1B87A

Crystal structure of an aminoglycoside 6'-n-acetyltransferase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
181
structure length
181
Chain Sequence
MIISEFDRNNPVLKDQLSDLLRLTWPEEYGDSSAEEVEEMMNPERIAVAAVDQDELVGFIGAIPQYGITGWELHPLVVESSRRKNQIGTRLVNYLEKEVASRGGITIYLGTDDLDHGTTLSQTDLYEHTFDKVASIQNLREHPYEFYEKLGYKIVGVLPNANGWDKPDIWMAKTIIPRPDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an aminoglycoside 6'-N-acetyltransferase: defining the GCN5-related N-acetyltransferase superfamily fold.
pubmed doi rcsb
molecule tags Transferase
molecule keywords PROTEIN (AMINOGLYCOSIDE N6'-ACETYLTRANSFERASE TYPE 1)
total genus 50
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 1999-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1b87A00
1MJAA 1R57A 1P4NA 4PSWA 4CRZB 2GANA 2B5GB 4F6AA 2P6EA 2F5IA 2ZXVA 2B3UA 4FD4A 4UBRA 3QB8A 4CS0B 3R9GA 4JXQA 2VI7A 3R9EA 3WR7A 4U5YA 2Q44A 1K4JA 4M3SA 5E96A 5IX3A 2R1IA 2BSWA 4HNXB 3PGPA 1QSRA 2WPXA 4LUAA 3R96A 3TT2A 3FB3A 2ZW7A 2ZW5A 3P2HA 4KLVA 4HNWB 1XMTA 4M85A 4CAXA 2J8NA 3I3GA 4OAEA 4UA3A 2GE3A 4FD6A 2FSRA 2FT0A 2OZUA 2G3TA 3DDDA 4XPLA 1RO5A 2FS5A 2Z0ZA 2OZGA 2VZZA 4NF1A 2B3VA 2CNSA 4FD5A 4Y49C 3P2FA 2HUZA 5F48A 4UWJA 1CJWA 1YREA 3G8WA 2I79A 3TE4A 2PSWA 3SXNA 1KUXA 1I1DA 1MJ9A 1NE9A 3FXTA 3JVNA 1OZPA 4RI1A 3ZJ0A 2R98A 4KOTA 4KOVA 4L89A 5ISVA 2GIVA 4E0AA 3DSBA 4MY0A 2REEA 2P6FA 4J3GA 1S5KA 2IL4A 1B6BA 5F46A 1ON0A 2ZW4A 5KTCA 1I12A 3C26A 2EVNA 4PK3A 2Y0MA 4EVYA 3BJ7A 4ONUA 4NCZA 1XEBA 3OWCA 3S6KA 4YFJA 4AB7A 1QSTA 3F8KA 2VQYA 4QB9A 2C27A 2O28A 4Y49B 1M4IA 2ATRA 5CNPA 2JEVA 1VHSA 5HMNA 2PR8A 3R95A 1KUVA 3W6XA 2FE7A 4NXYA 4AG9A 2K5TA 3KKWA 4KVME 3F5BA 4B5PB 3GY9A 5IV0A 4CRYB 2HQYA 1Y9WA 3W91A 1Q2DA 3W6SA 4H89A 4QUSA 2ARHA 2PDOA 3T9YA 3F0AA 1L0CA 2P6GA 2AE6A 4JJXA 2D4PA 5F49A 3ZZIA 3SHPA 4AVCA 1IIDA 3G3SA 4XPDB 2QMLA 3S6HA 1Z4EA 2R7HA 4KOWA 1NMTA 4KOYA 4JD6A 4XNHB 5I0CA 1YX0A 3VWDA 1MK4A 4KLWA 4AVBA 1FY7A 4NSQA 2Z10A 2AJ6A 3FRMA 3FNCA 2ZW6A 4YGOA 4XNHC 3K9UA 5DWNA 1YVKA 1BOBA 3N7ZA 2BEIA 1V0CA 4FD7A 4KOSA 2Q4YA 1XE4A 5EC4A 1LRZA 4K30A 4IUSA 5IB0A 3EFAA 4HKFA 4JWPA 5KTAA 1M4DA 4II9A 3IWGA 4KOXA 2D4OA 1KZFA 4QC6A 2CNTA 1S7NA 2Q04A 3E0KA 4HNYB 3PZJA 2I00A 1BO4A 4XPDC 1XF8A 3D2MA 3GKRA 2CNMA 5F47A 3S6GA 3SXOA 5FVJA 3RYOA 1S7LA 3B8GA 2FIWA 4MJ8A 4AG7A 4R87A 2VZYA 3D8PA 2A4NA 5EBVA 4XPKA 2ZPAA 1IYLA 3D2PA 3DR6A 4L8AA 4PV6A 4U9ZA 1Q2YA 2Q0YA 1TIQA 3TO9A 5J8FA 3UY5A 1WWZA 2J8MA 2FL4A 4F0YA 1Y9KA 4DNCA 1M4GA 4B5OA 2FCKA 1CM0A 3TOBA 2B4DA 4KORA 1IICA 1YGHA 3BJ8A 4QBJA 3LD2A 3EC4A 1PUAA 2B4BA 1Y7RA 5C88A 1J4JA 2VEZA 4MBUA 1N71A 1S3ZA 5JQ4A 4X5KA 3H4QA 3IGRA 4E8OA 4LX9A 3CXPA 4RS2A 1YLEA 2DXQA 2X7BA 4IF5A 3R1KA 2B5GA 4MHDA 4PK2A 4R9MA 1Z4RA 2OZHA 4AVAA 3NE7A 2B58A 4QVTA 2PC1A 3CXSA 2H5MA 1KUYA 5DWMA 4ORFA 3R9FA 2BUEA 1RXTA 3JUWA 3VWEA 2FIAA 1I21A 3D3SA 2QECA 2OB0A 2REFA 1Q2CA 4KVXA 4KUAA 3TCVA 2P0WA 2QIRA 5KTDA 5GCNA 2BL1A 4R3LA 1NSLA 3TO6A 4NEXA 1SQHA 4CAVA 4UWIA 4E2AA 4CAWA 3GYAA 1M1DA 3I9SA 1GHEA 1XIXA 1YR0A 1S7KA 3BLNA 5JPHA 3CXQA 3V8IA 4PSXA 3QAHA 3PP9A 1IYKA 5HH1A 1YK3A 3LODA 1YVOA 2JLMA 2FXFA 4H6UA 4KZTA 2G3AA 5C82A 1S60A 2EUIA 1PU9A 3TOAA 1VKCA 4KVOE 3TO7A 4KOUA 4GS4A 4B5PA 2Z11A 4MY3A 5H86A 2JDDA 1WK4A 3TTHA 2PRBA 4H6ZA 1IB1E 2KCWA 2J8RA 4MI4A 2JDCA 4OADA 3EXNA 2RC4A 2Q7BA 1Z9UA 3EO4A 5J8CA 1QSNA 2PQ8A 1P0HA 2CY2A 2PR1A 1B87A 2Q4VA 4ZBGA 1MJBA 4I49A 2WPWA 4JLYA 3MGDA 4R3KA 2R8VA 3EY5A 3T90A 2NMTA 1QSMA 2VBQA 4OLLA 3TFYA 2OU2A 1M44A 5H84A 4YRHA 4KUBA 1U6MA 1UFHA 4BMHA 3FYNA 1QSOA 3DNSA 3S6FA 2B4DB 2G0BA 4JXRA 4U9YA 3FIXA 1S7FA 3FBUA 2HV2A 4R57A 2OH1A 2VXKA 3DR8A
chains in the Genus database with same CATH superfamily
1MJAA 1R57A 3K2KA 1P4NA 4PSWA 4B11A 2GANA 1QQ9A 4CRZB 2B5GB 4F6AA 1IOIA 4OMEA 2P6EA 2F5IA 2ZXVA 3GUXA 3KL9A 4A2ZA 2B3UA 4A39A 4FD4A 4UBRA 2Q7SA 3QB8A 4CS0B 4FBEA 3R9GA 4JXQA 3B3SA 5D29A 4CYQA 4R7MA 5G22A 2QYVA 2VI7A 3V7ZA 2Z3LA 4Z65A 2ABZA 2YGWA 3PB9X 3R9EA 4MMOA 3WR7A 4NGSA 4U5YA 2Q44A 2AFWA 3IC1A 1K4JA 1TXRA 4M3SA 4KSAA 3ISZA 5E96A 5IX3A 2R1IA 2BSWA 4HNXB 3PGPA 5LYDA 1Z2LA 1QSRA 2CIJA 2WPXA 4LUAA 3R96A 3TT2A 2F7VA 3FB3A 3B35A 2ODFA 2WSAA 3GLJA 4ZGYB 2ZW7A 1AYEA 4YWYA 1YW6A 4PPZA 4UIBA 3JRUA 2ZW5A 4CGLA 4A38A 3P2HA 3BHXA 4KLVA 4HNWB 1XMTA 4M85A 4W9YA 4CAXA 3B3WA 4MFZA 4Q7AA 2Z3NA 4ZI6A 2J8NA 3I3GA 5JH9A 4NGMA 1ZLHA 4OAEA 4UCMA 4UA3A 2GE3A 4FD6A 6CPAA 2PCUA 2FSRA 2FT0A 7CPAA 1QMUA 3KASA 2OZUA 4X3RA 4RUHA 3IJ3A 3VH9A 2G3TA 2PVWA 4R76A 1AMPA 3DDDA 1DTDA 3KZWA 4MCPA 1IY7A 4MFJA 4P44A 4XPLA 1RO5A 2FS5A 2Z0ZA 3CPAA 2OZGA 3H8FA 2VZZA 2B3VA 2Z3PA 4NF1A 2CNSA 4FD5A 1H8LA 4Y49C 3P2FA 2HUZA 1DE4C 5F48A 4UWJA 3PB4X 1FT7A 1CJWA 1YREA 3G8WA 4LQ6A 4OP4A 4UEFA 4B14A 2I79A 3KR4A 4RN7A 4A37A 4H2KA 3TE4A 2HC9A 2QJ8A 2PSWA 3PBEA 3SXNA 1KUXA 1I1DA 1MJ9A 1NE9A 4Q36A 3D68A 3FXTA 4OC5A 1ZG9A 2G9DA 2EK8A 3B7IA 3JVNA 4BBHA 3FMCA 1F2PA 1OZPA 4RI1A 1XOVA 3SI1A 3ZJ0A 2R98A 4GM5A 4KOTA 4KOVA 2ZEMA 2F8HA 3GIUA 2DPTA 4L89A 2NSMA 3S9LA 4P4FA 5ISVA 2GIVA 1HEEA 2VL1A 4E0AA 3DSBA 4MY0A 2REEA 2EWBA 2P6FA 4J3GA 3NA6A 3CPXA 4OKOA 1S5KA 3ISXA 2IL4A 3B2YA 1B6BA 4OC1A 4P4IA 5F46A 1ON0A 2ZW4A 3QAYA 4MFPA 3FJUA 1CPXA 5KTCA 2AFMA 1I12A 1EE3P 3C26A 2EVNA 2ZEGA 4PK3A 4C2YA 2Y0MA 1BPMA 4EVYA 3IFEA 3BJ7A 4P6YA 4FWUA 4A94A 4ONUA 4FAIA 4NCZA 1XEBA 3OWCA 3S6KA 4YFJA 5LYFA 5LYLA 4AB7A 2QVPA 4UF4A 4JZ0A 1QSTA 4ZY1A 4OIDA 2JEWA 2C1CA 2VQYA 3F8KA 4QB9A 4CGPA 3BXMA 3QNVA 2C27A 3MN8A 2O28A 4Y49B 1M4IA 2ATRA 5CNPA 2JEVA 5LRGA 3FVLA 1VHSA 2BCOA 4KSIA 5HMNA 3H8EA 1ZLIA 2PR8A 3R95A 1KUVA 1YSJA 3W6XA 2GU2A 2FE7A 4NXYA 4PXBA 4AG9A 2K5TA 2J9AA 2OOTA 3KKWA 4KVME 4CGNA 1VGYA 3F5BA 5D8NA 2GFQA 4B5PB 3GY9A 4UCPA 2PJ6A 5IV0A 4CRYB 3D7HA 2CTBA 2HQYA 1Y9WA 3W91A 1Q2DA 5CBMA 2RFHA 3W6SA 4H89A 3LACA 4QUSA 4NJRA 5LRJA 4C7IA 2BO9A 1Q7LA 2ARHA 1FNOA 2PDOA 3T9YA 3SI0A 4C2XA 1ELLP 3IO1A 3F0AA 5K8OA 1L0CA 3SJXA 2P6GA 2PJ3A 2AE6A 4JJXA 2D4PA 3NH8A 2ZELA 8CPAA 3FH4A 1XMBA 3RAMA 4B12A 5F49A 3ZZIA 2PRQA 3SHPA 4AVCA 1RTQA 1IIDA 3G3SA 4XPDB 2QMLA 3S6HA 1Z4EA 2ANPA 4CYPA 2IMOA 2R7HA 1NSAA 4MFLA 5K8MA 4KOWA 1NMTA 4MRIA 4KOYA 4JD6A 4XNHB 5I0CA 1LAMA 5G1ZA 1YX0A 3WC6A 3VWDA 1MK4A 4KLWA 3T8WA 4AVBA 1FY7A 3NFZA 2AFSA 3NH5A 4MHZA 2DPSA 4O23A 3SI2A 2PJ0A 2PIZA 5AGEA 4NSQA 5JGFA 2Z3MA 4G1PA 2Z10A 2AJ6A 3FRMA 3FNCA 4EMEA 2ZW6A 4YGOA 3CZXA 4XNHC 1XJOA 2PJCA 3KQZA 3K9UA 4NGTA 5DWNA 4ZX8A 4B13A 4GXHA 3PFEA 1YVKA 1BOBA 3N7ZA 2BEIA 1V0CA 4FD7A 4KOSA 2Q4YA 5J1QA 5LYIA 1YLOA 1XE4A 2Q43A 1LRZA 1BAVA 4NGPA 5EC4A 4K3NA 4F0XA 1JQGA 4K30A 2PJ8A 4IUSA 2ZEDA 5IB0A 3EFAA 2PVVA 4HKFA 4JWPA 5KTAA 1M4DA 4II9A 3IWGA 3KI9A 1Z8XA 2PJ4A 4KOXA 2D4OA 4MHPA 5A27A 1KZFA 2AFXA 4QC6A 2CNTA 1S7NA 5I4MA 3VARA 2Q04A 4A95A 3E0KA 4HNYB 1LANA 4PXEA 4A33A 1VHOA 3A9LA 5K8NA 1PCAA 3PZJA 4NFRA 2GREA 2ZEOA 4M6GA 4HPSA 3D7DA 4WJBA 1IGBA 2I00A 3H5ZA 1X10A 2JBKA 1BO4A 3PEIA 4XPDC 5ELYA 2V8HA 2WZNA 2Z3KA 1TKFA 1XF8A 3D2MA 3GKRA 3BI0A 4Q38A 4CYNA 2CNMA 5F47A 4TNUA 3S6GA 2AFZA 3SXOA 1Y0RA 4ONWA 4B6ZA 4ZYQA 5FVJA 3KGQA 3RYOA 3RO0A 4UFVA 1Z8LA 1S7LA 3KHXA 3B8GA 4MHYA 2FIWA 3MRUA 4MJ8A 4P45A 4UFWA 1R43A 4R87A 5DS0A 4KSFA 4AG7A 2VZYA 2GLFA 1IOFA 3D8PA 2A4NA 5EBVA 4XPKA 2NYQA 5AG6A 4EWTA 2ZPAA 1IYLA 3D2PA 2PJ7A 2POKA 1GYTA 3HUVA 3FF3A 3RNZA 5JM6A 3DR6A 4M6IA 4MFQA 2BOAA 2DF5A 4L8AA 4PV6A 4U9ZA 1Q2YA 2Q0YA 2Z3OA 3DLJA 1BPNA 3RBUA 1TIQA 3TO9A 2CF4A 3PB8X 5J8FA 3UY5A 4CAEA 1WWZA 2J8MA 2FL4A 2YNCC 4F0YA 1TF8A 4MFKA 1Y9KA 4DNCA 4R6TA 5LRKA 3D66A 2I3CA 4NGQA 4PXCA 4P10A 1M4GA 1IU8A 4PQAA 4B5OA 3B3VA 3HLPA 1ZG7A 2FCKA 1CM0A 3TOBA 1TKHA 2B4DA 4KORA 2DEAA 1IICA 1YGHA 2PE3A 3H8GA 2ZOGA 3BJ8A 3KQXA 4QBJA 4YU9A 3LD2A 3EC4A 1PUAA 3GB0A 2B4BA 3WC7A 1Y7RA 5C88A 4MCQA 1J4JA 2VEZA 2V77A 4MBUA 1N71A 3IIBA 1S3ZA 5JQ4A 4ZX9A 3S9NA 1ARLA 4X5KA 4IHMA 3H4QA 3IGRA 4UFXA 2ZOFA 4E8OA 4LX9A 3CXPA 4RS2A 3FEEA 1XBUA 4LQGA 1CX8A 4TWEA 1CP6A 1YLEA 3I1UA 4C2ZA 2DXQA 4CGOA 2X7BA 2ZEPA 2PIYA 4IF5A 4YRHA 4CGMA 2Q4ZA 2XEFA 3R1KA 4IK2A 2B5GA 1F2OA 1HDUA 4UEEA 5HVHA 4A30A 4M6HA 5HXDA 4MHDA 5A28A 4PK2A 4R9MA 4X8IA 3D7GA 1Z4RA 4P4EA 2OZHA 1CPSA 3TC8A 3LWUA 1ELMP 1Z5RA 2O53A 4AVAA 1LOKA 3NE7A 2EO8A 2B58A 4EFDA 4QVTA 5HVGA 2PC1A 3PB6X 1Y7EA 3CXSA 2H5MA 1ZG8A 2PJ1A 3WABA 1TF9A 4C68A 4CPAA 3WT4A 3NH4A 4UEZA 3V38A 1A2ZA 1KUYA 2HB6A 3B3CA 3BI1A 3IEHA 3LMSA 4P4JA 2ZENA 5DWMA 4JYWA 3NE8A 4ORFA 2WUUA 3JTKA 3S9MA 4OIWA 4DYOA 4F8ZA 1Z8WA 1LAPA 3R9FA 2PJ5A 2BUEA 5H84A 3RZAA 1RXTA 3JUWA 3VWEA 4WWVA 2CXAA 4C7HA 2FIAA 1HDQA 1I21A 2QECA 3D3SA 1TKJA 2ZEHA 2OB0A 2REFA 4NGRA 1BLLE 2C6CA 1Q2CA 4KVXA 4KUAA 3SJFA 2JBJA 2V8DA 3TCVA 4F9VA 5G21A 2OR4A 2P0WA 2QIRA 5KTDA 5GCNA 2BL1A 3SJEA 5CPAA 3PRTA 4R3LA 3PFOA 1NSLA 4CYOA 3TO6A 4NEXA 5HVFA 4MCRA 1SQHA 4CAVA 5BWAB 4AXVA 4DUKA 4UWIA 4E2AA 4FUUA 3VATA 3WC5A 1OBRA 4CAWA 1AUGA 3GYAA 2XEJA 1M1DA 5AG5A 3I9SA 1GHEA 3SJGA 1XIXA 2WYRA 1YR0A 2V8VA 2AFUA 2YNDA 4MCSA 1S7KA 3BLNA 5JPHA 3CXQA 4UCNA 3V8IA 4PSXA 1CBXA 3QAHA 3PP9A 1IYKA 5HH1A 2XEIA 1YK3A 2PJBA 2C6GA 3FEDA 3LODA 1YVOA 2JLMA 2FXFA 1ZO0A 3FECA 3D4UA 4H6UA 1XRYA 4KZTA 2G3AA 1VIXA 4ZY0A 4MXUA 2ZEFA 1S60A 2XEGA 5C82A 2EUIA 1PU9A 3TOAA 1VKCA 2PJ2A 4KVOE 3TO7A 4KOUA 5F09A 4GS4A 4B5PA 3PB7X 4DJLA 2Z11A 4CAFA 4MY3A 1X12A 5H86A 2JDDA 1WK4A 1ARMA 4KS9A 2ZEEA 3TTHA 2PRBA 4A32A 4OC3A 4H6ZA 1UWYA 1IB1E 2KCWA 2O4HA 2J8RA 4MI4A 3DGVA 2JDCA 4OADA 2V8GA 1XFOA 3EXNA 2RC4A 2Q7BA 4OC4A 1Z9UA 4F9UA 1Z8TA 4UIAA 4MHNA 3EO4A 5J8CA 1QSNA 2PQ8A 1P0HA 2YNEA 3TX8A 2CY2A 2PR1A 1B87A 2PJ9A 2Q4VA 1MJBA 2GLJA 4ZBGA 4I49A 3K9TA 2WPWA 5G20A 3B3TA 4ZY2A 4JLYA 4A31A 3KR5A 5K8PA 3MGDA 2Q51A 4R3KA 4NGNA 2R8VA 3EY5A 1F57A 2EK9A 2IJZA 3T90A 2NMTA 4NJQA 3IWEA 1QSMA 2VBQA 4OLLA 1JWQA 2FVGA 3TFYA 4BD9A 5IB9A 3CDXA 2PJAA 2OU2A 3IU2A 1KWMA 1M44A 1R3NA 1Y0YA 3L2NA 4IAVA 4OC0A 4KUBA 4P4DA 1M4LA 1U6MA 1UFHA 3KHZA 3PBBA 4R8FA 4BINA 2EBJA 4BMHA 3CT9A 3FYNA 1QSOA 3D67A 1VHEA 2C6PA 1PYTB 3DNSA 5EMIA 4X2TA 3S6FA 1LCPA 2B4DB 2G0BA 2RB7A 1CG2A 3FX6A 5AG7A 1YQEA 1YMEA 3IWWA 4JXRA 5THWA 4U9YA 4P4BA 2YNCA 1CP7A 3N5FA 3FIXA 4PXDA 1S7FA 3FBUA 2AFOA 4B10A 3IU1A 1YW4A 5AG4A 2HV2A 1LFWA 4R57A 2CTCA 4OC2A 2IQ6A 2OH1A 2VXKA 3D7FA 3DR8A
chains in the Genus database with same CATH topology
1MJAA 1R57A 4B11A 1P4NA 4PSWA 4CRZB 2GANA 2B5GB 4F6AA 2P6EA 2F5IA 2ZXVA 4A2ZA 2B3UA 4FD4A 4UBRA 3QB8A 4CS0B 3R9GA 4JXQA 4CYQA 5G22A 2VI7A 2Z3LA 2YGWA 3R9EA 3WR7A 4U5YA 2Q44A 1K4JA 4M3SA 4KSAA 5E96A 5IX3A 2R1IA 2BSWA 4HNXB 3PGPA 1QSRA 2WPXA 4LUAA 3R96A 3TT2A 3FB3A 4ZGYB 2WSAA 2ZW7A 2ZW5A 4CGLA 3P2HA 4KLVA 4HNWB 1XMTA 4M85A 4CAXA 4MFZA 2Z3NA 2J8NA 3I3GA 4OAEA 4UCMA 4UA3A 2GE3A 4FD6A 2FSRA 2FT0A 2OZUA 2G3TA 3DDDA 4MFJA 4XPLA 1RO5A 2FS5A 2Z0ZA 2OZGA 2VZZA 2B3VA 2Z3PA 4NF1A 2CNSA 4FD5A 4Y49C 3P2FA 2HUZA 5F48A 4UWJA 1CJWA 1YREA 3G8WA 4B14A 2I79A 3TE4A 2PSWA 3SXNA 1KUXA 1I1DA 1MJ9A 1NE9A 4Q36A 3FXTA 4BBHA 3JVNA 1OZPA 4RI1A 3ZJ0A 2R98A 4KOTA 4KOVA 2DPTA 4L89A 5ISVA 2GIVA 4E0AA 3DSBA 4MY0A 2REEA 2P6FA 4J3GA 1S5KA 2IL4A 1B6BA 5F46A 1ON0A 2ZW4A 4MFPA 5KTCA 1I12A 3C26A 2EVNA 4C2YA 4PK3A 2Y0MA 4EVYA 3BJ7A 4ONUA 4NCZA 1XEBA 3OWCA 3S6KA 4YFJA 4AB7A 1QSTA 3F8KA 2VQYA 4QB9A 4CGPA 2C27A 2O28A 4Y49B 1M4IA 2ATRA 5CNPA 2JEVA 1VHSA 5HMNA 2PR8A 3R95A 1KUVA 3W6XA 2FE7A 4NXYA 4AG9A 2K5TA 3KKWA 4KVME 4CGNA 3F5BA 4B5PB 3GY9A 4UCPA 5IV0A 4CRYB 2HQYA 1Y9WA 3W91A 1Q2DA 3W6SA 4H89A 4QUSA 4C7IA 2ARHA 2PDOA 3T9YA 4C2XA 3F0AA 1L0CA 2P6GA 2AE6A 4JJXA 2D4PA 4B12A 5F49A 3ZZIA 3SHPA 4AVCA 1IIDA 3G3SA 4XPDB 2QMLA 3S6HA 1Z4EA 4CYPA 2R7HA 4MFLA 4KOWA 1NMTA 4KOYA 4JD6A 4XNHB 5I0CA 5G1ZA 1YX0A 3VWDA 1MK4A 4KLWA 4AVBA 1FY7A 2DPSA 5AGEA 4NSQA 2Z3MA 2Z10A 2AJ6A 3FRMA 3FNCA 2ZW6A 4YGOA 4XNHC 3K9UA 5DWNA 4B13A 1YVKA 1BOBA 3N7ZA 2BEIA 1V0CA 4FD7A 4KOSA 2Q4YA 1XE4A 5EC4A 1LRZA 4F0XA 4K30A 4IUSA 5IB0A 3EFAA 4HKFA 4JWPA 5KTAA 1M4DA 4II9A 3IWGA 4KOXA 2D4OA 5A27A 1KZFA 4QC6A 2CNTA 1S7NA 2Q04A 4A95A 3E0KA 4HNYB 4A33A 3A9LA 3PZJA 2I00A 3H5ZA 1BO4A 4XPDC 2Z3KA 1XF8A 3D2MA 3GKRA 4Q38A 4CYNA 2CNMA 5F47A 3S6GA 3SXOA 5FVJA 3RYOA 4UFVA 1S7LA 3B8GA 2FIWA 4MJ8A 4UFWA 4AG7A 4R87A 4KSFA 2VZYA 3D8PA 2A4NA 5EBVA 4XPKA 5AG6A 2ZPAA 1IYLA 3D2PA 3DR6A 4MFQA 4L8AA 4PV6A 4U9ZA 1Q2YA 2Q0YA 2Z3OA 1TIQA 3TO9A 5J8FA 3UY5A 4CAEA 1WWZA 2J8MA 2FL4A 2YNCC 4F0YA 4MFKA 1Y9KA 4DNCA 1M4GA 4B5OA 2FCKA 1CM0A 3TOBA 2B4DA 4KORA 1IICA 1YGHA 3BJ8A 4QBJA 3LD2A 3EC4A 1PUAA 2B4BA 1Y7RA 5C88A 1J4JA 2VEZA 4MBUA 1N71A 1S3ZA 5JQ4A 4X5KA 3H4QA 3IGRA 4UFXA 4E8OA 4LX9A 3CXPA 4RS2A 4C2ZA 1YLEA 2DXQA 4CGOA 2X7BA 4IF5A 4CGMA 3R1KA 2B5GA 4A30A 4MHDA 5A28A 4PK2A 4R9MA 1Z4RA 2OZHA 4AVAA 3NE7A 2B58A 4QVTA 2PC1A 3CXSA 2H5MA 4C68A 1KUYA 5DWMA 4ORFA 2WUUA 3JTKA 3R9FA 2BUEA 1RXTA 3JUWA 3VWEA 2CXAA 4C7HA 2FIAA 1I21A 3D3SA 2QECA 2OB0A 2REFA 1Q2CA 4KVXA 4KUAA 3TCVA 5G21A 2P0WA 2QIRA 5KTDA 5GCNA 2BL1A 4R3LA 4CYOA 1NSLA 3TO6A 4NEXA 1SQHA 4CAVA 5BWAB 4UWIA 4E2AA 4CAWA 3GYAA 1M1DA 5AG5A 3I9SA 1GHEA 1XIXA 1YR0A 2YNDA 1S7KA 3BLNA 5JPHA 3CXQA 4UCNA 3V8IA 4PSXA 3QAHA 3PP9A 1IYKA 5HH1A 1YK3A 3LODA 1YVOA 2JLMA 2FXFA 1ZO0A 4H6UA 4KZTA 2G3AA 5C82A 1S60A 2EUIA 1PU9A 3TOAA 1VKCA 4KVOE 3TO7A 4KOUA 4GS4A 4B5PA 2Z11A 4CAFA 4MY3A 5H86A 2JDDA 1WK4A 4KS9A 3TTHA 2PRBA 4A32A 4H6ZA 1IB1E 2KCWA 2J8RA 4MI4A 2JDCA 4OADA 3EXNA 2RC4A 2Q7BA 1Z9UA 3EO4A 5J8CA 1QSNA 2PQ8A 1P0HA 2YNEA 2CY2A 2PR1A 1B87A 2Q4VA 4ZBGA 1MJBA 4I49A 2WPWA 5G20A 4JLYA 4A31A 3MGDA 4R3KA 2R8VA 3EY5A 3T90A 2NMTA 3IWEA 1QSMA 2VBQA 4OLLA 3TFYA 2OU2A 3IU2A 1M44A 5H84A 4YRHA 4KUBA 1U6MA 1UFHA 4BMHA 3FYNA 1QSOA 3DNSA 3S6FA 2B4DB 2G0BA 5AG7A 4JXRA 4U9YA 2YNCA 4B10A 3FIXA 1S7FA 3FBUA 3IU1A 5AG4A 2HV2A 4R57A 2OH1A 2VXKA 3DR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MJA A;  1R57 A;  1P4N A;  4PSW A;  4CRZ B;  2GAN A;  2B5G B;  4F6A A;  2P6E A;  2F5I A;  2ZXV A;  2B3U A;  4FD4 A;  4UBR A;  3QB8 A;  4CS0 B;  3R9G A;  4JXQ A;  2VI7 A;  3R9E A;  3WR7 A;  4U5Y A;  2Q44 A;  1K4J A;  4M3S A;  5E96 A;  5IX3 A;  2R1I A;  2BSW A;  4HNX B;  3PGP A;  1QSR A;  2WPX A;  4LUA A;  3R96 A;  3TT2 A;  3FB3 A;  2ZW7 A;  2ZW5 A;  3P2H A;  4KLV A;  4HNW B;  1XMT A;  4M85 A;  4CAX A;  2J8N A;  3I3G A;  4OAE A;  4UA3 A;  2GE3 A;  4FD6 A;  2FSR A;  2FT0 A;  2OZU A;  2G3T A;  3DDD A;  4XPL A;  1RO5 A;  2FS5 A;  2Z0Z A;  2OZG A;  2VZZ A;  4NF1 A;  2B3V A;  2CNS A;  4FD5 A;  4Y49 C;  3P2F A;  2HUZ A;  5F48 A;  4UWJ A;  1CJW A;  1YRE A;  3G8W A;  2I79 A;  3TE4 A;  2PSW A;  3SXN A;  1KUX A;  1I1D A;  1MJ9 A;  1NE9 A;  3FXT A;  3JVN A;  1OZP A;  4RI1 A;  3ZJ0 A;  2R98 A;  4KOT A;  4KOV A;  4L89 A;  5ISV A;  2GIV A;  4E0A A;  3DSB A;  4MY0 A;  2REE A;  2P6F A;  4J3G A;  1S5K A;  2IL4 A;  1B6B A;  5F46 A;  1ON0 A;  2ZW4 A;  5KTC A;  1I12 A;  3C26 A;  2EVN A;  4PK3 A;  2Y0M A;  4EVY A;  3BJ7 A;  4ONU A;  4NCZ A;  1XEB A;  3OWC A;  3S6K A;  4YFJ A;  4AB7 A;  1QST A;  3F8K A;  2VQY A;  4QB9 A;  2C27 A;  2O28 A;  4Y49 B;  1M4I A;  2ATR A;  5CNP A;  2JEV A;  1VHS A;  5HMN A;  2PR8 A;  3R95 A;  1KUV A;  3W6X A;  2FE7 A;  4NXY A;  4AG9 A;  2K5T A;  3KKW A;  4KVM E;  3F5B A;  4B5P B;  3GY9 A;  5IV0 A;  4CRY B;  2HQY A;  1Y9W A;  3W91 A;  1Q2D A;  3W6S A;  4H89 A;  4QUS A;  2ARH A;  2PDO A;  3T9Y A;  3F0A A;  1L0C A;  2P6G A;  2AE6 A;  4JJX A;  2D4P A;  5F49 A;  3ZZI A;  3SHP A;  4AVC A;  1IID A;  3G3S A;  4XPD B;  2QML A;  3S6H A;  1Z4E A;  2R7H A;  4KOW A;  1NMT A;  4KOY A;  4JD6 A;  4XNH B;  5I0C A;  1YX0 A;  3VWD A;  1MK4 A;  4KLW A;  4AVB A;  1FY7 A;  4NSQ A;  2Z10 A;  2AJ6 A;  3FRM A;  3FNC A;  2ZW6 A;  4YGO A;  4XNH C;  3K9U A;  5DWN A;  1YVK A;  1BOB A;  3N7Z A;  2BEI A;  1V0C A;  4FD7 A;  4KOS A;  2Q4Y A;  1XE4 A;  5EC4 A;  1LRZ A;  4K30 A;  4IUS A;  5IB0 A;  3EFA A;  4HKF A;  4JWP A;  5KTA A;  1M4D A;  4II9 A;  3IWG A;  4KOX A;  2D4O A;  1KZF A;  4QC6 A;  2CNT A;  1S7N A;  2Q04 A;  3E0K A;  4HNY B;  3PZJ A;  2I00 A;  1BO4 A;  4XPD C;  1XF8 A;  3D2M A;  3GKR A;  2CNM A;  5F47 A;  3S6G A;  3SXO A;  5FVJ A;  3RYO A;  1S7L A;  3B8G A;  2FIW A;  4MJ8 A;  4AG7 A;  4R87 A;  2VZY A;  3D8P A;  2A4N A;  5EBV A;  4XPK A;  2ZPA A;  1IYL A;  3D2P A;  3DR6 A;  4L8A A;  4PV6 A;  4U9Z A;  1Q2Y A;  2Q0Y A;  1TIQ A;  3TO9 A;  5J8F A;  3UY5 A;  1WWZ A;  2J8M A;  2FL4 A;  4F0Y A;  1Y9K A;  4DNC A;  1M4G A;  4B5O A;  2FCK A;  1CM0 A;  3TOB A;  2B4D A;  4KOR A;  1IIC A;  1YGH A;  3BJ8 A;  4QBJ A;  3LD2 A;  3EC4 A;  1PUA A;  2B4B A;  1Y7R A;  5C88 A;  1J4J A;  2VEZ A;  4MBU A;  1N71 A;  1S3Z A;  5JQ4 A;  4X5K A;  3H4Q A;  3IGR A;  4E8O A;  4LX9 A;  3CXP A;  4RS2 A;  1YLE A;  2DXQ A;  2X7B A;  4IF5 A;  3R1K A;  2B5G A;  4MHD A;  4PK2 A;  4R9M A;  1Z4R A;  2OZH A;  4AVA A;  3NE7 A;  2B58 A;  4QVT A;  2PC1 A;  3CXS A;  2H5M A;  1KUY A;  5DWM A;  4ORF A;  3R9F A;  2BUE A;  1RXT A;  3JUW A;  3VWE A;  2FIA A;  1I21 A;  3D3S A;  2QEC A;  2OB0 A;  2REF A;  1Q2C A;  4KVX A;  4KUA A;  3TCV A;  2P0W A;  2QIR A;  5KTD A;  5GCN A;  2BL1 A;  4R3L A;  1NSL A;  3TO6 A;  4NEX A;  1SQH A;  4CAV A;  4UWI A;  4E2A A;  4CAW A;  3GYA A;  1M1D A;  3I9S A;  1GHE A;  1XIX A;  1YR0 A;  1S7K A;  3BLN A;  5JPH A;  3CXQ A;  3V8I A;  4PSX A;  3QAH A;  3PP9 A;  1IYK A;  5HH1 A;  1YK3 A;  3LOD A;  1YVO A;  2JLM A;  2FXF A;  4H6U A;  4KZT A;  2G3A A;  5C82 A;  1S60 A;  2EUI A;  1PU9 A;  3TOA A;  1VKC A;  4KVO E;  3TO7 A;  4KOU A;  4GS4 A;  4B5P A;  2Z11 A;  4MY3 A;  5H86 A;  2JDD A;  1WK4 A;  3TTH A;  2PRB A;  4H6Z A;  1IB1 E;  2KCW A;  2J8R A;  4MI4 A;  2JDC A;  4OAD A;  3EXN A;  2RC4 A;  2Q7B A;  1Z9U A;  3EO4 A;  5J8C A;  1QSN A;  2PQ8 A;  1P0H A;  2CY2 A;  2PR1 A;  1B87 A;  2Q4V A;  4ZBG A;  1MJB A;  4I49 A;  2WPW A;  4JLY A;  3MGD A;  4R3K A;  2R8V A;  3EY5 A;  3T90 A;  2NMT A;  1QSM A;  2VBQ A;  4OLL A;  3TFY A;  2OU2 A;  1M44 A;  5H84 A;  4YRH A;  4KUB A;  1U6M A;  1UFH A;  4BMH A;  3FYN A;  1QSO A;  3DNS A;  3S6F A;  2B4D B;  2G0B A;  4JXR A;  4U9Y A;  3FIX A;  1S7F A;  3FBU A;  2HV2 A;  4R57 A;  2OH1 A;  2VXK A;  3DR8 A; 
#chains in the Genus database with same CATH topology
 1MJA A;  1R57 A;  3K2K A;  1P4N A;  4PSW A;  4B11 A;  2GAN A;  1QQ9 A;  4CRZ B;  2B5G B;  4F6A A;  1IOI A;  4OME A;  2P6E A;  2F5I A;  2ZXV A;  3GUX A;  3KL9 A;  4A2Z A;  2B3U A;  4A39 A;  4FD4 A;  4UBR A;  2Q7S A;  3QB8 A;  4CS0 B;  4FBE A;  3R9G A;  4JXQ A;  3B3S A;  5D29 A;  4CYQ A;  4R7M A;  5G22 A;  2QYV A;  2VI7 A;  3V7Z A;  2Z3L A;  4Z65 A;  2ABZ A;  2YGW A;  3PB9 X;  3R9E A;  4MMO A;  3WR7 A;  4NGS A;  4U5Y A;  2Q44 A;  2AFW A;  3IC1 A;  1K4J A;  1TXR A;  4M3S A;  4KSA A;  3ISZ A;  5E96 A;  5IX3 A;  2R1I A;  2BSW A;  4HNX B;  3PGP A;  5LYD A;  1Z2L A;  1QSR A;  2CIJ A;  2WPX A;  4LUA A;  3R96 A;  3TT2 A;  2F7V A;  3FB3 A;  3B35 A;  2ODF A;  2WSA A;  3GLJ A;  4ZGY B;  2ZW7 A;  1AYE A;  4YWY A;  1YW6 A;  4PPZ A;  4UIB A;  3JRU A;  2ZW5 A;  4CGL A;  4A38 A;  3P2H A;  3BHX A;  4KLV A;  4HNW B;  1XMT A;  4M85 A;  4W9Y A;  4CAX A;  3B3W A;  4MFZ A;  4Q7A A;  2Z3N A;  4ZI6 A;  2J8N A;  3I3G A;  5JH9 A;  4NGM A;  1ZLH A;  4OAE A;  4UCM A;  4UA3 A;  2GE3 A;  4FD6 A;  6CPA A;  2PCU A;  2FSR A;  2FT0 A;  7CPA A;  1QMU A;  3KAS A;  2OZU A;  4X3R A;  4RUH A;  3IJ3 A;  3VH9 A;  2G3T A;  2PVW A;  4R76 A;  1AMP A;  3DDD A;  1DTD A;  3KZW A;  4MCP A;  1IY7 A;  4MFJ A;  4P44 A;  4XPL A;  1RO5 A;  2FS5 A;  2Z0Z A;  3CPA A;  2OZG A;  3H8F A;  2VZZ A;  2B3V A;  2Z3P A;  4NF1 A;  2CNS A;  4FD5 A;  1H8L A;  4Y49 C;  3P2F A;  2HUZ A;  1DE4 C;  5F48 A;  4UWJ A;  3PB4 X;  1FT7 A;  1CJW A;  1YRE A;  3G8W A;  4LQ6 A;  4OP4 A;  4UEF A;  4B14 A;  2I79 A;  3KR4 A;  4RN7 A;  4A37 A;  4H2K A;  3TE4 A;  2HC9 A;  2QJ8 A;  2PSW A;  3PBE A;  3SXN A;  1KUX A;  1I1D A;  1MJ9 A;  1NE9 A;  4Q36 A;  3D68 A;  3FXT A;  4OC5 A;  1ZG9 A;  2G9D A;  2EK8 A;  3B7I A;  3JVN A;  4BBH A;  3FMC A;  1F2P A;  1OZP A;  4RI1 A;  1XOV A;  3SI1 A;  3ZJ0 A;  2R98 A;  4GM5 A;  4KOT A;  4KOV A;  2ZEM A;  2F8H A;  3GIU A;  2DPT A;  4L89 A;  2NSM A;  3S9L A;  4P4F A;  5ISV A;  2GIV A;  1HEE A;  2VL1 A;  4E0A A;  3DSB A;  4MY0 A;  2REE A;  2EWB A;  2P6F A;  4J3G A;  3NA6 A;  3CPX A;  4OKO A;  1S5K A;  3ISX A;  2IL4 A;  3B2Y A;  1B6B A;  4OC1 A;  4P4I A;  5F46 A;  1ON0 A;  2ZW4 A;  3QAY A;  4MFP A;  3FJU A;  1CPX A;  5KTC A;  2AFM A;  1I12 A;  1EE3 P;  3C26 A;  2EVN A;  2ZEG A;  4PK3 A;  4C2Y A;  2Y0M A;  1BPM A;  4EVY A;  3IFE A;  3BJ7 A;  4P6Y A;  4FWU A;  4A94 A;  4ONU A;  4FAI A;  4NCZ A;  1XEB A;  3OWC A;  3S6K A;  4YFJ A;  5LYF A;  5LYL A;  4AB7 A;  2QVP A;  4UF4 A;  4JZ0 A;  1QST A;  4ZY1 A;  4OID A;  2JEW A;  2C1C A;  2VQY A;  3F8K A;  4QB9 A;  4CGP A;  3BXM A;  3QNV A;  2C27 A;  3MN8 A;  2O28 A;  4Y49 B;  1M4I A;  2ATR A;  5CNP A;  2JEV A;  5LRG A;  3FVL A;  1VHS A;  2BCO A;  4KSI A;  5HMN A;  3H8E A;  1ZLI A;  2PR8 A;  3R95 A;  1KUV A;  1YSJ A;  3W6X A;  2GU2 A;  2FE7 A;  4NXY A;  4PXB A;  4AG9 A;  2K5T A;  2J9A A;  2OOT A;  3KKW A;  4KVM E;  4CGN A;  1VGY A;  3F5B A;  5D8N A;  2GFQ A;  4B5P B;  3GY9 A;  4UCP A;  2PJ6 A;  5IV0 A;  4CRY B;  3D7H A;  2CTB A;  2HQY A;  1Y9W A;  3W91 A;  1Q2D A;  5CBM A;  2RFH A;  3W6S A;  4H89 A;  3LAC A;  4QUS A;  4NJR A;  5LRJ A;  4C7I A;  2BO9 A;  1Q7L A;  2ARH A;  1FNO A;  2PDO A;  3T9Y A;  3SI0 A;  4C2X A;  1ELL P;  3IO1 A;  3F0A A;  5K8O A;  1L0C A;  3SJX A;  2P6G A;  2PJ3 A;  2AE6 A;  4JJX A;  2D4P A;  3NH8 A;  2ZEL A;  8CPA A;  3FH4 A;  1XMB A;  3RAM A;  4B12 A;  5F49 A;  3ZZI A;  2PRQ A;  3SHP A;  4AVC A;  1RTQ A;  1IID A;  3G3S A;  4XPD B;  2QML A;  3S6H A;  1Z4E A;  2ANP A;  4CYP A;  2IMO A;  2R7H A;  1NSA A;  4MFL A;  5K8M A;  4KOW A;  1NMT A;  4MRI A;  4KOY A;  4JD6 A;  4XNH B;  5I0C A;  1LAM A;  5G1Z A;  1YX0 A;  3WC6 A;  3VWD A;  1MK4 A;  4KLW A;  3T8W A;  4AVB A;  1FY7 A;  3NFZ A;  2AFS A;  3NH5 A;  4MHZ A;  2DPS A;  4O23 A;  3SI2 A;  2PJ0 A;  2PIZ A;  5AGE A;  4NSQ A;  5JGF A;  2Z3M A;  4G1P A;  2Z10 A;  2AJ6 A;  3FRM A;  3FNC A;  4EME A;  2ZW6 A;  4YGO A;  3CZX A;  4XNH C;  1XJO A;  2PJC A;  3KQZ A;  3K9U A;  4NGT A;  5DWN A;  4ZX8 A;  4B13 A;  4GXH A;  3PFE A;  1YVK A;  1BOB A;  3N7Z A;  2BEI A;  1V0C A;  4FD7 A;  4KOS A;  2Q4Y A;  5J1Q A;  5LYI A;  1YLO A;  1XE4 A;  2Q43 A;  1LRZ A;  1BAV A;  4NGP A;  5EC4 A;  4K3N A;  4F0X A;  1JQG A;  4K30 A;  2PJ8 A;  4IUS A;  2ZED A;  5IB0 A;  3EFA A;  2PVV A;  4HKF A;  4JWP A;  5KTA A;  1M4D A;  4II9 A;  3IWG A;  3KI9 A;  1Z8X A;  2PJ4 A;  4KOX A;  2D4O A;  4MHP A;  5A27 A;  1KZF A;  2AFX A;  4QC6 A;  2CNT A;  1S7N A;  5I4M A;  3VAR A;  2Q04 A;  4A95 A;  3E0K A;  4HNY B;  1LAN A;  4PXE A;  4A33 A;  1VHO A;  3A9L A;  5K8N A;  1PCA A;  3PZJ A;  4NFR A;  2GRE A;  2ZEO A;  4M6G A;  4HPS A;  3D7D A;  4WJB A;  1IGB A;  2I00 A;  3H5Z A;  1X10 A;  2JBK A;  1BO4 A;  3PEI A;  4XPD C;  5ELY A;  2V8H A;  2WZN A;  2Z3K A;  1TKF A;  1XF8 A;  3D2M A;  3GKR A;  3BI0 A;  4Q38 A;  4CYN A;  2CNM A;  5F47 A;  4TNU A;  3S6G A;  2AFZ A;  3SXO A;  1Y0R A;  4ONW A;  4B6Z A;  4ZYQ A;  5FVJ A;  3KGQ A;  3RYO A;  3RO0 A;  4UFV A;  1Z8L A;  1S7L A;  3KHX A;  3B8G A;  4MHY A;  2FIW A;  3MRU A;  4MJ8 A;  4P45 A;  4UFW A;  1R43 A;  4R87 A;  5DS0 A;  4KSF A;  4AG7 A;  2VZY A;  2GLF A;  1IOF A;  3D8P A;  2A4N A;  5EBV A;  4XPK A;  2NYQ A;  5AG6 A;  4EWT A;  2ZPA A;  1IYL A;  3D2P A;  2PJ7 A;  2POK A;  1GYT A;  3HUV A;  3FF3 A;  3RNZ A;  5JM6 A;  3DR6 A;  4M6I A;  4MFQ A;  2BOA A;  2DF5 A;  4L8A A;  4PV6 A;  4U9Z A;  1Q2Y A;  2Q0Y A;  2Z3O A;  3DLJ A;  1BPN A;  3RBU A;  1TIQ A;  3TO9 A;  2CF4 A;  3PB8 X;  5J8F A;  3UY5 A;  4CAE A;  1WWZ A;  2J8M A;  2FL4 A;  2YNC C;  4F0Y A;  1TF8 A;  4MFK A;  1Y9K A;  4DNC A;  4R6T A;  5LRK A;  3D66 A;  2I3C A;  4NGQ A;  4PXC A;  4P10 A;  1M4G A;  1IU8 A;  4PQA A;  4B5O A;  3B3V A;  3HLP A;  1ZG7 A;  2FCK A;  1CM0 A;  3TOB A;  1TKH A;  2B4D A;  4KOR A;  2DEA A;  1IIC A;  1YGH A;  2PE3 A;  3H8G A;  2ZOG A;  3BJ8 A;  3KQX A;  4QBJ A;  4YU9 A;  3LD2 A;  3EC4 A;  1PUA A;  3GB0 A;  2B4B A;  3WC7 A;  1Y7R A;  5C88 A;  4MCQ A;  1J4J A;  2VEZ A;  2V77 A;  4MBU A;  1N71 A;  3IIB A;  1S3Z A;  5JQ4 A;  4ZX9 A;  3S9N A;  1ARL A;  4X5K A;  4IHM A;  3H4Q A;  3IGR A;  4UFX A;  2ZOF A;  4E8O A;  4LX9 A;  3CXP A;  4RS2 A;  3FEE A;  1XBU A;  4LQG A;  1CX8 A;  4TWE A;  1CP6 A;  1YLE A;  3I1U A;  4C2Z A;  2DXQ A;  4CGO A;  2X7B A;  2ZEP A;  2PIY A;  4IF5 A;  4YRH A;  4CGM A;  2Q4Z A;  2XEF A;  3R1K A;  4IK2 A;  2B5G A;  1F2O A;  1HDU A;  4UEE A;  5HVH A;  4A30 A;  4M6H A;  5HXD A;  4MHD A;  5A28 A;  4PK2 A;  4R9M A;  4X8I A;  3D7G A;  1Z4R A;  4P4E A;  2OZH A;  1CPS A;  3TC8 A;  3LWU A;  1ELM P;  1Z5R A;  2O53 A;  4AVA A;  1LOK A;  3NE7 A;  2EO8 A;  2B58 A;  4EFD A;  4QVT A;  5HVG A;  2PC1 A;  3PB6 X;  1Y7E A;  3CXS A;  2H5M A;  1ZG8 A;  2PJ1 A;  3WAB A;  1TF9 A;  4C68 A;  4CPA A;  3WT4 A;  3NH4 A;  4UEZ A;  3V38 A;  1A2Z A;  1KUY A;  2HB6 A;  3B3C A;  3BI1 A;  3IEH A;  3LMS A;  4P4J A;  2ZEN A;  5DWM A;  4JYW A;  3NE8 A;  4ORF A;  2WUU A;  3JTK A;  3S9M A;  4OIW A;  4DYO A;  4F8Z A;  1Z8W A;  1LAP A;  3R9F A;  2PJ5 A;  2BUE A;  5H84 A;  3RZA A;  1RXT A;  3JUW A;  3VWE A;  4WWV A;  2CXA A;  4C7H A;  2FIA A;  1HDQ A;  1I21 A;  2QEC A;  3D3S A;  1TKJ A;  2ZEH A;  2OB0 A;  2REF A;  4NGR A;  1BLL E;  2C6C A;  1Q2C A;  4KVX A;  4KUA A;  3SJF A;  2JBJ A;  2V8D A;  3TCV A;  4F9V A;  5G21 A;  2OR4 A;  2P0W A;  2QIR A;  5KTD A;  5GCN A;  2BL1 A;  3SJE A;  5CPA A;  3PRT A;  4R3L A;  3PFO A;  1NSL A;  4CYO A;  3TO6 A;  4NEX A;  5HVF A;  4MCR A;  1SQH A;  4CAV A;  5BWA B;  4AXV A;  4DUK A;  4UWI A;  4E2A A;  4FUU A;  3VAT A;  3WC5 A;  1OBR A;  4CAW A;  1AUG A;  3GYA A;  2XEJ A;  1M1D A;  5AG5 A;  3I9S A;  1GHE A;  3SJG A;  1XIX A;  2WYR A;  1YR0 A;  2V8V A;  2AFU A;  2YND A;  4MCS A;  1S7K A;  3BLN A;  5JPH A;  3CXQ A;  4UCN A;  3V8I A;  4PSX A;  1CBX A;  3QAH A;  3PP9 A;  1IYK A;  5HH1 A;  2XEI A;  1YK3 A;  2PJB A;  2C6G A;  3FED A;  3LOD A;  1YVO A;  2JLM A;  2FXF A;  1ZO0 A;  3FEC A;  3D4U A;  4H6U A;  1XRY A;  4KZT A;  2G3A A;  1VIX A;  4ZY0 A;  4MXU A;  2ZEF A;  1S60 A;  2XEG A;  5C82 A;  2EUI A;  1PU9 A;  3TOA A;  1VKC A;  2PJ2 A;  4KVO E;  3TO7 A;  4KOU A;  5F09 A;  4GS4 A;  4B5P A;  3PB7 X;  4DJL A;  2Z11 A;  4CAF A;  4MY3 A;  1X12 A;  5H86 A;  2JDD A;  1WK4 A;  1ARM A;  4KS9 A;  2ZEE A;  3TTH A;  2PRB A;  4A32 A;  4OC3 A;  4H6Z A;  1UWY A;  1IB1 E;  2KCW A;  2O4H A;  2J8R A;  4MI4 A;  3DGV A;  2JDC A;  4OAD A;  2V8G A;  1XFO A;  3EXN A;  2RC4 A;  2Q7B A;  4OC4 A;  1Z9U A;  4F9U A;  1Z8T A;  4UIA A;  4MHN A;  3EO4 A;  5J8C A;  1QSN A;  2PQ8 A;  1P0H A;  2YNE A;  3TX8 A;  2CY2 A;  2PR1 A;  1B87 A;  2PJ9 A;  2Q4V A;  1MJB A;  2GLJ A;  4ZBG A;  4I49 A;  3K9T A;  2WPW A;  5G20 A;  3B3T A;  4ZY2 A;  4JLY A;  4A31 A;  3KR5 A;  5K8P A;  3MGD A;  2Q51 A;  4R3K A;  4NGN A;  2R8V A;  3EY5 A;  1F57 A;  2EK9 A;  2IJZ A;  3T90 A;  2NMT A;  4NJQ A;  3IWE A;  1QSM A;  2VBQ A;  4OLL A;  1JWQ A;  2FVG A;  3TFY A;  4BD9 A;  5IB9 A;  3CDX A;  2PJA A;  2OU2 A;  3IU2 A;  1KWM A;  1M44 A;  1R3N A;  1Y0Y A;  3L2N A;  4IAV A;  4OC0 A;  4KUB A;  4P4D A;  1M4L A;  1U6M A;  1UFH A;  3KHZ A;  3PBB A;  4R8F A;  4BIN A;  2EBJ A;  4BMH A;  3CT9 A;  3FYN A;  1QSO A;  3D67 A;  1VHE A;  2C6P A;  1PYT B;  3DNS A;  5EMI A;  4X2T A;  3S6F A;  1LCP A;  2B4D B;  2G0B A;  2RB7 A;  1CG2 A;  3FX6 A;  5AG7 A;  1YQE A;  1YME A;  3IWW A;  4JXR A;  5THW A;  4U9Y A;  4P4B A;  2YNC A;  1CP7 A;  3N5F A;  3FIX A;  4PXD A;  1S7F A;  3FBU A;  2AFO A;  4B10 A;  3IU1 A;  1YW4 A;  5AG4 A;  2HV2 A;  1LFW A;  4R57 A;  2CTC A;  4OC2 A;  2IQ6 A;  2OH1 A;  2VXK A;  3D7F A;  3DR8 A; 
#chains in the Genus database with same CATH homology
 1MJA A;  1R57 A;  4B11 A;  1P4N A;  4PSW A;  4CRZ B;  2GAN A;  2B5G B;  4F6A A;  2P6E A;  2F5I A;  2ZXV A;  4A2Z A;  2B3U A;  4FD4 A;  4UBR A;  3QB8 A;  4CS0 B;  3R9G A;  4JXQ A;  4CYQ A;  5G22 A;  2VI7 A;  2Z3L A;  2YGW A;  3R9E A;  3WR7 A;  4U5Y A;  2Q44 A;  1K4J A;  4M3S A;  4KSA A;  5E96 A;  5IX3 A;  2R1I A;  2BSW A;  4HNX B;  3PGP A;  1QSR A;  2WPX A;  4LUA A;  3R96 A;  3TT2 A;  3FB3 A;  4ZGY B;  2WSA A;  2ZW7 A;  2ZW5 A;  4CGL A;  3P2H A;  4KLV A;  4HNW B;  1XMT A;  4M85 A;  4CAX A;  4MFZ A;  2Z3N A;  2J8N A;  3I3G A;  4OAE A;  4UCM A;  4UA3 A;  2GE3 A;  4FD6 A;  2FSR A;  2FT0 A;  2OZU A;  2G3T A;  3DDD A;  4MFJ A;  4XPL A;  1RO5 A;  2FS5 A;  2Z0Z A;  2OZG A;  2VZZ A;  2B3V A;  2Z3P A;  4NF1 A;  2CNS A;  4FD5 A;  4Y49 C;  3P2F A;  2HUZ A;  5F48 A;  4UWJ A;  1CJW A;  1YRE A;  3G8W A;  4B14 A;  2I79 A;  3TE4 A;  2PSW A;  3SXN A;  1KUX A;  1I1D A;  1MJ9 A;  1NE9 A;  4Q36 A;  3FXT A;  4BBH A;  3JVN A;  1OZP A;  4RI1 A;  3ZJ0 A;  2R98 A;  4KOT A;  4KOV A;  2DPT A;  4L89 A;  5ISV A;  2GIV A;  4E0A A;  3DSB A;  4MY0 A;  2REE A;  2P6F A;  4J3G A;  1S5K A;  2IL4 A;  1B6B A;  5F46 A;  1ON0 A;  2ZW4 A;  4MFP A;  5KTC A;  1I12 A;  3C26 A;  2EVN A;  4C2Y A;  4PK3 A;  2Y0M A;  4EVY A;  3BJ7 A;  4ONU A;  4NCZ A;  1XEB A;  3OWC A;  3S6K A;  4YFJ A;  4AB7 A;  1QST A;  3F8K A;  2VQY A;  4QB9 A;  4CGP A;  2C27 A;  2O28 A;  4Y49 B;  1M4I A;  2ATR A;  5CNP A;  2JEV A;  1VHS A;  5HMN A;  2PR8 A;  3R95 A;  1KUV A;  3W6X A;  2FE7 A;  4NXY A;  4AG9 A;  2K5T A;  3KKW A;  4KVM E;  4CGN A;  3F5B A;  4B5P B;  3GY9 A;  4UCP A;  5IV0 A;  4CRY B;  2HQY A;  1Y9W A;  3W91 A;  1Q2D A;  3W6S A;  4H89 A;  4QUS A;  4C7I A;  2ARH A;  2PDO A;  3T9Y A;  4C2X A;  3F0A A;  1L0C A;  2P6G A;  2AE6 A;  4JJX A;  2D4P A;  4B12 A;  5F49 A;  3ZZI A;  3SHP A;  4AVC A;  1IID A;  3G3S A;  4XPD B;  2QML A;  3S6H A;  1Z4E A;  4CYP A;  2R7H A;  4MFL A;  4KOW A;  1NMT A;  4KOY A;  4JD6 A;  4XNH B;  5I0C A;  5G1Z A;  1YX0 A;  3VWD A;  1MK4 A;  4KLW A;  4AVB A;  1FY7 A;  2DPS A;  5AGE A;  4NSQ A;  2Z3M A;  2Z10 A;  2AJ6 A;  3FRM A;  3FNC A;  2ZW6 A;  4YGO A;  4XNH C;  3K9U A;  5DWN A;  4B13 A;  1YVK A;  1BOB A;  3N7Z A;  2BEI A;  1V0C A;  4FD7 A;  4KOS A;  2Q4Y A;  1XE4 A;  5EC4 A;  1LRZ A;  4F0X A;  4K30 A;  4IUS A;  5IB0 A;  3EFA A;  4HKF A;  4JWP A;  5KTA A;  1M4D A;  4II9 A;  3IWG A;  4KOX A;  2D4O A;  5A27 A;  1KZF A;  4QC6 A;  2CNT A;  1S7N A;  2Q04 A;  4A95 A;  3E0K A;  4HNY B;  4A33 A;  3A9L A;  3PZJ A;  2I00 A;  3H5Z A;  1BO4 A;  4XPD C;  2Z3K A;  1XF8 A;  3D2M A;  3GKR A;  4Q38 A;  4CYN A;  2CNM A;  5F47 A;  3S6G A;  3SXO A;  5FVJ A;  3RYO A;  4UFV A;  1S7L A;  3B8G A;  2FIW A;  4MJ8 A;  4UFW A;  4AG7 A;  4R87 A;  4KSF A;  2VZY A;  3D8P A;  2A4N A;  5EBV A;  4XPK A;  5AG6 A;  2ZPA A;  1IYL A;  3D2P A;  3DR6 A;  4MFQ A;  4L8A A;  4PV6 A;  4U9Z A;  1Q2Y A;  2Q0Y A;  2Z3O A;  1TIQ A;  3TO9 A;  5J8F A;  3UY5 A;  4CAE A;  1WWZ A;  2J8M A;  2FL4 A;  2YNC C;  4F0Y A;  4MFK A;  1Y9K A;  4DNC A;  1M4G A;  4B5O A;  2FCK A;  1CM0 A;  3TOB A;  2B4D A;  4KOR A;  1IIC A;  1YGH A;  3BJ8 A;  4QBJ A;  3LD2 A;  3EC4 A;  1PUA A;  2B4B A;  1Y7R A;  5C88 A;  1J4J A;  2VEZ A;  4MBU A;  1N71 A;  1S3Z A;  5JQ4 A;  4X5K A;  3H4Q A;  3IGR A;  4UFX A;  4E8O A;  4LX9 A;  3CXP A;  4RS2 A;  4C2Z A;  1YLE A;  2DXQ A;  4CGO A;  2X7B A;  4IF5 A;  4CGM A;  3R1K A;  2B5G A;  4A30 A;  4MHD A;  5A28 A;  4PK2 A;  4R9M A;  1Z4R A;  2OZH A;  4AVA A;  3NE7 A;  2B58 A;  4QVT A;  2PC1 A;  3CXS A;  2H5M A;  4C68 A;  1KUY A;  5DWM A;  4ORF A;  2WUU A;  3JTK A;  3R9F A;  2BUE A;  1RXT A;  3JUW A;  3VWE A;  2CXA A;  4C7H A;  2FIA A;  1I21 A;  3D3S A;  2QEC A;  2OB0 A;  2REF A;  1Q2C A;  4KVX A;  4KUA A;  3TCV A;  5G21 A;  2P0W A;  2QIR A;  5KTD A;  5GCN A;  2BL1 A;  4R3L A;  4CYO A;  1NSL A;  3TO6 A;  4NEX A;  1SQH A;  4CAV A;  5BWA B;  4UWI A;  4E2A A;  4CAW A;  3GYA A;  1M1D A;  5AG5 A;  3I9S A;  1GHE A;  1XIX A;  1YR0 A;  2YND A;  1S7K A;  3BLN A;  5JPH A;  3CXQ A;  4UCN A;  3V8I A;  4PSX A;  3QAH A;  3PP9 A;  1IYK A;  5HH1 A;  1YK3 A;  3LOD A;  1YVO A;  2JLM A;  2FXF A;  1ZO0 A;  4H6U A;  4KZT A;  2G3A A;  5C82 A;  1S60 A;  2EUI A;  1PU9 A;  3TOA A;  1VKC A;  4KVO E;  3TO7 A;  4KOU A;  4GS4 A;  4B5P A;  2Z11 A;  4CAF A;  4MY3 A;  5H86 A;  2JDD A;  1WK4 A;  4KS9 A;  3TTH A;  2PRB A;  4A32 A;  4H6Z A;  1IB1 E;  2KCW A;  2J8R A;  4MI4 A;  2JDC A;  4OAD A;  3EXN A;  2RC4 A;  2Q7B A;  1Z9U A;  3EO4 A;  5J8C A;  1QSN A;  2PQ8 A;  1P0H A;  2YNE A;  2CY2 A;  2PR1 A;  1B87 A;  2Q4V A;  4ZBG A;  1MJB A;  4I49 A;  2WPW A;  5G20 A;  4JLY A;  4A31 A;  3MGD A;  4R3K A;  2R8V A;  3EY5 A;  3T90 A;  2NMT A;  3IWE A;  1QSM A;  2VBQ A;  4OLL A;  3TFY A;  2OU2 A;  3IU2 A;  1M44 A;  5H84 A;  4YRH A;  4KUB A;  1U6M A;  1UFH A;  4BMH A;  3FYN A;  1QSO A;  3DNS A;  3S6F A;  2B4D B;  2G0B A;  5AG7 A;  4JXR A;  4U9Y A;  2YNC A;  4B10 A;  3FIX A;  1S7F A;  3FBU A;  3IU1 A;  5AG4 A;  2HV2 A;  4R57 A;  2OH1 A;  2VXK A;  3DR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...