2V8HA

Crystal structure of mutant e159a of beta-alanine synthase from saccharomyces kluyveri in complex with its substrate n-carbamyl-beta- alanine
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
431
structure length
431
Chain Sequence
LSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNAEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGHQFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-ALANINE SYNTHASE
publication title Crystal Structures of Yeast -Alanine Synthase Complexes Reveal the Mode of Substrate Binding and Large Scale Domain Closure Movements.
pubmed doi rcsb
source organism Saccharomyces kluyveri
total genus 159
structure length 431
sequence length 431
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2007-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v8hA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2v8hA01
1FNOA 2WZNA 1VHOA 4DYOA 2Q4ZA 2C1CA 2J9AA 1CBXA 3PB9X 4ZYQA 3TX8A 1Z2LA 2WYRA 3KL9A 3GB0A 1VHEA 4NGNA 1HDUA 4EFDA 4FUUA 3SI2A 4PQAA 2G9DA 5K8OA 1YLOA 2ZELA 3CPXA 3NA6A 2PE3A 4UEFA 2NYQA 1IGBA 3RZAA 1YSJA 5LRJA 4P4IA 1CX8A 2PJ5A 1LAMA 1NSAA 1ZLHA 2EWBA 3B3VA 4MCQA 3MN8A 2PCUA 4ZX8A 1LANA 2PVVA 4ZX9A 2PIZA 5JH9A 3FX6A 2AFWA 2JBKA 4GM5A 4FBEA 3KQXA 3WC5A 1TF9A 4PXEA 4X3RA 3VATA 2BO9A 2PVWA 2AFXA 2POKA 3BXMA 7CPAA 5DS0A 2Q51A 2EK9A 2ZEEA 4BD9A 4K3NA 4ZI6A 1BPMA 4X8IA 4DUKA 2C6PA 1XFOA 3WC6A 5D29A 3IJ3A 4NGMA 1FT7A 1RTQA 3IFEA 4P44A 1GYTA 3T8WA 1YW4A 5IB9A 2PJ8A 3B3TA 4IHMA 1IY7A 3PB7X 3KR4A 3WC7A 5CPAA 5JM6A 1R3NA 1ZG7A 4O23A 4YU9A 4Q7AA 3S9MA 4ZY0A 5K8NA 2FVGA 2RFHA 3ISXA 3KHZA 3H8FA 1AMPA 3NFZA 4NGQA 4UEEA 4PXCA 1PCAA 3IEHA 3PBBA 1ZLIA 4P4EA 5HVFA 2V77A 2GLJA 2ZEFA 1DTDA 1CP6A 4X2TA 2QJ8A 1UWYA 1CG2A 4R76A 1Y7EA 2HB6A 4OMEA 4P4JA 3NH5A 1HDQA 1Z5RA 4AXVA 3ISZA 1TKJA 4TNUA 4MCPA 4NJQA 3SJFA 2ZEGA 1LAPA 3L2NA 2ZEPA 4OC0A 5LRKA 4IAVA 2JBJA 1ELMP 4NGPA 2BCOA 4Z65A 5LYDA 2Q43A 4JYWA 4OC3A 4OC5A 3PEIA 2IMOA 3B7IA 3KR5A 3IWWA 1TKHA 2BOAA 1F57A 4MHNA 4B6ZA 1Z8LA 4PPZA 1AYEA 2ZOGA 3FF3A 3NH8A 1XMBA 4R8FA 2PJ2A 1QMUA 4P4FA 5D8NA 4PXBA 1PYTB 2AFSA 3VARA 2PJ1A 2EK8A 3WABA 2ANPA 3TC8A 3D7FA 3DGVA 1ZG9A 5ELYA 4H2KA 3FMCA 3WT4A 3SJGA 2PRQA 4UIAA 3DLJA 3IIBA 4NGTA 4OIDA 3V38A 1QQ9A 3B3CA 1TF8A 4EMEA 2OR4A 5HVGA 3K2KA 3KHXA 2AFMA 2C6CA 3HUVA 8CPAA 3D7DA 4NJRA 4OC2A 1BLLE 4G1PA 2F7VA 4JZ0A 1XRYA 1F2OA 3KQZA 2IJZA 4P4DA 3FECA 4P4BA 2V8HA 5K8PA 3CDXA 4OIWA 4R6TA 4WWVA 2O4HA 3FEDA 4WJBA 2IQ6A 1CP7A 2QVPA 1LOKA 2XEGA 4MHZA 5J1QA 1BAVA 3GLJA 2PJ0A 1VGYA 3BI0A 2GU2A 2V8GA 4OC1A 2HC9A 2JEWA 3N5FA 3H8EA 2XEJA 4OC4A 2GLFA 4A37A 1TKFA 3BI1A 3B2YA 4DJLA 3K9TA 3CT9A 3RBUA 3RAMA 1ARMA 5LYFA 1LCPA 1R43A 4EWTA 2CIJA 1YMEA 1BPNA 1CPXA 3V7ZA 3PB6X 5CBMA 2ZEOA 4RUHA 4NGRA 2XEFA 3D7GA 3KGQA 1ARLA 2VL1A 2C6GA 4UEZA 3B35A 2V8VA 4MMOA 4MCRA 3PFEA 4W9YA 3D68A 1ZG8A 1CPSA 2PJ7A 2PJ6A 3D66A 1HEEA 1VIXA 4A94A 1Y0RA 3FJUA 3SI0A 2DEAA 1YW6A 1F2PA 2XEIA 6CPAA 4F9UA 4KSIA 3QNVA 1TXRA 4MHPA 3KZWA 4P6YA 1DE4C 2AFOA 3PRTA 4MCSA 4ZY1A 4A38A 4F9VA 3D7HA 4ONWA 4P45A 2QYVA 4F8ZA 3B3WA 2NSMA 4OP4A 5JGFA 5K8MA 4P10A 2AFUA 2PJ4A 2ZENA 3IO1A 2RB7A 4MRIA 4UF4A 4LQGA 2F8HA 4MHYA 5LYIA 3SI1A 3B3SA 3IC1A 3S9LA 3PB4X 3CPAA 3PFOA 4PXDA 4A39A 4YWYA 1LFWA 4CPAA 3S9NA 2PJAA 5THWA 2PJ9A 2ZEDA 5HXDA 2ZEMA 3PBEA 3PB8X 1Y0YA 2ABZA 2AFZA 3FEEA 3FH4A 4TWEA 5I4MA 2CTCA 3GUXA 4MXUA 1M4LA 4R7MA 4FAIA 3D67A 2CF4A 1JQGA 4UIBA 1EE3P 4OKOA 3D4UA 3I1UA 2ZOFA 3LMSA 3SJXA 2O53A 4ZY2A 2GREA 2PJ3A 4FWUA 3MRUA 3LWUA 1ELLP 3KASA 5F09A 5LRGA 4NGSA 3NH4A 2ZEHA 3H8GA 3HLPA 3KI9A 3SJEA 3BHXA 1Q7LA 2V8DA 1XJOA 2PIYA 1H8LA 2OOTA 3FVLA 4NFRA 5LYLA 2I3CA 1XBUA 4IK2A 5HVHA 2PJBA 1KWMA 1OBRA 2PJCA 2CTBA 3JRUA 3VH9A
chains in the Genus database with same CATH superfamily
4MKYA 2F8MA 3EO4A 2DR5A 4USMA 3LP0A 6FDRA 4ANEA 1Z1ZA 4Q2MA 1LW2A 3TOAA 4B5PB 1VHEA 5AE3A 3W5ZA 4OADA 3T1HJ 2OD4A 2GVZA 4P2FA 3ZNJ1 1IGBA 5RUBA 3ITHB 1NSAA 1IB1E 1WOPA 2DNQA 3I0RA 4GKKJ 1O6XA 5ISVA 2VC1A 3P2FA 1NXIA 3OT9A 5E3AA 2VFSA 4ZIWA 3M7VA 3ZC4A 2AFXA 4DV1F 2IA0A 4ITSA 2JLFA 4ZI6A 3ENAA 2EG1A 1Q2CA 1QJHA 2ZJPQ 4N7TA 3UR0A 4DV7J 3KJQB 1IBKF 2ZBQA 2YNIA 1RTQA 1I94J 1LKZA 4HNXB 2FVPA 4H6UA 2HNZB 1VQOS 3CDWA 5L1KA 4JI0J 3LH2S 1IR0A 1RLDA 1OSDA 2JSXA 1TKZA 2IM2A 3FCVA 4DJBA 2CPIA 4AXJA 3MCMA 2EVNA 2R2UA 1RAOA 3GV8B 3NFZA 2RNEA 5H86A 3SSSA 4E0AA 4K4SA 1M44A 1TK0A 2I9SA 1DHMA 4C98A 4RS2A 2C2KB 5HVFA 2QA4S 4CI0B 3LPEA 4G1IA 1ZAXA 4HH1A 2WVFA 4NJQA 2Q6BA 2C1EB 3OUYB 1LAPA 5KFMA 4Z65A 3W91A 4USJC 4I2QA 2BEIA 3DCAA 5KFQA 2X1FA 3RNZA 1DTTB 4R8FA 5ETMA 3GJRB 3R27A 1UPPA 4MY0A 5D8NA 2LQJA 4DZDA 1RTHA 2P9CA 1BQNB 2H54B 5GMEA 1DAXA 1OYDA 2RRBA 1JNRB 2AJFE 4OIDA 4IDKB 4YB1P 3UE2A 2JOQA 3TUJC 1RT4B 4ILMA 5LJ5Y 2PE8A 4CLLA 5G22A 2W2OP 2IAJA 1KSPA 4KORA 1VK3A 1YDLA 2XO6A 2FVRA 1C0TA 2FC9A 3KJFB 3HXMA 4P4BA 4DQIA 5A8RB 2QE5A 3H4QA 2ACYA 3HZEA 1KOOA 4K2XA 3ILOA 3JTOA 1SQFA 1EIYB 2E9TA 3CMAS 4XDCA 3M2VB 4UCMA 2HC9A 1NJIT 4MFQA 2JEWA 4QYZK 4N8NA 3DOKA 4A37A 1TKFA 1P1LA 3BKFA 1EAYC 5HJYA 3FQLA 2UVWA 4PK3A 1R43A 3E01B 4EWTA 3RUBL 1N88A 2LXUA 5CZXA 2P2CB 3TW0A 4HTJA 3AOCA 2BKNA 4ZVHA 4NYZA 2LP4A 4FKXA 2QGFB 2R8IA 2ATCB 2N7CA 3UVJA 3GU0A 1B7FA 1VCTA 2HVDA 2VA3A 1X4HA 3EY5A 2FVCA 1HNXJ 4ZCLA 2PA3A 1MU2B 1IXKA 4QU6A 1M5HA 3WX8A 2I00A 2DHAA 2HHPA 1N34F 3BJYA 2BR0A 2XWYA 4URSA 2ZM6F 1DE4C 2ZH1A 3W8PA 3OLBA 2MQ8A 4ZVRB 2M8DB 2WW4A 3BBCA 3QZ8A 3M4XA 1TL4A 3MCOA 5IS2A 1Y11A 2DH9A 2XULA 2ZH6A 1VQ8S 4L72B 5JJBA 5D8HB 3HI9A 1XNRF 1X4AA 4KYZA 4LRCA 4ZPDA 2WSCC 4O44B 3I0RB 4XNHC 2ILZA 1KTVA 5E3QA 3PB4X 1HFEL 2IBOA 5F8JA 4ZPVR 3DXSX 3SSRA 4DR6F 3TX0A 2QIFA 5KFUA 3PX4A 2ZEDA 4NLYA 3MTJA 4J9QA 4HNYB 4R7MA 4DFKA 4U7CA 4M5GA 4DX7A 1CJWA 1VQ6S 1Z8TA 5KFYA 2FS5A 2B58A 2WVDA 4ZK7M 2H3EB 2GVDB 3HKZD 1HR0J 4ORFA 1NMTA 4FWUA 4PYAA 2NXNA 3ZZUA 4NGSA 1SKWA 2ZEHA 3FYNA 3HLPA 4WZQA 2HUZA 4O3NA 1U6ZA 4ZBGA 1N5TA 2RRNA 1J5EJ 2KXFA 1HWJA 4TN2A 5E33A 1S9GA 4DX5A 3IBFB 1HBMB 1WOOA 2X1GA 1RCOB 3D6TB 2KJWA 4PEOA 5KFFA 4C3LA 1RK8A 2WZNA 2KZMA 3PX6A 2FT0A 3A8IA 3BN4A 2VIHA 2E7VA 4MJKA 4F4XA 2VQEJ 1PJ5A 2IC3A 1N48A 5IQ6A 5KFJA 2K3IA 3NA6A 4I1TA 3BQ1A 2XI2A 4RW6B 2YX1A 1UL3A 2ODFA 4RWWA 4LQ9A 3MMCB 2BRKA 2D4PA 2K8GA 4M6HA 1R8AA 3PJWA 2DITA 2MEWA 2F8EX 4DL4A 5HO4A 4IFVB 2J7WA 5DWNA 3RBEA 4DU7A 2EK9A 1BPMA 5KG0A 2J9DE 1RTZA 4RBUA 1FRJA 1KVKA 4DUZJ 2VQFF 3LTOA 1VBYA 4YMEA 2IAJB 5KFEA 2PDOA 4WBFA 2V2QA 4ERDA 1K0VA 1U47A 4A8OA 4KRWA 3G2XA 3WBZA 3W62A 4NASA 4KOWA 2KRRA 2CJBA 2NMTA 3LWLA 4U9RA 2YWKA 4P4EA 1HQ2A 4UZBA 1XF8A 4OZJA 3TARA 2RHQB 3G9CA 5F8LA 1IOFA 1IJFB 2HB6A 1PC5A 3SQGB 4P4JA 4KJIA 5HSPA 3ISZA 2QL9B 4DL5A 4BDPA 4TNUA 1UP1A 1TL1A 4ECTA 2IBKA 2HHSA 4NGPA 2CADA 3BSNA 4LQ3A 2FLPA 2XSJB 1U0HA 5CYQB 3WIUA 3GIMA 1PYTA 4L89A 4MHNA 4DN0A 2KH9A 4ECSA 4C48A 3MAAA 3KK2A 2DNMA 2PJ2A 4P4FA 3DM2B 3R9EA 4ZVQB 4II9A 1RWWB 2G2ZA 2VDHA 4B3SJ 4ECRA 3BSCA 4KS9A 4P2XA 1IR2A 2PEBA 4LFCJ 4FF4A 3BREA 4FS2A 4NGTA 2R1IA 3IM8A 4DEZA 2GX8A 2JEGA 1YQEA 1U0SA 3KHXA 1T8EA 3KDNA 4NJRA 3HHLA 1WKJA 4ECVA 4NXMJ 3ONQA 2HRYA 4ZN3A 1LW0A 1K0TA 9RUBA 3R5JB 4FS1A 5E3CA 4KFBA 1WSVA 3M1VB 4J7CA 2R7XA 4WTYA 2HGLA 4JI6F 4JI7J 2VU5A 1YGHA 4OJGA 3QJPA 5KFHA 1NHUA 4NMXA 1IICA 1U2RA 3W2WA 4DOZA 2IRUA 1LWEB 4A4JA 4LIWA 2YNEA 1NDLA 3THPA 2YKNB 1D9AA 4QWDA 4DR2F 4J37A 1V3ZA 1LWCB 5F9LA 4USVA 5LYFA 1J5OB 1LWFA 3J7Z5 1Z4UA 3RRKA 1OMSA 2Z57B 4MAKA 1S9GB 2HHXA 2V2VA 3J7AN 2EBGA 4F4AA 4N76A 2MLZA 5AG6A 1SL2A 4JI1J 1NK7A 1RI7A 1HEEA 3T9YA 4K5RA 4ANCA 3C6TB 3SI0A 4NXNF 1TAQA 4UW2A 1YW6A 2BX6A 3QAEA 3QGIA 1WWHA 3JUWA 3MEDA 1QTMA 2I5JA 3GYNA 4F9VA 1JIHA 1WTFA 4UWJA 3TZZA 3KJNB 2RQCA 2FTRA 5HQMA 3HM9A 3DDNA 5LSRA 1X0PA 1CULA 3NBPA 4MYUA 1REVB 1B6BA 4RL1A 1WC0A 3O3LA 2AFUA 4B11A 1S10A 3AB2B 2CZ4A 3THTA 3OTEA 1WDTA 4YDDB 2HMIA 3VAFA 3RB0A 3HFZB 2MSSA 5HMNA 3OVSA 2EKNA 2Z3MA 1R6YA 2CQ3A 3TO6A 3PVXA 1Y0YA 2AFZA 2WZ1A 3DRPB 5ETVA 1FE4A 4UOGA 3FKBA 1YRUA 1EHWA 1D8ZA 2F5IA 4WIQA 2HAIA 4UIBA 2VG7B 3BEGB 1OPIA 3HJFA 3I9ZA 4Z37A 1UVNA 1S6PB 4G1QB 4OYXA 5A28A 4ZY2A 4JI8F 2NYIA 3KASA 4HL9A 2VG5B 2QMLA 3MPDA 3KHGA 4RN7A 1SVDA 2FVSA 4H4OB 4NX9A 4ZLJA 1PAEX 1URRA 3HP6A 4D3HA 3LF0A 3WX4A 1G3OA 2UUCJ 2IFXA 4OHYA 5HVHA 1X4CA 3AQPA 1KWMA 4OMFG 3T1HF 2QMUB 2SXLA 4KOUA 2FC8A 5H1SV 4DYOA 1XMQF 3IAM9 2Q4ZA 2C2NA 1WTBA 2XMTA 3M32A 2GHVC 1WF1A 3KJVA 3PYGA 4EZ9A 2PO4A 2WRMA 1VYAA 5J1PA 3OJUA 2D1CA 1RE1B 2DCUB 4ES1A 4CP5A 2HVIA 2F63A 1U2FA 4F36A 2VODA 2R8HA 2R7QA 9ATCB 4EZ6A 2ZELA 4ED3A 2BQ3A 5E5NA 1HD1A 3OTOJ 1U0HB 3B3VA 2VZ9A 1HBUA 1FRLA 2D41A 4OI3A 1NH7A 2VV5A 3OXFA 3K8VA 4KSAA 1MN9A 2POKA 4H4KA 1FWLA 2D3OR 3QIPA 3HHEA 4FN5A 2DCLA 1VK8A 3I5AA 4NLRA 5FDLB 2AE6A 3WC6A 1X0FA 2OMOA 4MFLA 2EI5A 2QLBB 1JLCB 2W4CA 3SHPA 1JLGB 1U6FA 4DNCA 4PWDA 1TV6B 2RQKA 1Q8LA 2G1HA 4PQUA 1FDAA 3MECB 4Y34A 5JM6A 1YLEA 4F0KA 2PT0A 4U6PA 4CCHA 2DPTA 5K8NA 4I7FA 2GIQA 3I87A 5BXIA 1MSWD 4ICLA 1HBNB 4EGLA 3EYZA 1YVKA 2P5VA 3FRYA 1L3VA 2CZVC 5D0RA 1QVGR 4K0KJ 5T7LA 3HZGA 3DI6A 3VAHA 4RW4A 4EYIB 4ZJLA 1H72C 1CG2A 3VZIA 5ETRA 1FJ7A 4R76A 4BWJA 4W92B 5G21A 2DXFA 3CXQA 1Z5RA 5KFSA 4LSLB 3G6YA 4ECZA 1B3TA 2F3JA 3O44A 3L95X 3F73A 3CTRA 5IC4B 1ROFA 1BHNA 2X7IA 3L2NA 4IAVA 4DQSA 2JBJA 1EQMA 5CQGA 4DX8H 1T05A 1S60A 4B5OA 1A6LA 5CYMB 2ZXVA 2DEJA 1S1XA 3Q8QB 1Z8LA 1MJAA 2DGVA 2CG4A 5C24A 2K7KA 1D1UA 1SQGA 5ETNA 3L3CA 1G1XA 3SV4A 1JNZB 5B0GA 1JLQA 4CH0S 4KO0B 3TJ9A 3ETMA 4A8MP 3IWXA 3MEDB 4F6AA 1NM2A 2MMYA 1IBCB 2G2YA 3NL0A 3CD6S 2CPDA 1RTDA 4CNZA 4B08A 1RWKB 3C14A 2V9KA 3T5KA 3KTQA 2IYGA 2K1RB 3R1LA 5AJ3J 2Z3OA 2QECA 4GMKA 1YZ7A 2EK6A 3VAGA 5KFLA 2DNHA 2CQDA 3NOCA 4KT0C 4OIWA 1S12A 2QJ3A 1YR0A 1F9FA 3C6UA 2UUBJ 1RXOB 3ZNUA 1FFSB 1IKYA 4A47A 1LOKA 3BGUA 4NA3A 5E41A 1KKHA 3VGVA 1KHWA 3EMTA 2GU2A 5KFNA 4AXIA 3PYFA 3VVUA 3AXMA 4YR2A 4DV4F 1RAEB 1RHQB 5J2QA 5DM6Q 2MKYA 2PEHA 2Q1LA 1DTQA 3ZTRA 4KZTA 2M88A 4YFUA 1Q95G 4NE9C 4CS0B 1RA7A 2AU0A 3VWEA 4B9SA 1QE1B 2QYGA 4R87A 2VOPA 1WNEA 2MLXA 4O4GA 2MQQA 2XY5A 3C19A 3HPOA 2OAUA 1WD6A 3MOJB 2CJYB 2XEIA 3Q0AA 1BD6A 3D5MA 1PO6A 3JXOA 3IAS9 4LSZB 3ENWA 4TLQA 3MMBA 3NMRA 3QO9B 1FNMA 2MKCA 3ULHA 3SXLA 3V5RA 1S0MA 3FBFA 2B0GA 2F9DA 2MZSA 1HW8A 4QC6A 3FBCA 3BV8A 3I0SA 2A0FB 4PKDB 4LFBF 3G82A 3A3NB 1ZPVA 2ARHA 2ZENA 3PRBA 3DNSA 4FZVA 2RB7A 3J7A1 4EO8A 4MRIA 5KFPA 5LYIA 5IFMA 2RC4A 3HCXA 1OY6A 1NSKL 3LAKA 1PJ6A 1XNQJ 2DHGA 3JQKA 3NOGA 2BE2A 3PBEA 1GNKA 2GZOA 2VASA 4HDHA 4B9NA 4MHDA 2CF4A 4CLTA 3BDPA 4J5OA 2UV8A 3OFGA 2WTFA 3OTBA 1HWIA 2YKPA 2HQCA 3D2MA 1VQSA 1R6VA 3SJXA 3H5YA 4A8QA 4U9ZA 2C42A 4A8XA 4JI5J 3PTWA 1ELLP 2ZHBA 5F09A 4ECUA 3TVYA 2HBZB 4LVOP 2ZH3A 2V0NA 5EGYA 2PRBA 2LQBA 3CO9A 1XBUA 1ZZFA 3NAIA 4ZCKA 2D69A 1YK3A 3GIKA 4Q38A 3G96A 2WB4A 3FUYA 1UFWA 1VHOA 4URGA 3DDKA 4RW4B 1WEYA 4DPOA 1CBXA 1P9YA 4I67A 1NJXA 1GH8A 2AGPA 2VZYA 4KB7A 3O1LA 2H5JB 4LVNP 4NF1A 3GFHA 1Q53A 3CCUS 2JFDA 3RZAA 2XMVA 3U1MA 4KOXA 4OZ5A 4QWAA 2WSEC 1T05B 3R7SB 1RU2A 4WE1A 3K5MA 3NGSA 2BKPA 4RNFA 5DLFA 4C8OA 5HROA 4K4VA 4DL3A 2VPXB 4LF4F 1HPZA 3M6WA 2KXHA 2Q6CA 3MCSA 2E5JA 2N3LA 2IYIA 4X8IA 5GADI 3TA1A 3CXPA 2QLJB 3WC0A 3RBDA 1FEHA 3W7BA 3MR2A 5EBVA 5HBMB 4OZ1A 2D3UA 1KFDA 1NDCA 3KLHB 3B3TA 3LP1B 3PB7X 2ZE2B 3D9BA 3HVAA 2MY7A 4ZS6A 4IOAQ 1Q8BA 1KQGB 1VBKA 4Q7AA 2BVZA 1U6MA 5J2NB 2IHR1 3QZ7A 3H8FA 1GTEA 1OWXA 4JYAJ 5DDOC 1R7IA 2HFZA 1VQ7S 2HURA 1IOIA 2BKOA 1SJ1A 3Q8YA 3PBBA 2DPIA 5B0FA 2J9CA 1ZTTA 1JLAA 2ADCA 3QGHA 3LW5C 5AE1A 4M5KA 5GAGI 3NMAA 4QYRA 5A8WA 4DL0C 5IX3A 5H9EK 3IWNC 3MPUB 4OC0A 1ELMP 1FO1A 5I0CA 3FEZA 1EB0A 1HWLA 1RHUB 5L9XA 4NLOA 3EDQB 1F57A 4B6ZA 4UWIA 3RYOA 3I96A 4M5NA 5DM7Q 1FX4A 2Y0MA 2ZBIA 4NLQA 1JWQA 3U1NA 2NUUG 4LR8A 4NXMF 1P27B 3DGVA 1ZG9A 2PI4A 1NBEB 5BR8J 2CUYA 4USHA 4YQWA 2J7KA 5KOWA 1IYKA 4PG4A 2QMWA 4YOEA 5EUHA 1QQ9A 1RT3A 1Y5LB 2I2YA 3MMBB 5HAOA 2DNNA 1SC3B 8CPAA 1QAYA 2GAGC 3I0SB 1RHKB 1Q16B 3R9GA 3G82B 1YVOA 2XBPA 2CQ4A 2W9BA 4P2SA 2Z2YB 3ZXWA 4ZLPA 3A1YG 1UWBB 4G3IA 4B3MF 1RACB 3V2UC 4LF1A 2D3O1 1FK9A 3K8WA 1IM6A 3PM9A 3PZPA 3M8ZA 1VRTA 3AHPA 3GLJA 4A8KA 1FVQA 1TELA 2H5MA 2F4VF 5HMZA 4NCGB 3HX9A 3BI0A 4OC1A 1T94A 4C9DA 1R8HA 3IWGA 3O2IA 4B14A 3D54A 4CO3A 1GTHA 3OPKA 3B2YA 2ERRA 2W9CA 2RSQA 4PG5A 2GGPB 4PSWA 2L48A 4GVLA 1YMEA 2VICA 3IA0A 2EFGA 4WP8A 4R0EA 2DNKA 4FBUA 5A2QY 2C3OA 1VS3A 3A8JA 3J81Y 4YHHJ 2W25A 4PYDA 1BWEA 2BJEA 4X65F 5T14A 4DSKA 3I4HX 4ZVFA 1RBOB 3CWJA 3M6XA 1NKEA 2V8VA 3UO0A 2XMWA 1S1UB 5E3PA 1K1SA 1PYSB 3PP9A 3SXOA 5A6WA 2JEIA 1BE4A 2HGNA 4CAXA 4AQYJ 4XNHB 2VI7A 1M5SA 4X64J 2MJUA 4A8WA 2HHWA 1JKHB 4F7VA 1SXLA 4TYAA 2X3GA 3LACA 1U1KA 2Z0ZA 2RF2A 1XTZA 3CC2S 2E5HA 2BBEA 2P0WA 2PR8A 1Y3JA 4BC7A 4JBCA 3CPWR 2XMAA 1HNWF 5T41A 4RU2A 2J5AA 4DR5J 2CNKB 4OAEA 2HS3A 4CO0A 5U47A 3OXGA 1DJ0A 1U24A 2KT5A 1S6UA 4QWCA 3H40A 5DDRC 1HHQA 4YP3A 3P5BP 4LX9A 3FH4A 3KLGB 3BSOA 2M2BA 2OEJA 1QSNA 2IRXA 1CPZA 3D4UA 2MYFA 2UXBF 3I1UA 3D0IE 2H4YB 4ZIVA 2AWZA 2PJ3A 2V2KA 4HH0A 3EXCX 4ED6A 2AJ2A 3DOMB 4JI4F 3Q86A 2MZQA 3BQ2A 1W2IA 3AT1B 1S4FA 5AT1B 4DPUA 2DO4A 1C2PA 4TU9A 1S7IA 4DS5A 3AOAA 1AA1B 3VH9A 1KHVA 5B08A 1WKKA 1OPZA 1ZETA 1HW9A 5LM7E 3H42A 5KFZA 4DZ6A 1AB8A 1KR4A 3KL9A 2XZTB 5DGAA 3GB0A 4V19X 2UUWA 3H90A 1OQ6A 5A8WB 3HSDA 4X4NA 2DGSA 2Z58B 4EBEA 1X10A 2YWGA 1S1TA 3MFHA 4ELTA 3HSZA 4MCQA 1ZLHA 4CTAA 3DHWC 1Q4RA 1MW7A 5LXRA 1AW0A 4WU3A 1NRKA 2ZD1A 1S5ZA 3E8OA 3SCIE 3FBUA 3FX6A 5J2PB 3I82A 3FFIB 2LDIA 2V69A 3K5PA 3KG1A 3R5BA 4X3RA 2I1RA 3S8SA 4UOHA 3VGSA 1S49A 2K7JA 4ETXA 2R7HA 1ULRA 2GQCA 1WHXA 3VGTA 4HACA 3QBCA 3E2EA 4HHJA 3S01A 3M8QA 4CRZB 1FXDA 1HNZF 2ZNYA 1U6BA 5IB9A 4FP9A 2FXFA 3D6MB 1IY7A 3JSYA 1S79A 4DXLA 3QT8A 4OI2A 4X66J 4RNOA 3JVNA 3RBZA 3VCDA 1A0OB 4KPCA 3IMQJ 2DR9A 1L3KA 1TQLA 2W9BB 2FVGA 4LF6F 3ZTSA 4OI4A 1E6VA 5CHCB 3JQMA 3CCSS 1PKUA 1I6JA 2RD5C 4RKUC 4WWSA 2VH7A 1FK9B 2BDPA 5FLXU 1DURA 1RWNB 4PXCA 4OYMA 1U1LA 3MPWA 4KV8B 1Q86T 2OSRA 1GQEA 2FHMA 4AL5A 5K20B 1BC6A 2KZZA 4HNWB 2RKIA 2RHSB 4F3MA 4WFZA 3OR1A 2JVOA 1BUXA 4ECWA 1C4CA 4DV5F 1EZZB 4KE5A 4ZPAA 2PDAA 4RW9A 1U1PA 1V3SA 1AZSB 4C7IA 2OEKA 3PCOB 4A33A 3MM6B 4RLEA 4C2XA 3F5BA 1B0VA 1H73A 1XMBA 2AJ4A 1NK6A 3G8SA 4WIIA 1QMUA 3VV2B 4CLWA 1VC0A 2XTJP 1HHTP 3R95A 6AT1B 1F3FA 8ATCB 3LD2A 2C28A 2JWNA 1LQ9A 3PW2A 1T0TV 4KQZA 4FXVA 3MD3A 2YNHA 2RF2B 3B3CA 2FGOA 2KI2A 1KONA 1CQMA 1YWXA 3SCJE 2I6WA 4F4WA 2DPSA 1X60A 1S0OA 1HWUA 1NAQA 5HMWA 4P4DA 4B3RJ 2VD3A 3D3BJ 3EX7B 2FY1A 3UQSA 2R8KA 3OV7A 1UA1A 2M3DA 4ANDA 3FSXA 3DLLQ 3RO0A 3F44A 6FD1A 3UDVA 3FK4A 3FXTA 2R42A 4WJBA 1B87A 5IV4A 1CP7A 1N5VA 5LMNF 5LMUF 1M1HA 4GC6A 1FCAA 2B7BB 3GG1A 1Z8WA 3CUNA 2DGXA 1N32F 2EBJA 3K9TA 4CYUB 1Y9WA 4OYAA 1LCPA 1DRZA 1ITPA 5ETLA 5KT6A 2LQ9A 2QO3A 3C15B 1WG1A 4E0DA 4NLXA 3D7GA 4ZLNA 4YS2A 3OR2A 1M4IA 2UVVA 4YY3F 2NUHA 4D3GA 2PJ6A 4BLGA 4LF5F 1G6BA 3SFUA 2AT1B 2DEAA 6CPAA 2AX0A 5HQLA 2ZPAA 4I68A 2CY2A 3KZWA 1B4SA 4A38A 2GANA 2KT3A 3GG0A 5KFTA 5KFXA 5CXTA 4EEYA 4DL2A 2VONA 1S1TB 1CM0A 4P10A 3U7JA 1MMLA 2EFNA 4CTAB 2QZ8A 3EPIA 4ZPBA 1FDNA 1IJEB 3G4SS 3V4MA 4JJXA 4XPDB 1M90T 1HD0A 1X5PA 1HQEA 1YQHA 2AJ0A 4YGOA 5K9FA 3WC2A 5C42B 4KUAA 2ZEMA 4TWEA 1S99A 1NE9A 1CC8A 4M1KA 2R9LA 2UXDF 2MQOA 4X62F 2M0GB 3PIOQ 4DV1J 4OYPA 3NGKA 1N5QA 5G0RB 2V6AA 1IBKJ 3BQ0A 4FD4A 3I6PA 4ZHRA 3KI9A 2GQ2A 2XMKA 4DG1A 2YX4A 1TL3B 2VBQA 1TK5A 2MZJA 4K4XA 2LEAA 5B0CA 1SL0A 3QNWB 4DUYF 1FKOA 1Q7LB 4ZVUB 3TVKA 3OL8A 1RWMB 1IKVA 3PX0A 1GXTA 3KHHA 2RS8A 1XERA 4C7QA 3F8KA 1SPBP 4HHUA 1YZ6A 3ELHA 2ZZTA 3CO0P 2GMHA 2KFYA 1GXUA 4O3PA 3HD2A 2XC9A 1JXVA 4X4RA 4PUOB 1CJTA 2DHXA 4RW9B 1RT7A 4C8LA 2ZKUA 1RYRA 4WFBQ 7FD1A 2ROGA 2CAJA 2EWBA 2Q4YA 4UFVA 5DG9A 2HQYA 2PIZA 4OIXA 5M2PA 4GM5A 2JHEA 3J80Y 1S9FA 4FBEA 2WK4A 2Z3NA 2ZBPA 3DRRA 5EX3A 2HLUA 1N36F 2LECA 1RP5A 4NRUA 3FMBA 2L9DA 1DBDA 4ZVOB 5KFRA 2Q51A 2RUGA 3TCVA 4ED1A 1RT2A 4ED7A 1IQTA 3M30A 3CCQS 3VAJA 1HWKA 2DTJA 5A8KB 4L75A 5ADZA 3MMAA 5AG5A 4CH1A 5IB0A 2VDIA 1YX0A 1S7LA 4K4TA 1YK9A 4C8NA 2VPYB 3Q8VA 3DYAB 1LNQA 3SSQA 1UJ4A 2BJ8A 5C25A 3CD7A 4UEEA 1PCAA 1JX4A 5F3ZA 4M5MA 4WXWA 5HP1A 1WKLA 3LP2A 2WONA 5I42B 3PACA 2CQ1A 2Z30B 1CJUA 3GR1A 2RVJA 1FWKA 2Y1LB 1VQMS 4FD7A 2DGUA 2OPRB 2YWHA 2BUNA 3MM5B 3KLFB 4RJVA 1SCJB 3N28A 3H8YA 2CDQA 4YUDA 2MY8A 4NA2A 3JSMA 2DBBA 3LGHA 1WJ9A 3T6JA 5D78A 1B64A 1I5OB 3T9NA 2CQ0A 5EC4A 1CJKA 2KHCA 3HKWA 3G86A 2OB0A 4QJVA 1U1NA 3H0PA 2HVZA 1S0NA 2B3UA 3KMSA 3KLIA 3D7FA 3NNAA 4K8RA 2D9PA 1S4EA 3O8WA 3WIVA 4R5PB 4X4TA 2B5GA 4KBIA 2PRQA 5HANA 4QU7A 3RAQA 3G6ES 4KOTA 1N34J 2DIUA 4IOBA 1I51B 1HYSB 5ETTA 1VHFA 4C0HA 1N71A 2ZM6J 2UU9F 2J6TA 1N52B 3UW1A 2B51A 3E3XA 2XO7A 1HNVB 3EGVA 4CRJA 4ER8A 3BZQA 3IR7B 1HQEB 2YVSA 1WK4A 3VAIA 4IH7A 1DARA 2HRUA 1T7PA 3IU2A 4PR6A 4TYBA 1F2GA 1XNRJ 2QVPA 1LV5A 1W7WA 3M2RB 3DLGA 3OW2R 4NWBA 3IG1B 3QWPA 4L73A 3NS6A 1CS4B 4WKYA 1F2HA 2CKWA 1MWYA 3CCES 4KSFA 4P72A 5C2GA 3BB5A 4OX7A 4DR4F 7AT1B 2MZ1A 3RBUA 5D15A 1Q5VA 1B70B 1Q2YA 1Y9KA 1SQHA 3PB6X 2M5YA 4DU8A 3MFIA 4WZMA 3ET6A 3R5AA 4LSNA 4O0IA 1D8YA 2XYPB 2XSFA 2HS4A 3GSIA 1V9OA 1VMBA 2MKHA 2V2ZA 5IWAF 1FNXH 2F1FA 4QQBA 4KVME 1SJ3P 4R8UA 2PJ7A 1BQMB 1YBAA 3D66A 4XPEA 3HF5A 2XQCA 3AODA 4OL8A 1F1BB 1FKPA 4Y49C 3GYGA 3BSAA 2NCKL 1A7GE 1VOMA 1V5VA 2OPSB 1MROB 3I32A 3JYTA 3D7HA 1EARA 3NE7A 1S6QB 4CDIA 1VDHA 4KGKA 4OP4A 3J81j 1TKXA 4OYWA 2X1AA 2O66A 1S1WA 4HT7A 1RTJB 1YJVA 1RT1A 3UY5A 3DOLB 4QVTA 2X3DA 5F8NA 1WEZA 3SI1A 3JAMU 3KKWA 3DRSA 4XPCA 3LGNA 3S9LA 5DS7A 3BM7A 3D0GE 1T9WA 2ZVIA 3IGVA 1S9EA 1XIQA 4IKAA 4PRFA 2PJAA 2PFDA 1HHSA 3AY0A 3CE8A 2CTCA 2ZWPA 1M4LA 2ZJRQ 5D4NA 2P9EA 1C4AA 1S0VA 2DNOA 4I2PA 4DSJA 3N79A 3M30B 4OX8A 3BYRA 4KOVA 1FEEA 2W4DA 3LO3A 2CIMA 5AG7A 4WP9A 3EJMA 4USUA 2R8VA 1YBTA 3H5SA 5LRGA 1IM4A 1X5OA 4NLTA 4RW7B 2VQFJ 3CGIA 5DWMA 4E2FB 2WVBA 2HW3A 2B8QA 3UN3A 3H4BA 1RAAB 3RJMB 2J6SA 2E1AA 1VLOA 2VJUA 2X7BA 2Q7BA 3MM9B 5IV3A 2PMZD 4FPIA 4DR7F 2PJBA 2DR6A 3C46A 1D3WA 4PG8A 3TEHB 1IKXB 5HP1B 1FFGB 4LF2A 3UCGA 4B5PA 4A48A 1ZM3A 4ZYQA 3DR8A 3TVZA 2HLTA 4EBCA 3BGOP 3ITHA 2UVRA 2FCKA 1M5PC 4YB7A 2UUAF 3ISND 4ED8A 2JDDA 1TUGB 1JB0C 2Z0GA 3CCZA 2COLA 3NLCA 5E96A 2J0WA 1CJKB 3W9HA 1IBMF 4LF7F 2D9OA 4MIBA 3MURP 3PJ9A 5D77A 2PVWA 4USKA 5JVGQ 3FJ2A 5GAHU 3GIIA 3GYXB 2FLOA 1L3SA 2HNZA 5D29A 4KC5A 3IJ3A 1NHKL 3QRRA 5IZHA 2YPYA 3VVTA 1VJQA 2WBMA 1B0TA 3Q89A 2NQPA 2LEBA 1D9FA 1T3OA 1IWAA 4OHWA 1TL7B 2IDEA 1TKDA 2IDLA 2C3YA 4DQRA 2BYCA 5L1IA 3TNVA 5KFAA 3EGZA 3A4TA 2OPPB 3ISXA 1RT6B 1WACA 2M8HA 2HRTA 1RWUA 2HS0A 3PXGa 2AYEA 3GJSB 4USTA 5D0GA 2NPFA 3QWUA 2V9WA 2ASJA 3CC4S 2ROEA 4TQSA 1LK7A 4JI6J 4FVCA 4OZ3A 1DTDA 3TFYA 5KOXA 1IIDA 1Y10A 3A12A 4B9UA 1JLFA 3OUYA 4OMEA 1HDQA 4KLVA 4OLOA 4GO7X 3VQTA 4MCPA 3KLVA 4MFBB 3ADAC 1RUSA 2EO8A 5A6PA 5HATA 2ZEPA 2FDNA 4DR2J 1Y0HA 5LRKA 3MD1A 4H4MB 2HQFA 3NY0A 3QJLA 1DTTA 1UFHA 3SIPB 1S5KA 2NZCA 2KG0A 3BO4A 3IWWA 1L0CA 1TKHA 5FVJA 1OYEA 3PEJA 5KFBA 1O0PA 2ZOGA 1T03B 2NPIA 4AE5A 1BQNA 4HYKA 3W61A 5KG5A 3V6DB 4CLPA 2QN6B 3TZWA 2VJVA 3MM7B 4DV6F 4IDKA 3EGNA 2XM3A 2CPZA 3PDNA 1RAHB 2J9EA 5ELYA 1PAUB 1RT4A 4CWBA 4NLPA 3SYZA 1TIQA 4NL5A 2P9GA 3D1QA 4BCAA 4IG0B 3TJ8A 1KN6A 2VBWA 4NXNJ 2AYMA 3MGJA 2R7RA 4F4ZA 4CO4A 1Q8IA 3D7DA 1VBXA 1SJQA 3HMJG 5EDWA 4GC7A 5A8RA 4O3SA 1PUAA 3QB8A 2KJVA 3IN5A 3DU5A 1NJWA 3KHRA 2RRAA 1X5TA 3BKTA 4YN3B 2VFTA 4JV5F 3DLKB 5J8CA 4IH6A 2IVFB 3M2VA 4J9SA 4UY85 3C66A 1RWOB 1H7WA 3PRVA 3ZZTA 1XN9A 4OLLA 2XNQA 5DQIA 3CIZA 3QJJA 3P2HA 3E01A 2BSWA 3VQSA 3GJTB 1VQ9S 3CT9A 3K58A 1JJ2R 1ARMA 3V4IA 2IVMA 3TZXA 2VG6B 4DFMA 2XEXA 3T41A 3CJKB 1RKJA 3TOQA 1NK4A 2KFZA 4L3KA 1HI0P 4JI8J 3KK3B 5GCNA 3ISNC 1MU2A 1FRHA 1U1MA 3U02A 4U95A 3QAHA 4R3LA 1T9UA 1EKSA 4WCEQ 2YX7A 2CPEA 3FEXB 3JAMY 4A94A 1Y0RA 3SCKE 1FT8A 1RWPB 1OO0B 3QNVA 4MHPA 4MCSA 1XMQJ 4V19J 3IP0A 4NYOA 5HH1A 4K2JA 2FE7A 3PG9A 4DLEA 3SCLE 4L3NA 4C0OC 2HKEA 4GKJF 2PFFB 2R7TA 4O44A 3LODA 1YJ9S 3LAMA 2KB2A 2KVQE 3VAKA 3M2UB 5J2MB 4U7UD 1FDBA 2QL5B 4MY3A 2UV8G 3SQOP 5H9FK 1J27A 1I1GA 1YVFA 1LFWA 4LBHA 5DZ7A 3RB3A 2HYIB 3D1HA 1RHMB 3S6GA 1KRPA 1U45A 2DT9A 3I5BA 5I4MA 2K06A 5CNPA 2GVDA 3GKRA 2P6TA 3MRUA 2GQQA 2EK1A 1NNDA 2B5JB 1IQZA 1HBMA 3BHXA 4QR2A 2JDCA 4CYNA 2GO9A 4X5KA 3PKYA 5LYLA 3QGPA 1RDRA 2ILYA 2KT2A 1NO8A 3PKMA 4IR9A 5KAKA 2XMUA 4TY9A 1FY7A 3QATA 1K9MT 4RUBA 1ZYQA 1FFWB 1H2UX 3BDEA 1HBOB 4OV6A 1YJRA 1VQPS 2WHOA 4C3KA 3QT6A 2J8SA 2CPXA 1FJGF 4CLYA 1LWXA 1Z2LA 1JLFB 2XLIA 4U96A 4RW6A 4EFDA 1WC5A 3MM8B 4B13A 4J9RA 2QMXA 2Y1IA 3CD0A 3KYLA 3MMCA 1IU8A 2EFVA 2MSTA 2G3AA 3TT2A 4P4IA 1MK4A 1XR7A 1MMNA 2WOMB 3F0AA 5EHHA 4JP8A 3FCWA 4FYXB 4O4RA 1M1GA 1NUEA 2V50A 3HFKA 1Q0NA 2YNGB 4IFVA 1SH3A 3KUGA 3FMWA 1TMJA 2RUSA 2BV3A 3VATA 4OZNA 2ZHOA 1W25A 1UVIA 1QTNB 3V81B 1S72S 3BXMA 4KHPF 2QC3A 7CPAA 1IR1A 3RYLA 4M5DB 2IM0A 2L3MA 2ZEEA 4FYDA 2G0IA 3LQVA 2BXJA 2MJNA 2QL7B 4ZMMA 3IFEA 3CXCR 3W63A 4I6WA 4YB5A 3CCMS 3L7PA 2FJVA 4IHMA 2CVEA 4Y65A 2ATLA 3PR5B 3GYAA 1R3NA 4OLPA 4MTPA 1UVKA 3MHYA 4BHQA 2DVIA 1ON0A 4O23A 4PWUA 3FNCA 2F5GA 3A3PB 1AMPA 2ADBA 2CZ9A 2LA4A 4K5SA 3ENQA 1D09B 5F8MA 2CNLB 1RTIB 3EVMA 2A10A 3N7ZA 3SQGA 1UAWA 4NCBA 3DLEA 2ZEFA 1WWZA 4HDGA 4F50A 4QW8A 1Q82T 4TLRA 5K14B 2Z2LA 5KTDA 3KXDA 2CJAA 4B3TF 4LR7A 2HBQB 2PSWA 3D4JA 2ZEGA 1SBRA 2XSJA 3V4IB 3AAWB 5CYQA 5HL7Q 1UETA 3DU6A 1CEZA 1FJCA 3P49B 3N6MA 3MEGB 2PGCA 3R9LA 4DV4J 3G8WA 3PEIA 3DM2A 1HL6A 2V4RA 2C22A 5KG3A 1N0UA 3TWZA 3DHXA 2XMJA 2AF6A 2C2DA 3IS9B 4HVZA 4UIAA 3DLJA 2A4NA 3V38A 1X7VA 1P9QC 3T1YF 2NXEA 5IXUA 2HFVA 2DRBA 1AXQA 3CMES 3M1VA 2F7VA 3K0JA 4A95A 4GVBB 2G9OA 2Z2ZA 3C26A 3K59A 4I49A 3R2DJ 2EC0A 2FHKA 4DWIA 1U09A 2CNMA 4OJHA 4F4KA 3R8YA 4WF9Q 3RTVA 4LFBJ 3M8PB 4XAKA 4ZN1A 3DDDA 1LWEA 3I3GA 3PV8A 2VA2A 1GXLA 2ALYB 3KK1A 4LF9F 2YKNA 3QSIA 3AJ2A 2UZAA 2ZW7A 2VZZA 4M3SA 1FD2A 1RWXB 1LWCA 4USWA 1J5OA 3G8TA 1DY3A 4L8AA 3Q8SB 2N3OA 2YQ1A 3AB4B 1C1BB 4A30A 3CCWA 3ICLA 2CIJA 3FRZA 1N6QB 1CPXA 2N7YA 3FBEA 3IRXB 3QFHA 4Y2CA 3OD2A 3C16A 2DXDA 1ARLA 2KL8A 3ETOA 2C6GA 3C6TA 4C8ZA 3P3DA 3BS9A 1CPSA 4BS2A 4PABA 1WI6A 5J8FA 2D4OA 4IQXA 2RU9A 1KVIA 2W2MP 1FWPA 4ALZA 1DQ8A 4I69A 2AEJA 4C68A 4Y28C 3HSGA 2AFOA 2R2SA 1QSLA 5C5JA 2JC0A 2HVHA 1REVA 3FCHA 4CLUA 3W5YA 3LUYA 3R3TA 4M5JA 4DL7A 2XS7A 2NSMA 4KY3A 4AG7A 4DV3F 1XR5A 2CA9A 1OQ3A 4DPTA 3D3SA 1GMWD 1HNIB 3D0HE 4CRYB 2YKMB 3N9UC 3G71S 4CO1A 1NKBA 4DMZA 4WFYA 4ID5B 2IVYA 3T5JA 4C11B 1XE4A 4A39A 2JLEA 3DRPA 2FJAB 4DV2F 2ZUAA 1U49A 1SQEA 2YKAA 4YDXA 2O01C 3S9NA 4WKRA 5THWA 3JTNA 5G20A 2IM1A 2VG7A 2KYZA 2R7WA 4F2RA 3HVRA 3W65A 3AJ1A 4LF4J 4MXUA 5KFOA 3I55S 2ZC3A 1S6PA 3JS9A 4G1QA 4FAIA 4U5YA 4QW9A 4ED2A 4J91A 3IGNA 2AEMA 1QSOA 3O5TB 2VG5A 1FXLA 1RBAA 4C0BA 2OLWA 4H4OA 3TUIC 3H2VE 3TR5A 4FXWA 3RG6A 3RB6A 2DXEA 2E1CA 3R1HA 2RE1A 3M9NB 1AROP 2KYXA 3FVLA 4O3QA 3P96A 4ES2A 4Y00A 5C7PA 3I31A 1FRMA 3JRUA 1UEKA 2DR8A 2HNDB 4R9MA 3DLEB 3HHLD 4U7UK 2J9AA 1UZDA 1U2CA 3CW2C 2ZDPA 4ZVEA 5BWAB 2JLMA 2QG9B 5DZ6A 3VAMA 4DR1F 3T5LA 4UZCA 2AGOA 1DQ9A 3SI2A 3L7OA 2F4FA 2QSWA 5L1LA 1YLOA 4YFJA 2A6OA 1X9WA 4ZPWR 1RB0A 1F5CA 4WK3A 4F8RA 1TKTB 2PJ5A 2MQPA 4NLSA 1NLKL 3HULA 2CQGA 3UI3A 3X1LB 4UCNA 5IT9Y 2AJ1A 3NXZA 3WC5A 1CC7A 4ES3A 1QY7A 4HTIA 4N47A 2JEFA 1VC5A 5FDLA 4Q36A 4IRKA 3M8RA 1VHIA 1U7LA 1WHVA 3FSIA 4HKFA 1JLCA 3MEEB 1JLGA 4HI1A 2RS2A 5A76A 2B7CB 1TV6A 1D9DA 4NEYA 2H51B 4XO0A 1UW4A 2AHOB 3VTIA 3MECA 2DGTA 4NEXA 4R57A 3T8WA 1O5JA 3EXYA 1RAJA 3Q23A 2P6FA 3KR4A 3WC7A 2VFRA 2CNSA 4X4VA 4A31A 3BO2A 2Q79A 1HBNA 4FYWB 4MFPA 2XS5A 1UJ6A 2YNDA 4LT6A 3ZO7A 1DLOB 3PYEA 3M6VA 3I4PA 1SV5B 4UY8T 5KFDA 3KK1B 2AD9A 1YJUA 1LXNA 2UXCF 2JX2A 2GLJA 3TUPA 2HWTA 2HBYB 4B3MJ 2LCWA 5GMDA 4LSLA 4X2TA 3F41A 3V8IA 2RU3A 2IM3A 5KT4A 4NLWA 2F4VJ 3G8QA 5JXSA 3EC4A 2CXEA 2H4WB 2Z8QA 4WFAQ 2PMWA 5LSOA 5CYMA 3CJ3A 1VLYA 2DF5A 3BPDA 3Q24A 5E0OA 2AW0A 2Q43A 3CMQA 4MI4A 1VISA 2JNJA 4F67A 1VQ4S 5I3UA 1JXLA 4K4WA 1TUWA 2BOAA 3C16B 4IOCQ 3MUTP 2K3KA 4KO0A 2VF3A 4GRSA 4OFZA 3KG0A 1N5YB 5F8GA 2YNFB 2B4DB 1M5KC 2PJ1A 1YITS 4C8KA 4X65J 4BMHA 4F26A 1MN7A 5HLFB 5KT3A 4B17A 4AVAA 3NNHA 1OIAA 1Q78A 1TF8A 2HNYA 3CF5Q 4KTQA 3OL9A 2RDJA 3M8WA 3K2KA 3BGFA 1RAIB 4CLSA 2K1RA 4OC2A 3DMJB 3Q8PB 4KGMA 4NZ6A 4DSEA 1R57A 5K8PA 1U4BA 2AYBA 3LALA 4V1Ak 2A3JA 1Y7RA 5D3GB 1HNWJ 2F65A 2O4HA 3B54A 1KNZA 1FE0A 1HMVB 2ZJQQ 2J0QD 3HVWA 2BJ9A 1BMQB 2BW2A 4GXHA 2HK3A 1BAVA 3MF5A 3BH6B 4AD6A 2V8GA 2W01A 2ZH8A 2CWKA 1FESA 1WEXA 4DFJA 1XMTA 4XPDC 2GLFA 2EWHA 2MZTA 1JMTA 4GO5X 1QDUB 1NK8A 3TI0A 3OVBA 4DJLA 1AT1B 4Y49B 3RAMA 1EP4A 1SB6A 4J9LA 2UXBJ 1Y7PA 4QR0A 1WHWA 3THVA 3US5A 1I1DA 4LUAA 1QE1A 3S6KA 5L38A 3MUMP 1F0XA 3V6KA 4RUHA 1C1CB 2KN4A 4MK9A 2PN6A 5AXLA 3QPIA 1NEEA 3MUVP 4UEZA 4JI4J 4URQU 1ZG8A 4AVBA 4P2MA 1X4DA 1T3NA 1A9NB 4LF8F 3FBBA 4DFPA 3QO9A 2YWEA 3LOUA 1SUQB 2K5TA 3K9UA 4P6QA 4KUBA 3R1KA 4B10A 4ONWA 3CB4A 3K89A 4DCPB 4CM0A 4ZITA 4K4ZA 2Z10A 2Z3LA 3UD4P 1LRZA 4JI2F 2A18A 5FIIA 4HR2A 4MHYA 1RT5A 4TU7A 1EETB 4QYZJ 5B0BA 2R7OA 4RUCA 3HK2A 2FIUA 2OZUA 2W7PA 4BC9A 3KLEB 2AX1A 3AD7C 1GHEA 3FEEA 1UVMA 4A46A 3RU0A 5G4DA 2N82B 8RUCA 1KC8T 4X84A 1BXNA 4C2ZA 2VC0A 3G6XA 4K4YA 3POTB 3N0VA 2Q66A 3AD9C 4ZCIA 1WC3A 2MGZB 3PW7A 1N4LA 4WYLA 3KNGA 3NG8A 3NH4A 3EXNA 1HNZJ 2IRYA 2OZGA 3AQOA 4MIWA 1R89A 4P7TA 5L9NA 3GONA 1P0HA 3OL6A 1VHSA 4HHHA 2PIYA 2AJQA 2HGMA 2ZOMA 1OBRA 3HDSA 1HQUA 2XGQA 5CH7B 4LF6J 1Q79A 2WBRA 2Y0BB 2D7SA 2G4BA 2KM8B 3FRMA 4NCAA 1M0SA 5A0YB 2FHOB 1XJWB 3AOBA 4Q0BB 3PEHA 2EVZA 3HT0A 3M8SA 2CJXB 2P8IA 1XMOF 3VWDA 2D74B 1N5SA 3P4UB 3UN2A 3RB4A 4OHXA 3CDBA 2OUGA 4NXYA 2KG1A 1SC6A 4X4PA 4CGLA 3GTYX 1CX8A 2DXQA 4OX9F 4E2AA 5I3UB 2LKZA 2NZ4A 3CCRS 3MN8A 3RR7A 4DV5J 5DLGA 1LANA 4QB9A 3LPYA 4F0YA 2B6AB 4B3OB 1VRUB 1IKWB 2BO9A 3VGUA 2DHHA 5HBMA 5B0AA 5F9NA 2V4JB 2IL4A 3KLHA 3EVOA 3LP1A 2ZE2A 2ASDA 2H65B 2HNYB 5J1EB 2ATRA 2CQBA 1K73T 1GYTA 1U02A 3CDAA 4DPYA 3FB3A 2C3MA 5BJRA 3ZTQA 5J2NA 2FY8A 1VQNS 2OFHX 4EVYA 2OU2A 4IUSA 4MJ8A 2M70A 5KG2A 1YRTA 4ONUA 4PSXA 3KHZA 3Q8RB 4R3KA 2E5LF 3QMQA 3AFGA 4J9OA 1N8RT 4B9TA 4GS4A 2W7AA 1LK5A 1WG4A 2GAHC 3PW4A 1QAJA 2BE9B 2HHUA 1FD8A 4ZJOA 2E9RX 2FZCB 2HIQA 3HJVA 5F0UA 5EWFA 1QSRA 2YGWA 5LMNJ 5LMUJ 4AXVA 4FNIA 4KR0B 4QPXA 1I12A 2OGUA 1UFLA 4LBPA 1EP4B 5DDQC 3OWCA 4ZVPB 1RKIA 5ETOA 4N41A 4QZVB 4MKVA 5JVHQ 3NWRA 4AG9A 2PQ8A 1YHQS 4JYWA 2CXAA 4CLZA 1UEVA 1NSQA 1N32J 3QRPA 1V5IB 5F0WA 1QSMA 4OX6A 3N01A 1OSCA 1WC1A 2JLGA 2REFA 3KHLA 3VARA 3WABA 2VPZB 3H2UB 1KFSA 3TC8A 4O0NA 3JTPA 2QEXS 5A2QU 1TVRB 2BQUA 4YY3J 3J81U 3FZ2A 3H20A 5IM0B 2EW9A 5BYSA 4NSQA 4IFYB 3FEYB 5F46A 4LF5J 4WK1A 4KKOB 1U25A 2XS2A 4NOHA 2C6CA 2HFNA 4CAEA 3OXLA 4CYQA 1S3ZA 2VBYA 1R0AB 1NPKA 2KFNA 5KFIA 1DZ5A 4CAFA 4PWWA 2OPQB 1UWBA 3ZZ0A 2B56A 2IJZA 3PYDA 3EZUA 4JOUA 4KH0B 5EWEA 2V68A 2Q04A 1RT5B 3TAMB 1L3TA 1FI4A 4R6TA 2BMBA 4WWVA 1KVJA 3FEDA 1N33F 1RISA 4NCGA 4O3OA 1BWVA 1OZPA 1YRXA 3QT7A 1N54B 2XLKA 2AMCB 5AG4A 2QV6A 5GAHI 3TYTA 4W4MA 2ASYA 2RIJA 4X2BA 2GGPA 3N5FA 3H8EA 2J0SD 4ILLA 3T1AA 2UXDJ 2B4BA 2EUIA 4NI2A 4YEAA 2VFVA 3CCTA 1ZBTA 4X62J 3KWMA 2OSQA 4Q44A 8AT1B 2O5DA 2AYGA 2OEMA 1YI2S 3RBXA 1S1UA 1P4NA 4C2YA 3KGQA 4CYOA 2Z3PA 5AXNA 1X4BA 3C2PA 4U67Q 1HQUB 1JKHA 1GX6A 1GEHA 1S77D 2MHNA 3RW7A 3DGPB 3FJUA 1T9XA 3VHQA 4QWBA 4DUYJ 3W9JA 4DL6A 2W8KA 4KSIA 4ILRA 3D6FB 2NXCA 2FZGB 3D2WA 4P45A 3NNCA 1UFKA 4DX6A 2VB6A 2HQDA 2G1DA 4MFZA 3R2CJ 4Q2LA 1L5UA 5MLCV 1NSLA 4HLBA 1YKWA 2FHJD 3B3SA 3TO9A 1LOUA 2AP6A 2EXUA 5M2RA 4UOCA 2HAFA 1EKRA 3I5CA 5D4PA 1FHTA 3KLGA 4CGNA 4ZDNA 3T90A 1ZPWX 2PJ9A 2HQ3A 1BY9A 1WC4A 3R7BB 1M1DA 1N36J 1HKAA 4UT4A 4U8VA 1NK9A 1JQGA 2B9EA 3P5TL 2FLLA 3DOMA 5F3TA 2O53A 4RW8B 4JV0A 2FYXA 2FUG9 3AA8A 4DBQA 4MK7A 3ZTPA 2HBRB 4KGVB 2YPZA 3JQJA 2G2OA 3CSKA 3PR4A 1IBLF 3OTDA 1VKCA 3ZZRA 4DPXA 2PC6A 2Q0YA 2BANB 2UP1A 4P74A 2L9WA 2XGPA 3CJRA 3LANA 3TX8A 4UBRA 4DV0F 3LP0B 3EM1A 3B82A 2RDDA 4ED4A 4FYYB 4IF5A 1LW2B 1REGX 3GILA 3FVYA 4K59A 2Y1RI 2RH3A 3CULA 1YSJA 2QA2A 3BH7B 2GJ2A 5J2PA 3FFIA 1BGXT 2ZWOA 3GQCA 2OTLS 2GVZB 2NSBA 4RZRA 4UTGA 1WHYA 2CG8A 1KS2A 3NCQA 3G3SA 3IWLA 1SJFA 2PR1A 5HK4A 2KU7A 3CDUA 1UWAA 2MKIA 1TMMA 4YR0A 2VFUA 3EWGA 4PAAA 4OHZA 1XFOA 1I21A 2YH0A 1F3VA 2E7XA 2V5HG 3Q2SC 4DN9A 5LL6d 3OHBA 4AL7A 3OFEA 2F40A 4DR3F 3W5XA 2YNIB 2UVUA 1NJZA 1ZTWA 2OH2A 2JL9A 3D8PA 3DNCA 2EFQA 3QAUA 4ZP7A 3S9MA 2PD1A 2JJ4D 4CYPA 1X8DA 4OI0A 1T9YA 3UPFA 2UU9J 1TKZB 2XMMA 4KV8A 2C2ZB 4Y6IA 1S1VA 4JI3F 3IU1A 5GAEU 2V77A 4Q5VA 1SJ4P 1ZH5A 2XHWA 3KFWX 3PHTA 1OY9A 2DH7A 4N5SA 1NSPA 2NYHA 5BYRA 4HKQA 1X5SA 5LJ3Y 3K2YA 1FX2A 4NI2B 1AZSA 1BO4A 2WAQD 4NLGA 2XI3A 3OSNA 3MM6A 5B09A 3TANA 5LYDA 2ZH2A 2I38A 2PMHA 4DR4J 4ZKAA 4ELVA 4PPZA 4I56A 3FZBA 3CJ4A 2WPWA 1JK9B 4Q8EA 3K5NA 4I2QB 3X3UA 2IMWP 4QIEA 3MOZA 3OJSA 1GX5A 4ZJQA 3DRYA 4AB7A 4W90B 2I8EA 5IWAJ 3E0KA 3WT4A 4M5LA 2Z56B 1RTHB 4C8YA 1Y00A 4K7QA 2VBZA 1W2BR 3P8BB 4G1PA 1SH2A 3B78A 1BOBA 4BWMA 4YB6A 1S57A 3GSDA 2V8HA 2P6SA 4KGXB 3UN5A 1GFWB 2ZH9A 3CDXA 2ZC4A 1C0TB 3GE9A 2G3TA 1SJRA 4EO6A 2HSEB 2J76E 1G4CA 4OI6A 2GNKA 3CJ5A 5SUHA 4C4WA 1JJ4A 1GMWA 4L6V3 4CYUA 2HFUA 4ZA1A 2XEJA 2PIIA 1Y4ZB 2IJFA 3FC9A 3R5GA 1O51A 3M05A 2MQMA 5AGEA 3IGRA 2QRRA 2ZITA 3C15A 2DY1A 3DOKB 2LLZA 3GY9A 2R8GA 2KVIA 4DSLA 4IUFA 3HLUA 5MAOA 3U1LA 4NLDA 2AEFA 2XEFA 3CNQP 1UZHA 2FJBB 4Q43A 2VL1A 3BBFA 4S0MA 2YTCA 4IG3A 3PFEA 3OBIA 1J2VA 3TP2A 4IYQA 1VIXA 2LQ5A 2VXKA 3UVJB 4DR7J 5C88A 3VR1A 4Q8FA 2IPOB 4MH8A 4P71A 4P6YA 4M5IA 3PRTA 5C82A 2J8MA 3ENVA 3CCLS 5ITHA 1K44A 3AJDA 3EZOA 2MKKA 3UCUP 4MKBA 2QYVA 4F8ZA 3BF4A 3G6VA 3H59A 3QRQA 3N5BA 2REEA 2DNLA 3AA9A 2W7OA 1NK5A 3SXNA 3ZJ0A 4P73A 3D1OA 2QFJA 2AZ3A 3SFGA 2KO1A 4OYIA 2W9AA 2P6GA 3GP9A 4IQMA 5C42A 2ROPA 2UUAJ 2C3PA 3CPAA 2JVRA 2MDAA 1IWGA 2YWFA 2DRDA 4CPAA 2U2FA 4IO1A 1UKUA 1G2EA 4RX6A 5KFVA 1KTQA 2WB1D 1WDDA 4UA3A 1IBMJ 4ECXA 4LF7J 2KTQA 3VF0B 2HWIA 5G0RA 1EE3P 4OKOA 3MTKA 3R9FA 3IWEA 1K47A 4FBTA 3L4BC 3J80U 2UUTA 2VEZA 4TXSA 2OHDA 1B0PA 1UPMB 1C0UA 2E5IA 1TL3A 5CAAA 4OJ3A 3R96A 1ZAVA 1Q7LA 1MMDA 1YX2A 4UQTA 2B8PA 4NFRA 3UNGC 2Q44A 3P45B 2XG8A 3OQ2A 1W26A 2CTBA 1YBUA 3W64A 2LMIA 1S1VB 1JLEA 3TUZC 3EE3A 3KMQA 2YQ3A 3EFAA 4ZVSB 2DR7A 3CZXA 2WYRA 4J9NA 2MZRA 4Y2AA 4PUOA 2WVCA 3QFWA 4XK8C 2HV2A 1FTCA 2MLYA 4FUUA 2MPUA 3W1YC 3LWMA 4CLFA 4UEFA 5JQ4A 2IC3B 1CBKA 4TVAB 5L1JA 4OQJA 4NLUA 4Z7YA 1MJ9A 2JBKA 5K5MA 2CPJA 4ID8A 4QCLA 5B0DA 2C2OB 4LIRA 1MLAA 4F0XA 5KTCA 4BD9A 2BJ3A 4DQQA 4KLWA 4DUKA 4LFAF 2C6PA 5A8KA 4FNHA 4DV6J 1R27B 3W8GA 4UOFA 4KOSA 3QSYB 2W1BA 4X4QA 3DYAA 3M8YA 1GMVA 3HO1A 3MWBA 2WPXA 4BINA 2EG2A 2RFHA 1XEBA 1NB7A 2ABYA 3EZ5A 2B3VA 1OY8A 3IEHA 2DNYA 5I42A 4E8UA 1ZZNA 2ZEJA 1X31C 3GCWP 4JV5J 1S59A 2J6UA 3L9ZA 2OPRA 3MR3A 5F41A 2B4OA 3MM5A 3KLFA 4B02A 2YWWA 5KG6A 4A2ZA 2IIHA 4F3OA 5KFKA 4MBUA 3NKYA 3M9OB 4GKKF 5IT4A 2DHSA 2G0JA 3ZZOA 2CQCA 4HEA9 1L3UA 4OC3A 4OC5A 3A13A 3SDEA 2B3TB 1VC6A 1TL1B 3ZZIA 2GJFA 3OSPA 2OTJS 1YJWS 4IG3B 4UFXA 4R5PA 4PXBA 1PYTB 2RT3A 2ZDOA 3CJ2A 2LDYA 4DV7F 1I94F 3MAAB 3KK2B 4JXQA 3MZIA 3MAHA 4AT1B 4PV6A 1FDDA 4JI0F 1HYSA 5KTQA 2R7VA 3TQ1A 2VBXA 4JB8B 2Y8WA 5HVGA 4I6AA 2AFMA 4JWPA 1KD1T 1TZ0A 1ZAWA 2R3VA 1VQLS 4JZ0A 1HNVA 2DGQA 1TK8A 3KQZA 5EX0A 4EBDA 4M63A 1RO5A 3CJ8A 3HHLB 2E9ZA 1S97A 2ZZMA 2QT7A 1QUPA 3DC2A 4GKJJ 1LW0B 3M2RA 4KFBB 5J1NA 4I6YA 3UFCX 1U1OA 4NLVA 3VALA 3IG1A 3TJAA 2GMJA 5KFWA 1CS4A 1M1KT 5GVQA 1QUVA 3JSRA 5H9EJ 5HN0A 4UUXA 2KDOA 1RU1A 3TZYA 3NGDA 3W2WB 1V3RA 4MT1A 1VI7A 3CJQA 1C0UB 1FRIA 1VFJA 4X4OA 1YTYA 4UFWA 2EKYA 3PNIA 1SIZA 2ZEOA 1TTHB 3GMGA 1LWFB 2V34A 5GMKa 3KUEA 1BQMA 2DNRA 4A32A 2EFPA 3WR7A 4OHVA 3WQPA 2MQLA 2YH1A 1JLEB 2OP5A 2EC2A 2OPSA 2R98A 1YJ7A 1MROA 3UDEA 4P7VA 1U26A 4ETZA 2HHHJ 4DHVA 1S6QA 1NZ8A 1AUGA 2V63A 1JXEA 4J9VA 1RTJA 1WF0A 2I5JB 3D28A 3DOLA 4AUKA 1FJGJ 4JLYA 3IBCB 1I3OB 4DF8A 2GHPA 5CCLA 2BM0A 1VBZA 4ECQA 4LQGA 3GFZA 5G1ZA 1CULB 3NBPB 4ELUA 2L08A 2GIFA 2AKWB 3GIRA 2HMIB 4FF2A 2G0BA 1H74A 3U27A 2ABZA 5B7WA 3B4MA 3BJ7A 1UCNA 4HI2A 4KHPJ 2ZOFA 2YXLA 2E1MC 4RW7A 4C6AA 1KP6A 3GWCA 1X9MA 1NDPA 2FL4A 1HI8A 2ZW6A 4FDFA 4DF4A 2BA9A 3H5XA 2ALZA 1IVZA 3MM9A 3A8EA 5ETKA 5HQ8A 2GFFA 1HNXF 4WYWA 5E7OB 1P8GA 2B4UA 1ACMB 1KQFB 2I3CA 1IKXA 4ZOSA 2HPUA 1Z4EA 1KQKA 3PO4A 4EFAC 1YGYA 1DFDA 1LXJA 4NZ0A 3NGRA 3DR6A 2CPHA 5FJ4A 5D0EA 3HHDA 1U48A 3W66A 3CEDA 5KTAA 2B4PA 3PB9X 5LOQA 2ZNZA 3R97A 1CLFA 4FYVB 4FF1A 1FTRA 4C3MA 4IRCA 3M32B 3KJVB 4NGNA 2NS1B 4Y2KA 3CPXA 2R2RA 5JMNA 2ZHAA 2MTLA 4MIAA 4B3TJ 1Q2DA 3B8HA 2FPHX 3SDEB 2M52A 3NRBA 2PCUA 4ZX9A 1AFIA 5JH9A 2W2NP 2AFWA 1S76D 5EN1A 2Y0SD 3KQXA 2LYVA 2HQGA 4PXEA 1HBUB 2FZKB 4F3QA 3EDRB 3UDCA 2A2DA 3BGRA 3W2VA 2R7UA 1H0HB 2OO4A 2DKOB 2N4CA 1HR0F 4DDFA 2Z11A 2E29A 2YKQA 3RAXA 1OJ4A 3QIPB 4M95A 4LMZA 1TL7A 1Q8KA 1J5EF 1LEOA 4WPAA 2JEJA 2WSAA 5CPAA 2OPPA 2RMLA 3T1YJ 1RT6A 4PWDB 1JLBA 5CD4A 2CFXA 2Q3PA 1XC9A 2FVQA 4YU9A 2EEYA 4PQUB 5HJXA 2EBEA 4CM2A 5DETA 5DRKA 2VPWB 4I7FB 4E98A 2V94A 3PW0A 2VQEF 2O1PA 4ICLB 3EPGA 2OELA 1R8CA 3ILIA 4OYOA 4B9MA 3ZZPA 3UWTA 3DN9A 5DDPC 2FJXA 1Y7EA 4MFBA 1FA0A 4ECYA 1UA0A 5T7LB 4RUAA 3DI6B 4LF9J 3GZ7A 4X4SA 5F47A 3QYYA 4H4MA 2B9XA 1X12A 5LT5A 3ZZYA 1A2ZA 3SJFA 1S6OA 2FJWA 1ZA2B 3PJXA 2Z2MA 2CJQA 1T03A 3TAPA 2BCOA 1PBAA 2PC1A 3MGDA 2XLJA 1KEKA 4P9SA 3B7IA 3S1TA 3F0NA 3V6DA 3TTHA 3KKFA 3MM7A 1EX8A 2W2QP 2WW8A 3SEOA 1S1XB 1WF2A 2ZBRA 4QIGA 2EK8A 5C24B 4DUZF 1TAUA 1MJBA 1PG5B 1R8BA 2BM1A 4IG0A 2BJ1A 4H2KA 3CD5A 1JLQB 1BQXA 4M6IA 3IIBA 4DCOB 2QLXA 2DB1A 4CO5A 3GFXA 4OZ0A 2Q4VA 1Y3KA 3J7YU 1F9HA 3G87A 3HUVA 2LXIA 2XB2D 1NDKA 3RGIA 4PZVA 1CQNA 1RTDB 4C7HA 2FQQB 4J90A 3B8GA 5IOLA 4ZGYB 5CCMA 1U8SA 3DLKA 4R25A 4F2SA 3C14B 4DV3J 1Y9OA 1ZOTA 1P1TA 1NMEB 2HZCA 2OFGX 3S6FA 2FLNA 1HARA 2IQ6A 1RCXB 2VKRA 3KUHA 1MWQA 2XHCA 3C6UB 3MI7X 4DV2J 4QIWD 1IKYB 3IR5B 4OYBA 2GV1A 2FHJA 1RAGB 4MYTA 2VG6A 3SV3A 4CH7A 1JJHA 3CJKA 1NCLA 1Z4RA 3H4DA 4X4UA 3DXBA 3QAYA 2L9NA 1R0BG 3KK3A 3NE8A 3V6JA 5J2QB 2MKSA 2C2RA 5M2UA 3J7ZT 1DTQB 4LRAA 3NAHA 1SC4B 1Y5IB 4B3SF 5LSLA 2M7SA 1WSRA 4LFCF 1OS5A 2Q7SA 2AV5A 2FJDB 3E51A 4M5HA 1QLNA 4LUBA 3A3OB 3KOAA 4O4GB 1F2PA 1T11A 3V6HA 1FRKA 3QT5A 4XIUA 3QIDA 4J3GA 2BE7D 1T9TA 1X4FA 4EUVA 2QLWA 3M2UA 5J2MA 4Y3CA 5L8RC 4DR1J 4JI7F 2XCPA 2KM8C 3F56A 3HD1A 4CAWA 5KG7A 3RR8A 3IRWP 4UF4A 5E3RA 4L76A 4KPYA 2JC1A 4FVMA 3OL7A 4PK2A 3GIJA 3FSYA 3B4DA 3KG4A 2LFVA 4NEZA 3BGRB 3W2VB 5KG4A 4XTTA 3UD5A 3UNYA 2YNCC 2BE2B 1U1RA 2CQ2A 4KVXA 2FIAA 3BBBA 2YBVA 5CYJA 4CT9A 2HFSA 2B5JA 5CA5A 4TY8A 3MCNA 4RBTA 1SKSA 1JLBB 5DG8A 4YR3A 2HG4A 1H3DA 3SJEA 4CT8A 1M4DA 1PSDA 4JI1F 2HZAA 1B99A 3ILJA 1G7CB 2QIRA 2R7SA 1S7FA 4PPDA 1HBOA 2PJCA 4EU0A 4E8OA 4G6VB 3WZ0A 3HVTA 2IA6A 2QA4G 4QIFA 2LQ8A 3ZZZA 2JRSA 2XYGB 3MM8A 3IR6B 4AFFA 2FSRA 1Y5NB 1ZM2A 4PCQA 2UXCJ 3CC7S 1HDUA 2OH1A 2DGWA 2WVEA 2WOMA 5K8OA 3PZJA 5D4LA 5FD1A 5AXKA 2Y1JA 3R5CA 2AQ4A 2H5IB 4C8MA 2PE3A 3K17A 2NYQA 1H7XA 2C2MB 3NP5A 3UDLA 2YNGA 2OIHA 1RHJB 1KQSR 5F49A 1UMJA 1NB2A 3PW5A 1AUSL 3V81A 4M5DA 4WE1B 1S7KA 2JDJA 2CPYA 4KIAA 1Q1KA 3KNAA 1VR6A 5HROB 2J8NA 1M5VC 1WI8A 1HPZB 5DS0A 1RGVA 3JSBA 2CPFA 4RWXA 2C3UA 2WSFC 2HEKA 4P44A 1QD1A 1VQKS 3UD3P 2ZFHA 3BN7A 5HMXA 3T5HA 2UUCF 3PHEA 4CGMA 3IM9A 3FDSA 4ZY0A 4NMLA 2GIRA 5DO2A 2LU1A 1PC4A 3CDEA 1RTIA 3UR3C 5B0EA 4KHRA 2CJKA 1HI1A 4RU9A 5L39A 4ENOA 1RAFB 2JFKA 2ZZNA 1TR0A 5IC6B 5K14A 1ZLIA 4I64A 2KCWA 4DPWA 2QJ8A 1UWYA 5D0HA 1VQYA 1ZM9A 3D6HB 3OTOF 3AH6A 2C27A 3NH5A 1JLAB 2NSCA 1FVSA 3MEGA 3TEGA 5CABA 3I56S 3MDFA 2DK2A 3CCVS 5IQQA 4WFNQ 2PSZA 3NCRA 4RR5A 2M4MA 2A6MA 2OI2A 2DNGA 3Q8UA 3FIXA 4CGPA 4KHMA 3T19A 3MR5A 2KKHA 1K1QA 2HHVA 3IS9A 3OLAA 1CVJA 4NRTA 2ZBCA 2VKZG 1YJTA 1FJEB 4ATNA 5I3PA 4P75A 4K30A 1B7YB 1RABB 1V6HA 3SMZA 3SJGA 2MB0B 2MHEA 4EMEA 4RI1A 2LEPA 2OR4A 2J0XA 1YREA 4LF8J 4GVBA 4USIA 4Z7CA 1O8BA 5DQGA 4EYHB 1RT3B 1F2OA 4ZP6A 2H5EA 2J8AA 5I3QA 1IYLA 3K5OA 3M8PA 5DJBA 2ZH7A 2DPJA 2YQ0A 1RSCA 4K0KF 3NS7B 4JI2J 1YIJS 4UUWA 4OI1A 5JUMA 2XEGA 4B12A 5J1QA 2PJ0A 3TOBA 1VRTB 1C1BA 4OC4A 1NZAA 5HI7A 1N6QA 2E1RA 3ZTOA 7FDRA 3IRXA 1QSSA 2CYYA 4TY8B 5F8IA 4C97A 3V7ZA 2W9CB 1RADB 2HHHF 3NWGA 5EMIA 4KAIA 1UEUA 4W9YA 4RNNA 2CQPA 3HVTB 4F0HA 3R5DA 4CQ1A 4JXRA 5GAEI 2GO8A 1SH0A 3HSJA 3EVWA 2DRAA 2OMLA 3T6BA 3OVAA 1LFPA 1V0CA 4J9UE 5AJ3F 1HNIA 2WCXA 1H38A 2YKMA 5K8MA 3W6XA 2RAQA 1XMOJ 2L41A 1ZS6A 3BR8A 4ID5A 5BYQA 5A27A 3K5LA 1VQ5S 3FNNA 3L09A 4C11A 2UUBF 3IO1A 2PJ4A 1QAXA 2D3ZA 2F8HA 3DLBA 4ZPTR 3BJ8A 3PFOA 3MR6A 4K4UA 3BYPA 4OX9J 4XPLA 4J9PA 1AUDA 4TNOA 3PIPQ 3GUXA 5AE2A 1JWWA 3RRGA 1U1QA 4LJMA 4LRFA 4IH5A 5DGBA 3T3FA 5IT9U 2O28A 3RRHA 5L46A 2GE3A 4DS4A 2GMLA 5DQHA 2I79A 3WHIA 2CJ9A 4CLKA 3W6SA 3CJTA 2P6EA 2GW8A 2PA8D 2ZH4A 2E5GA 2V8DA 4IO9Q 2V67A 1XJOA 1RLCL 1H8LA 4QUSA 2LVWA 4IK2A 3GV7B 4QBUA 1XBWA 2HNDA 4KVOE 3C3LA 2W2PP 1APSA 2F9JA 1FNOA 2ACMA 1FERA 1VJWA 4RO0A 3MEKA 2E5LJ 1J4JA 3Q22A 4JUZA 3QLHA 3ILLA 1KUYA 2B9WA 1Q5YA 4ZP9A 2FJEB 1KLNA 4M85A 1WUUA 2EPIA 1SI9A 2ZW5A 4PQAA 4L74A 5IT0A 1TKTA 1QSYA 4N56A 3SBMA 2E7WA 1NPRA 5LRJA 1XNQF 1T9VA 1LAMA 1NHVA 1S7NA 4DSFA 4ZVGA 2HHQA 1KUXA 4ZX8A 4EK2A 4QIVA 4NYPA 4WP3A 3A9LA 2QLFB 2H9ZA 3D2PA 2Y9HA 4P52A 3MEEA 2ZD1B 1UVJA 1GK8A 1F6TA 3B6BA 2DIVA 1RBLA 4F25A 2CDRB 3DRXA 2BEFA 1TFYA 3W9IA 5CD4H 2QTWA 4M94A 5ETSA 2KXNB 4JI5F 3KDOA 2QFIA 4U8YA 3GR0A 4QPTA 1YW4A 3H5UA 4HACB 4QBJA 2VHGA 3H98A 3M8QB 1QSTA 1WOSA 1ZG7A 2Y8YA 2KRBA 1DLOA 4HPSA 2DH8A 2E66A 1Q7YT 4TQRA 4CIOA 4TU8A 1SV5A 3Q83A 4I0WA 1KDNA 2NREA 1TL5A 1N0VC 4NGQA 3CJ0A 4CAVA 2GCFA 2CNOB 3D3CJ 4O3RA 4MFJA 1E6VB 2B43A 3TO7A 2GIVA 2MKJA 3PY8A 4JD6A 2WUUA 3K57A 1N33J 2AJ6A 3VWSA 3PO5A 4JV2A 1ELOA 2RKIB 4PG6A 3SZ2A 4H89A 2O3DA 3OR1B 2BACA 1E6YA 1KLMA 1X4EA 3RW6A 2BQRA 1PU9A 4CGOA 4NZ7A 5KFGA 1N5YA 1AYEA 3C8YA 2YNFA 2B4DA 2O67A 2DEIA 3NEKA 3HHNB 2GJIA 2BJDA 2DNZA 3A8KA 2AFSA 3DDIA 5HLFA 3TO8A 3TA0A 1GAOA 4RPFA 1RQ0A 4ZP8A 2BABA 3AXKA 2RJZA 2ZW4A 3FMCA 1IUJA 3TRGA 4HT5A 3GV5B 4CNYA 2XNRA 2G13A 1BLUA 2OD6A 3DMJA 4DUTA 1TU0B 4F02A 3H5ZA 2YNHB 5FLXY 2R2TA 1AFJA 1XRYA 1QAIA 5D3GA 2K2PA 2YY3A 4OJ1A 4JYAF 4MKAA 5AXMA 1HMVA 1RWVB 3BLNA 5KT2A 2Y3YA 1XQIA 4MHZA 4M6GA 4U9YA 1Z8XA 1H98A 1RJJA 5C2CA 4A8FA 2RQ4A 1YG0A 3MPVA 4EI2A 2LU2A 3BKUA 2CRLA 4AVCA 1PILA 3Q2TC 2GHWA 3UCZP 1RA6A 3BI1A 5H84A 5E2QA 2CWXA 1C1CA 1UW9A 1U8WA 2CQIA 1EQ0A 1CJVA 4J9MA 3IBWA 3TA2A 4G65A 2ZVSA 1N56A 2DNPA 4FKYA 3NCPA 4N8OA 1RXTA 5BR8F 4NA1A 4MCRA 1R0CB 1SKUB 1IBLJ 4JV1A 3MAQA 1SIWB 2NLWA 4LQ6A 4KSEB 5IV0A 1SUQA 3OR2B 2DJWA 4ZVTB 3QLHB 4RBVA 5ETPA 3NGUA 3ZFVA 1TXRA 2CNTA 2ASLA 1FKAF 3MR7A 3SI8A 2BOPA 3OFHA 5JGFA 1PIEA 1FF2A 4Y2IA 2NR0A 4DV0J 2FB0A 4XPKA 4Y0FA 1F5AA 1EETA 3MMJA 3S6HA 2XY6A 4M8LA 4MK8A 3IC1A 3KLEA 4FXDA 2BUEA 2VQYA 3DSBA 4PXDA 4FPRA 1GMUA 3FGVA 3H25A 4YRHA 4B9LA 3OTCA 5HXDA 2LXFA 4DQPA 3PB8X 1QVFR 1P6TA 2EFOA 2GC8A 3POTA 1PGZA 1UTAA 1M5OC 1NK0A 3N4WA 2MGZA 4ED5A 3LMSA 4LBIA 1MWZA 4DR6J 3I9SA 4YHHF 1FXRA 2X1BA 2X51A 4LRDA 5HMYA 3H7HB 2E1PA 3R7NB 2QX0A 3VZHA 3DFEA 2JH3A 4RNHA 1WORA 1TFWA 4DSIA 4DR3J 2OOTA 1K8AT 4AQYF 2HQIA 1Z9UA 2CVIA 4ZHRB 2QA1A 2W4PA 3H2LA 4X64F 4DG1B 4AL6A 5A0YA 3GIUA 3EICA 3JB9k 1NJYA 2GS8A 4Q0BA 1D0EA 1H6KX 3CIMA 1FKOB 2C1CA 2PI5A 4FF3A 1RHRB 1IKVB 3K7RA 1UVLA 5LXYA 1KOHA 3M9MB 4JI3J 3PGPA 4KOYA 4EMDA 1H2VZ 2YNCA 4DR5F 5H9FJ 2G9DA 2B4VA 3BPSP 3IXQA 4Z2XA 2JEVA 1E6YB 4F04B 2XY7A 3CXSA 1Q81T 2B6AA 1KLMB 4J9KA 4BBHA 1ZA1B 1VRUA 2B9YA 4B3OA 4UCPA 2RDIA 1CJTB 2HFOA 1RT7B 1IKWA 2PVVA 2GFQA 3R6GB 1RYSA 2KHDA 2R8JA 2DISA 1UJ5A 2M9KA 1TF9A 2V4JA 3MXHP 1R31A 3CJSA 2XWXA 2I0XA 3DRRB 1XIXA 1F60B 4K3NA 1WG5A 5J1EA 2HHTA 2DYAA 3I9V9 3AD8C 3JTKA 4NGMA 1R8PA 1FT7A 4A8SA 2FIWA 1RT2B 1PBUA 2PJ8A 1F5BA 2ZH5A 5KG1A 1H2TZ 1HIYA 4NCZA 3MMAB 3BGLA 1DQAA 3OFFA 4QOTA 2AGQA 4NPOA 2XYHB 3BR9A 1GT8A 1MG7A 2J9DA 2ZKTA 1JJCB 2DO0A 1NU4A 3HFVA 4FD5A 1SC1B 4H54A 1F9EB 4BBYA 4N77A 1S7HA 5KFCA 2LA6A 5C25B 3LGMA 3HHLC 1CP6A 1XEZA 1TUVA 1IN0A 1M4GA 2A2CA 3MPYA 2XZDB 3LP2B 2C2EA 3CCJS 4MFKA 4XDDA 1HA1A 1XK8A 1TKJA 2WONB 1CJUB 3EUNA 5F48A 2V8PA 3QQCD 3GFYA 2J8RA 3NGTA 4K50A 4R0JA 3TE4A 1URNA 1MNEA 2GA7A 1CJVB 2N4DA 3S6EA 2IMOA 2IJRA 3KR5A 2HWHA 3JSMB 3P6YC 3FF3A 4B9VA 3NH8A 4KH1B 4F4YA 1S48A 2W8LA 2BL1A 1TVRA 2E44A 3OHAA 2QSFA 1XWLA 2ANPA 5IM0A 2DGOA 3D7SB 4IFYA 2MXYA 2G0CA 4KKOA 3QGGA 1WC6A 3KLIB 5KT5A 3O6QA 3N6LA 4IRDA 3TAQA 2FGCA 1R0AA 4X66F 4OZLA 2B5GB 1EJ7L 2OPQA 5D6GA 3NS5A 1BLLE 1NPPA 4DCJB 1T95A 4CO2A 1SKRA 3TAMA 2R4FA 3W3SA 2DY9A 4FD6A 4LREA 3FECA 1VRQC 1KBRA 2BZ2A 3TQEA 1VIOA 2XCAA 2H1YA 2W24A 2CQHA 4IR1A 2HK2A 4LRBA 4W98A 2ZUGA 3EGWB 1QM9A 1T02A 1ICEB 4C2MA 2OJ3A 2VUGA 3DKDA 1VGYA 3N6NA 5ETQA 4LR9A 2OKQA 1KZFA 2RQMA 3DLGB 5F8HA 1X4GA 2OZHA 3S7RA 3CVKA 1WELA 1BPNA 3LA0A 2APOA 4PG7A 5CBMA 1PJ7A 1PYOB 4CZCA 4NGRA 4DLGA 4F0MA 5D4OA 3WDOA 2BRLA 4OV1A 3B35A 3ET6B 3DGPA 2XZWA 4MMOA 4LSNB 5KT7A 2IJNA 2HVEA 4KGZB 3D68A 4DI6A 5SZTA 1CSJA 4A8YA 2FD2A 2BJ7A 4WFXA 5GADU 2QYCA 3BO3A 4R8UB 1HLWA 4UQGA 4F9UA 1ZO0A 2JZ5A 2V4QA 1TP7A 4WXOA 1NH8A 2A1BA 3W60A 4Q45A 1NKCA 1K4JA 4ZY1A 1XR6A 1FKPB 2H48B 3HHKA 4B3RF 3B3WA 5JPHA 4ZCMA 3JYTB 2AZ1A 4Y2MA 4OYZA 2Z3KA 4AYBD 3DLHA 2HIYA 4QR1A 4ED0A 1KUVA 1TKXB 1XOVA 4WTOB 2CNNB 2U1AA 1S1WB 1Z2ZA 4ZLLA 1RT1B 1RZMA 3HT3A 4ZPCA 2BW7A 4YWYA 3R6LB 3M6UA 1SL1A 2RILA 2DD8S 3DRSB 2NXUA 2YKOA 1S9EB 3FQKA 3GJQB 3D67A 5EWGA 3T9ZA 4RW8A 3GCXP 5GAGU 2VOOA 2IY5B 4RNMA 3PRDA 4I4BA 4LFAJ 4I2PB 3J7YI 2MQNA 2GREA 3LWUA