2V8HA

Crystal structure of mutant e159a of beta-alanine synthase from saccharomyces kluyveri in complex with its substrate n-carbamyl-beta- alanine
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
431
structure length
431
Chain Sequence
b'LSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNAEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGHQFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-ALANINE SYNTHASE
molecule tags Hydrolase
source organism Saccharomyces kluyveri
publication title Crystal Structures of Yeast -Alanine Synthase Complexes Reveal the Mode of Substrate Binding and Large Scale Domain Closure Movements.
pubmed doi rcsb
total genus 159
structure length 431
sequence length 431
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2007-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v8hA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2v8hA01
3KI9A 1IY7A 3BXMA 1YW4A 4ZX9A 1XFOA 5K8OA 3BI0A 2V8DA 2ZEFA 4F9VA 3BHXA 3KZWA 3KL9A 3JRUA 3QNVA 1YSJA 2WZNA 3SI2A 3D7GA 1Y7EA 4P4IA 1OBRA 4PQAA 4PXDA 2V8HA 2F7VA 5F09A 1ZLHA 4MCQA 5JGFA 4Z65A 5HVGA 2HB6A 4A94A 2CF4A 1R43A 1HDUA 4MHNA 2ANPA 4P45A 1GYTA 4MMOA 2DEAA 3PB6X 2ZEOA 8CPAA 2PIZA 1Q7LA 3VATA 2EK8A 2ZEDA 4B6ZA 2PE3A 1TF9A 2O4HA 2CTBA 4WWVA 5K8NA 4ZX8A 5D29A 3IIBA 3D67A 4YWYA 4OMEA 3KGQA 2ZEHA 3PFEA 4PXEA 3N5FA 2PJAA 3D66A 2Q51A 4AXVA 5LYFA 4P4JA 4Q7AA 3B3SA 3KHZA 2BCOA 3HLPA 1PYTB 3CT9A 4X3RA 5JM6A 1YMEA 2C6GA 1CBXA 4PXCA 2G9DA 3NH5A 4R76A 3B3TA 1TKHA 2V77A 4O23A 3PBEA 4OC5A 2AFUA 2PIYA 1TKJA 2PJ8A 2F8HA 4OC3A 4IAVA 3VH9A 4ZY2A 1ARMA 2RFHA 1ELMP 3ISXA 2C6PA 2XEGA 4ZY1A 5LYDA 1LAMA 3FVLA 4NGQA 2ZELA 1F57A 2OR4A 2GU2A 5LRKA 2PJ1A 3PB9X 2PJ7A 2XEIA 4P10A 3NA6A 4NGPA 3WC5A 2OOTA 4WJBA 2AFMA 2JBKA 3RZAA 4OKOA 1Z8LA 3TX8A 1BAVA 3DGVA 4CPAA 4OIDA 3S9NA 5ELYA 4DYOA 3KQZA 4FBEA 3S9MA 4PXBA 1JQGA 3WC6A 3WC7A 4MHYA 2RB7A 2CIJA 5J1QA 2J9AA 5LRJA 4GM5A 2IJZA 4X2TA 4P44A 1LFWA 4NJRA 1LOKA 4A37A 2ZOGA 5K8PA 3DLJA 1Z5RA 2VL1A 3FECA 4BD9A 4R6TA 3KR5A 1F2PA 5THWA 1VIXA 4R7MA 1DTDA 5IB9A 1KWMA 2WYRA 3FH4A 2ZEEA 2AFXA 3CPAA 4P4DA 3B2YA 4P6YA 2V8GA 2JBJA 3RAMA 4FUUA 4ONWA 1HEEA 2POKA 1FNOA 4ZYQA 3PB4X 4UEFA 3MN8A 3K9TA 4R8FA 1BLLE 2AFOA 3MRUA 3SJEA 3FEDA 1LANA 3PB7X 2AFZA 1ZLIA 3B7IA 3PBBA 2PJ3A 4YU9A 2BOAA 1XRYA 1YLOA 2PJ4A 4NGTA 7CPAA 4P4EA 2AFWA 1BPMA 4NFRA 2IMOA 1EE3P 1FT7A 4P4BA 3H8GA 5D8NA 4A38A 3WABA 3D4UA 4IHMA 2QVPA 1TXRA 3CDXA 2Q43A 2V8VA 4MCSA 3FX6A 4OIWA 4OC0A 3KHXA 2NYQA 4KSIA 4EMEA 4EWTA 4DUKA 3NH8A 3SJFA 1CG2A 1DE4C 3V7ZA 2GREA 2PJ0A 1RTQA 2EWBA 1UWYA 2ZOFA 4MXUA 3D7FA 4NGSA 5HVFA 3SI0A 2XEJA 1IGBA 3PEIA 4G1PA 1HDQA 1LCPA 3PFOA 4NGMA 3WT4A 4OC2A 3KQXA 3B3WA 3KR4A 4PPZA 4UIAA 2ZEMA 5I4MA 4OC1A 4DJLA 3H8FA 2PRQA 3FEEA 3SJXA 6CPAA 2PVVA 1NSAA 4UIBA 4F8ZA 5LYIA 4MHPA 3NFZA 1CPXA 1CPSA 1Y0YA 1ELLP 2C1CA 1BPNA 3FJUA 5DS0A 4MCRA 2ABZA 3CPXA 3FMCA 2PJ5A 4ZI6A 4H2KA 2EK9A 3D68A 4IK2A 3IC1A 1ZG8A 2GLFA 5HVHA 2CTCA 3FF3A 1CP7A 1VHEA 4LQGA 2IQ6A 4JZ0A 4FWUA 5HXDA 3GUXA 1TF8A 1CX8A 4FAIA 2FVGA 1XJOA 1H8LA 4EFDA 5CBMA 4F9UA 3B3VA 1XMBA 3RBUA 3SJGA 3GLJA 1VHOA 2JEWA 2PJ2A 1Y0RA 3HUVA 1ZG7A 3K2KA 5JH9A 4MHZA 2GLJA 1R3NA 2PJ9A 3GB0A 5LRGA 2O53A 1M4LA 1CP6A 1YW6A 3B35A 3LWUA 4NGRA 2AFSA 3S9LA 2BO9A 1QMUA 3KASA 4UF4A 5LYLA 4ZY0A 3PB8X 3LMSA 1ZG9A 3H8EA 2XEFA 2QJ8A 2Q4ZA 4NGNA 3D7DA 4A39A 1ARLA 2PCUA 1TKFA 3TC8A 1Z2LA 1AMPA 2ZEGA 3V38A 5K8MA 3SI1A 1LAPA 4MRIA 4OP4A 1PCAA 4UEEA 3PRTA 2QYVA 4OC4A 3IEHA 3NH4A 4NJQA 4JYWA 3VARA 2NSMA 3T8WA 1VGYA 3ISZA 3D7HA 4TNUA 5CPAA 4K3NA 3IO1A 3IJ3A 4X8IA 2HC9A 4TWEA 2ZEPA 2C6CA 4MCPA 4P4FA 3L2NA 1AYEA 1QQ9A 3IWWA 2PJBA 4UEZA 2ZENA 2I3CA 3B3CA 2PJCA 3BI1A 2PJ6A 1XBUA 4RUHA 3IFEA 1F2OA 3I1UA 4W9YA 2PVWA
chains in the Genus database with same CATH superfamily
3CE8A 5K8OA 5ETLA 3S6FA 2AGPA 4ECVA 1NPPA 3MEGB 3PO4A 3KL9A 4B14A 1A7GE 3SI2A 2C2OB 3DRRA 2I00A 2ATCB 4F8RA 3OTOF 2ZJQQ 4FXDA 3WC2A 5GAHU 1SQGA 1FO1A 3GTYX 3K17A 3ZZZA 2OZHA 2WBMA 2W2QP 2A1BA 3V4IA 3MR7A 4JI5J 1EZZB 4TQRA 1XMTA 1TF9A 3TO6A 4KYZA 3IXQA 4K4XA 1IOIA 1PG5B 1D9AA 2AYMA 3Q83A 4OMEA 3P49B 2VBZA 3D66A 3G96A 1HYSA 2J7KA 1BWEA 4FDFA 4IG3B 3RW7A 1LKZA 2XS5A 3JQJA 1XIQA 5E0OA 4A47A 4NLXA 4LF8J 5A28A 3CMAS 4DV5J 2KI2A 3NCQA 4C97A 3UW1A 2R1IA 4IFVA 2XCAA 4P2SA 2DXQA 4RW6A 3SXOA 1W2IA 1NK4A 3PRVA 5HN0A 1ELMP 2C6PA 1BMQB 1GT8A 1Z8TA 4NZ0A 3I6PA 1X4AA 2OR4A 4OV1A 1FJGJ 1CVJA 1I12A 2XEIA 4FP9A 3MMAA 4J9VA 4M5MA 4Y6IA 3I96A 2OOTA 4H4MA 3EVMA 2PI4A 3GG0A 4IFYB 4ZPCA 2WW4A 1WHXA 4CPAA 3M30A 1CJTA 5HK4A 4Y2CA 5EWGA 5F0WA 3WIUA 4DQRA 3OFGA 5HANA 4KSAA 2AJ4A 2K1RB 3MEDB 1LV5A 3MCMA 3AXKA 4ZVGA 4C2XA 3GIJA 1RI7A 3ETMA 3DLJA 3KHLA 4FD7A 1Z5RA 4R6TA 1DJ0A 1NZAA 1RCXB 2REFA 1EKRA 4R7MA 4KHPF 2RF2A 1FRJA 4TY9A 3C6UA 2E29A 2ZEEA 2HMIB 1APSA 2XI3A 5B7WA 3GCWP 4H4KA 2K3KA 3H5UA 5E2QA 5E96A 2HZVA 1YKWA 5BR8J 3KHGA 1LXNA 4UUXA 5CNPA 4DV6F 4C9DA 2VQEJ 1MMNA 5KFZA 4ZJQA 2JEJA 1RJJA 2DGWA 2VV5A 3THTA 1S9EB 4WTOB 4FBTA 1U09A 2VG5A 3GIKA 2N4CA 1S6PB 4DU7A 7AT1B 2YNIB 4UZCA 3GQCA 2Z3NA 2VFSA 3CJ5A 1F1BB 1TTHB 3EDQB 4A32A 2V5HG 2HHUA 2VFVA 3IRWP 3CUNA 2V8VA 4B13A 3SSRA 2PR1A 3VHQA 2MQOA 1WC6A 3NG8A 2XMVA 1C0UB 1WC1A 1OO0B 3FGVA 1QDUB 2RF2B 2BKOA 3V81B 2XMKA 3W8GA 4DPXA 1QVGR 1GNKA 4CDIA 2Q4VA 2ZWPA 4LBHA 3K2YA 2J8MA 5B0BA 4LF5F 3NS7B 4RU9A 2XMUA 3EMTA 1RTDA 4P52A 3NE8A 3HK2A 3W63A 3FUYA 1PILA 2K1RA 1TV6B 1FHTA 2Z3PA 2CADA 2FHOB 3OD2A 1IOFA 4ZCIA 3UI3A 3PEJA 2OPRB 2DITA 3T19A 4MJ8A 1UFKA 1FEEA 2Z58B 2PJ5A 3QT6A 4EBEA 4ZVRB 1C1BB 4CGMA 2AJ0A 4NX9A 4ES1A 1CP7A 4XPDB 2ZH4A 3CXSA 5B0GA 1Z4EA 4ZJOA 5IV4A 4QR2A 1XJOA 1XJWB 4AUKA 2IVFB 4F6AA 5J1EB 4EFDA 4B17A 1VFJA 2DNPA 3DRSA 3MFHA 5F3ZA 4XPEA 3OT9A 1X4EA 1RT4A 1R0AB 3NOCA 3TZXA 4KOXA 2XHWA 3D1HA 4JXQA 7FD1A 2CWKA 1IBLF 1AXQA 2CXEA 4GKKF 1C4CA 5EMIA 4ZVSB 1SVDA 1FNXH 3LWUA 3S9LA 1W7WA 2C3OA 2YQ1A 4JI7J 2I2YA 4LSLB 3OSNA 2NQPA 2JEFA 3OTOJ 1RT1A 1U6FA 3BO3A 4FNIA 2XEFA 2YPYA 4RBTA 3Q8QB 2XWYA 3L3CA 2GS8A 4IG0B 2B4DB 1GFWB 2HQCA 5LSRA 1B70B 2E7XA 3SI1A 1TKXA 5KFNA 1WEZA 3AJDA 3WBZA 1MW7A 1QD1A 2XYHB 3NH4A 3Q2TC 2C2RA 3PR5B 3W61A 4Q38A 3GIIA 3RNZA 4LF8F 1VCTA 2Q79A 1O51A 3IS9B 4L76A 1HD0A 1R0BG 4YN3B 3RR7A 4TWEA 3R8YA 1Q0NA 4JI6F 2ZBPA 1RT7B 2PJCA 4WIQA 2MKSA 2G0CA 1F2OA 4MY3A 4C11A 3BXMA 4ZX9A 1HBNA 4G1IA 4F9VA 4PV6A 4JJXA 1TL5A 1YSJA 2FHJA 2M7SA 3D7GA 4LSNA 2A6MA 2F7VA 4YRHA 2HFZA 1JNZB 2W2NP 4KGKA 3HSGA 5LMUJ 4B6ZA 3FK4A 3ILOA 4YEAA 1WC0A 2FPHX 3BSAA 4I67A 5C5JA 5CQGA 2B5GB 3OLAA 2NSCA 2ZEHA 2LU1A 3N5FA 1YVOA 2EVZA 1NO8A 1CJKA 4U7UK 4Q7AA 4I2PB 1B87A 2E7VA 1NJXA 2N7YA 3ZTOA 4FVCA 4E8OA 3BR8A 3CMES 3FRZA 2ZBIA 5IT9U 1REVB 1RWWB 3HHLD 4OHVA 2X51A 4QPTA 1WG5A 3ISXA 3GYAA 1RT1B 2WONA 2JDJA 2GAGC 3LO3A 4USHA 3JQMA 3UD5A 3QBCA 4QUSA 1YDLA 4PWWA 2CQDA 4IRCA 3OL8A 1MWZA 4DCOB 3KQZA 5ETPA 1NAQA 3TARA 4B9UA 4CLKA 2RB7A 2Z57B 1EARA 4PUOB 1QE1B 2X1GA 1LK7A 1TAQA 3QIDA 1DLOB 3C66A 3J7AN 4F2RA 4X2TA 1DQ9A 5B0FA 4P44A 4A37A 4PYAA 1YG0A 1S49A 2Y0SD 2MPUA 1RWNB 1F60B 2Q6CA 4OZ3A 4YR0A 3B4DA 2ZNZA 1J5OB 4M94A 2KRBA 2DRDA 2LA4A 4DV4F 4O44B 1CJUB 2IIHA 5AXKA 1TQLA 4IRDA 2GW8A 4PUOA 4H6ZA 1N5QA 3MAHA 4ECZA 2DNMA 1CJKB 4M1KA 4DV2J 3MPVA 5A8RB 4C8ZA 3PBBA 3R9EA 1NPKA 3C14B 3GYGA 2NXUA 4IO1A 2ARHA 2JNJA 3T9NA 2AD9A 4XO0A 5CYQB 1N71A 4DX6A 4TU7A 4WXOA 1FRMA 2ZD1A 4A8SA 4A38A 2UUBJ 4U9YA 2FYXA 4CM2A 4B3RJ 3W7BA 3RRGA 3MMBB 4DR6F 2NYQA 3TTHA 3RYOA 1H2VZ 1HHQA 2LQBA 1ZA1B 2C42A 5KT2A 3AJ2A 3BSOA 2XLIA 2MZJA 1RTQA 3AD8C 1UWYA 2V8PA 5F9NA 3ENVA 1SKWA 4LF4J 2G2ZA 1FI4A 1RT5B 4UIAA 4JXRA 4HTJA 2IPOB 2BM0A 3BPDA 4DJLA 3SJXA 3DRXA 4B11A 2PVVA 1NK8A 3LP2B 3NFZA 4HDHA 2E5LF 3SMZA 4Q0BA 2ZOMA 3KG4A 4JI5F 2HNDA 3GR0A 3MPWA 4C6AA 2H5EA 2EK9A 1GEHA 2I5JA 4IK2A 3SQOP 3N4WA 3FF3A 4YS2A 2DXFA 4JZ0A 2HQ3A 1OS5A 5DDQC 2REEA 4WP3A 5E3RA 2HMIA 3QLHB 5EC4A 1N52B 2RS8A 2CZ4A 2ACMA 4TNOA 3B6BA 5GADU 3NY0A 2IYIA 1HLWA 4Q2LA 2ASDA 2CIMA 2J7WA 1LOUA 4OZ0A 1U25A 2R9LA 1RLCL 1IR1A 1NUEA 4HT7A 3N7ZA 3TWZA 3IR5B 4ZPBA 1YQEA 2DD8S 2M70A 3CC7S 2KYZA 5L39A 1ZG7A 2ZBRA 2EFVA 4EUVA 4TKTA 4KB7A 4ELVA 2PA3A 4G65A 4ZP9A 4J9SA 1WSVA 2P6SA 1VQKS 4RS2A 1ZG9A 4LF6F 4RNOA 2CNKB 3D7DA 5DQIA 2EO8A 1MSWD 2EG2A 3LF0A 3TC8A 3NLCA 1OYDA 4J9PA 3V38A 3SI8A 2P6EA 2GAHC 3VAFA 1KUXA 3MTKA 1MG7A 4MRIA 4QYZJ 4CO3A 3D9BA 3UR3C 2R8HA 1RHRB 4JV0A 4R87A 4A2ZA 3V6KA 2ZC4A 3THVA 2VG6A 1OPIA 4MIBA 4ENOA 2MKCA 4B5OA 3DXSX 5AE2A 2BJ8A 2WTFA 2R42A 3D7HA 2W1BA 2I5JB 3MD1A 1E6VB 5CZVA 2PE8A 1I94J 3DR8A 3M05A 2W4DA 1FCAA 2AEJA 3I9SA 3TQEA 1FD8A 4CAEA 1XF8A 1WDTA 2R7HA 5JPHA 4K5SA 2K2PA 4AXIA 1QQ9A 4X4QA 5JUMA 2PJ6A 1NB2A 1X4CA 3TAPA 2VI7A 1S0MA 3EX7B 1SJ3P 4X4UA 5G22A 2R98A 1WHVA 1X10A 2FZCB 2QA4G 4BWMA 1IN0A 4MTPA 4KT0C 2XY5A 2CF4A 2HRTA 2ZE2B 4USVA 1T05B 4WU2A 4F4KA 2O67A 4ED6A 1RAGB 2EK8A 4CRJA 2Y1IA 1KTVA 2K3IA 3DRRB 2CTBA 2NXEA 1P9YA 2HSEB 5H9FJ 2Q3PA 1IJFB 2CJKA 4LRDA 1VMBA 3B3SA 2YKQA 3P45B 4HH0A 3W60A 3NNHA 3M6XA 2MJUA 1PYTB 1UPPA 2LXUA 1IM6A 4NLDA 2NLWA 3MM9B 4K0KF 3TNVA 2HHWA 2BRKA 4KOSA 2QG9B 5C24A 4ZY2A 3HJFA 2RFHA 3SQGA 1SC4B 2NXJA 1F57A 1JXVA 2QT7A 3EWGA 2E44A 2AFMA 2UU9J 4UTGA 4KUAA 5C42B 1RT6A 1JK9B 4OIDA 3S9NA 2V4RA 2F8MA 2EFGA 4LRFA 4MHYA 1Y5LB 2CIJA 3C2PA 4XPKA 4GM5A 4FYVB 3ONQA 3N6NA 3EFAA 3V6DA 5IFMA 3DOKA 3NL0A 1MJAA 1F5CA 2BSWA 5DLGA 4CGNA 1T9YA 2YWFA 2HFNA 2ZVIA 1T9TA 1RCOB 2UXDF 2D1CA 4LR8A 4ED8A 4X4OA 3LD2A 1AZSB 1RB0A 1FJGF 2P9GA 1SKUB 1PAEX 5L1IA 4MYUA 3OTBA 3BJ8A 3PX4A 1EP4B 2DGTA 1K8AT 3BKFA 4ZIWA 4CLZA 2KO1A 3A3NB 3I56S 2PSWA 2HBZB 4GC7A 3KDNA 2C3PA 4GKJJ 4TXSA 4A33A 3HJVA 2MHEA 3HMJG 1AZSA 4RW6B 3D1OA 3TJ9A 2W9CA 2YNFB 2OZUA 4I6WA 4NLRA 2GREA 2VFTA 4RW8A 4W98A 5KOXA 4EGLA 3SI0A 2XEJA 4JP8A 1LCPA 2VIHA 1ZAWA 3MCOA 3MGJA 4OC2A 4CNYA 3BGUA 3MOJB 1UJ5A 3HVRA 1RKJA 4C0OC 3RB6A 4RW7A 1KUYA 3M8QA 3DGPB 4C2MA 3PXGa 3UO0A 1N0UA 5IC6B 4A4JA 1WKKA 4OHXA 3I82A 2KT5A 1TP7A 2IM2A 4AVCA 2H1YA 2LXFA 1NB7A 3FJUA 2FJBB 3HHNB 2XSFA 3JTPA 5FD1A 2MYFA 1ZG8A 2B4BA 3H5ZA 4KLVA 4IDKA 2FVCA 2WB4A 4FXWA 3GUXA 4RR5A 3OJSA 4DZDA 4QOTA 4QIGA 3B3VA 1HWLA 5BJRA 5B0DA 4UOCA 3F41A 4Y2KA 2G0JA 4OJ3A 5KFYA 2DXDA 3G82A 3IG1B 4U5YA 5GMDA 5JH9A 4UQGA 4IYQA 2EBEA 3TA1A 3R6GB 2XZWA 3DLKB 2HBRB 3EVOA 1ZOTA 2B4OA 2ZKTA 2EFNA 1Z8WA 3MM5B 4NA2A 4KOYA 5SZTA 1BY9A 4MKYA 4F4ZA 4AG9A 3PW0A 3BYPA 3CCES 1AMPA 2KCWA 3LANA 1SQEA 1X7VA 1R8AA 3QIPA 1S7FA 1QAYA 1J4JA 4FF3A 2ALYB 3FZBA 3BKUA 2CAJA 2GX8A 4NJQA 2H3EB 4LIWA 3JB9k 4AG7A 1XMQF 4FYXB 1KVKA 2NSBA 3TA0A 3BLNA 3OVBA 1C1BA 1YJ7A 3FNCA 2HK3A 1X9MA 3PX6A 1Y11A 1F2GA 3IU2A 1CJVA 4C7HA 4LVOP 3I0SB 4X84A 5H9EJ 3UCZP 5D8HB 1HD1A 1N4LA 2QLWA 3TFYA 2C27A 1JXEA 2VDHA 2YQ0A 2X7IA 4CAFA 4NPOA 1N6QA 3NGKA 4YB1P 3MUVP 1YJVA 2DXEA 3MURP 4NXMJ 3HCXA 3R2DJ 5IS2A 2FSRA 1Y7EA 2WRMA 1WEXA 3VAMA 3CVKA 2RKIA 4PR6A 4A94A 1RAIB 2VPZB 2V67A 4ZP8A 3J7ZT 4OI3A 2WOMA 4C48A 1FY7A 1GMWA 3PRBA 2B3UA 4LF4F 1S7NA 4ZPVR 2VQYA 4F4YA 3DM2B 4M8LA 1LWEA 3G6VA 1HNVB 4CLFA 3L9ZA 3CMQA 5K8NA 3ITHB 3IIBA 3D67A 4LJMA 5KFWA 1S1UA 2ACYA 1N6QB 5IT9Y 3NOGA 2PJAA 3BDPA 2QSWA 3HHDA 2BCOA 2G9OA 4P2FA 2ERRA 1G1XA 3K8VA 4ZJLA 1RADB 3MPUB 2YNGA 4F3OA 2DNOA 1JLAA 3OXGA 2DO4A 5IC4B 3CCRS 3K9UA 2E5HA 4OI6A 4O3QA 2PJ8A 4JV5J 2KHDA 2B4VA 3BV8A 2PIIA 3VGVA 1HARA 5F8HA 2BMBA 1SCJB 3JYTA 2KT2A 1UL3A 3EM1A 2ILYA 1FWKA 1HBMA 1JX4A 2KDOA 2RUSA 4HKFA 2GMLA 4C0BA 3C16B 1M5OC 3AY0A 1RTZA 4ZVPB 1U1OA 1ITPA 1DFDA 3OBIA 3U1LA 3KWMA 4AYBD 3FQLA 4NXNF 3BH7B 2HQDA 4TVAB 4XAKA 1VOMA 3BQ1A 4XTTA 3HSDA 2KG0A 5DRKA 1Q5YA 1IUJA 4PEOA 3W66A 1A2ZA 2J8AA 4CCHA 4AL6A 2PC1A 2I1RA 3AXMA 5DZ6A 2HS4A 4DL3A 1UMJA 2EFPA 1RAOA 4DR3F 2O5DA 2AFXA 1U8SA 4CO4A 4J9MA 2MMYA 2KL8A 3K5MA 1ZTWA 5LM7E 3OTCA 3RAMA 3BJYA 1HEEA 4TLRA 1N5SA 2LLZA 2X3DA 4AXJA 3KLVA 3HSJA 2MZTA 1Q86T 3N6LA 2BOAA 3GPAA 4NMXA 2RD5C 3MFIA 4NGTA 4LSZB 3CJKB 1FT7A 3H8GA 2XLJA 5A8RA 2EXUA 1E6YA 1WOOA 5H9FK 2ZW6A 4MCSA 3R5DA 2AF6A 3EPIA 3FEYB 1Q5VA 4EWTA 3SXNA 1S7KA 2XMWA 3DLGB 4DV4J 2HFOA 1T95A 2HHHJ 3MAAB 3M1VA 1PIEA 3CCZA 4TU9A 4DUYF 2QLJB 4LF6J 2BW2A 3KR4A 5KFSA 2YBVA 1IKXB 5JJBA 2NXNA 3O5TB 4FPRA 2B6AB 1SL1A 5AXNA 4MFQA 3VAHA 4B3TF 4WBFA 3B8GA 1XBWA 2G0BA 3CCJS 4F8ZA 3BM7A 4CLSA 2HKEA 4RJVA 5KFOA 3CCUS 3H5YA 3N28A 3RBEA 2Q44A 3O3LA 1HWKA 4CAWA 4FXVA 1BQXA 2OMOA 4CH7A 4L75A 1EB0A 2IA6A 4P73A 3DLEB 3MGDA 1XMOF 2QMUB 2WONB 1J5OA 3I5CA 2HAFA 3DLGA 2IJRA 2P6FA 2Y3YA 2FE7A 1T8EA 2MLZA 3S6HA 3BSCA 3FCVA 1H8LA 3SBMA 3UR0A 3EO4A 2E5IA 2OELA 1RAAB 2HEKA 4LUBA 3QFHA 4I7FA 2LCWA 3R9LA 5KFKA 5AG5A 2WK4A 2B8QA 4C8NA 1TKTB 2IM0A 3HUVA 4R25A 4NYOA 3RBXA 2IM1A 2P6TA 2OP5A 2FB0A 5KFFA 3GB0A 3GIUA 2O53A 1M4LA 2RNEA 2JC0A 4O3RA 3R5AA 5ETRA 3Q8SB 2AZ1A 4OYMA 2HGLA 2GVZA 1FRKA 1U02A 3ZC4A 4WIIA 4YY3F 1P4NA 3R95A 3QGHA 4JI8F 2O3DA 2WSFC 1U49A 5C2GA 1YBUA 3IBWA 1CQMA 5B0CA 2FJAB 1MN7A 1P6TA 1M5HA 1SV5A 5I3UA 1QAIA 4X5KA 4J9QA 3L09A 5LOQA 2EW9A 1WEYA 1YQHA 4K8RA 1RAEB 1NDKA 2EG1A 4OZ2A 2WSAA 2HAIA 3H20A 2CNNB 2XBPA 3W8PA 4ZA1A 2IDEA 1P8GA 3J7YI 2BEFA 3MM6B 2JLMA 1G7CB 2YKPA 3CJ3A 4OFZA 3AAWB 3RB0A 3PZPA 2B4PA 1JKHA 3KZWA 1JLQB 1KBRA 2DF5A 1RT3B 4LQ9A 3QNVA 4UCPA 4B9TA 2ZITA 4AFFA 1H73A 1JNRB 3PHTA 1RTHB 5A76A 4NMLA 3PB6X 3GWCA 3OFEA 2HGMA 1FNMA 2UUCF 3R7SB 1YZ7A 2QEXS 3OR2B 3FEZA 4MKBA 5KFBA 4C11B 1TL7B 2DBBA 5J2NB 2CPFA 4X65F 1KVJA 2DYAA 2FY8A 4CTAA 2XSJA 2RU3A 4YB5A 2WOMB 2MQ8A 2O66A 1CS4A 1WKJA 3DLLQ 2YQ3A 4DN9A 2AX0A 2VOOA 4MIWA 3CT9A 2W2MP 3QGIA 4DR1J 5J1PA 3PCOB 4WP9A 2YXLA 3A8EA 3IAM9 4O3PA 1SPBP 2IVYA 2XS2A 2V34A 1KS2A 5F46A 2J6TA 3EZOA 4QR0A 4OC5A 3C6TA 1SJQA 4A8XA 2QSFA 2RQ4A 1IWGA 1QSYA 1HPZA 3KUEA 2ZFHA 4OAEA 3H98A 3CIZA 4HACB 1WACA 1TMMA 3QRRA 4JYAJ 3PB9X 1T05A 4IR9A 2E1AA 2G2OA 2MZQA 2I0XA 3NA6A 3QFWA 1Z9UA 3TX8A 2AW0A 3P5BP 1XQIA 3QPIA 2J9DE 4JWPA 4IO9Q 5CXTA 5HL7Q 4MFZA 4LF9F 1JKHB 2JLFA 3J80U 5IT0A 3RO0A 4J9RA 3T6JA 2IBOA 4JV1A 1VQNS 4F3QA 5THWA 4DUZJ 1VIXA 3TI0A 1HYSB 4DF8A 1KWMA 2E66A 3W9IA 2UVRA 1NKEA 3IAS9 1XIXA 3B2YA 2K5TA 3ZZOA 2FZGB 4QWDA 5D78A 4KO0A 2PSZA 4CAXA 3LACA 3IRXA 3QZ8A 4C7IA 5HJXA 5KFEA 1Q8IA 4BHQA 4M5DB 1YJUA 4DLEA 2VC0A 2ZJPQ 2Z3LA 1RT3A 5AXMA 4WFNQ 2V68A 2UP1A 2DNNA 1TR0A 2A18A 3SSQA 4DV2F 4DR6J 4MFJA 3A3OB 2HNYB 4DPTA 3WABA 3TQ1A 5DZ7A 5EUHA 1S4EA 5EX0A 4ANEA 1AFJA 5AG6A 5KT5A 5B09A 4ILMA 1UW4A 1EJ7L 4BS2A 2EWBA 1S1WB 2ZOFA 2NXCA 1R57A 2P8IA 2RDJA 2QC3A 4NEZA 1HDQA 1HNXF 3DDKA 4K4TA 3PFOA 4E2AA 5E3AA 2V4JA 3TOQA 3L7OA 1YVFA 3KK3B 2PT0A 2HURA 1I21A 2ZJRQ 3OLBA 4JV5F 3X1LB 1PYSB 5KTQA 1S3ZA 1U1QA 2HK2A 1Y7RA 1UZDA 3OQ2A 2BKNA 1FKOB 1X4BA 4F50A 3BGRB 2C1CA 4X2BA 2BE7D 1CULA 3EGNA 2PFFB 3GR1A 4UBRA 2ZZTA 4DV7J 4R57A 1U24A 3HZGA 3QATA 2NUHA 2CTCA 1HR0F 4CZCA 3CULA 2ZW4A 2XYPB 3TW0A 3MUMP 2OSRA 1Q79A 2ZD1B 3N0VA 1CX8A 2ZHOA 4M63A 4Y34A 1BQMA 3F0NA 5HAOA 4S0MA 4B5PA 4LSNB 3KJNB 3DOMA 2HBQB 4OYOA 4LF2A 3SJGA 4C7QA 4DQSA 4A8OA 5CCLA 1JLGA 1G4CA 2V2VA 5A8KA 3FEXB 4F0XA 1HQEB 2NPFA 3OR2A 5J8CA 1LXJA 3FRMA 2HV2A 2X7BA 1PJ6A 4I68A 4U8VA 1PAUB 3VAIA 3H4BA 4EBCA 1Q78A 2BQUA 2N3OA 3EDRB 2FHJD 1TL1A 1WG1A 3LMSA 1UW9A 4C0HA 1RAFB 4LX9A 2SXLA 1WG4A 2EC2A 2HLTA 5DDRC 1VQSA 2V4JB 3VGUA 2EI5A 3PV8A 3H59A 4RL1A 2XQCA 1AUSL 4D3GA 3E51A 3HVWA 2IDLA 3D28A 3ETOA 5A6PA 1V3SA 1L3UA 4DPWA 3K59A 3MPDA 1RYRA 1RXTA 5HP1B 3T5LA 2IJNA 2AMCB 4GO7X 3MM9A 2B4DA 2LKZA 4W4MA 4DPOA 1UVJA 2ZNYA 4E2FB 1YJ9S 3M9MB 2CQ2A 4WZMA 1BLUA 4QC6A 1C4AA 3H25A 2UUWA 1X5OA 2CQ4A 4P4FA 4UWIA 2QGFB 2J7UA 2B43A 1NU4A 3AD7C 1WC3A 3CSKA 2C2KB 5D0RA 5DJBA 3ZNJ1 3PKMA 2Q04A 4NLVA 2KM8B 2WZNA 2ASLA 4NCGA 4DL4A 2ZZNA 2FC8A 4PQAA 2BXJA 8RUCA 5FDLA 1CBKA 1IIDA 4OZJA 2FIAA 8AT1B 4X4SA 2OU2A 2GHPA 2KVIA 2LDYA 4CLLA 1WELA 4UFVA 2B0GA 2HZCA 1FD2A 4ZK7M 2DHHA 3RBZA 3R7NB 2DGOA 3BO4A 2P5VA 4DSIA 1S5KA 4P4JA 2RIJA 4TYAA 1HL6A 4KHMA 5A8KB 3AHPA 3DM2A 1E6VA 1H98A 2P6GA 4MHDA 1JWQA 1H7XA 2AIRB 1CBXA 2G9DA 3NH5A 4R76A 2D41A 1M4DA 1S59A 5AG7A 1LK5A 2DGXA 3UN5A 2CDRB 2WVCA 2GIVA 1RT7A 5D3GA 2PMZD 2B7BB 4YUDA 2F8EX 4NLTA 2BUNA 4RUBA 4DV1J 2APOA 3G86A 1VC0A 2CQHA 2DISA 3D7SB 2XZTB 3OWCA 4DFPA 3DLHA 2MKJA 1VJWA 5KFPA 1S9FA 5ELYA 4OI4A 2HUZA 1N5YA 3RB4A 1PGZA 2RHQB 1Y9KA 2C2EA 3W2VB 2EKNA 2VG6B 2XHCA 3F73A 3VGTA 5HMWA 1ZETA 3PZJA 1FX4A 1LOKA 3FBCA 4WTYA 2VL1A 2QMWA 4ZS6A 1VQYA 3NCRA 1YVKA 2XGQA 2DR5A 3FH4A 1S77D 2D9PA 4ED3A 2BUEA 1ZO0A 1HNWF 4DV7F 1Y5NB 3DXBA 2ZHAA 3ENQA 2XMAA 2PDAA 3RB3A 2OPRA 5LXRA 2ZH5A 2VG7A 3A8JA 5GAHI 3SCKE 4CRYB 1YHQS 1FKPA 2R8JA 2Z2LA 2ZVSA 4OZLA 3EXYA 4ICLA 5GAGI 2XG8A 5E33A 1SQFA 2YKOA 3AQPA 1ZM9A 2Z10A 3S01A 1IR0A 1Q1KA 5DG7A 1QSSA 1REGX 1DHMA 2UUCJ 3T9ZA 4EMEA 3FCWA 1EX8A 2BANA 1CG2A 2QLXA 4ZP7A 5K20B 1NCLA 3CD6S 3PRDA 3N01A 3HX9A 1HWUA 3WQPA 2BQ3A 3PEIA 3RBDA 1SB6A 4ZPTR 2L9DA 1TL3A 4ZLLA 3QYYA 4GKJF 4Q0BB 1N5YB 3I0RA 3DI6A 3GU0A 3LODA 3HSZA 3GMGA 1KSPA 2YWEA 3IGVA 4DR5J 1R7IA 3GSDA 1I1GA 2YNHA 3NGUA 4OJGA 1NMTA 1RT5A 2QL7B 4Y00A 2OPQA 3AOAA 5DS0A 2VPXB 4U7CA 3GJQB 3W5ZA 3T41A 1TUGB 3DC2A 4CLYA 1S0VA 1T9XA 4LQGA 3M8PB 1C0UA 1Y0HA 2DY1A 2HNYA 4KHPJ 1U6ZA 2RILA 4ZMMA 4NI2A 4FAIA 2IRYA 4QIEA 1KDNA 1N0VC 3LGMA 1V9OA 4ALZA 2YKNB 4F4AA 1UJ4A 3AOBA 3I87A 3G6ES 2VZ9A 1IBCB 3SV4A 3QJPA 4LFBF 3EGZA 2R2TA 4DF4A 2OFGX 4RBVA 1CJVB 1NPRA 4ECTA 2ZM6F 4EEYA 1CP6A 3A4TA 3HFVA 2HQYA 2MKYA 4K4WA 3SIPB 2E1CA 4YB7A 3KASA 4UF4A 3M6WA 4ZY0A 3PB8X 5ETOA 2KJVA 4B3OA 3AJ1A 3B8HA 2DNHA 5KFUA 3TOAA 2PCUA 1TKFA 3G8QA 4USJC 5LSLA 4N8NA 3PG9A 4EU0A 2AJQA 3D4JA 2RRBA 5LMNJ 4DL0C 1KTQA 1EIYB 2W9AA 1DAXA 3A1YG 1VJQA 3V5RA 4K2JA 4OC4A 5LJ3Y 3QSIA 4JYWA 4OMFG 4A8QA 3KLFA 2ZH1A 2XB2D 4DUZF 3CTRA 3MZIA 4NZ7A 3UE2A 3H5SA 4LVNP 1VK3A 1RT2B 1UZHA 3DHXA 2VQEF 4WP8A 2AQ4A 1TUWA 2DNQA 2GVDB 1SBRA 2E5GA 2UXBF 3S6EA 1FA0A 3E3XA 3B3CA 3BI1A 4J9NA 3DLEA 3Q86A 3LAKA 4OYBA 2N3LA 4W9YA 2PVWA 1IY7A 4KSEB 2Q7BA 4IH5A 3TCVA 2YX4A 1I6JA 1S1TA 1NDPA 3JRUA 2OUGA 5ETNA 5DGBA 3MM6A 4P4IA 1YZ6A 4NF1A 3T6BA 5JGFA 5CYMB 1VC6A 1WI6A 4I6YA 1VRUA 4G3IA 3DNCA 5A8WB 5KFJA 3JTNA 4UOGA 1AUGA 1X31C 2HHPA 3MMBA 3HPOA 1T94A 2FDNA 4KGMA 4WWVA 4L3KA 5J2MA 4QPXA 1KKHA 3GE9A 3KGQA 3KLHA 3GFHA 2GJIA 2LA6A 3HHKA 4MFPA 3S6KA 1YJRA 1RAJA 4TU8A 4MJKA 2C3YA 1U1LA 1N56A 4MFBB 5CYMA 4X3RA 2WCXA 5JM6A 1YX0A 5B08A 4WFYA 3DHWC 5A8WA 1NJYA 2BL1A 1UVKA 1JLFB 4O23A 3M8YA 4ZBGA 2DR9A 1L3KA 4JI4J 1P27B 4YR2A 5KG6A 2DPSA 1ZYQA 5IV0A 1GX5A 2RU9A 2GHVC 3LTOA 1GTEA 2JH3A 3TO7A 3ZNUA 4OL8A 2JEIA 3T1HF 1W2BR 3P6YC 5HQMA 3AOCA 5F0UA 2OAUA 4URSA 2V9WA 4HL9A 3SQGB 1TVRA 2J5AA 3H7HB 4AE5A 2RMLA 2E7WA 1MU2A 1JJHA 4PPDA 1VBYA 1KRPA 1U48A 2IJZA 3HKWA 5DETA 3PIPQ 5ETVA 4O0IA 1L0CA 3ISND 2ZOGA 2JWNA 4C8YA 1OMSA 5F3TA 3U27A 2WW8A 4CRZB 4LRBA 3KK3A 3PJWA 3DOLA 1TFWA 4AQYJ 3I55S 1XTZA 1FRLA 5HSPA 5K5MA 4WFAQ 1S79A 4J3GA 1K9MT 3DYAB 4JUZA 2Y8WA 2J8NA 4LFCF 2AFOA 3SJEA 5GCNA 2JZ5A 5D0EA 4XNHC 3PO5A 2AFZA 3ILIA 1MNEA 2BZ2A 1S72S 2E9TA 3H0PA 1XNRJ 2F5GA 2PRBA 5AGEA 2VQFJ 2IMOA 3POTA 3SCIE 1M0SA 2Z30B 2FZKB 3D4UA 2DGUA 2G1HA 1RWVB 1TL4A 1YRTA 2QVPA 2WPWA 3IWLA 3ZZ0A 1QJHA 2C2ZB 2F5IA 1IBKJ 4OX9F 3BREA 2OB0A 4IOBA 3QNWB 4XPCA 1MJ9A 3QT5A 5IT4A 1L3VA 5HH1A 3T90A 1CEZA 1VDHA 1C0TB 4NGMA 4KY3A 6AT1B 3B3WA 2YNCC 4WF9Q 4WZQA 5E41A 2ZEMA 1IKYB 2D7SA 1YBAA 2AYEA 4ZVQB 2Y1JA 3LWMA 4GVBB 2W9BA 2D3UA 5JMNA 1RWXB 4J37A 2DH8A 5RUBA 4P9SA 2HZAA 1KD1T 4C4WA 4MIAA 5KFGA 3ZFVA 2VBWA 3VGSA 2MDAA 2X1AA 4DV0J 2UUTA 3CC2S 1AROP 1CULB 2BV3A 1RT4B 2EFQA 3NS5A 3FYNA 4NLUA 3UNYA 4F0KA 4JOUA 1M1DA 1X0FA 2FVGA 1YJWS 1B4SA 4PSWA 4RBUA 3EYZA 5CBMA 5IZHA 4JI0F 4URGA 5EWEA 5KFLA 1A6LA 4OJHA 3CDBA 3FSYA 4LUAA 3R9GA 4GO5X 1SC6A 1SIWB 3DLKA 1M4IA 2IC3B 3W5XA 2XGPA 3MMJA 4RWWA 1IBMJ 4DV1F 2PJ2A 3QAEA 1KQFB 2DNGA 2RRAA 2WBRA 2M8HA 1SKRA 1RTHA 4NEYA 3RAQA 5K9FA 1G3OA 5LRGA 5H9EK 3W9JA 4NGRA 4KGZB 2BO9A 3DGPA 2Z3MA 1B0VA 2GJ2A 4C8MA 2KHCA 1HR0J 1S9GB 3TZYA 3NEKA 3VWDA 1RYSA 3NMAA 1YGHA 4N8OA 4QBUA 1HI1A 1OQ6A 5CH7B 2LYVA 2DB1A 2OSQA 2IYGA 3M9OB 1BUXA 1JJCB 3M2VA 5KFTA 2D74B 4ZLPA 5F8LA 1UEVA 3DI6B 1QM9A 1U47A 3IEHA 2BE2A 2K06A 1BHNA 3HLUA 3C16A 4KORA 4ZVHA 3VARA 2B58A 2V50A 4RLEA 4H4MB 4JI4F 2MKKA 3T1AA 3UVJA 2JEGA 3LP0B 1XMQJ 5ETTA 2BJ7A 3THPA 5G0RA 5IXUA 2VU5A 5I42B 4MCPA 3QRQA 3FCHA 2O1PA 5HMNA 1HQUB 2DIVA 2HLUA 1H7WA 1S12A 3PACA 3W5YA 2XO7A 1ZM2A 2V8DA 1OPZA 4GS4A 3BHXA 1M5SA 1GH8A 2MJNA 3LUYA 1RU2A 5F8GA 1DZ5A 4DSLA 2RH3A 4IFYA 2MQQA 2CJAA 3W1YC 3MR2A 1HDUA 5D4LA 4PZVA 4DR7J 4O4GA 1R31A 1O8BA 3VWEA 3UDVA 1VRTB 3BBFA 4DR4F 1XNQJ 1Q7LA 3PJ9A 1KQGB 4R0EA 2ZEDA 1S6QB 4ZDNA 3G2XA 1C0TA 3G8TA 4ZX8A 2MKIA 2FQQB 2MEWA 4HVZA 1RBOB 1VLYA 2XEXA 4RW8B 3PX0A 3M2UA 2X1BA 4X66F 2DHXA 3CB4A 2DO0A 3RTVA 2HS0A 2CQGA 1FXRA 1IQTA 3PGPA 1ZTTA 4YFJA 1Q81T 4ZPAA 1R0CB 2ZM6J 2ASYA 5I3PA 1VQ5S 1TKJA 2C3UA 5DG8A 3NAHA 5G20A 2CPIA 3GFZA 3V6DB 3CCWA 2VC1A 3L4BC 3ET6A 1FDAA 3SCLE 1LAMA 1IWAA 4KPCA 2DGVA 4ZCKA 3CJKA 1C1CA 1DTQA 4QZVB 5GMEA 4FKYA 3PW5A 1VHFA 3OFFA 4YOEA 4ED4A 1BAVA 5KFMA 1R89A 2JFKA 3WC7A 2W9CB 1SC1B 4RKUC 4WWSA 2J0WA 3A13A 1DRZA 3BQ2A 2QA4S 1VBXA 3G6XA 4J9UE 2ODFA 2XY7A 2ZH3A 5CZXA 1SL2A 2K7KA 2FIUA 1HHTP 5IM0A 3ULHA 2DHGA 4I2PA 1NJIT 1VISA 4MK9A 1TVRB 4L6V3 3HF5A 4YDXA 4LF7J 3MR5A 4A8MP 2JBJA 1UPMB 4HTIA 1OWXA 2HHVA 5DWNA 4UEFA 3MN8A 4KH0B 1D0EA 1P0HA 2MSSA 4WU3A 4MKAA 2KZZA 4KC5A 1FVSA 1RSCA 3EJMA 4M6IA 1D9FA 3UY5A 3M8RA 3K5NA 3FXTA 3MM7A 1VRUB 5J1NA 1S6OA 5D8NA 3MHYA 2RSQA 2AGQA 3NNAA 4OIWA 4FKXA 3H40A 2CNLB 4DUKA 1B0TA 1F0XA 4RZRA 1R6VA 2Q66A 1QSOA 2B6AA 5KT6A 6FD1A 3KK1B 2HPUA 1RXOB 1AT1B 4DCPB 2HIQA 1UVLA 4ZVOB 3TRGA 1DY3A 2JX2A 5IQQA 4OC1A 2F40A 1A0OB 4B9VA 2LDIA 4CLWA 1FF2A 4UIBA 1BGXT 2OIHA 2DH7A 1ACMB 4FS2A 3P3DA 4MHPA 4HNYB 3PHEA 3BBBA 1N36F 1HNXJ 1SL0A 5EBVA 1F5BA 1WSRA 4ERDA 3DLBA 4MCRA 1XWLA 3CJ8A 3T1HJ 4CT9A 4F2SA 3TT2A 1YTYA 5C82A 3V6HA 3BJ7A 2CKWA 4CH0S 3E2EA 1RKIA 4I2QB 4NYZA 1UFWA 3CJ2A 2JLGA 2AGOA 2PQ8A 5CHCB 3CD5A 1VS3A 4HDGA 3IM9A 4CYUB 2CA9A 1R6YA 1HKAA 3SDEB 4QIVA 1HHSA 2QMXA 4OLPA 1QSTA 2G3TA 2MY7A 1BXNA 3FDSA 1UVIA 4IOCQ 5KTDA 2ROEA 1X12A 2XI2A 2W2PP 4A95A 2YKAA 4E8UA 2YNGB 1W25A 5FVJA 5D0GA 1S60A 3MCSA 3R96A 4TY8B 2P9EA 4ICLB 2R7RA 2YNIA 4LRCA 3G8WA 4P72A 3CD7A 4URQU 4BWJA 1YW6A 2MZRA 5KG5A 3UPFA 4ETZA 5C2CA 2V4QA 4V19J 3U02A 4F26A 3R6LB 2X1FA 1H6KX 1TL3B 3RRKA 5B0EA 2BEIA 5A2QY 4I4BA 2W24A 3V81A 1NSLA 3RJMB 4HI1A 3OUYB 2XM3A 1Z2LA 3D3SA 2B4UA 4QYZK 4DX7A 1LAPA 4QWAA 3M32B 4ECRA 3D2PA 2OPQB 2MGZA 4TQSA 3OVAA 2CWXA 2QLFB 1FTRA 2GE3A 1Z4RA 5C25A 2QZ8A 1XE4A 4DU8A 1N32F 1JLQA 5G4DA 2AU0A 1TK5A 2RQMA 3RYLA 2R2UA 5SUHA 1SC3B 1QSMA 4X4PA 1AA1B 3I1UA 2GU2A 4KLWA 2J9DA 2VODA 1LQ9A 3TEHB 1S7LA 2CJYB 2M3DA 5M2RA 1UJ6A 3KLEB 2DIUA 1MWYA 5J1EA 1FTCA 1Q7YT 4V1Ak 2CPYA 4KVXA 3KFWX 4DV0F 1R43A 3FZ2A 2V69A 2PIZA 1WDDA 3P5TL 4KQZA 1OY9A 4JI2F 3CD0A 3MECA 3D1QA 2YWWA 2O4HA 3BSNA 3IWGA 5A0YA 4YWYA 4KIAA 4O4RA 2MQMA 3PFEA 2E1MC 3VV2B 1FK9A 4U9ZA 3P2FA 3TP2A 2NMTA 1SH2A 5GAGU 3WC0A 1FERA 1HPZB 3TO9A 2JFDA 4NZ6A 2WVEA 1S7HA 4PXCA 9ATCB 2HVZA 4YHHJ 2VQFF 5K14A 3B3TA 1TMJA 2H48B 4XDCA 1YREA 3MEEA 5AT1B 3R7BB 2BRLA 4DL6A 2HBYB 1GXUA 1NZ8A 4IAVA 2YNDA 2B3TB 1M5KC 5F8NA 1QTNB 2PN6A 2W4CA 2UU9F 2HHTA 1HI0P 1K47A 4NGQA 3D3CJ 4X4VA 2WZ1A 3G8SA 2NREA 1KLMA 2ZH9A 4P74A 2CFXA 1T9WA 2JBKA 5F49A 1DQAA 4WFBQ 4Y2AA 4KH1B 1UTAA 2KXNB 4WXWA 4CT8A 4LR7A 5KFAA 1OY6A 1IYKA 4OYAA 2V9KA 4KPYA 4LQ3A 5ISVA 4ZITA 3R1LA 4CP5A 4Q8FA 4NJRA 2R8KA 5K8PA 2DCLA 2YX7A 2XCPA 4HPSA 1FWLA 4FYYB 2ZBQA 4XNHB 1QE1A 2WYRA 3DDDA 1TKTA 3PW2A 4ELTA 2WSEC 3J81j 2VDIA 4P4DA 1V5IB 3CNQP 2DCUB 3DU5A 3B78A 4O3NA 4FUUA 4OHYA 4C2ZA 3EY5A 4B3RF 4R8FA 3KMQA 1BLLE 3QMQA 4P71A 1UEUA 2QRRA 4I56A 4QBJA 1LANA 3K7RA 2JL9A 4CLTA 3HDSA 1D8ZA 2GZOA 1RBAA 3DFEA 4P2MA 4M85A 1BD6A 2UVUA 4ZN1A 1DLOA 4CLUA 4IHMA 2A0FB 4U96A 1D1UA 2YX1A 3ZZPA 4N56A 3VAJA 4NLWA 3NH8A 3H4DA 5H1SV 2K8GA 1KFDA 4ID8A 2Z56B 2CQ1A 3FKBA 1N33F 5ETSA 1X4GA 4M5JA 3CJQA 3CO0P 3D8PA 1U2FA 3VWSA 3WT4A 2Q6BA 1X4FA 3DU6A 3KLGA 4WCEQ 2MB0B 2GO8A 1HFEL 4NL5A 4DI6A 4CI0B 1Z4UA 4BC7A 3KK1A 1NSAA 1S76D 4X4RA 3C14A 4B10A 1B7FA 3PYDA 1I5OB 1FEHA 2CPXA 4ZP6A 3ET6B 4DR5F 1HNZJ 3N79A 5D4OA 4DV3J 1NMEB 1KQSR 1B7YB 4X62F 2EFOA 3PW7A 4AVBA 2GGPB 3FQKA 3A9LA 1J27A 1KLMB 3BDEA 3Q8RB 3TUZC 3IC1A 4A8FA 1KHWA 2BBEA 2KG1A 1WKLA 4Z7CA 2AJ2A 2HQIA 5AXLA 3CCTA 3KLHB 4FWUA 4ILRA 1OYEA 4KUBA 4EO8A 4GRSA 3N5BA 3J81U 2VXKA 1NK5A 1QAJA 4I6AA 4PKDB 2DHAA 1X4DA 2OMLA 4DSEA 5HROB 4DUTA 4OX8A 3H42A 2F3JA 5G0RB 3FNNA 1IKVA 1K4JA 3MECB 4DLGA 3O44A 4HYKA 3K2KA 2CG8A 4KE5A 4U8YA 5EHHA 2QLBB 2VBYA 1RA6A 5A0YB 3C8YA 4N76A 2H5IB 4HNXB 5DLFA 1T7PA 4YDDB 9RUBA 2R7XA 4OZ5A 3T3FA 2FVRA 4ED1A 3GZ7A 1ARLA 3NGSA 3ZZTA 1HBUB 1TUVA 4N41A 1M1HA 4KRWA 5K8MA 1RGVA 3R5GA 1LRZA 4ED2A 3BGFA 4F25A 5DGAA 4NCZA 4QVTA 3DR6A 2RT3A 4KGVB 2ROGA 2ZH7A 1GHEA 3J7Z5 5KFXA 3TVYA 1MROB 4MYTA 3ISZA 4NASA 1PYTA 3EGVA 2M5YA 4NRTA 4I0WA 3M6UA 1I51B 5L38A 2VFUA 1B64A 3ZO7A 4R9MA 4RUHA 1SXLA 2LMIA 5LMNF 1PBAA 1YI2S 4M5KA 2FJVA 1JLBA 1WHWA 4KO0B 3MUTP 1CLFA 3KLFB 1Q16B 2XSJB 4X64J 3IBCB 1H0HB 1W26A 5MLCV 1Y10A 1Y3JA 1OBRA 2VONA 3JXOA 4QWEA 1U7LA 4P45A 1S7IA 2CPHA 4DDFA 2CZ9A 5IB0A 5G21A 1VQMS 1YK9A 1VQPS 4UOHA 2J9CA 2BE9B 2QFIA 1UAWA 3W6SA 3JQKA 5KT4A 1N33J 1Y4ZB 3EZUA 1V3RA 4OYXA 3NMRA 4DL7A 1HIYA 1LWCA 3BEGB 4AXVA 1LNQA 1VRTA 1VQOS 1X4HA 1VQLS 3HKZD 3EZ5A 6FDRA 3V2UC 3VCDA 3HLPA 1X60A 5B0AA 1FRXA 2PFDA 2NZCA 4PAAA 2IY5B 2CQBA 4XK8C 1S0NA 5CAAA 3NGDA 2M4MA 2V77A 3WZ0A 4P6QA 3PBEA 2OGUA 4KOWA 3PDNA 1HI8A 2W8LA 3M2VB 2CQ3A 1FJEB 2ZKUA 5DDOC 3QAHA 4OLOA 3I5AA 3ITHA 5LXYA 2XEGA 2KFZA 2HWHA 3D5MA 5EDWA 5LRKA 3HO1A 5HLFA 3UCUP 5I42A 4M3SA 4DJBA 4KFBB 3S9MA 3US5A 4IDKB 1WUUA 1TL7A 1KLNA 4UW2A 3GYXB 1M4GA 2P2CB 3JTOA 3PR4A 3T1YJ 2J9AA 1QTMA 2H65B 2NYIA 1GMVA 4NA3A 2VPWB 3NNCA 1S10A 1U26A 4ECYA 3IU1A 1RHKB 1LFWA 1T11A 3HZEA 2Q7SA 5LL6d 2E5LJ 1F2PA 2FVPA 3M6VA 5ETQA 2LVWA 4F4WA 2VD3A 3CCSS 3SHPA 4NI2B 5HMXA 4J91A 5A2QU 3R27A 1U6MA 4Y49B 3K57A 2HWIA 3M7VA 1T3OA 2H4WB 3CJ0A 4NYPA 1IKYA 1D3WA 2G1DA 2YWHA 3MRUA 1IKWB 3V4MA 2B7CB 3BQ0A 1QSRA 4IR1A 3OXFA 1ZLIA 3VF0B 2R7OA 1YLOA 2PJ4A 4M5IA 4NFRA 4IOAQ 4RUCA 1S97A 2VASA 1TIQA 3D3BJ 1TXRA 4NCGB 2FLOA 2DT9A 2G3AA 3QIPB 3CCQS 3B4MA 4OC0A 1HMVA 2ZH6A 3KHXA 1FFWB 2P0WA 1FDDA 2MLXA 4OX7A 1RZMA 2KN4A 3AH6A 3EPGA 4MI4A 5IM0B 1FDBA 3OR1A 3QLHA 5JQ4A 3LGHA 2F4VF 4MXUA 2R8IA 3VQSA 4PCQA 3TEGA 5J2QB 3KLIB 1NHVA 2CQ0A 1JLBB 2BANB 2JHEA 2F63A 2FHMA 5L1JA 2YWGA 3DRPA 3IGNA 2ZHBA 2QL5B 3ZXWA 5D6GA 2YTCA 2IJFA 1N34F 4LFAF 1SV5B 4RPFA 1QSNA 3KJQB 2BABA 1BPNA 2DPJA 4MT1A 1FJ7A 4FPIA 2CNMA 4HHHA 4NA1A 1XNRF 1IICA 4FYDA 1MWQA 4JI0J 3QWUA 1BE4A 5GAEU 2CPZA 4A8KA 2MQLA 4U67Q 3QO9A 4F0MA 1GX6A 2JOQA 3VAKA 3H8YA 1JLEA 4DG1B 1RWPB 3JSMA 3OTDA 2HVHA 3R5CA 3GLJA 4LF1A 2DKOB 4KV8B 1VHOA 2IA0A 4WK3A 2JEWA 2GMHA 1K1QA 4BMHA 3DOLB 3RGIA 5M2UA 2ZWOA 3VR1A 4UFWA 4CQ1A 2M9KA 1VIOA 5IX3A 2AWZA 2PJ9A 4EYHB 4Y3CA 2FTRA 4OYIA 3FSXA 4LF5J 3UD4P 1XK8A 2WB1D 7FDRA 1LW0A 2EC0A 4WYLA 4BC9A 2YNFA 1Y5IB 2QJ8A 3GIMA 2QECA 1NXIA 2VB6A 1H74A 3GV7B 2A10A 2GCFA 3KTQA 3NGTA 2EPIA 5C42A 5HMYA 2ZEGA 3GCXP 4BBHA 3M30B 2GIQA 2KKHA 3GFYA 5HMZA 2R7UA 4W92B 3HFKA 4R3LA 3U1MA 4Z2XA 4RW7B 2BM1A 2F9JA 1X0PA 4KS9A 5KG7A 3CZXA 4B9MA 3KXDA 3Q8VA 4CGPA 4NXMF 4Z37A 3EGWB 4ZGYB 3UNGC 1VK8A 1Y00A 4N77A 2QIRA 1SJ1A 2XTJP 2UZAA 4UEZA 4LBPA 1JXLA 2P9CA 1TL1B 4OIXA 1F5AA 1RWKB 1DURA 4U7UD 3KI9A 1AFIA 1VBZA 1YW4A 2LU2A 3KOAA 1GXTA 1HBMB 5DO2A 3LPYA 2ZEFA 4OHWA 2DRAA 2FJWA 2CQCA 3D2MA 4YFUA 2FJEB 1XNQF 4CGOA 1FE4A 3MR6A 2FC9A 3T1YF 1IM4A 2ATLA 3TJAA 3WX8A 1LWCB 3FC9A 8CPAA 3T5KA 5F41A 5DWMA 2BJ9A 1KZFA 2FS5A 1KQKA 2PE3A 5D4PA 1PKUA 2BQRA 2HW3A 2F4VJ 4FD4A 1ZPWX 2ZEJA 1VQ6S 5BYSA 2IRXA 1BQMB 2DGQA 2ROPA 4CWBA 2HHQA 1RT2A 5DDPC 4KKOA 4CH1A 3D6FB 3QWPA 4ITSA 4AVAA 2XULA 2GVDA 4USUA 2J0XA 3LA0A 3PEHA 2AFUA 2PIYA 3OR1B 1YITS 2KU7A 1J5EF 4CYQA 3H90A 4EMDA 1WK4A 4NEXA 2N82B 3CF5Q 3KYLA 1R8PA 3HVTA 4ONUA 4ZY1A 2E5JA 4H4OA 4ZHRA 2KH9A 3H2VE 5G1ZA 5LYDA 2G13A 4MH8A 2AJ1A 4LREA 5KG0A 1Q8BA 5C25B 3M2UB 2D9OA 1IVZA 2CRLA 5E5NA 4X66J 3QJLA 3D6HB 2OKQA 4NGPA 2R7SA 4ECWA 1Z8LA 4FF1A 2GIFA 3KJVB 1RQ0A 1JQGA 2HQFA 1F3VA 1KFSA 2IC3A 1U0HB 2GHWA 3I4PA 4RO0A 5LRJA 4ED0A 4OI2A 1M5PC 2RDDA 4DUYJ 3K58A 4BD9A 3MPYA 3UVJB 5FLXU 3RR8A 3O2IA 1ELOA 4LT6A 4MFKA 1FFSB 2FLPA 3AB4B 2DR8A 3MEEB 3MEDA 4H54A 2VZYA 1A9NB 2ZDOA 3I9ZA 2RHSB 2DNKA 2POKA 3PVXA 1UEKA 1UP1A 3OJUA 4K2XA 1RTJB 3OUYA 2D4PA 1XC9A 2MLYA 3VQTA 3QRPA 1F9EB 2UXBJ 1S48A 4DNCA 2UVVA 2UXCF 3HHLB 3E01B 4B02A 1WWHA 2ILZA 4P4EA 2AFWA 2A2CA 4UA3A 2BE2B 1EE3P 4JD6A 1U1NA 4NCAA 2FY1A 4KOTA 3QGPA 3FX6A 1OSDA 3J7YU 4LMZA 2BYCA 1IQZA 4LF7F 2D4OA 3SJFA 3CW2C 1FKAF 2PJ0A 4M5DA 1VBKA 4ES3A 3BS9A 2KXHA 5HVFA 2N4DA 3D7FA 1Y3KA 1CS4B 2WPXA 2WVFA 5T7LB 2CQIA 3O1LA 1GMWD 4J7CA 3MM5A 1EAYC 4A8WA 1Q2DA 4MFLA 4ATNA 4EYIB 3TZWA 2H4YB 1SJ4P 1U0HA 4EZ6A 1ZPVA 4FD5A 1N5TA 4X64F 2B9YA 1ELLP 2CZVC 3LGNA 1L5UA 1RHJB 3P8BB 1Z1ZA 1U2RA 5KG2A 2VZZA 2VF3A 3HFZB 3RUBL 3G82B 2AE6A 3IA0A 1VC5A 3PY8A 2L41A 5HVHA 3BYRA 5KFDA 2GANA 2HVEA 5HXDA 4U9RA 1FRIA 1V5VA 3HULA 3M8QB 3DCAA 3CIMA 2PR8A 3LH2S 1D8YA 4F9UA 3OPKA 3QQCD 1NDCA 5DG9A 2G4BA 2DEIA 5H86A 3A8IA 3HM9A 4DMZA 2XYGB 3FBEA 5U47A 2CY2A 1H38A 4DX8H 3OL9A 2DNYA 1OQ3A 1RHUB 4J9KA 4U6PA 4O44A 2UUAJ 4I1TA 4FYWB 4F7VA 2KFYA 2W2OP 1P1TA 1R3NA 4DV3F 5DQGA 1QMUA 2OPSB 2J6SA 4DWIA 5F8JA 1NM2A 1GTHA 3TAMB 3H8EA 3BN4A 1XN9A 1ICEB 2J76E 2HVDA 3MM7B 1WF1A 3MWBA 4IF5A 4FF4A 3TA2A 2RAQA 4HHJA 1FESA 4B3SF 3CXCR 3EVWA 1GK8A 2CUYA 4X65J 1PCAA 2WVBA 3G87A 3J81Y 2C1EB 2LFVA 3B82A 3GYNA 4OV6A 1TAUA 2F65A 1UWAA 5LSOA 2XLKA 3QO9B 3EC4A 4H89A 5D3GB 4YP3A 5GMKa 4DR4J 3T5JA 3NCPA 4B9SA 1NBEB 3IR7B 2L48A 4GVLA 2F1FA 4YB6A 2DR7A 4C3LA 2YY3A 4K3NA 3IJ3A 3TUJC 2ZEPA 4JI3F 1EP4A 5I0CA 2ZENA 4AQYF 3MAAA 3KUHA 2EWHA 4R3KA 2V94A 1GMUA 3KG0A 5J2MB 3MM8B 3C46A 1WTFA 1XFOA 1HNIA 4JYAF 4AB7A 3OHAA 1WTBA 1F6TA 2HFSA 5GADI 5M2PA 4Q8EA 2H54B 3A12A 1SH3A 2BX6A 2DTJA 2HB6A 2GC8A 4XIUA 1HBNB 4K5RA 4PG4A 1BQNA 1YRXA 1JLCB 5KAKA 2OD6A 1R27B 2OPSA 3JS9A 1F9FA 4RX6A 2D3ZA 4FN5A 2O28A 2JLEA 1AUDA 3C15B 2B9WA 1JIHA 1SUQA 5L1KA 3M1VB 1K1SA 1R8HA 2NPIA 5C24B 4JB8B 1UKUA 2B5JB 2DNLA 2O01C 3L95X 5ADZA 2LEPA 3IMQJ 1X8DA 4O3OA 4M5GA 5FIIA 3VZHA 3V6JA 1JLCA 2FUG9 4NLSA 3R2CJ 1MMLA 2GGPA 4OC3A 3WIVA 1T9UA 1LW0B 3M2RB 3TAMA 1WHYA 3MDFA 3IN5A 1BOBA 2R3VA 3FVLA 2VJUA 4PG5A 4R8UB 2BR0A 2PJ1A 4RU2A 2YPZA 3OW2R 1YGYA 4QWBA 2BW7A 2M0GB 3NGRA 4A31A 3ZTQA 3UN2A 5L8RC 2YNHB 3C3LA 1FFGB 4DYOA 4FBEA 3D54A 4X4NA 2AT1B 2QN6B 3OL7A 4WE1B 5HQLA 4DR2J 2MZ1A 1U1PA 1S1WA 4G6VB 2YKMB 3OSPA 2UVWA 4RNNA 4OHZA 3G6YA 3JSRA 3CXPA 2UUAF 3CDUA 2FCKA 3HVAA 1M90T 3LP1A 4WKRA 3KHRA 4DFMA 1DBDA 3PYGA 3QT7A 1UCNA 2AHOB 3KLGB 3PB4X 3K9TA 3ZZIA 1D9DA 2NR0A 3FFIB 3ILJA 1T02A 2KB2A 2CJQA 2IMWP 3T9YA 4YY3J 3B7IA 2PJ3A 4Y0FA 2W7AA 1XRYA 3F44A 4F02A 1KEKA 5J2QA 5ETKA 4ZVFA 5IWAJ 2CNTA 1XOVA 2GQ2A 5KG1A 2M88A 1T3NA 2ZC3A 3GP9A 2XS7A 1VQ4S 1NE9A 3KJVA 2FGCA 3E01A 3GONA 5J2PA 2JDDA 1KUVA 1XR7A 4F0YA 1OZPA 2Y1RI 4P2XA 2Q1LA 4NGSA 4B3SJ 1EHWA 2Z2YB 2RUGA 3FBUA 4ECUA 2AYGA 3F0AA 2VG5B 4H4OB 1WI8A 4HT5A 3KQXA 4CYOA 5C88A 2VFRA 2ADBA 2YGWA 8ATCB 4DSKA 4ZCLA 4OYZA 2JEVA 4E0AA 4H4KC 4ANDA 3PW4A 3LQVA 1ROFA 1WJ9A 1ON0A 1M1KT 1CC8A 1WF0A 1NK6A 4Z7YA 1Y0YA 3AD9C 2YH1A 1WORA 3SV3A 4C98A 3MD3A 1HQ2A 3DRYA 2ABZA 1LW2B 2LQ5A 3CPXA 3JAMU 4LSLA 1N36J 2BVZA 1RACB 3D68A 1U1RA 4JI1J 2M2BA 3MMCA 2I38A 1S6PA 3BB5A 1S99A 3HHLC 2KT3A 5AJ3F 2VUGA 2MGZB 4J5OA 4E98A 4DOZA 3FB3A 1HQUA 1ZS6A 3Q89A 2CPDA 4ER8A 2C3MA 2AX1A 4H6UA 1HNZF 3LP0A 2KVQE 2KZMA 1Q2YA 1N88A 5HBMB 2BDPA 2R2SA 3GFXA 2CXAA 1LWFA 2GJFA 2RDIA 4ECSA 3ZTPA 3EUNA 3OVSA 1X5TA 3RU0A 2MXYA 1N54B 2R7TA 1DQ8A 4F67A 1ZZFA 2UXCJ 1WD6A 4ZPDA 3H5XA 1Q8LA 1X9WA 4MK8A 4NGNA 3FRYA 3TOBA 3BH6B 4K4YA 4B3MF 4IH6A 1JJ2R 5T14A 5A27A 1H2UX 4JI3J 2IM3A 4KAIA 3TUIC 1FT8A 4I2QA 2L9NA 4F3MA 4EVYA 1H3DA 4F36A 3T8WA 1ZAXA 2HHXA 5IV3A 4KSFA 2OZGA 5CPAA 2Y9HA 2QFJA 4M5HA 1GQEA 4DR2F 1EKSA 3C15A 1HW8A 4UY8T 3MEGA 3L2NA 4P7TA 2EKYA 2PJBA 1R8CA 2I3CA 3BGOP 4KZTA 4CO2A 2AJ6A 2KFNA 4MFBA 4RW9A 3X3UA 2DH9A 2DY9A 1NSKL 2PGCA 3EE3A 3BI0A 3CCLS 4QWCA 4I7FB 4F0HA 2H51B 4KV8A 3SSSA 3M9NB 4CYUA 2KJWA 2E9RX 1JLEB 2V8HA 3LAMA 4MY0A 1ZLHA 5JVGQ 4MCQA 1X5SA 4Y28C 1RHQB 4FNHA 2ANPA 1T9VA 4ECQA 2LP4A 1BC6A 4CAVA 1N48A 2ZEOA 3BPSP 4WYWA 2QA1A 5GVQA 4KOVA 2YVSA 4EK2A 3GILA 2KXFA 3CC4S 1KN6A 4KJIA 3DYAA 1JLFA 3PTWA 3VVUA 4PXEA 2A4NA 4C8LA 2VICA 1QLNA 2W7OA 1ZBTA 5LYFA 1BQNB 3H2LA 3C6UB 3I3GA 1YWXA 3SFGA 2YKMA 3VAGA 3FBFA 3V4IB 4DSJA 3PNIA 5EGYA 4O3SA 1RT6B 2C6GA 3PYFA 3JSMB 1VYAA 5IWAF 2KTQA 5BXIA 4ES2A 3GKRA 2VBQA 2VOPA 1KP6A 2HS3A 1NH8A 4UT4A 4TLQA 5KFIA 3SFUA 1PC5A 4LQ6A 2ZE2A 3MI7X 1S1TB 4P7VA 1KHVA 4UZBA 4XPLA 3M4XA 1B3TA 2JVRA 3DGVA 1KONA 2QX0A 1U1MA 5CD4A 2JVOA 2I6WA 2FT0A 3ADAC 3UN3A 2FJXA 5KFQA 5ITHA 4B5PB 3E0KA 4RNMA 2Y0BB 2XC9A 2ALZA 1KOOA 2C2MB 4BDPA 4HI2A 2ASJA 2OEMA 5HP1A 3D0HE 2GFFA 5HO4A 5IB9A 1YJNS 2CVIA 3G4SS 4NXNJ 2CNSA 2XY6A 2ATRA 4OZ1A 1S6QA 2LQ9A 4Y65A 3AFGA 4LFCJ 4HHUA 3KLIA 4DX5A 4EI2A 4UWJA 2V8GA 1QAXA 2QIFA 2YNEA 1FNOA 4USWA 4DS4A 1UFHA 4UUWA 4K50A 1HNIB 1DTTB 4ZCMA 1Q82T 4EO6A 2PO4A 4DSFA 4ILLA 1P1LA 1K0TA 1FVQA 1Q2CA 4Y49C 4TYBA 2G2YA 4PYDA 1H72C 3W62A 4USMA 4JV2A 4OLLA 4PK3A 3JSYA 4FVMA 4UQTA 1QY7A 4IUSA 1S1XB 3RAXA 2MSTA 3TE4A 1DE4C 2VKZG 2OH1A 1YK3A 2MHNA 2IAJA 1NH7A 1ZZNA 5HLFB 4G1PA 4P75A 4CIOA 5KOWA 5I3QA 4DG1A 1OIAA 1XERA 1G6BA 4OI0A 5F8MA 1RP5A 4LF9J 3WHIA 1S6UA 1XR5A 4J9LA 2EUIA 2Z3KA 1RU1A 2I9SA 1CPXA 1U8WA 1FKPB 3I0RB 3PJXA 2HHHF 4ED7A 2E1RA 3BO2A 1N34J 4LFAJ 3HD1A 4NLGA 1IXKA 2HYIB 5F8IA 1VHEA 2OPPA 2MY8A 2QYCA 1RTIA 1NHUA 2XMJA 2R4FA 4CLPA 2KRRA 1FE0A 3CJRA 4BLGA 1URNA 1QUVA 3Q22A 2FLNA 2EK6A 2Z2MA 4HLBA 1IBLJ 3I9V9 2OD4A 2QV6A 4DPUA 4N7TA 3T5HA 3I5BA 2OI2A 1S9GA 3MR3A 4PQUB 3ZTSA 4B3MJ 4KVOE 3CDAA 4U95A 4MHZA 1PSDA 1J2VA 1FKOA 1CQNA 2RQKA 3D6TB 3K89A 2CYYA 3FBBA 4B3TJ 1TV6A 3EXNA 4CM0A 4WPAA 2PMHA 3J80Y 1G2EA 2OO4A 1F2HA 5J2PB 1ZM4A 4DBQA 3R1KA 3HXMA 3GJRB 4QW8A 4D3HA 2JSXA 1TKDA 2Q4ZA 2QYGA 4CO1A 4DQIA 3G3SA 1OJ4A 4AL7A 1RK8A 1LW2A 5KFHA 4NLQA 1FK9B 2VH7A 3SZ2A 2Z11A 2DJWA 2CVEA 3I0SA 4M5LA 3CPWR 2KM8C 2H5MA 4BBYA 4DQQA 4G1QB 3NAIA 1NJZA 1UA1A 4UEEA 2OH2A 3TJ8A 4A46A 2DGSA 4UY85 2ZW5A 2IFXA 1FRHA 2VA2A 4J9OA 1TELA 1CJUA 1O6XA 3HT0A 1ZAVA 3PIOQ 2OPPB 2HQGA 3IO1A 3Q2SC 3IRXB 3TR5A 4Q5VA 1U45A 3W9HA 3GG1A 3LP1B 2B9EA 1NSQA 3TANA 2WVDA 4PWUA 2HRUA 3TVKA 1MJBA 1XBUA 2DNRA 5T41A 2Z0GA 3AT1B 1PC4A 5LT5A 2UUBF 1SKSA 4MK7A 1Q53A 4GXHA 2Y0MA 2B3VA 4DR7F 3MOZA 2DEJA 1MK4A 1CJWA 5HVGA 1JMTA 4MHNA 4RI1A 2H9ZA 1RHMB 4RW4B 1TFYA 2M52A 4QB9A 4B12A 3K8WA 1TKZA 2XMTA 2VJVA 4Q44A 2D3OR 1RWOB 4QYRA 3BF4A 1JJ4A 1U6BA 5HJYA 2ZH8A 4QU6A 4GC6A 3OV7A 5AE1A 4PK2A 3IWNC 2HHSA 4DEZA 1XR6A 3KKWA 2WAQD 2GIRA 3DMJB 2EBJA 4ORFA 3KHZA 4L74A 3OL6A 4DFJA 4RN7A 1NK0A 4PQUA 2PEHA 2GO9A 4WE1A 5EN1A 2AP6A 1YRUA 4ZOSA 1SUQB 2PMWA 3K5LA 3IG1A 5E3QA 2HFUA 3VH9A 1NEEA 1K0VA 1S9EA 2I8EA 5FDLB 4II9A 3H4QA 1RTIB 5AE3A 2ZELA 1YIJS 2KYXA 2QTWA 3WC5A 5KG4A 2VPYB 4ZPWR 2HRYA 2Z3OA 4M6GA 4G1QA 1IBKF 1QSLA 3GV5B 3WC6A 5CD4H 3D6MB 2Z0ZA 5JVHQ 1Y9WA 1Q4RA 3ILLA 4N47A 2ZZMA 3CJTA 3IR6B 3CEDA 3Q23A 2OFHX 3HP6A 3C19A 1FWPA 2EEYA 3Q8YA 4LFBJ 4IRKA 1LWXA 2ZBCA 3AB2B 1ZH5A 2F4FA 1VKCA 4I49A 4PG7A 2CJBA 2UV8G 3CPAA 4CNZA 1O5JA 4P6YA 1SJFA 2C28A 4BINA 3M2RA 4WFZA 1T03B 4ZYQA 3LW5C 3V8IA 4ID5A 4B9NA 3D0IE 1HWJA 2RS2A 3KG1A 3M8ZA 5D77A 3QZ7A 2XNRA 4AL5A 3PB7X 1GXLA 5FLXY 1CPZA 1UVMA 4YU9A 4KKOB 4NLYA 1B6BA 4XDDA 2V0NA 2OHDA 4EBDA 4P4BA 2ABYA 3AA8A 5D15A 1I94F 4OX6A 1DTTA 4M5NA 4CO5A 3NRBA 5J8FA 2W4PA 3UFCX 3M8WA 5BR8F 2IBKA 2CG4A 1FDNA 5EX3A 4LIRA 4KBIA 4N5SA 4J90A 2GNKA 1M5VC 3UCGA 3EICA 2F9DA 3EXCX 5D4NA 4C8KA 4KVME 5CABA 2R8GA 4PG6A 3RW6A 1IGBA 5GAEI 3DKDA 1S1XA 1OSCA 4ZKAA 3MXHP 4B9LA 1WNEA 3CO9A 2B5GA 3IS9A 4PPZA 2X3GA 4L73A 4IG0A 3TVZA 4NRUA 1VLOA 6CPAA 2AEFA 2QJ3A 4ZVTB 2FLLA 1NRKA 3CDEA 3P96A 1UWBA 3TZZA 3FMBA 4MKVA 1PBUA 3JSBA 3A8KA 3QAYA 5IOLA 5H84A 2BJEA 2J0QD 4YMEA 1RO5A 4UCNA 4EFAC 3FMCA 1KOHA 4ZI6A 4H2KA 3JYTB 1HNWJ 3N6MA 2BKPA 3TYTA 4O4GB 1VQ8S 3KUGA 3JVNA 3BGRA 2R7QA 4ID5B 1JLGB 1LEOA 2YH0A 1EETB 2LQ8A 3SEOA 4GKKJ 4USKA 4NSQA 2CJXB 4YHHF 2AKWB 2RVJA 5E7OB 2W8KA 3BKTA 1NDLA 1CC7A 4FBUA 3RBUA 2B8PA 2FGOA 1X5PA 2UV8A 2AV5A 4C2YA 3RRHA 1U4BA 1I1DA 1RISA 4USIA 3CXQA 1RUSA 2PDOA 3W2WA 2K7JA 3VZIA 2GLJA 2COLA 3ICLA 2BJDA 1FJCA 2BACA 2AFSA 3Q8PB 4F04B 4NLOA 2BJ1A 1S4FA 5HATA 4M6HA 4Y2IA 5LYLA 4JBCA 3F8KA 4C3KA 3QSYB 2R8VA 3DOMB 3H2UB 3NWGA 3CCMS 4DZ6A 4KR0B 2YNCA 4FS1A 5JXSA 5K14B 1UA0A 2AJFE 3W64A 1VRQC 1L3SA 2AEMA 3L7PA 4PABA 4CO0A 5KFCA 3KLEA 4B08A 3KK2A 3TUPA 5CA5A 4NLPA 2YKNA 1VR6A 2J8SA 4JI6J 1PO6A 2QYVA 3NS6A 4RWXA 3LOUA 3R3TA 1O0PA 5HBMA 3KDOA 2V2KA 2I79A 1N8RT 4QR1A 1E6YB 1VGYA 1Z8XA 5BWAB 4WK1A 4JLYA 1HMVB 5DM7Q 3D2WA 1SQHA 4DL2A 2Y1LB 4Q45A 4X8IA 4ZLNA 1KC8T 2C6CA 3DSBA 2OJ3A 1H2TZ 1MMDA 4F4XA 2V63A 1IR2A 1SIZA 2RRNA 3IFEA 2C2NA 1S0OA 3LPEA 1ZA2B 1BWVA 3W3SA 3M32A 3I4HX 2LEAA 1RE1B 4CTAB 3KNAA 3ZTRA 2LECA 1J5EJ 2EVNA 1FXDA 4UCMA 1ZM3A 2FXFA 1GYTA 3IBFB 2Q4YA 2DEAA 2HNDB 3DMJA 3VATA 1RTJA 4DFKA 2L9WA 2J9EA 4R0JA 2DPTA 4OYPA 2RJZA 4NXYA 2LQJA 2GA7A 4AT1B 1CSJA 3BBCA 2Q51A 1WC4A 5LMUF 1BO4A 2D69A 2MQNA 3WDOA 3F5BA 1PJ5A 2HNZB 1RWUA 2ZUGA 4K0KJ 1YMEA 4QQBA 1PUAA 5DS7A 2J6UA 5BYRA 3MMAB 3GY9A 1R0AA 3R5JB 4L3NA 4DR1F 2C2DA 3R5BA 5IQ6A 1U2CA 2XZDB 5CYJA 4KOUA 1ULRA 3C26A 4NCBA 2HFVA 3A3PB 3QJJA 2PJ7A 3FFIA 1MLAA 2IHR1 4DQPA 4NOHA 4WJBA 4L89A 2Z4PA 1IU8A 3S7RA 2R2RA 2N7CA 4ZN3A 4IUFA 5KT7A 3HVTB 3F56A 4HACA 5KT3A 5J1QA 3UDEA 4CYPA 4QW9A 3BR9A 2ZW7A 4CS0B 3PP9A 4I69A 4QU7A 4E0DA 5L9XA 4CYNA 5T7LA 3SYZA 3FECA 3TX0A 1CM0A 2V2QA 2NS1B 3I32A 1DTDA 3KNGA 2IVMA 2Q0YA 1KVIA 1RA7A 2B51A 3MF5A 3MMCB 2H5JB 2L08A 2XMMA 2AZ3A 2JRSA 1M44A 1NSPA 3R1HA 4C8OA 1Y7PA 2HIYA 5F48A 4DN0A 1Q8KA 4K7QA 3KHHA 1EQMA 2BA9A 5KFVA 3PKYA 5J2NA 2PD1A 7CPAA 5HROA 2B5JA 4HR2A 3FSIA 4A48A 1MU2B 2EK1A 3OTEA 5KTCA 1HWIA 3ZZRA 2GFQA 3QB8A 2VEZA 5KTAA 3MCNA 3KKFA 4OZNA 4ECXA 2DHSA 4JI8J 1I3OB 3S8SA 4DHVA 2MTLA 2GQCA 2ZH2A 1Q95G 2BOPA 1MN9A 4IG3A 4FF2A 3OFHA 2NZ4A 2NUUG 3NBPB 4IKAA 3POTB 2FJDB 4LR9A 1R8BA 4DPYA 2BJ3A 4KGXB 1QVFR 3IP0A 2WUUA 3H8FA 4OYWA 1IKVB 4OQJA 3HT3A 4K4VA 4X62J 3PYEA 1F3FA 1K73T 3AA9A 1V6HA 4IH7A 1QUPA 3UD3P 1EETA 1KNZA 5AJ3J 2G0IA 3K0JA 4R5PA 2GLFA 3FVYA 4IQMA 4DXLA 3JUWA 3JAMY 4PWDB 4I64A 4RNFA 1Q7LB 2IAJB 2OEJA 1IYLA 2HGNA 4C3MA 3QGGA 4QIWD 1NHKL 3WX4A 5E3CA 1XMBA 3W2WB 5HQ8A 3AODA 2FIWA 1T03A 2LEBA 2JC1A 4FZVA 4WKYA 3NE7A 4DR3J 3N9UC 5C7PA 4JI1F 1NK7A 4NE9C 2DVIA 3MAQA 2QA2A 2Y8YA 3ZJ0A 4OJ1A 4DV5F 3P2HA 2GMJA 4R8UA 3B35A 1T0TV 3CWJA 3JTKA 3DNSA 2FVQA 3FMWA 4W90B 4DS5A 1TKXB 3TO8A 2W7PA 2B56A 1TZ0A 2JJ4D 4ZIVA 1NNDA 3D0GE 1RAHB 1WOSA 5F9LA 1NK9A 3NKYA 2CPEA 5FJ4A 3UDCA 2M8DB 4PG8A 1N32J 3IWXA 3KJFB 3ENAA 3I31A 4ELUA 1B0PA 5D0HA 4TN2A 4K59A 3UDLA 3IGRA 3SCJE 3Q0AA 1C1CB 1DTQB 2RC4A 2A6OA 1AYEA 3IWWA 1YR0A 3GJSB 4WFXA 3W6XA 2R7WA 4ZVEA 2ZUAA 3HD2A 2MKHA 3S1TA 1VHSA 4Q36A 4JI2J 4KHRA 1REVA 3J7A1 2OLWA 1WC5A 2V2ZA 3DN9A 1LWEB 4PXDA 5F09A 1S5ZA 4Z65A 1S1UB 5HI7A 1WWZA 2IL4A 4MMOA 3M8PA 4IQXA 1SI9A 1VI7A 1WOPA 5EWFA 1IKWA 4QIFA 1UVNA 4Q43A 2HNZA 4RW9B 1Z2ZA 3K5OA 5LJ5Y 2MZSA 3BN7A 5D29A 3SXLA 5BYQA 2GV1A 1IKXA 2U1AA 2RE1A 1HBOA 1JB0C 1NKBA 4O0NA 2DNZA 2UXDJ 5AG4A 1VQ7S 4USTA 1PYOB 4K4UA 2LXIA 4OADA 4K4SA 4B3OB 3IM8A 2DK2A 4NWBA 4QCLA 1AB8A 5L46A 4K30A 3PM9A 1TKHA 4HEA9 4AD6A 3O8WA 2F8HA 2RQCA 2D3O1 1YJTA 3GV8B 2VA3A 1SH0A 3TAQA 1ARMA 4KFBA 3VALA 4C68A 3M8SA 2E9ZA 2DR6A 2PEBA 1LFPA 3UWTA 4ED5A 1D09B 1RLDA 1SJRA 4A30A 3CJSA 4P10A 4HH1A 1Y9OA 4CGLA 3OHBA 4HNWB 3RZAA 1YLEA 4OKOA 2WHOA 5KG3A 2PA8D 3L7UA 4PXBA 2ADCA 5L1LA 3IWEA 3HHEA 4LRAA 2XNQA 3DRPB 1HBOB 3CCVS 4LBIA 1S1VB 1U1KA 1MROA 1TK8A 2VG7B 5L9NA 4EZ9A 4UFXA 1HNVA 3G9CA 2NYHA 2GQQA 2C22A 3HHLA 4ZVUB 3KR5A 2J8RA 1FXLA 4PRFA 5KFRA 1UFLA 3B54A 1TKZB 2RKIB 2ZDPA 2QL9B 4GMKA 2A2DA 1JLAB 4ONWA 3FJ2A 2FVSA 1KR4A 4ZHRB 3RG6A 2FD2A 3S6GA 2PC6A 4RW4A 1OY8A 3DRSB 3OXLA 4YGOA 3Q8UA 3C6TB 3FEDA 2AYBA 5ETMA 4JI7F 4XPDC 1C2PA 3U7JA 3LP2A 3WR7A 2CDQA 4MAKA 4RNHA 1AW0A 1PU9A 4UOFA 3QT8A 4HKQA 2L3MA 1BPMA 4ZLJA 1YBTA 1M1GA 1HBUA 4Y2MA 2QMLA 2CPJA 2VKRA 1TK0A 3CDXA 2VBXA 3BGLA 2Q43A 2QO3A 1S1VA 2W25A 4M95A 4V19X 4KSIA 4BCAA 1DARA 5DM6Q 4MBUA 1XEZA 3K5PA 3V7ZA 4A8YA 4IFVB 3E8OA 1L3TA 1IB1E 3CJ4A 2HWTA 3ZZYA 4YQWA 4GVBA 1LWFB 4OI1A 5CYQA 2MQPA 1N5VA 5I4MA 2HVIA 3W2VA 3G71S 4QJVA 2PRQA 3FEEA 3O6QA 1K44A 4FD6A 5LYIA 1NKCA 4L8AA 2CQPA 1F9HA 1CPSA 1GAOA 2EBGA 3SDEA 1VQ9S 2YWKA 2A3JA 4L72B 4PWDA 1HW9A 1S57A 1RTDB 1V3ZA 3LWLA 4K4ZA 4KTQA 3KK2B 4DCJB 3CDWA 3DDNA 2E1PA 2IQ6A 1U0SA 4TY8A 2U2FA 1JWWA 2ZXVA 4PSXA 1TF8A 5I3UB 3UQSA 3QAUA 2WSCC 3GJTB 3P4UB 2W9BB 1X9SA 1HA1A 3U1NA 3ENWA 1CJTB 2OTLS 3NXZA 2CJ9A 3VVTA 3CGIA 1RBLA 2OTJS 1UETA 2HG4A 3HI9A 4OX9J 3NWRA 1XEBA 4ETXA 1Y0RA 2Z2ZA 1UWBB 3W65A 2DPIA 3R9FA 5MAOA 2OEKA 3MM8A 2V6AA 1VHIA 2NCKL 2QE5A 1FX2A 3MTJA 4Q2MA 3Q24A 1XMOJ 3BZQA 4DV6J 1WF2A 1IBMF 2DRBA 3R97A 3GIRA 1YX2A 3FIXA 3ISNC 2Z8QA 4A39A 2B9XA 3KMSA 4DL5A 2JDCA 2FL4A 3LALA 1YLXA 2ZPAA 3DDIA 4R5PB 1NLKL 4YR3A 2R7VA 2GVZB 1PJ7A 1TU0B 2FHKA 3ZZUA 5F47A 4ANCA 4OP4A 1RWMB 3PRTA 1EQ0A 2VHGA 1RABB 3MEKA 2XWXA 5A6WA 3ELHA 2NSMA 1B99A 3W91A 3AQOA 4RUAA 2PI5A 2IRUA