4R57A

Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with acetyl-coa
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
170
structure length
170
Chain Sequence
NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Spermidine n1-acetyltransferase
publication title A Novel Polyamine Allosteric Site of SpeG from Vibrio cholerae Is Revealed by Its Dodecameric Structure.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
total genus 53
structure length 170
sequence length 170
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2014-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4r57A00
1S5KA 2VZZA 1NE9A 3R96A 4KUAA 3BJ7A 2Z11A 1MJ9A 4HNWB 4PV6A 5F47A 3SXOA 2GE3A 3T90A 5JPHA 4JD6A 1Z4RA 4CAWA 2JLMA 4CAVA 1XE4A 2VI7A 3SHPA 2FSRA 2VZYA 3TT2A 1M44A 3EXNA 2ZXVA 3G8WA 3DR6A 4U5YA 4XPDB 4KOTA 1KZFA 1YLEA 4NXYA 4KLVA 5IB0A 3B8GA 1Z4EA 2OZUA 5ISVA 3R1KA 3KKWA 4PSXA 4XPKA 4B5PA 1BO4A 3CXQA 2B58A 1QSOA 1XEBA 2ARHA 4MY0A 1Y9WA 2QECA 1SQHA 1I12A 2P6FA 4NCZA 3CXPA 3CXSA 4Y49B 4YFJA 4FD5A 1GHEA 5FVJA 3S6HA 5HMNA 4JWPA 1Q2CA 1I21A 4H89A 4K30A 2WPWA 1QSMA 4JLYA 4QVTA 3I9SA 2ZPAA 3TO9A 4XNHB 3P2HA 2BUEA 1S7NA 1PU9A 2FL4A 4PK2A 4KOVA 2PR8A 2OZHA 2OZGA 2A4NA 2CNSA 3S6FA 2ATRA 2ZW4A 2VBQA 4J3GA 4ORFA 3QB8A 3TCVA 3TE4A 3VWEA 2J8NA 1YX0A 2PQ8A 1LRZA 2FCKA 3PGPA 1OZPA 5E96A 1IYLA 3BLNA 4R87A 1IICA 1M4IA 5F49A 5H86A 1YVKA 4KUBA 2R8VA 1YR0A 4QBJA 4M3SA 1M4GA 3F8KA 2CNTA 4FD7A 3C26A 4BMHA 4QB9A 2EUIA 1ON0A 2P6GA 4MJ8A 2J8MA 1P0HA 4X5KA 3EO4A 4U9YA 5KTCA 1B87A 4AG9A 4FD4A 2R98A 2O28A 5C82A 1MJBA 4KOWA 5KTAA 4KLWA 1TIQA 5KTDA 2JDDA 2VQYA 1QSRA 1IB1E 4KOXA 5CNPA 4H6UA 4MY3A 1IYKA 2I79A 3FYNA 1S7LA 3F5BA 5DWNA 4QC6A 2DXQA 4KOYA 1QSTA 4KZTA 3OWCA 3FRMA 3TO6A 2OH1A 3EC4A 1S3ZA 1S7KA 3V8IA 1WK4A 2FXFA 1Z9UA 2B5GA 1M4DA 4DNCA 2KCWA 4R57A 4AG7A 3TOAA 2X7BA 3EY5A 4HKFA 1VHSA 5IX3A 3R9EA 4OLLA 1KUYA 4M85A 1KUXA 4AB7A 4R9MA 1S7FA 1KUVA 4RS2A 5I0CA 1XIXA 2Q44A 2FT0A 2PSWA 2J8RA 3PZJA 2FE7A 1P4NA 3DR8A 1M1DA 4E8OA 4AVBA 4YRHA 3MGDA 4B5OA 4FD6A 3TFYA 1XMTA 4KOSA 1QSNA 2OU2A 2REFA 4QUSA 3I3GA 5HH1A 1Q2YA 3D3SA 2Q4VA 3TOBA 2Z0ZA 2G0BA 1RXTA 1YK3A 4MBUA 4ZBGA 2P6EA 4Y49C 4ONUA 3D8PA 2QMLA 3LD2A 2ZW5A 1N71A 3JUWA 3FXTA 4H6ZA 4L89A 2WPXA 3R9FA 3D2PA 3NE7A 4B5PB 4PSWA 2Q4YA 4KVOE 2ZW7A 1J4JA 4AVAA 3JVNA 2Z10A 2ZW6A 4MHDA 3S6GA 4NF1A 4OADA 2Q0YA 3W91A 1B6BA 3F0AA 3D2MA 3SXNA 1XF8A 2JEVA 1CJWA 4HNYB 1YREA 2B4BA 2P0WA 1Y9KA 4I49A 4IUSA 1CM0A 4KVME 2GANA 4KOUA 2G3TA 3RYOA 2FIAA 4UBRA 5GCNA 4II9A 2QIRA 5F48A 2CNMA 2REEA 3WR7A 4OAEA 4CS0B 2D4PA 4CRYB 2R7HA 1BOBA 3UY5A 3FIXA 4L8AA 4KORA 3VWDA 2B3VA 5H84A 4EVYA 2PDOA 5DWMA 5F46A 5J8FA 5C88A 1NSLA 4CAXA 3DSBA 4JJXA 2AJ6A 2RC4A 3LODA 3W6XA 2FIWA 1MK4A 2Q04A 3GKRA 1UFHA 3FBUA 2AE6A 3S6KA 2HQYA 1VKCA 3GYAA 3N7ZA 4KVXA 3PP9A 4E2AA 4XPLA 3FB3A 2B4DA 2C27A 2IL4A 4U9ZA 4XPDC 2H5MA 4UA3A 3W6SA 3R95A 3IGRA 4RI1A 2VXKA 4E0AA 1MJAA 1R57A 4IF5A 1FY7A 2G3AA 4UWIA 5J8CA 3FNCA 2PC1A 4LX9A 4YGOA 4JXQA 3BJ8A 4GS4A 1K4JA 2VEZA 5JQ4A 3P2FA 3GY9A 3QAHA 2F5IA 2HV2A 2B5GB 4LUAA 2JDCA 4R3LA 1NMTA 3EFAA 1WWZA 3DDDA 4F6AA 2B3UA 2BSWA 4XNHC 1PUAA 2PR1A 4R3KA 2HUZA 1Q2DA 2D4OA 4NSQA 3TTHA 4PK3A 3ZZIA 3E0KA 4F0YA 3R9GA 4MI4A 1U6MA 3H4QA 4HNXB 1L0CA 2Y0MA 2NMTA 2BL1A 3G3SA 1S60A 3IWGA 2PRBA 2GIVA 3DNSA 2CY2A 2I00A 3ZJ0A 2B4DB 4JXRA 5IV0A 4UWJA 1YGHA 5EC4A 4CRZB 1V0CA 1YVOA 1RO5A 2FS5A 3K9UA 1I1DA 1Y7RA 5EBVA 2Q7BA 2OB0A 4AVCA 1IIDA 4NEXA 2K5TA 3TO7A 2BEIA 3T9YA 2EVNA 2R1IA
chains in the Genus database with same CATH superfamily
4MCRA 4OC3A 1S5KA 3DGVA 2VZZA 3D68A 3D7DA 1NE9A 4JYWA 4A38A 3R96A 4KUAA 3I1UA 3BJ7A 2Z11A 1MJ9A 4HNWB 4PV6A 4UF4A 5F47A 2IMOA 2PIYA 4W9YA 3SXOA 2AFWA 2GE3A 3T90A 2PJ4A 5JPHA 4ONWA 3B3VA 4JD6A 1Z4RA 4MCSA 4C7IA 1Z5RA 4CAWA 2JLMA 5DS0A 4CAVA 2YNEA 4BBHA 1XE4A 2VI7A 3SHPA 2BO9A 2FSRA 2VZYA 3TT2A 4K3NA 4NGNA 3S9NA 2IQ6A 1M44A 3GIUA 3EXNA 2ZXVA 3G8WA 3DR6A 4U5YA 4P4JA 4XPDB 4G1PA 3IWWA 4KOTA 5F09A 1KZFA 1YLEA 4NXYA 4KLVA 4LQGA 5IB0A 3B8GA 1TF8A 1TKHA 4OIWA 5D29A 1Z4EA 1RTQA 2OZUA 1TXRA 3R1KA 5ISVA 4UEFA 3KKWA 4PSXA 4XPKA 3PBBA 4OKOA 4B5PA 2AFSA 1BO4A 3CXQA 2B58A 1QSOA 3NE8A 3WT4A 1IOFA 2PJAA 2ZEPA 1XEBA 3IU1A 3JTKA 2ARHA 4MY0A 2Q4ZA 1Y9WA 2QECA 1SQHA 1I12A 2P6FA 2WUUA 3DLJA 4IK2A 3CXPA 4NCZA 3CXSA 3FX6A 4OC5A 2GU2A 4Y49B 4YFJA 2YGWA 4NJRA 5HVFA 3FEDA 1Y7EA 4FD5A 1GHEA 3V38A 5FVJA 3S6HA 5HMNA 1IY7A 1ZG9A 6CPAA 4JWPA 3BXMA 1Q2CA 1I21A 2XEGA 4H89A 4K30A 5JM6A 2WPWA 1QSMA 4JLYA 4NFRA 4QVTA 3L2NA 3NA6A 1CPXA 2Q51A 3I9SA 2ZPAA 3IFEA 1ZG8A 3B2YA 3FMCA 3TO9A 4R76A 4XNHB 4PQAA 3P2HA 4NJQA 2Q7SA 2QVPA 5I4MA 2BUEA 1S7NA 3V7ZA 3B3SA 1PU9A 2F8HA 5LRJA 3JRUA 2FL4A 4PK2A 2QYVA 3KI9A 4FBEA 4KOVA 2PJ2A 2PR8A 3LACA 1CX8A 1XRYA 2OZHA 5JH9A 2Q43A 1AUGA 2OZGA 4F8ZA 5AGEA 2EK9A 2A4NA 2CNSA 3KL9A 5G1ZA 2XEIA 3TC8A 4ZX8A 2PE3A 3S6FA 2WYRA 2RFHA 3WC5A 2ATRA 1Y0YA 2ZW4A 2VBQA 1OBRA 3B7IA 4J3GA 4ORFA 3QB8A 3TCVA 4DUKA 3TE4A 4MFLA 3VWEA 2Z3KA 1DTDA 1YX0A 2J8NA 2PQ8A 4A94A 1LRZA 4B10A 2AFMA 2FCKA 1OZPA 3PGPA 2ZOGA 3KZWA 1LAPA 2Z3PA 4PXCA 4UCPA 1IYLA 3BLNA 4R87A 1IICA 3PFOA 4X8IA 1M4IA 4KSAA 5F49A 5H86A 4FAIA 4A2ZA 1YVKA 3SJEA 3QNVA 2AFZA 4KUBA 2R8VA 5EMIA 4F9UA 5A28A 1YR0A 4QBJA 4M3SA 1M4GA 3F8KA 2CNTA 4FD7A 3C26A 2BOAA 4BMHA 4MHPA 1LCPA 5K8MA 4QB9A 2EUIA 1ON0A 2P6GA 4FUUA 2J8MA 1P0HA 4MJ8A 4WJBA 3EO4A 4X5KA 4U9YA 3FJUA 5KTCA 3KHXA 4P4FA 4OC0A 2Z3OA 4MCPA 1X10A 1B87A 4TNUA 4AG9A 4FD4A 1Z8WA 2R98A 3H8EA 2O28A 3VARA 2PJ9A 5C82A 3KR5A 1MJBA 4KOWA 4FWUA 5KTAA 4KLWA 1Z2LA 1TIQA 4CGNA 2PJ5A 2WZNA 4P4IA 4X3RA 3PB7X 2EWBA 1NSAA 5KTDA 2JDDA 3IWEA 1AYEA 2VQYA 1PYTB 4ZX9A 1QSRA 1IB1E 2PJCA 5CPAA 4KOXA 5CNPA 2IJZA 4H6UA 4MY3A 1IYKA 2I79A 2YNCC 3FYNA 1ELLP 5D8NA 1S7LA 3KQZA 3SJXA 4F9VA 2V8DA 3F5BA 5DWNA 4QC6A 2DXQA 4A30A 4B13A 4KOYA 2ABZA 2I3CA 1QSTA 3B3WA 3T8WA 5AG4A 4KZTA 2V8GA 3B35A 3FRMA 3OWCA 3TO6A 4ZI6A 4P10A 2OH1A 3EC4A 5BWAB 4NGPA 5JGFA 2ZEFA 1S3ZA 5G22A 1S7KA 1VIXA 3FVLA 4OMEA 3V8IA 2V8HA 1WK4A 2PVWA 4NGTA 2FXFA 3BHXA 5J1QA 1TKJA 1Z9UA 2B5GA 4B14A 1M4DA 2ZOFA 4DNCA 3CPAA 2KCWA 4UFXA 4R57A 3IEHA 3B3CA 4AG7A 2Z3MA 2JEWA 5K8PA 2AFUA 3D67A 3TOAA 3SI0A 5ELYA 2PRQA 2X7BA 2G9DA 3EY5A 4HKFA 1VHSA 4Q7AA 4ZY1A 4NGMA 2QJ8A 2YNCA 4CYOA 4ZYQA 2PIZA 2GFQA 4Q36A 3H8GA 1XBUA 5IX3A 3R9EA 4OLLA 1F2PA 1KUYA 4M6GA 4M85A 1KUXA 4AB7A 1CPSA 4R9MA 3SJFA 5K8NA 1S7FA 3BI0A 1KUVA 4RS2A 5I0CA 3A9LA 4NGRA 1XIXA 4CGLA 2Q44A 2GLFA 1ARLA 4MHZA 2FT0A 4X2TA 2PSWA 4YWYA 2J8RA 2O53A 3PZJA 4C2XA 2FE7A 4H2KA 1KWMA 4CYPA 1P4NA 3B3TA 1F57A 1M1DA 3DR8A 4MFPA 4AVBA 4E8OA 4MHNA 4BD9A 2NSMA 2ANPA 3MGDA 4YRHA 4B5OA 4FD6A 4IAVA 3PB8X 1IU8A 3TFYA 1XMTA 4KOSA 1XJOA 1QSNA 5HXDA 2OU2A 2REFA 5G21A 4QUSA 2HB6A 4A37A 3I3GA 3IJ3A 3NH8A 4CAFA 5AG5A 1BAVA 5HH1A 1Q2YA 3D3SA 3KASA 2Q4VA 3GUXA 3TOBA 4EFDA 2Z0ZA 1JQGA 2G0BA 4CGOA 1BLLE 4HPSA 1RXTA 1YK3A 4MBUA 4WWVA 4PPZA 1ZO0A 4ZBGA 1LOKA 3FF3A 2P6EA 3KQXA 4Y49C 4CYQA 4ONUA 4P4EA 3D8PA 2QMLA 3LD2A 2ZW5A 3WC7A 3LWUA 3SI1A 1N71A 2DPTA 4MFJA 2EO8A 4R6TA 2OR4A 3JUWA 3FXTA 5AG6A 4B12A 4H6ZA 4L89A 1TKFA 5LRGA 2WPXA 3R9FA 3D2PA 2XEJA 3NE7A 4ZGYB 4B5PB 4PSWA 4DYOA 2Q4YA 1PCAA 2ZW7A 4KVOE 1EE3P 2ZEHA 1J4JA 4AVAA 3JVNA 4PXDA 2Z10A 2ZW6A 3N5FA 4MHDA 3S6GA 2PJBA 4A33A 3IU2A 4NF1A 4OADA 2Q0YA 4NGSA 3W91A 4MCQA 2Z3LA 1B6BA 1YW6A 1LAMA 3D7FA 2EBJA 3KR4A 4BINA 3F0AA 4C7HA 4GM5A 3D2MA 3KHZA 1HDQA 3IO1A 4YU9A 4R8FA 1XF8A 4KSIA 4KSFA 2JEVA 3SXNA 4PXEA 1CJWA 4HNYB 4AXVA 1YREA 2B4BA 2P0WA 4OIDA 1Y9KA 4A39A 4I49A 4IUSA 2BCOA 1CM0A 5CBMA 2PJ7A 4MRIA 4KVME 2GANA 1FT7A 4KOUA 2G3TA 1QMUA 1ZLIA 4OC4A 3RYOA 5LYLA 1H8LA 4CAEA 2FIAA 2ZEOA 2ODFA 3FEEA 4UBRA 4UCNA 3SJGA 5GCNA 4II9A 1QQ9A 2QIRA 2C6GA 5F48A 1CP6A 2CNMA 2REEA 3NFZA 3WR7A 1M4LA 2V8VA 4OAEA 4C68A 3WABA 4CS0B 4MFKA 2CXAA 2D4PA 1BPMA 1LFWA 4CRYB 2R7HA 2ZEGA 1BOBA 1YSJA 3HLPA 3FIXA 3UY5A 1CBXA 4Z65A 4MMOA 4L8AA 4KORA 3VWDA 2YNDA 1FNOA 2B3VA 3RAMA 3FECA 5H84A 4P44A 4C2ZA 4P6YA 4EVYA 2PDOA 1Z8LA 3GB0A 3RBUA 5DWMA 3RZAA 3CZXA 4UCMA 2CF4A 3PEIA 4DJLA 3H5ZA 1CG2A 1HDUA 5C88A 4UEZA 5F46A 5J8FA 1NSLA 4CAXA 1VGYA 3DSBA 5HVGA 2PJ3A 2RB7A 4JJXA 2AJ6A 2RC4A 2POKA 4P45A 3K9TA 3ISZA 1ELMP 4EMEA 4KS9A 3FH4A 1VHEA 3LODA 3NH5A 4PXBA 4CYNA 1JWQA 3W6XA 1Z8TA 5LRKA 2FIWA 1MK4A 3ISXA 2Q04A 3GKRA 3PB9X 3VH9A 3LMSA 3BI1A 1UFHA 1ZLHA 2DPSA 3RNZA 3FBUA 2AE6A 3S6KA 5IB9A 2GLJA 2HQYA 3PRTA 3S9LA 1VKCA 4A95A 5THWA 4A31A 3GYAA 3N7ZA 3KGQA 4KVXA 5AG7A 3PP9A 4E2AA 4XPLA 4C2YA 3NH4A 2C1CA 3FB3A 2B4DA 2C27A 4Q38A 4RUHA 4F0XA 1IGBA 2EK8A 3D4UA 2IL4A 2C6CA 4OC2A 4U9ZA 4JZ0A 2VL1A 4MXUA 4XPDC 2H5MA 5G20A 1R3NA 5LYIA 2JBJA 5LYDA 4CPAA 4UA3A 3W6SA 1BPNA 2PJ8A 1IOIA 3IGRA 3R95A 4RN7A 4RI1A 2VXKA 1YW4A 4E0AA 2F7VA 1MJAA 2PJ6A 3K2KA 4UIAA 4P4BA 1R57A 3CPXA 4P4DA 4IF5A 4UFVA 1AMPA 1FY7A 2JBKA 2G3AA 8CPAA 4UWIA 3PB4X 4UFWA 5HVHA 1UWYA 5J8CA 1CP7A 2Z3NA 3FNCA 1YLOA 2V77A 4B11A 2PC1A 1YQEA 1A2ZA 2PVVA 4LX9A 4M6HA 3MN8A 4YGOA 2ZEDA 4JXQA 3BJ8A 2NYQA 4GS4A 1K4JA 3D66A 3H8FA 3PB6X 4LQ6A 1Q7LA 2VEZA 2WSAA 2FVGA 3IIBA 1GYTA 5JQ4A 3TX8A 3P2FA 3GY9A 3QAHA 2F5IA 1HEEA 4B6ZA 2ZEMA 2HV2A 2ZEEA 2B5GB 2ZENA 4LUAA 5K8OA 1ZG7A 2CTCA 4TWEA 5LYFA 4R7MA 2JDCA 3QAYA 4OP4A 4R3LA 4GXHA 1XMBA 4A32A 1NMTA 3EFAA 1WWZA 3DDDA 3D7GA 4NGQA 3SI2A 3VATA 4F6AA 2B3UA 2DEAA 2BSWA 4XNHC 1PUAA 2PR1A 3CT9A 1F2OA 4R3KA 4CGMA 2HUZA 2AFXA 1YMEA 4M6IA 1XFOA 3PFEA 1Q2DA 2D4OA 2C6PA 2AFOA 2PJ1A 2PCUA 4NSQA 2ZELA 4MHYA 2XEFA 4PK3A 4UIBA 2OOTA 3TTHA 4EWTA 3ZZIA 3D7HA 3E0KA 4F0YA 1R43A 3R9GA 4MI4A 1U6MA 3H4QA 4HNXB 4MFQA 3GLJA 3S9MA 1L0CA 4ZY0A 2Y0MA 4OC1A 2PJ0A 3MRUA 2O4HA 1TF9A 2NMTA 2BL1A 2J9AA 4CGPA 2CIJA 3G3SA 1X12A 1LANA 1S60A 2DF5A 3IWGA 2CTBA 4IHMA 2PRBA 2GIVA 3DNSA 1DE4C 2CY2A 2I00A 4UEEA 5E96A 3ZJ0A 7CPAA 3WC6A 1ARMA 2B4DB 3PBEA 4JXRA 5IV0A 2HC9A 1Z8XA 4O23A 1YGHA 4UWJA 3HUVA 5EC4A 4CRZB 1Y0RA 1VHOA 1V0CA 1YVOA 1RO5A 2FS5A 2GREA 1I1DA 3K9UA 4MFZA 1Y7RA 5EBVA 2Q7BA 2OB0A 4AVCA 1IIDA 4NEXA 3RO0A 2K5TA 3CDXA 3IC1A 3TO7A 1XOVA 2BEIA 3T9YA 4ZY2A 2EVNA 5A27A 2R1IA
chains in the Genus database with same CATH topology
1S5KA 2VZZA 1NE9A 3R96A 4KUAA 3BJ7A 2Z11A 1MJ9A 4HNWB 4PV6A 5F47A 3SXOA 2GE3A 3T90A 5JPHA 4JD6A 1Z4RA 4C7IA 4CAWA 2JLMA 4CAVA 2YNEA 4BBHA 1XE4A 2VI7A 3SHPA 2FSRA 2VZYA 3TT2A 1M44A 3EXNA 2ZXVA 3G8WA 3DR6A 4U5YA 4XPDB 4KOTA 1KZFA 1YLEA 4NXYA 4KLVA 5IB0A 3B8GA 1Z4EA 2OZUA 5ISVA 3R1KA 3KKWA 4PSXA 4XPKA 4B5PA 1BO4A 3CXQA 2B58A 1QSOA 1XEBA 3IU1A 3JTKA 2ARHA 4MY0A 1Y9WA 2QECA 1SQHA 1I12A 2P6FA 2WUUA 4NCZA 3CXPA 3CXSA 4Y49B 4YFJA 2YGWA 4FD5A 1GHEA 5FVJA 3S6HA 5HMNA 4JWPA 1Q2CA 1I21A 4H89A 4K30A 2WPWA 1QSMA 4JLYA 4QVTA 3I9SA 2ZPAA 3TO9A 4XNHB 3P2HA 2BUEA 1S7NA 1PU9A 2FL4A 4PK2A 4KOVA 2PR8A 2OZHA 2OZGA 5AGEA 2A4NA 2CNSA 5G1ZA 3S6FA 2ATRA 2ZW4A 2VBQA 4J3GA 4ORFA 3QB8A 3TCVA 3TE4A 4MFLA 3VWEA 2Z3KA 2J8NA 1YX0A 2PQ8A 1LRZA 4B10A 2FCKA 3PGPA 1OZPA 4UCPA 2Z3PA 5E96A 1IYLA 3BLNA 4R87A 1IICA 1M4IA 4KSAA 5F49A 5H86A 4A2ZA 1YVKA 4KUBA 2R8VA 5A28A 1YR0A 4QBJA 4M3SA 1M4GA 3F8KA 2CNTA 4FD7A 3C26A 4BMHA 4QB9A 2EUIA 1ON0A 2P6GA 4MJ8A 2J8MA 1P0HA 4X5KA 3EO4A 4U9YA 5KTCA 2Z3OA 1B87A 4AG9A 4FD4A 2R98A 2O28A 5C82A 1MJBA 4KOWA 5KTAA 4KLWA 1TIQA 4CGNA 5KTDA 2JDDA 3IWEA 2VQYA 1QSRA 1IB1E 4KOXA 5CNPA 4H6UA 4MY3A 1IYKA 2I79A 2YNCC 3FYNA 1S7LA 3F5BA 5DWNA 4QC6A 2DXQA 4A30A 4B13A 4KOYA 1QSTA 5AG4A 4KZTA 3OWCA 3FRMA 3TO6A 2OH1A 3EC4A 5BWAB 1S3ZA 5G22A 1S7KA 3V8IA 1WK4A 2FXFA 1Z9UA 2B5GA 4B14A 1M4DA 4DNCA 2KCWA 4UFXA 4R57A 4AG7A 2Z3MA 3TOAA 2X7BA 3EY5A 4HKFA 1VHSA 2YNCA 4CYOA 5IX3A 4Q36A 3R9EA 4OLLA 1KUYA 4M85A 1KUXA 4AB7A 4R9MA 1S7FA 1KUVA 4RS2A 5I0CA 3A9LA 1XIXA 4CGLA 2Q44A 2FT0A 2PSWA 2J8RA 3PZJA 4C2XA 2FE7A 4CYPA 1P4NA 3DR8A 1M1DA 4MFPA 4E8OA 4AVBA 4YRHA 3MGDA 4B5OA 4FD6A 3TFYA 1XMTA 4KOSA 1QSNA 2OU2A 2REFA 5G21A 4QUSA 3I3GA 4CAFA 5AG5A 5HH1A 1Q2YA 3D3SA 2Q4VA 3TOBA 2Z0ZA 2G0BA 4CGOA 1RXTA 1YK3A 4MBUA 1ZO0A 4ZBGA 4CYQA 2P6EA 4Y49C 4ONUA 3D8PA 2QMLA 3LD2A 2ZW5A 1N71A 2DPTA 4MFJA 3JUWA 3FXTA 5AG6A 4B12A 4H6ZA 4L89A 2WPXA 3R9FA 3D2PA 3NE7A 4ZGYB 4B5PB 4PSWA 2Q4YA 4KVOE 2ZW7A 1J4JA 4AVAA 3JVNA 2Z10A 2ZW6A 4MHDA 3S6GA 4A33A 3IU2A 4NF1A 4OADA 2Q0YA 3W91A 2Z3LA 1B6BA 3F0AA 4C7HA 3D2MA 3SXNA 1XF8A 4KSFA 2JEVA 1CJWA 4HNYB 1YREA 2B4BA 2P0WA 1Y9KA 4I49A 4IUSA 1CM0A 4KVME 2GANA 4KOUA 2G3TA 3RYOA 4CAEA 2FIAA 4UBRA 4UCNA 5GCNA 4II9A 2QIRA 5F48A 2CNMA 2REEA 3WR7A 4OAEA 4C68A 4CS0B 4MFKA 2CXAA 2D4PA 4CRYB 2R7HA 1BOBA 3UY5A 3FIXA 4L8AA 4KORA 3VWDA 2YNDA 2B3VA 5H84A 4C2ZA 4EVYA 2PDOA 5DWMA 4UCMA 3H5ZA 5F46A 5J8FA 5C88A 1NSLA 4CAXA 3DSBA 4JJXA 2AJ6A 2RC4A 4KS9A 3LODA 4CYNA 3W6XA 2FIWA 1MK4A 2Q04A 3GKRA 1UFHA 2DPSA 3FBUA 2AE6A 3S6KA 2HQYA 1VKCA 4A95A 4A31A 3GYAA 3N7ZA 4KVXA 5AG7A 3PP9A 4E2AA 4XPLA 4C2YA 3FB3A 2B4DA 2C27A 4Q38A 4F0XA 2IL4A 4U9ZA 4XPDC 2H5MA 5G20A 4UA3A 3W6SA 3R95A 3IGRA 4RI1A 2VXKA 4E0AA 1MJAA 1R57A 4IF5A 4UFVA 1FY7A 2G3AA 4UWIA 4UFWA 5J8CA 2Z3NA 3FNCA 4B11A 2PC1A 4LX9A 4YGOA 4JXQA 3BJ8A 4GS4A 1K4JA 2VEZA 2WSAA 5JQ4A 3P2FA 3GY9A 3QAHA 2F5IA 2HV2A 2B5GB 4LUAA 2JDCA 4R3LA 4A32A 1NMTA 3EFAA 1WWZA 3DDDA 4F6AA 2B3UA 2BSWA 4XNHC 1PUAA 2PR1A 4R3KA 4CGMA 2HUZA 1Q2DA 2D4OA 4NSQA 3TTHA 4PK3A 3ZZIA 3E0KA 4F0YA 3R9GA 4MI4A 1U6MA 3H4QA 4HNXB 4MFQA 1L0CA 2Y0MA 2NMTA 4CGPA 2BL1A 3G3SA 1S60A 3IWGA 2PRBA 2GIVA 3DNSA 2CY2A 2I00A 3ZJ0A 2B4DB 4JXRA 5IV0A 4UWJA 1YGHA 5EC4A 4CRZB 1V0CA 1YVOA 1RO5A 2FS5A 3K9UA 1I1DA 4MFZA 1Y7RA 5EBVA 2Q7BA 2OB0A 4AVCA 1IIDA 4NEXA 2K5TA 3TO7A 2BEIA 3T9YA 2EVNA 5A27A 2R1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5K A;  2VZZ A;  1NE9 A;  3R96 A;  4KUA A;  3BJ7 A;  2Z11 A;  1MJ9 A;  4HNW B;  4PV6 A;  5F47 A;  3SXO A;  2GE3 A;  3T90 A;  5JPH A;  4JD6 A;  1Z4R A;  4CAW A;  2JLM A;  4CAV A;  1XE4 A;  2VI7 A;  3SHP A;  2FSR A;  2VZY A;  3TT2 A;  1M44 A;  3EXN A;  2ZXV A;  3G8W A;  3DR6 A;  4U5Y A;  4XPD B;  4KOT A;  1KZF A;  1YLE A;  4NXY A;  4KLV A;  5IB0 A;  3B8G A;  1Z4E A;  2OZU A;  5ISV A;  3R1K A;  3KKW A;  4PSX A;  4XPK A;  4B5P A;  1BO4 A;  3CXQ A;  2B58 A;  1QSO A;  1XEB A;  2ARH A;  4MY0 A;  1Y9W A;  2QEC A;  1SQH A;  1I12 A;  2P6F A;  4NCZ A;  3CXP A;  3CXS A;  4Y49 B;  4YFJ A;  4FD5 A;  1GHE A;  5FVJ A;  3S6H A;  5HMN A;  4JWP A;  1Q2C A;  1I21 A;  4H89 A;  4K30 A;  2WPW A;  1QSM A;  4JLY A;  4QVT A;  3I9S A;  2ZPA A;  3TO9 A;  4XNH B;  3P2H A;  2BUE A;  1S7N A;  1PU9 A;  2FL4 A;  4PK2 A;  4KOV A;  2PR8 A;  2OZH A;  2OZG A;  2A4N A;  2CNS A;  3S6F A;  2ATR A;  2ZW4 A;  2VBQ A;  4J3G A;  4ORF A;  3QB8 A;  3TCV A;  3TE4 A;  3VWE A;  2J8N A;  1YX0 A;  2PQ8 A;  1LRZ A;  2FCK A;  3PGP A;  1OZP A;  5E96 A;  1IYL A;  3BLN A;  4R87 A;  1IIC A;  1M4I A;  5F49 A;  5H86 A;  1YVK A;  4KUB A;  2R8V A;  1YR0 A;  4QBJ A;  4M3S A;  1M4G A;  3F8K A;  2CNT A;  4FD7 A;  3C26 A;  4BMH A;  4QB9 A;  2EUI A;  1ON0 A;  2P6G A;  4MJ8 A;  2J8M A;  1P0H A;  4X5K A;  3EO4 A;  4U9Y A;  5KTC A;  1B87 A;  4AG9 A;  4FD4 A;  2R98 A;  2O28 A;  5C82 A;  1MJB A;  4KOW A;  5KTA A;  4KLW A;  1TIQ A;  5KTD A;  2JDD A;  2VQY A;  1QSR A;  1IB1 E;  4KOX A;  5CNP A;  4H6U A;  4MY3 A;  1IYK A;  2I79 A;  3FYN A;  1S7L A;  3F5B A;  5DWN A;  4QC6 A;  2DXQ A;  4KOY A;  1QST A;  4KZT A;  3OWC A;  3FRM A;  3TO6 A;  2OH1 A;  3EC4 A;  1S3Z A;  1S7K A;  3V8I A;  1WK4 A;  2FXF A;  1Z9U A;  2B5G A;  1M4D A;  4DNC A;  2KCW A;  4R57 A;  4AG7 A;  3TOA A;  2X7B A;  3EY5 A;  4HKF A;  1VHS A;  5IX3 A;  3R9E A;  4OLL A;  1KUY A;  4M85 A;  1KUX A;  4AB7 A;  4R9M A;  1S7F A;  1KUV A;  4RS2 A;  5I0C A;  1XIX A;  2Q44 A;  2FT0 A;  2PSW A;  2J8R A;  3PZJ A;  2FE7 A;  1P4N A;  3DR8 A;  1M1D A;  4E8O A;  4AVB A;  4YRH A;  3MGD A;  4B5O A;  4FD6 A;  3TFY A;  1XMT A;  4KOS A;  1QSN A;  2OU2 A;  2REF A;  4QUS A;  3I3G A;  5HH1 A;  1Q2Y A;  3D3S A;  2Q4V A;  3TOB A;  2Z0Z A;  2G0B A;  1RXT A;  1YK3 A;  4MBU A;  4ZBG A;  2P6E A;  4Y49 C;  4ONU A;  3D8P A;  2QML A;  3LD2 A;  2ZW5 A;  1N71 A;  3JUW A;  3FXT A;  4H6Z A;  4L89 A;  2WPX A;  3R9F A;  3D2P A;  3NE7 A;  4B5P B;  4PSW A;  2Q4Y A;  4KVO E;  2ZW7 A;  1J4J A;  4AVA A;  3JVN A;  2Z10 A;  2ZW6 A;  4MHD A;  3S6G A;  4NF1 A;  4OAD A;  2Q0Y A;  3W91 A;  1B6B A;  3F0A A;  3D2M A;  3SXN A;  1XF8 A;  2JEV A;  1CJW A;  4HNY B;  1YRE A;  2B4B A;  2P0W A;  1Y9K A;  4I49 A;  4IUS A;  1CM0 A;  4KVM E;  2GAN A;  4KOU A;  2G3T A;  3RYO A;  2FIA A;  4UBR A;  5GCN A;  4II9 A;  2QIR A;  5F48 A;  2CNM A;  2REE A;  3WR7 A;  4OAE A;  4CS0 B;  2D4P A;  4CRY B;  2R7H A;  1BOB A;  3UY5 A;  3FIX A;  4L8A A;  4KOR A;  3VWD A;  2B3V A;  5H84 A;  4EVY A;  2PDO A;  5DWM A;  5F46 A;  5J8F A;  5C88 A;  1NSL A;  4CAX A;  3DSB A;  4JJX A;  2AJ6 A;  2RC4 A;  3LOD A;  3W6X A;  2FIW A;  1MK4 A;  2Q04 A;  3GKR A;  1UFH A;  3FBU A;  2AE6 A;  3S6K A;  2HQY A;  1VKC A;  3GYA A;  3N7Z A;  4KVX A;  3PP9 A;  4E2A A;  4XPL A;  3FB3 A;  2B4D A;  2C27 A;  2IL4 A;  4U9Z A;  4XPD C;  2H5M A;  4UA3 A;  3W6S A;  3R95 A;  3IGR A;  4RI1 A;  2VXK A;  4E0A A;  1MJA A;  1R57 A;  4IF5 A;  1FY7 A;  2G3A A;  4UWI A;  5J8C A;  3FNC A;  2PC1 A;  4LX9 A;  4YGO A;  4JXQ A;  3BJ8 A;  4GS4 A;  1K4J A;  2VEZ A;  5JQ4 A;  3P2F A;  3GY9 A;  3QAH A;  2F5I A;  2HV2 A;  2B5G B;  4LUA A;  2JDC A;  4R3L A;  1NMT A;  3EFA A;  1WWZ A;  3DDD A;  4F6A A;  2B3U A;  2BSW A;  4XNH C;  1PUA A;  2PR1 A;  4R3K A;  2HUZ A;  1Q2D A;  2D4O A;  4NSQ A;  3TTH A;  4PK3 A;  3ZZI A;  3E0K A;  4F0Y A;  3R9G A;  4MI4 A;  1U6M A;  3H4Q A;  4HNX B;  1L0C A;  2Y0M A;  2NMT A;  2BL1 A;  3G3S A;  1S60 A;  3IWG A;  2PRB A;  2GIV A;  3DNS A;  2CY2 A;  2I00 A;  3ZJ0 A;  2B4D B;  4JXR A;  5IV0 A;  4UWJ A;  1YGH A;  5EC4 A;  4CRZ B;  1V0C A;  1YVO A;  1RO5 A;  2FS5 A;  3K9U A;  1I1D A;  1Y7R A;  5EBV A;  2Q7B A;  2OB0 A;  4AVC A;  1IID A;  4NEX A;  2K5T A;  3TO7 A;  2BEI A;  3T9Y A;  2EVN A;  2R1I A; 
#chains in the Genus database with same CATH topology
 4MCR A;  4OC3 A;  1S5K A;  3DGV A;  2VZZ A;  3D68 A;  3D7D A;  1NE9 A;  4JYW A;  4A38 A;  3R96 A;  4KUA A;  3I1U A;  3BJ7 A;  2Z11 A;  1MJ9 A;  4HNW B;  4PV6 A;  4UF4 A;  5F47 A;  2IMO A;  2PIY A;  4W9Y A;  3SXO A;  2AFW A;  2GE3 A;  3T90 A;  2PJ4 A;  5JPH A;  4ONW A;  3B3V A;  4JD6 A;  1Z4R A;  4MCS A;  4C7I A;  1Z5R A;  4CAW A;  2JLM A;  5DS0 A;  4CAV A;  2YNE A;  4BBH A;  1XE4 A;  2VI7 A;  3SHP A;  2BO9 A;  2FSR A;  2VZY A;  3TT2 A;  4K3N A;  4NGN A;  3S9N A;  2IQ6 A;  1M44 A;  3GIU A;  3EXN A;  2ZXV A;  3G8W A;  3DR6 A;  4U5Y A;  4P4J A;  4XPD B;  4G1P A;  3IWW A;  4KOT A;  5F09 A;  1KZF A;  1YLE A;  4NXY A;  4KLV A;  4LQG A;  5IB0 A;  3B8G A;  1TF8 A;  1TKH A;  4OIW A;  5D29 A;  1Z4E A;  1RTQ A;  2OZU A;  1TXR A;  3R1K A;  5ISV A;  4UEF A;  3KKW A;  4PSX A;  4XPK A;  3PBB A;  4OKO A;  4B5P A;  2AFS A;  1BO4 A;  3CXQ A;  2B58 A;  1QSO A;  3NE8 A;  3WT4 A;  1IOF A;  2PJA A;  2ZEP A;  1XEB A;  3IU1 A;  3JTK A;  2ARH A;  4MY0 A;  2Q4Z A;  1Y9W A;  2QEC A;  1SQH A;  1I12 A;  2P6F A;  2WUU A;  3DLJ A;  4IK2 A;  3CXP A;  4NCZ A;  3CXS A;  3FX6 A;  4OC5 A;  2GU2 A;  4Y49 B;  4YFJ A;  2YGW A;  4NJR A;  5HVF A;  3FED A;  1Y7E A;  4FD5 A;  1GHE A;  3V38 A;  5FVJ A;  3S6H A;  5HMN A;  1IY7 A;  1ZG9 A;  6CPA A;  4JWP A;  3BXM A;  1Q2C A;  1I21 A;  2XEG A;  4H89 A;  4K30 A;  5JM6 A;  2WPW A;  1QSM A;  4JLY A;  4NFR A;  4QVT A;  3L2N A;  3NA6 A;  1CPX A;  2Q51 A;  3I9S A;  2ZPA A;  3IFE A;  1ZG8 A;  3B2Y A;  3FMC A;  3TO9 A;  4R76 A;  4XNH B;  4PQA A;  3P2H A;  4NJQ A;  2Q7S A;  2QVP A;  5I4M A;  2BUE A;  1S7N A;  3V7Z A;  3B3S A;  1PU9 A;  2F8H A;  5LRJ A;  3JRU A;  2FL4 A;  4PK2 A;  2QYV A;  3KI9 A;  4FBE A;  4KOV A;  2PJ2 A;  2PR8 A;  3LAC A;  1CX8 A;  1XRY A;  2OZH A;  5JH9 A;  2Q43 A;  1AUG A;  2OZG A;  4F8Z A;  5AGE A;  2EK9 A;  2A4N A;  2CNS A;  3KL9 A;  5G1Z A;  2XEI A;  3TC8 A;  4ZX8 A;  2PE3 A;  3S6F A;  2WYR A;  2RFH A;  3WC5 A;  2ATR A;  1Y0Y A;  2ZW4 A;  2VBQ A;  1OBR A;  3B7I A;  4J3G A;  4ORF A;  3QB8 A;  3TCV A;  4DUK A;  3TE4 A;  4MFL A;  3VWE A;  2Z3K A;  1DTD A;  1YX0 A;  2J8N A;  2PQ8 A;  4A94 A;  1LRZ A;  4B10 A;  2AFM A;  2FCK A;  1OZP A;  3PGP A;  2ZOG A;  3KZW A;  1LAP A;  2Z3P A;  4PXC A;  4UCP A;  1IYL A;  3BLN A;  4R87 A;  1IIC A;  3PFO A;  4X8I A;  1M4I A;  4KSA A;  5F49 A;  5H86 A;  4FAI A;  4A2Z A;  1YVK A;  3SJE A;  3QNV A;  2AFZ A;  4KUB A;  2R8V A;  5EMI A;  4F9U A;  5A28 A;  1YR0 A;  4QBJ A;  4M3S A;  1M4G A;  3F8K A;  2CNT A;  4FD7 A;  3C26 A;  2BOA A;  4BMH A;  4MHP A;  1LCP A;  5K8M A;  4QB9 A;  2EUI A;  1ON0 A;  2P6G A;  4FUU A;  2J8M A;  1P0H A;  4MJ8 A;  4WJB A;  3EO4 A;  4X5K A;  4U9Y A;  3FJU A;  5KTC A;  3KHX A;  4P4F A;  4OC0 A;  2Z3O A;  4MCP A;  1X10 A;  1B87 A;  4TNU A;  4AG9 A;  4FD4 A;  1Z8W A;  2R98 A;  3H8E A;  2O28 A;  3VAR A;  2PJ9 A;  5C82 A;  3KR5 A;  1MJB A;  4KOW A;  4FWU A;  5KTA A;  4KLW A;  1Z2L A;  1TIQ A;  4CGN A;  2PJ5 A;  2WZN A;  4P4I A;  4X3R A;  3PB7 X;  2EWB A;  1NSA A;  5KTD A;  2JDD A;  3IWE A;  1AYE A;  2VQY A;  1PYT B;  4ZX9 A;  1QSR A;  1IB1 E;  2PJC A;  5CPA A;  4KOX A;  5CNP A;  2IJZ A;  4H6U A;  4MY3 A;  1IYK A;  2I79 A;  2YNC C;  3FYN A;  1ELL P;  5D8N A;  1S7L A;  3KQZ A;  3SJX A;  4F9V A;  2V8D A;  3F5B A;  5DWN A;  4QC6 A;  2DXQ A;  4A30 A;  4B13 A;  4KOY A;  2ABZ A;  2I3C A;  1QST A;  3B3W A;  3T8W A;  5AG4 A;  4KZT A;  2V8G A;  3B35 A;  3FRM A;  3OWC A;  3TO6 A;  4ZI6 A;  4P10 A;  2OH1 A;  3EC4 A;  5BWA B;  4NGP A;  5JGF A;  2ZEF A;  1S3Z A;  5G22 A;  1S7K A;  1VIX A;  3FVL A;  4OME A;  3V8I A;  2V8H A;  1WK4 A;  2PVW A;  4NGT A;  2FXF A;  3BHX A;  5J1Q A;  1TKJ A;  1Z9U A;  2B5G A;  4B14 A;  1M4D A;  2ZOF A;  4DNC A;  3CPA A;  2KCW A;  4UFX A;  4R57 A;  3IEH A;  3B3C A;  4AG7 A;  2Z3M A;  2JEW A;  5K8P A;  2AFU A;  3D67 A;  3TOA A;  3SI0 A;  5ELY A;  2PRQ A;  2X7B A;  2G9D A;  3EY5 A;  4HKF A;  1VHS A;  4Q7A A;  4ZY1 A;  4NGM A;  2QJ8 A;  2YNC A;  4CYO A;  4ZYQ A;  2PIZ A;  2GFQ A;  4Q36 A;  3H8G A;  1XBU A;  5IX3 A;  3R9E A;  4OLL A;  1F2P A;  1KUY A;  4M6G A;  4M85 A;  1KUX A;  4AB7 A;  1CPS A;  4R9M A;  3SJF A;  5K8N A;  1S7F A;  3BI0 A;  1KUV A;  4RS2 A;  5I0C A;  3A9L A;  4NGR A;  1XIX A;  4CGL A;  2Q44 A;  2GLF A;  1ARL A;  4MHZ A;  2FT0 A;  4X2T A;  2PSW A;  4YWY A;  2J8R A;  2O53 A;  3PZJ A;  4C2X A;  2FE7 A;  4H2K A;  1KWM A;  4CYP A;  1P4N A;  3B3T A;  1F57 A;  1M1D A;  3DR8 A;  4MFP A;  4AVB A;  4E8O A;  4MHN A;  4BD9 A;  2NSM A;  2ANP A;  3MGD A;  4YRH A;  4B5O A;  4FD6 A;  4IAV A;  3PB8 X;  1IU8 A;  3TFY A;  1XMT A;  4KOS A;  1XJO A;  1QSN A;  5HXD A;  2OU2 A;  2REF A;  5G21 A;  4QUS A;  2HB6 A;  4A37 A;  3I3G A;  3IJ3 A;  3NH8 A;  4CAF A;  5AG5 A;  1BAV A;  5HH1 A;  1Q2Y A;  3D3S A;  3KAS A;  2Q4V A;  3GUX A;  3TOB A;  4EFD A;  2Z0Z A;  1JQG A;  2G0B A;  4CGO A;  1BLL E;  4HPS A;  1RXT A;  1YK3 A;  4MBU A;  4WWV A;  4PPZ A;  1ZO0 A;  4ZBG A;  1LOK A;  3FF3 A;  2P6E A;  3KQX A;  4Y49 C;  4CYQ A;  4ONU A;  4P4E A;  3D8P A;  2QML A;  3LD2 A;  2ZW5 A;  3WC7 A;  3LWU A;  3SI1 A;  1N71 A;  2DPT A;  4MFJ A;  2EO8 A;  4R6T A;  2OR4 A;  3JUW A;  3FXT A;  5AG6 A;  4B12 A;  4H6Z A;  4L89 A;  1TKF A;  5LRG A;  2WPX A;  3R9F A;  3D2P A;  2XEJ A;  3NE7 A;  4ZGY B;  4B5P B;  4PSW A;  4DYO A;  2Q4Y A;  1PCA A;  2ZW7 A;  4KVO E;  1EE3 P;  2ZEH A;  1J4J A;  4AVA A;  3JVN A;  4PXD A;  2Z10 A;  2ZW6 A;  3N5F A;  4MHD A;  3S6G A;  2PJB A;  4A33 A;  3IU2 A;  4NF1 A;  4OAD A;  2Q0Y A;  4NGS A;  3W91 A;  4MCQ A;  2Z3L A;  1B6B A;  1YW6 A;  1LAM A;  3D7F A;  2EBJ A;  3KR4 A;  4BIN A;  3F0A A;  4C7H A;  4GM5 A;  3D2M A;  3KHZ A;  1HDQ A;  3IO1 A;  4YU9 A;  4R8F A;  1XF8 A;  4KSI A;  4KSF A;  2JEV A;  3SXN A;  4PXE A;  1CJW A;  4HNY B;  4AXV A;  1YRE A;  2B4B A;  2P0W A;  4OID A;  1Y9K A;  4A39 A;  4I49 A;  4IUS A;  2BCO A;  1CM0 A;  5CBM A;  2PJ7 A;  4MRI A;  4KVM E;  2GAN A;  1FT7 A;  4KOU A;  2G3T A;  1QMU A;  1ZLI A;  4OC4 A;  3RYO A;  5LYL A;  1H8L A;  4CAE A;  2FIA A;  2ZEO A;  2ODF A;  3FEE A;  4UBR A;  4UCN A;  3SJG A;  5GCN A;  4II9 A;  1QQ9 A;  2QIR A;  2C6G A;  5F48 A;  1CP6 A;  2CNM A;  2REE A;  3NFZ A;  3WR7 A;  1M4L A;  2V8V A;  4OAE A;  4C68 A;  3WAB A;  4CS0 B;  4MFK A;  2CXA A;  2D4P A;  1BPM A;  1LFW A;  4CRY B;  2R7H A;  2ZEG A;  1BOB A;  1YSJ A;  3HLP A;  3FIX A;  3UY5 A;  1CBX A;  4Z65 A;  4MMO A;  4L8A A;  4KOR A;  3VWD A;  2YND A;  1FNO A;  2B3V A;  3RAM A;  3FEC A;  5H84 A;  4P44 A;  4C2Z A;  4P6Y A;  4EVY A;  2PDO A;  1Z8L A;  3GB0 A;  3RBU A;  5DWM A;  3RZA A;  3CZX A;  4UCM A;  2CF4 A;  3PEI A;  4DJL A;  3H5Z A;  1CG2 A;  1HDU A;  5C88 A;  4UEZ A;  5F46 A;  5J8F A;  1NSL A;  4CAX A;  1VGY A;  3DSB A;  5HVG A;  2PJ3 A;  2RB7 A;  4JJX A;  2AJ6 A;  2RC4 A;  2POK A;  4P45 A;  3K9T A;  3ISZ A;  1ELM P;  4EME A;  4KS9 A;  3FH4 A;  1VHE A;  3LOD A;  3NH5 A;  4PXB A;  4CYN A;  1JWQ A;  3W6X A;  1Z8T A;  5LRK A;  2FIW A;  1MK4 A;  3ISX A;  2Q04 A;  3GKR A;  3PB9 X;  3VH9 A;  3LMS A;  3BI1 A;  1UFH A;  1ZLH A;  2DPS A;  3RNZ A;  3FBU A;  2AE6 A;  3S6K A;  5IB9 A;  2GLJ A;  2HQY A;  3PRT A;  3S9L A;  1VKC A;  4A95 A;  5THW A;  4A31 A;  3GYA A;  3N7Z A;  3KGQ A;  4KVX A;  5AG7 A;  3PP9 A;  4E2A A;  4XPL A;  4C2Y A;  3NH4 A;  2C1C A;  3FB3 A;  2B4D A;  2C27 A;  4Q38 A;  4RUH A;  4F0X A;  1IGB A;  2EK8 A;  3D4U A;  2IL4 A;  2C6C A;  4OC2 A;  4U9Z A;  4JZ0 A;  2VL1 A;  4MXU A;  4XPD C;  2H5M A;  5G20 A;  1R3N A;  5LYI A;  2JBJ A;  5LYD A;  4CPA A;  4UA3 A;  3W6S A;  1BPN A;  2PJ8 A;  1IOI A;  3IGR A;  3R95 A;  4RN7 A;  4RI1 A;  2VXK A;  1YW4 A;  4E0A A;  2F7V A;  1MJA A;  2PJ6 A;  3K2K A;  4UIA A;  4P4B A;  1R57 A;  3CPX A;  4P4D A;  4IF5 A;  4UFV A;  1AMP A;  1FY7 A;  2JBK A;  2G3A A;  8CPA A;  4UWI A;  3PB4 X;  4UFW A;  5HVH A;  1UWY A;  5J8C A;  1CP7 A;  2Z3N A;  3FNC A;  1YLO A;  2V77 A;  4B11 A;  2PC1 A;  1YQE A;  1A2Z A;  2PVV A;  4LX9 A;  4M6H A;  3MN8 A;  4YGO A;  2ZED A;  4JXQ A;  3BJ8 A;  2NYQ A;  4GS4 A;  1K4J A;  3D66 A;  3H8F A;  3PB6 X;  4LQ6 A;  1Q7L A;  2VEZ A;  2WSA A;  2FVG A;  3IIB A;  1GYT A;  5JQ4 A;  3TX8 A;  3P2F A;  3GY9 A;  3QAH A;  2F5I A;  1HEE A;  4B6Z A;  2ZEM A;  2HV2 A;  2ZEE A;  2B5G B;  2ZEN A;  4LUA A;  5K8O A;  1ZG7 A;  2CTC A;  4TWE A;  5LYF A;  4R7M A;  2JDC A;  3QAY A;  4OP4 A;  4R3L A;  4GXH A;  1XMB A;  4A32 A;  1NMT A;  3EFA A;  1WWZ A;  3DDD A;  3D7G A;  4NGQ A;  3SI2 A;  3VAT A;  4F6A A;  2B3U A;  2DEA A;  2BSW A;  4XNH C;  1PUA A;  2PR1 A;  3CT9 A;  1F2O A;  4R3K A;  4CGM A;  2HUZ A;  2AFX A;  1YME A;  4M6I A;  1XFO A;  3PFE A;  1Q2D A;  2D4O A;  2C6P A;  2AFO A;  2PJ1 A;  2PCU A;  4NSQ A;  2ZEL A;  4MHY A;  2XEF A;  4PK3 A;  4UIB A;  2OOT A;  3TTH A;  4EWT A;  3ZZI A;  3D7H A;  3E0K A;  4F0Y A;  1R43 A;  3R9G A;  4MI4 A;  1U6M A;  3H4Q A;  4HNX B;  4MFQ A;  3GLJ A;  3S9M A;  1L0C A;  4ZY0 A;  2Y0M A;  4OC1 A;  2PJ0 A;  3MRU A;  2O4H A;  1TF9 A;  2NMT A;  2BL1 A;  2J9A A;  4CGP A;  2CIJ A;  3G3S A;  1X12 A;  1LAN A;  1S60 A;  2DF5 A;  3IWG A;  2CTB A;  4IHM A;  2PRB A;  2GIV A;  3DNS A;  1DE4 C;  2CY2 A;  2I00 A;  4UEE A;  5E96 A;  3ZJ0 A;  7CPA A;  3WC6 A;  1ARM A;  2B4D B;  3PBE A;  4JXR A;  5IV0 A;  2HC9 A;  1Z8X A;  4O23 A;  1YGH A;  4UWJ A;  3HUV A;  5EC4 A;  4CRZ B;  1Y0R A;  1VHO A;  1V0C A;  1YVO A;  1RO5 A;  2FS5 A;  2GRE A;  1I1D A;  3K9U A;  4MFZ A;  1Y7R A;  5EBV A;  2Q7B A;  2OB0 A;  4AVC A;  1IID A;  4NEX A;  3RO0 A;  2K5T A;  3CDX A;  3IC1 A;  3TO7 A;  1XOV A;  2BEI A;  3T9Y A;  4ZY2 A;  2EVN A;  5A27 A;  2R1I A; 
#chains in the Genus database with same CATH homology
 1S5K A;  2VZZ A;  1NE9 A;  3R96 A;  4KUA A;  3BJ7 A;  2Z11 A;  1MJ9 A;  4HNW B;  4PV6 A;  5F47 A;  3SXO A;  2GE3 A;  3T90 A;  5JPH A;  4JD6 A;  1Z4R A;  4C7I A;  4CAW A;  2JLM A;  4CAV A;  2YNE A;  4BBH A;  1XE4 A;  2VI7 A;  3SHP A;  2FSR A;  2VZY A;  3TT2 A;  1M44 A;  3EXN A;  2ZXV A;  3G8W A;  3DR6 A;  4U5Y A;  4XPD B;  4KOT A;  1KZF A;  1YLE A;  4NXY A;  4KLV A;  5IB0 A;  3B8G A;  1Z4E A;  2OZU A;  5ISV A;  3R1K A;  3KKW A;  4PSX A;  4XPK A;  4B5P A;  1BO4 A;  3CXQ A;  2B58 A;  1QSO A;  1XEB A;  3IU1 A;  3JTK A;  2ARH A;  4MY0 A;  1Y9W A;  2QEC A;  1SQH A;  1I12 A;  2P6F A;  2WUU A;  4NCZ A;  3CXP A;  3CXS A;  4Y49 B;  4YFJ A;  2YGW A;  4FD5 A;  1GHE A;  5FVJ A;  3S6H A;  5HMN A;  4JWP A;  1Q2C A;  1I21 A;  4H89 A;  4K30 A;  2WPW A;  1QSM A;  4JLY A;  4QVT A;  3I9S A;  2ZPA A;  3TO9 A;  4XNH B;  3P2H A;  2BUE A;  1S7N A;  1PU9 A;  2FL4 A;  4PK2 A;  4KOV A;  2PR8 A;  2OZH A;  2OZG A;  5AGE A;  2A4N A;  2CNS A;  5G1Z A;  3S6F A;  2ATR A;  2ZW4 A;  2VBQ A;  4J3G A;  4ORF A;  3QB8 A;  3TCV A;  3TE4 A;  4MFL A;  3VWE A;  2Z3K A;  2J8N A;  1YX0 A;  2PQ8 A;  1LRZ A;  4B10 A;  2FCK A;  3PGP A;  1OZP A;  4UCP A;  2Z3P A;  5E96 A;  1IYL A;  3BLN A;  4R87 A;  1IIC A;  1M4I A;  4KSA A;  5F49 A;  5H86 A;  4A2Z A;  1YVK A;  4KUB A;  2R8V A;  5A28 A;  1YR0 A;  4QBJ A;  4M3S A;  1M4G A;  3F8K A;  2CNT A;  4FD7 A;  3C26 A;  4BMH A;  4QB9 A;  2EUI A;  1ON0 A;  2P6G A;  4MJ8 A;  2J8M A;  1P0H A;  4X5K A;  3EO4 A;  4U9Y A;  5KTC A;  2Z3O A;  1B87 A;  4AG9 A;  4FD4 A;  2R98 A;  2O28 A;  5C82 A;  1MJB A;  4KOW A;  5KTA A;  4KLW A;  1TIQ A;  4CGN A;  5KTD A;  2JDD A;  3IWE A;  2VQY A;  1QSR A;  1IB1 E;  4KOX A;  5CNP A;  4H6U A;  4MY3 A;  1IYK A;  2I79 A;  2YNC C;  3FYN A;  1S7L A;  3F5B A;  5DWN A;  4QC6 A;  2DXQ A;  4A30 A;  4B13 A;  4KOY A;  1QST A;  5AG4 A;  4KZT A;  3OWC A;  3FRM A;  3TO6 A;  2OH1 A;  3EC4 A;  5BWA B;  1S3Z A;  5G22 A;  1S7K A;  3V8I A;  1WK4 A;  2FXF A;  1Z9U A;  2B5G A;  4B14 A;  1M4D A;  4DNC A;  2KCW A;  4UFX A;  4R57 A;  4AG7 A;  2Z3M A;  3TOA A;  2X7B A;  3EY5 A;  4HKF A;  1VHS A;  2YNC A;  4CYO A;  5IX3 A;  4Q36 A;  3R9E A;  4OLL A;  1KUY A;  4M85 A;  1KUX A;  4AB7 A;  4R9M A;  1S7F A;  1KUV A;  4RS2 A;  5I0C A;  3A9L A;  1XIX A;  4CGL A;  2Q44 A;  2FT0 A;  2PSW A;  2J8R A;  3PZJ A;  4C2X A;  2FE7 A;  4CYP A;  1P4N A;  3DR8 A;  1M1D A;  4MFP A;  4E8O A;  4AVB A;  4YRH A;  3MGD A;  4B5O A;  4FD6 A;  3TFY A;  1XMT A;  4KOS A;  1QSN A;  2OU2 A;  2REF A;  5G21 A;  4QUS A;  3I3G A;  4CAF A;  5AG5 A;  5HH1 A;  1Q2Y A;  3D3S A;  2Q4V A;  3TOB A;  2Z0Z A;  2G0B A;  4CGO A;  1RXT A;  1YK3 A;  4MBU A;  1ZO0 A;  4ZBG A;  4CYQ A;  2P6E A;  4Y49 C;  4ONU A;  3D8P A;  2QML A;  3LD2 A;  2ZW5 A;  1N71 A;  2DPT A;  4MFJ A;  3JUW A;  3FXT A;  5AG6 A;  4B12 A;  4H6Z A;  4L89 A;  2WPX A;  3R9F A;  3D2P A;  3NE7 A;  4ZGY B;  4B5P B;  4PSW A;  2Q4Y A;  4KVO E;  2ZW7 A;  1J4J A;  4AVA A;  3JVN A;  2Z10 A;  2ZW6 A;  4MHD A;  3S6G A;  4A33 A;  3IU2 A;  4NF1 A;  4OAD A;  2Q0Y A;  3W91 A;  2Z3L A;  1B6B A;  3F0A A;  4C7H A;  3D2M A;  3SXN A;  1XF8 A;  4KSF A;  2JEV A;  1CJW A;  4HNY B;  1YRE A;  2B4B A;  2P0W A;  1Y9K A;  4I49 A;  4IUS A;  1CM0 A;  4KVM E;  2GAN A;  4KOU A;  2G3T A;  3RYO A;  4CAE A;  2FIA A;  4UBR A;  4UCN A;  5GCN A;  4II9 A;  2QIR A;  5F48 A;  2CNM A;  2REE A;  3WR7 A;  4OAE A;  4C68 A;  4CS0 B;  4MFK A;  2CXA A;  2D4P A;  4CRY B;  2R7H A;  1BOB A;  3UY5 A;  3FIX A;  4L8A A;  4KOR A;  3VWD A;  2YND A;  2B3V A;  5H84 A;  4C2Z A;  4EVY A;  2PDO A;  5DWM A;  4UCM A;  3H5Z A;  5F46 A;  5J8F A;  5C88 A;  1NSL A;  4CAX A;  3DSB A;  4JJX A;  2AJ6 A;  2RC4 A;  4KS9 A;  3LOD A;  4CYN A;  3W6X A;  2FIW A;  1MK4 A;  2Q04 A;  3GKR A;  1UFH A;  2DPS A;  3FBU A;  2AE6 A;  3S6K A;  2HQY A;  1VKC A;  4A95 A;  4A31 A;  3GYA A;  3N7Z A;  4KVX A;  5AG7 A;  3PP9 A;  4E2A A;  4XPL A;  4C2Y A;  3FB3 A;  2B4D A;  2C27 A;  4Q38 A;  4F0X A;  2IL4 A;  4U9Z A;  4XPD C;  2H5M A;  5G20 A;  4UA3 A;  3W6S A;  3R95 A;  3IGR A;  4RI1 A;  2VXK A;  4E0A A;  1MJA A;  1R57 A;  4IF5 A;  4UFV A;  1FY7 A;  2G3A A;  4UWI A;  4UFW A;  5J8C A;  2Z3N A;  3FNC A;  4B11 A;  2PC1 A;  4LX9 A;  4YGO A;  4JXQ A;  3BJ8 A;  4GS4 A;  1K4J A;  2VEZ A;  2WSA A;  5JQ4 A;  3P2F A;  3GY9 A;  3QAH A;  2F5I A;  2HV2 A;  2B5G B;  4LUA A;  2JDC A;  4R3L A;  4A32 A;  1NMT A;  3EFA A;  1WWZ A;  3DDD A;  4F6A A;  2B3U A;  2BSW A;  4XNH C;  1PUA A;  2PR1 A;  4R3K A;  4CGM A;  2HUZ A;  1Q2D A;  2D4O A;  4NSQ A;  3TTH A;  4PK3 A;  3ZZI A;  3E0K A;  4F0Y A;  3R9G A;  4MI4 A;  1U6M A;  3H4Q A;  4HNX B;  4MFQ A;  1L0C A;  2Y0M A;  2NMT A;  4CGP A;  2BL1 A;  3G3S A;  1S60 A;  3IWG A;  2PRB A;  2GIV A;  3DNS A;  2CY2 A;  2I00 A;  3ZJ0 A;  2B4D B;  4JXR A;  5IV0 A;  4UWJ A;  1YGH A;  5EC4 A;  4CRZ B;  1V0C A;  1YVO A;  1RO5 A;  2FS5 A;  3K9U A;  1I1D A;  4MFZ A;  1Y7R A;  5EBV A;  2Q7B A;  2OB0 A;  4AVC A;  1IID A;  4NEX A;  2K5T A;  3TO7 A;  2BEI A;  3T9Y A;  2EVN A;  5A27 A;  2R1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...