4R57A

Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with acetyl-coa
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
170
structure length
170
Chain Sequence
NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Novel Polyamine Allosteric Site of SpeG from Vibrio cholerae Is Revealed by Its Dodecameric Structure.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Transferase
molecule keywords Spermidine n1-acetyltransferase
total genus 53
structure length 170
sequence length 170
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2014-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4r57A00
3IGRA 4KVME 2REEA 3T90A 3D3SA 4CRZB 3BJ8A 4AVBA 2JDCA 1VHSA 4XPLA 4KOVA 2Z0ZA 1QSRA 3FB3A 1Y9KA 4KVOE 1NSLA 5JQ4A 4F6AA 1CJWA 1KUVA 4IF5A 2PQ8A 2C27A 4KOTA 3V8IA 1GHEA 3P2HA 4KVXA 1M1DA 4XPDC 4CAXA 4XPKA 3I9SA 5HMNA 2OH1A 3LODA 4KUAA 1S7FA 2BUEA 1I1DA 3DR6A 3G8WA 2PC1A 3EXNA 5IB0A 4CRYB 5H86A 4OAEA 4MY0A 2ZW5A 4HNXB 1IIDA 1Q2CA 4J3GA 5DWNA 2FS5A 2VZZA 4UBRA 1NMTA 1TIQA 3F0AA 2CY2A 2B4DA 4XPDB 4LUAA 3VWEA 3FRMA 1S7NA 4U9ZA 2P6GA 4PSWA 1Z4EA 5F48A 3JVNA 5JPHA 2BEIA 3GY9A 2PR8A 3E0KA 1Y9WA 3I3GA 1B87A 2Q4VA 3TO6A 2O28A 3ZZIA 4UA3A 4KZTA 2J8RA 1U6MA 1CM0A 5J8FA 4NCZA 1YVOA 4KUBA 4NEXA 1N71A 2KCWA 4Y49B 2F5IA 2X7BA 1B6BA 1UFHA 1M44A 2J8MA 3SXOA 5HH1A 1M4IA 3K9UA 3G3SA 4ZBGA 3SHPA 3FXTA 3C26A 3CXQA 1ON0A 2R98A 2ZPAA 3TO9A 2FCKA 3LD2A 2Z10A 4FD6A 1V0CA 5IX3A 3TE4A 3R1KA 4MHDA 3GKRA 3R96A 2Q44A 4JXRA 3SXNA 5KTAA 1Y7RA 4CAVA 3B8GA 3ZJ0A 5I0CA 3RYOA 1I12A 5EBVA 1PUAA 2CNSA 1Z9UA 2GANA 1S7LA 4H6ZA 1XIXA 3F5BA 1KUXA 3UY5A 1P4NA 4PV6A 4AB7A 4B5PB 2B4BA 3W6SA 1S7KA 3S6KA 1YLEA 2AE6A 2Y0MA 3DSBA 2VQYA 1Q2DA 2Z11A 1YK3A 2B3VA 4AVCA 2ZW4A 2B4DB 2NMTA 4II9A 4XNHC 5F49A 2IL4A 2G3TA 1YX0A 4HNWB 1RO5A 1I21A 1MJ9A 2R8VA 4MBUA 3WR7A 3TFYA 4RI1A 5C88A 4E8OA 2K5TA 1S5KA 1Z4RA 2EVNA 4B5OA 2AJ6A 5F47A 3FNCA 4QBJA 4I49A 4GS4A 2VEZA 4KORA 3QAHA 4FD5A 4MY3A 5J8CA 5KTCA 3MGDA 4X5KA 3FBUA 4NXYA 3T9YA 4B5PA 1IYKA 4H6UA 2VZYA 3P2FA 4AG9A 1BOBA 5ISVA 2ARHA 3R9EA 1QSMA 2CNMA 3TO7A 1WK4A 3IWGA 4OADA 1PU9A 2D4OA 4L8AA 3TCVA 2FL4A 2WPXA 1FY7A 3QB8A 2RC4A 3CXPA 3JUWA 2A4NA 3S6HA 2ATRA 2P0WA 1KUYA 3BLNA 3BJ7A 5IV0A 4ORFA 3TTHA 4DNCA 3DR8A 1IB1E 2QIRA 2Q04A 3VWDA 2ZW7A 2JLMA 1VKCA 2PDOA 4QVTA 2OB0A 4KLWA 2FE7A 2VXKA 1YGHA 4U9YA 4E0AA 2PR1A 4UWJA 5F46A 3KKWA 1XE4A 4M3SA 3CXSA 2I79A 4R9MA 1QSOA 2HV2A 2EUIA 4MJ8A 3S6FA 1YREA 2OZGA 3D2MA 3D8PA 3EC4A 3PP9A 4QC6A 2OZHA 1MJAA 4F0YA 2Q0YA 1Q2YA 1IICA 4NF1A 2PSWA 1YR0A 4XNHB 5GCNA 2WPWA 2J8NA 3EO4A 4AVAA 1LRZA 2G0BA 4QB9A 3NE7A 2D4PA 1R57A 2OZUA 2QECA 3W6XA 4KOWA 2JDDA 3H4QA 4HNYB 4RS2A 2B58A 2BL1A 2Q4YA 2VBQA 2HQYA 2CNTA 4IUSA 1P0HA 3D2PA 4PK2A 4BMHA 4KOUA 2B5GB 2PRBA 1XF8A 5FVJA 5E96A 2R7HA 3TOBA 5DWMA 2FXFA 3EFAA 3OWCA 3DDDA 2B5GA 4E2AA 2P6FA 5KTDA 5EC4A 4LX9A 1XMTA 2GE3A 1WWZA 1RXTA 4PSXA 2GIVA 4KOYA 1S60A 2QMLA 4EVYA 4AG7A 1K4JA 3FYNA 2I00A 3R95A 1L0CA 2JEVA 2R1IA 4YRHA 4MI4A 2Q7BA 2OU2A 2FIWA 4KOSA 2FIAA 4M85A 4H89A 3PGPA 4FD4A 3W91A 4OLLA 2VI7A 2B3UA 5H84A 4R87A 3TOAA 2FT0A 4FD7A 4PK3A 3PZJA 3DNSA 4KOXA 1M4DA 4JWPA 3EY5A 4K30A 3TT2A 4Y49C 4YGOA 1XEBA 1MK4A 4CS0B 3GYAA 2P6EA 4R3LA 3R9GA 5C82A 4HKFA 4ONUA 4QUSA 1S3ZA 4KLVA 2FSRA 4R57A 4UWIA 2REFA 2HUZA 2G3AA 2ZW6A 2ZXVA 4L89A 4R3KA 5CNPA 1J4JA 1YVKA 2H5MA 4U5YA 1MJBA 4YFJA 1IYLA 1NE9A 2DXQA 3N7ZA 1SQHA 4JJXA 3S6GA 4NSQA 1QSNA 1KZFA 3FIXA 2BSWA 1BO4A 3R9FA 4CAWA 1M4GA 1OZPA 3F8KA 4JD6A 4JXQA 1QSTA 4JLYA
chains in the Genus database with same CATH superfamily
2AFUA 3IGRA 4KVME 2REEA 1IGBA 2PJ4A 3T90A 2FVGA 2ZENA 4LQGA 3D3SA 4OIWA 4CRZB 4NGNA 4PPZA 4NGMA 4MFKA 3GUXA 3BJ8A 4AVBA 4OC5A 2JDCA 3SI1A 3TC8A 2J9AA 1VHSA 4XPLA 3RNZA 4KSIA 3IU1A 4KOVA 5AG4A 2Z0ZA 3B3WA 1QSRA 3FB3A 1Y9KA 4KVOE 4NGPA 1NSLA 3NH8A 4F6AA 5JQ4A 1R3NA 1CJWA 1KUVA 4IF5A 3WC6A 2PQ8A 2C27A 4KOTA 4MHPA 1PYTB 4CAFA 3V8IA 3B7IA 2YNCC 4MMOA 1GHEA 3P2HA 4KVXA 1M1DA 1XBUA 1ZG8A 2O53A 2PRQA 4XPDC 4CAXA 4C68A 4XPKA 3I9SA 3KR5A 5HMNA 4ZY1A 4FUUA 3S9NA 2OH1A 3LODA 4KUAA 1KWMA 3IU2A 1S7FA 4A37A 4P6YA 2BUEA 1I1DA 3DGVA 4UCMA 1YSJA 3DR6A 4RN7A 3G8WA 2PC1A 4EFDA 3EXNA 2PJ6A 4UCNA 5IB0A 4CRYB 4A32A 5H86A 2XEFA 4F0XA 4IAVA 4Z65A 4OAEA 4MY0A 2ZW5A 4HNXB 1IIDA 1Q2CA 2DEAA 3FMCA 4J3GA 4GM5A 4JZ0A 4KS9A 1BPMA 5DWNA 1Z5RA 3JRUA 3VARA 2FS5A 2VZZA 4NGQA 4UBRA 4F9VA 2Z3KA 2ZEHA 4MRIA 1NMTA 2ZEDA 3IFEA 1TIQA 3F0AA 2CY2A 2B4DA 4XPDB 4LUAA 3KHXA 4CGLA 3A9LA 3WC7A 2PJ7A 2WUUA 4G1PA 4KSFA 3VWEA 2Q43A 3FRMA 1YW6A 4UIBA 5JM6A 3NH5A 1S7NA 4U9ZA 2PJBA 2P6GA 4ZY0A 4PSWA 4PXEA 1XOVA 1Z4EA 3PBBA 5F48A 3ISZA 3JVNA 5JPHA 2BEIA 3GY9A 5ELYA 2PR8A 3E0KA 3I1UA 1Y9WA 3HLPA 4ZX9A 2V8HA 5DS0A 3I3GA 4M6HA 1B87A 2Q4VA 3TO6A 1ELLP 2O28A 3ZZIA 1X12A 4KZTA 2J8RA 4P4JA 4UA3A 3V38A 2CXAA 1U6MA 1CM0A 5J8FA 2AFOA 3CDXA 2PJ1A 3NH4A 3QNVA 1YVOA 1GYTA 4NCZA 4WWVA 3GIUA 2YNCA 1CP6A 3PEIA 4KUBA 2KCWA 1N71A 4NEXA 4Y49B 2F5IA 2PIYA 2X7BA 5HXDA 2WSAA 1B6BA 1UFHA 1M44A 2J8MA 3SXOA 3B35A 1Z2LA 2Q51A 3H8EA 5LYLA 3D4UA 1AMPA 1TKFA 5HH1A 4CGMA 1M4IA 3K9UA 3G3SA 4ZBGA 3SHPA 1CX8A 3C26A 3FXTA 3CXQA 5THWA 1YMEA 1ON0A 2R98A 2ZPAA 1F2OA 3TO9A 2FCKA 4ZGYB 1FT7A 3H8GA 2PJ9A 2EO8A 3LD2A 2Z10A 3MRUA 2G9DA 1DTDA 1V0CA 1PCAA 4FD6A 4JYWA 5IX3A 3TE4A 4P44A 3R1KA 4MHDA 3LMSA 2ZEOA 4OC3A 3GKRA 3R96A 3PB7X 2Q44A 4JXRA 2V8DA 4MXUA 1BLLE 2DPTA 4PQAA 2RFHA 5LYFA 1ZLHA 3SXNA 5KTAA 1Y7RA 4A31A 4CAVA 4KSAA 2DPSA 3B8GA 3KGQA 1TF8A 4NGSA 2PJ2A 3ZJ0A 5I0CA 3RYOA 1I12A 3PB4X 5EBVA 4YWYA 3WT4A 2XEGA 1PUAA 1FNOA 2CNSA 1Z9UA 2GANA 4ONWA 5CPAA 3B3CA 1S7LA 2ZOGA 4H6ZA 4B11A 1XIXA 5F09A 1LOKA 4F9UA 4UEFA 3F5BA 4B14A 5CBMA 1KUXA 4OC4A 3UY5A 5EMIA 3H5ZA 2YNEA 1P4NA 1IOIA 2ZEPA 1M4LA 4P45A 4PV6A 2JEWA 4NFRA 3RZAA 4A2ZA 4AB7A 4B5PB 2B4BA 3W6SA 4A95A 1CPSA 4OC0A 1S7KA 3S6KA 1YLEA 4M6GA 1RTQA 2NYQA 3WC5A 4C7HA 2AE6A 2Z3OA 3CPAA 3VH9A 2Y0MA 1X10A 2PJ8A 2VQYA 1Q2DA 3DSBA 5K8PA 2WYRA 2Z11A 1YK3A 2B3VA 3B3TA 4AVCA 5A28A 2ZW4A 2B4DB 1LCPA 2NMTA 1XFOA 1LAMA 4MHYA 4XNHC 4II9A 5F49A 2HC9A 2GLFA 2IL4A 2PIZA 5J1QA 3D7FA 4Q36A 2G3TA 4ZY2A 5IB9A 1YX0A 2F7VA 4HNWB 1RO5A 5AG5A 1I21A 2PJAA 3GB0A 1MJ9A 4C2YA 2ZEFA 1YW4A 2R8VA 4MBUA 4UF4A 3WR7A 1R43A 3L2NA 2OR4A 3PB9X 4A94A 1Z8WA 3D7HA 3KHZA 2ZEEA 4H2KA 3VATA 4MCQA 3TFYA 4RI1A 2XEIA 3PRTA 2K5TA 4R8FA 2EK9A 1S5KA 4B10A 3K2KA 4E8OA 8CPAA 5JH9A 2AFSA 2AFZA 4CGPA 1Z4RA 2EVNA 3N5FA 4B5OA 3SI0A 1CP7A 2AJ6A 3NE8A 5F47A 3FNCA 3B3SA 4I49A 4W9YA 3RAMA 4QBJA 4GS4A 4ZI6A 2VEZA 4KORA 1XJOA 4A33A 3QAHA 3FVLA 4FD5A 4MY3A 3S9MA 1Z8LA 4P10A 5J8CA 1HDQA 5KTCA 3ISXA 3MGDA 4UFVA 4OMEA 1Z8XA 3D7GA 4X5KA 3FBUA 1HEEA 4NXYA 4P4DA 5G21A 3PB6X 3T9YA 4B5PA 1ZG9A 2GLJA 1IYKA 4H6UA 2WZNA 4MFQA 2VZYA 4CGOA 4DJLA 5HVHA 1IOFA 3P2FA 4CAEA 5LYDA 1Z8TA 2PVWA 4AG9A 1BOBA 2C6PA 5ISVA 2PE3A 2C1CA 3FF3A 5I4MA 2ARHA 4OC2A 4UCPA 3R9EA 1QSMA 2CNMA 4PXDA 3BI1A 2DF5A 4MFJA 2ZOFA 3TO7A 1CG2A 2ZEMA 3BI0A 4MHNA 1WK4A 3IWGA 4P4BA 4OADA 2QJ8A 5LRKA 1PU9A 2D4OA 4L8AA 2ZELA 2PCUA 2BOAA 1AUGA 4TNUA 3TCVA 4P4FA 2FL4A 1IU8A 3KL9A 7CPAA 2Q7SA 3HUVA 1H8LA 2WPXA 2O4HA 3DLJA 4PXBA 2I3CA 1FY7A 2ABZA 2BCOA 4AXVA 4UFXA 3IJ3A 3D67A 3RO0A 1IY7A 5JGFA 3QB8A 2PJ5A 4C2ZA 3IWEA 2RC4A 1ELMP 3KASA 3NFZA 4DYOA 3CXPA 1ARLA 2Z3NA 3JUWA 4CGNA 2GU2A 3IC1A 2A4NA 3IWWA 3S6HA 5K8NA 3QAYA 2ATRA 2P0WA 1KUYA 3BLNA 3BJ7A 5IV0A 4ORFA 2NSMA 4R7MA 4R76A 3TTHA 3PFEA 3DR8A 4DNCA 1CBXA 4F8ZA 1IB1E 1UWYA 1Y0YA 2QIRA 1JWQA 5K8MA 3LACA 1TF9A 2Q04A 3VWDA 2ZW7A 2JLMA 3GLJA 1VKCA 2PDOA 4QVTA 1Y0RA 2OB0A 1DE4C 2ODFA 4KLWA 4BINA 4TWEA 2FE7A 2GFQA 2VXKA 4UIAA 4B12A 3KQXA 4ZYQA 5G1ZA 1VHOA 1YGHA 4FAIA 4U9YA 4E0AA 2POKA 2PR1A 4UWJA 5F46A 1ARMA 1XE4A 2Q4ZA 3B2YA 3CXSA 2I79A 3KKWA 2BO9A 4M3SA 4R9MA 4B13A 1A2ZA 4RUHA 5K8OA 4YU9A 4CYPA 1LAPA 3FEDA 1QSOA 2HV2A 2EUIA 4MJ8A 3S6FA 3WABA 1Y7EA 4BBHA 1YREA 1ZLIA 1YQEA 2OZGA 4CYQA 5G20A 3D2MA 2V77A 3D8PA 2XEJA 3EC4A 3PP9A 4QC6A 4NJRA 2OZHA 4IK2A 2Z3LA 5LRJA 4M6IA 4C2XA 1MJAA 4F0YA 2Q0YA 1Q2YA 1IICA 2IMOA 3JTKA 4NF1A 2PSWA 1YR0A 4XNHB 5GCNA 4FBEA 1QQ9A 3KQZA 2Z3MA 2PJCA 3IIBA 3KI9A 4Q38A 2WPWA 4X2TA 2EK8A 2J8NA 3EO4A 4AVAA 3SJGA 1F2PA 1LRZA 2G0BA 4QB9A 3PB8X 4UFWA 4MHZA 3NE7A 2D4PA 1R57A 2OZUA 2QECA 4EWTA 5LYIA 4KOWA 2JDDA 2Z3PA 3H4QA 4HNYB 1ZG7A 2EBJA 5HVFA 3W6XA 3K9TA 2BL1A 2B58A 4RS2A 2Q4YA 1VGYA 2ZEGA 2VBQA 2AFMA 2HQYA 2CNTA 1BPNA 1NSAA 4IUSA 1P0HA 4MFPA 3D2PA 2F8HA 4PK2A 4MCSA 4BMHA 5BWAB 2C6CA 4Q7AA 2QVPA 3SI2A 4KOUA 2B5GB 1F57A 2PRBA 4CPAA 1XF8A 5FVJA 5AG6A 5E96A 2R7HA 3MN8A 3TOBA 4A30A 5DWMA 1LFWA 3S9LA 2FXFA 2VL1A 3EFAA 3OWCA 3DDDA 4A38A 2B5GA 4E2AA 2P6FA 5KTDA 5EC4A 3D68A 3CPXA 2JBKA 4LX9A 2CTBA 3BXMA 1XMTA 1BAVA 2GE3A 3D7DA 1WWZA 4NGTA 1RXTA 1VIXA 1QMUA 4PSXA 3CT9A 2GIVA 4KOYA 4PXCA 1S60A 2QMLA 4EVYA 3SJFA 4AG7A 2V8VA 1K4JA 4CYNA 4EMEA 3FYNA 2I00A 4MFLA 3R95A 4DUKA 4MFZA 3FEEA 1L0CA 2JEVA 2PJ3A 2R1IA 4OP4A 3PBEA 4MI4A 4UEEA 3FX6A 4YRHA 2Q7BA 3IO1A 4OIDA 2OU2A 5AGEA 2FIWA 4KOSA 2PVVA 2FIAA 4HPSA 4M85A 4H89A 3PGPA 4P4EA 5AG7A 3LWUA 4FD4A 4B6ZA 3W91A 2HB6A 3V7ZA 4OLLA 3BHXA 4A39A 2QYVA 1XMBA 2VI7A 3T8WA 2B3UA 4CYOA 5H84A 4R87A 3TOAA 2FT0A 2AFWA 4FD7A 4PK3A 1TKHA 1TKJA 5HVGA 3PZJA 4UEZA 1AYEA 3DNSA 2EWBA 4KOXA 3KR4A 4X3RA 4K3NA 1M4DA 1Q7LA 4JWPA 3EY5A 1JQGA 3FECA 4GXHA 4K30A 2IJZA 3TT2A 2CTCA 4LQ6A 4NJQA 4IHMA 1OBRA 4Y49C 2YNDA 4YGOA 4BD9A 1XEBA 1XRYA 4C7IA 5C88A 3FJUA 1MK4A 1YLOA 3SJEA 3GYAA 3IEHA 4CS0B 2P6EA 4O23A 2ANPA 1TXRA 4R3LA 3R9GA 5C82A 4P4IA 4HKFA 4ONUA 3B3VA 2CF4A 4QUSA 4WJBA 1S3ZA 4KLVA 5D8NA 2FSRA 2V8GA 4R57A 4X8IA 5A27A 4UWIA 2REFA 5LRGA 2HUZA 3NA6A 2G3AA 2GREA 4NGRA 2ZW6A 4ZX8A 1HDUA 2ZXVA 4L89A 4R3KA 5CNPA 5G22A 1J4JA 1ZO0A 1YVKA 2H5MA 2IQ6A 3PFOA 2PJ0A 4U5YA 1MJBA 4YFJA 2CIJA 1IYLA 1NE9A 2DXQA 3N7ZA 1SQHA 1EE3P 5D29A 4JJXA 2RB7A 4OKOA 1LANA 3S6GA 3CZXA 4NSQA 1QSNA 1KZFA 3TX8A 1VHEA 2BSWA 2C6GA 3FIXA 1BO4A 4FWUA 4OC1A 2OOTA 3R9FA 6CPAA 4CAWA 3SJXA 2AFXA 2JBJA 3FH4A 1M4GA 1OZPA 4MCRA 4R6TA 2YGWA 3F8KA 4JD6A 1CPXA 4JXQA 4MCPA 3H8FA 3RBUA 3KZWA 3D66A 1QSTA 4JLYA
chains in the Genus database with same CATH topology
3IGRA 4KVME 2REEA 3T90A 3D3SA 4CRZB 4MFKA 3BJ8A 4AVBA 2JDCA 1VHSA 4XPLA 3IU1A 4KOVA 5AG4A 2Z0ZA 1QSRA 3FB3A 1Y9KA 4KVOE 1NSLA 5JQ4A 4F6AA 1CJWA 1KUVA 4IF5A 2PQ8A 2C27A 4KOTA 4CAFA 3V8IA 2YNCC 1GHEA 3P2HA 4KVXA 1M1DA 4XPDC 4CAXA 4C68A 4XPKA 3I9SA 5HMNA 2OH1A 3LODA 4KUAA 3IU2A 1S7FA 2BUEA 1I1DA 4UCMA 3DR6A 3G8WA 2PC1A 3EXNA 4UCNA 5IB0A 4CRYB 4A32A 5H86A 4F0XA 4OAEA 4MY0A 2ZW5A 4HNXB 1IIDA 1Q2CA 4J3GA 5DWNA 4KS9A 2FS5A 2VZZA 4UBRA 2Z3KA 1NMTA 1TIQA 3F0AA 2CY2A 2B4DA 4XPDB 4LUAA 4CGLA 3A9LA 2WUUA 4KSFA 3VWEA 3FRMA 1S7NA 4U9ZA 2P6GA 4PSWA 1Z4EA 5F48A 3JVNA 5JPHA 2BEIA 3GY9A 2PR8A 3E0KA 1Y9WA 3I3GA 1B87A 2Q4VA 3TO6A 2O28A 3ZZIA 4UA3A 4KZTA 2J8RA 2CXAA 1U6MA 1CM0A 5J8FA 4NCZA 1YVOA 2YNCA 4KUBA 1N71A 2KCWA 4NEXA 4Y49B 2F5IA 2X7BA 2WSAA 1B6BA 1UFHA 1M44A 2J8MA 3SXOA 4CGMA 5HH1A 1M4IA 3K9UA 3G3SA 4ZBGA 3SHPA 3FXTA 3C26A 3CXQA 1ON0A 2R98A 2ZPAA 3TO9A 2FCKA 4ZGYB 3LD2A 2Z10A 4FD6A 1V0CA 5IX3A 3TE4A 3R1KA 4MHDA 3GKRA 3R96A 2Q44A 4JXRA 2DPTA 3SXNA 5KTAA 1Y7RA 4A31A 4CAVA 4KSAA 2DPSA 3B8GA 3ZJ0A 5I0CA 3RYOA 1I12A 5EBVA 1PUAA 2CNSA 1Z9UA 2GANA 1S7LA 4H6ZA 4B11A 1XIXA 3F5BA 4B14A 1KUXA 3UY5A 3H5ZA 2YNEA 1P4NA 4PV6A 4A2ZA 4AB7A 4B5PB 2B4BA 3W6SA 4A95A 1S7KA 3S6KA 1YLEA 4C7HA 2AE6A 2Z3OA 2Y0MA 3DSBA 2VQYA 1Q2DA 2Z11A 1YK3A 2B3VA 4AVCA 5A28A 2ZW4A 2B4DB 2NMTA 4II9A 4XNHC 5F49A 2IL4A 4Q36A 2G3TA 1YX0A 4HNWB 1RO5A 5AG5A 1I21A 1MJ9A 4C2YA 2R8VA 4MBUA 3WR7A 3TFYA 4RI1A 4B10A 4E8OA 2K5TA 5C88A 1S5KA 4CGPA 1Z4RA 2EVNA 4B5OA 2AJ6A 5F47A 3FNCA 4QBJA 4I49A 4GS4A 2VEZA 4KORA 4A33A 3QAHA 4FD5A 4MY3A 5J8CA 5KTCA 3MGDA 4UFVA 4X5KA 3FBUA 4NXYA 3T9YA 5G21A 4B5PA 4MFQA 1IYKA 4H6UA 2VZYA 4CGOA 3P2FA 4CAEA 4AG9A 1BOBA 5ISVA 2ARHA 3R9EA 4UCPA 1QSMA 2CNMA 4MFJA 3TO7A 1WK4A 3IWGA 4OADA 1PU9A 2D4OA 4L8AA 3TCVA 2FL4A 2WPXA 1FY7A 4UFXA 3QB8A 4C2ZA 3IWEA 2RC4A 3CXPA 2Z3NA 3JUWA 4CGNA 2A4NA 3S6HA 2ATRA 2P0WA 1KUYA 3BLNA 3BJ7A 5IV0A 4ORFA 3TTHA 4DNCA 3DR8A 1IB1E 2QIRA 2Q04A 3VWDA 2ZW7A 2JLMA 1VKCA 2PDOA 4QVTA 2OB0A 4KLWA 2FE7A 2VXKA 4B12A 5G1ZA 1YGHA 4U9YA 4E0AA 2PR1A 4UWJA 5F46A 3KKWA 1XE4A 4M3SA 3CXSA 2I79A 4R9MA 4B13A 4CYPA 1QSOA 2HV2A 2EUIA 4MJ8A 3S6FA 4BBHA 1YREA 2OZGA 4CYQA 5G20A 3D2MA 3D8PA 3EC4A 3PP9A 4QC6A 2OZHA 2Z3LA 4C2XA 1MJAA 4F0YA 2Q0YA 1Q2YA 1IICA 3JTKA 4NF1A 2PSWA 1YR0A 4XNHB 5GCNA 2Z3MA 4Q38A 2WPWA 2J8NA 3EO4A 4AVAA 1LRZA 2G0BA 4QB9A 4UFWA 3NE7A 2D4PA 1R57A 2OZUA 2QECA 3W6XA 4KOWA 2JDDA 4HNYB 2Z3PA 3H4QA 2BL1A 2B58A 4RS2A 2Q4YA 2VBQA 2HQYA 2CNTA 4IUSA 1P0HA 4MFPA 3D2PA 4PK2A 4BMHA 5BWAB 4KOUA 2B5GB 2PRBA 1XF8A 5FVJA 5AG6A 5E96A 2R7HA 3TOBA 4A30A 5DWMA 2FXFA 3EFAA 3OWCA 3DDDA 2B5GA 4E2AA 2P6FA 5KTDA 5EC4A 4LX9A 1XMTA 2GE3A 1WWZA 1RXTA 4PSXA 2GIVA 4KOYA 1S60A 2QMLA 4EVYA 4AG7A 1K4JA 4CYNA 3FYNA 2I00A 4MFLA 3R95A 4MFZA 1L0CA 2JEVA 2R1IA 4YRHA 4MI4A 2Q7BA 2OU2A 5AGEA 2FIWA 4KOSA 2FIAA 4M85A 4H89A 3PGPA 5AG7A 4FD4A 3W91A 4OLLA 2VI7A 2B3UA 4CYOA 5H84A 4R87A 3TOAA 2FT0A 4FD7A 4PK3A 3PZJA 3DNSA 4KOXA 1M4DA 4JWPA 3EY5A 4K30A 3TT2A 4Y49C 2YNDA 4YGOA 1XEBA 4C7IA 1MK4A 4CS0B 3GYAA 2P6EA 4R3LA 3R9GA 5C82A 4HKFA 4ONUA 4QUSA 1S3ZA 4KLVA 2FSRA 4R57A 5A27A 4UWIA 2REFA 2HUZA 2G3AA 2ZW6A 2ZXVA 4L89A 4R3KA 5CNPA 5G22A 1J4JA 1ZO0A 1YVKA 2H5MA 4U5YA 1MJBA 4YFJA 1IYLA 1NE9A 2DXQA 3N7ZA 1SQHA 4JJXA 3S6GA 4NSQA 1QSNA 1KZFA 3FIXA 2BSWA 1BO4A 3R9FA 4CAWA 1M4GA 1OZPA 2YGWA 3F8KA 4JD6A 4JXQA 1QSTA 4JLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IGR A;  4KVM E;  2REE A;  3T90 A;  3D3S A;  4CRZ B;  3BJ8 A;  4AVB A;  2JDC A;  1VHS A;  4XPL A;  4KOV A;  2Z0Z A;  1QSR A;  3FB3 A;  1Y9K A;  4KVO E;  1NSL A;  5JQ4 A;  4F6A A;  1CJW A;  1KUV A;  4IF5 A;  2PQ8 A;  2C27 A;  4KOT A;  3V8I A;  1GHE A;  3P2H A;  4KVX A;  1M1D A;  4XPD C;  4CAX A;  4XPK A;  3I9S A;  5HMN A;  2OH1 A;  3LOD A;  4KUA A;  1S7F A;  2BUE A;  1I1D A;  3DR6 A;  3G8W A;  2PC1 A;  3EXN A;  5IB0 A;  4CRY B;  5H86 A;  4OAE A;  4MY0 A;  2ZW5 A;  4HNX B;  1IID A;  1Q2C A;  4J3G A;  5DWN A;  2FS5 A;  2VZZ A;  4UBR A;  1NMT A;  1TIQ A;  3F0A A;  2CY2 A;  2B4D A;  4XPD B;  4LUA A;  3VWE A;  3FRM A;  1S7N A;  4U9Z A;  2P6G A;  4PSW A;  1Z4E A;  5F48 A;  3JVN A;  5JPH A;  2BEI A;  3GY9 A;  2PR8 A;  3E0K A;  1Y9W A;  3I3G A;  1B87 A;  2Q4V A;  3TO6 A;  2O28 A;  3ZZI A;  4UA3 A;  4KZT A;  2J8R A;  1U6M A;  1CM0 A;  5J8F A;  4NCZ A;  1YVO A;  4KUB A;  4NEX A;  1N71 A;  2KCW A;  4Y49 B;  2F5I A;  2X7B A;  1B6B A;  1UFH A;  1M44 A;  2J8M A;  3SXO A;  5HH1 A;  1M4I A;  3K9U A;  3G3S A;  4ZBG A;  3SHP A;  3FXT A;  3C26 A;  3CXQ A;  1ON0 A;  2R98 A;  2ZPA A;  3TO9 A;  2FCK A;  3LD2 A;  2Z10 A;  4FD6 A;  1V0C A;  5IX3 A;  3TE4 A;  3R1K A;  4MHD A;  3GKR A;  3R96 A;  2Q44 A;  4JXR A;  3SXN A;  5KTA A;  1Y7R A;  4CAV A;  3B8G A;  3ZJ0 A;  5I0C A;  3RYO A;  1I12 A;  5EBV A;  1PUA A;  2CNS A;  1Z9U A;  2GAN A;  1S7L A;  4H6Z A;  1XIX A;  3F5B A;  1KUX A;  3UY5 A;  1P4N A;  4PV6 A;  4AB7 A;  4B5P B;  2B4B A;  3W6S A;  1S7K A;  3S6K A;  1YLE A;  2AE6 A;  2Y0M A;  3DSB A;  2VQY A;  1Q2D A;  2Z11 A;  1YK3 A;  2B3V A;  4AVC A;  2ZW4 A;  2B4D B;  2NMT A;  4II9 A;  4XNH C;  5F49 A;  2IL4 A;  2G3T A;  1YX0 A;  4HNW B;  1RO5 A;  1I21 A;  1MJ9 A;  2R8V A;  4MBU A;  3WR7 A;  3TFY A;  4RI1 A;  5C88 A;  4E8O A;  2K5T A;  1S5K A;  1Z4R A;  2EVN A;  4B5O A;  2AJ6 A;  5F47 A;  3FNC A;  4QBJ A;  4I49 A;  4GS4 A;  2VEZ A;  4KOR A;  3QAH A;  4FD5 A;  4MY3 A;  5J8C A;  5KTC A;  3MGD A;  4X5K A;  3FBU A;  4NXY A;  3T9Y A;  4B5P A;  1IYK A;  4H6U A;  2VZY A;  3P2F A;  4AG9 A;  1BOB A;  5ISV A;  2ARH A;  3R9E A;  1QSM A;  2CNM A;  3TO7 A;  1WK4 A;  3IWG A;  4OAD A;  1PU9 A;  2D4O A;  4L8A A;  3TCV A;  2FL4 A;  2WPX A;  1FY7 A;  3QB8 A;  2RC4 A;  3CXP A;  3JUW A;  2A4N A;  3S6H A;  2ATR A;  2P0W A;  1KUY A;  3BLN A;  3BJ7 A;  5IV0 A;  4ORF A;  3TTH A;  4DNC A;  3DR8 A;  1IB1 E;  2QIR A;  2Q04 A;  3VWD A;  2ZW7 A;  2JLM A;  1VKC A;  2PDO A;  4QVT A;  2OB0 A;  4KLW A;  2FE7 A;  2VXK A;  1YGH A;  4U9Y A;  4E0A A;  2PR1 A;  4UWJ A;  5F46 A;  3KKW A;  1XE4 A;  4M3S A;  3CXS A;  2I79 A;  4R9M A;  1QSO A;  2HV2 A;  2EUI A;  4MJ8 A;  3S6F A;  1YRE A;  2OZG A;  3D2M A;  3D8P A;  3EC4 A;  3PP9 A;  4QC6 A;  2OZH A;  1MJA A;  4F0Y A;  2Q0Y A;  1Q2Y A;  1IIC A;  4NF1 A;  2PSW A;  1YR0 A;  4XNH B;  5GCN A;  2WPW A;  2J8N A;  3EO4 A;  4AVA A;  1LRZ A;  2G0B A;  4QB9 A;  3NE7 A;  2D4P A;  1R57 A;  2OZU A;  2QEC A;  3W6X A;  4KOW A;  2JDD A;  3H4Q A;  4HNY B;  4RS2 A;  2B58 A;  2BL1 A;  2Q4Y A;  2VBQ A;  2HQY A;  2CNT A;  4IUS A;  1P0H A;  3D2P A;  4PK2 A;  4BMH A;  4KOU A;  2B5G B;  2PRB A;  1XF8 A;  5FVJ A;  5E96 A;  2R7H A;  3TOB A;  5DWM A;  2FXF A;  3EFA A;  3OWC A;  3DDD A;  2B5G A;  4E2A A;  2P6F A;  5KTD A;  5EC4 A;  4LX9 A;  1XMT A;  2GE3 A;  1WWZ A;  1RXT A;  4PSX A;  2GIV A;  4KOY A;  1S60 A;  2QML A;  4EVY A;  4AG7 A;  1K4J A;  3FYN A;  2I00 A;  3R95 A;  1L0C A;  2JEV A;  2R1I A;  4YRH A;  4MI4 A;  2Q7B A;  2OU2 A;  2FIW A;  4KOS A;  2FIA A;  4M85 A;  4H89 A;  3PGP A;  4FD4 A;  3W91 A;  4OLL A;  2VI7 A;  2B3U A;  5H84 A;  4R87 A;  3TOA A;  2FT0 A;  4FD7 A;  4PK3 A;  3PZJ A;  3DNS A;  4KOX A;  1M4D A;  4JWP A;  3EY5 A;  4K30 A;  3TT2 A;  4Y49 C;  4YGO A;  1XEB A;  1MK4 A;  4CS0 B;  3GYA A;  2P6E A;  4R3L A;  3R9G A;  5C82 A;  4HKF A;  4ONU A;  4QUS A;  1S3Z A;  4KLV A;  2FSR A;  4R57 A;  4UWI A;  2REF A;  2HUZ A;  2G3A A;  2ZW6 A;  2ZXV A;  4L89 A;  4R3K A;  5CNP A;  1J4J A;  1YVK A;  2H5M A;  4U5Y A;  1MJB A;  4YFJ A;  1IYL A;  1NE9 A;  2DXQ A;  3N7Z A;  1SQH A;  4JJX A;  3S6G A;  4NSQ A;  1QSN A;  1KZF A;  3FIX A;  2BSW A;  1BO4 A;  3R9F A;  4CAW A;  1M4G A;  1OZP A;  3F8K A;  4JD6 A;  4JXQ A;  1QST A;  4JLY A; 
#chains in the Genus database with same CATH topology
 2AFU A;  3IGR A;  4KVM E;  2REE A;  1IGB A;  2PJ4 A;  3T90 A;  2FVG A;  2ZEN A;  4LQG A;  3D3S A;  4OIW A;  4CRZ B;  4NGN A;  4PPZ A;  4NGM A;  4MFK A;  3GUX A;  3BJ8 A;  4AVB A;  4OC5 A;  2JDC A;  3SI1 A;  3TC8 A;  2J9A A;  1VHS A;  4XPL A;  3RNZ A;  4KSI A;  3IU1 A;  4KOV A;  5AG4 A;  2Z0Z A;  3B3W A;  1QSR A;  3FB3 A;  1Y9K A;  4KVO E;  4NGP A;  1NSL A;  3NH8 A;  4F6A A;  5JQ4 A;  1R3N A;  1CJW A;  1KUV A;  4IF5 A;  3WC6 A;  2PQ8 A;  2C27 A;  4KOT A;  4MHP A;  1PYT B;  4CAF A;  3V8I A;  3B7I A;  2YNC C;  4MMO A;  1GHE A;  3P2H A;  4KVX A;  1M1D A;  1XBU A;  1ZG8 A;  2O53 A;  2PRQ A;  4XPD C;  4CAX A;  4C68 A;  4XPK A;  3I9S A;  3KR5 A;  5HMN A;  4ZY1 A;  4FUU A;  3S9N A;  2OH1 A;  3LOD A;  4KUA A;  1KWM A;  3IU2 A;  1S7F A;  4A37 A;  4P6Y A;  2BUE A;  1I1D A;  3DGV A;  4UCM A;  1YSJ A;  3DR6 A;  4RN7 A;  3G8W A;  2PC1 A;  4EFD A;  3EXN A;  2PJ6 A;  4UCN A;  5IB0 A;  4CRY B;  4A32 A;  5H86 A;  2XEF A;  4F0X A;  4IAV A;  4Z65 A;  4OAE A;  4MY0 A;  2ZW5 A;  4HNX B;  1IID A;  1Q2C A;  2DEA A;  3FMC A;  4J3G A;  4GM5 A;  4JZ0 A;  4KS9 A;  1BPM A;  5DWN A;  1Z5R A;  3JRU A;  3VAR A;  2FS5 A;  2VZZ A;  4NGQ A;  4UBR A;  4F9V A;  2Z3K A;  2ZEH A;  4MRI A;  1NMT A;  2ZED A;  3IFE A;  1TIQ A;  3F0A A;  2CY2 A;  2B4D A;  4XPD B;  4LUA A;  3KHX A;  4CGL A;  3A9L A;  3WC7 A;  2PJ7 A;  2WUU A;  4G1P A;  4KSF A;  3VWE A;  2Q43 A;  3FRM A;  1YW6 A;  4UIB A;  5JM6 A;  3NH5 A;  1S7N A;  4U9Z A;  2PJB A;  2P6G A;  4ZY0 A;  4PSW A;  4PXE A;  1XOV A;  1Z4E A;  3PBB A;  5F48 A;  3ISZ A;  3JVN A;  5JPH A;  2BEI A;  3GY9 A;  5ELY A;  2PR8 A;  3E0K A;  3I1U A;  1Y9W A;  3HLP A;  4ZX9 A;  2V8H A;  5DS0 A;  3I3G A;  4M6H A;  1B87 A;  2Q4V A;  3TO6 A;  1ELL P;  2O28 A;  3ZZI A;  1X12 A;  4KZT A;  2J8R A;  4P4J A;  4UA3 A;  3V38 A;  2CXA A;  1U6M A;  1CM0 A;  5J8F A;  2AFO A;  3CDX A;  2PJ1 A;  3NH4 A;  3QNV A;  1YVO A;  1GYT A;  4NCZ A;  4WWV A;  3GIU A;  2YNC A;  1CP6 A;  3PEI A;  4KUB A;  2KCW A;  1N71 A;  4NEX A;  4Y49 B;  2F5I A;  2PIY A;  2X7B A;  5HXD A;  2WSA A;  1B6B A;  1UFH A;  1M44 A;  2J8M A;  3SXO A;  3B35 A;  1Z2L A;  2Q51 A;  3H8E A;  5LYL A;  3D4U A;  1AMP A;  1TKF A;  5HH1 A;  4CGM A;  1M4I A;  3K9U A;  3G3S A;  4ZBG A;  3SHP A;  1CX8 A;  3C26 A;  3FXT A;  3CXQ A;  5THW A;  1YME A;  1ON0 A;  2R98 A;  2ZPA A;  1F2O A;  3TO9 A;  2FCK A;  4ZGY B;  1FT7 A;  3H8G A;  2PJ9 A;  2EO8 A;  3LD2 A;  2Z10 A;  3MRU A;  2G9D A;  1DTD A;  1V0C A;  1PCA A;  4FD6 A;  4JYW A;  5IX3 A;  3TE4 A;  4P44 A;  3R1K A;  4MHD A;  3LMS A;  2ZEO A;  4OC3 A;  3GKR A;  3R96 A;  3PB7 X;  2Q44 A;  4JXR A;  2V8D A;  4MXU A;  1BLL E;  2DPT A;  4PQA A;  2RFH A;  5LYF A;  1ZLH A;  3SXN A;  5KTA A;  1Y7R A;  4A31 A;  4CAV A;  4KSA A;  2DPS A;  3B8G A;  3KGQ A;  1TF8 A;  4NGS A;  2PJ2 A;  3ZJ0 A;  5I0C A;  3RYO A;  1I12 A;  3PB4 X;  5EBV A;  4YWY A;  3WT4 A;  2XEG A;  1PUA A;  1FNO A;  2CNS A;  1Z9U A;  2GAN A;  4ONW A;  5CPA A;  3B3C A;  1S7L A;  2ZOG A;  4H6Z A;  4B11 A;  1XIX A;  5F09 A;  1LOK A;  4F9U A;  4UEF A;  3F5B A;  4B14 A;  5CBM A;  1KUX A;  4OC4 A;  3UY5 A;  5EMI A;  3H5Z A;  2YNE A;  1P4N A;  1IOI A;  2ZEP A;  1M4L A;  4P45 A;  4PV6 A;  2JEW A;  4NFR A;  3RZA A;  4A2Z A;  4AB7 A;  4B5P B;  2B4B A;  3W6S A;  4A95 A;  1CPS A;  4OC0 A;  1S7K A;  3S6K A;  1YLE A;  4M6G A;  1RTQ A;  2NYQ A;  3WC5 A;  4C7H A;  2AE6 A;  2Z3O A;  3CPA A;  3VH9 A;  2Y0M A;  1X10 A;  2PJ8 A;  2VQY A;  1Q2D A;  3DSB A;  5K8P A;  2WYR A;  2Z11 A;  1YK3 A;  2B3V A;  3B3T A;  4AVC A;  5A28 A;  2ZW4 A;  2B4D B;  1LCP A;  2NMT A;  1XFO A;  1LAM A;  4MHY A;  4XNH C;  4II9 A;  5F49 A;  2HC9 A;  2GLF A;  2IL4 A;  2PIZ A;  5J1Q A;  3D7F A;  4Q36 A;  2G3T A;  4ZY2 A;  5IB9 A;  1YX0 A;  2F7V A;  4HNW B;  1RO5 A;  5AG5 A;  1I21 A;  2PJA A;  3GB0 A;  1MJ9 A;  4C2Y A;  2ZEF A;  1YW4 A;  2R8V A;  4MBU A;  4UF4 A;  3WR7 A;  1R43 A;  3L2N A;  2OR4 A;  3PB9 X;  4A94 A;  1Z8W A;  3D7H A;  3KHZ A;  2ZEE A;  4H2K A;  3VAT A;  4MCQ A;  3TFY A;  4RI1 A;  2XEI A;  3PRT A;  2K5T A;  4R8F A;  2EK9 A;  1S5K A;  4B10 A;  3K2K A;  4E8O A;  8CPA A;  5JH9 A;  2AFS A;  2AFZ A;  4CGP A;  1Z4R A;  2EVN A;  3N5F A;  4B5O A;  3SI0 A;  1CP7 A;  2AJ6 A;  3NE8 A;  5F47 A;  3FNC A;  3B3S A;  4I49 A;  4W9Y A;  3RAM A;  4QBJ A;  4GS4 A;  4ZI6 A;  2VEZ A;  4KOR A;  1XJO A;  4A33 A;  3QAH A;  3FVL A;  4FD5 A;  4MY3 A;  3S9M A;  1Z8L A;  4P10 A;  5J8C A;  1HDQ A;  5KTC A;  3ISX A;  3MGD A;  4UFV A;  4OME A;  1Z8X A;  3D7G A;  4X5K A;  3FBU A;  1HEE A;  4NXY A;  4P4D A;  5G21 A;  3PB6 X;  3T9Y A;  4B5P A;  1ZG9 A;  2GLJ A;  1IYK A;  4H6U A;  2WZN A;  4MFQ A;  2VZY A;  4CGO A;  4DJL A;  5HVH A;  1IOF A;  3P2F A;  4CAE A;  5LYD A;  1Z8T A;  2PVW A;  4AG9 A;  1BOB A;  2C6P A;  5ISV A;  2PE3 A;  2C1C A;  3FF3 A;  5I4M A;  2ARH A;  4OC2 A;  4UCP A;  3R9E A;  1QSM A;  2CNM A;  4PXD A;  3BI1 A;  2DF5 A;  4MFJ A;  2ZOF A;  3TO7 A;  1CG2 A;  2ZEM A;  3BI0 A;  4MHN A;  1WK4 A;  3IWG A;  4P4B A;  4OAD A;  2QJ8 A;  5LRK A;  1PU9 A;  2D4O A;  4L8A A;  2ZEL A;  2PCU A;  2BOA A;  1AUG A;  4TNU A;  3TCV A;  4P4F A;  2FL4 A;  1IU8 A;  3KL9 A;  7CPA A;  2Q7S A;  3HUV A;  1H8L A;  2WPX A;  2O4H A;  3DLJ A;  4PXB A;  2I3C A;  1FY7 A;  2ABZ A;  2BCO A;  4AXV A;  4UFX A;  3IJ3 A;  3D67 A;  3RO0 A;  1IY7 A;  5JGF A;  3QB8 A;  2PJ5 A;  4C2Z A;  3IWE A;  2RC4 A;  1ELM P;  3KAS A;  3NFZ A;  4DYO A;  3CXP A;  1ARL A;  2Z3N A;  3JUW A;  4CGN A;  2GU2 A;  3IC1 A;  2A4N A;  3IWW A;  3S6H A;  5K8N A;  3QAY A;  2ATR A;  2P0W A;  1KUY A;  3BLN A;  3BJ7 A;  5IV0 A;  4ORF A;  2NSM A;  4R7M A;  4R76 A;  3TTH A;  3PFE A;  3DR8 A;  4DNC A;  1CBX A;  4F8Z A;  1IB1 E;  1UWY A;  1Y0Y A;  2QIR A;  1JWQ A;  5K8M A;  3LAC A;  1TF9 A;  2Q04 A;  3VWD A;  2ZW7 A;  2JLM A;  3GLJ A;  1VKC A;  2PDO A;  4QVT A;  1Y0R A;  2OB0 A;  1DE4 C;  2ODF A;  4KLW A;  4BIN A;  4TWE A;  2FE7 A;  2GFQ A;  2VXK A;  4UIA A;  4B12 A;  3KQX A;  4ZYQ A;  5G1Z A;  1VHO A;  1YGH A;  4FAI A;  4U9Y A;  4E0A A;  2POK A;  2PR1 A;  4UWJ A;  5F46 A;  1ARM A;  1XE4 A;  2Q4Z A;  3B2Y A;  3CXS A;  2I79 A;  3KKW A;  2BO9 A;  4M3S A;  4R9M A;  4B13 A;  1A2Z A;  4RUH A;  5K8O A;  4YU9 A;  4CYP A;  1LAP A;  3FED A;  1QSO A;  2HV2 A;  2EUI A;  4MJ8 A;  3S6F A;  3WAB A;  1Y7E A;  4BBH A;  1YRE A;  1ZLI A;  1YQE A;  2OZG A;  4CYQ A;  5G20 A;  3D2M A;  2V77 A;  3D8P A;  2XEJ A;  3EC4 A;  3PP9 A;  4QC6 A;  4NJR A;  2OZH A;  4IK2 A;  2Z3L A;  5LRJ A;  4M6I A;  4C2X A;  1MJA A;  4F0Y A;  2Q0Y A;  1Q2Y A;  1IIC A;  2IMO A;  3JTK A;  4NF1 A;  2PSW A;  1YR0 A;  4XNH B;  5GCN A;  4FBE A;  1QQ9 A;  3KQZ A;  2Z3M A;  2PJC A;  3IIB A;  3KI9 A;  4Q38 A;  2WPW A;  4X2T A;  2EK8 A;  2J8N A;  3EO4 A;  4AVA A;  3SJG A;  1F2P A;  1LRZ A;  2G0B A;  4QB9 A;  3PB8 X;  4UFW A;  4MHZ A;  3NE7 A;  2D4P A;  1R57 A;  2OZU A;  2QEC A;  4EWT A;  5LYI A;  4KOW A;  2JDD A;  2Z3P A;  3H4Q A;  4HNY B;  1ZG7 A;  2EBJ A;  5HVF A;  3W6X A;  3K9T A;  2BL1 A;  2B58 A;  4RS2 A;  2Q4Y A;  1VGY A;  2ZEG A;  2VBQ A;  2AFM A;  2HQY A;  2CNT A;  1BPN A;  1NSA A;  4IUS A;  1P0H A;  4MFP A;  3D2P A;  2F8H A;  4PK2 A;  4MCS A;  4BMH A;  5BWA B;  2C6C A;  4Q7A A;  2QVP A;  3SI2 A;  4KOU A;  2B5G B;  1F57 A;  2PRB A;  4CPA A;  1XF8 A;  5FVJ A;  5AG6 A;  5E96 A;  2R7H A;  3MN8 A;  3TOB A;  4A30 A;  5DWM A;  1LFW A;  3S9L A;  2FXF A;  2VL1 A;  3EFA A;  3OWC A;  3DDD A;  4A38 A;  2B5G A;  4E2A A;  2P6F A;  5KTD A;  5EC4 A;  3D68 A;  3CPX A;  2JBK A;  4LX9 A;  2CTB A;  3BXM A;  1XMT A;  1BAV A;  2GE3 A;  3D7D A;  1WWZ A;  4NGT A;  1RXT A;  1VIX A;  1QMU A;  4PSX A;  3CT9 A;  2GIV A;  4KOY A;  4PXC A;  1S60 A;  2QML A;  4EVY A;  3SJF A;  4AG7 A;  2V8V A;  1K4J A;  4CYN A;  4EME A;  3FYN A;  2I00 A;  4MFL A;  3R95 A;  4DUK A;  4MFZ A;  3FEE A;  1L0C A;  2JEV A;  2PJ3 A;  2R1I A;  4OP4 A;  3PBE A;  4MI4 A;  4UEE A;  3FX6 A;  4YRH A;  2Q7B A;  3IO1 A;  4OID A;  2OU2 A;  5AGE A;  2FIW A;  4KOS A;  2PVV A;  2FIA A;  4HPS A;  4M85 A;  4H89 A;  3PGP A;  4P4E A;  5AG7 A;  3LWU A;  4FD4 A;  4B6Z A;  3W91 A;  2HB6 A;  3V7Z A;  4OLL A;  3BHX A;  4A39 A;  2QYV A;  1XMB A;  2VI7 A;  3T8W A;  2B3U A;  4CYO A;  5H84 A;  4R87 A;  3TOA A;  2FT0 A;  2AFW A;  4FD7 A;  4PK3 A;  1TKH A;  1TKJ A;  5HVG A;  3PZJ A;  4UEZ A;  1AYE A;  3DNS A;  2EWB A;  4KOX A;  3KR4 A;  4X3R A;  4K3N A;  1M4D A;  1Q7L A;  4JWP A;  3EY5 A;  1JQG A;  3FEC A;  4GXH A;  4K30 A;  2IJZ A;  3TT2 A;  2CTC A;  4LQ6 A;  4NJQ A;  4IHM A;  1OBR A;  4Y49 C;  2YND A;  4YGO A;  4BD9 A;  1XEB A;  1XRY A;  4C7I A;  5C88 A;  3FJU A;  1MK4 A;  1YLO A;  3SJE A;  3GYA A;  3IEH A;  4CS0 B;  2P6E A;  4O23 A;  2ANP A;  1TXR A;  4R3L A;  3R9G A;  5C82 A;  4P4I A;  4HKF A;  4ONU A;  3B3V A;  2CF4 A;  4QUS A;  4WJB A;  1S3Z A;  4KLV A;  5D8N A;  2FSR A;  2V8G A;  4R57 A;  4X8I A;  5A27 A;  4UWI A;  2REF A;  5LRG A;  2HUZ A;  3NA6 A;  2G3A A;  2GRE A;  4NGR A;  2ZW6 A;  4ZX8 A;  1HDU A;  2ZXV A;  4L89 A;  4R3K A;  5CNP A;  5G22 A;  1J4J A;  1ZO0 A;  1YVK A;  2H5M A;  2IQ6 A;  3PFO A;  2PJ0 A;  4U5Y A;  1MJB A;  4YFJ A;  2CIJ A;  1IYL A;  1NE9 A;  2DXQ A;  3N7Z A;  1SQH A;  1EE3 P;  5D29 A;  4JJX A;  2RB7 A;  4OKO A;  1LAN A;  3S6G A;  3CZX A;  4NSQ A;  1QSN A;  1KZF A;  3TX8 A;  1VHE A;  2BSW A;  2C6G A;  3FIX A;  1BO4 A;  4FWU A;  4OC1 A;  2OOT A;  3R9F A;  6CPA A;  4CAW A;  3SJX A;  2AFX A;  2JBJ A;  3FH4 A;  1M4G A;  1OZP A;  4MCR A;  4R6T A;  2YGW A;  3F8K A;  4JD6 A;  1CPX A;  4JXQ A;  4MCP A;  3H8F A;  3RBU A;  3KZW A;  3D66 A;  1QST A;  4JLY A; 
#chains in the Genus database with same CATH homology
 3IGR A;  4KVM E;  2REE A;  3T90 A;  3D3S A;  4CRZ B;  4MFK A;  3BJ8 A;  4AVB A;  2JDC A;  1VHS A;  4XPL A;  3IU1 A;  4KOV A;  5AG4 A;  2Z0Z A;  1QSR A;  3FB3 A;  1Y9K A;  4KVO E;  1NSL A;  5JQ4 A;  4F6A A;  1CJW A;  1KUV A;  4IF5 A;  2PQ8 A;  2C27 A;  4KOT A;  4CAF A;  3V8I A;  2YNC C;  1GHE A;  3P2H A;  4KVX A;  1M1D A;  4XPD C;  4CAX A;  4C68 A;  4XPK A;  3I9S A;  5HMN A;  2OH1 A;  3LOD A;  4KUA A;  3IU2 A;  1S7F A;  2BUE A;  1I1D A;  4UCM A;  3DR6 A;  3G8W A;  2PC1 A;  3EXN A;  4UCN A;  5IB0 A;  4CRY B;  4A32 A;  5H86 A;  4F0X A;  4OAE A;  4MY0 A;  2ZW5 A;  4HNX B;  1IID A;  1Q2C A;  4J3G A;  5DWN A;  4KS9 A;  2FS5 A;  2VZZ A;  4UBR A;  2Z3K A;  1NMT A;  1TIQ A;  3F0A A;  2CY2 A;  2B4D A;  4XPD B;  4LUA A;  4CGL A;  3A9L A;  2WUU A;  4KSF A;  3VWE A;  3FRM A;  1S7N A;  4U9Z A;  2P6G A;  4PSW A;  1Z4E A;  5F48 A;  3JVN A;  5JPH A;  2BEI A;  3GY9 A;  2PR8 A;  3E0K A;  1Y9W A;  3I3G A;  1B87 A;  2Q4V A;  3TO6 A;  2O28 A;  3ZZI A;  4UA3 A;  4KZT A;  2J8R A;  2CXA A;  1U6M A;  1CM0 A;  5J8F A;  4NCZ A;  1YVO A;  2YNC A;  4KUB A;  1N71 A;  2KCW A;  4NEX A;  4Y49 B;  2F5I A;  2X7B A;  2WSA A;  1B6B A;  1UFH A;  1M44 A;  2J8M A;  3SXO A;  4CGM A;  5HH1 A;  1M4I A;  3K9U A;  3G3S A;  4ZBG A;  3SHP A;  3FXT A;  3C26 A;  3CXQ A;  1ON0 A;  2R98 A;  2ZPA A;  3TO9 A;  2FCK A;  4ZGY B;  3LD2 A;  2Z10 A;  4FD6 A;  1V0C A;  5IX3 A;  3TE4 A;  3R1K A;  4MHD A;  3GKR A;  3R96 A;  2Q44 A;  4JXR A;  2DPT A;  3SXN A;  5KTA A;  1Y7R A;  4A31 A;  4CAV A;  4KSA A;  2DPS A;  3B8G A;  3ZJ0 A;  5I0C A;  3RYO A;  1I12 A;  5EBV A;  1PUA A;  2CNS A;  1Z9U A;  2GAN A;  1S7L A;  4H6Z A;  4B11 A;  1XIX A;  3F5B A;  4B14 A;  1KUX A;  3UY5 A;  3H5Z A;  2YNE A;  1P4N A;  4PV6 A;  4A2Z A;  4AB7 A;  4B5P B;  2B4B A;  3W6S A;  4A95 A;  1S7K A;  3S6K A;  1YLE A;  4C7H A;  2AE6 A;  2Z3O A;  2Y0M A;  3DSB A;  2VQY A;  1Q2D A;  2Z11 A;  1YK3 A;  2B3V A;  4AVC A;  5A28 A;  2ZW4 A;  2B4D B;  2NMT A;  4II9 A;  4XNH C;  5F49 A;  2IL4 A;  4Q36 A;  2G3T A;  1YX0 A;  4HNW B;  1RO5 A;  5AG5 A;  1I21 A;  1MJ9 A;  4C2Y A;  2R8V A;  4MBU A;  3WR7 A;  3TFY A;  4RI1 A;  4B10 A;  4E8O A;  2K5T A;  5C88 A;  1S5K A;  4CGP A;  1Z4R A;  2EVN A;  4B5O A;  2AJ6 A;  5F47 A;  3FNC A;  4QBJ A;  4I49 A;  4GS4 A;  2VEZ A;  4KOR A;  4A33 A;  3QAH A;  4FD5 A;  4MY3 A;  5J8C A;  5KTC A;  3MGD A;  4UFV A;  4X5K A;  3FBU A;  4NXY A;  3T9Y A;  5G21 A;  4B5P A;  4MFQ A;  1IYK A;  4H6U A;  2VZY A;  4CGO A;  3P2F A;  4CAE A;  4AG9 A;  1BOB A;  5ISV A;  2ARH A;  3R9E A;  4UCP A;  1QSM A;  2CNM A;  4MFJ A;  3TO7 A;  1WK4 A;  3IWG A;  4OAD A;  1PU9 A;  2D4O A;  4L8A A;  3TCV A;  2FL4 A;  2WPX A;  1FY7 A;  4UFX A;  3QB8 A;  4C2Z A;  3IWE A;  2RC4 A;  3CXP A;  2Z3N A;  3JUW A;  4CGN A;  2A4N A;  3S6H A;  2ATR A;  2P0W A;  1KUY A;  3BLN A;  3BJ7 A;  5IV0 A;  4ORF A;  3TTH A;  4DNC A;  3DR8 A;  1IB1 E;  2QIR A;  2Q04 A;  3VWD A;  2ZW7 A;  2JLM A;  1VKC A;  2PDO A;  4QVT A;  2OB0 A;  4KLW A;  2FE7 A;  2VXK A;  4B12 A;  5G1Z A;  1YGH A;  4U9Y A;  4E0A A;  2PR1 A;  4UWJ A;  5F46 A;  3KKW A;  1XE4 A;  4M3S A;  3CXS A;  2I79 A;  4R9M A;  4B13 A;  4CYP A;  1QSO A;  2HV2 A;  2EUI A;  4MJ8 A;  3S6F A;  4BBH A;  1YRE A;  2OZG A;  4CYQ A;  5G20 A;  3D2M A;  3D8P A;  3EC4 A;  3PP9 A;  4QC6 A;  2OZH A;  2Z3L A;  4C2X A;  1MJA A;  4F0Y A;  2Q0Y A;  1Q2Y A;  1IIC A;  3JTK A;  4NF1 A;  2PSW A;  1YR0 A;  4XNH B;  5GCN A;  2Z3M A;  4Q38 A;  2WPW A;  2J8N A;  3EO4 A;  4AVA A;  1LRZ A;  2G0B A;  4QB9 A;  4UFW A;  3NE7 A;  2D4P A;  1R57 A;  2OZU A;  2QEC A;  3W6X A;  4KOW A;  2JDD A;  4HNY B;  2Z3P A;  3H4Q A;  2BL1 A;  2B58 A;  4RS2 A;  2Q4Y A;  2VBQ A;  2HQY A;  2CNT A;  4IUS A;  1P0H A;  4MFP A;  3D2P A;  4PK2 A;  4BMH A;  5BWA B;  4KOU A;  2B5G B;  2PRB A;  1XF8 A;  5FVJ A;  5AG6 A;  5E96 A;  2R7H A;  3TOB A;  4A30 A;  5DWM A;  2FXF A;  3EFA A;  3OWC A;  3DDD A;  2B5G A;  4E2A A;  2P6F A;  5KTD A;  5EC4 A;  4LX9 A;  1XMT A;  2GE3 A;  1WWZ A;  1RXT A;  4PSX A;  2GIV A;  4KOY A;  1S60 A;  2QML A;  4EVY A;  4AG7 A;  1K4J A;  4CYN A;  3FYN A;  2I00 A;  4MFL A;  3R95 A;  4MFZ A;  1L0C A;  2JEV A;  2R1I A;  4YRH A;  4MI4 A;  2Q7B A;  2OU2 A;  5AGE A;  2FIW A;  4KOS A;  2FIA A;  4M85 A;  4H89 A;  3PGP A;  5AG7 A;  4FD4 A;  3W91 A;  4OLL A;  2VI7 A;  2B3U A;  4CYO A;  5H84 A;  4R87 A;  3TOA A;  2FT0 A;  4FD7 A;  4PK3 A;  3PZJ A;  3DNS A;  4KOX A;  1M4D A;  4JWP A;  3EY5 A;  4K30 A;  3TT2 A;  4Y49 C;  2YND A;  4YGO A;  1XEB A;  4C7I A;  1MK4 A;  4CS0 B;  3GYA A;  2P6E A;  4R3L A;  3R9G A;  5C82 A;  4HKF A;  4ONU A;  4QUS A;  1S3Z A;  4KLV A;  2FSR A;  4R57 A;  5A27 A;  4UWI A;  2REF A;  2HUZ A;  2G3A A;  2ZW6 A;  2ZXV A;  4L89 A;  4R3K A;  5CNP A;  5G22 A;  1J4J A;  1ZO0 A;  1YVK A;  2H5M A;  4U5Y A;  1MJB A;  4YFJ A;  1IYL A;  1NE9 A;  2DXQ A;  3N7Z A;  1SQH A;  4JJX A;  3S6G A;  4NSQ A;  1QSN A;  1KZF A;  3FIX A;  2BSW A;  1BO4 A;  3R9F A;  4CAW A;  1M4G A;  1OZP A;  2YGW A;  3F8K A;  4JD6 A;  4JXQ A;  1QST A;  4JLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...