2V8HA

Crystal structure of mutant e159a of beta-alanine synthase from saccharomyces kluyveri in complex with its substrate n-carbamyl-beta- alanine
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
431
structure length
431
Chain Sequence
LSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNAEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGHQFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Yeast -Alanine Synthase Complexes Reveal the Mode of Substrate Binding and Large Scale Domain Closure Movements.
pubmed doi rcsb
source organism Saccharomyces kluyveri
molecule tags Hydrolase
molecule keywords BETA-ALANINE SYNTHASE
total genus 159
structure length 431
sequence length 431
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2007-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v8hA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2v8hA01
3B3SA 1YSJA 1VIXA 3SI1A 4ZI6A 2PE3A 2CTCA 3N5FA 1FT7A 4PXCA 2F7VA 8CPAA 5I4MA 1PYTB 2ZELA 4A94A 4ZX9A 1BPMA 2F8HA 4OC4A 2C6GA 5LRJA 1VHOA 3V7ZA 2PJ5A 4IAVA 3VATA 1FNOA 3KQXA 4MCSA 1XMBA 3IC1A 4OKOA 4OC2A 4TWEA 4YU9A 2AFSA 3VH9A 2PCUA 3NA6A 1M4LA 4CPAA 2CIJA 6CPAA 3WT4A 4MCQA 3LWUA 3B35A 2HC9A 2JEWA 3B3VA 4MMOA 2ZEPA 3KASA 2PJ8A 1LAPA 2V8HA 4FAIA 3HLPA 1XRYA 3D4UA 4MHNA 2PVWA 5HVHA 2Q4ZA 5HXDA 3PEIA 4O23A 3IO1A 4OC0A 4NGRA 4R76A 3SJXA 3D7GA 1KWMA 5F09A 2ZEHA 4PQAA 1TF9A 4DJLA 1LFWA 1NSAA 2PJ2A 2PJ3A 4OIWA 2V8VA 2PJ6A 4UIBA 3PBEA 2ANPA 3LMSA 3ISXA 1CX8A 2PJ4A 1BPNA 5ELYA 3BHXA 3PB4X 5LRKA 3ISZA 1IGBA 2HB6A 3PBBA 3B3WA 5CBMA 1OBRA 1CP6A 4MCRA 2QVPA 1ZG9A 2V8GA 2RFHA 2EWBA 2Q43A 2BCOA 1ZLHA 4KSIA 3WC5A 2QJ8A 4P4JA 5DS0A 4FBEA 2FVGA 2ZOGA 1Z2LA 2ZEFA 2QYVA 1LANA 3KGQA 4IHMA 4P44A 4OIDA 4P4BA 2AFWA 3NFZA 3SJEA 2NYQA 3BI1A 3D68A 4ZX8A 1UWYA 2AFOA 5CPAA 4TNUA 1EE3P 3FF3A 3CPAA 4PXDA 3FECA 4ZYQA 3SJGA 5HVFA 3S9LA 3T8WA 1ARMA 3B2YA 1ARLA 4NGTA 2PJ1A 3HUVA 3DLJA 5J1QA 3KR5A 2PRQA 3V38A 1GYTA 3MRUA 4K3NA 2PJCA 1R43A 1TKFA 2ZEEA 4X2TA 5JH9A 2C1CA 2O53A 3GB0A 3PB7X 3SJFA 4ZY0A 3PB8X 2PIYA 3RBUA 3KQZA 3PB6X 4EMEA 4PXEA 2POKA 1ZG7A 1YW4A 3B7IA 3GLJA 1TKJA 1ZG8A 2OR4A 2AFXA 5LYFA 1VGYA 2EK8A 3KHXA 4WJBA 4UEFA 4UEEA 4B6ZA 3FVLA 5JGFA 4F8ZA 1BLLE 1CPXA 1Y0YA 4UIAA 3D7FA 2ABZA 4F9VA 1Z8LA 3S9NA 4ZY1A 3RZAA 3DGVA 5HVGA 2ZOFA 5K8NA 1XFOA 3QNVA 4W9YA 2PJ0A 2GLJA 4MHYA 3KL9A 4NGQA 5K8OA 2ZEMA 1F2PA 2EK9A 4NJQA 3CDXA 3KZWA 1XJOA 4H2KA 2C6PA 1ELMP 4NGSA 2V77A 4AXVA 4P4FA 4MXUA 3FEDA 3IWWA 4P45A 7CPAA 1QQ9A 5JM6A 1ZLIA 3FMCA 3MN8A 3IFEA 4OC3A 2RB7A 4Q7AA 1TXRA 1IY7A 4X3RA 4Z65A 4BD9A 2O4HA 1PCAA 4NGMA 3IJ3A 2AFUA 4GM5A 2VL1A 4WWVA 4R7MA 3PFOA 2BO9A 5LYLA 1YLOA 4NJRA 3RAMA 1DE4C 3JRUA 3L2NA 3H8EA 3WABA 3KHZA 2PVVA 5D29A 2PJ9A 4P4DA 2PJAA 2XEFA 4R8FA 4EWTA 3NH5A 1R3NA 3SI2A 2DEAA 1CG2A 1ELLP 4PPZA 2PJBA 2OOTA 1F57A 3BI0A 1JQGA 5IB9A 2IMOA 3VARA 1AYEA 3WC6A 2BOAA 2I3CA 3H8FA 2JBJA 4MHZA 1CP7A 3K9TA 2CF4A 4NFRA 4P4EA 5LRGA 3PRTA 3TX8A 2PIZA 1TKHA 2CTBA 4IK2A 3H8GA 3IIBA 1H8LA 1VHEA 2WZNA 1LOKA 1LCPA 4UEZA 2JBKA 4F9UA 3S9MA 4P4IA 1TF8A 3PFEA 2V8DA 2G9DA 3B3CA 5K8PA 4OP4A 2Q51A 4P10A 4NGNA 4MCPA 2WYRA 4RUHA 4R6TA 3FJUA 4UF4A 3GUXA 3KI9A 3SI0A 3PB9X 1BAVA 4JYWA 2C6CA 2XEIA 5THWA 4A37A 4OC5A 1YMEA 4DUKA 3FX6A 1Z5RA 4PXBA 3CT9A 1F2OA 4YWYA 1AMPA 1DTDA 1QMUA 4X8IA 3D67A 1YW6A 2ZENA 4MRIA 4MHPA 2AFZA 2XEGA 3CPXA 3BXMA 4LQGA 2IQ6A 3IEHA 4G1PA 3NH4A 5LYIA 2GREA 3I1UA 1Y7EA 1CPSA 3D7DA 4OC1A 3B3TA 3FH4A 1CBXA 1HEEA 2ZEOA 1LAMA 1XBUA 3D7HA 2J9AA 4A39A 4JZ0A 4P6YA 2IJZA 3FEEA 3TC8A 2AFMA 1Y0RA 3NH8A 2ZEDA 5D8NA 3KR4A 4ONWA 2GU2A 5LYDA 2PJ7A 4DYOA 4ZY2A 4FUUA 1HDUA 2ZEGA 3D66A 1HDQA 1Q7LA 4OMEA 2NSMA 4FWUA 2GLFA 4A38A 5K8MA 4EFDA 4NGPA 1RTQA 3K2KA 3WC7A 2XEJA
chains in the Genus database with same CATH superfamily
2RKIB 3E01B 3EX7B 4M5MA 4KTQA 1U6ZA 3Q22A 1T03B 1FT7A 2JH3A 1CSJA 3GTYX 1Y9KA 2ZELA 4A94A 2DHSA 3N0VA 3R95A 2PRBA 4NLRA 2ROEA 1HMVB 3IC1A 2ZH7A 2ZC3A 2HHPA 3R7NB 2RT3A 2DK2A 4ZPVR 3S7RA 4JV5F 3C46A 5FJ4A 3I5AA 4DLEA 2B56A 4I6YA 3GZ7A 1FD2A 1FVSA 1T0TV 4H4MA 1EHWA 1V6HA 2VA3A 4C3LA 4J9UE 2DNPA 2DF5A 1REVA 1NJYA 1CJKA 2D4PA 2X7IA 2OPQA 1FKPA 2HVDA 4L8AA 2NYIA 3LW5C 3JAMY 4WU2A 1AW0A 3PRDA 2OPRB 1M5PC 2J0XA 1PG5B 1DTQB 2BACA 1D1UA 2GANA 2D41A 1RAFB 4PSXA 5KFWA 1LWEB 1ZS6A 1NJIT 1R0AA 5C42A 1X4HA 1WG5A 2REFA 4DCJB 1NSPA 1CP6A 2ZBPA 2OPSA 2BE2A 3FDSA 3Q0AA 4ORFA 4X4PA 4LF6J 2EBJA 2YNFA 1R6YA 1F2HA 5AXKA 3G3SA 1XNQF 3BI1A 3UCGA 2WSFC 1RT5A 2B5JB 1HYSB 1K0VA 5IC4B 3IRXA 3VGSA 4TNUA 5GAEI 2AX1A 3C15B 4QYZJ 3S9LA 3T8WA 4EZ9A 2A1BA 2DNKA 2BXJA 1C0TB 3M6VA 4E2FB 5ETRA 4CZCA 2PRQA 1RI7A 2IM2A 2LLZA 2RVJA 2RQCA 5IFMA 5KFNA 1Q2YA 1Z9UA 2HKEA 4ZY0A 2HEKA 1T7PA 1HNIA 2LMIA 2B4DA 3DLGB 4KV8B 2G2OA 3IR6B 3LOUA 1T95A 4B3RF 1BXNA 5IQ6A 2ZJQQ 2BUEA 3ADAC 1N5QA 1TL5A 5LYFA 3DRSB 3W9JA 2CZ4A 4DPOA 2D9OA 4F3OA 1GMWD 3HKWA 1UWBB 1BLLE 5DM6Q 3DOMA 4OI0A 2DO0A 5HJXA 2R9LA 5HVGA 2FD2A 4B3OB 1TL1A 1F1BB 1NDLA 2PJ0A 3QNWB 1HQEA 2W2MP 3MM5A 2HHHF 3CDUA 2CQGA 2YQ0A 3OXLA 5D3GA 3THPA 3ZXWA 2G1DA 4MYUA 2DHGA 3M8PB 4ECYA 4MKYA 2F9JA 1SKRA 7CPAA 4HNWB 2RH3A 1N0VC 5KFTA 3SCIE 1YVKA 2WBRA 4CYOA 3B78A 3RAXA 3GY9A 4YDDB 2Y8YA 2VQFF 4P4DA 3TA2A 2B4VA 4ZKAA 1G3OA 2DH9A 1F5AA 2LEPA 3EGNA 3SBMA 1NZAA 2AWZA 4WFNQ 2HRTA 4BLGA 2RF2A 2HHHJ 3VAHA 1QTNB 4PPZA 3TJ8A 3ZZ0A 1Y11A 2PJBA 1S3ZA 2HNDB 4H4KA 5J2NB 1XMOJ 5ETKA 3FBUA 3LODA 3MM8A 4OV6A 3FRMA 4C6AA 1EAYC 3K9TA 2VG6B 3G82A 1K1SA 1RAGB 3KG0A 4YB1P 3UCZP 4WTYA 2DEIA 2OPPB 4UWIA 2K1RB 1OY8A 1XC9A 3CCQS 3OTEA 1S0MA 5MLCV 3X3UA 1BWVA 2YWFA 4K4WA 4NXMJ 1CJWA 3VR1A 2WYRA 4R8UB 1JJ4A 3DLBA 2LQ9A 3OL6A 3KI9A 4NXMF 1PBAA 4L75A 3J80U 2V4JA 4JYAJ 3PV8A 4LQ9A 1L3VA 4RUAA 3CT9A 3JUWA 4OZ3A 4DL4A 1F6TA 2LDIA 3MR2A 1MK4A 2HBRB 3C16A 1HWKA 4HT7A 3A3NB 4B3MJ 3TA0A 4HKQA 4P7VA 2HHXA 1XBWA 2QMWA 2CXEA 3R5CA 3DNCA 3CEDA 1YITS 2EK1A 3W5YA 2F8EX 5HQMA 2DNQA 1AUGA 3TAMB 4JV1A 3TT2A 4F0XA 4WE1B 2W1BA 3TZZA 5T7LB 4LSNB 3AFGA 4MKAA 2R2RA 2YKQA 2NSMA 2J6SA 1RHUB 4K4SA 1SXLA 2YX7A 5K8MA 2I8EA 2VF3A 1U8SA 5CA5A 4P72A 4NCGA 4LSZB 1OPZA 3WC7A 3ILLA 5D0EA 2BJEA 5A8RB 3KLHB 4HEA9 2PGCA 1T9TA 2LKZA 4PXCA 1E6VA 1GHEA 1BQXA 2QO3A 2XS7A 2CWKA 1PKUA 3AD9C 4AQYJ 2GIFA 2QFJA 4Y2CA 5DDRC 3UDEA 1SUQA 4LRDA 5KG7A 2MJNA 3FXTA 2IVFB 4I49A 3HD2A 1T05A 4CGNA 2E7VA 2LYVA 4V19X 1FNMA 3EZUA 2LECA 1YQEA 2ZM6J 4G1QB 3WDOA 4IO1A 4PG7A 2Q4ZA 3OPKA 1NK0A 2VBYA 1TL3A 2F3JA 1HIYA 3BSNA 3H4QA 1PC4A 3QSIA 3D8PA 4PRFA 2LXUA 3DMJB 2PJ3A 4X66J 5KFVA 4JI8F 3CSKA 5ETVA 3KJVB 2PJ6A 3A8JA 3T41A 4CLUA 3MCOA 1QE1B 3CDAA 3DRYA 2A0FB 2M5YA 3ICLA 2X51A 4IRCA 3MMCB 2DO4A 1B87A 3DR6A 1YKWA 3PW5A 2D3OR 1KNZA 1NHVA 3HHKA 3D3CJ 4YDXA 1EZZB 1AZSA 3UFCX 1RUSA 2BCOA 4B3SF 3TUIC 1KQFB 3BLNA 1DQ8A 2I79A 4P6QA 4KZTA 1HFEL 4R57A 2B6AB 2Q4YA 2XI3A 4F8RA 3KLGA 4AXJA 2KT5A 5ETLA 3H40A 2R7RA 1M5KC 3W9IA 4MKVA 4YRHA 2AFWA 2FIAA 3IGNA 5IWAF 4CO5A 2HG4A 5BXIA 2ZBIA 2FSRA 2AFOA 1HLWA 1PU9A 1BLUA 1SH2A 4LF8F 5LXRA 4KY3A 1NH8A 4ECSA 5HVFA 4C48A 4DR2J 2G0JA 1HKAA 4NGTA 1XMQF 2FDNA 3OL9A 2EUIA 4DQIA 4DR2F 6FD1A 2BEFA 1R43A 2YQ3A 5ITHA 3C19A 1G4CA 1I94J 4E8UA 3PB7X 3D1OA 1IYLA 4M6HA 3NXZA 3KQZA 1U25A 4F67A 2AYBA 1R6VA 3QFHA 4FS1A 3MPUB 1RT2B 1QUVA 3PX4A 2Y3YA 3MEEB 2N7CA 3KHXA 3GYAA 2WPWA 4UFWA 4UEEA 4O3NA 3NE7A 3IS9B 5LT5A 1ZTTA 4DR4J 1KHWA 1IM6A 3KYLA 2FHJA 3FNCA 3MEDA 2ZOFA 1DRZA 1VMBA 4PV6A 2HZVA 3MMAB 1FEHA 3EPGA 3I0SB 3KZWA 4H2KA 3RBEA 2C6PA 1IYKA 2ZNZA 3AB2B 1NK6A 2DPTA 4NRUA 2V2VA 4F4AA 3DI6A 4NX9A 4MIWA 3IXQA 5DZ7A 4Z65A 5CYJA 3M2RB 3IJ3A 4R7MA 5LYLA 2QMUB 1P1LA 2V8PA 2BM0A 2PVVA 4B3TJ 3CCJS 2GA7A 1KVKA 3WX4A 1O6XA 4EWTA 4O4RA 1C1BA 1RHMB 3BQ1A 2FC9A 4JYAF 1S7KA 4M5IA 4LRAA 3QIPA 4AG7A 4UFVA 5DLGA 3DLEB 3U27A 2OPRA 1K4JA 2CNNB 4F3QA 1MN7A 2ROGA 4L89A 3OFHA 4TKTA 4IK2A 5KFKA 1JLAB 2BJ7A 4K5SA 2AX0A 2MPUA 2GQQA 3MTKA 2M3DA 2F4VF 2ZUGA 3N79A 1M1DA 1CS4B 2Q51A 2BBEA 2JRSA 3TUZC 2X1BA 1I21A 2C2KB 1B99A 4ANDA 4C97A 1U6FA 3LACA 1FRJA 1AROP 3GWCA 3DR8A 1KFDA 2W7OA 4NLTA 1U1LA 3HJVA 4WWSA 4DR6F 1BO4A 4YY3J 3Q2TC 3M32A 3V4MA 2UP1A 1RT2A 5KG1A 2O66A 4KKOB 2C2NA 4DLGA 3C15A 4CGMA 2YWEA 5KT6A 2GX8A 1TAQA 3PRBA 1S6PB 3IAS9 3QO9A 5G22A 1Q78A 2Z3PA 3GQCA 3TWZA 2DXDA 4DSJA 2E1AA 3PVXA 3SHPA 2DYAA 3E01A 3S01A 4Y2AA 1YGYA 2E9ZA 1I51B 3GV7B 1WTBA 3Q83A 1F3VA 1RTJB 1I1GA 3BREA 2LA4A 2UU9J 5EC4A 4LF2A 3H2VE 2DGOA 1X60A 1WD6A 2Q04A 3MECB 4ZBGA 3KLFB 3P49B 4FWUA 4HI1A 2HRYA 3K5LA 4EYIB 2FVSA 2C3OA 1S1XA 2OI2A 4IR9A 4QWDA 5LJ5Y 3F56A 2WK4A 1BWEA 3IBWA 2W7PA 1IB1E 4HACA 4DSEA 4OFZA 3BKTA 1JLFB 3I5CA 4R8UA 1S1VB 3O5TB 1K8AT 2BKPA 1FI4A 2KT2A 3VV2B 3BJYA 3CD0A 1DHMA 2CNLB 2CNMA 4KOTA 4L6V3 4YHHJ 4USVA 1ZAXA 3FK4A 3M32B 4AD6A 3KG1A 1XR7A 2M88A 4CPAA 5KFJA 4ECQA 1RWKB 2EFOA 2QJ3A 3TNVA 2HV2A 2QYCA 4A8XA 3BGOP 1UEUA 5J2NA 3HLPA 3J81j 4ELUA 2IAJA 4RW8A 4E98A 4DR3J 1KDNA 3DRRA 2UXBF 2U2FA 3QWUA 2PA3A 3MURP 4R25A 4GC7A 3L7OA 1IIDA 5F09A 1E6YA 1DZ5A 1TF9A 2DXFA 3CJKA 5FVJA 3K89A 3W1YC 1DURA 3HSGA 1A0OB 4PYAA 1RAAB 1FD8A 1TKTA 4CO0A 4AT1B 4OYBA 4TQSA 1P9QC 2M8DB 1KVJA 3MECA 5CYQA 1NHKL 2N3OA 4C8NA 2KXNB 2WBMA 2JX2A 5KFEA 4OX9F 4B9MA 3FRYA 3CC2S 3ZZIA 2OHDA 4ZPAA 3M2VA 1B7YB 1CJTB 5KT3A 2EWHA 3ZZOA 4F2RA 1U45A 4MFJA 2ATCB 4RO0A 5HBMA 1CPZA 3S1TA 1S9EA 3SQGB 1BQNB 1IBKJ 2B9EA 3P3DA 3ENWA 2J8NA 1HQUB 2IBKA 1ARLA 1P6TA 1U48A 5IB0A 3QWPA 2BABA 3UR3C 1TKFA 2CJBA 2KL8A 2O53A 1WKJA 2G0BA 5KG5A 3R7BB 2EFVA 1IJFB 3GE9A 1EARA 2DNNA 4GS4A 4JD6A 2VV5A 2WSCC 2POKA 1XIQA 1VISA 1T02A 1Q79A 5HQLA 2WAQD 4R5PA 2AFXA 1VR6A 2BJ1A 3EE3A 1U1RA 5F48A 2FJEB 1BQMA 1VRTA 2VDIA 4XDDA 4EFAC 1CPXA 2IBOA 3GYGA 4HLBA 5KFUA 4CCHA 4B9VA 1NBEB 3TO7A 2SXLA 4NXNF 3TR5A 1TR0A 4ZVSB 2Z2LA 3KL9A 3UWTA 3BBCA 1B7FA 3S6EA 4JV0A 4C8MA 4C2YA 2QLJB 1RU1A 1JIHA 3D6TB 5J1EB 1MSWD 3Q2SC 2IRYA 4A46A 3M8YA 3V5RA 2MGZA 2AFUA 3WIVA 2DGVA 1HNVA 1ZOTA 3CIMA 3G8WA 2OP5A 4ECVA 3THTA 4Z37A 1FX2A 1S10A 3IG1A 5DM7Q 1W2BR 2Q1LA 3D9BA 1WOOA 2JVOA 3RRHA 3H25A 4OHVA 2CJQA 2OEKA 4RX6A 2CYYA 3VF0B 1UVJA 4M5DB 3HF5A 1VQ7S 3TZWA 2JFKA 2PMZD 1Y9WA 1Y5NB 4F4WA 3R8YA 4MHZA 1TV6B 4JLYA 1VQ6S 4P4EA 3D2WA 2CTBA 2B5GB 1WI8A 1QAIA 3G87A 2Z0ZA 1UA0A 2ZH6A 1TFYA 4OP4A 2D3O1 2PSWA 4PG4A 2NQPA 4KHPJ 4WP8A 4P10A 1JKHB 1U4BA 1L3SA 2BW7A 3IGRA 3UDLA 1L3UA 2W2PP 2KVIA 3V2UC 1EKRA 4JI7J 1RT3A 4FD7A 1Z5RA 2AF6A 4WK3A 1RWUA 2W9AA 1OIAA 1UEKA 4DX7A 1WG1A 2YNGA 3J7YI 3M30A 3AAWB 2NPIA 5LYIA 2KYZA 2QL9B 5F3ZA 1ZETA 4OC1A 5IC6B 5DG7A 1VRQC 5A76A 2Y1JA 1X4CA 4KJIA 2ZEOA 2N3LA 4OZLA 2LQBA 3VWEA 4YR3A 4A39A 4U95A 4DFJA 5F8MA 3G6YA 3NMAA 2FT0A 2ASJA 1OS5A 2CPDA 3GJSB 4CO1A 3G9CA 3O2IA 4NRTA 1S5ZA 3J81U 4FVCA 3I56S 1LW0B 3LUYA 1WF2A 2UUCJ 4LFBF 2C2DA 1ZZNA 2CQDA 5DO2A 1EQMA 4X64F 4F2SA 2RDIA 4LFBJ 2CVEA 2UUBJ 4I6WA 3VGVA 2F63A 3OTBA 2VEZA 3W6SA 3C16B 1DTTB 3ZTPA 2EG2A 3MUVP 4WXWA 2G2YA 2XM3A 8CPAA 3R9GA 5I4MA 3HMJG 2FVCA 1TKZA 1BPMA 1HI0P 3T1HF 1VHOA 1U47A 5H84A 2I1RA 4Z7CA 1XMBA 5GAEU 1V3ZA 4QIVA 2YNEA 2MQ8A 3JVNA 2L41A 2IY5B 2JC1A 5KFRA 4MY0A 2MTLA 4DPWA 1QAXA 2C2OB 2V8HA 3EWGA 3VQTA 1X4EA 2QLXA 1XRYA 1HWIA 2DHXA 2ZBQA 4EBCA 5HXDA 4JI3F 5IX3A 3AODA 1YRTA 3UVJA 3LPEA 3M2VB 3L95X 2AYMA 2IYIA 3KLIA 2AE6A 4CAXA 2AV5A 2CJYB 1M4DA 3HHLB 1VQ4S 3KLFA 1U02A 3FFIA 3D1HA 3TEHB 2VFRA 1EETB 5IZHA 4UIBA 1KUXA 3MUTP 1WOSA 3PBEA 1CX8A 2XMAA 1UFHA 5I3PA 3KK1A 4U8VA 4P52A 1BE4A 1HWJA 1ELOA 1VQKS 1GMVA 1B0PA 1S1WA 3MR7A 1QSSA 2VG5A 4OZ0A 5K14B 2F40A 4EO8A 4CIOA 2KKHA 3KMSA 2VPWB 4CLLA 1OMSA 1I5OB 2ILZA 3J7AN 3C6UA 2FJAB 4LRCA 3B8HA 2VFUA 4ZVPB 4DV0F 3Q8QB 2F9DA 4C8LA 2J5AA 2M8HA 3DLHA 4KKOA 2HZAA 4IHMA 1TUGB 1NXIA 2MEWA 1UFWA 2NYQA 4ZCLA 1F2GA 3J7A1 1YBTA 1VRUB 3FFIB 1NPRA 2OB0A 4QU6A 2LU2A 1WNEA 2MZ1A 2VASA 1KOOA 1NDKA 5E3QA 4KRWA 4K3NA 3JSYA 1G6BA 2ZEEA 3JB9k 4X2TA 1WC6A 4H4KC 2ODFA 5KFYA 3K8VA 2J7UA 2BQRA 3MMBA 3QGPA 1M1GA 3BKUA 2G1HA 2DD8S 4LRBA 1JXEA 4DR7J 4DN0A 1ZG7A 4WTOB 5EWFA 5JMNA 2H3EB 1S48A 2MHNA 2RS8A 2J8MA 2R42A 2OFHX 2VG6A 2Z2ZA 1Y0YA 2FHOB 4JB8B 3M7VA 3MCMA 1Z8WA 4ATNA 2V2QA 3M8PA 2HK3A 3G96A 3ILOA 1JLQB 3I6PA 4B17A 4YFUA 2Z8QA 2MQQA 3N5BA 4BC7A 5GMKa 2YNIB 5C24A 1F2PA 1SJQA 2GGPB 3M2RA 1W7WA 1FK9B 1O5JA 4CLPA 2B5JA 4WIIA 1QQ9A 1Z2ZA 2XSJA 3IFEA 4DV4J 3IN5A 4GM5A 2HPUA 4N47A 4OZJA 4U9YA 3R9EA 2FLPA 1ZAWA 1VI7A 4XTTA 1OYDA 4MJKA 4RW6B 1N36J 4WBFA 5IT0A 4NXYA 4ZVRB 3JYTB 4QPXA 3DCAA 4C98A 1XMOF 2KHDA 4NCAA 2YNHB 3FZBA 1RYRA 1LWEA 4M5JA 4EGLA 2VKZG 3PW2A 5IWAJ 2XS2A 2K8GA 3IBCB 4PWUA 4QYRA 4ENOA 2LDYA 4II9A 2L9NA 4YOEA 4DMZA 1JLAA 5IQQA 2QYGA 3TAQA 5C25A 1U6MA 4F4KA 3QJJA 2BUNA 4TNOA 1LXNA 1NKCA 2VBWA 2YVSA 5LRGA 3HXMA 5KG0A 3TTHA 3DDKA 3P2HA 3V6JA 4KOUA 1H8LA 4B9LA 2DNHA 4LQ3A 1F5BA 2YNFB 2A2DA 3SDEB 3S9MA 2L9WA 4P4IA 3RRKA 3H0PA 1HW8A 3D0IE 3MEGB 4RUCA 2I2YA 3N6MA 1TK0A 3TQ1A 3BPSP 4JI8J 4R3KA 2B9YA 2RHSB 3PM9A 3NGRA 4DDFA 4YUDA 3NOCA 4K0KJ 5F8HA 1SJ3P 4CWBA 1F2OA 1NKBA 2YWGA 1X4GA 5IXUA 4D3GA 3LWLA 1X9MA 2AFZA 3W63A 2HNDA 3G2XA 3VWSA 2QN6B 5K20B 2C28A 4DCOB 2OUGA 2DPSA 4I69A 4A4JA 1H73A 2FXFA 1EJ7L 4OHZA 4NLPA 1CPSA 3NRBA 2M2BA 1UVLA 3IU2A 1VJQA 2DY1A 4F4XA 2Q79A 4MFPA 1LAMA 1HR0J 4HTJA 4IKAA 2C3UA 4TYBA 5A2QU 1MMLA 1N33F 2IYGA 2ZEDA 1KLNA 2FHKA 1WKLA 5D8NA 4CYPA 5KFCA 2YNGB 1DBDA 4OX6A 2IVYA 1FO1A 2PA8D 1KVIA 1ZAVA 4H4OA 1M5SA 3ILIA 2ABYA 3H8YA 3FZ2A 1M5OC 4OHWA 5H9EK 2RDJA 2DNLA 2F7VA 1KC8T 1JB0C 3HHEA 2HS3A 4AYBD 4QWCA 2EBGA 4MT1A 2DPIA 4IDKB 3CO9A 4URQU 1RTDA 1IKVA 1QSRA 3CE8A 4DR5J 2XLIA 3MPWA 3HM9A 2A6OA 2CIJA 1RWNB 1X5SA 3KASA 1G7CB 4WP3A 1NKEA 2CQBA 3RUBL 1MLAA 1N71A 4NLWA 2VPXB 3D4UA 3BBBA 3DOLA 2IVMA 4PG8A 1JJCB 1FRIA 2DRAA 4M1KA 2FY1A 3QLHA 1KWMA 2LQ5A 1Q8KA 1T03A 2FGOA 2I9SA 2XYGB 3BR8A 1P9YA 2DKOB 3DOKA 2L9DA 3CCUS 5T7LA 3AOCA 4H4OB 1BC6A 4HNXB 1R0BG 5JVGQ 2V68A 1EKSA 1RISA 4QOTA 4B5PB 2CKWA 5CBMA 3CO0P 1U1PA 4DR1J 5J1PA 1UZHA 2GVDA 3QPIA 4C8YA 4NXNJ 3QGGA 5BYSA 1TL3B 5DQGA 1RP5A 1T3OA 5CYQB 5GAGU 3I87A 2XHCA 5M2UA 2E9TA 1OZPA 3MCNA 2N82B 1Z8TA 4M6IA 4ICLA 1ON0A 5HH1A 3FECA 3C14A 1SJRA 3LPYA 4CGLA 4KOSA 2R8HA 1CEZA 2EW9A 1KTVA 3GV5B 2G0CA 4ITSA 1GYTA 3MRUA 2Z57B 5DJBA 2QA1A 2HNZB 4M5HA 1U2RA 2X3DA 4I67A 1RHJB 4KIAA 2BKNA 3NMRA 3BF4A 3ENVA 3RBUA 3GONA 4H6UA 3OV7A 1LOUA 3MM6B 4LF1A 3X1LB 4NCGB 4LR9A 1NDPA 5D8HB 2R7XA 1BQNA 4KH0B 2VQEF 2HLTA 5JQ4A 3BS9A 2FIWA 5GMDA 1HMVA 4N76A 1QUPA 2ZZNA 2R7OA 5EWGA 1CJVA 2GMJA 1YJWS 1AUSL 5AG6A 1PAEX 4MHYA 3JXOA 4CAEA 1OPIA 2HVHA 3LANA 5FIIA 2ZEMA 2EK9A 3HZEA 1N33J 2QZ8A 4RNFA 1D09B 5C5JA 2H4WB 2PIIA 3GIMA 3D2MA 5CCMA 2VBZA 4OC3A 4MTPA 2O4HA 4IH6A 3JSBA 3R7SB 4B3TF 3N28A 5D3GB 1DE4C 1NZ8A 2C2ZB 4MK7A 2YY3A 1Y10A 5DRKA 4B9NA 4RNOA 2FZKB 1KUYA 3W91A 4NLDA 2HHTA 1ELLP 3BQ2A 4DCPB 3TVYA 1F57A 4O3RA 1JQGA 2IAJB 2IMOA 2WSEC 2BOAA 2PR8A 4O44B 1VOMA 1Q1KA 3AD7C 3R1LA 4USTA 5GVQA 3F0AA 4HI2A 3TX8A 3K8WA 1VQ9S 5J8CA 4B9SA 4DXLA 2GJIA 3DC2A 2XMTA 2MQPA 3ILJA 4LUAA 2RF2B 1O8BA 3R6GB 4R6TA 3M8WA 3GUXA 1B0VA 2JNJA 3OQ2A 1RBLA 2HFSA 2FE7A 4XPKA 2MZRA 1FX4A 2MKKA 3P2FA 4QC6A 3EXCX 5IOLA 4NZ7A 1XK8A 3MM9B 2HFZA 2LXIA 3CPWR 3GFZA 1S59A 3EDRB 3BKFA 1NM2A 2ZUAA 4J9PA 2BJDA 2VKRA 4W90B 2HMIA 1WF1A 3KUEA 4V19J 3EC4A 4H89A 4XPDC 3OD2A 1CBXA 2Q4VA 3ET6B 5DQHA 1O0PA 4A8MP 4P6YA 2R2TA 1VK8A 2QLBB 3NL0A 4F4ZA 3NGUA 3BSAA 1WC0A 3FBCA 2PJ7A 1S6UA 4ELTA 3M1VA 3W60A 4DUZF 3OWCA 4IQXA 3NBPB 3PX0A 2AIRB 1VQ5S 4BWJA 2NPFA 3ZFVA 2E5JA 3PHTA 2HS4A 3KMQA 4KOWA 2MXYA 3FQKA 4K4XA 4ZVHA 2PE3A 3N5FA 1X4BA 3L9ZA 3P5BP 3WIUA 7FDRA 2HVIA 3S8SA 2E29A 5AXMA 2F4VJ 3GIKA 3H4DA 2C6GA 4X66F 3ETOA 3D1QA 3G6ES 2AGPA 1FRHA 1D0EA 2PJ5A 1SVDA 1Z4EA 4FKXA 4YU9A 1ZTWA 4CRJA 2PCUA 2PT0A 3NA6A 3ZZZA 4OHXA 6CPAA 2E5GA 3T9NA 2MLZA 2OIHA 3O8WA 3JS9A 4IH5A 3LTOA 4KGVB 5H9EJ 4PK2A 2HFNA 2PJ8A 2WVCA 2Y9HA 2PVWA 4QR0A 3OL7A 1FJEB 2XWYA 2CZVC 2C1EB 1HNZF 6FDRA 2CQHA 2VONA 4M5GA 2CQ1A 2GHVC 4MH8A 3PKYA 4J7CA 3TX0A 3CXQA 1OYEA 3SSQA 5ETSA 3OLAA 3CULA 2ZPAA 2FIUA 2UU9F 4YQWA 1YI2S 3EICA 3QAUA 4TY8B 1NO8A 2FZCB 3BHXA 3QT7A 4X4SA 1ROFA 2H5IB 2A18A 1N34F 4IG0A 2KJVA 3LGNA 1M0SA 2XCPA 1UTAA 4CQ1A 4MCRA 4HDGA 1UP1A 2AEFA 4R87A 2CPEA 4KBIA 3OFFA 4U96A 3LWMA 4ZVGA 5K9FA 2NXEA 5HP1B 2EWBA 5J2QA 3HDSA 1SI9A 2R7TA 2HHUA 3HO1A 2EO8A 4ZP9A 4P44A 4IG3B 4LSLA 4Q8EA 1NMTA 1IKWB 5FDLB 3D3SA 3MEEA 1MWYA 4PXDA 4DPTA 2VHGA 2GS8A 1ARMA 3CIZA 2ASLA 3B2YA 4KGMA 3BYPA 2PJ1A 3P96A 1OY6A 5J1QA 4F36A 1R7IA 2PJCA 4RW9B 2YWHA 1YGHA 3KDNA 3GB0A 3C6TB 1QJHA 2KTQA 2JDCA 2BANB 3PB8X 3T3FA 3FCHA 2KJWA 3HSDA 2HFUA 4FPIA 2XULA 3CCZA 1K1QA 2B3TB 4BMHA 2DTJA 5B7WA 3R2DJ 5HAOA 5H1SV 3P5TL 1LWFA 1DQAA 3ZNJ1 2WVFA 4F0HA 2RC4A 3BO3A 1HBNA 3RZAA 4RW6A 5AG4A 2W01A 4ZJOA 3CB4A 2BX6A 2E1PA 4NJQA 2DY9A 1XEZA 3CJSA 3LA0A 2UVWA 1Y3KA 3L7UA 1J5EJ 2AMCB 3MR3A 5JVHQ 2KU7A 3KK2B 3FYNA 3MN8A 1T9WA 3FC9A 3PR5B 1QY7A 1PCAA 2CPZA 3NE8A 4C7HA 1JNRB 3TOQA 4NA2A 3HD1A 4WYLA 3RAMA 2UUBF 4KOXA 4JP8A 3RBXA 3WABA 5F9NA 4A8QA 5HROA 2PJAA 5AG7A 1XNRJ 3B82A 3NH5A 4WCEQ 2NUHA 4MBUA 1CG2A 4WYWA 4U9RA 2HMIB 2UVVA 4JV2A 3BI0A 2NZ4A 1HR0F 3THVA 1X9SA 3AA9A 2R98A 1RXOB 2CQIA 4TLRA 3OFGA 2VICA 3SSSA 1FF2A 3OTDA 4O3QA 5KT7A 3H90A 1KQKA 5C2GA 3CJKB 5JPHA 2OELA 4ZLNA 4CH1A 5EBVA 1C0UB 9RUBA 4QB9A 1WK4A 2D3ZA 3VAGA 4L76A 2V9WA 1LCPA 2BE7D 2ZD1A 1Y7RA 4KHPF 2B3VA 1TKZB 1S5KA 3PFEA 3MI7X 3B3CA 4PZVA 1Q81T 4ZVUB 1E6VB 3QT8A 3SCKE 4KOYA 3E51A 2A10A 1PJ7A 2DIUA 4LFAJ 1XE4A 3PHEA 4CO4A 3EVWA 3I5BA 2JJ4D 5I42A 2ACMA 4AUKA 1Q86T 3ZNUA 2GZOA 3HFKA 4EO6A 4ZPTR 4TN2A 1UETA 3KK2A 2B3UA 3IEHA 2K06A 2QG9B 3RW7A 4IOCQ 1T9UA 5J2PA 3V8IA 3FH4A 2R3VA 3EZOA 1RWVB 2RSQA 1MG7A 2XY6A 2YKOA 1Y0RA 3RB4A 1Y9OA 4H6ZA 1HL6A 1FKOA 4A8OA 2GU2A 5LYDA 2UV8A 2L3MA 2UUCF 4R0EA 2V67A 5CCLA 2CPYA 1QSMA 2VC0A 2J7WA 5KT5A 4OYPA 1SPBP 2GLFA 3HI9A 1NK4A 1RT3B 4EFDA 3HZGA 3W7BA 1C1CA 1HA1A 3HHLD 3OXFA 3P45B 4UCNA 1YRXA 5KFAA 3C6UB 2RE1A 2HWHA 2KDOA 4NEZA 4E0DA 2G9OA 4NLVA 3O6QA 2WVDA 1T9XA 4DV6F 1TIQA 1QSOA 2WPXA 4UA3A 3T19A 2DGWA 2IDEA 4OYOA 1RT4B 4IAVA 4NCZA 2EVZA 5C2CA 3HP6A 1WSRA 1RAIB 3LQVA 2ZHBA 4K4TA 1XERA 2GAGC 4PWDB 4YGOA 1VRUA 1V3RA 4QWBA 2G13A 1HNIB 2FVRA 2B43A 2OU2A 2HIYA 2MZSA 3LH2S 3DXBA 4GO7X 4ECZA 2OSRA 1J5OA 4MYTA 4DI6A 4UQGA 2ZBCA 5LMNJ 1V5IB 2ZFHA 4ILRA 1IWGA 3DLLQ 5J2QB 8AT1B 1S76D 3TJ9A 2BJ9A 3PW7A 1NSAA 4GVLA 1XWLA 2XB2D 3HJFA 2JSXA 2ZITA 3NBPA 2FHMA 1HNVB 2BYCA 3N4WA 4MK8A 2MGZB 1S1XB 1S9GA 4B3RJ 4YB6A 4WKRA 1RHQB 1C4AA 3MGDA 1F9EB 4YS2A 3ISZA 3MEKA 4XNHC 3OHBA 4TLQA 4CLFA 4I7FA 3B3WA 5G4DA 3TOBA 2D74B 1R8HA 2DIVA 1XR5A 2W25A 2XZDB 3PW0A 5HSPA 2VODA 3WC2A 4DU7A 2QMLA 3SJEA 9ATCB 2EEYA 4XIUA 2JHEA 2HGLA 4CAVA 1UEVA 4P71A 4G1IA 2MZTA 5DS7A 1JLEB 5AT1B 4MFBB 5LSLA 5IV3A 4CT9A 3SJGA 1MNEA 1QD1A 4L3KA 2UUAF 2FHJD 1GX6A 3CW2C 3HUVA 4A8KA 2P9GA 2HWIA 4ZVEA 5D78A 1U7LA 1Y5IB 2YPYA 4OLLA 2J0SD 3JSMA 4OYXA 4IR1A 4TVAB 4IFVA 5KFSA 2HHQA 1FFWB 2JL9A 2E5HA 1SC1B 2BEIA 1TV6A 4P2XA 2KO1A 1B0TA 4F50A 2CNTA 2MB0B 1GFWB 3CCTA 2OR4A 4KO0A 4Y3CA 4XAKA 2GJFA 1IBLF 1FJ7A 1IKVB 2OLWA 4IDKA 2OMLA 1Y7PA 3D7FA 2QTWA 3ISND 3W2WA 3W2VA 1Z8LA 4CYQA 1OQ6A 1X4DA 3JTPA 3GKRA 1A2ZA 2GIVA 3T1AA 2J76E 3UCUP 1NSLA 3PEHA 2J9CA 5H9FJ 4DV2J 1RT7A 3NGSA 5B09A 3PRVA 5CYMA 2UUTA 3UE2A 3UY5A 4AXIA 2MKYA 1FEEA 3CNQP 3N6NA 3R5JB 4RZRA 4J5OA 3UDVA 3KKFA 4NEXA 4KQZA 2FJWA 1FXDA 3PZPA 4P7TA 2KRRA 1MWZA 1X31C 4CM0A 2HVEA 4EEYA 4NJRA 1UPMB 2YKMA 3PZJA 5T41A 2ZZMA 5J2MB 2BOPA 1H0HB 1YTYA 2HGMA 1PUAA 3SI2A 1FKPB 4USKA 2QEXS 3G8SA 4MJ8A 4DN9A 3KDOA 3NOGA 4ES3A 4KFBA 4UBRA 3UD4P 3JTOA 1CP7A 4ECRA 1TAUA 2X1AA 4DSKA 1OSDA 4B08A 2G4BA 1MU2B 4X65F 2VIHA 2PIZA 4X4QA 2XBPA 3MFHA 1VHEA 5HI7A 2HQDA 2Y0SD 3Q8SB 3MFIA 3MPVA 1FWLA 3C26A 4DS5A 1Q5YA 2ZW5A 1U8WA 1JLFA 4QCLA 5F49A 4KHRA 1FJCA 1RKIA 1JMTA 5I3QA 4NLSA 2DJWA 2XGPA 4OLOA 5THWA 1S1WB 4I2PB 1UMJA 4KPCA 5CQGA 3UQSA 3K9UA 4A30A 4DUKA 3AD8C 2DNYA 2L48A 1DLOB 4U7CA 3BDPA 2AT1B 3LGHA 1JLCB 5D4PA 3SV3A 2CIMA 2CAJA 1IBMF 2C27A 5LMUJ 1FFGB 3BXMA 1FKOB 1T94A 2LEAA 1QVGR 5AE2A 2Q44A 2OEJA 4GKKF 5JJBA 3HSZA 3D7DA 3B3TA 3KLHA 1HEEA 1RHRB 3VWDA 2CRLA 1H7XA 3UD5A 1YRUA 3B6BA 3QO9B 4RNHA 2Y1IA 2R8GA 3TO6A 4ONWA 4MI4A 2ZXVA 1X0FA 4OYWA 1P27B 3K57A 3CJ2A 2N4CA 2QGFB 3I4PA 1HDUA 3BGLA 2VI7A 4DV1F 2MKHA 4CP5A 4N5SA 3HVRA 3VQSA 3K2KA 2YNIA 2CDRB 2ERRA 4PQUA 4MKBA 5KTQA 4JI3J 4Y34A 3IMQJ 3DOLB 2V2ZA 4N8NA 2CTCA 1YLEA 1I94F 2P2CB 3V6DB 3FMWA 3R5DA 5GAGI 3K2YA 3SMZA 1IXKA 4LF5J 1Y3JA 3OJSA 2FGCA 4BCAA 3AJ2A 2KG0A 2KN4A 3MZIA 3S6GA 3KQXA 5F8JA 2BM1A 1CQNA 3MCSA 4GKJJ 4NLXA 3WT4A 3T5LA 2PEHA 1RBAA 3B35A 1YJNS 5DGAA 4ICLB 2X1GA 5DETA 1KLMB 1YJ7A 3B3VA 2ZEPA 3W66A 5AE3A 2VPZB 4Q5VA 1JNZB 3US5A 5HVHA 3D4JA 3OLBA 4WF9Q 2V5HG 4DX6A 1LW2B 3ZTSA 2ZWOA 5IS2A 3HHNB 4Y2MA 5DQIA 1KOHA 5B0GA 2NXJA 1SC4B 1NEEA 1HNXJ 3GFXA 3RB6A 3DU6A 3AOAA 1HBMB 5A8RA 3RO0A 2E1RA 4BHQA 1WHVA 1Q82T 4B5PA 2ANPA 1BMQB 4I0WA 1BHNA 3SCLE 5ELYA 5EDWA 5B0AA 4MFKA 3I0RB 2I00A 2IJNA 3AOBA 3DI6B 1T9YA 4ZP6A 2HB6A 1JXVA 4UFXA 3DDDA 2CVIA 3PBBA 1MW7A 1WC4A 4X4VA 4NI2A 2Q43A 2H5JB 2YKMB 3UO0A 2OTJS 2DRDA 5DS0A 4AVBA 1WG4A 1QAJA 3RGIA 3JTNA 1HBNB 4OIDA 3SV4A 1RSCA 2DGXA 2I6WA 4Q2LA 4GC6A 4BINA 3EMTA 5CPAA 1PJ6A 1YK3A 1NK7A 1CJUB 1VJWA 1V5VA 3DRXA 4PR6A 3MM5B 2MQOA 4E2AA 1GNKA 3A9LA 3KG4A 1MJ9A 3T5JA 1OSCA 1RWOB 3NCQA 3OHAA 4LF6F 2GIQA 5RUBA 1FWPA 1S97A 5F8NA 3OVAA 1K47A 2QLFB 2PIYA 3TVZA 5D0HA 4YMEA 5C25B 5CD4A 1AB8A 3CJ4A 3FMBA 2E7XA 2UUWA 2E9RX 4URSA 1HI8A 2CJKA 3R9FA 4UWJA 3I82A 2R4FA 3GJQB 4ALZA 4F9VA 1SQEA 3RU0A 3TAPA 4FBUA 1VDHA 1VQLS 1C0TA 2CNSA 1AZSB 1B3TA 4UUWA 2M9KA 1HHQA 4X4RA 1G2EA 2XHWA 5AGEA 1HBUB 2A6MA 3J7Z5 3HT0A 4B14A 3IWWA 4CM2A 1SIZA 1VRTB 3VTIA 4I2QB 4TU8A 3C66A 3QIPB 4BD9A 4NGMA 5C7PA 3BSCA 2Z2YB 2BO9A 4OL8A 1ZA1B 2WZ1A 5A28A 3G4SS 1FXLA 1R89A 2O5DA 2H48B 5CYMB 3W8GA 2Q3PA 1H3DA 2Q7BA 2GV1A 2BJ3A 4YFJA 1CS4A 1FJGJ 2DXEA 4YR2A 5IT9U 4UT4A 4QJVA 2Q66A 1AYEA 4ZCMA 1LRZA 3H8FA 4P2MA 5KFLA 1MN9A 2V69A 4CYUA 1RKJA 5F3TA 1JJHA 1IJEB 1YDLA 1UL3A 3QIDA 1FE0A 4J9VA 2ZH1A 3MPDA 1CULB 3H8GA 5HMXA 1JKHA 1FRMA 4UEZA 3I9SA 1TL7B 4JI1F 2B4DB 2JVRA 3NNAA 2DH7A 3CMAS 5AJ3J 3R97A 1B64A 3SXNA 5KTCA 5DWNA 2AJ0A 3PX6A 5EX3A 4O4GA 2EFNA 2IDLA 2B0GA 3ZTRA 4DV1J 3W64A 2ZNYA 3O44A 1VFJA 1Q16B 3PR4A 2CQ0A 2BMBA 4I2QA 3HLUA 1U49A 5IM0B 1TTHB 4G1PA 2VOOA 1F3FA 5HATA 3VVUA 3D2PA 5ADZA 3OL8A 5SZTA 4UOCA 4DG1A 4ID8A 4CH0S 1RT6A 5CHCB 3PJWA 3K5PA 5LMNF 4JXRA 1AXQA 2P6SA 4G6VB 4KLVA 1T8EA 3KR4A 2XEXA 3N9UC 3ZJ0A 2LCWA 2M0GB 1YZ6A 4ZN3A 4KLWA 3MF5A 1JJ2R 2Z2MA 1Z8XA 2J8AA 4OMEA 4JI6J 4DEZA 1YJVA 1S79A 4C8KA 4CNYA 3HVTA 2FVQA 4PG6A 2DR7A 4Z7YA 2XMUA 2VOPA 4XNHB 3B3SA 5LSOA 1FRKA 4FF4A 5J2PB 2GMHA 2DGUA 3VZIA 4HH0A 2GIRA 3MMBB 4ED1A 4CO2A 4F0YA 2GAHC 1RO5A 2GHWA 4ZX9A 2ZW7A 4C2ZA 4X4NA 4ZVFA 2MY7A 4ZN1A 4R0JA 2R7QA 1FNOA 4DNCA 2FCKA 4Y0FA 2KHCA 1FESA 5AG5A 1Y4ZB 3KJVA 1Z4RA 1LWCB 5L9XA 4PWDA 1N8RT 3CCES 2KM8C 2GFFA 4WU3A 2AD9A 4NYZA 4L3NA 2XYPB 2VPYB 1R8CA 1LAPA 2QECA 3H2UB 2J7KA 1DTTA 4UOGA 4CRZB 4MY3A 2MQNA 3PEIA 3Q8UA 1FERA 1APSA 3Q8YA 2D1CA 4RR5A 4DV3F 2Z0GA 5ETMA 3A4TA 1PO6A 2QA4G 2CNOB 1WDTA 4JV5J 2H4YB 4CS0B 2R2SA 1XTZA 3LMSA 1KONA 2VD3A 4KSAA 4CI0B 2IA0A 3TZXA 2XWXA 1FKAF 1M4IA 1IGBA 3KXDA 5DDPC 3ENAA 4KSFA 1S1TA 3BN7A 5HMZA 1GAOA 4AL6A 2R7HA 4RBUA 2CJAA 4KSIA 1HQEB 3WC5A 2RU9A 3WHIA 3J81Y 1PBUA 2AYEA 2D4OA 4Y00A 2ZD1B 3DDNA 2E1CA 2LA6A 4Q38A 2VQEJ 2C3PA 4GXHA 2RU3A 4AB7A 2B4OA 2KYXA 4LVOP 1ULRA 1CBKA 3MM7B 4JI2J 1Q95G 2XZWA 4CYUB 4OZNA 2GE3A 2DVIA 4ZJLA 3EY5A 1HBOB 1PILA 1VHFA 3J80Y 2F5GA 1IBCB 3DRRB 5HMNA 4OYAA 4ED3A 4ZIVA 3CJRA 4UZCA 3TUPA 4FS2A 1NUEA 4J91A 4DFKA 1NU4A 5KFGA 1ZPVA 4QIEA 4M8LA 1LWFB 2HBZB 3B7IA 3M6UA 1P4NA 3D5MA 3BN4A 4ZJQA 3ENQA 3GPAA 3C2PA 2NSCA 1VGYA 3DDIA 2H5EA 4EU0A 5KG2A 1KZFA 1A9NB 2FS5A 5KT2A 3NG8A 2IL4A 5G21A 4UQTA 3MHYA 1AT1B 2IMWP 5J2MA 1S1VA 3M8QA 2CDQA 2E66A 3GCWP 3PCOB 3AXMA 4QPTA 4IUFA 1PC5A 2MYFA 3EO4A 4EMDA 4OYMA 1RT1B 2YNCA 2NSBA 1RK8A 2MKCA 4DL3A 1U6BA 4KC5A 5LSRA 1Y5LB 4EUVA 3TEGA 1NSKL 4Q7AA 5E41A 5GADI 2W8LA 5CH7B 3T5KA 1IKXB 4KE5A 1HD1A 1XJWB 1RLCL 4FF2A 3H8EA 2AZ1A 4J3GA 1F9HA 4B10A 1PIEA 2AU0A 2LP4A 1SJ4P 3POTB 1HI1A 4IG0B 1XF8A 4K2XA 3VAKA 3GSIA 2DCLA 1BQMB 3DGPA 3DRSA 1FCAA 2HAIA 4J9QA 3RJMB 2B5GA 3QFWA 2KM8B 2FL4A 4RN7A 3I4HX 3PO4A 1X5PA 3WBZA 4C2MA 4QQBA 2K3KA 5A0YA 4I4BA 2WZNA 4UTGA 2HLUA 4UY8T 1MROA 4F9UA 4BBYA 3TO8A 4B3MF 1UVNA 5F46A 4QWEA 1HPZB 2ZWPA 3FJUA 3DM2B 2AEMA 4C11A 1L5UA 1IR2A 3W2WB 3T1YJ 3MOJB 1BAVA 2WVEA 1R27B 1SIWB 1M90T 1NMEB 1JLBA 2IC3B 3Q8PB 3IG1B 3R5GA 4DQRA 2JZ5A 2MZJA 3CDEA 1S57A 2F5IA 3KLEB 4YWYA 1DTDA 3M6XA 3QT6A 4Y49C 3U02A 3DLGA 2Z3LA 3QAEA 3NGKA 4ID5A 2QC3A 3V6HA 1S0OA 5HMWA 1HARA 4U8YA 2QLWA 4FYVB 4KPYA 2GREA 3ZC4A 1Q8IA 1SH0A 2BL1A 5ISVA 1PAUB 4DR7F 2GQCA 3UN3A 2MLYA 2F4FA 4OYZA 3CCLS 2B8PA 1Q7LB 3I55S 2AKWB 3RTVA 2WHOA 1RT5B 2ARHA 1UPPA 1N32J 2WONA 1RTQA 4HT5A 1FRXA 4PCQA 2C42A 1ACMB 4NSQA 2IM0A 1REVB 4M3SA 4NLOA 2K7KA 4EBEA 2ZVSA 4GO5X 4DSIA 2O1PA 4A32A 4DV3J 3DYAB 3FGVA 4CLZA 3B4MA 5BR8J 5E3AA 1RQ0A 4WKYA 5LRJA 5LXYA 3IS9A 3MAQA 4C7QA 3DLKA 4DV4F 2BQUA 1GTHA 1EIYB 1JLBB 2IC3A 3IRXB 4C11B 3SQGA 5HANA 3L4BC 2KRBA 2CQ3A 5B08A 2YTCA 2YPZA 3MR6A 2APOA 2X3GA 3P4UB 3A8KA 1N6QB 2CPHA 3KFWX 2NREA 4NGRA 3SQOP 2VC1A 4C9DA 3PEJA 5CNPA 5M2PA 2XY5A 2BE2B 2OPSB 2P6TA 5KFDA 3IBFB 1DFDA 1SBRA 1M5HA 4PUOA 3L3CA 4W4MA 2HGNA 5C82A 1HHTP 3CZXA 4ZHRA 2XMWA 4UCMA 2WONB 3BQ0A 3POTA 3IWXA 3D0HE 1OBRA 1ZZFA 4LJMA 1FXRA 3MPYA 3UNYA 4XO0A 5SUHA 1YK9A 2QVPA 2JDJA 3K0JA 5F9LA 5H9FK 3H5YA 1IOIA 2FVGA 3PTWA 3NEKA 3DKDA 1S77D 1N52B 2ZZTA 3QATA 1R31A 3PO5A 2J9DE 3PDNA 3HKZD 3RW6A 4JWPA 2YKNB 2XGQA 1KD1T 1XNQJ 1RWPB 5LOQA 5L38A 1OJ4A 7AT1B 5H86A 3FB3A 4J9SA 3HPOA 3FBBA 4KFBB 4FXVA 5JH9A 1SL1A 2C1CA 4JI4J 3CUNA 3G8TA 4KB7A 1N5TA 4J9MA 2FVPA 2MKIA 4NF1A 2V4QA 2Z3MA 1KQSR 2CQ2A 2OZGA 2OD6A 4GKJF 1VIOA 2H1YA 4ED7A 4YN3B 3OSPA 1FHTA 4WJBA 3FVLA 4F8ZA 1SUQB 2JC0A 3QQCD 2XYHB 4OMFG 2W9CA 4M6GA 4UIAA 4R9MA 2DGSA 4DWIA 3CJ3A 1W2IA 1M1KT 2IA6A 3IR5B 5K8NA 2HNZA 4W9YA 4ETZA 2Z58B 4ED5A 3DFEA 3FIXA 1ZM4A 3W5ZA 1XJOA 4RU2A 1WF0A 2CQPA 2XLKA 4MAKA 3BJ8A 4AVAA 1NCLA 4EYHB 3IWLA 5EGYA 3ZTOA 4WE1A 4ZOSA 4ZP8A 2OZUA 2VL1A 2M7SA 1RTIB 1U2CA 2QL7B 2C2MB 4XPLA 1IVZA 1RT1A 4M5LA 5L1JA 1VBYA 1Y00A 4IOBA 4RL1A 4USUA 2EBEA 1R3NA 2RILA 3JQMA 3UVJB 3CJ8A 2HZCA 1X4AA 1S7FA 4JI0F 5FLXU 4Q43A 1FTRA 3CF5Q 3RBDA 4Z2XA 2AZ3A 4V1Ak 1MWQA 3WC6A 1XIXA 4PYDA 5KG6A 3R3TA 3M9NB 2HRUA 4FKYA 4I2PA 1RTZA 4OJ1A 5D4NA 3EJMA 2BDPA 1YBAA 4GVBB 1VQMS 5HO4A 2KI2A 3D0GE 4FF3A 3SFUA 3IIBA 2VZ9A 1KKHA 2LU1A 2V63A 3R9LA 4LQ6A 1XR6A 4C7IA 1TF8A 4AQYF 2HQ3A 4NLGA 5IV0A 1J27A 4X84A 3FQLA 4TU7A 2PR1A 2QA2A 1BD6A 4JYWA 4RUBA 4WFBQ 4I7FB 1RACB 1U24A 3AXKA 1JWWA 1S4FA 4BS2A 2BZ2A 3FCWA 4KAIA 1QMUA 3MOZA 3D67A 5GMEA 1SQHA 2ZENA 4MRIA 3CPXA 4LIRA 1N48A 2G3AA 2IQ6A 4J37A 4X4TA 5KTAA 2D3UA 4DR1F 5CAAA 3E2EA 5A6PA 2AJ4A 4OHYA 4MHDA 3H5SA 3ITHA 1RU2A 4XPDB 2BKOA 2NS1B 3KK3A 2YH0A 1JLGB 4BWMA 4AVCA 3CMES 1HD0A 1YZ7A 1RCXB 4Y2KA 1GXUA 3MAAA 1VC6A 3P6YC 4FUUA 1GQEA 4F0MA 2ADCA 4HR2A 2NZCA 1ZH5A 4RW4A 4U7UK 2XEJA 3FKBA 8ATCB 2NMTA 3LAKA 1N36F 4ZI6A 2EC2A 1WDDA 1RB0A 1IKYB 1IKYA 5EX0A 1RAOA 3PP9A 2UZAA 4Y2IA 2HSEB 2VG7B 3MXHP 2X7BA 3DOMB 3W3SA 2FQQB 2P6GA 2KXFA 1RE1B 3BZQA 3VH9A 2W24A 1X5TA 1EETA 2KB2A 2EKNA 4KT0C 2CZ9A 4DL5A 4HDHA 5LJ3Y 2PO4A 4ZLPA 5L8RC 4ECTA 4HH1A 1KFSA 1RYSA 1URRA 3ITHB 1OQ3A 1S7HA 2XMKA 4O23A 4IRKA 3CGIA 4LX9A 1RZMA 2HYIB 4MIAA 1CULA 2HQCA 4NLUA 5L46A 4DQSA 3TP2A 4YHHF 5KFFA 2FC8A 3PYGA 4NEYA 4PKDB 4ZA1A 4K4ZA 4DF8A 2BRKA 3NGDA 4IQMA 2M4MA 1X4FA 5E3CA 3NP5A 1RWXB 2YNCC 4DBQA 3MAAB 5JXSA 3K5OA 3OTCA 3GV8B 1B70B 1FFSB 4KHMA 4L72B 4K4YA 5KTDA 2A3JA 4BC9A 4QR1A 4DG1B 1S1UB 4G3IA 2ZEFA 3UR0A 3OSNA 4DX5A 3M4XA 3W65A 1G1XA 4DV6J 3KGQA 1UA1A 1R0AB 3M8SA 1OWXA 3EZ5A 1TP7A 2DNOA 1FK9A 2XG8A 1UJ5A 4ZYQA 2YX4A 1WHWA 2JWNA 1H6KX 4LF7F 2EFQA 1BUXA 1Q7YT 3FJ2A 4RW7A 3E0KA 4JI1J 3HVAA 1S0VA 2OPQB 4J9LA 4WP9A 5A8WB 1SKSA 4HL9A 2RUGA 3RR8A 4NA3A 5F8IA 5A2QY 5BJRA 1C2PA 4O3PA 1P1TA 3EGZA 3G86A 3BH7B 3MGJA 2W9CB 4DJBA 5HROB 1VLOA 1HWLA 1ZM9A 3FSXA 2FJVA 2B4UA 3HFZB 5G1ZA 4EMEA 1ZM3A 4PXEA 4LR8A 2LVWA 3CJTA 3GLJA 2J9EA 1ZG8A 4LBIA 1RTIA 4Q8FA 1J5EF 1U26A 4GVBA 2EK8A 4X4OA 4ZCKA 4B6ZA 5JGFA 3RB0A 4OLPA 2P9EA 2CG8A 1SH3A 3I9V9 2JDDA 1VQSA 2KH9A 1HPZA 4DV5F 4OAEA 2YXLA 3TAMA 1B4SA 2HHWA 3ZTQA 4QIGA 3GYXB 1CJTA 4ZPWR 1KEKA 4F4YA 4NGQA 2E5LJ 2Q6CA 2GFQA 1X9WA 4M63A 3CDXA 3CCMS 2V77A 3GSDA 3Q86A 3W6XA 1YJ9S 3IM8A 2HHVA 1Z1ZA 2AJ2A 4Q44A 2C3MA 3VAIA 1VBZA 3FMCA 3HSJA 5F47A 4QBJA 2ATRA 2PE8A 3BR9A 3TZYA 1FRLA 3I9ZA 3MM9A 1N32F 4F0KA 3PFOA 4AL7A 4X62J 8RUCA 2WRMA 3KHHA 2RQKA 2PSZA 1KTQA 3QGHA 4B5OA 3KNAA 2Z11A 2ZDOA 4B3OA 3D54A 3GIJA 2XEFA 5AXNA 5ETQA 2F1FA 4RW9A 2W8KA 3CMQA 2OGUA 3B4DA 1RGVA 4NA1A 3GR1A 2Y1RI 2UXDJ 4ECWA 3MM6A 1BOBA 5IT9Y 3PJ9A 5FD1A 1SQFA 1N34J 3VZHA 3GIRA 1R8PA 2K7JA 4OI4A 4RBTA 1N5YB 2VDHA 1NK8A 4KGKA 5KOWA 1VQNS 3K7RA 1LV5A 1XOVA 2G9DA 1UW4A 2BE9B 3FEZA 2DB1A 3QRRA 1RTHB 4UF4A 5EHHA 3T5HA 4F6AA 3IAM9 3WZ0A 4U67Q 2G3TA 4MFZA 1R57A 2VUGA 4MFQA 2J8RA 4P9SA 3W61A 2W2OP 4A37A 4OC5A 3DRPB 4PXBA 1IBMJ 3M6WA 1AMPA 4DPXA 1YW6A 1GXLA 2MQLA 3HX9A 2XEGA 3V81B 2RRAA 5F8LA 1HNWJ 2OJ3A 2UXBJ 3RRGA 3G8QA 1Y7EA 1LWXA 4S0MA 4TQRA 4DV7F 2ZKTA 2KCWA 1B6BA 3NCRA 5U47A 2ZEJA 5M2RA 1TL1B 1NB7A 5HJYA 2OD4A 1DY3A 5L1LA 4JI6F 2VA2A 4DX8H 4ZY2A 1GEHA 5EWEA 2CNKB 4AL5A 3N01A 1Q7LA 4B9TA 1QM9A 4OYIA 3IWNC 2DR9A 1L3KA 4PUOB 4ZVQB 4J9RA 1WC1A 1YSJA 3CJ5A 3T9ZA 1VYAA 4X5KA 1IICA 1YREA 4HVZA 3QAHA 3JTKA 4J90A 4LUBA 2Q6BA 1LW2A 2VZZA 1VC0A 1S7LA 1VBKA 1XN9A 1KBRA 2DR6A 4M85A 3PNIA 2DGTA 3LP2B 3GG0A 4K4VA 2J0QD 4U9ZA 4CLSA 1FA0A 1M4LA 2I5JB 5F8GA 3KJFB 3QRPA 3GU0A 4NMXA 2B4BA 2ZH3A 4MCQA 1NAQA 5GAHU 3LWUA 4NLYA 1HWUA 3IP0A 1Q2CA 4WZQA 5E0OA 1HHSA 3GILA 4M5KA 2CPXA 2DR8A 4MHNA 1S49A 3DN9A 4OZ5A 1MROB 1TU0B 3QZ8A 5HN0A 2XMJA 2QMXA 1TMMA 2R8KA 2WOMB 2XMVA 1LFWA 2D7SA 4N7TA 3M30B 4JJXA 3FSYA 2OMOA 3R2CJ 1EP4B 2VU5A 2DBBA 5D4LA 1AUDA 2IFXA 5DDOC 1FY7A 2YKNA 1S6QB 2CFXA 2VQYA 1K44A 4DS4A 1IBKF 2BW2A 1LW0A 4K2JA 4M5DA 4DPYA 3DOKB 1UZDA 1IUJA 2GQ2A 4EBDA 4BDPA 2AJ6A 3MMJA 2V8GA 3LD2A 2CA9A 3KHGA 2RJZA 4FBEA 3H5XA 4NPOA 2CY2A 2QYVA 3HVTB 1LANA 1RXTA 3W8PA 1SQGA 2Z3OA 4C3KA 2HQGA 4U7UD 3MEDB 3A13A 3NNHA 4P2FA 3CXSA 3PGPA 4DL2A 1GTEA 2V6AA 2IM1A 4G65A 1N4LA 5ETTA 3OW2R 4GMKA 1D9FA 1ZO0A 2LQJA 3CXCR 4EZ6A 2EFGA 1H2UX 1WELA 2MZQA 2UVUA 2AJ1A 2E7WA 3A8IA 4QU7A 2RUSA 3DGPB 3CXPA 3V38A 3PACA 4JBCA 1XMTA 1JK9B 4J9OA 2R7SA 1NB2A 1RWWB 4E8OA 4FYYB 3SXLA 1S7NA 2RDDA 1RLDA 3SJFA 1I3OB 1A6LA 1SL0A 1A7GE 3CDWA 5G20A 1MJBA 3C8YA 1YW4A 4USMA 2OAUA 2QV6A 1KUVA 4C68A 4FF1A 1PGZA 3R6LB 4QYZK 2VJUA 3JQKA 2J6UA 3EGVA 5T14A 1GT8A 3W62A 3QGIA 4AE5A 2HNYB 3TOAA 2FB0A 5J1EA 4HPSA 3PIOQ 2ABZA 1PJ5A 5LMUF 2B4PA 3JYTA 1JLGA 5I0CA 4RWXA 2PC1A 3SDEA 4K7QA 3CC4S 3H5ZA 2ZOMA 2RD5C 2YH1A 3QZ7A 3JSRA 2Z3KA 2DNMA 2RRNA 4OI3A 2KFZA 1IR1A 2IJFA 1UCNA 2BRLA 3I0RA 1AFJA 3GYNA 1JXLA 3A8EA 3TYTA 3OTOF 1URNA 2EFPA 3Q23A 1LEOA 1GMWA 1LK7A 1YX2A 3KWMA 3IU1A 3KHZA 4B11A 2YWWA 1QTMA 3EXNA 2AQ4A 4R8FA 2NXCA 1GX5A 1X0PA 3LF0A 3PW4A 4GKKJ 2C2RA 4FPRA 3S6FA 2W4CA 1LFPA 1Q5VA 2W2QP 3V81A 1QSLA 4ILMA 3NS5A 4G1QA 3B8GA 3U1MA 1W25A 2LQ8A 4OI2A 2QSWA 3A3PB 1X5OA 4LIWA 4AFFA 4CO3A 3UNGC 2JBJA 4LBPA 2RS2A 4JXQA 4JI7F 5A27A 2HK2A 2ZH2A 2IHR1 5DWMA 4DZ6A 4LF8J 3NS7B 1S9EB 3OTOJ 1X12A 3TRGA 2J0WA 1E6YB 3H98A 5L1IA 2K5TA 1RTHA 4P74A 4P2SA 3B54A 2E5IA 3R1KA 3M2UA 5KFBA 3EM1A 3V6DA 3JSMB 4ERDA 2COLA 3EVMA 2KXHA 4ETXA 2C6CA 4UY85 4XPCA 3NWGA 4TU9A 1NJZA 1YMEA 3FX6A 4LRFA 3TI0A 4O44A 2FLOA 4X8IA 2HW3A 4K50A 2WTFA 3VAJA 2XSJB 3FVYA 3P8BB 5GADU 2PC6A 4TY9A 1S99A 4NYOA 4Y49B 4KUAA 3I1UA 2E44A 2MSSA 4RJVA 4IFYB 1SJ1A 4JUZA 1C4CA 5DLFA 2AYGA 2G0IA 1Q4RA 3VAMA 2H65B 3R5AA 1XBUA 1YBUA 2VG5B 5K14A 2NCKL 5KFQA 1IU8A 2D9PA 2FPHX 5HLFA 3EDQB 2R1IA 5GAHI 1IWAA 3LP0A 3A1YG 1IKXA 4RW8B 3T1YF 4NZ6A 2FY8A 1D9AA 3SIPB 4ZHRB 1KHVA 1UKUA 4E0AA 1LQ9A 2M70A 4DZDA 4DL7A 4DYOA 3OR1B 3MR5A 3VVTA 2YBVA 3D66A 4ES2A 1NRKA 4J9KA 3ZZUA 2UUAJ 1H38A 4A38A 1S9GB 2Y0MA 1JWQA 1SV5A 3RB3A 1WEYA 1U1NA 4OJGA 4CGOA 4A8YA 2GCFA 3QBCA 4OJ3A 3AT1B 3SI1A 3M8QB 1IR0A 4WFZA 2HVZA 3OVSA 3K5MA 4H54A 4KSEB 1IN0A 1PYTB 3DHWC 3BYRA 1TUWA 2F8HA 1RA7A 4QVTA 1HW9A 4DQPA 1TFWA 1N88A 4DHVA 1K73T 2K1RA 4OQJA 3KK1B 2NYHA 2MY8A 3HULA 1WORA 2Q0YA 4ZGYB 5DG9A 2JEIA 1NPPA 2IJRA 4O4GB 3GFHA 1RHKB 2Z4PA 1I1DA 3M9MB 4KR0B 1PYOB 4LT6A 2HC9A 3DMJA 4L74A 2ZVIA 3MM8B 2JEFA 1N54B 2FZGB 2JLEA 4FAIA 3M2UB 1HNZJ 1RT4A 1MMNA 2A4NA 2FUG9 4FD5A 1U1OA 3D7GA 2ZEHA 4OI1A 1HBOA 4KORA 1KLMA 1NJWA 4L73A 2B58A 5ETNA 2V50A 1C1CB 5E96A 1T3NA 3H7HB 1YVOA 3ISXA 3FUYA 3KUHA 2MLXA 4EVYA 4M5NA 1YX0A 4ER8A 2IPOB 3OVBA 1WHYA 3W5XA 2ZM6F 4QW8A 3QSYB 1U1QA 1UAWA 3H59A 2V34A 2AJQA 1O51A 4CTAA 1SC3B 4J9NA 3MEGA 1F0XA 2JLGA 5G0RA 2QJ8A 3SI8A 5KG3A 2ZW4A 3F41A 4IF5A 5EN1A 1EB0A 4CNZA 4IFYA 3I3GA 3D68A 1S6PA 1W26A 2JFDA 2O28A 4F3MA 5IM0A 1UVKA 4FXWA 3ULHA 2XY7A 3DM2A 4DL0C 5I42B 1BGXT 3I31A 3KR5A 3KKWA 2DHHA 2WSAA 1QSNA 3NNCA 1YLXA 3MUMP 4OJHA 1OY9A 3TFYA 2KFNA 1L0CA 3KLVA 1WUUA 5B0EA 1WEZA 2W9BB 4MFBA 4JI2F 4ZLLA 2KVQE 4LF9F 4UW2A 4NYPA 3DLEA 5HQ8A 4DSLA 4USIA 5ETOA 2BJ8A 1HNWF 2XLJA 2V4RA 2VZYA 2OH1A 5CD4H 5E3PA 4DR3F 3OUYB 2GLJA 1DQ9A 5G0RB 5F0WA 2RQ4A 3L7PA 3SSRA 5L9NA 3GIIA 1K9MT 3DXSX 1UWAA 1NJXA 4NLQA 4CLKA 4NGSA 4P4FA 4P45A 1N5SA 2VJVA 2ZHAA 1N56A 5CABA 2ALZA 4LBHA 5JM6A 4CH7A 1TK5A 4I56A 2UVRA 3ETMA 1XMQJ 3HVWA 4ZMMA 4K5RA 3Q8VA 3GJRB 5L39A 2NR0A 5E2QA 5E33A 4U6PA 2R8IA 3JRUA 2I0XA 2XNQA 1Q0NA 2DR5A 4RLEA 4FNHA 4RWWA 2W7AA 4IYQA 3GJTB 4NWBA 5B0FA 4DF4A 3D6FB 3RBZA 3V4IA 2CJ9A 2HQIA 4IO9Q 3PIPQ 4DV0J 1J5OB 5BYRA 1UVMA 4Q2MA 3TO9A 4R5PB 4C0BA 1U09A 5A0YB 2YGWA 2NXUA 3HHDA 3AB4B 4ZLJA 2HNYA 4DFMA 3CTRA 4QUSA 1QSYA 2C3YA 1KSPA 3PRTA 4F7VA 5DG8A 1D8ZA 4QIWD 3FBEA 4RKUC 4UCPA 2RAQA 4ILLA 1WOPA 2VXKA 2B6AA 3AQPA 2ZJPQ 1PYTA 2V8DA 2PDAA 3QB8A 5F0UA 3MAHA 2KT3A 1HNXF 1NE9A 2AP6A 3IR7B 2XO6A 2AW0A 3NCPA 1U1KA 4RBVA 2RQMA 4JI5F 1S72S 2YNDA 4IRDA 2V2KA 1GK8A 3IM9A 3MD1A 1DARA 2HQYA 5E3RA 4DPUA 3OR1A 4C3MA 3FBFA 4LFCJ 2D69A 2YNHA 4ZCIA 2WW8A 3O3LA 2WUUA 1ZM2A 1HQ2A 3EXYA 3KLIB 1V3SA 3TCVA 3NAHA 2PEBA 4W92B 4ED2A 2QA4S 3CD7A 2GC8A 3D7HA 3Q89A 1QVFR 4CYNA 2IJZA 3M8RA 5KOXA 3HK2A 3GIUA 4QIFA 2PN6A 4O3OA 3AY0A 4K59A 3U1LA 3BB5A 3TANA 1FE4A 1NNDA 3M1VB 4OX8A 3UW1A 1S6OA 4HTIA 2FJBB 2ZKUA 5HBMB 1T9VA 4C0OC 2GGPA 4KYZA 5C24B 4N56A 3MTJA 1YVFA 1CC8A 2YKAA 3LGMA 3BV8A 3BM7A 4Q36A 4CTAB 4MK9A 1Z4UA 1GXTA 4OC4A 1NLKL 1WEXA 4ED6A 1DLOA 4OC2A 4DOZA 4TWEA 2DPJA 4JOUA 5DGBA 2ZH4A 2XCAA 5KFXA 1HQUA 2DCUB 1VBXA 2EVNA 3CD6S 1X8DA 1S0NA 1M4GA 4K30A 2PI5A 2Y8WA 3Q8RB 4LF9J 5LM7E 2HIQA 3BPDA 4MMOA 2MJUA 3EFAA 3LO3A 2ZE2A 5KAKA 4URGA 2Q7SA 3IO1A 4HHJA 3KJNB 2ZH9A 4GRSA 3MDFA 4R76A 3SJXA 1WKKA 1VHIA 1XNRF 1P0HA 3DHXA 4FNIA 2CG4A 2BA9A 1RAHB 4FYDA 3PYEA 4N41A 3CVKA 4CDIA 3FEYB 1VS3A 4RI1A 4WFXA 3FNNA 3PB4X 3SCJE 2DRBA 3VGUA 1PYSB 2W2NP 2DH8A 3CJQA 2V4JB 3HFVA 2QE5A 4ZS6A 1KP6A 1WWZA 3FRZA 4P75A 2RFHA 5DDQC 3T1HJ 2CJXB 1TELA 2ZOGA 1Z2LA 3PXGa 4NMLA 2ASYA 3ZZRA 2PFFB 3NKYA 2DXQA 2FJDB 3CCSS 2AGQA 2OPPA 1YHQS 4ZX8A 4FN5A 1NSQA 4KUBA 1EE3P 3CPAA 2RRBA 1KS2A 1ZA2B 2REEA 1RDRA 1CC7A 2XNRA 2CPIA 1FDDA 4HNYB 2WW4A 1FDNA 1QLNA 4DUTA 2HHSA 3CD5A 3PYDA 1H72C 1S9FA 1CJVB 5B0CA 3SXOA 3V4IB 3T90A 3F0NA 4A47A 3CDBA 1OO0B 3C6TA 5KFIA 2U1AA 2VB6A 4ZP7A 2O67A 3MWBA 3F73A 4HHUA 1XQIA 1FT8A 4O0NA 4K0KF 3RR7A 2QFIA 1I6JA 5CZXA 1SKUB 4JI5J 1VLYA 4WZMA 4KV8A 3OJUA 4HHHA 4RS2A 1YJTA 2DEJA 1F5CA 1Q2DA 2P6EA 3BJ7A 2XZTB 4LFCF 4ZY1A 1C1BB 2ZDPA 3A12A 3SFGA 1XFOA 2R7VA 3N6LA 1VQPS 3QNVA 3ZZYA 1LXJA 2ZJRQ 1YR0A 1M44A 3RNZA 4USWA 1RTJA 3D6HB 4QBUA 1EX8A 1RT6B 2F65A 2P5VA 3KTQA 3U1NA 4PQUB 2OFGX 4DL6A 3QYYA 4YY3F 1ELMP 1VC5A 4QR2A 3W2VB 1J4JA 3FEDA 3IGVA 1VQ8S 4LMZA 5LL6d 4XK8C 2RHQB 4NL5A 5DZ6A 3DSBA 1M5VC 1CVJA 4TY8A 3TQEA 2ZBRA 1ICEB 4KO0B 2XS5A 4O3SA 4WWVA 4PK3A 5KFMA 3T9YA 3PJXA 3A3OB 1UVIA 4C2XA 3OR2A 5D29A 2JEGA 4HKFA 4TXSA 1QDUB 3GG1A 2Z10A 2EKYA 4JI0J 1TVRA 2CQCA 4XPEA 1RABB 1R8AA 1SL2A 2OOTA 2RIJA 2ZW6A 4A8FA 1TL7A 4OADA 5BR8F 2P0WA 2XSFA 2W4DA 2P9CA 1VQYA 3QAYA 2HBYB 2R7WA 2WB1D 2I3CA 2AGOA 3I96A 7FD1A 3IWGA 2KFYA 1UWBA 2I38A 1NPKA 3R27A 4NFRA 2BR0A 3DNSA 2F8MA 3D6MB 2W4PA 3I0SA 2J9DA 2R2UA 1KRPA 4CLYA 3EGWB 4MFLA 4B02A 4XDCA 1Q8BA 4DUYF 4C8OA 3DYAA 4DSFA 3BEGB 4DV5J 1NH7A 4OX9J 4NGNA 3QT5A 1QAYA 1TVRB 2YWKA 3PB9X 2FTRA 3ZZPA 1CJUA 2QL5B 4CGPA 4DV2F 2E5LF 3NLCA 1QSTA 4UOHA 4NE9C 5C42B 5KFOA 2UXDF 3R96A 2LFVA 1U1MA 1TKTB 4N8OA 1JLEA 4USJC 3CJ0A 3E8OA 4JI4F 4ZVOB 4X62F 3WX8A 3UPFA 5A8KA 3EVOA 3OFEA 1FNXH 1RADB 4ED4A 4RW4B 2DNRA 4JZ0A 5E7OB 3QRQA 3SZ2A 3MMCA 3TC8A 2G2ZA 2NUUG 3NAIA 1MJAA 3CCVS 1QE1A 2Z3NA 1S6QA 3MD3A 1I12A 2DNGA 1HBMA 4OX7A 2ZEGA 3KLEA 4FD4A 3UDCA 3HHLC 4IG3A 4LSLB 1K0TA 2ALYB 4NGPA 5AE1A 1UFKA 4OI6A 4X65J 5MAOA 3AA8A 4OZ2A 2B9XA 5HP1A 1VIXA 4B3SJ 4PAAA 3L09A 3E3XA 2ZE2B 3OXGA 4LF5F 1M1HA 1RCOB 4Y65A 4Q0BA 2JEVA 4KOVA 2N4DA 1CJKB 3TJAA 4DQQA 3VATA 4MCSA 2ILYA 2EPIA 3D28A 3K5NA 2JEJA 2N7YA 2B9WA 4B12A 5C88A 1L3TA 3GR0A 4YEAA 4YP3A 1N5YA 5CXTA 2GMLA 1EP4A 4ONUA 2PDOA 2ATLA 2UXCF 4WFYA 1F9FA 3ZO7A 2NLWA 3NGTA 2WOMA 2UXCJ 1AFIA 4KS9A 3K58A 2OZHA 5HLFB 4NOHA 2YX1A 1C0UA 1RWMB 1AA1B 4NI2B 4PQAA 2MQMA 2PI4A 3JQJA 4WPAA 4RU9A 2PJ2A 2CPFA 4OIWA 2GVZB 4IH7A 1XEBA 2RKIA 1UFLA 4Q45A 1H98A 5L1KA 2V8VA 4A48A 4EK2A 3T6JA 4ZPCA 4LREA 2BQ3A 1ITPA 4HYKA 4X64J 1Y0HA 3BBFA 2PJ4A 3CCWA 1X10A 3G6VA 4LF4J 1GH8A 2GO9A 5LRKA 3WR7A 3VAFA 4W98A 4RNNA 1WTFA 5KFZA 4RPFA 1S1TB 2VBXA 4A33A 5F41A 4KVOE 2EG1A 2VFTA 3C3LA 1TK8A 3SEOA 2ZHOA 2CADA 3NFZA 2K2PA 1UWYA 4LSNA 3RYLA 4WXOA 1T05B 3KJQB 3FF3A 1DJ0A 5HL7Q 4CT8A 2I5JA 4ZITA 4KH1B 2QT7A 4A95A 2CWXA 3BH6B 1T11A 5EMIA 4F04B 5JUMA 2R8VA 1J2VA 3VALA 1LKZA 5B0DA 4PEOA 4USHA 2GNKA 4RW7B 5D15A 2XMMA 3PB6X 1S7IA 4C0HA 3TARA 4F25A 2HBQB 1TKJA 2X1FA 3KHRA 4KVXA 3DRPA 4IUSA 3MM7A 4DR5F 4YB7A 3H2LA 4OZ1A 4N77A 4ES1A 3BGRA 4I68A 4OIXA 4LF4F 6AT1B 2PD1A 2J6TA 1S1UA 3BO2A 3JAMU 3MMAA 2HWTA 1V0CA 1VQOS 4R3LA 3GFYA 3FCVA 4LFAF 2KZZA 5K8OA 2HAFA 3AH6A 2QX0A 3PY8A 1YJRA 4A8SA 2EI5A 3D3BJ 4YB5A 2R7UA 5FDLA 1IKWA 2V9KA 4PPDA 4ELVA 1U0HA 3H20A 4AG9A 1CQMA 4A2ZA 1ZLIA 4Y6IA 3F44A 4I64A 4ZIWA 4X3RA 2MKSA 1TZ0A 2OEMA 4ANEA 2V0NA 1YIJS 3L2NA 2EXUA 4KGXB 2QSFA 3OUYA 3TA1A 2JLMA 4MIBA 3K17A 4I6AA 3R1HA 1X7VA 1FWKA 1MMDA 5D0RA 3IRWP 1U2FA 2Y1LB 3RG6A 4ZVTB 1S12A 1BY9A 3UN2A 1IQTA 5HMYA 2CPJA 5D0GA 2O3DA 4F26A 4PSWA 2CF4A 3EYZA 3LALA 1SKWA 4F02A 3N7ZA 2BSWA 4IFVB 2QRRA 5KFPA 1TKHA 1F60B 4K4UA 1NK5A 3IWEA 3KLGB 3BSOA 2VG7A 3VCDA 4CLWA 4FD6A 2HS0A 5K8PA 3J7YU 3Q24A 1IQZA 2EK6A 2BANA 4MCPA 4RUHA 5J8FA 1SCJB 1RAEB 3SI0A 1RAJA 2MKJA 4ANCA 2ZH8A 3LP1A 1JX4A 2XEIA 1TUVA 1TKDA 3F5BA 5AXLA 1RJJA 3DLKB 4P73A 4LF7J 4A31A 2CXAA 4FYXB 1FDAA 3KUGA 2J8SA 2HURA 3H5UA 1EQ0A 4MHPA 2MDAA 3BO4A 4LQGA 4DR4F 4DV7J 4FBTA 1IOFA 3NH4A 5KT4A 3GCXP 4C8ZA 3TUJC 4ECXA 1R8BA 2O01C 1V9OA 3I32A 2AEJA 1RT7B 3W9HA 5AJ3F 3S6KA 3NY0A 5E5NA 2J9AA 3PYFA 3FEEA 1H2TZ 3NH8A 3QMQA 4M95A 3F8KA 1N5VA 3ONQA 2AJFE 5IT4A 3GP9A 1FJGF 1UJ4A 1HYSA 3QJPA 4LVNP 1HDQA 4WFAQ 1NHUA 1WI6A 2UV8G 4LR7A 3J7ZT 4WIQA 4ED0A 4WK1A 2A2CA 3M8ZA 2W9BA 2ASDA 3IA0A 3AJDA 4FDFA 5FLXY 2XO7A 4BBHA 5IV4A 2CQ4A 3KOAA 4QZVB 3S6HA 2PQ8A 1WC5A 2ADBA 2BV3A 1N6QA 2VH7A 3V7ZA 3RYOA 2NXNA 1FTCA 2DISA 4OKOA 2JOQA 2AFSA 2M52A 3BDEA 1TQLA 4FXDA 5K5MA 4X2BA 2GVZA 1YG0A 1DTQA 3WC0A 2JEWA 1ZPWX 2WB4A 4YR0A 3QLHB 1CM0A 2XQCA 1DAXA 3OBIA 1D3WA 5J1NA 4OC0A 3D7SB 2OTLS 3T6BA 5B0BA 4DJLA 1VCTA 2GO8A 3VHQA 4CLTA 4H4MB 3O1LA 4FYWB 4IOAQ 4FVMA 2RNEA 2YQ1A 5D77A 3BGUA 2Y0BB 1BPNA 4QW9A 2PMWA 1WJ9A 1YQHA 3EPIA 2L08A 1R0CB 2V94A 3QJLA 3LP0B 4UUXA 3OT9A 4NZ0A 4DUYJ 1UW9A 1HBUA 3GMGA 4Q0BB 2PMHA 1Q8LA 4UOFA 1ZG9A 4RNMA 4ZPBA 1SB6A 2FLLA 4Y28C 4M94A 1WC3A 1D9DA 1ZLHA 4P4JA 4CAWA 2AHOB 2MSTA 1JLQA 3CCRS 1WACA 4KGZB 2B51A 2Z56B 2DGQA 1D8YA 2LXFA 5KFHA 4P4BA 2PFDA 3TVKA 1LNQA 3CWJA 4NASA 4ID5B 2Z30B 2HQFA 3TW0A 4D3HA 4QWAA 3UD3P 4TYAA 1TKXA 3AQOA 3U7JA 3DLJA 1S60A 1P8GA 2FLNA 3LP1B 4DFPA 2DNZA 1VHSA 2IRXA 5A8KB 1REGX 1YWXA 3H4BA 2ROPA 4U5YA 2XTJP 2DHAA 4UZBA 2KG1A 3HT3A 1GMUA 3UI3A 2IM3A 1PSDA 2MHEA 2P8IA 2HFVA 5I3UB 1SV5B 4DR6J 5A6WA 2OH2A 4ECUA 4B13A 2GJ2A 1TMJA 3K59A 4K8RA 4PWWA 4O0IA 4DUZJ 4UEFA 3LP2A 4FP9A 2VFSA 1U0HB 4PABA 5EUHA 1IBLJ 2OO4A 3S9NA 2IIHA 2ZH5A 3FEXB 3DGVA 2WCXA 3KK3B 1LK5A 2C2EA 1NDCA 2K3IA 3M9OB 2E1MC 1WWHA 4C4WA 2MMYA 4KVME 3WQPA 1FVQA 5D4OA 2VBQA 3KHLA 4X4UA 3G71S 3NWRA 3C14B 2H54B 3CC7S 4AXVA 2FYXA 4MXUA 3RAQA 1TL4A 3H42A 3BGRB 3KNGA 2P6FA 1RA6A 2RB7A 1TXRA 1IY7A 3TE4A 2WVBA 1SC6A 1YLOA 3AJ1A 2FJXA 3R5BA 2GVDB 1KR4A 3HHLA 2PJ9A 2GHPA 3ET6A 2OSQA 2CUYA 1WSVA 4CAFA 1RBOB 2DEAA 4NCBA 1U0SA 3OR2B 2ACYA 2B7CB 1CLFA 4OV1A 5A8WA 2XC9A 3PKMA 2H5MA 3BGFA 3V6KA 5IB9A 1YJUA 3VARA 4PG5A 1JLCA 4B9UA 1NK9A 2VFVA 4FZVA 1IM4A 3SYZA 5KG4A 1S4EA 3ELHA 2GW8A 3UN5A 1ZYQA 2ZC4A 1LOKA 5BWAB 4EI2A 2H51B 2QIFA 3HCXA 2QIRA 1SJFA 4A8WA 2JBKA 1H74A 1UJ6A 2EC0A 1H2VZ 4ZDNA 4CRYB 3VGTA 4ED8A 3EUNA 2JLFA 1MU2A 2DITA 1LWCA 3G82B 2KZMA 3FSIA 1VK3A 5I3UA 1RTDB 2IRUA 4DU8A 2C22A 2R8JA 2HUZA 1KQGB 1H7WA 3G6XA 2RMLA 2B7BB 2LEBA 3ISNC 1N0UA 4HACB 3LAMA 5CZVA 4ZK7M 5HK4A 3M05A 2AFMA 2DT9A 4I1TA 2XI2A 3ZZTA 2BVZA 1TKXB