1B87A

Crystal structure of an aminoglycoside 6'-n-acetyltransferase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
181
structure length
181
Chain Sequence
MIISEFDRNNPVLKDQLSDLLRLTWPEEYGDSSAEEVEEMMNPERIAVAAVDQDELVGFIGAIPQYGITGWELHPLVVESSRRKNQIGTRLVNYLEKEVASRGGITIYLGTDDLDHGTTLSQTDLYEHTFDKVASIQNLREHPYEFYEKLGYKIVGVLPNANGWDKPDIWMAKTIIPRPDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (AMINOGLYCOSIDE N6'-ACETYLTRANSFERASE TYPE 1)
publication title Crystal structure of an aminoglycoside 6'-N-acetyltransferase: defining the GCN5-related N-acetyltransferase superfamily fold.
pubmed doi rcsb
molecule tags Transferase
total genus 50
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 1999-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1b87A00
3JUWA 5KTDA 2PSWA 4MY3A 5DWMA 3R1KA 1S7NA 1LRZA 4MBUA 5IV0A 3CXSA 1VHSA 5HMNA 3P2FA 1Y9KA 2R1IA 4CAWA 2FSRA 5I0CA 2BL1A 3CXQA 4QBJA 2Q4VA 1S5KA 3NE7A 5KTAA 1L0CA 4KVOE 5EBVA 3SXOA 1M4IA 2X7BA 2Z11A 2BSWA 2ZW4A 4NXYA 2OU2A 1CM0A 2D4OA 1M44A 3BJ8A 2I79A 4QC6A 2VZYA 2VQYA 3F5BA 2ZW5A 1YVKA 2FXFA 4KZTA 1Y9WA 4JJXA 1IYKA 2G0BA 2C27A 3R9GA 4B5OA 3UY5A 2GIVA 4LUAA 4KUBA 5J8FA 4NF1A 3P2HA 3TO9A 4KOYA 5F48A 1S3ZA 2QECA 4FD5A 1RXTA 3CXPA 3OWCA 3WR7A 4KOUA 2VZZA 2J8MA 4JXQA 4M85A 2H5MA 4JD6A 4PK3A 3R96A 4XNHB 3PP9A 1YLEA 2B4BA 1J4JA 3G3SA 2OB0A 3V8IA 2PC1A 4M3SA 2B58A 5ISVA 1MK4A 1PUAA 4PSWA 2PR8A 4J3GA 4L8AA 1YR0A 1Y7RA 2F5IA 4B5PA 4RS2A 2CNTA 4CRYB 2J8RA 1YREA 1XF8A 2FS5A 3DSBA 2CY2A 2ZW6A 3SHPA 3VWDA 1KZFA 1IB1E 3EXNA 3QB8A 1N71A 3I9SA 2IL4A 3TOAA 1S7FA 4XPDB 2FCKA 2FIAA 4NSQA 4UA3A 4BMHA 2WPWA 1TIQA 2HQYA 3TO7A 4L89A 4Y49C 1UFHA 4QB9A 3ZZIA 1BO4A 2ZPAA 4H6UA 4KOXA 3TO6A 1MJAA 4JXRA 2B5GB 4H6ZA 4E2AA 3F8KA 2CNSA 2VXKA 1Z9UA 3W91A 4KVXA 4UWIA 1SQHA 1QSTA 2G3TA 3D3SA 4KLWA 1IICA 1P4NA 4R87A 3R95A 2ZW7A 1MJBA 4RI1A 1GHEA 3S6HA 4OLLA 3GYAA 4FD6A 2I00A 4FD7A 3E0KA 1KUXA 3TFYA 3DR8A 3FNCA 1XE4A 4KORA 3QAHA 4R57A 2P0WA 5F46A 1V0CA 4U9ZA 3PGPA 2VBQA 3S6GA 4HNWB 3TE4A 1IIDA 3DNSA 4IUSA 4MY0A 3D2MA 5E96A 2K5TA 5HH1A 3IGRA 4OAEA 2ATRA 2REFA 5GCNA 4CAVA 2P6EA 4ONUA 4CRZB 4F0YA 1QSMA 1CJWA 1QSOA 4KLVA 3FIXA 4X5KA 3LODA 4R3KA 4KUAA 4LX9A 4AG9A 4QVTA 2O28A 5KTCA 1BOBA 4UWJA 5JQ4A 1NE9A 3DDDA 3GY9A 1R57A 2QIRA 3TTHA 3SXNA 2PDOA 1K4JA 2Z10A 2OZGA 4DNCA 2GE3A 3T90A 2JDCA 3R9FA 1S7LA 1YVOA 1PU9A 3TOBA 4E8OA 3T9YA 2R98A 5J8CA 2REEA 4KOWA 1M4DA 3W6SA 3B8GA 3S6KA 2B4DB 4UBRA 3PZJA 2Q7BA 5EC4A 4F6AA 2AE6A 2HUZA 2ZXVA 4KOTA 2QMLA 5IB0A 4XNHC 4H89A 3JVNA 4KVME 3I3GA 2GANA 3KKWA 2Q44A 3N7ZA 4I49A 1Z4RA 4IF5A 2BEIA 1S60A 3RYOA 3LD2A 1OZPA 1B87A 3FRMA 3K9UA 1FY7A 2B5GA 3C26A 3DR6A 5C82A 2VI7A 4YRHA 5JPHA 1Q2DA 3EC4A 1ON0A 4MI4A 5IX3A 3TT2A 4E0AA 2FE7A 2FL4A 2P6FA 1YK3A 4JLYA 2R7HA 1XIXA 4XPLA 3VWEA 4R9MA 3G8WA 4XPKA 4ZBGA 2FIWA 4JWPA 2EUIA 4AB7A 2DXQA 1B6BA 3MGDA 4ORFA 2JLMA 2NMTA 2EVNA 4HKFA 2ARHA 4YFJA 2J8NA 2CNMA 4AG7A 3TCVA 5F49A 5DWNA 2JDDA 4II9A 1XMTA 3FXTA 2B3UA 4R3LA 4AVCA 3H4QA 2A4NA 3EFAA 1M1DA 4PV6A 2P6GA 2PR1A 2BUEA 4U5YA 5C88A 4U9YA 4KOVA 1YX0A 1YGHA 4PSXA 3ZJ0A 2HV2A 1RO5A 3R9EA 4AVAA 2PRBA 3F0AA 2Q4YA 5H86A 4HNYB 1QSRA 4MHDA 1Z4EA 4MJ8A 2B4DA 4K30A 4EVYA 3GKRA 3EY5A 4NCZA 3FYNA 2G3AA 1S7KA 4HNXB 2D4PA 1WWZA 1Q2YA 2R8VA 2OH1A 4FD4A 3W6XA 4QUSA 3BJ7A 3EO4A 3D8PA 5FVJA 1I21A 2AJ6A 1XEBA 5CNPA 2OZHA 2Z0ZA 1P0HA 5F47A 1VKCA 1NMTA 2Y0MA 2WPXA 1NSLA 5H84A 1I1DA 4Y49B 4B5PB 1IYLA 4OADA 2RC4A 4NEXA 1KUYA 1U6MA 3FBUA 3S6FA 4PK2A 4GS4A 4YGOA 2Q0YA 1KUVA 1QSNA 2PQ8A 4CAXA 1I12A 3BLNA 2B3VA 2JEVA 4KOSA 3IWGA 3D2PA 3FB3A 2OZUA 2VEZA 2KCWA 1M4GA 4XPDC 2FT0A 4AVBA 1WK4A 4CS0B 2Q04A 1MJ9A 1Q2CA
chains in the Genus database with same CATH superfamily
3JUWA 5KTDA 2PSWA 4MY3A 5DWMA 3R1KA 1S7NA 4P44A 4OIWA 1LRZA 2PCUA 4MBUA 5IV0A 3CXSA 4P4IA 5K8PA 1VHSA 5HMNA 4A39A 1XBUA 3P2FA 3IEHA 3RO0A 4FAIA 1ZO0A 5LRGA 1Y9KA 4CYPA 2R1IA 3D4UA 4CAWA 2FSRA 5I0CA 1HEEA 1FNOA 3FJUA 2BL1A 2Z3OA 3CXQA 3NH8A 4QBJA 2Q4VA 1S5KA 1X12A 3CPXA 3PRTA 3NE7A 4MFLA 5KTAA 1L0CA 4KVOE 5EBVA 1LFWA 1ZG9A 4OC5A 3B3WA 4ZX8A 4CGOA 1LCPA 2Q51A 3SXOA 1M4IA 2X7BA 2Z11A 3B3VA 4BD9A 1Q7LA 2BSWA 2ZW4A 2ZOGA 2OU2A 4NXYA 5D8NA 1CM0A 2D4OA 4NFRA 4P4BA 4MHZA 1M44A 4P6YA 3KASA 4A2ZA 3BJ8A 2I79A 3S9NA 4P4JA 2AFWA 4ZGYB 4QC6A 1IOIA 2VZYA 2VQYA 3F5BA 2ZW5A 1VHEA 1YVKA 2FXFA 4KZTA 3SJFA 1Y9WA 4JJXA 2V77A 1IYKA 2G0BA 2C27A 3R9GA 4B5OA 4UFXA 2GIVA 3UY5A 4LUAA 4W9YA 1CX8A 4KUBA 4UEZA 4NF1A 5J8FA 3P2HA 3SJEA 3WC5A 3TO9A 4KOYA 2ZEGA 1XMBA 5F48A 1S3ZA 2QECA 3IC1A 4FD5A 1RXTA 3CXPA 1Z8LA 3OWCA 3WR7A 3FH4A 4KOUA 2VZZA 2J8MA 4JXQA 4M85A 2H5MA 4JD6A 1AMPA 2YNEA 4PXBA 1ELLP 4PXCA 4PK3A 3R96A 5I4MA 3GB0A 5HVHA 4XNHB 4LQ6A 3PP9A 1YLEA 2WSAA 2B4BA 1J4JA 3G3SA 1ZG7A 5HVFA 2OB0A 4C68A 3V8IA 2CTCA 4C7IA 2PC1A 1BPNA 4M3SA 2B58A 3PEIA 1MK4A 5ISVA 1PUAA 2BCOA 1XJOA 4PSWA 1TXRA 2PR8A 1VIXA 4J3GA 4L8AA 1YR0A 1Y7RA 2F5IA 4B5PA 4RS2A 2CNTA 1RTQA 4CRYB 2J8RA 2IJZA 4R8FA 1ELMP 1YREA 3PB9X 2V8VA 5K8NA 2Z3KA 3D7GA 4CGNA 1JWQA 1XF8A 5AG7A 2FS5A 2Z3MA 4EWTA 2V8GA 5KTCA 3DSBA 3I1UA 4RUHA 4MFZA 2CY2A 5G20A 4NGSA 1IOFA 2ZW6A 3BXMA 4TNUA 2CXAA 4IK2A 3GLJA 2RB7A 4KSFA 3MN8A 2BOAA 3WC7A 2OR4A 2PJAA 5AGEA 3SHPA 4F9VA 3VWDA 1VHOA 1F2PA 1KZFA 4F0XA 1IB1E 3L2NA 3EXNA 2C6GA 1DE4C 3QB8A 1N71A 3I9SA 2IL4A 3TOAA 1QMUA 4NGPA 4EMEA 2WUUA 3PB4X 2ODFA 2ZELA 1S7FA 2DF5A 4XPDB 2YGWA 4A37A 1OBRA 4NJQA 2FCKA 2FIAA 4IHMA 4NSQA 1CP6A 4UA3A 4BMHA 2WPWA 1TIQA 4CGPA 2ZEPA 2HQYA 3LWUA 4DYOA 1F57A 3TO7A 1KWMA 1Z8XA 2AFOA 3LACA 2I3CA 1TKFA 4L89A 1UFHA 4QB9A 4Y49C 4UIAA 1BO4A 2WZNA 2ZPAA 1BAVA 3NH5A 1CPSA 1Z2LA 5D29A 2JBKA 4A32A 4H6UA 4C2YA 4CYOA 4KOXA 2NYQA 2EBJA 3TO6A 4OC0A 4O23A 2FVGA 1MJAA 3IU2A 3PFEA 4JXRA 2B5GB 3NH4A 4H6ZA 4X3RA 4E2AA 3D67A 2CNSA 3F8KA 4MFKA 5CPAA 2VXKA 3D66A 1Z9UA 3NFZA 3RNZA 3W91A 4KVXA 4UWIA 1SQHA 1QSTA 2XEGA 2POKA 2ZEHA 1YLOA 4Q36A 2G3TA 4P4EA 3D3SA 4ZY0A 2Q7SA 4KLWA 1XFOA 1IICA 1P4NA 4R87A 3R95A 2ZW7A 1MJBA 4NGQA 3HUVA 5ELYA 2ZEEA 4RI1A 1GHEA 3S6HA 4OLLA 2O4HA 5LRKA 1IY7A 3CZXA 3GYAA 3FEDA 4FD6A 2I00A 4P4FA 3WABA 4FD7A 4A94A 3E0KA 2PIYA 1KUXA 4MHPA 3TFYA 1FT7A 1TKJA 3DR8A 3FNCA 1XE4A 4KORA 1Y0RA 5HXDA 3QAHA 4R57A 2YNCA 1YMEA 2P0WA 5F46A 1V0CA 2XEJA 5HVGA 4U9ZA 3PGPA 2VBQA 4KSIA 3S6GA 1YW6A 4HNWB 1IIDA 3DNSA 4IUSA 4MY0A 5CBMA 3TE4A 4MCSA 1A2ZA 1BLLE 1QQ9A 3D2MA 5K8OA 1HDQA 3KGQA 5E96A 2K5TA 5HH1A 4C7HA 4F8ZA 3IGRA 4A95A 3SI1A 4OAEA 4DJLA 2ATRA 2REFA 3JTKA 5GCNA 4CAVA 2IQ6A 2P6EA 4ONUA 4CRZB 3GIUA 4F0YA 1QSMA 1CJWA 4MFJA 1PYTB 1QSOA 1TF8A 3DLJA 4KLVA 3KQZA 3KR4A 2WYRA 3FIXA 4X5KA 3LODA 2GFQA 2GLJA 5JM6A 1YQEA 4R3KA 2VL1A 4KUAA 1TF9A 4KSAA 4LX9A 4UCNA 4AG9A 4QVTA 2O28A 2GREA 3PBBA 1VGYA 1BPMA 1BOBA 2PJ8A 3CDXA 4UWJA 3PB8X 1Z8TA 4B12A 5JQ4A 3KZWA 3TC8A 3B3TA 5J1QA 4ZY1A 1NE9A 3DDDA 1AUGA 1YW4A 3GY9A 1Z8WA 2HC9A 1R57A 2QIRA 2PIZA 4A30A 5A28A 4JZ0A 3TTHA 3IU1A 3SXNA 2PDOA 2PJ7A 2ZEFA 3IWWA 1K4JA 2OZGA 2Z10A 2AFMA 4DNCA 3KHZA 2V8HA 2F7VA 2YNCC 2GE3A 3T90A 2JDCA 4M6GA 3R9FA 1S7LA 3D7DA 1YVOA 3BI0A 3KI9A 1PU9A 2PJ1A 3TOBA 4FWUA 4E8OA 1LAPA 3FVLA 4PXEA 3T9YA 2R98A 3SI2A 3ISZA 3H8EA 4MCQA 4OC2A 5J8CA 5JH9A 2GLFA 2REEA 3B35A 3IFEA 4KOWA 4A38A 1M4DA 3W6SA 3B8GA 3RBUA 2B4DB 4UBRA 3S6KA 3PZJA 2Q7BA 5EC4A 3S9MA 4F6AA 2AE6A 2PJ3A 2HUZA 2ZXVA 3KQXA 4KOTA 4YWYA 2QMLA 2DEAA 4MHNA 2ZEDA 5IB0A 3NA6A 4XNHC 4G1PA 4H89A 3JVNA 4KVME 4TWEA 3I3GA 4WJBA 4IAVA 1YSJA 3B3SA 2GANA 3KKWA 4PPZA 3B7IA 3T8WA 4C2ZA 2Q44A 4B11A 4OC4A 5G1ZA 3N7ZA 3A9LA 1Z4RA 4I49A 4IF5A 2ABZA 4WWVA 1Y7EA 2GU2A 4UCMA 4MXUA 4ZX9A 3SJXA 3PB6X 4AXVA 2BEIA 4NGTA 3D68A 2BO9A 4MFPA 4UCPA 4EFDA 4UIBA 1S60A 3RYOA 3VH9A 2AFSA 3LD2A 1OZPA 1B87A 3FRMA 3K9UA 1FY7A 2B5GA 3C26A 3DGVA 4NGMA 3PB7X 3DR6A 5C82A 2C6CA 1M4LA 2VI7A 4MFQA 4YU9A 4B10A 2EK8A 2PJCA 5LRJA 3ISXA 4OIDA 3HLPA 1IGBA 3K2KA 4P4DA 4YRHA 5G21A 5JPHA 2PJ2A 8CPAA 3IWEA 1ZLIA 1ARMA 1Q2DA 2PJ6A 3EC4A 4H2KA 4ZY2A 5K8MA 1ON0A 3CT9A 2CF4A 2JEWA 4MI4A 3H8GA 4BBHA 5IX3A 3TT2A 5LYFA 2J9AA 3FF3A 5AG5A 2FE7A 4E0AA 2Q4ZA 2FL4A 2P6FA 2QJ8A 3FEEA 1YK3A 3KL9A 4Q38A 1IU8A 3PBEA 3VARA 4JLYA 2EO8A 2R7HA 1XIXA 4XPLA 3V38A 3VWEA 3B2YA 1XOVA 2PJBA 4LQGA 4R9MA 1DTDA 3G8WA 1H8LA 2JBJA 2AFZA 4UEFA 4XPKA 4BINA 4ZBGA 2FIWA 4JWPA 1ZG8A 3N5FA 4B14A 6CPAA 1CBXA 2EUIA 3FECA 4AB7A 2DXQA 3LMSA 3JRUA 5LYDA 1B6BA 3MGDA 4ORFA 5DS0A 2JLMA 5EMIA 5AG4A 4FBEA 2RFHA 3B3CA 2NMTA 2EVNA 4HKFA 2ARHA 2PVWA 4YFJA 4F9UA 3VATA 2J8NA 2CNMA 2CTBA 2DPSA 2QVPA 3TCVA 4AG7A 5F49A 5DWNA 3QAYA 3D7FA 1Y0YA 2PE3A 2JDDA 4II9A 1XMTA 3FXTA 2B3UA 4HPSA 3K9TA 4R3LA 3D7HA 4MCRA 4AVCA 1CP7A 2QYVA 4OP4A 2ANPA 2F8HA 2ZEOA 1CPXA 1R43A 1HDUA 3H4QA 4FUUA 2A4NA 4OKOA 3EFAA 2PVVA 1JQGA 4B13A 1LOKA 1M1DA 4PV6A 2P6GA 2PR1A 2BUEA 4U5YA 3NE8A 2Z3PA 4C2XA 4ZI6A 4U9YA 4KOVA 3SJGA 5C88A 4PQAA 1YX0A 4OC1A 4Q7AA 1YGHA 4PSXA 3ZJ0A 2HV2A 4KS9A 1RO5A 2O53A 3R9EA 4GM5A 4AVAA 2PRBA 1PCAA 3F0AA 1ARLA 2Q4YA 3PFOA 1LANA 5H86A 7CPAA 1EE3P 4R76A 2CIJA 4HNYB 1QSRA 4MHDA 1XRYA 1Z4EA 4MJ8A 2PJ0A 2ZENA 4CAFA 2B4DA 2XEIA 4Z65A 3QNVA 4K30A 4EVYA 4MMOA 4CGLA 3GKRA 3MRUA 3RAMA 3EY5A 5F09A 4NCZA 3FYNA 2EK9A 4UFVA 2G3AA 2PJ5A 3SI0A 1S7KA 4HNXB 3FMCA 4UFWA 2DPTA 2D4PA 1Z5RA 3BI1A 4UEEA 1WWZA 1Q2YA 2R8VA 5IB9A 2OH1A 4NGNA 3IJ3A 4FD4A 3W6XA 4X2TA 3KHXA 4QUSA 3S9LA 3BJ7A 3EO4A 4M6HA 2Z3LA 4CAEA 3D8PA 2HB6A 2PJ9A 5FVJA 1I21A 2AJ6A 1XEBA 3IO1A 5CNPA 4OMEA 4R6TA 2OZHA 5LYLA 2Z0ZA 3ZZIA 1P0HA 5F47A 1VKCA 4P45A 2AFXA 3V7ZA 4X8IA 2ZOFA 3CPAA 3WC6A 1NMTA 2Y0MA 5BWAB 2XEFA 2WPXA 2PRQA 3TX8A 1NSLA 1CG2A 5H84A 3GUXA 1I1DA 4Y49B 4JYWA 2V8DA 4B6ZA 2Q43A 4B5PB 5G22A 1IYLA 3RZAA 1X10A 4R7MA 4MCPA 3H5ZA 5A27A 2EWBA 4GXHA 4OADA 2RC4A 4NEXA 4M6IA 4OC3A 1KUYA 1U6MA 3BHXA 3FBUA 4ONWA 3S6FA 2C6PA 4PK2A 4GS4A 3WT4A 2G9DA 4YGOA 2Q0YA 1KUVA 1QSNA 2PJ4A 2PQ8A 1I12A 4K3NA 4CAXA 4CGMA 4P10A 2NSMA 4NGRA 4ZYQA 3BLNA 2B3VA 2JEVA 1TKHA 4KOSA 2IMOA 3FX6A 4A31A 3IIBA 2C1CA 4CPAA 3KR5A 3IWGA 4DUKA 3D2PA 3H8FA 3FB3A 4MRIA 1F2OA 2OZUA 5JGFA 2ZEMA 4NJRA 2VEZA 4UF4A 2KCWA 1GYTA 1M4GA 1ZLHA 4A33A 2YNDA 2Z3NA 4XPDC 2FT0A 4MHYA 5THWA 4PXDA 4AVBA 1UWYA 2AFUA 4CYQA 1NSAA 4CYNA 2OOTA 1WK4A 5LYIA 4CS0B 5AG6A 1AYEA 4RN7A 1R3NA 2Q04A 1LAMA 1MJ9A 1Q2CA
chains in the Genus database with same CATH topology
3JUWA 5KTDA 2PSWA 4MY3A 5DWMA 3R1KA 1S7NA 1LRZA 4MBUA 5IV0A 3CXSA 1VHSA 5HMNA 3P2FA 1ZO0A 1Y9KA 4CYPA 2R1IA 4CAWA 2FSRA 5I0CA 2BL1A 2Z3OA 3CXQA 4QBJA 2Q4VA 1S5KA 3NE7A 4MFLA 5KTAA 1L0CA 4KVOE 5EBVA 4CGOA 3SXOA 1M4IA 2X7BA 2Z11A 2BSWA 2ZW4A 4NXYA 2OU2A 1CM0A 2D4OA 1M44A 4A2ZA 3BJ8A 2I79A 4ZGYB 4QC6A 2VZYA 2VQYA 3F5BA 2ZW5A 1YVKA 2FXFA 4KZTA 1Y9WA 4JJXA 1IYKA 2G0BA 2C27A 3R9GA 4B5OA 4UFXA 2GIVA 3UY5A 4LUAA 4KUBA 5J8FA 4NF1A 3P2HA 3TO9A 4KOYA 5F48A 1S3ZA 2QECA 4FD5A 1RXTA 3CXPA 3OWCA 3WR7A 4KOUA 2VZZA 2J8MA 4JXQA 4M85A 2H5MA 4JD6A 2YNEA 4PK3A 3R96A 4XNHB 3PP9A 1YLEA 2WSAA 2B4BA 1J4JA 3G3SA 2OB0A 4C68A 3V8IA 4C7IA 2PC1A 4M3SA 2B58A 5ISVA 1MK4A 1PUAA 4PSWA 2PR8A 4J3GA 4L8AA 1YR0A 1Y7RA 2F5IA 4B5PA 4RS2A 2CNTA 4CRYB 2J8RA 1YREA 2Z3KA 4CGNA 1XF8A 5AG7A 2FS5A 2Z3MA 3DSBA 4MFZA 2CY2A 5G20A 2ZW6A 2CXAA 4KSFA 5AGEA 3SHPA 3VWDA 1KZFA 4F0XA 1IB1E 3EXNA 3QB8A 1N71A 3I9SA 2IL4A 3TOAA 2WUUA 1S7FA 4XPDB 2YGWA 2FCKA 2FIAA 4NSQA 4UA3A 4BMHA 2WPWA 1TIQA 4CGPA 2HQYA 3TO7A 4L89A 4Y49C 1UFHA 4QB9A 3ZZIA 1BO4A 2ZPAA 4C2YA 4A32A 4CYOA 4H6UA 4KOXA 3TO6A 1MJAA 3IU2A 4JXRA 2B5GB 4H6ZA 4E2AA 3F8KA 2CNSA 4MFKA 2VXKA 1Z9UA 3W91A 4KVXA 4UWIA 1SQHA 1QSTA 4Q36A 2G3TA 3D3SA 4KLWA 1IICA 1P4NA 4R87A 3R95A 2ZW7A 1MJBA 4RI1A 1GHEA 3S6HA 4OLLA 3GYAA 4FD6A 2I00A 4FD7A 3E0KA 1KUXA 3TFYA 3DR8A 3FNCA 1XE4A 4KORA 3QAHA 4R57A 2YNCA 2P0WA 5F46A 1V0CA 4U9ZA 3PGPA 2VBQA 3S6GA 4HNWB 3TE4A 1IIDA 3DNSA 4IUSA 4MY0A 3D2MA 5E96A 2K5TA 5HH1A 4C7HA 3IGRA 4A95A 4OAEA 2ATRA 2REFA 3JTKA 5GCNA 4CAVA 2P6EA 4ONUA 4CRZB 4F0YA 1QSMA 1CJWA 4MFJA 1QSOA 4KLVA 3FIXA 4X5KA 3LODA 4R3KA 4KUAA 4KSAA 4LX9A 4UCNA 4AG9A 4QVTA 2O28A 5KTCA 1BOBA 4B12A 4UWJA 5JQ4A 1NE9A 3DDDA 3GY9A 1R57A 2QIRA 5A28A 4A30A 3TTHA 3IU1A 3SXNA 2PDOA 1K4JA 2Z10A 2OZGA 4DNCA 2YNCC 2GE3A 3T90A 2JDCA 3R9FA 1S7LA 1YVOA 1PU9A 3TOBA 4E8OA 3T9YA 2R98A 5J8CA 2REEA 4KOWA 1M4DA 3W6SA 3B8GA 3S6KA 2B4DB 4UBRA 3PZJA 2Q7BA 5EC4A 4F6AA 2AE6A 2HUZA 2ZXVA 4KOTA 2QMLA 5IB0A 4XNHC 4H89A 3JVNA 4KVME 3I3GA 2GANA 3KKWA 4C2ZA 2Q44A 4B11A 5G1ZA 3N7ZA 3A9LA 1Z4RA 4I49A 4IF5A 4UCMA 2BEIA 4UCPA 4MFPA 1S60A 3RYOA 3LD2A 1OZPA 1B87A 3FRMA 3K9UA 1FY7A 2B5GA 3C26A 3DR6A 5C82A 2VI7A 4MFQA 4B10A 4YRHA 5G21A 5JPHA 3IWEA 1Q2DA 3EC4A 1ON0A 4MI4A 4BBHA 5IX3A 3TT2A 4E0AA 5AG5A 2FE7A 2FL4A 2P6FA 1YK3A 4Q38A 4JLYA 2R7HA 1XIXA 4XPLA 3VWEA 4R9MA 3G8WA 4XPKA 4ZBGA 2FIWA 4JWPA 4B14A 2EUIA 4AB7A 2DXQA 1B6BA 3MGDA 4ORFA 2JLMA 5AG4A 2NMTA 2EVNA 4HKFA 2ARHA 4YFJA 2J8NA 2CNMA 2DPSA 4AG7A 3TCVA 5F49A 5DWNA 2JDDA 4II9A 1XMTA 3FXTA 2B3UA 4R3LA 4AVCA 3H4QA 2A4NA 3EFAA 4B13A 1M1DA 4PV6A 2P6GA 2PR1A 2BUEA 4U5YA 2Z3PA 4C2XA 5C88A 4U9YA 4KOVA 1YX0A 1YGHA 4PSXA 3ZJ0A 2HV2A 4KS9A 1RO5A 3R9EA 4AVAA 2PRBA 3F0AA 2Q4YA 5H86A 4HNYB 1QSRA 4MHDA 1Z4EA 4MJ8A 4CAFA 2B4DA 4K30A 4EVYA 4CGLA 3GKRA 3EY5A 4NCZA 3FYNA 4UFVA 2G3AA 1S7KA 4HNXB 4UFWA 2DPTA 2D4PA 1WWZA 1Q2YA 2R8VA 2OH1A 4FD4A 3W6XA 4QUSA 3BJ7A 3EO4A 2Z3LA 4CAEA 3D8PA 5FVJA 1I21A 2AJ6A 1XEBA 5CNPA 2OZHA 2Z0ZA 1P0HA 5F47A 1VKCA 1NMTA 2Y0MA 5BWAB 2WPXA 1NSLA 5H84A 1I1DA 4Y49B 4B5PB 5G22A 1IYLA 3H5ZA 5A27A 4OADA 2RC4A 4NEXA 1KUYA 1U6MA 3FBUA 3S6FA 4PK2A 4GS4A 4YGOA 2Q0YA 1KUVA 1QSNA 2PQ8A 4CAXA 1I12A 4CGMA 3BLNA 2B3VA 2JEVA 4KOSA 4A31A 3IWGA 3D2PA 3FB3A 2OZUA 2VEZA 2KCWA 1M4GA 4A33A 2YNDA 2Z3NA 4XPDC 2FT0A 4AVBA 4CYQA 4CYNA 1WK4A 4CS0B 5AG6A 2Q04A 1MJ9A 1Q2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JUW A;  5KTD A;  2PSW A;  4MY3 A;  5DWM A;  3R1K A;  1S7N A;  1LRZ A;  4MBU A;  5IV0 A;  3CXS A;  1VHS A;  5HMN A;  3P2F A;  1Y9K A;  2R1I A;  4CAW A;  2FSR A;  5I0C A;  2BL1 A;  3CXQ A;  4QBJ A;  2Q4V A;  1S5K A;  3NE7 A;  5KTA A;  1L0C A;  4KVO E;  5EBV A;  3SXO A;  1M4I A;  2X7B A;  2Z11 A;  2BSW A;  2ZW4 A;  4NXY A;  2OU2 A;  1CM0 A;  2D4O A;  1M44 A;  3BJ8 A;  2I79 A;  4QC6 A;  2VZY A;  2VQY A;  3F5B A;  2ZW5 A;  1YVK A;  2FXF A;  4KZT A;  1Y9W A;  4JJX A;  1IYK A;  2G0B A;  2C27 A;  3R9G A;  4B5O A;  3UY5 A;  2GIV A;  4LUA A;  4KUB A;  5J8F A;  4NF1 A;  3P2H A;  3TO9 A;  4KOY A;  5F48 A;  1S3Z A;  2QEC A;  4FD5 A;  1RXT A;  3CXP A;  3OWC A;  3WR7 A;  4KOU A;  2VZZ A;  2J8M A;  4JXQ A;  4M85 A;  2H5M A;  4JD6 A;  4PK3 A;  3R96 A;  4XNH B;  3PP9 A;  1YLE A;  2B4B A;  1J4J A;  3G3S A;  2OB0 A;  3V8I A;  2PC1 A;  4M3S A;  2B58 A;  5ISV A;  1MK4 A;  1PUA A;  4PSW A;  2PR8 A;  4J3G A;  4L8A A;  1YR0 A;  1Y7R A;  2F5I A;  4B5P A;  4RS2 A;  2CNT A;  4CRY B;  2J8R A;  1YRE A;  1XF8 A;  2FS5 A;  3DSB A;  2CY2 A;  2ZW6 A;  3SHP A;  3VWD A;  1KZF A;  1IB1 E;  3EXN A;  3QB8 A;  1N71 A;  3I9S A;  2IL4 A;  3TOA A;  1S7F A;  4XPD B;  2FCK A;  2FIA A;  4NSQ A;  4UA3 A;  4BMH A;  2WPW A;  1TIQ A;  2HQY A;  3TO7 A;  4L89 A;  4Y49 C;  1UFH A;  4QB9 A;  3ZZI A;  1BO4 A;  2ZPA A;  4H6U A;  4KOX A;  3TO6 A;  1MJA A;  4JXR A;  2B5G B;  4H6Z A;  4E2A A;  3F8K A;  2CNS A;  2VXK A;  1Z9U A;  3W91 A;  4KVX A;  4UWI A;  1SQH A;  1QST A;  2G3T A;  3D3S A;  4KLW A;  1IIC A;  1P4N A;  4R87 A;  3R95 A;  2ZW7 A;  1MJB A;  4RI1 A;  1GHE A;  3S6H A;  4OLL A;  3GYA A;  4FD6 A;  2I00 A;  4FD7 A;  3E0K A;  1KUX A;  3TFY A;  3DR8 A;  3FNC A;  1XE4 A;  4KOR A;  3QAH A;  4R57 A;  2P0W A;  5F46 A;  1V0C A;  4U9Z A;  3PGP A;  2VBQ A;  3S6G A;  4HNW B;  3TE4 A;  1IID A;  3DNS A;  4IUS A;  4MY0 A;  3D2M A;  5E96 A;  2K5T A;  5HH1 A;  3IGR A;  4OAE A;  2ATR A;  2REF A;  5GCN A;  4CAV A;  2P6E A;  4ONU A;  4CRZ B;  4F0Y A;  1QSM A;  1CJW A;  1QSO A;  4KLV A;  3FIX A;  4X5K A;  3LOD A;  4R3K A;  4KUA A;  4LX9 A;  4AG9 A;  4QVT A;  2O28 A;  5KTC A;  1BOB A;  4UWJ A;  5JQ4 A;  1NE9 A;  3DDD A;  3GY9 A;  1R57 A;  2QIR A;  3TTH A;  3SXN A;  2PDO A;  1K4J A;  2Z10 A;  2OZG A;  4DNC A;  2GE3 A;  3T90 A;  2JDC A;  3R9F A;  1S7L A;  1YVO A;  1PU9 A;  3TOB A;  4E8O A;  3T9Y A;  2R98 A;  5J8C A;  2REE A;  4KOW A;  1M4D A;  3W6S A;  3B8G A;  3S6K A;  2B4D B;  4UBR A;  3PZJ A;  2Q7B A;  5EC4 A;  4F6A A;  2AE6 A;  2HUZ A;  2ZXV A;  4KOT A;  2QML A;  5IB0 A;  4XNH C;  4H89 A;  3JVN A;  4KVM E;  3I3G A;  2GAN A;  3KKW A;  2Q44 A;  3N7Z A;  4I49 A;  1Z4R A;  4IF5 A;  2BEI A;  1S60 A;  3RYO A;  3LD2 A;  1OZP A;  1B87 A;  3FRM A;  3K9U A;  1FY7 A;  2B5G A;  3C26 A;  3DR6 A;  5C82 A;  2VI7 A;  4YRH A;  5JPH A;  1Q2D A;  3EC4 A;  1ON0 A;  4MI4 A;  5IX3 A;  3TT2 A;  4E0A A;  2FE7 A;  2FL4 A;  2P6F A;  1YK3 A;  4JLY A;  2R7H A;  1XIX A;  4XPL A;  3VWE A;  4R9M A;  3G8W A;  4XPK A;  4ZBG A;  2FIW A;  4JWP A;  2EUI A;  4AB7 A;  2DXQ A;  1B6B A;  3MGD A;  4ORF A;  2JLM A;  2NMT A;  2EVN A;  4HKF A;  2ARH A;  4YFJ A;  2J8N A;  2CNM A;  4AG7 A;  3TCV A;  5F49 A;  5DWN A;  2JDD A;  4II9 A;  1XMT A;  3FXT A;  2B3U A;  4R3L A;  4AVC A;  3H4Q A;  2A4N A;  3EFA A;  1M1D A;  4PV6 A;  2P6G A;  2PR1 A;  2BUE A;  4U5Y A;  5C88 A;  4U9Y A;  4KOV A;  1YX0 A;  1YGH A;  4PSX A;  3ZJ0 A;  2HV2 A;  1RO5 A;  3R9E A;  4AVA A;  2PRB A;  3F0A A;  2Q4Y A;  5H86 A;  4HNY B;  1QSR A;  4MHD A;  1Z4E A;  4MJ8 A;  2B4D A;  4K30 A;  4EVY A;  3GKR A;  3EY5 A;  4NCZ A;  3FYN A;  2G3A A;  1S7K A;  4HNX B;  2D4P A;  1WWZ A;  1Q2Y A;  2R8V A;  2OH1 A;  4FD4 A;  3W6X A;  4QUS A;  3BJ7 A;  3EO4 A;  3D8P A;  5FVJ A;  1I21 A;  2AJ6 A;  1XEB A;  5CNP A;  2OZH A;  2Z0Z A;  1P0H A;  5F47 A;  1VKC A;  1NMT A;  2Y0M A;  2WPX A;  1NSL A;  5H84 A;  1I1D A;  4Y49 B;  4B5P B;  1IYL A;  4OAD A;  2RC4 A;  4NEX A;  1KUY A;  1U6M A;  3FBU A;  3S6F A;  4PK2 A;  4GS4 A;  4YGO A;  2Q0Y A;  1KUV A;  1QSN A;  2PQ8 A;  4CAX A;  1I12 A;  3BLN A;  2B3V A;  2JEV A;  4KOS A;  3IWG A;  3D2P A;  3FB3 A;  2OZU A;  2VEZ A;  2KCW A;  1M4G A;  4XPD C;  2FT0 A;  4AVB A;  1WK4 A;  4CS0 B;  2Q04 A;  1MJ9 A;  1Q2C A; 
#chains in the Genus database with same CATH topology
 3JUW A;  5KTD A;  2PSW A;  4MY3 A;  5DWM A;  3R1K A;  1S7N A;  4P44 A;  4OIW A;  1LRZ A;  2PCU A;  4MBU A;  5IV0 A;  3CXS A;  4P4I A;  5K8P A;  1VHS A;  5HMN A;  4A39 A;  1XBU A;  3P2F A;  3IEH A;  3RO0 A;  4FAI A;  1ZO0 A;  5LRG A;  1Y9K A;  4CYP A;  2R1I A;  3D4U A;  4CAW A;  2FSR A;  5I0C A;  1HEE A;  1FNO A;  3FJU A;  2BL1 A;  2Z3O A;  3CXQ A;  3NH8 A;  4QBJ A;  2Q4V A;  1S5K A;  1X12 A;  3CPX A;  3PRT A;  3NE7 A;  4MFL A;  5KTA A;  1L0C A;  4KVO E;  5EBV A;  1LFW A;  1ZG9 A;  4OC5 A;  3B3W A;  4ZX8 A;  4CGO A;  1LCP A;  2Q51 A;  3SXO A;  1M4I A;  2X7B A;  2Z11 A;  3B3V A;  4BD9 A;  1Q7L A;  2BSW A;  2ZW4 A;  2ZOG A;  2OU2 A;  4NXY A;  5D8N A;  1CM0 A;  2D4O A;  4NFR A;  4P4B A;  4MHZ A;  1M44 A;  4P6Y A;  3KAS A;  4A2Z A;  3BJ8 A;  2I79 A;  3S9N A;  4P4J A;  2AFW A;  4ZGY B;  4QC6 A;  1IOI A;  2VZY A;  2VQY A;  3F5B A;  2ZW5 A;  1VHE A;  1YVK A;  2FXF A;  4KZT A;  3SJF A;  1Y9W A;  4JJX A;  2V77 A;  1IYK A;  2G0B A;  2C27 A;  3R9G A;  4B5O A;  4UFX A;  2GIV A;  3UY5 A;  4LUA A;  4W9Y A;  1CX8 A;  4KUB A;  4UEZ A;  4NF1 A;  5J8F A;  3P2H A;  3SJE A;  3WC5 A;  3TO9 A;  4KOY A;  2ZEG A;  1XMB A;  5F48 A;  1S3Z A;  2QEC A;  3IC1 A;  4FD5 A;  1RXT A;  3CXP A;  1Z8L A;  3OWC A;  3WR7 A;  3FH4 A;  4KOU A;  2VZZ A;  2J8M A;  4JXQ A;  4M85 A;  2H5M A;  4JD6 A;  1AMP A;  2YNE A;  4PXB A;  1ELL P;  4PXC A;  4PK3 A;  3R96 A;  5I4M A;  3GB0 A;  5HVH A;  4XNH B;  4LQ6 A;  3PP9 A;  1YLE A;  2WSA A;  2B4B A;  1J4J A;  3G3S A;  1ZG7 A;  5HVF A;  2OB0 A;  4C68 A;  3V8I A;  2CTC A;  4C7I A;  2PC1 A;  1BPN A;  4M3S A;  2B58 A;  3PEI A;  1MK4 A;  5ISV A;  1PUA A;  2BCO A;  1XJO A;  4PSW A;  1TXR A;  2PR8 A;  1VIX A;  4J3G A;  4L8A A;  1YR0 A;  1Y7R A;  2F5I A;  4B5P A;  4RS2 A;  2CNT A;  1RTQ A;  4CRY B;  2J8R A;  2IJZ A;  4R8F A;  1ELM P;  1YRE A;  3PB9 X;  2V8V A;  5K8N A;  2Z3K A;  3D7G A;  4CGN A;  1JWQ A;  1XF8 A;  5AG7 A;  2FS5 A;  2Z3M A;  4EWT A;  2V8G A;  5KTC A;  3DSB A;  3I1U A;  4RUH A;  4MFZ A;  2CY2 A;  5G20 A;  4NGS A;  1IOF A;  2ZW6 A;  3BXM A;  4TNU A;  2CXA A;  4IK2 A;  3GLJ A;  2RB7 A;  4KSF A;  3MN8 A;  2BOA A;  3WC7 A;  2OR4 A;  2PJA A;  5AGE A;  3SHP A;  4F9V A;  3VWD A;  1VHO A;  1F2P A;  1KZF A;  4F0X A;  1IB1 E;  3L2N A;  3EXN A;  2C6G A;  1DE4 C;  3QB8 A;  1N71 A;  3I9S A;  2IL4 A;  3TOA A;  1QMU A;  4NGP A;  4EME A;  2WUU A;  3PB4 X;  2ODF A;  2ZEL A;  1S7F A;  2DF5 A;  4XPD B;  2YGW A;  4A37 A;  1OBR A;  4NJQ A;  2FCK A;  2FIA A;  4IHM A;  4NSQ A;  1CP6 A;  4UA3 A;  4BMH A;  2WPW A;  1TIQ A;  4CGP A;  2ZEP A;  2HQY A;  3LWU A;  4DYO A;  1F57 A;  3TO7 A;  1KWM A;  1Z8X A;  2AFO A;  3LAC A;  2I3C A;  1TKF A;  4L89 A;  1UFH A;  4QB9 A;  4Y49 C;  4UIA A;  1BO4 A;  2WZN A;  2ZPA A;  1BAV A;  3NH5 A;  1CPS A;  1Z2L A;  5D29 A;  2JBK A;  4A32 A;  4H6U A;  4C2Y A;  4CYO A;  4KOX A;  2NYQ A;  2EBJ A;  3TO6 A;  4OC0 A;  4O23 A;  2FVG A;  1MJA A;  3IU2 A;  3PFE A;  4JXR A;  2B5G B;  3NH4 A;  4H6Z A;  4X3R A;  4E2A A;  3D67 A;  2CNS A;  3F8K A;  4MFK A;  5CPA A;  2VXK A;  3D66 A;  1Z9U A;  3NFZ A;  3RNZ A;  3W91 A;  4KVX A;  4UWI A;  1SQH A;  1QST A;  2XEG A;  2POK A;  2ZEH A;  1YLO A;  4Q36 A;  2G3T A;  4P4E A;  3D3S A;  4ZY0 A;  2Q7S A;  4KLW A;  1XFO A;  1IIC A;  1P4N A;  4R87 A;  3R95 A;  2ZW7 A;  1MJB A;  4NGQ A;  3HUV A;  5ELY A;  2ZEE A;  4RI1 A;  1GHE A;  3S6H A;  4OLL A;  2O4H A;  5LRK A;  1IY7 A;  3CZX A;  3GYA A;  3FED A;  4FD6 A;  2I00 A;  4P4F A;  3WAB A;  4FD7 A;  4A94 A;  3E0K A;  2PIY A;  1KUX A;  4MHP A;  3TFY A;  1FT7 A;  1TKJ A;  3DR8 A;  3FNC A;  1XE4 A;  4KOR A;  1Y0R A;  5HXD A;  3QAH A;  4R57 A;  2YNC A;  1YME A;  2P0W A;  5F46 A;  1V0C A;  2XEJ A;  5HVG A;  4U9Z A;  3PGP A;  2VBQ A;  4KSI A;  3S6G A;  1YW6 A;  4HNW B;  1IID A;  3DNS A;  4IUS A;  4MY0 A;  5CBM A;  3TE4 A;  4MCS A;  1A2Z A;  1BLL E;  1QQ9 A;  3D2M A;  5K8O A;  1HDQ A;  3KGQ A;  5E96 A;  2K5T A;  5HH1 A;  4C7H A;  4F8Z A;  3IGR A;  4A95 A;  3SI1 A;  4OAE A;  4DJL A;  2ATR A;  2REF A;  3JTK A;  5GCN A;  4CAV A;  2IQ6 A;  2P6E A;  4ONU A;  4CRZ B;  3GIU A;  4F0Y A;  1QSM A;  1CJW A;  4MFJ A;  1PYT B;  1QSO A;  1TF8 A;  3DLJ A;  4KLV A;  3KQZ A;  3KR4 A;  2WYR A;  3FIX A;  4X5K A;  3LOD A;  2GFQ A;  2GLJ A;  5JM6 A;  1YQE A;  4R3K A;  2VL1 A;  4KUA A;  1TF9 A;  4KSA A;  4LX9 A;  4UCN A;  4AG9 A;  4QVT A;  2O28 A;  2GRE A;  3PBB A;  1VGY A;  1BPM A;  1BOB A;  2PJ8 A;  3CDX A;  4UWJ A;  3PB8 X;  1Z8T A;  4B12 A;  5JQ4 A;  3KZW A;  3TC8 A;  3B3T A;  5J1Q A;  4ZY1 A;  1NE9 A;  3DDD A;  1AUG A;  1YW4 A;  3GY9 A;  1Z8W A;  2HC9 A;  1R57 A;  2QIR A;  2PIZ A;  4A30 A;  5A28 A;  4JZ0 A;  3TTH A;  3IU1 A;  3SXN A;  2PDO A;  2PJ7 A;  2ZEF A;  3IWW A;  1K4J A;  2OZG A;  2Z10 A;  2AFM A;  4DNC A;  3KHZ A;  2V8H A;  2F7V A;  2YNC C;  2GE3 A;  3T90 A;  2JDC A;  4M6G A;  3R9F A;  1S7L A;  3D7D A;  1YVO A;  3BI0 A;  3KI9 A;  1PU9 A;  2PJ1 A;  3TOB A;  4FWU A;  4E8O A;  1LAP A;  3FVL A;  4PXE A;  3T9Y A;  2R98 A;  3SI2 A;  3ISZ A;  3H8E A;  4MCQ A;  4OC2 A;  5J8C A;  5JH9 A;  2GLF A;  2REE A;  3B35 A;  3IFE A;  4KOW A;  4A38 A;  1M4D A;  3W6S A;  3B8G A;  3RBU A;  2B4D B;  4UBR A;  3S6K A;  3PZJ A;  2Q7B A;  5EC4 A;  3S9M A;  4F6A A;  2AE6 A;  2PJ3 A;  2HUZ A;  2ZXV A;  3KQX A;  4KOT A;  4YWY A;  2QML A;  2DEA A;  4MHN A;  2ZED A;  5IB0 A;  3NA6 A;  4XNH C;  4G1P A;  4H89 A;  3JVN A;  4KVM E;  4TWE A;  3I3G A;  4WJB A;  4IAV A;  1YSJ A;  3B3S A;  2GAN A;  3KKW A;  4PPZ A;  3B7I A;  3T8W A;  4C2Z A;  2Q44 A;  4B11 A;  4OC4 A;  5G1Z A;  3N7Z A;  3A9L A;  1Z4R A;  4I49 A;  4IF5 A;  2ABZ A;  4WWV A;  1Y7E A;  2GU2 A;  4UCM A;  4MXU A;  4ZX9 A;  3SJX A;  3PB6 X;  4AXV A;  2BEI A;  4NGT A;  3D68 A;  2BO9 A;  4MFP A;  4UCP A;  4EFD A;  4UIB A;  1S60 A;  3RYO A;  3VH9 A;  2AFS A;  3LD2 A;  1OZP A;  1B87 A;  3FRM A;  3K9U A;  1FY7 A;  2B5G A;  3C26 A;  3DGV A;  4NGM A;  3PB7 X;  3DR6 A;  5C82 A;  2C6C A;  1M4L A;  2VI7 A;  4MFQ A;  4YU9 A;  4B10 A;  2EK8 A;  2PJC A;  5LRJ A;  3ISX A;  4OID A;  3HLP A;  1IGB A;  3K2K A;  4P4D A;  4YRH A;  5G21 A;  5JPH A;  2PJ2 A;  8CPA A;  3IWE A;  1ZLI A;  1ARM A;  1Q2D A;  2PJ6 A;  3EC4 A;  4H2K A;  4ZY2 A;  5K8M A;  1ON0 A;  3CT9 A;  2CF4 A;  2JEW A;  4MI4 A;  3H8G A;  4BBH A;  5IX3 A;  3TT2 A;  5LYF A;  2J9A A;  3FF3 A;  5AG5 A;  2FE7 A;  4E0A A;  2Q4Z A;  2FL4 A;  2P6F A;  2QJ8 A;  3FEE A;  1YK3 A;  3KL9 A;  4Q38 A;  1IU8 A;  3PBE A;  3VAR A;  4JLY A;  2EO8 A;  2R7H A;  1XIX A;  4XPL A;  3V38 A;  3VWE A;  3B2Y A;  1XOV A;  2PJB A;  4LQG A;  4R9M A;  1DTD A;  3G8W A;  1H8L A;  2JBJ A;  2AFZ A;  4UEF A;  4XPK A;  4BIN A;  4ZBG A;  2FIW A;  4JWP A;  1ZG8 A;  3N5F A;  4B14 A;  6CPA A;  1CBX A;  2EUI A;  3FEC A;  4AB7 A;  2DXQ A;  3LMS A;  3JRU A;  5LYD A;  1B6B A;  3MGD A;  4ORF A;  5DS0 A;  2JLM A;  5EMI A;  5AG4 A;  4FBE A;  2RFH A;  3B3C A;  2NMT A;  2EVN A;  4HKF A;  2ARH A;  2PVW A;  4YFJ A;  4F9U A;  3VAT A;  2J8N A;  2CNM A;  2CTB A;  2DPS A;  2QVP A;  3TCV A;  4AG7 A;  5F49 A;  5DWN A;  3QAY A;  3D7F A;  1Y0Y A;  2PE3 A;  2JDD A;  4II9 A;  1XMT A;  3FXT A;  2B3U A;  4HPS A;  3K9T A;  4R3L A;  3D7H A;  4MCR A;  4AVC A;  1CP7 A;  2QYV A;  4OP4 A;  2ANP A;  2F8H A;  2ZEO A;  1CPX A;  1R43 A;  1HDU A;  3H4Q A;  4FUU A;  2A4N A;  4OKO A;  3EFA A;  2PVV A;  1JQG A;  4B13 A;  1LOK A;  1M1D A;  4PV6 A;  2P6G A;  2PR1 A;  2BUE A;  4U5Y A;  3NE8 A;  2Z3P A;  4C2X A;  4ZI6 A;  4U9Y A;  4KOV A;  3SJG A;  5C88 A;  4PQA A;  1YX0 A;  4OC1 A;  4Q7A A;  1YGH A;  4PSX A;  3ZJ0 A;  2HV2 A;  4KS9 A;  1RO5 A;  2O53 A;  3R9E A;  4GM5 A;  4AVA A;  2PRB A;  1PCA A;  3F0A A;  1ARL A;  2Q4Y A;  3PFO A;  1LAN A;  5H86 A;  7CPA A;  1EE3 P;  4R76 A;  2CIJ A;  4HNY B;  1QSR A;  4MHD A;  1XRY A;  1Z4E A;  4MJ8 A;  2PJ0 A;  2ZEN A;  4CAF A;  2B4D A;  2XEI A;  4Z65 A;  3QNV A;  4K30 A;  4EVY A;  4MMO A;  4CGL A;  3GKR A;  3MRU A;  3RAM A;  3EY5 A;  5F09 A;  4NCZ A;  3FYN A;  2EK9 A;  4UFV A;  2G3A A;  2PJ5 A;  3SI0 A;  1S7K A;  4HNX B;  3FMC A;  4UFW A;  2DPT A;  2D4P A;  1Z5R A;  3BI1 A;  4UEE A;  1WWZ A;  1Q2Y A;  2R8V A;  5IB9 A;  2OH1 A;  4NGN A;  3IJ3 A;  4FD4 A;  3W6X A;  4X2T A;  3KHX A;  4QUS A;  3S9L A;  3BJ7 A;  3EO4 A;  4M6H A;  2Z3L A;  4CAE A;  3D8P A;  2HB6 A;  2PJ9 A;  5FVJ A;  1I21 A;  2AJ6 A;  1XEB A;  3IO1 A;  5CNP A;  4OME A;  4R6T A;  2OZH A;  5LYL A;  2Z0Z A;  3ZZI A;  1P0H A;  5F47 A;  1VKC A;  4P45 A;  2AFX A;  3V7Z A;  4X8I A;  2ZOF A;  3CPA A;  3WC6 A;  1NMT A;  2Y0M A;  5BWA B;  2XEF A;  2WPX A;  2PRQ A;  3TX8 A;  1NSL A;  1CG2 A;  5H84 A;  3GUX A;  1I1D A;  4Y49 B;  4JYW A;  2V8D A;  4B6Z A;  2Q43 A;  4B5P B;  5G22 A;  1IYL A;  3RZA A;  1X10 A;  4R7M A;  4MCP A;  3H5Z A;  5A27 A;  2EWB A;  4GXH A;  4OAD A;  2RC4 A;  4NEX A;  4M6I A;  4OC3 A;  1KUY A;  1U6M A;  3BHX A;  3FBU A;  4ONW A;  3S6F A;  2C6P A;  4PK2 A;  4GS4 A;  3WT4 A;  2G9D A;  4YGO A;  2Q0Y A;  1KUV A;  1QSN A;  2PJ4 A;  2PQ8 A;  1I12 A;  4K3N A;  4CAX A;  4CGM A;  4P10 A;  2NSM A;  4NGR A;  4ZYQ A;  3BLN A;  2B3V A;  2JEV A;  1TKH A;  4KOS A;  2IMO A;  3FX6 A;  4A31 A;  3IIB A;  2C1C A;  4CPA A;  3KR5 A;  3IWG A;  4DUK A;  3D2P A;  3H8F A;  3FB3 A;  4MRI A;  1F2O A;  2OZU A;  5JGF A;  2ZEM A;  4NJR A;  2VEZ A;  4UF4 A;  2KCW A;  1GYT A;  1M4G A;  1ZLH A;  4A33 A;  2YND A;  2Z3N A;  4XPD C;  2FT0 A;  4MHY A;  5THW A;  4PXD A;  4AVB A;  1UWY A;  2AFU A;  4CYQ A;  1NSA A;  4CYN A;  2OOT A;  1WK4 A;  5LYI A;  4CS0 B;  5AG6 A;  1AYE A;  4RN7 A;  1R3N A;  2Q04 A;  1LAM A;  1MJ9 A;  1Q2C A; 
#chains in the Genus database with same CATH homology
 3JUW A;  5KTD A;  2PSW A;  4MY3 A;  5DWM A;  3R1K A;  1S7N A;  1LRZ A;  4MBU A;  5IV0 A;  3CXS A;  1VHS A;  5HMN A;  3P2F A;  1ZO0 A;  1Y9K A;  4CYP A;  2R1I A;  4CAW A;  2FSR A;  5I0C A;  2BL1 A;  2Z3O A;  3CXQ A;  4QBJ A;  2Q4V A;  1S5K A;  3NE7 A;  4MFL A;  5KTA A;  1L0C A;  4KVO E;  5EBV A;  4CGO A;  3SXO A;  1M4I A;  2X7B A;  2Z11 A;  2BSW A;  2ZW4 A;  4NXY A;  2OU2 A;  1CM0 A;  2D4O A;  1M44 A;  4A2Z A;  3BJ8 A;  2I79 A;  4ZGY B;  4QC6 A;  2VZY A;  2VQY A;  3F5B A;  2ZW5 A;  1YVK A;  2FXF A;  4KZT A;  1Y9W A;  4JJX A;  1IYK A;  2G0B A;  2C27 A;  3R9G A;  4B5O A;  4UFX A;  2GIV A;  3UY5 A;  4LUA A;  4KUB A;  5J8F A;  4NF1 A;  3P2H A;  3TO9 A;  4KOY A;  5F48 A;  1S3Z A;  2QEC A;  4FD5 A;  1RXT A;  3CXP A;  3OWC A;  3WR7 A;  4KOU A;  2VZZ A;  2J8M A;  4JXQ A;  4M85 A;  2H5M A;  4JD6 A;  2YNE A;  4PK3 A;  3R96 A;  4XNH B;  3PP9 A;  1YLE A;  2WSA A;  2B4B A;  1J4J A;  3G3S A;  2OB0 A;  4C68 A;  3V8I A;  4C7I A;  2PC1 A;  4M3S A;  2B58 A;  5ISV A;  1MK4 A;  1PUA A;  4PSW A;  2PR8 A;  4J3G A;  4L8A A;  1YR0 A;  1Y7R A;  2F5I A;  4B5P A;  4RS2 A;  2CNT A;  4CRY B;  2J8R A;  1YRE A;  2Z3K A;  4CGN A;  1XF8 A;  5AG7 A;  2FS5 A;  2Z3M A;  3DSB A;  4MFZ A;  2CY2 A;  5G20 A;  2ZW6 A;  2CXA A;  4KSF A;  5AGE A;  3SHP A;  3VWD A;  1KZF A;  4F0X A;  1IB1 E;  3EXN A;  3QB8 A;  1N71 A;  3I9S A;  2IL4 A;  3TOA A;  2WUU A;  1S7F A;  4XPD B;  2YGW A;  2FCK A;  2FIA A;  4NSQ A;  4UA3 A;  4BMH A;  2WPW A;  1TIQ A;  4CGP A;  2HQY A;  3TO7 A;  4L89 A;  4Y49 C;  1UFH A;  4QB9 A;  3ZZI A;  1BO4 A;  2ZPA A;  4C2Y A;  4A32 A;  4CYO A;  4H6U A;  4KOX A;  3TO6 A;  1MJA A;  3IU2 A;  4JXR A;  2B5G B;  4H6Z A;  4E2A A;  3F8K A;  2CNS A;  4MFK A;  2VXK A;  1Z9U A;  3W91 A;  4KVX A;  4UWI A;  1SQH A;  1QST A;  4Q36 A;  2G3T A;  3D3S A;  4KLW A;  1IIC A;  1P4N A;  4R87 A;  3R95 A;  2ZW7 A;  1MJB A;  4RI1 A;  1GHE A;  3S6H A;  4OLL A;  3GYA A;  4FD6 A;  2I00 A;  4FD7 A;  3E0K A;  1KUX A;  3TFY A;  3DR8 A;  3FNC A;  1XE4 A;  4KOR A;  3QAH A;  4R57 A;  2YNC A;  2P0W A;  5F46 A;  1V0C A;  4U9Z A;  3PGP A;  2VBQ A;  3S6G A;  4HNW B;  3TE4 A;  1IID A;  3DNS A;  4IUS A;  4MY0 A;  3D2M A;  5E96 A;  2K5T A;  5HH1 A;  4C7H A;  3IGR A;  4A95 A;  4OAE A;  2ATR A;  2REF A;  3JTK A;  5GCN A;  4CAV A;  2P6E A;  4ONU A;  4CRZ B;  4F0Y A;  1QSM A;  1CJW A;  4MFJ A;  1QSO A;  4KLV A;  3FIX A;  4X5K A;  3LOD A;  4R3K A;  4KUA A;  4KSA A;  4LX9 A;  4UCN A;  4AG9 A;  4QVT A;  2O28 A;  5KTC A;  1BOB A;  4B12 A;  4UWJ A;  5JQ4 A;  1NE9 A;  3DDD A;  3GY9 A;  1R57 A;  2QIR A;  5A28 A;  4A30 A;  3TTH A;  3IU1 A;  3SXN A;  2PDO A;  1K4J A;  2Z10 A;  2OZG A;  4DNC A;  2YNC C;  2GE3 A;  3T90 A;  2JDC A;  3R9F A;  1S7L A;  1YVO A;  1PU9 A;  3TOB A;  4E8O A;  3T9Y A;  2R98 A;  5J8C A;  2REE A;  4KOW A;  1M4D A;  3W6S A;  3B8G A;  3S6K A;  2B4D B;  4UBR A;  3PZJ A;  2Q7B A;  5EC4 A;  4F6A A;  2AE6 A;  2HUZ A;  2ZXV A;  4KOT A;  2QML A;  5IB0 A;  4XNH C;  4H89 A;  3JVN A;  4KVM E;  3I3G A;  2GAN A;  3KKW A;  4C2Z A;  2Q44 A;  4B11 A;  5G1Z A;  3N7Z A;  3A9L A;  1Z4R A;  4I49 A;  4IF5 A;  4UCM A;  2BEI A;  4UCP A;  4MFP A;  1S60 A;  3RYO A;  3LD2 A;  1OZP A;  1B87 A;  3FRM A;  3K9U A;  1FY7 A;  2B5G A;  3C26 A;  3DR6 A;  5C82 A;  2VI7 A;  4MFQ A;  4B10 A;  4YRH A;  5G21 A;  5JPH A;  3IWE A;  1Q2D A;  3EC4 A;  1ON0 A;  4MI4 A;  4BBH A;  5IX3 A;  3TT2 A;  4E0A A;  5AG5 A;  2FE7 A;  2FL4 A;  2P6F A;  1YK3 A;  4Q38 A;  4JLY A;  2R7H A;  1XIX A;  4XPL A;  3VWE A;  4R9M A;  3G8W A;  4XPK A;  4ZBG A;  2FIW A;  4JWP A;  4B14 A;  2EUI A;  4AB7 A;  2DXQ A;  1B6B A;  3MGD A;  4ORF A;  2JLM A;  5AG4 A;  2NMT A;  2EVN A;  4HKF A;  2ARH A;  4YFJ A;  2J8N A;  2CNM A;  2DPS A;  4AG7 A;  3TCV A;  5F49 A;  5DWN A;  2JDD A;  4II9 A;  1XMT A;  3FXT A;  2B3U A;  4R3L A;  4AVC A;  3H4Q A;  2A4N A;  3EFA A;  4B13 A;  1M1D A;  4PV6 A;  2P6G A;  2PR1 A;  2BUE A;  4U5Y A;  2Z3P A;  4C2X A;  5C88 A;  4U9Y A;  4KOV A;  1YX0 A;  1YGH A;  4PSX A;  3ZJ0 A;  2HV2 A;  4KS9 A;  1RO5 A;  3R9E A;  4AVA A;  2PRB A;  3F0A A;  2Q4Y A;  5H86 A;  4HNY B;  1QSR A;  4MHD A;  1Z4E A;  4MJ8 A;  4CAF A;  2B4D A;  4K30 A;  4EVY A;  4CGL A;  3GKR A;  3EY5 A;  4NCZ A;  3FYN A;  4UFV A;  2G3A A;  1S7K A;  4HNX B;  4UFW A;  2DPT A;  2D4P A;  1WWZ A;  1Q2Y A;  2R8V A;  2OH1 A;  4FD4 A;  3W6X A;  4QUS A;  3BJ7 A;  3EO4 A;  2Z3L A;  4CAE A;  3D8P A;  5FVJ A;  1I21 A;  2AJ6 A;  1XEB A;  5CNP A;  2OZH A;  2Z0Z A;  1P0H A;  5F47 A;  1VKC A;  1NMT A;  2Y0M A;  5BWA B;  2WPX A;  1NSL A;  5H84 A;  1I1D A;  4Y49 B;  4B5P B;  5G22 A;  1IYL A;  3H5Z A;  5A27 A;  4OAD A;  2RC4 A;  4NEX A;  1KUY A;  1U6M A;  3FBU A;  3S6F A;  4PK2 A;  4GS4 A;  4YGO A;  2Q0Y A;  1KUV A;  1QSN A;  2PQ8 A;  4CAX A;  1I12 A;  4CGM A;  3BLN A;  2B3V A;  2JEV A;  4KOS A;  4A31 A;  3IWG A;  3D2P A;  3FB3 A;  2OZU A;  2VEZ A;  2KCW A;  1M4G A;  4A33 A;  2YND A;  2Z3N A;  4XPD C;  2FT0 A;  4AVB A;  4CYQ A;  4CYN A;  1WK4 A;  4CS0 B;  5AG6 A;  2Q04 A;  1MJ9 A;  1Q2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...