1B87A

Crystal structure of an aminoglycoside 6'-n-acetyltransferase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
181
structure length
181
Chain Sequence
MIISEFDRNNPVLKDQLSDLLRLTWPEEYGDSSAEEVEEMMNPERIAVAAVDQDELVGFIGAIPQYGITGWELHPLVVESSRRKNQIGTRLVNYLEKEVASRGGITIYLGTDDLDHGTTLSQTDLYEHTFDKVASIQNLREHPYEFYEKLGYKIVGVLPNANGWDKPDIWMAKTIIPRPDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (AMINOGLYCOSIDE N6'-ACETYLTRANSFERASE TYPE 1)
publication title Crystal structure of an aminoglycoside 6'-N-acetyltransferase: defining the GCN5-related N-acetyltransferase superfamily fold.
pubmed doi rcsb
total genus 50
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 1999-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1b87A00
2CNMA 1MJ9A 1KUVA 1IYKA 2J8MA 2VXKA 5GCNA 1P0HA 4KVOE 4L8AA 4DNCA 4JD6A 4KORA 5IX3A 4KZTA 4H6ZA 3SXNA 2J8RA 5I0CA 5H84A 2D4PA 2DXQA 1Y9WA 4AG7A 2R8VA 5F48A 4JWPA 2OH1A 4B5PB 2B5GB 3LD2A 2BSWA 2R1IA 1Q2CA 5IV0A 2BUEA 3JVNA 3BJ7A 1KUYA 4R87A 2IL4A 4JLYA 3EXNA 1TIQA 4OADA 1Z9UA 1YX0A 3UY5A 2PSWA 5DWMA 4Y49C 2AE6A 3TO6A 4HNYB 1XF8A 3TFYA 1XE4A 3C26A 3FRMA 4OAEA 2NMTA 1VHSA 3GY9A 3KKWA 5HH1A 1YLEA 2PR8A 2I00A 4QBJA 2FCKA 2OZHA 4KVME 4LX9A 3P2FA 4LUAA 4ONUA 2ZW7A 4CAXA 4RI1A 1VKCA 3QB8A 2B3VA 1NSLA 3FBUA 2REEA 4UWIA 5KTDA 4CRYB 2Q4VA 2PDOA 3TCVA 2VZYA 4Y49B 4L89A 4EVYA 5C82A 4KOXA 5J8CA 4AB7A 2K5TA 3W6XA 2CY2A 2F5IA 3F0AA 1P4NA 1I12A 2QIRA 3JUWA 4QUSA 3GKRA 4KLWA 2FT0A 2FE7A 3T90A 1Q2DA 2ATRA 4MBUA 2OU2A 1PU9A 2CNSA 1IB1E 1S60A 1MK4A 1SQHA 1XIXA 2FSRA 4R57A 3R1KA 4R3LA 1IIDA 2X7BA 1R57A 2GIVA 5IB0A 3K9UA 3S6KA 2VZZA 3D2PA 4IUSA 4F6AA 2C27A 2JDCA 3DR8A 4XPLA 3T9YA 1KUXA 1BOBA 4R3KA 3PP9A 4KLVA 1QSMA 2H5MA 2EUIA 2ARHA 1Z4EA 3CXPA 1M1DA 1NE9A 4OLLA 2A4NA 2JLMA 3CXSA 1N71A 5C88A 3D2MA 4IF5A 5H86A 3RYOA 1OZPA 1M4IA 5F46A 2BEIA 2WPXA 1NMTA 3TE4A 2B4BA 4K30A 4CAWA 4PK3A 2VEZA 4QB9A 3V8IA 1MJAA 1J4JA 3OWCA 4AVCA 1L0CA 2GE3A 2REFA 1YREA 2Q4YA 4MY3A 4MY0A 2R7HA 4KOVA 4ORFA 4HNXB 4J3GA 4XNHC 4GS4A 2ZW4A 2HV2A 1YK3A 3FNCA 3ZZIA 2D4OA 2PR1A 4UBRA 5CNPA 1Y9KA 4M3SA 4KOWA 5JPHA 4NF1A 1YVOA 3N7ZA 3FYNA 2Q7BA 1M44A 4QC6A 2BL1A 3I3GA 3EFAA 1XMTA 1S5KA 4PK2A 2FIAA 1YVKA 3EO4A 1IYLA 4NEXA 1U6MA 2G0BA 2B58A 5HMNA 3W91A 3R9EA 4II9A 3R96A 2B4DA 4AVAA 2I79A 4FD7A 3NE7A 3LODA 3S6GA 1FY7A 2J8NA 3R95A 4HNWB 4AVBA 4XNHB 2KCWA 4FD5A 1M4GA 3F8KA 4PSXA 3FIXA 3DDDA 3IGRA 4I49A 1QSOA 4CS0B 3FB3A 1YGHA 1Z4RA 2PQ8A 5EBVA 5EC4A 4KOSA 1Q2YA 3FXTA 4YRHA 3G3SA 2RC4A 4BMHA 2EVNA 2FS5A 1M4DA 2FXFA 3MGDA 4XPDB 5KTCA 3D3SA 2WPWA 3VWDA 1UFHA 4E8OA 1K4JA 1S3ZA 2ZXVA 1CJWA 1ON0A 1Y7RA 1S7LA 5F47A 5J8FA 2HUZA 2Q04A 1B6BA 4FD6A 1RXTA 3TOAA 4UWJA 3PGPA 4RS2A 1CM0A 3VWEA 5F49A 2P0WA 1PUAA 4CRZB 4AG9A 4E0AA 2B3UA 2Z11A 4KUAA 3P2HA 3GYAA 1WWZA 3PZJA 1IICA 4QVTA 4KOTA 3W6SA 4X5KA 5DWNA 3TO9A 4FD4A 1V0CA 4KUBA 4F0YA 1XEBA 1S7FA 2B4DB 2JDDA 3S6FA 4NSQA 2VBQA 4PV6A 3D8PA 2P6FA 4U5YA 4PSWA 2R98A 2VQYA 3TT2A 4R9MA 4NXYA 4MI4A 1B87A 2FIWA 3I9SA 4M85A 4U9YA 2VI7A 1GHEA 2O28A 2QMLA 1I21A 5KTAA 2Q0YA 3TOBA 1QSRA 2Z10A 4YFJA 4B5OA 1QSTA 1S7KA 3R9GA 2PC1A 4MJ8A 3WR7A 1YR0A 3F5BA 2OB0A 4XPDC 4YGOA 1RO5A 4B5PA 3E0KA 2B5GA 2GANA 4MHDA 3ZJ0A 1MJBA 4JXRA 4U9ZA 3IWGA 3DR6A 3BJ8A 3CXQA 3BLNA 3S6HA 2Q44A 4HKFA 1QSNA 3SXOA 2AJ6A 1S7NA 1LRZA 4KOUA 3G8WA 4H6UA 3QAHA 4NCZA 1I1DA 4JXQA 2CNTA 3DNSA 5FVJA 2P6GA 5E96A 5JQ4A 4KOYA 4KVXA 2FL4A 2G3AA 1BO4A 1WK4A 2PRBA 3H4QA 5ISVA 2G3TA 2JEVA 2ZW6A 2P6EA 2QECA 3B8GA 4UA3A 3DSBA 4ZBGA 1KZFA 2OZGA 4JJXA 3EC4A 2Y0MA 3R9FA 2ZPAA 2ZW5A 2HQYA 3SHPA 4E2AA 4H89A 3TO7A 4CAVA 3TTHA 2OZUA 3EY5A 4XPKA 2Z0ZA
chains in the Genus database with same CATH superfamily
2CNMA 1MJ9A 3CPXA 4OC2A 5BWAB 1KUVA 1IYKA 2J8MA 3KR5A 2VXKA 5GCNA 1P0HA 4KVOE 2QVPA 5F09A 4L8AA 4A37A 4DNCA 2HC9A 4JD6A 3WC5A 5IB9A 4KORA 3FH4A 3TC8A 5IX3A 3PBBA 4ZY2A 4A32A 4KSIA 4KZTA 4UEZA 3D4UA 4H6ZA 3SXNA 3D7FA 4A33A 2J8RA 5I0CA 3KGQA 5H84A 4P4JA 2D4PA 4DUKA 4P6YA 2YGWA 2DXQA 1Y9WA 4AG7A 2R8VA 5F48A 4JWPA 2JEWA 4R8FA 4ZYQA 2OH1A 4B5PB 2B5GB 1ZG8A 3KQXA 1IGBA 3MN8A 3LD2A 2ABZA 3B3SA 2BSWA 1DE4C 2ZEMA 2R1IA 1Q2CA 2ZEFA 4IAVA 4LQGA 2BUEA 5IV0A 3JVNA 3BJ7A 1KUYA 4R87A 6CPAA 3S9LA 4KSAA 2PJ1A 4A2ZA 5JH9A 2IL4A 1A2ZA 4JLYA 5HVGA 5JGFA 4IHMA 2HB6A 3EXNA 2Q7SA 4ZX8A 1TIQA 4OADA 1Z9UA 1YX0A 4P4FA 2PVVA 4MCSA 2BOAA 3SJXA 1LOKA 2EK8A 3UY5A 4B13A 2PJAA 2XEIA 2C6CA 4MFJA 2PSWA 4M6HA 5DWMA 2Z3OA 2PJ3A 4FUUA 4Y49C 3NFZA 4CGNA 2AE6A 3TO6A 1CG2A 4NGSA 4B11A 1XMBA 4HNYB 2PJ0A 1XF8A 2C1CA 1DTDA 4A95A 3TFYA 1XE4A 3C26A 3FRMA 4OAEA 4P45A 1Y0RA 2NMTA 3LACA 1VHSA 1Y7EA 3GY9A 1TXRA 4OC0A 3PBEA 4MMOA 2DPTA 3KKWA 1CPSA 5HH1A 1YLEA 4R76A 1HDQA 5HXDA 2PR8A 2I00A 4C2XA 2YNDA 4WJBA 4QBJA 2FCKA 2OZHA 3VH9A 4KVME 3RBUA 2XEFA 4LX9A 7CPAA 2Q51A 3KASA 3P2FA 5I4MA 3SJEA 4PQAA 4LUAA 2AFOA 2AFMA 4ONUA 2ZW7A 4CAXA 3H5ZA 4RI1A 1VKCA 4CAFA 4ONWA 3QB8A 2XEJA 4UIAA 2B3VA 1NSLA 4Q7AA 2IMOA 3FBUA 3PB7X 2PJ8A 2REEA 4F9UA 1X10A 4UWIA 3NE8A 4CYPA 1TKFA 5KTDA 4CRYB 2Q4VA 2F8HA 2PDOA 3TCVA 4C2ZA 5AG4A 1CP6A 3K9TA 4ZI6A 2YNCC 2VZYA 3IC1A 4Y49B 2AFXA 4P4DA 4DYOA 4NGNA 4L89A 1ARLA 4NGQA 4EVYA 5C82A 3RZAA 4ZY0A 1F2OA 4KOXA 5J8CA 4AB7A 2K5TA 4PPZA 3W6XA 4C68A 2CY2A 2F5IA 3F0AA 1P4NA 1YLOA 1I12A 2QIRA 3JUWA 4QUSA 3GKRA 2PCUA 3WC6A 4KLWA 2FT0A 4F9VA 1R43A 2FE7A 5AG5A 1Q2DA 3T90A 3NH5A 2ATRA 4A39A 1PYTB 4MBUA 5EMIA 2OU2A 4FBEA 1PU9A 2CNSA 3KI9A 1IB1E 1S60A 4B12A 1MK4A 1SQHA 1XIXA 3S9NA 2FSRA 4MHYA 4R57A 3R1KA 2PJ6A 4R3LA 2ZELA 3D66A 3WC7A 2CXAA 3CDXA 1IIDA 3VATA 3FEEA 1YQEA 4MHZA 2X7BA 3L2NA 2QJ8A 3H8FA 2CTCA 1R57A 3FVLA 4PXCA 2GIVA 5IB0A 1Z8TA 3LMSA 3KR4A 4YU9A 3K9UA 3IO1A 3S6KA 2VZZA 1AMPA 3D2PA 4IUSA 4F6AA 2ZEPA 5CBMA 5K8OA 2C27A 2GREA 2JDCA 5DS0A 3DR8A 4LQ6A 4XPLA 3PRTA 3T9YA 3SJFA 1CPXA 1KUXA 1BOBA 4R3KA 3PP9A 4PXEA 5CPAA 2AFUA 4Q36A 2ZEHA 1YSJA 4B10A 2RB7A 4KLVA 5AG7A 1QSMA 2H5MA 2EUIA 3QNVA 2ARHA 1YW6A 1Z4EA 3CXPA 3ISZA 3WABA 4B6ZA 4GM5A 1M1DA 4X3RA 2NSMA 5G20A 4BD9A 1NE9A 4OLLA 2A4NA 2JLMA 3CXSA 1N71A 1ARMA 2PJ4A 5C88A 1ELMP 2Z3NA 5G1ZA 3FF3A 3D2MA 4IF5A 3K2KA 3NA6A 5H86A 3RYOA 4UFWA 2EK9A 1M4IA 1OZPA 1XFOA 2ZEEA 5F46A 4NJQA 2BEIA 1IY7A 1NMTA 2WPXA 1YW4A 3PEIA 4A30A 3TE4A 4BBHA 4YWYA 1LANA 4ZY1A 2JBJA 2B4BA 3BXMA 4K30A 3GUXA 4F8ZA 3ISXA 2PJ9A 8CPAA 4CAWA 4PK3A 2ZEGA 2VEZA 4QB9A 3KZWA 3V8IA 1MJAA 2V8HA 1J4JA 3OWCA 2BO9A 2PJ2A 4AVCA 4MCRA 1L0CA 2GE3A 1FNOA 2WZNA 4DJLA 1YREA 2REFA 2Q4YA 1BPNA 4MY3A 4MY0A 2OR4A 1HEEA 4MRIA 2AFWA 3IWWA 4W9YA 2PJ7A 5J1QA 2DF5A 1HDUA 2R7HA 4KOVA 4ORFA 4MFQA 1ZLHA 3SI2A 4HNXB 1F57A 4CAEA 1VIXA 3D68A 4J3GA 5JM6A 4XNHC 4CPAA 4GS4A 2PJ5A 2ZW4A 3FEDA 2HV2A 1R3NA 1QQ9A 1YK3A 2WUUA 3FNCA 4OIWA 3ZZIA 2ZOGA 3FJUA 1GYTA 2D4OA 2CTBA 2PR1A 4B14A 2XEGA 4UBRA 5CNPA 1Y9KA 2ZEOA 3N5FA 4CYNA 3KHZA 1CBXA 4C2YA 4M3SA 4KOWA 5JPHA 3PFOA 4NF1A 1YVOA 4CGMA 1X12A 1Z5RA 4R6TA 3N7ZA 3QAYA 3FYNA 2Q7BA 4FWUA 1M44A 4QC6A 2BL1A 5K8PA 3I3GA 2PJBA 4PXDA 3EFAA 2PRQA 3IJ3A 1XMTA 1S5KA 4PK2A 2FIAA 2PJCA 5THWA 1YVKA 3BI0A 1IYLA 3B2YA 3EO4A 2V77A 1U6MA 1FT7A 2C6GA 4NEXA 2G0BA 2B58A 3D7DA 5HMNA 4F0XA 3W91A 3R9EA 5AG6A 4II9A 4P4EA 2J9AA 3R96A 2VL1A 3IFEA 2B4DA 4AVAA 2ZOFA 3NH8A 2I79A 4FD7A 4MFZA 3NE7A 1QMUA 3LODA 3JRUA 4M6IA 2FVGA 3S6GA 3D67A 4NFRA 1FY7A 2J8NA 4OMEA 1ELLP 3B35A 4HNWB 4MHPA 3R95A 4AVBA 4XNHB 2KCWA 4FD5A 2ZENA 1M4GA 1Y0YA 3SI0A 3F8KA 3FECA 2CIJA 4PSXA 2C6PA 4BINA 4EWTA 3FIXA 4OC5A 3DDDA 5A28A 1KWMA 3IGRA 3GB0A 4I49A 1QSOA 4KS9A 2NYQA 3A9LA 3B3TA 4MXUA 5LYDA 4CS0B 1TKHA 2CF4A 3FB3A 1YGHA 3HLPA 4K3NA 1Z4RA 2PQ8A 2YNEA 3D7GA 3IEHA 4NGTA 4EFDA 2ODFA 4KSFA 2POKA 5EBVA 4MFLA 4UCMA 5EC4A 2Z3MA 3MRUA 4KOSA 4A94A 3CT9A 1Q2YA 3FXTA 3RO0A 5A27A 5HVHA 1ZLIA 2O4HA 2GFQA 4P4IA 4YRHA 3G3SA 2Q4ZA 2RC4A 4BMHA 2EVNA 2FS5A 1M4DA 2FXFA 1TF9A 3MGDA 5G21A 4XPDB 5KTCA 3FMCA 3SI1A 3D3SA 2WPWA 4C7HA 3VWDA 1TKJA 1UFHA 4E8OA 2GLFA 3IWEA 4Z65A 1UWYA 3H8GA 4ZGYB 1K4JA 4C7IA 2Q43A 1S3ZA 2ZXVA 4MFPA 4AXVA 1CJWA 1ON0A 1Y7RA 1S7LA 5F47A 1OBRA 1JWQA 2V8GA 5J8FA 2V8VA 1ZG7A 4OC1A 4GXHA 4OC4A 3SJGA 3V38A 3LWUA 3B7IA 3IU2A 5D8NA 2HUZA 2Q04A 1B6BA 4FD6A 1TF8A 2F7VA 1LAPA 1RXTA 2GU2A 5AGEA 3TOAA 3CZXA 4MHNA 1VHOA 4UWJA 3PGPA 5D29A 4JZ0A 2OOTA 4RS2A 3CPAA 1CM0A 4X8IA 1Z2LA 4UCPA 1XRYA 3VWEA 1IU8A 5F49A 2P0WA 1PUAA 1XJOA 3RNZA 4CRZB 1BPMA 1Z8LA 3H8EA 4AG9A 3PB8X 4E0AA 1H8LA 2B3UA 2Z11A 3DGVA 2AFZA 4KUAA 4TNUA 3PB6X 1VGYA 3P2HA 3GYAA 1WWZA 3PZJA 1IICA 2PIZA 3PFEA 4QVTA 2WYRA 4KOTA 3W6SA 3B3WA 4X5KA 3WT4A 5DWNA 3TO9A 4FD4A 1BLLE 1V0CA 4KUBA 4F0YA 3BI1A 2JBKA 3HUVA 1XEBA 1S7FA 2B4DB 4MCPA 2Z3PA 2JDDA 4M6GA 4OKOA 3S6FA 4WWVA 2I3CA 4NGRA 4CYOA 2EO8A 4NSQA 4NGMA 2VBQA 4RUHA 3B3VA 4FAIA 4PV6A 5LYLA 4P10A 1M4LA 3D8PA 2P6FA 4U5YA 4PSWA 4CGLA 2R98A 4OIDA 4UFXA 1CP7A 1Z8XA 2VQYA 1F2PA 3JTKA 4NXYA 1EE3P 4R9MA 5HVFA 3TT2A 4MI4A 1B87A 2FIWA 2O53A 3I9SA 4M85A 4U9YA 2VI7A 1GHEA 1VHEA 4X2TA 1Z8WA 2O28A 2EBJA 1XBUA 1PCAA 2YNCA 2QMLA 4EMEA 5K8MA 3KHXA 1YMEA 3GIUA 1I21A 5LYIA 5KTAA 2Q0YA 4OP4A 3I1UA 3TOBA 4UFVA 1QSRA 2Z10A 2Z3LA 4H2KA 5LRGA 4YFJA 1IOFA 4CGOA 3GLJA 3FX6A 4R7MA 3BHXA 4B5OA 2GLJA 2ZEDA 1XOVA 3IU1A 5G22A 1QSTA 2V8DA 4A38A 4JYWA 1S7KA 4O23A 1RTQA 2DEAA 1JQGA 3R9GA 2PC1A 2PVWA 4MJ8A 3WR7A 1YR0A 2RFHA 3F5BA 5LRKA 3VARA 2OB0A 1CX8A 4HPSA 4XPDC 4YGOA 5ELYA 1RO5A 2EWBA 4B5PA 3E0KA 2B5GA 1AYEA 3S9MA 2GANA 4IK2A 4MHDA 3ZJ0A 4CGPA 3TX8A 1LCPA 4P44A 1MJBA 3NH4A 4JXRA 4U9ZA 4UF4A 5LRJA 4ZX9A 3IWGA 3DR6A 3BJ8A 3CXQA 1LAMA 4Q38A 4P4BA 3BLNA 3S6HA 2Q44A 3PB4X 4HKFA 3KL9A 1QSNA 3SXOA 2AJ6A 2BCOA 1S7NA 1LRZA 4KOUA 2G9DA 3D7HA 2PE3A 4UEFA 3G8WA 4H6UA 4PXBA 3QAHA 3V7ZA 4NCZA 3KQZA 1I1DA 2AFSA 4JXQA 2CNTA 3DNSA 1ZG9A 2WSAA 5FVJA 2IQ6A 4UCNA 2P6GA 5E96A 5JQ4A 4KOYA 4KVXA 2FL4A 1Q7LA 2G3AA 3PB9X 1BO4A 1WK4A 5LYFA 2PRBA 4NGPA 4RN7A 2ANPA 4NJRA 4UIBA 4MCQA 3H4QA 5ISVA 2G3TA 3IIBA 1NSAA 5K8NA 4A31A 2JEVA 2ZW6A 3RAMA 1BAVA 2P6EA 3DLJA 2QECA 2DPSA 3B8GA 4UA3A 3DSBA 3T8WA 4ZBGA 1KZFA 2OZGA 3B3CA 4JJXA 2IJZA 3EC4A 2Z3KA 2PIYA 1LFWA 2Y0MA 3R9FA 2ZPAA 4UEEA 2ZW5A 1IOIA 2HQYA 4G1PA 4CYQA 3SHPA 4E2AA 4H89A 3TO7A 4CAVA 2QYVA 3TTHA 2OZUA 1ZO0A 3EY5A 4OC3A 4XPKA 4TWEA 2Z0ZA 4MFKA 1AUGA
chains in the Genus database with same CATH topology
2CNMA 1MJ9A 5BWAB 1KUVA 1IYKA 2J8MA 2VXKA 5GCNA 1P0HA 4KVOE 4L8AA 4DNCA 4JD6A 4KORA 5IX3A 4A32A 4KZTA 4H6ZA 3SXNA 4A33A 2J8RA 5I0CA 5H84A 2D4PA 2YGWA 2DXQA 1Y9WA 4AG7A 2R8VA 5F48A 4JWPA 2OH1A 4B5PB 2B5GB 3LD2A 2BSWA 2R1IA 1Q2CA 5IV0A 2BUEA 3JVNA 3BJ7A 1KUYA 4R87A 4KSAA 4A2ZA 2IL4A 4JLYA 3EXNA 1TIQA 4OADA 1Z9UA 1YX0A 3UY5A 4B13A 4MFJA 2PSWA 5DWMA 2Z3OA 4Y49C 4CGNA 2AE6A 3TO6A 4B11A 4HNYB 1XF8A 4A95A 3TFYA 1XE4A 3C26A 3FRMA 4OAEA 2NMTA 1VHSA 3GY9A 2DPTA 3KKWA 5HH1A 1YLEA 2PR8A 2I00A 4C2XA 2YNDA 4QBJA 2FCKA 2OZHA 4KVME 4LX9A 3P2FA 4LUAA 4ONUA 2ZW7A 4CAXA 3H5ZA 4RI1A 1VKCA 4CAFA 3QB8A 2B3VA 1NSLA 3FBUA 2REEA 4UWIA 4CYPA 5KTDA 4CRYB 2Q4VA 2PDOA 3TCVA 4C2ZA 5AG4A 2YNCC 2VZYA 4Y49B 4L89A 4EVYA 5C82A 4KOXA 5J8CA 4AB7A 2K5TA 3W6XA 4C68A 2CY2A 2F5IA 3F0AA 1P4NA 1I12A 2QIRA 3JUWA 4QUSA 3GKRA 4KLWA 2FT0A 2FE7A 3T90A 5AG5A 1Q2DA 2ATRA 4MBUA 2OU2A 1PU9A 2CNSA 4B12A 1IB1E 1S60A 1MK4A 1SQHA 1XIXA 2FSRA 4R57A 3R1KA 4R3LA 2CXAA 1IIDA 2X7BA 1R57A 2GIVA 5IB0A 3K9UA 3S6KA 2VZZA 3D2PA 4IUSA 4F6AA 2C27A 2JDCA 3DR8A 4XPLA 3T9YA 1KUXA 1BOBA 4R3KA 3PP9A 4Q36A 4B10A 4KLVA 5AG7A 1QSMA 2H5MA 2EUIA 2ARHA 1Z4EA 3CXPA 1M1DA 5G20A 1NE9A 4OLLA 2A4NA 2JLMA 3CXSA 1N71A 5C88A 2Z3NA 5G1ZA 3D2MA 4IF5A 5H86A 3RYOA 4UFWA 1OZPA 1M4IA 5F46A 2BEIA 2WPXA 1NMTA 4A30A 3TE4A 4BBHA 2B4BA 4K30A 4CAWA 4PK3A 2VEZA 4QB9A 3V8IA 1MJAA 1J4JA 3OWCA 4AVCA 1L0CA 2GE3A 2REFA 1YREA 2Q4YA 4MY3A 4MY0A 2R7HA 4KOVA 4ORFA 4MFQA 4HNXB 4CAEA 4J3GA 4XNHC 4GS4A 2ZW4A 2HV2A 1YK3A 2WUUA 3FNCA 3ZZIA 2D4OA 4B14A 2PR1A 4UBRA 5CNPA 1Y9KA 4CYNA 4C2YA 4M3SA 4KOWA 5JPHA 4CGMA 4NF1A 1YVOA 3N7ZA 3FYNA 2Q7BA 1M44A 4QC6A 2BL1A 3I3GA 3EFAA 1XMTA 1S5KA 4PK2A 2FIAA 1YVKA 3EO4A 1IYLA 4NEXA 1U6MA 2G0BA 2B58A 5HMNA 4F0XA 3W91A 3R9EA 5AG6A 4II9A 3R96A 2B4DA 4AVAA 2I79A 4FD7A 4MFZA 3NE7A 3LODA 3S6GA 1FY7A 2J8NA 3R95A 4HNWB 4AVBA 4XNHB 2KCWA 4FD5A 1M4GA 3F8KA 4PSXA 3FIXA 5A28A 3DDDA 3IGRA 4I49A 1QSOA 4KS9A 3A9LA 4CS0B 3FB3A 1YGHA 1Z4RA 2PQ8A 2YNEA 4KSFA 5EBVA 4MFLA 4UCMA 5EC4A 2Z3MA 4KOSA 1Q2YA 3FXTA 5A27A 4YRHA 3G3SA 2RC4A 4BMHA 2EVNA 2FS5A 1M4DA 2FXFA 3MGDA 5G21A 4XPDB 5KTCA 3D3SA 2WPWA 4C7HA 3VWDA 1UFHA 4E8OA 3IWEA 4ZGYB 1K4JA 4C7IA 1S3ZA 2ZXVA 4MFPA 1CJWA 1ON0A 1Y7RA 1S7LA 5F47A 5J8FA 3IU2A 2HUZA 2Q04A 1B6BA 4FD6A 1RXTA 5AGEA 3TOAA 4UWJA 3PGPA 4RS2A 1CM0A 4UCPA 3VWEA 5F49A 2P0WA 1PUAA 4CRZB 4AG9A 4E0AA 2B3UA 2Z11A 4KUAA 3P2HA 3GYAA 1WWZA 3PZJA 1IICA 4QVTA 4KOTA 3W6SA 4X5KA 5DWNA 3TO9A 4FD4A 1V0CA 4KUBA 4F0YA 1XEBA 1S7FA 2B4DB 2Z3PA 2JDDA 3S6FA 4CYOA 4NSQA 2VBQA 4PV6A 3D8PA 2P6FA 4U5YA 4PSWA 4CGLA 2R98A 4UFXA 2VQYA 3JTKA 3TT2A 4R9MA 4NXYA 4MI4A 1B87A 2FIWA 3I9SA 4M85A 4U9YA 2VI7A 1GHEA 2O28A 2YNCA 2QMLA 1I21A 5KTAA 2Q0YA 3TOBA 4UFVA 1QSRA 2Z10A 2Z3LA 4YFJA 4CGOA 4B5OA 3IU1A 5G22A 1QSTA 1S7KA 3R9GA 2PC1A 4MJ8A 3WR7A 1YR0A 3F5BA 2OB0A 4XPDC 4YGOA 1RO5A 4B5PA 3E0KA 2B5GA 2GANA 4MHDA 3ZJ0A 4CGPA 1MJBA 4JXRA 4U9ZA 3IWGA 3DR6A 3BJ8A 3CXQA 4Q38A 3BLNA 3S6HA 2Q44A 4HKFA 1QSNA 3SXOA 2AJ6A 1S7NA 1LRZA 4KOUA 3G8WA 4H6UA 3QAHA 4NCZA 1I1DA 4JXQA 2CNTA 3DNSA 2WSAA 5FVJA 4UCNA 2P6GA 5E96A 5JQ4A 4KOYA 4KVXA 2FL4A 2G3AA 1BO4A 1WK4A 2PRBA 3H4QA 5ISVA 2G3TA 4A31A 2JEVA 2ZW6A 2P6EA 2QECA 2DPSA 3B8GA 4UA3A 3DSBA 4ZBGA 1KZFA 2OZGA 4JJXA 3EC4A 2Z3KA 2Y0MA 3R9FA 2ZPAA 2ZW5A 2HQYA 4CYQA 3SHPA 4E2AA 4H89A 3TO7A 4CAVA 3TTHA 2OZUA 1ZO0A 3EY5A 4XPKA 2Z0ZA 4MFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CNM A;  1MJ9 A;  1KUV A;  1IYK A;  2J8M A;  2VXK A;  5GCN A;  1P0H A;  4KVO E;  4L8A A;  4DNC A;  4JD6 A;  4KOR A;  5IX3 A;  4KZT A;  4H6Z A;  3SXN A;  2J8R A;  5I0C A;  5H84 A;  2D4P A;  2DXQ A;  1Y9W A;  4AG7 A;  2R8V A;  5F48 A;  4JWP A;  2OH1 A;  4B5P B;  2B5G B;  3LD2 A;  2BSW A;  2R1I A;  1Q2C A;  5IV0 A;  2BUE A;  3JVN A;  3BJ7 A;  1KUY A;  4R87 A;  2IL4 A;  4JLY A;  3EXN A;  1TIQ A;  4OAD A;  1Z9U A;  1YX0 A;  3UY5 A;  2PSW A;  5DWM A;  4Y49 C;  2AE6 A;  3TO6 A;  4HNY B;  1XF8 A;  3TFY A;  1XE4 A;  3C26 A;  3FRM A;  4OAE A;  2NMT A;  1VHS A;  3GY9 A;  3KKW A;  5HH1 A;  1YLE A;  2PR8 A;  2I00 A;  4QBJ A;  2FCK A;  2OZH A;  4KVM E;  4LX9 A;  3P2F A;  4LUA A;  4ONU A;  2ZW7 A;  4CAX A;  4RI1 A;  1VKC A;  3QB8 A;  2B3V A;  1NSL A;  3FBU A;  2REE A;  4UWI A;  5KTD A;  4CRY B;  2Q4V A;  2PDO A;  3TCV A;  2VZY A;  4Y49 B;  4L89 A;  4EVY A;  5C82 A;  4KOX A;  5J8C A;  4AB7 A;  2K5T A;  3W6X A;  2CY2 A;  2F5I A;  3F0A A;  1P4N A;  1I12 A;  2QIR A;  3JUW A;  4QUS A;  3GKR A;  4KLW A;  2FT0 A;  2FE7 A;  3T90 A;  1Q2D A;  2ATR A;  4MBU A;  2OU2 A;  1PU9 A;  2CNS A;  1IB1 E;  1S60 A;  1MK4 A;  1SQH A;  1XIX A;  2FSR A;  4R57 A;  3R1K A;  4R3L A;  1IID A;  2X7B A;  1R57 A;  2GIV A;  5IB0 A;  3K9U A;  3S6K A;  2VZZ A;  3D2P A;  4IUS A;  4F6A A;  2C27 A;  2JDC A;  3DR8 A;  4XPL A;  3T9Y A;  1KUX A;  1BOB A;  4R3K A;  3PP9 A;  4KLV A;  1QSM A;  2H5M A;  2EUI A;  2ARH A;  1Z4E A;  3CXP A;  1M1D A;  1NE9 A;  4OLL A;  2A4N A;  2JLM A;  3CXS A;  1N71 A;  5C88 A;  3D2M A;  4IF5 A;  5H86 A;  3RYO A;  1OZP A;  1M4I A;  5F46 A;  2BEI A;  2WPX A;  1NMT A;  3TE4 A;  2B4B A;  4K30 A;  4CAW A;  4PK3 A;  2VEZ A;  4QB9 A;  3V8I A;  1MJA A;  1J4J A;  3OWC A;  4AVC A;  1L0C A;  2GE3 A;  2REF A;  1YRE A;  2Q4Y A;  4MY3 A;  4MY0 A;  2R7H A;  4KOV A;  4ORF A;  4HNX B;  4J3G A;  4XNH C;  4GS4 A;  2ZW4 A;  2HV2 A;  1YK3 A;  3FNC A;  3ZZI A;  2D4O A;  2PR1 A;  4UBR A;  5CNP A;  1Y9K A;  4M3S A;  4KOW A;  5JPH A;  4NF1 A;  1YVO A;  3N7Z A;  3FYN A;  2Q7B A;  1M44 A;  4QC6 A;  2BL1 A;  3I3G A;  3EFA A;  1XMT A;  1S5K A;  4PK2 A;  2FIA A;  1YVK A;  3EO4 A;  1IYL A;  4NEX A;  1U6M A;  2G0B A;  2B58 A;  5HMN A;  3W91 A;  3R9E A;  4II9 A;  3R96 A;  2B4D A;  4AVA A;  2I79 A;  4FD7 A;  3NE7 A;  3LOD A;  3S6G A;  1FY7 A;  2J8N A;  3R95 A;  4HNW B;  4AVB A;  4XNH B;  2KCW A;  4FD5 A;  1M4G A;  3F8K A;  4PSX A;  3FIX A;  3DDD A;  3IGR A;  4I49 A;  1QSO A;  4CS0 B;  3FB3 A;  1YGH A;  1Z4R A;  2PQ8 A;  5EBV A;  5EC4 A;  4KOS A;  1Q2Y A;  3FXT A;  4YRH A;  3G3S A;  2RC4 A;  4BMH A;  2EVN A;  2FS5 A;  1M4D A;  2FXF A;  3MGD A;  4XPD B;  5KTC A;  3D3S A;  2WPW A;  3VWD A;  1UFH A;  4E8O A;  1K4J A;  1S3Z A;  2ZXV A;  1CJW A;  1ON0 A;  1Y7R A;  1S7L A;  5F47 A;  5J8F A;  2HUZ A;  2Q04 A;  1B6B A;  4FD6 A;  1RXT A;  3TOA A;  4UWJ A;  3PGP A;  4RS2 A;  1CM0 A;  3VWE A;  5F49 A;  2P0W A;  1PUA A;  4CRZ B;  4AG9 A;  4E0A A;  2B3U A;  2Z11 A;  4KUA A;  3P2H A;  3GYA A;  1WWZ A;  3PZJ A;  1IIC A;  4QVT A;  4KOT A;  3W6S A;  4X5K A;  5DWN A;  3TO9 A;  4FD4 A;  1V0C A;  4KUB A;  4F0Y A;  1XEB A;  1S7F A;  2B4D B;  2JDD A;  3S6F A;  4NSQ A;  2VBQ A;  4PV6 A;  3D8P A;  2P6F A;  4U5Y A;  4PSW A;  2R98 A;  2VQY A;  3TT2 A;  4R9M A;  4NXY A;  4MI4 A;  1B87 A;  2FIW A;  3I9S A;  4M85 A;  4U9Y A;  2VI7 A;  1GHE A;  2O28 A;  2QML A;  1I21 A;  5KTA A;  2Q0Y A;  3TOB A;  1QSR A;  2Z10 A;  4YFJ A;  4B5O A;  1QST A;  1S7K A;  3R9G A;  2PC1 A;  4MJ8 A;  3WR7 A;  1YR0 A;  3F5B A;  2OB0 A;  4XPD C;  4YGO A;  1RO5 A;  4B5P A;  3E0K A;  2B5G A;  2GAN A;  4MHD A;  3ZJ0 A;  1MJB A;  4JXR A;  4U9Z A;  3IWG A;  3DR6 A;  3BJ8 A;  3CXQ A;  3BLN A;  3S6H A;  2Q44 A;  4HKF A;  1QSN A;  3SXO A;  2AJ6 A;  1S7N A;  1LRZ A;  4KOU A;  3G8W A;  4H6U A;  3QAH A;  4NCZ A;  1I1D A;  4JXQ A;  2CNT A;  3DNS A;  5FVJ A;  2P6G A;  5E96 A;  5JQ4 A;  4KOY A;  4KVX A;  2FL4 A;  2G3A A;  1BO4 A;  1WK4 A;  2PRB A;  3H4Q A;  5ISV A;  2G3T A;  2JEV A;  2ZW6 A;  2P6E A;  2QEC A;  3B8G A;  4UA3 A;  3DSB A;  4ZBG A;  1KZF A;  2OZG A;  4JJX A;  3EC4 A;  2Y0M A;  3R9F A;  2ZPA A;  2ZW5 A;  2HQY A;  3SHP A;  4E2A A;  4H89 A;  3TO7 A;  4CAV A;  3TTH A;  2OZU A;  3EY5 A;  4XPK A;  2Z0Z A; 
#chains in the Genus database with same CATH topology
 2CNM A;  1MJ9 A;  3CPX A;  4OC2 A;  5BWA B;  1KUV A;  1IYK A;  2J8M A;  3KR5 A;  2VXK A;  5GCN A;  1P0H A;  4KVO E;  2QVP A;  5F09 A;  4L8A A;  4A37 A;  4DNC A;  2HC9 A;  4JD6 A;  3WC5 A;  5IB9 A;  4KOR A;  3FH4 A;  3TC8 A;  5IX3 A;  3PBB A;  4ZY2 A;  4A32 A;  4KSI A;  4KZT A;  4UEZ A;  3D4U A;  4H6Z A;  3SXN A;  3D7F A;  4A33 A;  2J8R A;  5I0C A;  3KGQ A;  5H84 A;  4P4J A;  2D4P A;  4DUK A;  4P6Y A;  2YGW A;  2DXQ A;  1Y9W A;  4AG7 A;  2R8V A;  5F48 A;  4JWP A;  2JEW A;  4R8F A;  4ZYQ A;  2OH1 A;  4B5P B;  2B5G B;  1ZG8 A;  3KQX A;  1IGB A;  3MN8 A;  3LD2 A;  2ABZ A;  3B3S A;  2BSW A;  1DE4 C;  2ZEM A;  2R1I A;  1Q2C A;  2ZEF A;  4IAV A;  4LQG A;  2BUE A;  5IV0 A;  3JVN A;  3BJ7 A;  1KUY A;  4R87 A;  6CPA A;  3S9L A;  4KSA A;  2PJ1 A;  4A2Z A;  5JH9 A;  2IL4 A;  1A2Z A;  4JLY A;  5HVG A;  5JGF A;  4IHM A;  2HB6 A;  3EXN A;  2Q7S A;  4ZX8 A;  1TIQ A;  4OAD A;  1Z9U A;  1YX0 A;  4P4F A;  2PVV A;  4MCS A;  2BOA A;  3SJX A;  1LOK A;  2EK8 A;  3UY5 A;  4B13 A;  2PJA A;  2XEI A;  2C6C A;  4MFJ A;  2PSW A;  4M6H A;  5DWM A;  2Z3O A;  2PJ3 A;  4FUU A;  4Y49 C;  3NFZ A;  4CGN A;  2AE6 A;  3TO6 A;  1CG2 A;  4NGS A;  4B11 A;  1XMB A;  4HNY B;  2PJ0 A;  1XF8 A;  2C1C A;  1DTD A;  4A95 A;  3TFY A;  1XE4 A;  3C26 A;  3FRM A;  4OAE A;  4P45 A;  1Y0R A;  2NMT A;  3LAC A;  1VHS A;  1Y7E A;  3GY9 A;  1TXR A;  4OC0 A;  3PBE A;  4MMO A;  2DPT A;  3KKW A;  1CPS A;  5HH1 A;  1YLE A;  4R76 A;  1HDQ A;  5HXD A;  2PR8 A;  2I00 A;  4C2X A;  2YND A;  4WJB A;  4QBJ A;  2FCK A;  2OZH A;  3VH9 A;  4KVM E;  3RBU A;  2XEF A;  4LX9 A;  7CPA A;  2Q51 A;  3KAS A;  3P2F A;  5I4M A;  3SJE A;  4PQA A;  4LUA A;  2AFO A;  2AFM A;  4ONU A;  2ZW7 A;  4CAX A;  3H5Z A;  4RI1 A;  1VKC A;  4CAF A;  4ONW A;  3QB8 A;  2XEJ A;  4UIA A;  2B3V A;  1NSL A;  4Q7A A;  2IMO A;  3FBU A;  3PB7 X;  2PJ8 A;  2REE A;  4F9U A;  1X10 A;  4UWI A;  3NE8 A;  4CYP A;  1TKF A;  5KTD A;  4CRY B;  2Q4V A;  2F8H A;  2PDO A;  3TCV A;  4C2Z A;  5AG4 A;  1CP6 A;  3K9T A;  4ZI6 A;  2YNC C;  2VZY A;  3IC1 A;  4Y49 B;  2AFX A;  4P4D A;  4DYO A;  4NGN A;  4L89 A;  1ARL A;  4NGQ A;  4EVY A;  5C82 A;  3RZA A;  4ZY0 A;  1F2O A;  4KOX A;  5J8C A;  4AB7 A;  2K5T A;  4PPZ A;  3W6X A;  4C68 A;  2CY2 A;  2F5I A;  3F0A A;  1P4N A;  1YLO A;  1I12 A;  2QIR A;  3JUW A;  4QUS A;  3GKR A;  2PCU A;  3WC6 A;  4KLW A;  2FT0 A;  4F9V A;  1R43 A;  2FE7 A;  5AG5 A;  1Q2D A;  3T90 A;  3NH5 A;  2ATR A;  4A39 A;  1PYT B;  4MBU A;  5EMI A;  2OU2 A;  4FBE A;  1PU9 A;  2CNS A;  3KI9 A;  1IB1 E;  1S60 A;  4B12 A;  1MK4 A;  1SQH A;  1XIX A;  3S9N A;  2FSR A;  4MHY A;  4R57 A;  3R1K A;  2PJ6 A;  4R3L A;  2ZEL A;  3D66 A;  3WC7 A;  2CXA A;  3CDX A;  1IID A;  3VAT A;  3FEE A;  1YQE A;  4MHZ A;  2X7B A;  3L2N A;  2QJ8 A;  3H8F A;  2CTC A;  1R57 A;  3FVL A;  4PXC A;  2GIV A;  5IB0 A;  1Z8T A;  3LMS A;  3KR4 A;  4YU9 A;  3K9U A;  3IO1 A;  3S6K A;  2VZZ A;  1AMP A;  3D2P A;  4IUS A;  4F6A A;  2ZEP A;  5CBM A;  5K8O A;  2C27 A;  2GRE A;  2JDC A;  5DS0 A;  3DR8 A;  4LQ6 A;  4XPL A;  3PRT A;  3T9Y A;  3SJF A;  1CPX A;  1KUX A;  1BOB A;  4R3K A;  3PP9 A;  4PXE A;  5CPA A;  2AFU A;  4Q36 A;  2ZEH A;  1YSJ A;  4B10 A;  2RB7 A;  4KLV A;  5AG7 A;  1QSM A;  2H5M A;  2EUI A;  3QNV A;  2ARH A;  1YW6 A;  1Z4E A;  3CXP A;  3ISZ A;  3WAB A;  4B6Z A;  4GM5 A;  1M1D A;  4X3R A;  2NSM A;  5G20 A;  4BD9 A;  1NE9 A;  4OLL A;  2A4N A;  2JLM A;  3CXS A;  1N71 A;  1ARM A;  2PJ4 A;  5C88 A;  1ELM P;  2Z3N A;  5G1Z A;  3FF3 A;  3D2M A;  4IF5 A;  3K2K A;  3NA6 A;  5H86 A;  3RYO A;  4UFW A;  2EK9 A;  1M4I A;  1OZP A;  1XFO A;  2ZEE A;  5F46 A;  4NJQ A;  2BEI A;  1IY7 A;  1NMT A;  2WPX A;  1YW4 A;  3PEI A;  4A30 A;  3TE4 A;  4BBH A;  4YWY A;  1LAN A;  4ZY1 A;  2JBJ A;  2B4B A;  3BXM A;  4K30 A;  3GUX A;  4F8Z A;  3ISX A;  2PJ9 A;  8CPA A;  4CAW A;  4PK3 A;  2ZEG A;  2VEZ A;  4QB9 A;  3KZW A;  3V8I A;  1MJA A;  2V8H A;  1J4J A;  3OWC A;  2BO9 A;  2PJ2 A;  4AVC A;  4MCR A;  1L0C A;  2GE3 A;  1FNO A;  2WZN A;  4DJL A;  1YRE A;  2REF A;  2Q4Y A;  1BPN A;  4MY3 A;  4MY0 A;  2OR4 A;  1HEE A;  4MRI A;  2AFW A;  3IWW A;  4W9Y A;  2PJ7 A;  5J1Q A;  2DF5 A;  1HDU A;  2R7H A;  4KOV A;  4ORF A;  4MFQ A;  1ZLH A;  3SI2 A;  4HNX B;  1F57 A;  4CAE A;  1VIX A;  3D68 A;  4J3G A;  5JM6 A;  4XNH C;  4CPA A;  4GS4 A;  2PJ5 A;  2ZW4 A;  3FED A;  2HV2 A;  1R3N A;  1QQ9 A;  1YK3 A;  2WUU A;  3FNC A;  4OIW A;  3ZZI A;  2ZOG A;  3FJU A;  1GYT A;  2D4O A;  2CTB A;  2PR1 A;  4B14 A;  2XEG A;  4UBR A;  5CNP A;  1Y9K A;  2ZEO A;  3N5F A;  4CYN A;  3KHZ A;  1CBX A;  4C2Y A;  4M3S A;  4KOW A;  5JPH A;  3PFO A;  4NF1 A;  1YVO A;  4CGM A;  1X12 A;  1Z5R A;  4R6T A;  3N7Z A;  3QAY A;  3FYN A;  2Q7B A;  4FWU A;  1M44 A;  4QC6 A;  2BL1 A;  5K8P A;  3I3G A;  2PJB A;  4PXD A;  3EFA A;  2PRQ A;  3IJ3 A;  1XMT A;  1S5K A;  4PK2 A;  2FIA A;  2PJC A;  5THW A;  1YVK A;  3BI0 A;  1IYL A;  3B2Y A;  3EO4 A;  2V77 A;  1U6M A;  1FT7 A;  2C6G A;  4NEX A;  2G0B A;  2B58 A;  3D7D A;  5HMN A;  4F0X A;  3W91 A;  3R9E A;  5AG6 A;  4II9 A;  4P4E A;  2J9A A;  3R96 A;  2VL1 A;  3IFE A;  2B4D A;  4AVA A;  2ZOF A;  3NH8 A;  2I79 A;  4FD7 A;  4MFZ A;  3NE7 A;  1QMU A;  3LOD A;  3JRU A;  4M6I A;  2FVG A;  3S6G A;  3D67 A;  4NFR A;  1FY7 A;  2J8N A;  4OME A;  1ELL P;  3B35 A;  4HNW B;  4MHP A;  3R95 A;  4AVB A;  4XNH B;  2KCW A;  4FD5 A;  2ZEN A;  1M4G A;  1Y0Y A;  3SI0 A;  3F8K A;  3FEC A;  2CIJ A;  4PSX A;  2C6P A;  4BIN A;  4EWT A;  3FIX A;  4OC5 A;  3DDD A;  5A28 A;  1KWM A;  3IGR A;  3GB0 A;  4I49 A;  1QSO A;  4KS9 A;  2NYQ A;  3A9L A;  3B3T A;  4MXU A;  5LYD A;  4CS0 B;  1TKH A;  2CF4 A;  3FB3 A;  1YGH A;  3HLP A;  4K3N A;  1Z4R A;  2PQ8 A;  2YNE A;  3D7G A;  3IEH A;  4NGT A;  4EFD A;  2ODF A;  4KSF A;  2POK A;  5EBV A;  4MFL A;  4UCM A;  5EC4 A;  2Z3M A;  3MRU A;  4KOS A;  4A94 A;  3CT9 A;  1Q2Y A;  3FXT A;  3RO0 A;  5A27 A;  5HVH A;  1ZLI A;  2O4H A;  2GFQ A;  4P4I A;  4YRH A;  3G3S A;  2Q4Z A;  2RC4 A;  4BMH A;  2EVN A;  2FS5 A;  1M4D A;  2FXF A;  1TF9 A;  3MGD A;  5G21 A;  4XPD B;  5KTC A;  3FMC A;  3SI1 A;  3D3S A;  2WPW A;  4C7H A;  3VWD A;  1TKJ A;  1UFH A;  4E8O A;  2GLF A;  3IWE A;  4Z65 A;  1UWY A;  3H8G A;  4ZGY B;  1K4J A;  4C7I A;  2Q43 A;  1S3Z A;  2ZXV A;  4MFP A;  4AXV A;  1CJW A;  1ON0 A;  1Y7R A;  1S7L A;  5F47 A;  1OBR A;  1JWQ A;  2V8G A;  5J8F A;  2V8V A;  1ZG7 A;  4OC1 A;  4GXH A;  4OC4 A;  3SJG A;  3V38 A;  3LWU A;  3B7I A;  3IU2 A;  5D8N A;  2HUZ A;  2Q04 A;  1B6B A;  4FD6 A;  1TF8 A;  2F7V A;  1LAP A;  1RXT A;  2GU2 A;  5AGE A;  3TOA A;  3CZX A;  4MHN A;  1VHO A;  4UWJ A;  3PGP A;  5D29 A;  4JZ0 A;  2OOT A;  4RS2 A;  3CPA A;  1CM0 A;  4X8I A;  1Z2L A;  4UCP A;  1XRY A;  3VWE A;  1IU8 A;  5F49 A;  2P0W A;  1PUA A;  1XJO A;  3RNZ A;  4CRZ B;  1BPM A;  1Z8L A;  3H8E A;  4AG9 A;  3PB8 X;  4E0A A;  1H8L A;  2B3U A;  2Z11 A;  3DGV A;  2AFZ A;  4KUA A;  4TNU A;  3PB6 X;  1VGY A;  3P2H A;  3GYA A;  1WWZ A;  3PZJ A;  1IIC A;  2PIZ A;  3PFE A;  4QVT A;  2WYR A;  4KOT A;  3W6S A;  3B3W A;  4X5K A;  3WT4 A;  5DWN A;  3TO9 A;  4FD4 A;  1BLL E;  1V0C A;  4KUB A;  4F0Y A;  3BI1 A;  2JBK A;  3HUV A;  1XEB A;  1S7F A;  2B4D B;  4MCP A;  2Z3P A;  2JDD A;  4M6G A;  4OKO A;  3S6F A;  4WWV A;  2I3C A;  4NGR A;  4CYO A;  2EO8 A;  4NSQ A;  4NGM A;  2VBQ A;  4RUH A;  3B3V A;  4FAI A;  4PV6 A;  5LYL A;  4P10 A;  1M4L A;  3D8P A;  2P6F A;  4U5Y A;  4PSW A;  4CGL A;  2R98 A;  4OID A;  4UFX A;  1CP7 A;  1Z8X A;  2VQY A;  1F2P A;  3JTK A;  4NXY A;  1EE3 P;  4R9M A;  5HVF A;  3TT2 A;  4MI4 A;  1B87 A;  2FIW A;  2O53 A;  3I9S A;  4M85 A;  4U9Y A;  2VI7 A;  1GHE A;  1VHE A;  4X2T A;  1Z8W A;  2O28 A;  2EBJ A;  1XBU A;  1PCA A;  2YNC A;  2QML A;  4EME A;  5K8M A;  3KHX A;  1YME A;  3GIU A;  1I21 A;  5LYI A;  5KTA A;  2Q0Y A;  4OP4 A;  3I1U A;  3TOB A;  4UFV A;  1QSR A;  2Z10 A;  2Z3L A;  4H2K A;  5LRG A;  4YFJ A;  1IOF A;  4CGO A;  3GLJ A;  3FX6 A;  4R7M A;  3BHX A;  4B5O A;  2GLJ A;  2ZED A;  1XOV A;  3IU1 A;  5G22 A;  1QST A;  2V8D A;  4A38 A;  4JYW A;  1S7K A;  4O23 A;  1RTQ A;  2DEA A;  1JQG A;  3R9G A;  2PC1 A;  2PVW A;  4MJ8 A;  3WR7 A;  1YR0 A;  2RFH A;  3F5B A;  5LRK A;  3VAR A;  2OB0 A;  1CX8 A;  4HPS A;  4XPD C;  4YGO A;  5ELY A;  1RO5 A;  2EWB A;  4B5P A;  3E0K A;  2B5G A;  1AYE A;  3S9M A;  2GAN A;  4IK2 A;  4MHD A;  3ZJ0 A;  4CGP A;  3TX8 A;  1LCP A;  4P44 A;  1MJB A;  3NH4 A;  4JXR A;  4U9Z A;  4UF4 A;  5LRJ A;  4ZX9 A;  3IWG A;  3DR6 A;  3BJ8 A;  3CXQ A;  1LAM A;  4Q38 A;  4P4B A;  3BLN A;  3S6H A;  2Q44 A;  3PB4 X;  4HKF A;  3KL9 A;  1QSN A;  3SXO A;  2AJ6 A;  2BCO A;  1S7N A;  1LRZ A;  4KOU A;  2G9D A;  3D7H A;  2PE3 A;  4UEF A;  3G8W A;  4H6U A;  4PXB A;  3QAH A;  3V7Z A;  4NCZ A;  3KQZ A;  1I1D A;  2AFS A;  4JXQ A;  2CNT A;  3DNS A;  1ZG9 A;  2WSA A;  5FVJ A;  2IQ6 A;  4UCN A;  2P6G A;  5E96 A;  5JQ4 A;  4KOY A;  4KVX A;  2FL4 A;  1Q7L A;  2G3A A;  3PB9 X;  1BO4 A;  1WK4 A;  5LYF A;  2PRB A;  4NGP A;  4RN7 A;  2ANP A;  4NJR A;  4UIB A;  4MCQ A;  3H4Q A;  5ISV A;  2G3T A;  3IIB A;  1NSA A;  5K8N A;  4A31 A;  2JEV A;  2ZW6 A;  3RAM A;  1BAV A;  2P6E A;  3DLJ A;  2QEC A;  2DPS A;  3B8G A;  4UA3 A;  3DSB A;  3T8W A;  4ZBG A;  1KZF A;  2OZG A;  3B3C A;  4JJX A;  2IJZ A;  3EC4 A;  2Z3K A;  2PIY A;  1LFW A;  2Y0M A;  3R9F A;  2ZPA A;  4UEE A;  2ZW5 A;  1IOI A;  2HQY A;  4G1P A;  4CYQ A;  3SHP A;  4E2A A;  4H89 A;  3TO7 A;  4CAV A;  2QYV A;  3TTH A;  2OZU A;  1ZO0 A;  3EY5 A;  4OC3 A;  4XPK A;  4TWE A;  2Z0Z A;  4MFK A;  1AUG A; 
#chains in the Genus database with same CATH homology
 2CNM A;  1MJ9 A;  5BWA B;  1KUV A;  1IYK A;  2J8M A;  2VXK A;  5GCN A;  1P0H A;  4KVO E;  4L8A A;  4DNC A;  4JD6 A;  4KOR A;  5IX3 A;  4A32 A;  4KZT A;  4H6Z A;  3SXN A;  4A33 A;  2J8R A;  5I0C A;  5H84 A;  2D4P A;  2YGW A;  2DXQ A;  1Y9W A;  4AG7 A;  2R8V A;  5F48 A;  4JWP A;  2OH1 A;  4B5P B;  2B5G B;  3LD2 A;  2BSW A;  2R1I A;  1Q2C A;  5IV0 A;  2BUE A;  3JVN A;  3BJ7 A;  1KUY A;  4R87 A;  4KSA A;  4A2Z A;  2IL4 A;  4JLY A;  3EXN A;  1TIQ A;  4OAD A;  1Z9U A;  1YX0 A;  3UY5 A;  4B13 A;  4MFJ A;  2PSW A;  5DWM A;  2Z3O A;  4Y49 C;  4CGN A;  2AE6 A;  3TO6 A;  4B11 A;  4HNY B;  1XF8 A;  4A95 A;  3TFY A;  1XE4 A;  3C26 A;  3FRM A;  4OAE A;  2NMT A;  1VHS A;  3GY9 A;  2DPT A;  3KKW A;  5HH1 A;  1YLE A;  2PR8 A;  2I00 A;  4C2X A;  2YND A;  4QBJ A;  2FCK A;  2OZH A;  4KVM E;  4LX9 A;  3P2F A;  4LUA A;  4ONU A;  2ZW7 A;  4CAX A;  3H5Z A;  4RI1 A;  1VKC A;  4CAF A;  3QB8 A;  2B3V A;  1NSL A;  3FBU A;  2REE A;  4UWI A;  4CYP A;  5KTD A;  4CRY B;  2Q4V A;  2PDO A;  3TCV A;  4C2Z A;  5AG4 A;  2YNC C;  2VZY A;  4Y49 B;  4L89 A;  4EVY A;  5C82 A;  4KOX A;  5J8C A;  4AB7 A;  2K5T A;  3W6X A;  4C68 A;  2CY2 A;  2F5I A;  3F0A A;  1P4N A;  1I12 A;  2QIR A;  3JUW A;  4QUS A;  3GKR A;  4KLW A;  2FT0 A;  2FE7 A;  3T90 A;  5AG5 A;  1Q2D A;  2ATR A;  4MBU A;  2OU2 A;  1PU9 A;  2CNS A;  4B12 A;  1IB1 E;  1S60 A;  1MK4 A;  1SQH A;  1XIX A;  2FSR A;  4R57 A;  3R1K A;  4R3L A;  2CXA A;  1IID A;  2X7B A;  1R57 A;  2GIV A;  5IB0 A;  3K9U A;  3S6K A;  2VZZ A;  3D2P A;  4IUS A;  4F6A A;  2C27 A;  2JDC A;  3DR8 A;  4XPL A;  3T9Y A;  1KUX A;  1BOB A;  4R3K A;  3PP9 A;  4Q36 A;  4B10 A;  4KLV A;  5AG7 A;  1QSM A;  2H5M A;  2EUI A;  2ARH A;  1Z4E A;  3CXP A;  1M1D A;  5G20 A;  1NE9 A;  4OLL A;  2A4N A;  2JLM A;  3CXS A;  1N71 A;  5C88 A;  2Z3N A;  5G1Z A;  3D2M A;  4IF5 A;  5H86 A;  3RYO A;  4UFW A;  1OZP A;  1M4I A;  5F46 A;  2BEI A;  2WPX A;  1NMT A;  4A30 A;  3TE4 A;  4BBH A;  2B4B A;  4K30 A;  4CAW A;  4PK3 A;  2VEZ A;  4QB9 A;  3V8I A;  1MJA A;  1J4J A;  3OWC A;  4AVC A;  1L0C A;  2GE3 A;  2REF A;  1YRE A;  2Q4Y A;  4MY3 A;  4MY0 A;  2R7H A;  4KOV A;  4ORF A;  4MFQ A;  4HNX B;  4CAE A;  4J3G A;  4XNH C;  4GS4 A;  2ZW4 A;  2HV2 A;  1YK3 A;  2WUU A;  3FNC A;  3ZZI A;  2D4O A;  4B14 A;  2PR1 A;  4UBR A;  5CNP A;  1Y9K A;  4CYN A;  4C2Y A;  4M3S A;  4KOW A;  5JPH A;  4CGM A;  4NF1 A;  1YVO A;  3N7Z A;  3FYN A;  2Q7B A;  1M44 A;  4QC6 A;  2BL1 A;  3I3G A;  3EFA A;  1XMT A;  1S5K A;  4PK2 A;  2FIA A;  1YVK A;  3EO4 A;  1IYL A;  4NEX A;  1U6M A;  2G0B A;  2B58 A;  5HMN A;  4F0X A;  3W91 A;  3R9E A;  5AG6 A;  4II9 A;  3R96 A;  2B4D A;  4AVA A;  2I79 A;  4FD7 A;  4MFZ A;  3NE7 A;  3LOD A;  3S6G A;  1FY7 A;  2J8N A;  3R95 A;  4HNW B;  4AVB A;  4XNH B;  2KCW A;  4FD5 A;  1M4G A;  3F8K A;  4PSX A;  3FIX A;  5A28 A;  3DDD A;  3IGR A;  4I49 A;  1QSO A;  4KS9 A;  3A9L A;  4CS0 B;  3FB3 A;  1YGH A;  1Z4R A;  2PQ8 A;  2YNE A;  4KSF A;  5EBV A;  4MFL A;  4UCM A;  5EC4 A;  2Z3M A;  4KOS A;  1Q2Y A;  3FXT A;  5A27 A;  4YRH A;  3G3S A;  2RC4 A;  4BMH A;  2EVN A;  2FS5 A;  1M4D A;  2FXF A;  3MGD A;  5G21 A;  4XPD B;  5KTC A;  3D3S A;  2WPW A;  4C7H A;  3VWD A;  1UFH A;  4E8O A;  3IWE A;  4ZGY B;  1K4J A;  4C7I A;  1S3Z A;  2ZXV A;  4MFP A;  1CJW A;  1ON0 A;  1Y7R A;  1S7L A;  5F47 A;  5J8F A;  3IU2 A;  2HUZ A;  2Q04 A;  1B6B A;  4FD6 A;  1RXT A;  5AGE A;  3TOA A;  4UWJ A;  3PGP A;  4RS2 A;  1CM0 A;  4UCP A;  3VWE A;  5F49 A;  2P0W A;  1PUA A;  4CRZ B;  4AG9 A;  4E0A A;  2B3U A;  2Z11 A;  4KUA A;  3P2H A;  3GYA A;  1WWZ A;  3PZJ A;  1IIC A;  4QVT A;  4KOT A;  3W6S A;  4X5K A;  5DWN A;  3TO9 A;  4FD4 A;  1V0C A;  4KUB A;  4F0Y A;  1XEB A;  1S7F A;  2B4D B;  2Z3P A;  2JDD A;  3S6F A;  4CYO A;  4NSQ A;  2VBQ A;  4PV6 A;  3D8P A;  2P6F A;  4U5Y A;  4PSW A;  4CGL A;  2R98 A;  4UFX A;  2VQY A;  3JTK A;  3TT2 A;  4R9M A;  4NXY A;  4MI4 A;  1B87 A;  2FIW A;  3I9S A;  4M85 A;  4U9Y A;  2VI7 A;  1GHE A;  2O28 A;  2YNC A;  2QML A;  1I21 A;  5KTA A;  2Q0Y A;  3TOB A;  4UFV A;  1QSR A;  2Z10 A;  2Z3L A;  4YFJ A;  4CGO A;  4B5O A;  3IU1 A;  5G22 A;  1QST A;  1S7K A;  3R9G A;  2PC1 A;  4MJ8 A;  3WR7 A;  1YR0 A;  3F5B A;  2OB0 A;  4XPD C;  4YGO A;  1RO5 A;  4B5P A;  3E0K A;  2B5G A;  2GAN A;  4MHD A;  3ZJ0 A;  4CGP A;  1MJB A;  4JXR A;  4U9Z A;  3IWG A;  3DR6 A;  3BJ8 A;  3CXQ A;  4Q38 A;  3BLN A;  3S6H A;  2Q44 A;  4HKF A;  1QSN A;  3SXO A;  2AJ6 A;  1S7N A;  1LRZ A;  4KOU A;  3G8W A;  4H6U A;  3QAH A;  4NCZ A;  1I1D A;  4JXQ A;  2CNT A;  3DNS A;  2WSA A;  5FVJ A;  4UCN A;  2P6G A;  5E96 A;  5JQ4 A;  4KOY A;  4KVX A;  2FL4 A;  2G3A A;  1BO4 A;  1WK4 A;  2PRB A;  3H4Q A;  5ISV A;  2G3T A;  4A31 A;  2JEV A;  2ZW6 A;  2P6E A;  2QEC A;  2DPS A;  3B8G A;  4UA3 A;  3DSB A;  4ZBG A;  1KZF A;  2OZG A;  4JJX A;  3EC4 A;  2Z3K A;  2Y0M A;  3R9F A;  2ZPA A;  2ZW5 A;  2HQY A;  4CYQ A;  3SHP A;  4E2A A;  4H89 A;  3TO7 A;  4CAV A;  3TTH A;  2OZU A;  1ZO0 A;  3EY5 A;  4XPK A;  2Z0Z A;  4MFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...