1B87A

Crystal structure of an aminoglycoside 6'-n-acetyltransferase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
181
structure length
181
Chain Sequence
b'MIISEFDRNNPVLKDQLSDLLRLTWPEEYGDSSAEEVEEMMNPERIAVAAVDQDELVGFIGAIPQYGITGWELHPLVVESSRRKNQIGTRLVNYLEKEVASRGGITIYLGTDDLDHGTTLSQTDLYEHTFDKVASIQNLREHPYEFYEKLGYKIVGVLPNANGWDKPDIWMAKTIIPRPDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (AMINOGLYCOSIDE N6'-ACETYLTRANSFERASE TYPE 1)
publication title Crystal structure of an aminoglycoside 6'-N-acetyltransferase: defining the GCN5-related N-acetyltransferase superfamily fold.
pubmed doi rcsb
molecule tags Transferase
total genus 50
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 1999-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1b87A00
4KOTA 1XE4A 3W6SA 4KORA 2KCWA 4CS0B 2PRBA 4YFJA 4QVTA 3VWDA 2REEA 4R87A 2X7BA 4CAWA 3EY5A 4X5KA 3D3SA 5C88A 5JQ4A 3NE7A 4U9YA 5DWNA 2Z0ZA 4QB9A 1QSNA 2FSRA 4NEXA 4CRYB 1PU9A 3R96A 4XPDC 4UWJA 3W91A 2JDCA 4II9A 3S6KA 2HQYA 4PSWA 1Y9WA 3D8PA 4MJ8A 4EVYA 3T9YA 1RO5A 1S7KA 4I49A 4Y49C 3TO9A 5EBVA 2Y0MA 4R57A 1SQHA 2OZGA 1NSLA 3KKWA 5J8CA 5JPHA 1Q2DA 3B8GA 4JLYA 3R9EA 3QB8A 2OH1A 2GANA 2DXQA 3GY9A 4LUAA 3TOBA 4HNWB 1J4JA 2ZW6A 1Y9KA 2VBQA 3P2HA 4FD5A 4OADA 1WWZA 4HNYB 2J8MA 2B3UA 2GIVA 4BMHA 3TE4A 3R9GA 3OWCA 4MI4A 4XPLA 1PUAA 3G3SA 2B4BA 2R7HA 3DNSA 2VI7A 3BJ7A 4OAEA 4NXYA 4F0YA 3PZJA 3LODA 1QSRA 2PSWA 2CNSA 2ZXVA 2G3TA 1M4GA 4E0AA 1KUVA 4KLVA 1UFHA 1B87A 2P6EA 2PQ8A 3MGDA 4GS4A 3TT2A 5CNPA 2CNTA 4NF1A 3GYAA 3T90A 3WR7A 2CY2A 2QMLA 5KTCA 4JWPA 4H89A 5HH1A 2Q04A 4KOYA 1R57A 2K5TA 1XF8A 1P0HA 3FYNA 1NMTA 1NE9A 4LX9A 5H86A 4KOXA 2ARHA 4JXRA 3V8IA 2QIRA 3DR8A 2EVNA 2JLMA 2B4DB 4E8OA 2C27A 1BO4A 3FXTA 1Z4RA 1N71A 3G8WA 3BLNA 2PC1A 2WPWA 5HMNA 4FD6A 4YRHA 3R95A 4L8AA 2D4OA 4KLWA 1KUYA 4AG7A 4OLLA 2B3VA 2B4DA 2OZHA 3GKRA 3F5BA 5KTDA 4YGOA 2FL4A 2ZW5A 3SXOA 2PR1A 3W6XA 1QSOA 2R1IA 3IWGA 3D2PA 1Y7RA 4B5OA 5EC4A 5IB0A 4FD7A 3N7ZA 1VHSA 4XNHB 3P2FA 3UY5A 4M85A 3FIXA 2JEVA 4AG9A 2D4PA 4PK3A 4R9MA 4HNXB 3I9SA 1V0CA 4K30A 4AVBA 2P0WA 1WK4A 4DNCA 1FY7A 2BEIA 4KVXA 2FS5A 4IUSA 1YX0A 2Z11A 1IB1E 4U5YA 2Q4YA 4FD4A 1CJWA 3TTHA 1S3ZA 5DWMA 4JD6A 2AJ6A 2VQYA 4KZTA 3JVNA 5IX3A 3FNCA 1M4IA 1BOBA 2HV2A 3LD2A 2R98A 2J8RA 1S5KA 5IV0A 4NCZA 3F8KA 1TIQA 4H6UA 1Q2YA 1L0CA 2HUZA 1YREA 4JXQA 4E2AA 3TOAA 2OZUA 4IF5A 2G3AA 5J8FA 2VEZA 3CXPA 4H6ZA 5F47A 4ONUA 1MJ9A 1XIXA 2AE6A 4CAVA 2ATRA 2ZW7A 2VZZA 2ZPAA 4UWIA 4UBRA 2B5GB 2QECA 4XPDB 4CRZB 5C82A 4KOVA 2JDDA 3PP9A 4U9ZA 1MJBA 3DR6A 3PGPA 1S7NA 3H4QA 3FRMA 3DDDA 4AB7A 4Y49B 1YK3A 2IL4A 4F6AA 2B5GA 4PV6A 4R3KA 4KOSA 4HKFA 1IYLA 2BL1A 3VWEA 1IIDA 1QSMA 1CM0A 1I21A 2RC4A 1ON0A 2FE7A 4KVME 3SXNA 2FIWA 5ISVA 1KUXA 5H84A 2VZYA 3FBUA 3EXNA 1K4JA 4MHDA 4ZBGA 3TCVA 1XEBA 2Z10A 2FXFA 4MY0A 1YVKA 2FT0A 3EC4A 3F0AA 4QUSA 5I0CA 4AVAA 3C26A 1YVOA 3CXQA 2J8NA 2Q7BA 4QBJA 2WPXA 1M4DA 2CNMA 1I1DA 2PR8A 2A4NA 3EO4A 1VKCA 4RI1A 3E0KA 4KOUA 4UA3A 2B58A 4KOWA 2GE3A 3TO6A 3TFYA 1KZFA 2R8VA 4PK2A 4JJXA 4KUBA 2BUEA 1YLEA 4KVOE 2Q44A 4B5PB 1M44A 2OB0A 3IGRA 1LRZA 5F49A 3K9UA 3QAHA 1U6MA 2O28A 4XPKA 1QSTA 1Q2CA 3R1KA 2ZW4A 1YGHA 5KTAA 4MY3A 3S6HA 3BJ8A 2FCKA 3ZJ0A 1XMTA 2REFA 4B5PA 1IICA 2EUIA 2I00A 1B6BA 5F46A 3CXSA 5FVJA 1MJAA 3S6FA 4PSXA 1Z9UA 1Z4EA 2F5IA 4CAXA 1MK4A 2P6FA 3TO7A 4L89A 2Q0YA 2BSWA 3FB3A 4XNHC 2VXKA 3ZZIA 2NMTA 2Q4VA 1I12A 4ORFA 1IYKA 3RYOA 5E96A 1S7LA 1S7FA 4R3LA 1OZPA 3DSBA 2P6GA 5F48A 2G0BA 3R9FA 2FIAA 4RS2A 1YR0A 1P4NA 2I79A 4J3GA 4QC6A 3EFAA 3D2MA 2PDOA 4NSQA 5GCNA 3I3GA 2H5MA 4KUAA 1M1DA 4M3SA 3S6GA 2OU2A 1GHEA 4MBUA 1S60A 1RXTA 3SHPA 3JUWA 4AVCA
chains in the Genus database with same CATH superfamily
4P10A 1RTQA 4KOTA 1XE4A 3W6SA 3A9LA 3IO1A 2KCWA 2JBJA 4KORA 4CS0B 2PRBA 5G21A 4YFJA 3KR4A 4MHYA 4UEZA 4CYOA 4OC3A 4QVTA 3VARA 4OC4A 4MCRA 4YU9A 2YNCA 5D8NA 1R43A 3PBBA 4C7HA 2GLJA 1X10A 3LWUA 3VWDA 3WABA 1ZLHA 3SI2A 3IEHA 4UFVA 1XOVA 2Q43A 2PJ0A 2REEA 2PIZA 4R87A 3WC6A 2X7BA 3PB8X 4W9YA 4CAWA 3EY5A 4X5KA 3D3SA 5C88A 1Z8TA 1YSJA 2EWBA 4DYOA 3PB7X 3K2KA 5JQ4A 3NE7A 2GREA 3TC8A 4U9YA 4GXHA 4CGLA 5DWNA 4NGRA 2POKA 2Z0ZA 4CAEA 1XFOA 1YMEA 2PIYA 4QB9A 1QSNA 1CP7A 3GIUA 3KHZA 2FSRA 4NEXA 4IHMA 2EK8A 3SI0A 4CRYB 4MHZA 1PU9A 3R96A 4MCSA 1LFWA 4NGMA 4ZX9A 4MCQA 3FECA 4XPDC 4UWJA 1ZG9A 4P44A 3W91A 2JDCA 3SJGA 4II9A 1BPNA 2YNDA 2AFXA 3S6KA 2HQYA 4PSWA 5D29A 2EBJA 1Y9WA 3D8PA 3RAMA 2GLFA 4MJ8A 4EVYA 3B3VA 5F09A 3T9YA 2Q7SA 2Q4ZA 4PXBA 1RO5A 1S7KA 4I49A 4Y49C 2AFUA 3TO9A 5EBVA 1HEEA 2Y0MA 4R57A 1SQHA 4ZY1A 2XEJA 4MFJA 4R7MA 2ZEHA 3RO0A 2OZGA 1QMUA 1PYTB 1NSLA 3CPAA 3KKWA 5J8CA 4NJRA 5JPHA 1Q2DA 1XMBA 3B8GA 3NH8A 3QB8A 4JLYA 2IMOA 2OH1A 3R9EA 5K8NA 1CBXA 2GANA 2ZOGA 5HVHA 2DXQA 5A28A 3GY9A 4LUAA 5LYLA 2YGWA 3RZAA 4CGMA 3TOBA 4HNWB 1IOFA 1ZO0A 1TXRA 1J4JA 1IY7A 2V8GA 1Y9KA 2ZW6A 4G1PA 4BBHA 1CPXA 2WUUA 3KQXA 5AG4A 2VBQA 3P2HA 4FD5A 4OADA 4F9VA 1WWZA 4HNYB 3CT9A 3PEIA 2J8MA 2OOTA 2PJ8A 1R3NA 2C6GA 4NGNA 1M4LA 1UWYA 5ELYA 2PCUA 2QJ8A 2B3UA 4B6ZA 1Z5RA 2GIVA 2XEFA 4BMHA 3TE4A 4LQ6A 2PJ2A 1Q7LA 3IFEA 4P4JA 4O23A 3R9GA 3OWCA 4MI4A 4B12A 1FNOA 1PUAA 4XPLA 1OBRA 3FF3A 1Z8XA 4RN7A 1CG2A 4X3RA 3G3SA 4X2TA 3KGQA 2B4BA 3KR5A 4OC1A 2R7HA 4PXEA 1H8LA 2VI7A 3DNSA 2ABZA 2O4HA 4P4EA 5K8OA 3BJ7A 4X8IA 2C6CA 4MFZA 4OAEA 5AGEA 4NXYA 4OKOA 4F0YA 4R8FA 3PZJA 1Y7EA 4CGPA 3LODA 2ZEMA 4FUUA 1QSRA 5LYDA 4BINA 4ONWA 1VIXA 4OMEA 4DJLA 7CPAA 2G9DA 2PSWA 2CNSA 2ZXVA 2G3TA 1Y0YA 2OR4A 3ISXA 3B3WA 4P4BA 4CYQA 1M4GA 4JZ0A 1KUVA 4E0AA 5JH9A 1Y0RA 4KLVA 1TF8A 4C7IA 1UFHA 1B87A 2AFMA 2P6EA 2PQ8A 4A33A 3MGDA 3MRUA 1ELMP 2GU2A 4GS4A 4Q36A 1CPSA 3TT2A 5CNPA 2CNTA 4NF1A 3GYAA 4OP4A 3T90A 3WR7A 1LOKA 2CY2A 2QMLA 1FT7A 5KTCA 3GB0A 4JWPA 1IGBA 4H89A 5HH1A 1JQGA 2Q04A 4KOYA 5LRGA 2PJ1A 2CXAA 1R57A 2K5TA 1CX8A 2NSMA 1XF8A 2XEGA 1P0HA 2I3CA 3FYNA 1NMTA 1NE9A 2Z3MA 4LX9A 5H86A 4JXRA 2ARHA 4KOXA 3V8IA 1F2PA 2QIRA 3SI1A 3DR8A 3SJFA 3PB6X 4UF4A 2EVNA 2JLMA 5EMIA 2B4DB 5BWAB 1YLOA 4E8OA 2ZENA 2C27A 1BO4A 3JRUA 3FXTA 3H5ZA 1Z4RA 1N71A 3G8WA 5JGFA 4UCPA 4PPZA 3ISZA 4MRIA 3BLNA 2PC1A 4GM5A 5AG6A 2WPWA 5HMNA 4FD6A 4YRHA 1F57A 4PXCA 3R95A 4L8AA 2D4OA 4EWTA 2C6PA 4UIAA 2PRQA 4KLWA 1KUYA 4UEFA 4AG7A 4OIDA 4EFDA 4FAIA 4OLLA 6CPAA 2B3VA 2NYQA 2B4DA 2OZHA 3D68A 3GKRA 1LCPA 4PQAA 4C2YA 3F5BA 4P4DA 4YGOA 5KTDA 2FL4A 1TKHA 2ZW5A 3NH4A 3SXOA 2WSAA 1BPMA 2PR1A 2V8VA 3W6XA 1ARMA 1QSOA 4MFPA 2R1IA 2ZEEA 3IWGA 4ZI6A 3D2PA 1Y7RA 4UCMA 4B5OA 4UEEA 5EC4A 5IB0A 4FD7A 2YNEA 3N7ZA 1VHSA 4XNHB 5G20A 4WJBA 4C2ZA 3NE8A 4OC2A 3P2FA 4UIBA 3UY5A 4M85A 3FIXA 2Z3KA 5IB9A 3SJEA 3VATA 2JEVA 2Z3PA 2D4PA 4PK3A 4AG9A 4R9MA 3B2YA 3LMSA 4M6IA 4A94A 4PXDA 1NSAA 4HNXB 3I9SA 4ZYQA 1TF9A 1V0CA 2YNCC 4K30A 4KSIA 4LQGA 4AVBA 2AFOA 2P0WA 2Z3LA 3DLJA 3FEDA 1WK4A 1EE3P 4DNCA 1FY7A 2BEIA 3BHXA 5AG5A 3S9MA 3L2NA 3I1UA 4KVXA 1XRYA 2F7VA 4MHPA 2WZNA 2FS5A 3KL9A 3B3SA 4IUSA 1YX0A 3QNVA 2Z11A 1IB1E 4P4FA 1A2ZA 4U5YA 2Q4YA 2QYVA 4FD4A 2DPTA 1CJWA 2AFWA 3HLPA 4JYWA 4A32A 3TTHA 1S3ZA 5DWMA 1QQ9A 4CYNA 2DPSA 4A95A 2Z3NA 3K9TA 1ZLIA 4JD6A 4ZX8A 2AJ6A 4A39A 2VQYA 1CP6A 4KZTA 3FMCA 5K8PA 4MFLA 2PJ3A 1YW4A 3FX6A 3JVNA 4NGQA 5IX3A 3FNCA 4MMOA 1AYEA 1M4IA 5J1QA 1BOBA 2HV2A 3D4UA 3IIBA 3LD2A 1DE4C 2R98A 4NJQA 4DUKA 2J8RA 3FJUA 1LANA 2PJ7A 1S5KA 5IV0A 4NCZA 3F8KA 4P6YA 1TIQA 4H6UA 1Q2YA 1L0CA 2HUZA 3FEEA 1Z8WA 1XJOA 4B13A 3T8WA 4B14A 1YREA 4A37A 4JXQA 3WC5A 4E2AA 3TOAA 2OZUA 4MXUA 3TX8A 4IF5A 2G3AA 1HDUA 5J8FA 2VEZA 3CXPA 4WWVA 4H6ZA 2PJAA 5F47A 4ONUA 4A2ZA 4B11A 1MJ9A 1XIXA 3CZXA 2AE6A 3B7IA 4CAVA 2ATRA 2CTCA 2RB7A 2VZZA 2ZW7A 3KQZA 2ZPAA 4OC5A 3JTKA 4UWIA 4P45A 4UBRA 2B5GB 2PJ6A 2QECA 4M6GA 4P4IA 4XPDB 4AXVA 4A30A 4CRZB 3FVLA 3MN8A 5C82A 3D7GA 2VL1A 2Z3OA 3QAYA 4KOVA 2C1CA 2CF4A 5LYFA 2IJZA 2JDDA 3PP9A 3IU2A 3IWEA 3H8EA 4U9ZA 1MJBA 3DR6A 3PGPA 1S7NA 3N5FA 2Q51A 3H4QA 3FRMA 3DDDA 3IWWA 4UFXA 4AB7A 1BAVA 4Y49B 4KSFA 1YK3A 4ZY2A 1LAMA 2DF5A 1HDQA 2IL4A 2ZELA 4C68A 3B35A 4EMEA 4F6AA 2B5GA 1Z2LA 3BXMA 4PV6A 2PVWA 5LRJA 4BD9A 4R3KA 3NH5A 4KOSA 4CAFA 4HKFA 1IYLA 2BL1A 3VWEA 1IIDA 1QSMA 4C2XA 1CM0A 2PJ4A 1I21A 2RC4A 3S9NA 2AFSA 4F9UA 1ON0A 2FE7A 2O53A 2ZEPA 4KVME 3SXNA 4CYPA 4F8ZA 3DGVA 2WYRA 2FIWA 2ZEOA 5ISVA 1ZG7A 5HXDA 3PFOA 1KUXA 4KS9A 5H84A 2VZYA 1Z8LA 3FBUA 3NA6A 2ANPA 3EXNA 1TKJA 4F0XA 1K4JA 4MHDA 2PVVA 3PB4X 4MFQA 4ZBGA 3TCVA 1XEBA 4Q7AA 2Z10A 2FXFA 2GFQA 1YVKA 2FT0A 3BI0A 3EC4A 4H2KA 4MY0A 3F0AA 4QUSA 3BI1A 4UFWA 5I0CA 4R76A 5CPAA 2V8HA 4IK2A 1XBUA 4AVAA 3C26A 5DS0A 2ZEDA 2AFZA 1ARLA 1YVOA 3CXQA 2J8NA 2Q7BA 4QBJA 2WPXA 3PFEA 1LAPA 3D67A 1M4DA 1GYTA 4A31A 2CNMA 1I1DA 2PJBA 2PR8A 2A4NA 3IJ3A 4IAVA 3SJXA 4YWYA 1VHEA 3FH4A 3EO4A 1VKCA 2PJ5A 4RI1A 4CGNA 4MHNA 3KZWA 2QVPA 3E0KA 4KOUA 4UA3A 2B58A 3HUVA 3LACA 2GE3A 1F2OA 4KOWA 4KSAA 4FWUA 4OIWA 5AG7A 3TO6A 1KZFA 5G1ZA 3TFYA 2ZOFA 2R8VA 4PK2A 2XEIA 4JJXA 2EK9A 3D7DA 2BUEA 4KUBA 3CDXA 4CGOA 4FBEA 1ELLP 2BO9A 1YLEA 4KVOE 4NGTA 1IOIA 2Q44A 2JBKA 3PRTA 4Q38A 1M44A 2OB0A 3IGRA 4HPSA 4TWEA 4B5PB 1LRZA 5F49A 3K9UA 3B3TA 3NFZA 3D7HA 3QAHA 4NGPA 1U6MA 3VH9A 5K8MA 2O28A 4MFKA 5THWA 4XPKA 3IU1A 2FVGA 1QSTA 2RFHA 3RNZA 1Q2CA 3R1KA 1VHOA 2JEWA 2ZW4A 1YGHA 5KTAA 4A38A 5CBMA 4MY3A 1AUGA 3BJ8A 3S6HA 2FCKA 3ZJ0A 5A27A 1XMTA 2REFA 4UCNA 4B5PA 1JWQA 2ODFA 2BOAA 1IICA 3PB9X 3V38A 1BLLE 2PJCA 2EUIA 2I00A 3KASA 3WT4A 4RUHA 1B6BA 5I4MA 5F46A 3CXSA 3V7ZA 4NFRA 3CPXA 2IQ6A 4CPAA 4TNUA 5FVJA 4B10A 1MJAA 3S6FA 4PSXA 1Z9UA 4K3NA 1Z4EA 2F5IA 5LYIA 4CAXA 1MK4A 2HC9A 2P6FA 4L89A 3TO7A 3S9LA 2Q0YA 3D7FA 3H8FA 2BSWA 5G22A 2BCOA 3FB3A 2PJ9A 4XNHC 1YQEA 2VXKA 4R6TA 1YW6A 3ZZIA 8CPAA 4ZY0A 3GUXA 1AMPA 4MCPA 1IU8A 2NMTA 2PE3A 4OC0A 3RBUA 2Q4VA 3D66A 1TKFA 3KHXA 2CTBA 5JM6A 3IC1A 3B3CA 1I12A 1PCAA 1IYKA 4ORFA 5E96A 1S7LA 5HVFA 3RYOA 3WC7A 1S7FA 4ZGYB 5HVGA 4M6HA 4R3LA 1OZPA 4NGSA 2ZEGA 2P6GA 3DSBA 5F48A 5LRKA 2G0BA 2HB6A 3H8GA 3R9FA 2FIAA 4RS2A 4Z65A 1YR0A 1P4NA 2I79A 2V8DA 3GLJA 1X12A 4J3GA 2EO8A 4QC6A 2DEAA 1KWMA 1ZG8A 3EFAA 2CIJA 3D2MA 2PDOA 4NSQA 5GCNA 3PBEA 2V77A 2F8HA 3I3GA 2H5MA 1DTDA 4KUAA 2ZEFA 3KI9A 1M1DA 4M3SA 3S6GA 2OU2A 1GHEA 4MBUA 1S60A 1RXTA 3SHPA 3JUWA 4AVCA 2J9AA 1VGYA
chains in the Genus database with same CATH topology
4KOTA 1XE4A 3W6SA 3A9LA 4KORA 2KCWA 4CS0B 2PRBA 5G21A 4YFJA 4CYOA 4QVTA 2YNCA 4C7HA 3VWDA 4UFVA 2REEA 4R87A 2X7BA 4CAWA 3EY5A 4X5KA 3D3SA 5C88A 5JQ4A 3NE7A 4U9YA 4CGLA 5DWNA 4CAEA 2Z0ZA 4QB9A 1QSNA 2FSRA 4NEXA 4CRYB 1PU9A 3R96A 4XPDC 4UWJA 3W91A 2JDCA 4II9A 2YNDA 3S6KA 2HQYA 4PSWA 1Y9WA 3D8PA 4MJ8A 4EVYA 3T9YA 1RO5A 1S7KA 4I49A 4Y49C 3TO9A 5EBVA 2Y0MA 4R57A 1SQHA 4MFJA 2OZGA 1NSLA 3KKWA 5J8CA 5JPHA 1Q2DA 3B8GA 4JLYA 3R9EA 3QB8A 2OH1A 2GANA 2DXQA 5A28A 3GY9A 4LUAA 2YGWA 4CGMA 3TOBA 4HNWB 1ZO0A 1J4JA 2ZW6A 1Y9KA 4BBHA 2WUUA 5AG4A 2VBQA 3P2HA 4FD5A 4OADA 1WWZA 4HNYB 2J8MA 2B3UA 2GIVA 4BMHA 3TE4A 3R9GA 3OWCA 4MI4A 4B12A 4XPLA 1PUAA 3G3SA 2B4BA 2R7HA 3DNSA 2VI7A 3BJ7A 4MFZA 4OAEA 5AGEA 4NXYA 4F0YA 3PZJA 4CGPA 3LODA 1QSRA 2PSWA 2CNSA 2ZXVA 2G3TA 4CYQA 1M4GA 4E0AA 1KUVA 4KLVA 4C7IA 1UFHA 1B87A 2P6EA 2PQ8A 4A33A 3MGDA 4Q36A 4GS4A 3TT2A 5CNPA 2CNTA 4NF1A 3GYAA 3T90A 3WR7A 2CY2A 2QMLA 5KTCA 4JWPA 4H89A 5HH1A 2Q04A 4KOYA 2CXAA 1R57A 2K5TA 1XF8A 1P0HA 3FYNA 1NMTA 1NE9A 2Z3MA 4LX9A 5H86A 4JXRA 2ARHA 4KOXA 3V8IA 2QIRA 3DR8A 2EVNA 2JLMA 5BWAB 2B4DB 4E8OA 2C27A 1BO4A 3FXTA 3H5ZA 1Z4RA 1N71A 3G8WA 3BLNA 2PC1A 5AG6A 2WPWA 5HMNA 4FD6A 4YRHA 3R95A 4L8AA 2D4OA 4KLWA 1KUYA 4AG7A 4OLLA 2B3VA 2B4DA 2OZHA 3GKRA 4C2YA 3F5BA 5KTDA 4YGOA 2FL4A 2ZW5A 3SXOA 2WSAA 2PR1A 3W6XA 1QSOA 4MFPA 2R1IA 3IWGA 3D2PA 1Y7RA 4UCMA 4B5OA 5EC4A 5IB0A 4FD7A 2YNEA 3N7ZA 1VHSA 4XNHB 5G20A 4C2ZA 3P2FA 3UY5A 4M85A 3FIXA 2Z3KA 2JEVA 2Z3PA 2D4PA 4PK3A 4AG9A 4R9MA 4HNXB 3I9SA 1V0CA 2YNCC 4K30A 4AVBA 2P0WA 2Z3LA 1WK4A 4DNCA 1FY7A 2BEIA 5AG5A 4KVXA 2FS5A 4IUSA 1YX0A 2Z11A 1IB1E 4U5YA 2Q4YA 4FD4A 2DPTA 1CJWA 4A32A 3TTHA 1S3ZA 5DWMA 4CYNA 2DPSA 4A95A 2Z3NA 4JD6A 2AJ6A 2VQYA 4KZTA 4MFLA 3JVNA 5IX3A 3FNCA 1M4IA 1BOBA 2HV2A 3LD2A 2R98A 2J8RA 1S5KA 5IV0A 4NCZA 3F8KA 1TIQA 4H6UA 1Q2YA 1L0CA 2HUZA 4B13A 4B14A 1YREA 4JXQA 4E2AA 3TOAA 2OZUA 4IF5A 2G3AA 5J8FA 2VEZA 3CXPA 4H6ZA 4B11A 5F47A 4ONUA 4A2ZA 1MJ9A 1XIXA 2AE6A 4CAVA 2ATRA 2ZW7A 2VZZA 2ZPAA 3JTKA 4UWIA 4UBRA 2B5GB 2QECA 4XPDB 4A30A 4CRZB 5C82A 2Z3OA 4KOVA 2JDDA 3PP9A 3IU2A 3IWEA 4U9ZA 1MJBA 3DR6A 3PGPA 1S7NA 3H4QA 3FRMA 3DDDA 4UFXA 4AB7A 4Y49B 4KSFA 1YK3A 2IL4A 4F6AA 4C68A 2B5GA 4PV6A 4R3KA 4CAFA 4KOSA 4HKFA 1IYLA 2BL1A 3VWEA 1IIDA 1QSMA 4C2XA 1CM0A 1I21A 2RC4A 1ON0A 2FE7A 4KVME 3SXNA 4CYPA 2FIWA 5ISVA 1KUXA 4KS9A 5H84A 2VZYA 3FBUA 4F0XA 3EXNA 1K4JA 4MHDA 4MFQA 4ZBGA 3TCVA 1XEBA 2Z10A 2FXFA 4MY0A 1YVKA 2FT0A 4UFWA 3EC4A 3F0AA 4QUSA 5I0CA 4AVAA 3C26A 1YVOA 3CXQA 2J8NA 2Q7BA 4QBJA 2WPXA 1M4DA 4A31A 2CNMA 1I1DA 2PR8A 2A4NA 3EO4A 1VKCA 4RI1A 4CGNA 3E0KA 4KOUA 4UA3A 2B58A 4KOWA 4UCPA 2GE3A 4KSAA 5AG7A 3TO6A 3TFYA 1KZFA 5G1ZA 2R8VA 4PK2A 4JJXA 4KUBA 2BUEA 4CGOA 1YLEA 4KVOE 4Q38A 2Q44A 4B5PB 1M44A 2OB0A 3IGRA 1LRZA 5F49A 3K9UA 3QAHA 1U6MA 2O28A 4MFKA 4XPKA 3IU1A 1QSTA 1Q2CA 3R1KA 2ZW4A 1YGHA 5KTAA 4MY3A 3S6HA 3BJ8A 2FCKA 3ZJ0A 5A27A 1XMTA 2REFA 4UCNA 4B5PA 1IICA 2EUIA 2I00A 1B6BA 5F46A 3CXSA 5FVJA 4B10A 1MJAA 3S6FA 4PSXA 1Z9UA 1Z4EA 2F5IA 4CAXA 1MK4A 2P6FA 3TO7A 4L89A 2Q0YA 2BSWA 5G22A 3FB3A 4XNHC 2VXKA 3ZZIA 2NMTA 2Q4VA 1I12A 4ORFA 1IYKA 3RYOA 5E96A 1S7LA 1S7FA 4ZGYB 4R3LA 1OZPA 3DSBA 2P6GA 5F48A 2G0BA 3R9FA 2FIAA 4RS2A 1YR0A 1P4NA 2I79A 4J3GA 4QC6A 3EFAA 3D2MA 2PDOA 4NSQA 5GCNA 3I3GA 2H5MA 4KUAA 1M1DA 4M3SA 3S6GA 2OU2A 1GHEA 4MBUA 1S60A 1RXTA 3SHPA 3JUWA 4AVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOT A;  1XE4 A;  3W6S A;  4KOR A;  2KCW A;  4CS0 B;  2PRB A;  4YFJ A;  4QVT A;  3VWD A;  2REE A;  4R87 A;  2X7B A;  4CAW A;  3EY5 A;  4X5K A;  3D3S A;  5C88 A;  5JQ4 A;  3NE7 A;  4U9Y A;  5DWN A;  2Z0Z A;  4QB9 A;  1QSN A;  2FSR A;  4NEX A;  4CRY B;  1PU9 A;  3R96 A;  4XPD C;  4UWJ A;  3W91 A;  2JDC A;  4II9 A;  3S6K A;  2HQY A;  4PSW A;  1Y9W A;  3D8P A;  4MJ8 A;  4EVY A;  3T9Y A;  1RO5 A;  1S7K A;  4I49 A;  4Y49 C;  3TO9 A;  5EBV A;  2Y0M A;  4R57 A;  1SQH A;  2OZG A;  1NSL A;  3KKW A;  5J8C A;  5JPH A;  1Q2D A;  3B8G A;  4JLY A;  3R9E A;  3QB8 A;  2OH1 A;  2GAN A;  2DXQ A;  3GY9 A;  4LUA A;  3TOB A;  4HNW B;  1J4J A;  2ZW6 A;  1Y9K A;  2VBQ A;  3P2H A;  4FD5 A;  4OAD A;  1WWZ A;  4HNY B;  2J8M A;  2B3U A;  2GIV A;  4BMH A;  3TE4 A;  3R9G A;  3OWC A;  4MI4 A;  4XPL A;  1PUA A;  3G3S A;  2B4B A;  2R7H A;  3DNS A;  2VI7 A;  3BJ7 A;  4OAE A;  4NXY A;  4F0Y A;  3PZJ A;  3LOD A;  1QSR A;  2PSW A;  2CNS A;  2ZXV A;  2G3T A;  1M4G A;  4E0A A;  1KUV A;  4KLV A;  1UFH A;  1B87 A;  2P6E A;  2PQ8 A;  3MGD A;  4GS4 A;  3TT2 A;  5CNP A;  2CNT A;  4NF1 A;  3GYA A;  3T90 A;  3WR7 A;  2CY2 A;  2QML A;  5KTC A;  4JWP A;  4H89 A;  5HH1 A;  2Q04 A;  4KOY A;  1R57 A;  2K5T A;  1XF8 A;  1P0H A;  3FYN A;  1NMT A;  1NE9 A;  4LX9 A;  5H86 A;  4KOX A;  2ARH A;  4JXR A;  3V8I A;  2QIR A;  3DR8 A;  2EVN A;  2JLM A;  2B4D B;  4E8O A;  2C27 A;  1BO4 A;  3FXT A;  1Z4R A;  1N71 A;  3G8W A;  3BLN A;  2PC1 A;  2WPW A;  5HMN A;  4FD6 A;  4YRH A;  3R95 A;  4L8A A;  2D4O A;  4KLW A;  1KUY A;  4AG7 A;  4OLL A;  2B3V A;  2B4D A;  2OZH A;  3GKR A;  3F5B A;  5KTD A;  4YGO A;  2FL4 A;  2ZW5 A;  3SXO A;  2PR1 A;  3W6X A;  1QSO A;  2R1I A;  3IWG A;  3D2P A;  1Y7R A;  4B5O A;  5EC4 A;  5IB0 A;  4FD7 A;  3N7Z A;  1VHS A;  4XNH B;  3P2F A;  3UY5 A;  4M85 A;  3FIX A;  2JEV A;  4AG9 A;  2D4P A;  4PK3 A;  4R9M A;  4HNX B;  3I9S A;  1V0C A;  4K30 A;  4AVB A;  2P0W A;  1WK4 A;  4DNC A;  1FY7 A;  2BEI A;  4KVX A;  2FS5 A;  4IUS A;  1YX0 A;  2Z11 A;  1IB1 E;  4U5Y A;  2Q4Y A;  4FD4 A;  1CJW A;  3TTH A;  1S3Z A;  5DWM A;  4JD6 A;  2AJ6 A;  2VQY A;  4KZT A;  3JVN A;  5IX3 A;  3FNC A;  1M4I A;  1BOB A;  2HV2 A;  3LD2 A;  2R98 A;  2J8R A;  1S5K A;  5IV0 A;  4NCZ A;  3F8K A;  1TIQ A;  4H6U A;  1Q2Y A;  1L0C A;  2HUZ A;  1YRE A;  4JXQ A;  4E2A A;  3TOA A;  2OZU A;  4IF5 A;  2G3A A;  5J8F A;  2VEZ A;  3CXP A;  4H6Z A;  5F47 A;  4ONU A;  1MJ9 A;  1XIX A;  2AE6 A;  4CAV A;  2ATR A;  2ZW7 A;  2VZZ A;  2ZPA A;  4UWI A;  4UBR A;  2B5G B;  2QEC A;  4XPD B;  4CRZ B;  5C82 A;  4KOV A;  2JDD A;  3PP9 A;  4U9Z A;  1MJB A;  3DR6 A;  3PGP A;  1S7N A;  3H4Q A;  3FRM A;  3DDD A;  4AB7 A;  4Y49 B;  1YK3 A;  2IL4 A;  4F6A A;  2B5G A;  4PV6 A;  4R3K A;  4KOS A;  4HKF A;  1IYL A;  2BL1 A;  3VWE A;  1IID A;  1QSM A;  1CM0 A;  1I21 A;  2RC4 A;  1ON0 A;  2FE7 A;  4KVM E;  3SXN A;  2FIW A;  5ISV A;  1KUX A;  5H84 A;  2VZY A;  3FBU A;  3EXN A;  1K4J A;  4MHD A;  4ZBG A;  3TCV A;  1XEB A;  2Z10 A;  2FXF A;  4MY0 A;  1YVK A;  2FT0 A;  3EC4 A;  3F0A A;  4QUS A;  5I0C A;  4AVA A;  3C26 A;  1YVO A;  3CXQ A;  2J8N A;  2Q7B A;  4QBJ A;  2WPX A;  1M4D A;  2CNM A;  1I1D A;  2PR8 A;  2A4N A;  3EO4 A;  1VKC A;  4RI1 A;  3E0K A;  4KOU A;  4UA3 A;  2B58 A;  4KOW A;  2GE3 A;  3TO6 A;  3TFY A;  1KZF A;  2R8V A;  4PK2 A;  4JJX A;  4KUB A;  2BUE A;  1YLE A;  4KVO E;  2Q44 A;  4B5P B;  1M44 A;  2OB0 A;  3IGR A;  1LRZ A;  5F49 A;  3K9U A;  3QAH A;  1U6M A;  2O28 A;  4XPK A;  1QST A;  1Q2C A;  3R1K A;  2ZW4 A;  1YGH A;  5KTA A;  4MY3 A;  3S6H A;  3BJ8 A;  2FCK A;  3ZJ0 A;  1XMT A;  2REF A;  4B5P A;  1IIC A;  2EUI A;  2I00 A;  1B6B A;  5F46 A;  3CXS A;  5FVJ A;  1MJA A;  3S6F A;  4PSX A;  1Z9U A;  1Z4E A;  2F5I A;  4CAX A;  1MK4 A;  2P6F A;  3TO7 A;  4L89 A;  2Q0Y A;  2BSW A;  3FB3 A;  4XNH C;  2VXK A;  3ZZI A;  2NMT A;  2Q4V A;  1I12 A;  4ORF A;  1IYK A;  3RYO A;  5E96 A;  1S7L A;  1S7F A;  4R3L A;  1OZP A;  3DSB A;  2P6G A;  5F48 A;  2G0B A;  3R9F A;  2FIA A;  4RS2 A;  1YR0 A;  1P4N A;  2I79 A;  4J3G A;  4QC6 A;  3EFA A;  3D2M A;  2PDO A;  4NSQ A;  5GCN A;  3I3G A;  2H5M A;  4KUA A;  1M1D A;  4M3S A;  3S6G A;  2OU2 A;  1GHE A;  4MBU A;  1S60 A;  1RXT A;  3SHP A;  3JUW A;  4AVC A; 
#chains in the Genus database with same CATH topology
 4P10 A;  1RTQ A;  4KOT A;  1XE4 A;  3W6S A;  3A9L A;  3IO1 A;  2KCW A;  2JBJ A;  4KOR A;  4CS0 B;  2PRB A;  5G21 A;  4YFJ A;  3KR4 A;  4MHY A;  4UEZ A;  4CYO A;  4OC3 A;  4QVT A;  3VAR A;  4OC4 A;  4MCR A;  4YU9 A;  2YNC A;  5D8N A;  1R43 A;  3PBB A;  4C7H A;  2GLJ A;  1X10 A;  3LWU A;  3VWD A;  3WAB A;  1ZLH A;  3SI2 A;  3IEH A;  4UFV A;  1XOV A;  2Q43 A;  2PJ0 A;  2REE A;  2PIZ A;  4R87 A;  3WC6 A;  2X7B A;  3PB8 X;  4W9Y A;  4CAW A;  3EY5 A;  4X5K A;  3D3S A;  5C88 A;  1Z8T A;  1YSJ A;  2EWB A;  4DYO A;  3PB7 X;  3K2K A;  5JQ4 A;  3NE7 A;  2GRE A;  3TC8 A;  4U9Y A;  4GXH A;  4CGL A;  5DWN A;  4NGR A;  2POK A;  2Z0Z A;  4CAE A;  1XFO A;  1YME A;  2PIY A;  4QB9 A;  1QSN A;  1CP7 A;  3GIU A;  3KHZ A;  2FSR A;  4NEX A;  4IHM A;  2EK8 A;  3SI0 A;  4CRY B;  4MHZ A;  1PU9 A;  3R96 A;  4MCS A;  1LFW A;  4NGM A;  4ZX9 A;  4MCQ A;  3FEC A;  4XPD C;  4UWJ A;  1ZG9 A;  4P44 A;  3W91 A;  2JDC A;  3SJG A;  4II9 A;  1BPN A;  2YND A;  2AFX A;  3S6K A;  2HQY A;  4PSW A;  5D29 A;  2EBJ A;  1Y9W A;  3D8P A;  3RAM A;  2GLF A;  4MJ8 A;  4EVY A;  3B3V A;  5F09 A;  3T9Y A;  2Q7S A;  2Q4Z A;  4PXB A;  1RO5 A;  1S7K A;  4I49 A;  4Y49 C;  2AFU A;  3TO9 A;  5EBV A;  1HEE A;  2Y0M A;  4R57 A;  1SQH A;  4ZY1 A;  2XEJ A;  4MFJ A;  4R7M A;  2ZEH A;  3RO0 A;  2OZG A;  1QMU A;  1PYT B;  1NSL A;  3CPA A;  3KKW A;  5J8C A;  4NJR A;  5JPH A;  1Q2D A;  1XMB A;  3B8G A;  3NH8 A;  3QB8 A;  4JLY A;  2IMO A;  2OH1 A;  3R9E A;  5K8N A;  1CBX A;  2GAN A;  2ZOG A;  5HVH A;  2DXQ A;  5A28 A;  3GY9 A;  4LUA A;  5LYL A;  2YGW A;  3RZA A;  4CGM A;  3TOB A;  4HNW B;  1IOF A;  1ZO0 A;  1TXR A;  1J4J A;  1IY7 A;  2V8G A;  1Y9K A;  2ZW6 A;  4G1P A;  4BBH A;  1CPX A;  2WUU A;  3KQX A;  5AG4 A;  2VBQ A;  3P2H A;  4FD5 A;  4OAD A;  4F9V A;  1WWZ A;  4HNY B;  3CT9 A;  3PEI A;  2J8M A;  2OOT A;  2PJ8 A;  1R3N A;  2C6G A;  4NGN A;  1M4L A;  1UWY A;  5ELY A;  2PCU A;  2QJ8 A;  2B3U A;  4B6Z A;  1Z5R A;  2GIV A;  2XEF A;  4BMH A;  3TE4 A;  4LQ6 A;  2PJ2 A;  1Q7L A;  3IFE A;  4P4J A;  4O23 A;  3R9G A;  3OWC A;  4MI4 A;  4B12 A;  1FNO A;  1PUA A;  4XPL A;  1OBR A;  3FF3 A;  1Z8X A;  4RN7 A;  1CG2 A;  4X3R A;  3G3S A;  4X2T A;  3KGQ A;  2B4B A;  3KR5 A;  4OC1 A;  2R7H A;  4PXE A;  1H8L A;  2VI7 A;  3DNS A;  2ABZ A;  2O4H A;  4P4E A;  5K8O A;  3BJ7 A;  4X8I A;  2C6C A;  4MFZ A;  4OAE A;  5AGE A;  4NXY A;  4OKO A;  4F0Y A;  4R8F A;  3PZJ A;  1Y7E A;  4CGP A;  3LOD A;  2ZEM A;  4FUU A;  1QSR A;  5LYD A;  4BIN A;  4ONW A;  1VIX A;  4OME A;  4DJL A;  7CPA A;  2G9D A;  2PSW A;  2CNS A;  2ZXV A;  2G3T A;  1Y0Y A;  2OR4 A;  3ISX A;  3B3W A;  4P4B A;  4CYQ A;  1M4G A;  4JZ0 A;  1KUV A;  4E0A A;  5JH9 A;  1Y0R A;  4KLV A;  1TF8 A;  4C7I A;  1UFH A;  1B87 A;  2AFM A;  2P6E A;  2PQ8 A;  4A33 A;  3MGD A;  3MRU A;  1ELM P;  2GU2 A;  4GS4 A;  4Q36 A;  1CPS A;  3TT2 A;  5CNP A;  2CNT A;  4NF1 A;  3GYA A;  4OP4 A;  3T90 A;  3WR7 A;  1LOK A;  2CY2 A;  2QML A;  1FT7 A;  5KTC A;  3GB0 A;  4JWP A;  1IGB A;  4H89 A;  5HH1 A;  1JQG A;  2Q04 A;  4KOY A;  5LRG A;  2PJ1 A;  2CXA A;  1R57 A;  2K5T A;  1CX8 A;  2NSM A;  1XF8 A;  2XEG A;  1P0H A;  2I3C A;  3FYN A;  1NMT A;  1NE9 A;  2Z3M A;  4LX9 A;  5H86 A;  4JXR A;  2ARH A;  4KOX A;  3V8I A;  1F2P A;  2QIR A;  3SI1 A;  3DR8 A;  3SJF A;  3PB6 X;  4UF4 A;  2EVN A;  2JLM A;  5EMI A;  2B4D B;  5BWA B;  1YLO A;  4E8O A;  2ZEN A;  2C27 A;  1BO4 A;  3JRU A;  3FXT A;  3H5Z A;  1Z4R A;  1N71 A;  3G8W A;  5JGF A;  4UCP A;  4PPZ A;  3ISZ A;  4MRI A;  3BLN A;  2PC1 A;  4GM5 A;  5AG6 A;  2WPW A;  5HMN A;  4FD6 A;  4YRH A;  1F57 A;  4PXC A;  3R95 A;  4L8A A;  2D4O A;  4EWT A;  2C6P A;  4UIA A;  2PRQ A;  4KLW A;  1KUY A;  4UEF A;  4AG7 A;  4OID A;  4EFD A;  4FAI A;  4OLL A;  6CPA A;  2B3V A;  2NYQ A;  2B4D A;  2OZH A;  3D68 A;  3GKR A;  1LCP A;  4PQA A;  4C2Y A;  3F5B A;  4P4D A;  4YGO A;  5KTD A;  2FL4 A;  1TKH A;  2ZW5 A;  3NH4 A;  3SXO A;  2WSA A;  1BPM A;  2PR1 A;  2V8V A;  3W6X A;  1ARM A;  1QSO A;  4MFP A;  2R1I A;  2ZEE A;  3IWG A;  4ZI6 A;  3D2P A;  1Y7R A;  4UCM A;  4B5O A;  4UEE A;  5EC4 A;  5IB0 A;  4FD7 A;  2YNE A;  3N7Z A;  1VHS A;  4XNH B;  5G20 A;  4WJB A;  4C2Z A;  3NE8 A;  4OC2 A;  3P2F A;  4UIB A;  3UY5 A;  4M85 A;  3FIX A;  2Z3K A;  5IB9 A;  3SJE A;  3VAT A;  2JEV A;  2Z3P A;  2D4P A;  4PK3 A;  4AG9 A;  4R9M A;  3B2Y A;  3LMS A;  4M6I A;  4A94 A;  4PXD A;  1NSA A;  4HNX B;  3I9S A;  4ZYQ A;  1TF9 A;  1V0C A;  2YNC C;  4K30 A;  4KSI A;  4LQG A;  4AVB A;  2AFO A;  2P0W A;  2Z3L A;  3DLJ A;  3FED A;  1WK4 A;  1EE3 P;  4DNC A;  1FY7 A;  2BEI A;  3BHX A;  5AG5 A;  3S9M A;  3L2N A;  3I1U A;  4KVX A;  1XRY A;  2F7V A;  4MHP A;  2WZN A;  2FS5 A;  3KL9 A;  3B3S A;  4IUS A;  1YX0 A;  3QNV A;  2Z11 A;  1IB1 E;  4P4F A;  1A2Z A;  4U5Y A;  2Q4Y A;  2QYV A;  4FD4 A;  2DPT A;  1CJW A;  2AFW A;  3HLP A;  4JYW A;  4A32 A;  3TTH A;  1S3Z A;  5DWM A;  1QQ9 A;  4CYN A;  2DPS A;  4A95 A;  2Z3N A;  3K9T A;  1ZLI A;  4JD6 A;  4ZX8 A;  2AJ6 A;  4A39 A;  2VQY A;  1CP6 A;  4KZT A;  3FMC A;  5K8P A;  4MFL A;  2PJ3 A;  1YW4 A;  3FX6 A;  3JVN A;  4NGQ A;  5IX3 A;  3FNC A;  4MMO A;  1AYE A;  1M4I A;  5J1Q A;  1BOB A;  2HV2 A;  3D4U A;  3IIB A;  3LD2 A;  1DE4 C;  2R98 A;  4NJQ A;  4DUK A;  2J8R A;  3FJU A;  1LAN A;  2PJ7 A;  1S5K A;  5IV0 A;  4NCZ A;  3F8K A;  4P6Y A;  1TIQ A;  4H6U A;  1Q2Y A;  1L0C A;  2HUZ A;  3FEE A;  1Z8W A;  1XJO A;  4B13 A;  3T8W A;  4B14 A;  1YRE A;  4A37 A;  4JXQ A;  3WC5 A;  4E2A A;  3TOA A;  2OZU A;  4MXU A;  3TX8 A;  4IF5 A;  2G3A A;  1HDU A;  5J8F A;  2VEZ A;  3CXP A;  4WWV A;  4H6Z A;  2PJA A;  5F47 A;  4ONU A;  4A2Z A;  4B11 A;  1MJ9 A;  1XIX A;  3CZX A;  2AE6 A;  3B7I A;  4CAV A;  2ATR A;  2CTC A;  2RB7 A;  2VZZ A;  2ZW7 A;  3KQZ A;  2ZPA A;  4OC5 A;  3JTK A;  4UWI A;  4P45 A;  4UBR A;  2B5G B;  2PJ6 A;  2QEC A;  4M6G A;  4P4I A;  4XPD B;  4AXV A;  4A30 A;  4CRZ B;  3FVL A;  3MN8 A;  5C82 A;  3D7G A;  2VL1 A;  2Z3O A;  3QAY A;  4KOV A;  2C1C A;  2CF4 A;  5LYF A;  2IJZ A;  2JDD A;  3PP9 A;  3IU2 A;  3IWE A;  3H8E A;  4U9Z A;  1MJB A;  3DR6 A;  3PGP A;  1S7N A;  3N5F A;  2Q51 A;  3H4Q A;  3FRM A;  3DDD A;  3IWW A;  4UFX A;  4AB7 A;  1BAV A;  4Y49 B;  4KSF A;  1YK3 A;  4ZY2 A;  1LAM A;  2DF5 A;  1HDQ A;  2IL4 A;  2ZEL A;  4C68 A;  3B35 A;  4EME A;  4F6A A;  2B5G A;  1Z2L A;  3BXM A;  4PV6 A;  2PVW A;  5LRJ A;  4BD9 A;  4R3K A;  3NH5 A;  4KOS A;  4CAF A;  4HKF A;  1IYL A;  2BL1 A;  3VWE A;  1IID A;  1QSM A;  4C2X A;  1CM0 A;  2PJ4 A;  1I21 A;  2RC4 A;  3S9N A;  2AFS A;  4F9U A;  1ON0 A;  2FE7 A;  2O53 A;  2ZEP A;  4KVM E;  3SXN A;  4CYP A;  4F8Z A;  3DGV A;  2WYR A;  2FIW A;  2ZEO A;  5ISV A;  1ZG7 A;  5HXD A;  3PFO A;  1KUX A;  4KS9 A;  5H84 A;  2VZY A;  1Z8L A;  3FBU A;  3NA6 A;  2ANP A;  3EXN A;  1TKJ A;  4F0X A;  1K4J A;  4MHD A;  2PVV A;  3PB4 X;  4MFQ A;  4ZBG A;  3TCV A;  1XEB A;  4Q7A A;  2Z10 A;  2FXF A;  2GFQ A;  1YVK A;  2FT0 A;  3BI0 A;  3EC4 A;  4H2K A;  4MY0 A;  3F0A A;  4QUS A;  3BI1 A;  4UFW A;  5I0C A;  4R76 A;  5CPA A;  2V8H A;  4IK2 A;  1XBU A;  4AVA A;  3C26 A;  5DS0 A;  2ZED A;  2AFZ A;  1ARL A;  1YVO A;  3CXQ A;  2J8N A;  2Q7B A;  4QBJ A;  2WPX A;  3PFE A;  1LAP A;  3D67 A;  1M4D A;  1GYT A;  4A31 A;  2CNM A;  1I1D A;  2PJB A;  2PR8 A;  2A4N A;  3IJ3 A;  4IAV A;  3SJX A;  4YWY A;  1VHE A;  3FH4 A;  3EO4 A;  1VKC A;  2PJ5 A;  4RI1 A;  4CGN A;  4MHN A;  3KZW A;  2QVP A;  3E0K A;  4KOU A;  4UA3 A;  2B58 A;  3HUV A;  3LAC A;  2GE3 A;  1F2O A;  4KOW A;  4KSA A;  4FWU A;  4OIW A;  5AG7 A;  3TO6 A;  1KZF A;  5G1Z A;  3TFY A;  2ZOF A;  2R8V A;  4PK2 A;  2XEI A;  4JJX A;  2EK9 A;  3D7D A;  2BUE A;  4KUB A;  3CDX A;  4CGO A;  4FBE A;  1ELL P;  2BO9 A;  1YLE A;  4KVO E;  4NGT A;  1IOI A;  2Q44 A;  2JBK A;  3PRT A;  4Q38 A;  1M44 A;  2OB0 A;  3IGR A;  4HPS A;  4TWE A;  4B5P B;  1LRZ A;  5F49 A;  3K9U A;  3B3T A;  3NFZ A;  3D7H A;  3QAH A;  4NGP A;  1U6M A;  3VH9 A;  5K8M A;  2O28 A;  4MFK A;  5THW A;  4XPK A;  3IU1 A;  2FVG A;  1QST A;  2RFH A;  3RNZ A;  1Q2C A;  3R1K A;  1VHO A;  2JEW A;  2ZW4 A;  1YGH A;  5KTA A;  4A38 A;  5CBM A;  4MY3 A;  1AUG A;  3BJ8 A;  3S6H A;  2FCK A;  3ZJ0 A;  5A27 A;  1XMT A;  2REF A;  4UCN A;  4B5P A;  1JWQ A;  2ODF A;  2BOA A;  1IIC A;  3PB9 X;  3V38 A;  1BLL E;  2PJC A;  2EUI A;  2I00 A;  3KAS A;  3WT4 A;  4RUH A;  1B6B A;  5I4M A;  5F46 A;  3CXS A;  3V7Z A;  4NFR A;  3CPX A;  2IQ6 A;  4CPA A;  4TNU A;  5FVJ A;  4B10 A;  1MJA A;  3S6F A;  4PSX A;  1Z9U A;  4K3N A;  1Z4E A;  2F5I A;  5LYI A;  4CAX A;  1MK4 A;  2HC9 A;  2P6F A;  4L89 A;  3TO7 A;  3S9L A;  2Q0Y A;  3D7F A;  3H8F A;  2BSW A;  5G22 A;  2BCO A;  3FB3 A;  2PJ9 A;  4XNH C;  1YQE A;  2VXK A;  4R6T A;  1YW6 A;  3ZZI A;  8CPA A;  4ZY0 A;  3GUX A;  1AMP A;  4MCP A;  1IU8 A;  2NMT A;  2PE3 A;  4OC0 A;  3RBU A;  2Q4V A;  3D66 A;  1TKF A;  3KHX A;  2CTB A;  5JM6 A;  3IC1 A;  3B3C A;  1I12 A;  1PCA A;  1IYK A;  4ORF A;  5E96 A;  1S7L A;  5HVF A;  3RYO A;  3WC7 A;  1S7F A;  4ZGY B;  5HVG A;  4M6H A;  4R3L A;  1OZP A;  4NGS A;  2ZEG A;  2P6G A;  3DSB A;  5F48 A;  5LRK A;  2G0B A;  2HB6 A;  3H8G A;  3R9F A;  2FIA A;  4RS2 A;  4Z65 A;  1YR0 A;  1P4N A;  2I79 A;  2V8D A;  3GLJ A;  1X12 A;  4J3G A;  2EO8 A;  4QC6 A;  2DEA A;  1KWM A;  1ZG8 A;  3EFA A;  2CIJ A;  3D2M A;  2PDO A;  4NSQ A;  5GCN A;  3PBE A;  2V77 A;  2F8H A;  3I3G A;  2H5M A;  1DTD A;  4KUA A;  2ZEF A;  3KI9 A;  1M1D A;  4M3S A;  3S6G A;  2OU2 A;  1GHE A;  4MBU A;  1S60 A;  1RXT A;  3SHP A;  3JUW A;  4AVC A;  2J9A A;  1VGY A; 
#chains in the Genus database with same CATH homology
 4KOT A;  1XE4 A;  3W6S A;  3A9L A;  4KOR A;  2KCW A;  4CS0 B;  2PRB A;  5G21 A;  4YFJ A;  4CYO A;  4QVT A;  2YNC A;  4C7H A;  3VWD A;  4UFV A;  2REE A;  4R87 A;  2X7B A;  4CAW A;  3EY5 A;  4X5K A;  3D3S A;  5C88 A;  5JQ4 A;  3NE7 A;  4U9Y A;  4CGL A;  5DWN A;  4CAE A;  2Z0Z A;  4QB9 A;  1QSN A;  2FSR A;  4NEX A;  4CRY B;  1PU9 A;  3R96 A;  4XPD C;  4UWJ A;  3W91 A;  2JDC A;  4II9 A;  2YND A;  3S6K A;  2HQY A;  4PSW A;  1Y9W A;  3D8P A;  4MJ8 A;  4EVY A;  3T9Y A;  1RO5 A;  1S7K A;  4I49 A;  4Y49 C;  3TO9 A;  5EBV A;  2Y0M A;  4R57 A;  1SQH A;  4MFJ A;  2OZG A;  1NSL A;  3KKW A;  5J8C A;  5JPH A;  1Q2D A;  3B8G A;  4JLY A;  3R9E A;  3QB8 A;  2OH1 A;  2GAN A;  2DXQ A;  5A28 A;  3GY9 A;  4LUA A;  2YGW A;  4CGM A;  3TOB A;  4HNW B;  1ZO0 A;  1J4J A;  2ZW6 A;  1Y9K A;  4BBH A;  2WUU A;  5AG4 A;  2VBQ A;  3P2H A;  4FD5 A;  4OAD A;  1WWZ A;  4HNY B;  2J8M A;  2B3U A;  2GIV A;  4BMH A;  3TE4 A;  3R9G A;  3OWC A;  4MI4 A;  4B12 A;  4XPL A;  1PUA A;  3G3S A;  2B4B A;  2R7H A;  3DNS A;  2VI7 A;  3BJ7 A;  4MFZ A;  4OAE A;  5AGE A;  4NXY A;  4F0Y A;  3PZJ A;  4CGP A;  3LOD A;  1QSR A;  2PSW A;  2CNS A;  2ZXV A;  2G3T A;  4CYQ A;  1M4G A;  4E0A A;  1KUV A;  4KLV A;  4C7I A;  1UFH A;  1B87 A;  2P6E A;  2PQ8 A;  4A33 A;  3MGD A;  4Q36 A;  4GS4 A;  3TT2 A;  5CNP A;  2CNT A;  4NF1 A;  3GYA A;  3T90 A;  3WR7 A;  2CY2 A;  2QML A;  5KTC A;  4JWP A;  4H89 A;  5HH1 A;  2Q04 A;  4KOY A;  2CXA A;  1R57 A;  2K5T A;  1XF8 A;  1P0H A;  3FYN A;  1NMT A;  1NE9 A;  2Z3M A;  4LX9 A;  5H86 A;  4JXR A;  2ARH A;  4KOX A;  3V8I A;  2QIR A;  3DR8 A;  2EVN A;  2JLM A;  5BWA B;  2B4D B;  4E8O A;  2C27 A;  1BO4 A;  3FXT A;  3H5Z A;  1Z4R A;  1N71 A;  3G8W A;  3BLN A;  2PC1 A;  5AG6 A;  2WPW A;  5HMN A;  4FD6 A;  4YRH A;  3R95 A;  4L8A A;  2D4O A;  4KLW A;  1KUY A;  4AG7 A;  4OLL A;  2B3V A;  2B4D A;  2OZH A;  3GKR A;  4C2Y A;  3F5B A;  5KTD A;  4YGO A;  2FL4 A;  2ZW5 A;  3SXO A;  2WSA A;  2PR1 A;  3W6X A;  1QSO A;  4MFP A;  2R1I A;  3IWG A;  3D2P A;  1Y7R A;  4UCM A;  4B5O A;  5EC4 A;  5IB0 A;  4FD7 A;  2YNE A;  3N7Z A;  1VHS A;  4XNH B;  5G20 A;  4C2Z A;  3P2F A;  3UY5 A;  4M85 A;  3FIX A;  2Z3K A;  2JEV A;  2Z3P A;  2D4P A;  4PK3 A;  4AG9 A;  4R9M A;  4HNX B;  3I9S A;  1V0C A;  2YNC C;  4K30 A;  4AVB A;  2P0W A;  2Z3L A;  1WK4 A;  4DNC A;  1FY7 A;  2BEI A;  5AG5 A;  4KVX A;  2FS5 A;  4IUS A;  1YX0 A;  2Z11 A;  1IB1 E;  4U5Y A;  2Q4Y A;  4FD4 A;  2DPT A;  1CJW A;  4A32 A;  3TTH A;  1S3Z A;  5DWM A;  4CYN A;  2DPS A;  4A95 A;  2Z3N A;  4JD6 A;  2AJ6 A;  2VQY A;  4KZT A;  4MFL A;  3JVN A;  5IX3 A;  3FNC A;  1M4I A;  1BOB A;  2HV2 A;  3LD2 A;  2R98 A;  2J8R A;  1S5K A;  5IV0 A;  4NCZ A;  3F8K A;  1TIQ A;  4H6U A;  1Q2Y A;  1L0C A;  2HUZ A;  4B13 A;  4B14 A;  1YRE A;  4JXQ A;  4E2A A;  3TOA A;  2OZU A;  4IF5 A;  2G3A A;  5J8F A;  2VEZ A;  3CXP A;  4H6Z A;  4B11 A;  5F47 A;  4ONU A;  4A2Z A;  1MJ9 A;  1XIX A;  2AE6 A;  4CAV A;  2ATR A;  2ZW7 A;  2VZZ A;  2ZPA A;  3JTK A;  4UWI A;  4UBR A;  2B5G B;  2QEC A;  4XPD B;  4A30 A;  4CRZ B;  5C82 A;  2Z3O A;  4KOV A;  2JDD A;  3PP9 A;  3IU2 A;  3IWE A;  4U9Z A;  1MJB A;  3DR6 A;  3PGP A;  1S7N A;  3H4Q A;  3FRM A;  3DDD A;  4UFX A;  4AB7 A;  4Y49 B;  4KSF A;  1YK3 A;  2IL4 A;  4F6A A;  4C68 A;  2B5G A;  4PV6 A;  4R3K A;  4CAF A;  4KOS A;  4HKF A;  1IYL A;  2BL1 A;  3VWE A;  1IID A;  1QSM A;  4C2X A;  1CM0 A;  1I21 A;  2RC4 A;  1ON0 A;  2FE7 A;  4KVM E;  3SXN A;  4CYP A;  2FIW A;  5ISV A;  1KUX A;  4KS9 A;  5H84 A;  2VZY A;  3FBU A;  4F0X A;  3EXN A;  1K4J A;  4MHD A;  4MFQ A;  4ZBG A;  3TCV A;  1XEB A;  2Z10 A;  2FXF A;  4MY0 A;  1YVK A;  2FT0 A;  4UFW A;  3EC4 A;  3F0A A;  4QUS A;  5I0C A;  4AVA A;  3C26 A;  1YVO A;  3CXQ A;  2J8N A;  2Q7B A;  4QBJ A;  2WPX A;  1M4D A;  4A31 A;  2CNM A;  1I1D A;  2PR8 A;  2A4N A;  3EO4 A;  1VKC A;  4RI1 A;  4CGN A;  3E0K A;  4KOU A;  4UA3 A;  2B58 A;  4KOW A;  4UCP A;  2GE3 A;  4KSA A;  5AG7 A;  3TO6 A;  3TFY A;  1KZF A;  5G1Z A;  2R8V A;  4PK2 A;  4JJX A;  4KUB A;  2BUE A;  4CGO A;  1YLE A;  4KVO E;  4Q38 A;  2Q44 A;  4B5P B;  1M44 A;  2OB0 A;  3IGR A;  1LRZ A;  5F49 A;  3K9U A;  3QAH A;  1U6M A;  2O28 A;  4MFK A;  4XPK A;  3IU1 A;  1QST A;  1Q2C A;  3R1K A;  2ZW4 A;  1YGH A;  5KTA A;  4MY3 A;  3S6H A;  3BJ8 A;  2FCK A;  3ZJ0 A;  5A27 A;  1XMT A;  2REF A;  4UCN A;  4B5P A;  1IIC A;  2EUI A;  2I00 A;  1B6B A;  5F46 A;  3CXS A;  5FVJ A;  4B10 A;  1MJA A;  3S6F A;  4PSX A;  1Z9U A;  1Z4E A;  2F5I A;  4CAX A;  1MK4 A;  2P6F A;  3TO7 A;  4L89 A;  2Q0Y A;  2BSW A;  5G22 A;  3FB3 A;  4XNH C;  2VXK A;  3ZZI A;  2NMT A;  2Q4V A;  1I12 A;  4ORF A;  1IYK A;  3RYO A;  5E96 A;  1S7L A;  1S7F A;  4ZGY B;  4R3L A;  1OZP A;  3DSB A;  2P6G A;  5F48 A;  2G0B A;  3R9F A;  2FIA A;  4RS2 A;  1YR0 A;  1P4N A;  2I79 A;  4J3G A;  4QC6 A;  3EFA A;  3D2M A;  2PDO A;  4NSQ A;  5GCN A;  3I3G A;  2H5M A;  4KUA A;  1M1D A;  4M3S A;  3S6G A;  2OU2 A;  1GHE A;  4MBU A;  1S60 A;  1RXT A;  3SHP A;  3JUW A;  4AVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...