2V8HA

Crystal structure of mutant e159a of beta-alanine synthase from saccharomyces kluyveri in complex with its substrate n-carbamyl-beta- alanine
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
431
structure length
431
Chain Sequence
LSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNAEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGHQFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Yeast -Alanine Synthase Complexes Reveal the Mode of Substrate Binding and Large Scale Domain Closure Movements.
pubmed doi rcsb
source organism Saccharomyces kluyveri
molecule tags Hydrolase
molecule keywords BETA-ALANINE SYNTHASE
total genus 159
structure length 431
sequence length 431
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2007-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v8hA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2v8hA01
2ZEPA 4F9VA 4NGRA 3VH9A 3WC5A 3WC7A 1QQ9A 1BPNA 3H8GA 3LMSA 4IK2A 3PRTA 3FJUA 2OOTA 2Q51A 3I1UA 4TWEA 2F8HA 1LAPA 4A38A 5IB9A 2PIZA 4P45A 3FEDA 7CPAA 3FX6A 2QYVA 3FECA 3PBBA 4NGNA 4ZI6A 5HVFA 2BOAA 4ONWA 1M4LA 4EFDA 4ZX9A 4R76A 2AFXA 3S9MA 4A39A 4P4FA 3BHXA 2NSMA 2Q4ZA 1VHOA 1ELMP 2BCOA 4P44A 3NFZA 5LRJA 4ZX8A 1ZLIA 1HDQA 4O23A 2PJ6A 1CPXA 3RAMA 1JQGA 3CPXA 2EK9A 2XEFA 4B6ZA 3FF3A 3V38A 4EMEA 4KSIA 2V8GA 4P4DA 2V77A 3FH4A 2ZEHA 1XBUA 3BXMA 3IFEA 1OBRA 4OC3A 3PB9X 3GUXA 1RTQA 4F8ZA 3SJFA 2V8VA 3D7GA 4CPAA 4NJQA 2PJ8A 3PB6X 3KHZA 2VL1A 4MHYA 5K8OA 4ZY0A 3IEHA 4PXEA 3PB7X 3DLJA 2C6PA 3RZAA 1TF9A 1HEEA 2DEAA 2JBJA 4TNUA 1TKJA 3KZWA 3VATA 2PJ2A 1PCAA 3KL9A 3SI0A 5CPAA 2J9AA 2PE3A 5K8PA 5JH9A 4PQAA 3D4UA 2XEGA 3B35A 4NGSA 1XRYA 2V8DA 1KWMA 2ZEOA 3PFOA 1BAVA 3D7FA 3GB0A 2C6CA 1LANA 2AFSA 1ZLHA 3IO1A 3S9NA 3KASA 2PJ0A 3GLJA 3BI1A 5LRGA 1YLOA 2ZEMA 3K2KA 2JBKA 4UIAA 1Z8LA 1CG2A 2PJ4A 3MRUA 1GYTA 2GU2A 4OKOA 1TF8A 3RBUA 2PVWA 3NH5A 4ZY2A 4OP4A 3ISZA 4NFRA 4R7MA 1ARMA 2ZELA 2XEJA 1BPMA 3SI2A 2GREA 5K8NA 4MHNA 1FT7A 2PCUA 5LYLA 2GLJA 3SJXA 1VIXA 3WABA 3HUVA 2IMOA 5JGFA 4LQGA 4P4JA 5LYIA 2CIJA 3KI9A 3NH8A 3KHXA 4OC0A 3PB4X 4ZYQA 4MRIA 2CF4A 1HDUA 3NH4A 3V7ZA 4OC1A 3KR4A 3PBEA 5LYFA 2PJ1A 1R3NA 5D29A 2PJAA 6CPAA 2ANPA 3PEIA 2PVVA 1Q7LA 1FNOA 2BO9A 2NYQA 3D67A 3B7IA 1YSJA 1Z2LA 3H8EA 5HVGA 3N5FA 1CBXA 2Q43A 3VARA 4P10A 4P6YA 1DE4C 2ZENA 2O53A 4MCSA 1NSAA 3FMCA 4IHMA 4MCRA 4OIDA 1LAMA 5DS0A 4DJLA 1AMPA 1F2PA 1TKHA 2PJCA 3BI0A 4W9YA 2WYRA 3WT4A 3T8WA 1CP6A 4OC5A 5LYDA 4BD9A 2PJ7A 1H8LA 3IC1A 4OC2A 2AFUA 1Z5RA 4MHZA 4YWYA 4EWTA 3B2YA 3MN8A 2JEWA 3CDXA 3DGVA 3NA6A 2ZEDA 3SJGA 3H8FA 1DTDA 5JM6A 3TC8A 2QVPA 1ZG8A 4X2TA 1ZG7A 3CT9A 4WJBA 4P4EA 2PJ5A 3KGQA 4PXCA 5THWA 5J1QA 3L2NA 2EWBA 1ARLA 1YW4A 1CPSA 1IGBA 4GM5A 2ZEFA 2AFWA 4A94A 4MCQA 4NGQA 4RUHA 2ZEEA 2O4HA 4JYWA 2HB6A 1XJOA 1VGYA 4G1PA 3D7HA 4OIWA 4MHPA 1Y0YA 3ISXA 3B3SA 5CBMA 4NJRA 2C6GA 2HC9A 3B3VA 3WC6A 2AFZA 8CPAA 1YW6A 4X8IA 1F57A 1BLLE 2XEIA 2PJ3A 4ZY1A 4P4BA 4NGMA 4UEEA 4F9UA 4UIBA 3TX8A 1EE3P 4Z65A 4NGPA 2PRQA 2ZOGA 3B3CA 2WZNA 4AXVA 4PXBA 1XFOA 1YMEA 1VHEA 5K8MA 4X3RA 4PPZA 5HVHA 3SI1A 4H2KA 1TKFA 3IJ3A 1Y7EA 2PIYA 4FBEA 1ELLP 1ZG9A 2PJBA 2OR4A 4MXUA 2AFOA 1TXRA 2V8HA 3LWUA 2RB7A 3D68A 4R6TA 1UWYA 3KR5A 2IQ6A 4DUKA 3CPAA 3D66A 3FEEA 4UEZA 4MMOA 2ZEGA 3B3TA 2I3CA 4FAIA 4P4IA 2EK8A 4MCPA 1LOKA 3S9LA 1XMBA 2CTBA 3PFEA 1Y0RA 5HXDA 1QMUA 3QNVA 3B3WA 3IWWA 3FVLA 1CX8A 4OC4A 3D7DA 5D8NA 3K9TA 3SJEA 4UEFA 4JZ0A 2C1CA 4DYOA 1CP7A 4PXDA 1F2OA 2G9DA 4WWVA 2F7VA 2ZOFA 4YU9A 2ABZA 1PYTB 3IIBA 1AYEA 1IY7A 4A37A 4UF4A 3HLPA 3PB8X 4NGTA 2AFMA 2QJ8A 2CTCA 4OMEA 3KQXA 5F09A 3KQZA 5I4MA 3JRUA 1R43A 2PJ9A 2RFHA 4FWUA 1LCPA 5ELYA 5LRKA 4IAVA 4FUUA 2IJZA 2POKA 4K3NA 1LFWA 2FVGA 4Q7AA 2GLFA 4R8FA
chains in the Genus database with same CATH superfamily
2E9ZA 1HHQA 2KH9A 4JD6A 1SUQA 1I6JA 2DK2A 2CQHA 4GKJF 3ITHB 2HBYB 3AJ2A 3PKYA 4B3OB 3GILA 2Q51A 4NLSA 4P52A 3QT6A 1NJYA 1HWJA 1C2PA 2KB2A 1CVJA 2MLYA 2RT3A 4K5SA 4ZHRB 1D9AA 4I69A 4R9MA 3W61A 4YGOA 2HGMA 2AFXA 2XNRA 2PC6A 2OMLA 1UJ6A 4P44A 2CJ9A 2IYGA 4LSLB 4RNOA 1JLFA 5ETVA 3JSMA 5L1KA 2XEFA 4C8LA 3FF3A 4V1Ak 4J7CA 1XBUA 5KFTA 3PVXA 1EIYB 1NE9A 1TKZB 3M9OB 2V8VA 2KCWA 1PBAA 1P9YA 5J2PA 2QJ3A 1M4DA 1LW2A 2C2OB 5F46A 3Q8SB 1RGVA 1KN6A 2IA6A 3DLEA 4OX9F 1GEHA 2RDDA 3IRXA 4ZA1A 5LMUJ 4LQ3A 5J2MB 4I6WA 2ZJRQ 1Q5VA 2XEGA 1XRYA 3MMBB 3IBWA 1FDNA 1FNXH 4QBJA 1EX8A 4DR3F 4JI2F 2GX8A 5E3CA 4MFBA 3BI1A 3EGNA 4CLFA 5IT4A 4N8OA 5CYQA 2ZVSA 1KKHA 1SIZA 4DUYF 3BH6B 4BWJA 3IP0A 1Y5LB 4NLYA 4UQTA 3M05A 4UWJA 2JVOA 3GR1A 4OZ1A 2QGFB 2F9JA 4IUFA 1XR7A 3UPFA 1S1WA 5KT6A 3FIXA 4M5HA 3HF5A 2FY8A 4CNZA 1JLGB 2R8KA 3TEHB 4HEA9 1HNWJ 3T9YA 3FEZA 3V7ZA 3MEGA 4FXDA 2GVDB 4S0MA 3PBEA 3RBDA 4HNYB 3Q8YA 2J9DE 3CGIA 1SV5A 1REGX 4LFCF 2XI3A 5HVGA 1CBXA 3WBZA 1NPRA 3J7ZT 1HI1A 4EYIB 2E9RX 3TANA 2FGOA 5A27A 4LFBF 3TO7A 2JRSA 3J80U 3T8WA 3DRXA 2JC1A 4NZ0A 3HT0A 2HHSA 5EC4A 3I4PA 2WHOA 5B0FA 2M70A 2B8QA 3CJ3A 3UD3P 1AUGA 5AXMA 4ZPWR 4E8UA 1S9EA 4GKKJ 2CPXA 2OPQB 1RZMA 4XTTA 1JLAB 1P6TA 3ILIA 3MN8A 3M2VA 1UFLA 4FNHA 4I6YA 1VJQA 2G0IA 1C1CB 5M2RA 4HNWB 2B4DB 2FHJD 4DZ6A 2EWBA 2R7OA 3A3OB 5ETOA 1FKOB 2VKZG 2Y1JA 1MN9A 2Q6CA 3SDEA 5A2QU 3QMQA 4LSNB 5D4NA 4DFPA 2B9YA 3GFHA 1IBLF 2YBVA 4X62F 1YJ7A 3EYZA 1ZZFA 3C6TA 3GJSB 1EETB 4J9MA 1BLLE 3WQPA 1V6HA 3B4DA 2RSQA 1QSSA 4KFBB 1MWYA 4P7TA 1T8EA 1TIQA 3MAAA 2JX2A 1X0FA 3P96A 4P75A 1PILA 3R7BB 4FBEA 1FTCA 2KT5A 1B7FA 3W2VB 4PRFA 5C82A 4JXQA 1AZSA 1TXRA 4PG4A 4O3PA 3GY9A 3W62A 4G65A 2LECA 1ULRA 4DOZA 1YI2S 1DAXA 4O44A 4TYBA 2AHOB 3W8PA 4X65F 2ZC4A 4ZGYB 2YWWA 3NE8A 3MI7X 2ZC3A 1Y0RA 3GYGA 4ZVPB 4OC4A 3FQKA 4DSLA 2XYHB 1WJ9A 2KJWA 3TCVA 2C1CA 4LF1A 1KTVA 2VH7A 1RT5A 3W1YC 1WEZA 4CGPA 2GA7A 2X1FA 4DV6J 4YY3F 2C22A 1PKUA 3SSRA 2KVQE 4URSA 2AFMA 5KFLA 5IX3A 5E5NA 3T3FA 3N01A 1PU9A 4JLYA 1S99A 4DV6F 1LWEA 3IS9A 4FWUA 1EP4A 2W2MP 3H90A 1IM4A 1YG0A 3U1MA 2EWHA 4DL3A 2XHCA 3ILOA 1J5EJ 3F8KA 3HX9A 4ZMMA 5DG9A 1X4EA 1RKJA 2HFUA 5AE3A 4KC5A 3CMQA 5AT1B 4H4OB 5GAHI 1NUEA 3VVUA 3R5BA 1OQ6A 3PIPQ 2JDJA 5C42A 4K59A 3IR7B 4PWDB 2YWKA 4X4OA 2G0BA 2ARHA 2MKHA 3D1OA 2GAHC 3C8YA 2KXNB 2CDRB 3WC0A 3BHXA 5B09A 2EBEA 3MMAA 1VMBA 2Q4ZA 3NAHA 3E51A 1M90T 1T7PA 1S1VA 1N54B 3BGOP 2WONA 2ZD1B 4DLEA 5I42A 4ED7A 3AOCA 3MF5A 3K5NA 3V38A 3KG4A 3GONA 4C7IA 1R8CA 2Y1RI 3TQEA 2PMWA 4YQWA 3L4BC 3PB9X 2IIHA 4CLLA 4CGLA 3NP5A 1MU2A 4C98A 4B3RF 5KFHA 3AQPA 4AVBA 3K7RA 2Z11A 2B43A 3FEXB 1VKCA 1SH3A 2XLIA 2F65A 5T7LA 3MCNA 4DX6A 1PCAA 3VGUA 3KL9A 3SI0A 3IWEA 3PZPA 3HHNB 6FD1A 4HACB 2MJNA 1M1DA 1HR0F 1TL3B 3K9UA 1BAVA 2BJ1A 4AG9A 2RDIA 5GMDA 1I94F 2VBQA 2NMTA 1FXDA 4WP9A 3GLJA 1FRLA 3QT5A 3CJRA 3MRUA 2N7YA 4FVCA 3SCKE 1P4NA 1OQ3A 4N47A 1HMVA 4Y34A 1Q53A 1JLCA 4B17A 1ARMA 1WDDA 1RT4A 1Q16B 1RT2A 1S1UB 2ZW7A 2YKNA 4USUA 1U25A 3JTPA 4ZITA 4QUSA 5LYLA 4Y0FA 1DFDA 3OVSA 4ER8A 1YR0A 2CVEA 4KZTA 4NXNF 2HQCA 4WP3A 2Q0YA 2UUCF 4ZYQA 3BYPA 1HDUA 3NH4A 5B7WA 2V4RA 5L46A 2EG1A 3KNAA 1CQNA 5J8FA 2A6MA 2NSBA 3TAPA 1S7LA 4KS9A 3W65A 2RHSB 1VC0A 4A8QA 3Q23A 5KOWA 1NSAA 4CH7A 2A2DA 1RAHB 2IPOB 2DXDA 4NMLA 3IWLA 2CQPA 4GC7A 4DCOB 1F60B 4C2YA 1WSRA 5IS2A 5E3PA 2CVIA 3D0HE 3AH6A 4ZVEA 6FDRA 1AUSL 2JNJA 3Q89A 3ZZUA 3QAUA 4DR6J 1B4SA 2C3PA 3RW6A 1U09A 3RRKA 2X51A 2BBEA 3NWGA 3R5CA 2XYPB 4QWEA 1EB0A 2KI2A 1V3ZA 3JVNA 2HRYA 1Y10A 3PNIA 4ZP6A 4Z2XA 2NYIA 3BS9A 2CJKA 4PXCA 3UFCX 2XMAA 4F4YA 1WWHA 1ARLA 5C2CA 2FE7A 3R1KA 4Y2KA 5HP1B 4TQRA 4E8OA 2H65B 4DSFA 4F25A 2XWYA 2A18A 3FMWA 3H40A 2FLNA 5FIIA 4AD6A 3TJ9A 3SHPA 3NY0A 2DGXA 1VQ4S 1NPKA 5CBMA 2YNGB 3WX8A 3Q86A 4NRUA 2DH8A 2LU1A 4NLGA 3FUYA 2XCAA 3CZXA 3G82B 2O01C 4CWBA 2FJVA 3HSDA 3QIDA 4ZOSA 3G6ES 2LEBA 4WFYA 4DR4J 2G3TA 3V81B 4RW4B 1NU4A 4IRKA 1EQ0A 4DL2A 1Y7EA 4MT1A 3DRRB 4U7CA 2KZZA 2HLUA 3MM6B 1Q78A 4RWWA 1YITS 1LWXA 3C14B 3MD3A 1N0UA 4H89A 4A48A 3NBPB 4HI1A 5F8NA 4IRDA 1R8PA 1TK0A 3V6HA 3MEEA 4RUBA 4OI3A 3TR5A 4W92B 3MOJB 4MMOA 2ZOMA 5EBVA 2COLA 2HEKA 1NKBA 4ZKAA 4WCEQ 2HWHA 2JFKA 1Z8XA 4C0OC 4K7QA 1LWFA 1QD1A 1N34F 2UXBJ 2XS7A 1NH7A 3SJEA 2FHOB 2OEMA 3KMQA 1CP7A 4C0HA 3P45B 1JB0C 4A95A 1S59A 4NLDA 1PYTB 1AYEA 4A37A 1SBRA 2ILYA 2K7JA 3I56S 2MKYA 5F09A 3KQZA 2LQ9A 5HN0A 3DSBA 2G2OA 2KXFA 3JRUA 3GCXP 1YTYA 3ONQA 3LODA 2RFHA 4CAXA 4XK8C 3KK2B 3QQCD 2B5JA 3DU6A 1RB0A 1S10A 2PSZA 1F1BB 3PY8A 3MDFA 4DX7A 1RHUB 2Q66A 3G8WA 3Q83A 2ZEPA 3RB3A 3TRGA 1BD6A 2OGUA 3FBCA 4Q45A 3I1UA 2CPJA 1BOBA 4V19X 3IA0A 2HW3A 2HIQA 1DTQA 2HMIB 1HNVA 4AQYJ 1JLEB 3PRVA 4GRSA 3VZIA 3TVZA 3GKRA 2QMLA 4B13A 1U1KA 4C8ZA 1OO0B 3E01A 2JJ4D 2PD1A 5DLGA 4CLWA 5KFQA 1UVKA 3A3PB 4ZX8A 4M5KA 3BREA 4Y65A 2ALYB 4Q44A 1WC4A 2UV8A 3DXSX 1G6BA 2MB0B 1RT6A 2DR9A 2YWFA 2FXFA 3FZBA 2MKKA 3L7OA 1SQGA 4F8ZA 3RBZA 1P27B 3L9ZA 5KG7A 1N36J 2YX7A 4ELTA 3D3BJ 4KV8B 2QLBB 5K8OA 3IEHA 1J2VA 1TUVA 3DLJA 3PACA 2YKQA 4KQZA 3SQGA 1M0SA 1LWCA 4ECYA 5B0AA 1FD8A 2AX1A 4X64J 1WI8A 2AJQA 2ZH1A 2E7VA 4RW6A 2AWZA 3OXFA 3DOLB 4FYDA 3OV7A 1TAQA 1XMQJ 3D7FA 2AEMA 2UUTA 3U27A 5KG4A 1X12A 4YDXA 2O5DA 2J5AA 3M6UA 4AL6A 2G0CA 1YLOA 3K2KA 5D6GA 4QPXA 5K5MA 5EN1A 2PJ4A 2GU2A 3HVWA 3UR0A 1UJ4A 4YB7A 2R8GA 4AVCA 2VOPA 3P6YC 1MK4A 2AYBA 1S1XA 3FNNA 4C8YA 4CH1A 4OLPA 1S0VA 4P7VA 4FYVB 1YLEA 2CNTA 4DG1A 5IWAF 1ZBTA 2ZH4A 3DC2A 4EVYA 5B0BA 2UXBF 3TOAA 4IQMA 1FEHA 1CM0A 1R7IA 2QRRA 5DWNA 2BE7D 4IDKA 1RTDB 1ZPWX 2OKQA 2CJQA 1TL7B 1Y3KA 5AE2A 2CXEA 2QA4G 3SSQA 3DDKA 1H98A 2VPYB 2FVPA 1MROA 2QECA 2FJAB 4J3GA 1TZ0A 3WX4A 2UUAF 3PEIA 4MH8A 3R95A 4B10A 4L8AA 2XI2A 2BABA 2J9DA 2IVYA 3NS6A 3VARA 4P10A 3B54A 3MM5B 4LVNP 4MCRA 3RB4A 3JTKA 4ECVA 5CD4H 2N3OA 4TYAA 4I2PA 4C11B 3RRHA 3ENVA 4KSAA 3TZXA 1C0UA 4HVZA 4ED5A 1S5KA 1VR6A 4LF2A 1N4LA 2W9AA 2W9CB 4USJC 4J9VA 2DHAA 1RU1A 4D3HA 2ZHBA 1IR0A 3CULA 4K4ZA 2FL4A 2BZ2A 1QUVA 2Z2YB 2HNZB 3CXQA 2E7WA 3CCTA 4QYZK 1FRKA 4WXWA 5KFPA 4KHPF 1R8AA 1YJUA 1FKPB 3CDUA 3DGPA 1TFWA 4IRCA 4Y3CA 4C3MA 1YW4A 2J7KA 3SI8A 2EVNA 4F6AA 4A94A 1D9DA 2ZEEA 4QR0A 2M9KA 4DN0A 3DU5A 4DS4A 2R7XA 4MHDA 4C6AA 1RQ0A 2VQFJ 3GJTB 3B3SA 1RCOB 1HBMA 1TKXB 2HC9A 1BE4A 3H5YA 2NYHA 2IBOA 1IKXA 1H7XA 3NGDA 4OADA 3FBFA 2A4NA 1RISA 5IM0B 3SYZA 1CJUB 4F9UA 1NM2A 2XY7A 3I0RA 1YMEA 5FVJA 2D3ZA 5KG6A 2W7OA 1SQFA 1KOHA 1VIOA 1VISA 1YJ9S 1E6YA 2DNHA 1DLOB 4ED6A 4LRDA 1NB2A 2PIYA 1Z1ZA 4X5KA 2A3JA 4KVME 4PSWA 3R5JB 1Q2YA 1S9GA 2QL5B 4MK9A 3ZZYA 3BQ1A 2G2YA 3JQKA 4USWA 1FDBA 2GVZB 3BKFA 4B5PB 4ES1A 2REFA 3GMGA 3RR8A 4CO3A 3G6YA 3T90A 3FBBA 1RTZA 3ZZRA 3LP2A 4DV5J 1Y7RA 2D9PA 2VICA 2V4JB 4B12A 3SXNA 1X7VA 1UVJA 3T19A 4E0DA 5CAAA 3W6SA 3GJQB 3MGDA 1IKWB 1REVB 1TK5A 2WSCC 3PXGa 3LO3A 1FT8A 5D3GA 3QWPA 2F5IA 4UF4A 1WI6A 4A8FA 2YNHB 4OMEA 4LR8A 5DDOC 4YN3B 3CCJS 1KFDA 1WKJA 3L09A 2I79A 2GGPB 1S1TA 1GH8A 2XZTB 3OFFA 2IJZA 4AUKA 1KFSA 4NCBA 1X5SA 3L7UA 1LFWA 2WUUA 4R87A 3DDNA 3H2VE 3WDOA 1SUQB 3OLAA 4J9PA 1HBOA 1QQ9A 1XF8A 4KRWA 3ZZOA 1VQKS 3R5DA 5C88A 4P45A 2UU9F 1RWMB 2WRMA 4DHVA 1S7FA 3K59A 1WF1A 2AGPA 3KMSA 4A39A 3BO4A 4ECUA 3KUEA 1U47A 1VHOA 2ATCB 3NFZA 2JL9A 4Q38A 5HAOA 4XPCA 3CCES 1ZLIA 5K14B 3EXNA 2BKPA 1MJ9A 2B6AA 1K4JA 3MECB 4EBEA 3EDRB 1WHWA 3J7AN 1T9TA 1U24A 3TX0A 1NMTA 3D6HB 1U26A 3QIPA 1VLYA 3UD5A 2PRBA 3VAFA 4ZCKA 2PJ8A 3S8SA 4ZIVA 4XO0A 1GAOA 3M8PB 3PB7X 3DR8A 2NCKL 3FCWA 2JC0A 1OY9A 1T9UA 2ABYA 2R8IA 4DPXA 1WOOA 3CCQS 3QJJA 4ID5B 3K57A 4JI8J 2YWGA 3NXZA 2AGQA 1Y5NB 5M2UA 1FD2A 3BKUA 3T9NA 1W2IA 4Q5VA 1UEVA 5E33A 3TZWA 4OL8A 1FX4A 1U1QA 1NCLA 2BANB 1KRPA 2VONA 3K17A 4R5PB 1CJTA 4LRCA 1YJTA 2ZELA 1WHXA 2J0QD 5A8KB 2GLJA 3SJXA 1P1TA 1YBAA 3TZZA 2LEAA 1K47A 5KTCA 3DI6A 3G6VA 4N7TA 1SC6A 2V2KA 3KHGA 4LQGA 4WTOB 1JLGA 2HK2A 1UWBA 3V4IA 5A8RB 4RW8B 4WBFA 3K8WA 4I64A 1M44A 1WORA 4K2XA 3EUNA 2GMJA 3AD8C 2ADCA 4A30A 2OTLS 5AJ3J 2ODFA 2ANPA 2OPRA 4PZVA 1C1BA 3BB5A 3BDEA 2YY3A 1D1UA 3N5FA 4JI4J 2R7WA 1T3OA 1F5BA 4P9SA 4RNFA 4WE1A 2W7PA 2ZENA 2RDJA 3TJAA 3Q2SC 5DDPC 2MQQA 3BH7B 3KK3A 2H4WB 5DM6Q 5AG4A 5HMXA 1S57A 2Q4VA 4W9YA 4MKBA 1KOOA 3LD2A 3T1YF 4IFYA 5HROA 1G4CA 2XM3A 3D5MA 1VK8A 1Q8KA 4M5DA 2G3AA 3H59A 4L3KA 2R3VA 2VG5B 5LOQA 2Z57B 3KHLA 1S12A 2RMLA 3V2UC 2DPJA 4UUWA 3WZ0A 2XY6A 3QRPA 1BXNA 5J2NB 5AG5A 4P2MA 3SQOP 5GVQA 3CMAS 1VQ5S 4QW9A 4NEZA 3V6DB 2VPXB 3GV5B 2RC4A 3ICLA 1RYRA 4O3OA 2HHHJ 4QR1A 4JI1F 2QC3A 2O4HA 4ECSA 2ZE2B 4OIWA 4NMXA 3MHYA 4IH7A 2LFVA 1Q2CA 3B3VA 5BR8J 1RA7A 2IM1A 3WC6A 4C48A 4QW8A 1FVQA 2L9NA 4CDIA 2DH9A 3CIZA 2HFVA 5CHCB 3I5CA 2OH1A 1N34J 2WZNA 4KFBA 4PXBA 1VHEA 5K8MA 4NI2B 1FWPA 3HPOA 4LF6F 3R9GA 3IGRA 2RH3A 3NCPA 1SJRA 5GCNA 3TWZA 1R6YA 3LPYA 2R9LA 1FK9A 4DSEA 2AFOA 4U6PA 4DQIA 4L6V3 2ZEJA 4USMA 1UWYA 4NCAA 4LF8F 4Y2IA 4O44B 3CPAA 1L3VA 1AT1B 1BQXA 2XZWA 4JI0F 3DDDA 4H4KA 4TU9A 2EK1A 1APSA 1LW0A 1UW4A 1JJCB 1J5OB 4OHVA 3FRMA 2IJFA 3IG1A 2UZAA 3R1HA 2WW8A 4B9LA 3FVLA 2M52A 5E3RA 1WC5A 2CQBA 4EI2A 4ATNA 1YQEA 3G71S 2G9DA 1KLMB 2F7VA 4IO1A 4KOTA 4G6VB 3KLIB 5D8HB 4CLPA 2ZUAA 2E9TA 1XQIA 3KYLA 1BWEA 2ZM6F 1VFJA 3OTDA 5DDRC 2DGVA 2JDCA 2L41A 2H4YB 2IDEA 2I9SA 4CCHA 1X4BA 1KVJA 2XMUA 3M2RB 3T5KA 3MFIA 1TKDA 4F9VA 4PQUB 1NJXA 3TI0A 1N52B 4M95A 1QSRA 2OO4A 3CCVS 2Z56B 2G13A 3AY0A 4PAAA 4DV0F 3DN9A 2NXJA 1NK6A 1QE1A 1RHJB 2N82B 2R2TA 3S01A 2KYZA 3WIVA 3PM9A 4YOEA 1CC8A 1JLBA 2IA0A 4YP3A 2MHNA 5EHHA 2QA1A 2DEJA 1HBNA 5F0UA 4HH0A 2YKMB 2OLWA 3D2MA 3T41A 3RAMA 3CPXA 2DNGA 1B70B 2XLKA 2QG9B 2PO4A 4KHPJ 3S6EA 2B9EA 2V8GA 3MMCA 1VBYA 2FLLA 3R5AA 2E7XA 1TAUA 4GKKF 3UR3C 3T6BA 1RK8A 2SXLA 4M6IA 4B3OA 2ZZMA 3W5ZA 1U6MA 3IAM9 3I0SA 1UPMB 1GX6A 4URGA 1JMTA 4KO0B 3JAMU 1IUJA 2GFFA 2DEAA 4CYQA 5MAOA 1NK0A 3EZUA 2K3KA 4Q8FA 4JV1A 1SJ3P 2EFVA 2UVUA 3B35A 2AJ6A 2HUZA 2LQBA 3ZTSA 2JEVA 1NLKL 1ZLHA 2CQ1A 2ASLA 2NXNA 2PA3A 1M5SA 1YWXA 2N3LA 1G7CB 3QAEA 4OJ1A 1VOMA 1X4GA 3M8WA 3HJVA 3G3SA 4ZLJA 4KH0B 4A8MP 1Z4EA 1G2EA 2CPIA 5L1JA 4QYZJ 3EE3A 4ETZA 1VCTA 1IWAA 3Q0AA 1S60A 2PCUA 3H5SA 4UOGA 3V6JA 3R9LA 4NLOA 2LDYA 1VIXA 3NMAA 3PTWA 1X31C 1TMJA 2NXCA 1ICEB 5AXNA 4FS1A 3KHXA 4Q2LA 1LK5A 4M8LA 4OLLA 1CC7A 1WF2A 3SIPB 2DD8S 3H2LA 3E3XA 3UCUP 2I38A 1FNOA 3DRSA 2QTWA 3MR2A 3B7IA 5FDLA 3KNGA 1RAIB 2MZSA 3HSGA 4JI7F 3ISNC 3ZJ0A 1EKRA 1AFIA 2XGPA 5LL6d 4DR7F 5DZ7A 1K73T 3RAQA 2VODA 2J8AA 4K4TA 2HNDA 4WFXA 4AE5A 5DS0A 4RJVA 3OVAA 5KTAA 1Q79A 2EPIA 2VDHA 2P9CA 2OD6A 2B4BA 2G9OA 2M88A 3CCMS 4DU8A 2FCKA 3MXHP 1F9HA 1YGHA 1MWZA 1PSDA 2MZRA 3UDVA 3T5HA 3PZJA 4ID8A 2ASJA 4L76A 1U6FA 3AAWB 4M6HA 4DN9A 4OV6A 3H98A 2BDPA 3F0AA 4CLTA 3KGQA 3PW0A 1KP6A 4RU9A 3T6JA 1T05A 2J8SA 5THWA 3W7BA 1U1PA 1PYSB 4WYLA 1MMLA 4U9YA 2KT3A 2HS3A 1IGBA 1U6BA 2FSRA 4KOWA 3GIMA 4JV5F 2PEBA 1TKZA 4B9UA 4HPSA 4MCQA 2KG1A 1YZ7A 2FYXA 1HQ2A 3S7RA 1O0PA 3OFHA 3CC4S 5IXUA 3A8IA 3GE9A 1KS2A 2J8NA 5CA5A 3QO9A 1S5ZA 4LMZA 4X4TA 5JJBA 4I49A 4DV2F 4LF7F 4K4XA 5MLCV 2LXIA 3W66A 2R8VA 1DBDA 3T5LA 1FFSB 4Q8EA 1XFOA 4OZ5A 2Z3OA 3AA9A 3EGVA 2MHEA 3QPIA 3MM8B 2HFZA 1FHTA 4ZVHA 4H2KA 4M3SA 3IJ3A 2Z2LA 1UP1A 1S4EA 4Y2AA 5C24B 5DGBA 4HH1A 3C14A 1CJVB 2AMCB 2FHMA 2EXUA 3R6GB 2DY9A 2LKZA 1WTBA 2JEGA 3R7SB 1JLQA 1AUDA 3VWDA 4UTGA 1QAXA 2ZJQQ 3B3TA 3RW7A 4IF5A 3GFZA 3DLKA 1LOKA 3N28A 4MJKA 5F9NA 2FS5A 4CAWA 4ES2A 2NXEA 2HURA 3KLGA 1NK7A 2V63A 3K9TA 2K2PA 4F4WA 4Q0BA 2E44A 1F2OA 4MIWA 4JV0A 4RW7B 3HLPA 4NGTA 2B58A 1WWZA 3M2UB 1FI4A 1RSCA 3AD9C 3NRBA 4U9RA 2FLPA 3TAQA 4WFAQ 1SC4B 5D0HA 1IWGA 1N0VC 1SL2A 2KHDA 1HNIA 1T0TV 5J1EB 1XIXA 5L1LA 5H9FK 1SQHA 1N5YB 2FVGA 1VHSA 4AB7A 4WU2A 2Z2ZA 3QRQA 2HQYA 3OXGA 3R3TA 5E41A 4O3SA 5I3PA 1L0CA 4Y6IA 3TFYA 2VQEJ 7CPAA 5M2PA 4DL6A 3PBBA 3IGVA 2K1RA 2ZDPA 3ENAA 3MPUB 4NGNA 4ZI6A 1ZH5A 4ONWA 2UUAJ 1DQAA 4X4QA 3K5MA 3CJ0A 3GIUA 3MR7A 1KQFB 1ZOTA 1RBLA 3SXLA 3J7A1 2MQMA 1JQGA 2JEIA 4YB1P 2CFXA 4B9VA 2EK9A 3U1LA 3JAMY 1QJHA 1Y9OA 2HYIB 4HKFA 1U0HA 4DR5F 1SL1A 4LSNA 4U9ZA 4YFJA 1WC3A 3SJFA 2OTJS 5BWAB 3IBCB 1F0XA 3HHLB 4QWBA 2QFIA 2IC3B 4UA3A 1WSVA 2GFQA 5B0DA 3A9LA 4QBUA 2AV5A 3QRRA 5BJRA 3LANA 2BJDA 3ILLA 3PYDA 4K5RA 2W8LA 4PUOB 2VB6A 1R27B 1WF0A 4O0IA 2W24A 3UCGA 2ZEOA 2X7BA 1V5VA 2WVEA 2R2SA 2ZD1A 3NL0A 1IYKA 4NLQA 3S9NA 1WKKA 2V5HG 3KLEA 4M5MA 3A8KA 1S97A 1LXNA 3M1VA 1B0PA 3OL6A 2UVRA 2H5EA 4L74A 3NH5A 5DG7A 4NFRA 1RHMB 2VIHA 1NMEB 3OTOJ 1T9YA 4F4KA 2QYCA 2GREA 2JSXA 2CAJA 3ELHA 3Q8VA 2GMLA 1X5OA 4WXOA 5I3UB 2LEPA 2Q79A 4HLBA 8ATCB 2IHR1 5ETMA 2KZMA 4IDKB 2K06A 5GAGI 4IOCQ 3KKWA 3KI9A 2GQCA 3KG0A 2B3UA 2CNLB 4EBCA 2RAQA 4NA1A 2MY7A 4C2XA 5DS7A 2B7BB 1HFEL 3P5TL 4M5IA 4ZVUB 3A3NB 1BHNA 3DHXA 4JI4F 2HGNA 3BJ8A 5LSRA 1U1LA 2PDAA 4EGLA 3RYOA 4DEZA 4KE5A 2BVZA 3ET6B 5C5JA 4CYOA 2CA9A 3QGPA 4DL0C 1FE4A 2J7UA 1CP6A 3P3DA 5B08A 3T1HJ 3OHBA 2Q3PA 3MZIA 2V0NA 2IYIA 4IOBA 4R8UB 2YPYA 3V6KA 1SB6A 5F3ZA 2DXQA 3V5RA 4OHWA 3ZO7A 1GFWB 4MKYA 5G20A 3GIRA 5KG5A 3R97A 2F4FA 4KBIA 4NLPA 2XMTA 4GVLA 3PX4A 1GXLA 1ZG8A 1UKUA 2B51A 1S6OA 2PJ5A 2F5GA 4GS4A 3PV8A 2ZH2A 5F8JA 2EI5A 2ROGA 2YGWA 5L39A 2AE6A 5HANA 3UVJB 5GMKa 3V4MA 2ZBCA 4OYBA 3TAMA 4HHUA 2HS0A 2P8IA 1UZHA 2UV8G 1VGYA 4MHPA 1HBMB 2RKIA 3DCAA 1HHTP 5F41A 2CADA 2C6GA 3NLCA 3CNQP 3W3SA 3EXYA 4FN5A 2IVFB 5ETSA 5DDQC 3UY5A 1IKXB 5HL7Q 4ZHRA 1UTAA 4UOFA 1VQNS 4P4BA 2Q6BA 1WELA 3O6QA 4XDDA 4A8KA 2XMJA 4UIBA 3ZTRA 2MZTA 2BL1A 3AXKA 2ZITA 2B9XA 2Q7SA 1U02A 2QE5A 2EFOA 4F0HA 4CT8A 3H4DA 4KLVA 2BOPA 1HWUA 3W2WB 3CXCR 5BXIA 1AA1B 1SIWB 2CPDA 4OI6A 1KSPA 3D68A 1YRXA 4X64F 5HI7A 1N33J 2DO0A 5C25B 2U2FA 1Y0HA 1S6QA 4A8OA 1H38A 3D66A 3FEEA 2YNGA 5H86A 2AD9A 4LIRA 2IRXA 2FGCA 3PDNA 3M30A 3PFEA 3MR6A 4P2SA 1XNRJ 2EKYA 2P9EA 4ECQA 4I1TA 1FRMA 1CX8A 5KT4A 1VQMS 5D8NA 4YS2A 3CO9A 4QR2A 4DV5F 2UUCJ 2QLFB 1RAEB 4HTIA 5KFRA 3A8EA 4K4WA 1DARA 3HT3A 2ABZA 5A6WA 1D0EA 3KQXA 2DT9A 5HQMA 1QSYA 4USVA 1R43A 4TKTA 2DNMA 5ELYA 4IH5A 4FUUA 5LXRA 2RF2B 2B9WA 4KPYA 2PN6A 2Y0MA 2NSCA 1JK9B 4RPFA 2IBKA 4DV0J 3R27A 4LREA 4QJVA 4TWEA 4I4BA 4B08A 5A0YA 4GXHA 1IQTA 4I67A 3HFZB 1PJ6A 2QFJA 4CLZA 2HHVA 3C6UB 2B4DA 1R57A 5AJ3F 2UVWA 3BBFA 4KSFA 1HW9A 2L3MA 5HVFA 2GIRA 3R7NB 4DR6F 1XBWA 5JQ4A 2VF3A 2ZW6A 1TKTB 4OYXA 2AJ0A 3TA2A 1JX4A 1ELMP 3R8YA 2BCOA 2VG7A 3I32A 3D6TB 2R2RA 1YDLA 1CEZA 5IV0A 1F5AA 1SCJB 4ZJLA 2HVEA 4QWAA 1N32F 2LVWA 1NSPA 1OBRA 1YX2A 2YH0A 3I55S 3EGZA 4FNIA 3D7GA 4MFPA 4QIFA 4NEXA 4JBCA 2E1MC 4MHYA 3D2PA 3BKTA 1HARA 1RT7B 4I2QA 4O4GB 1L3UA 3LP1B 2FQQB 2DNQA 4DL5A 4XIUA 1HWIA 3KHHA 3I96A 1GMWA 1X4HA 4CO0A 2QX0A 4LF8J 5CPAA 2GO9A 1VQ9S 3UCZP 1SC3B 2OD4A 3MM9B 1AZSB 2JZ5A 4ZLNA 2F63A 1CJKA 1C4CA 2OFHX 1WHVA 3HO1A 1M5HA 2LP4A 1WUUA 4ZVOB 1FKOA 4CYUB 1VQ7S 4H4KC 1K8AT 4UIAA 5CD4A 3LGMA 3SDEB 2DHXA 2Z3PA 2RHQB 2M0GB 4KHMA 4OX8A 1GHEA 1MWQA 1NZ8A 1TVRB 2YNDA 1KQSR 2MMYA 2P2CB 4IR9A 3MM7B 2J0SD 2BXJA 1TUGB 3GIKA 2Y3YA 3FSYA 2E5LF 2AKWB 4CS0B 3LW5C 4RW8A 2E1RA 5EWEA 4NCGB 3PYEA 2XSJA 1FRIA 4MK8A 3VQTA 1XMQF 3MR5A 3JSYA 3IS9B 3MAQA 4Z7YA 5CYMB 2VBWA 1S72S 2OPRB 1Q7LA 2NYQA 3HFKA 5LMNF 4DX5A 1TK8A 2YNIB 1YSJA 1VBZA 1RI7A 1JJ2R 4NXMF 1TTHB 4MCSA 2J8MA 3QGIA 3NCQA 4IHMA 3IM8A 2EBGA 4A8WA 2R7QA 4UW2A 2DEIA 3R9FA 3KK1A 3CW2C 4PWDA 4KGZB 1X9MA 1EAYC 1WC0A 3ZNJ1 2WYRA 3SV4A 3DRPB 4A8XA 5HMZA 5HROB 2BX6A 2HRTA 4OC5A 3F73A 3DLGB 2ZW5A 4NL5A 3VZHA 1JWWA 3MMAB 4FZVA 4QCLA 1FKAF 4OC2A 1VRUB 1VQSA 1MROB 2WVFA 3QFWA 1FJEB 3NKYA 1KVIA 4TY8A 3DGVA 2ZEDA 3SJGA 1P8GA 4LFCJ 3SBMA 2B4UA 3H8FA 2HAFA 3TC8A 2HWTA 4KOYA 2VG6B 5CABA 3P2FA 3BSAA 4B3MJ 4OLOA 2P6SA 3DFEA 2RUSA 1HNZF 1KD1T 1XEBA 1N71A 1RLDA 2AFWA 4FBUA 1U1RA 2FC8A 4RR5A 4H4OA 3PEHA 4WKYA 4PWWA 1Y3JA 5LJ3Y 4UCPA 2KU7A 2XMMA 3DLBA 4HACA 1I51B 2YNFB 3F41A 2B0GA 5ETQA 3SCIE 8CPAA 4OYAA 3P49B 3JSMB 2D7SA 1Q81T 4DCPB 4GMKA 5KFXA 4DQRA 2PRQA 3GIJA 3R2CJ 3MGJA 2D3UA 1SH0A 3QBCA 1RTJB 2ZFHA 2HQ3A 1XNQJ 4PG8A 2YKNB 2PJBA 4OI2A 2WVBA 1FK9B 3QSIA 5I0CA 2N4DA 5L9XA 2KL8A 4R0EA 3DYAA 1OSCA 4DUZF 2DPSA 5IT9Y 2DGOA 3POTA 4DV7J 1IBLJ 4C8OA 2L9DA 2ZWPA 4DBQA 5F8HA 4P4IA 3LOUA 2PDOA 4DF4A 2VASA 3ZTQA 2JHEA 2KTQA 1FY7A 3JQJA 4DWIA 3W91A 2XCPA 4DL7A 2L9WA 4ECRA 3CUNA 3OTCA 1HNWF 1OWXA 4H6ZA 1T03B 4KHRA 2OAUA 2LYVA 4J9QA 4I7FA 1FDDA 2OPPB 3BF4A 2OEKA 1GMUA 3VV2B 5HBMA 4KJIA 4FP9A 2QA2A 4FD6A 1NEEA 3BO2A 5D78A 1S9GB 1LCPA 1FX2A 3CDAA 2OB0A 4XPEA 4IAVA 2DNOA 1AW0A 3IXQA 1FF2A 3CD5A 1IQZA 4USTA 2HKEA 3D8PA 4F2RA 4L72B 4PG5A 3MPYA 3FZ2A 2PIZA 2VFTA 2GIQA 3FKBA 1UAWA 4UCMA 2VA3A 5E96A 1HQUA 4KVOE 1QVGR 3KJVA 4QVTA 3RR7A 2VOOA 4UWIA 5D3GB 3EPIA 3UO0A 2JLFA 2D1CA 2C2NA 2AT1B 1R0AB 3LACA 2PFFB 1FJGF 1JKHB 5HSPA 1S1TB 2GGPA 5D4LA 2R2UA 5KTDA 4F0YA 3BGUA 3DRYA 4RWXA 2PJ6A 4LBHA 2QIFA 2DF5A 3AFGA 4J9NA 1F9EB 3ZZPA 2ZEHA 3PHEA 3HVAA 2R42A 3OR2B 5KFSA 3OT9A 4QWDA 3G82A 2VL1A 4HT7A 1DURA 4KGKA 3I0SB 4K4YA 2GHWA 2CZVC 4RBVA 1U8SA 2GO8A 4K8RA 1TF9A 3I9SA 5KFMA 2PMHA 4DF8A 1WC1A 1TKJA 1F3VA 1KHWA 3UN2A 3IRWP 4DV3J 3ADAC 1N5TA 3I9V9 5LMUF 3J81j 2W4CA 2HVDA 4NGSA 1KONA 3EVOA 4ITSA 3BN7A 4XNHB 2OFGX 5L1IA 2AJ1A 2QN6B 2NR0A 3NMRA 5KFIA 2CZ9A 3QGGA 3MEEB 5KAKA 1XTZA 1XN9A 4F0KA 2JBKA 4N8NA 2X1GA 2OELA 5BYRA 5HMWA 1NDPA 3JSBA 3PW5A 4IG0A 3X1LB 3NNCA 3HSZA 1IKVA 2CQCA 3OBIA 2DRAA 1UW9A 4X65J 1HNXJ 2XGQA 4GO5X 3M9MB 3EY5A 2P6FA 4DSKA 2RVJA 1RWPB 2RRAA 3ISND 4LF5J 3TO8A 4IOAQ 4P6QA 2F1FA 2PEHA 1S7HA 3CPWR 4NLXA 4NOHA 5A76A 1X4AA 4CO1A 2ZKTA 2H51B 3US5A 4C7QA 3TTHA 3I4HX 4J9LA 2HNYB 1EJ7L 3CJ2A 3R1LA 1HWKA 1URNA 2BUEA 2RD5C 1M4IA 1I12A 2VQEF 3GIIA 2KFNA 1VBKA 4EK2A 3FMCA 3B8GA 1OSDA 4RLEA 3G2XA 2PA8D 2M5YA 1TV6B 4F3MA 2VZYA 3GQCA 2ZDOA 2ROPA 2CJAA 2MKJA 5HO4A 1RADB 5LYDA 2ZHOA 4H4MB 3IC1A 4YDDB 2Y0SD 4GVBA 1TL1A 4F02A 1KC8T 4QIEA 4LRFA 5U47A 5JVGQ 1U2RA 1R6VA 1X5TA 3JB9k 3VAJA 3MTJA 5IT9U 2VD3A 3MEDB 3J7Z5 5B0CA 3PJXA 2IAJA 3MECA 1BLUA 4KV8A 3MURP 5J8CA 2IJRA 4P72A 3KK3B 4Y28C 3DNCA 2V4QA 2ZH5A 2VPWB 4X84A 4NGQA 3HKWA 3NS5A 1C4AA 4IFYB 2JDDA 1ON0A 3GTYX 1Y9WA 1WEYA 4A33A 4CRZB 2J6UA 3KTQA 3IGNA 3DOKA 3N6MA 1F57A 1EQMA 4BMHA 2XEIA 5GMEA 1LV5A 3CD6S 2P6EA 3FRYA 3D6MB 1IKYA 3EPGA 2E5LJ 2BJ7A 1PGZA 5AG6A 2MJUA 3KLVA 3M7VA 3VALA 1IBKF 1PBUA 1X4CA 2CQ3A 2BM0A 2V2ZA 3HHEA 4K0KF 3VAIA 4MXUA 4LF9J 2DCLA 4NCZA 1QAIA 2R4FA 4LBIA 2GIFA 5KG3A 4R6TA 1FVSA 2LXFA 2ZH8A 3S6GA 3FBUA 1PUAA 4ZVGA 3TOBA 3MPVA 4UOCA 1K9MT 4FAIA 4L3NA 1LWCB 3DKDA 1AB8A 3DLKB 3GR0A 1BMQB 1HQEB 3JS9A 2C2ZB 2Z3MA 4IFVB 5HXDA 3HD2A 2MQPA 5EX0A 3DLHA 5KOXA 5DGAA 2GNKA 2X3GA 2IVMA 4PYAA 2WPXA 2HGLA 4MFKA 4PXDA 2Q7BA 3G4SS 5L38A 3C19A 3GV7B 2NREA 3BGLA 1BY9A 5ADZA 5DQIA 2AZ3A 4DQQA 4CRYB 1C0UB 1S6PA 2CPYA 4ZP9A 1ZAWA 4RI1A 2W9CA 4JYAJ 1D3WA 3EZOA 4CH0S 4L89A 3KDNA 2VU5A 2U1AA 4PK3A 1KVKA 4ECXA 4JI6J 3ZC4A 3LMSA 4D3GA 3EDQB 2QLWA 4YR3A 1LAPA 4A38A 3M32B 3S6KA 4A8YA 1IYLA 4M5DB 4GC6A 3HCXA 2QL9B 2GCFA 3I5BA 4BCAA 3FFIB 4JI7J 4TLQA 3OL9A 1X5PA 3PX0A 3UE2A 2CXAA 2OZHA 4O3RA 4CTAA 4DMZA 3OPKA 1NNDA 1B7YB 2O67A 2YNEA 2NSMA 2P9GA 2F8MA 2XMKA 3VWSA 4CP5A 3NGSA 1FEEA 3FSIA 4UT4A 1VRTA 4J9OA 4JXRA 3M2RA 4CI0B 5KFFA 3FH4A 1U0HB 3OR1A 2KT2A 3IFEA 2VFSA 4A2ZA 4DPTA 2JOQA 1T9VA 2A2CA 4NLRA 1FJCA 3M6VA 1XNQF 2XULA 4OI4A 3KKFA 4OHZA 3AODA 5A8WB 3LWLA 2RS8A 3VATA 4II9A 2PJ2A 1HR0J 2J9AA 1HI0P 2DTJA 4C3LA 1SI9A 4EU0A 2V8DA 2DR6A 1FXRA 3CSKA 3D28A 4CLKA 2RRBA 3KLEB 1Q0NA 1SXLA 1S1UA 4FYYB 2H48B 4QYRA 4DR1F 3HM9A 4DR4F 4Q43A 2X1BA 1LOUA 1GYTA 4Y49C 3O1LA 1Y7PA 3C16A 3KUHA 2DGSA 5ETPA 4YR0A 4ZK7M 3EVWA 1Y11A 5J2MA 1HA1A 5F0WA 1FT7A 2W25A 5T14A 1SKRA 1CS4B 3HHLD 4WU3A 4Q36A 3H0PA 4K30A 1YKWA 3G8SA 1PYOB 2GE3A 3KLHB 4BBHA 2HRUA 4IG3B 3THTA 4KUAA 4A4JA 2DHSA 3MM6A 3HMJG 3C46A 1M5KC 1Q4RA 2W9BA 3NBPA 4ETXA 1DLOA 3SFUA 3CD7A 3WHIA 3VAKA 5H1SV 3PGPA 3PKMA 3HVRA 3AOBA 1Z2LA 2ZH9A 4AXIA 3W5YA 2LA4A 3AD7C 3OTBA 4C97A 1HYSA 2AEJA 2CUYA 1YJWS 2ZBIA 4HDGA 4JI6F 3P5BP 4RS2A 3CJ8A 3BI0A 3M8QB 2GVDA 4F04B 2FB0A 3L3CA 2VEZA 2WCXA 2IDLA 3THPA 3PJWA 4KLWA 1SJ1A 3TVYA 2QSWA 3M8RA 2KJVA 1BQMB 4CRJA 1VI7A 5G0RA 1RTIB 1LKZA 2EFQA 2R8JA 1RU2A 2B5JB 2BJ9A 2LQ8A 4F67A 2PR8A 2ILZA 1PC5A 4YFUA 2Z0GA 1S7NA 4GKJJ 4WJBA 3SCLE 1UJ5A 2RE1A 4IO9Q 1DJ0A 3Q2TC 4NX9A 1V3RA 5G21A 3M8PA 3MMCB 1HD0A 4Z37A 1VHFA 2VJUA 1WDTA 1R0BG 1SKUB 1K0TA 1HBOB 4PKDB 2HB6A 3A1YG 1GQEA 4NZ6A 3CJKB 1YBUA 4F3OA 3H7HB 3VTIA 1Y0YA 4W98A 3GZ7A 1PAUB 3FMBA 5DG8A 4DV4J 4OYWA 1ROFA 3QT7A 4PG6A 1F3FA 4K0KJ 1F6TA 3PRDA 3VGVA 4X8IA 3C3LA 1IR1A 2VV5A 4DV4F 2OPSB 3UN3A 4DV1F 2FD2A 2XHWA 1XC9A 1FESA 4UEEA 3E2EA 1JWQA 3C66A 2UP1A 1EE3P 4P73A 3E0KA 3O5TB 1QVFR 2IY5B 2L48A 4N56A 3OL8A 3ZZ0A 1RTHA 2AQ4A 4ECWA 1I21A 2Z8QA 3FK4A 2KN4A 4ZN1A 1D9FA 3MPDA 4OJGA 2R98A 1NJWA 1IB1E 1X10A 3IWNC 3C6TB 5A6PA 2WVCA 1N6QB 4F2SA 3LWUA 3LP0B 5KFOA 3LF0A 2C3UA 4DUKA 1X8DA 3K8VA 3QAHA 3W63A 4W90B 5DM7Q 4FBTA 1Z4UA 4RW9B 2DHGA 4KY3A 1XMBA 3MAAB 5IQ6A 3VAMA 2AF6A 4X4NA 3B3WA 1NKEA 1VS3A 2WTFA 3OSPA 2VZ9A 4RBTA 4R3KA 4RUAA 3RO0A 1TL4A 3BGRA 2XYGB 3HI9A 1P9QC 1S7IA 4RNMA 3ZTPA 5JVHQ 4WWVA 2ASDA 3DRSB 4A46A 3IIBA 1NHKL 1SPBP 1IY7A 3L7PA 2MTLA 5ITHA 5FDLB 4P2FA 1UEKA 4Y2MA 1I5OB 2LQ5A 4KAIA 1M1GA 5C2GA 4NZ7A 1T9XA 5H84A 3M8ZA 5HK4A 4ZCMA 1WOSA 1LXJA 4K3NA 1VQOS 5EX3A 1GK8A 2RJZA 3DOMA 4H54A 2V50A 3QLHA 1JLEA 1V5IB 2WZ1A 2ALZA 4YEAA 1RT1B 3RG6A 2F8HA 1G3OA 5IB9A 5D0EA 3D3CJ 3UI3A 2BQUA 2HWIA 3KWMA 2KHCA 4UBRA 3QATA 2DGTA 3IMQJ 5GAHU 2VDIA 3M4XA 5ISVA 5G22A 1PAEX 2D9OA 4U8YA 3NGRA 2DNZA 1XMOF 4DV2J 1BQNB 4KOSA 3AHPA 2ZE2A 2PE8A 4ES3A 4BBYA 4ECTA 3OUYB 4KSIA 2RQCA 2HHUA 4OV1A 1AFJA 5JMNA 1OS5A 3W9HA 4OC3A 2FZKB 1RTQA 4YUDA 1T9WA 4QIVA 2C2EA 4NJQA 2DNNA 5DJBA 4CO4A 1UVLA 3TJ8A 2AYMA 2Q04A 2R7UA 2E29A 1GMVA 4FF1A 2P6GA 3K2YA 2MGZA 2M8HA 1HEEA 2UXDF 1M5OC 3BV8A 1JLCB 3C2PA 2Z3LA 4CYNA 1H7WA 2FIUA 5J2PB 1YLXA 3OTEA 2IFXA 4PQAA 3RB0A 5CZXA 3PFOA 5J2QB 4J9KA 2CZ4A 1F2GA 1U1MA 3RGIA 4PWUA 3DM2A 3DLEB 1E6VA 3NEKA 2HLTA 4NLTA 5FD1A 3VAGA 4KGMA 5HLFB 3IWXA 4JP8A 1R8HA 1YJRA 4ZY2A 3H5ZA 3QAYA 4R7MA 3TUPA 2DXEA 1TVRA 4WF9Q 5IM0A 1M5PC 1ELOA 4MFBB 3ENQA 2CNOB 2B5GB 3I0RB 5KFYA 1RA6A 3MFHA 1Q7YT 3PW4A 4LT6A 2CYYA 3CVKA 3IBFB 3OJUA 2JLGA 1NO8A 1S9FA 1LRZA 2J9EA 1GTHA 3MCMA 1GXTA 2AIRB 2OHDA 5CYMA 5F8LA 2WSFC 2DBBA 4EBDA 3T1YJ 5HMNA 4KSEB 2HVIA 2PVVA 4B11A 3MEGB 1XJWB 4PQUA 2Q43A 3OL7A 1DE4C 3G8QA 2ZZNA 2DNKA 1UPPA 3NNHA 2GIVA 3RRGA 2FJWA 2YWEA 3CC2S 2GANA 3L95X 4ELVA 1A9NB 1RBOB 5L9NA 1LW0B 1HKAA 4N77A 2CKWA 1WG4A 3N5BA 2D4PA 2CWXA 5HP1A 2HVZA 3KLFA 2X7IA 3HXMA 4DR5J 2Y8WA 2PI5A 4YWYA 4OZNA 4ILRA 2V34A 3RU0A 4TY8B 2VPZB 2Z3KA 1U1OA 1OPIA 1ZM9A 1LFPA 1UA0A 4OHXA 4RX6A 1ACMB 1JXLA 1S7KA 5F47A 2EC2A 2QVPA 4TNOA 5CYJA 4X2TA 1ZG7A 3Q8PB 1HIYA 2CPEA 1AXQA 1N5QA 4ZBGA 2M2BA 2V94A 1S9EB 2YKPA 2P5VA 1TFYA 3IRXB 3L2NA 5J1QA 2LCWA 4U7UK 3QGHA 1CPSA 2HHQA 1GTEA 5GAGU 1S0OA 2FPHX 4QQBA 2RRNA 1FRXA 2KM8C 4EUVA 5ETTA 4RUHA 2VJVA 2FT0A 1XJOA 2ZHAA 4C7HA 4ERDA 4LF7J 3U1NA 2EC0A 5CXTA 2DNLA 5CYQB 4RNHA 2QEXS 1IBCB 2VQFF 5LJ5Y 2AP6A 3I31A 4HTJA 2AFZA 2Y8YA 5ETKA 4ECZA 4JI3F 4K50A 5SZTA 4PYDA 1JLBB 4LF4F 2IMWP 3TX8A 2ZOGA 4AXVA 2YWHA 3PRBA 2DITA 4X3RA 1Y5IB 1JNZB 1EETA 1RTJA 2DNYA 1TKFA 3U7JA 4UFWA 2WBMA 2VKRA 2P6TA 3RUBL 3DMJA 2E1CA 3RTVA 4KKOA 3Q24A 4C8KA 2HV2A 1SH2A 2KRRA 3TUIC 3TZYA 2I00A 4P71A 4CM2A 4ILMA 2DNRA 4MKAA 1UCNA 4CLSA 3OQ2A 3V81A 4AVAA 2C2KB 3QNVA 3IWWA 4LR9A 1N5SA 4X4RA 2HQDA 2ADBA 3H4QA 1O5JA 4DYOA 3CMES 2BYCA 3D2WA 3SMZA 3PCOB 4TQSA 4HKQA 2C2DA 4TLRA 3HVTA 2HNDB 5ETNA 4LQ9A 4B9TA 2XZDB 2E66A 4KGXB 3W2WA 1HNVB 5I4MA 1SL0A 4KVXA 1NDLA 2YQ3A 4ANCA 5HQ8A 3CO0P 1ITPA 3NCRA 4Q7AA 3U02A 2AEFA 4R8FA 1L3TA 2HHHF 1W25A 1EP4B 3CTRA 4E0AA 1Y00A 2EK6A 1TP7A 1HQUB 1OMSA 3C15B 4ZVQB 2C3MA 1NDCA 2JFDA 4ED4A 4DU7A 1V9OA 2HZVA 4MAKA 2BOAA 1T05B 2JEFA 2B6AB 1M4LA 2BW7A 3HDSA 3OHAA 4HDHA 4X66F 3TO6A 1JKHA 3N6LA 3CD0A 4R3LA 5F3TA 4OX7A 2CRLA 2LLZA 3TVKA 2RF2A 4B6ZA 3CB4A 3DOLA 1A6LA 1DTQB 3MCOA 2W2NP 3EVMA 4GO7X 3GUXA 2VG5A 2AX0A 1HWLA 4QPTA 2EFPA 5I42B 2DCUB 5J2NA 1S49A 2C6PA 3MOZA 1N36F 4EZ9A 1MW7A 4YB6A 3KUGA 4AG7A 1X9WA 3CC7S 3I82A 2BW2A 4BLGA 4WFNQ 3CCSS 4P74A 3TUJC 4RKUC 4U8VA 1R8BA 4C2MA 1S1XB 1YVFA 2Z30B 2BANA 3HHKA 1QSOA 2F8EX 2VZZA 4XAKA 2VG7B 2BQ3A 2QT7A 2RU9A 4C4WA 4WZQA 4OYMA 9RUBA 1S0MA 2RQKA 1X0PA 5F9LA 3B6BA 5KG1A 4ZCIA 5BR8F 4OKOA 4WKRA 3RBUA 1SQEA 1TR0A 1NK9A 1RT5B 4ED8A 1RT3A 2ZBQA 3K58A 2I8EA 3SI2A 4O0NA 2HFSA 3BLNA 1S6UA 3AJDA 4XPDB 3SFGA 2GQQA 4KH1B 2FIWA 1IJEB 3HUVA 4CAVA 3TA1A 3ITHA 3D0IE 2JEJA 1B99A 3OFEA 3BM7A 3G8TA 1C1BB 1RT4B 3TT2A 4C8NA 2MQLA 2VBXA 3M2UA 1NSQA 3N79A 4CGOA 3RBXA 3W8GA 4DR2J 1IU8A 3ENWA 3OD2A 3UDEA 2OH2A 4NRTA 6CPAA 2DHHA 3HK2A 3KJFB 2DGWA 5FLXY 2MDAA 4C2ZA 2KXHA 3H8EA 4LFAJ 3SEOA 2REEA 2W7AA 2BE2B 2XMVA 3A12A 4ZS6A 3VGSA 3F56A 4KPCA 1U6ZA 4BINA 3K89A 2PJCA 1DQ9A 2CQDA 3A13A 4LF5F 7FDRA 1OIAA 3K5PA 4USIA 1D8ZA 1CSJA 3N9UC 5K9FA 5BYQA 3LAKA 4EO8A 3GFXA 3MM5A 4PPDA 4XDCA 5DLFA 2MLXA 1TKTA 4H6UA 2I5JB 1NBEB 2I0XA 4YB5A 5GADI 2G1DA 1YK3A 2XO6A 4X66J 4P4EA 2C3OA 1WTFA 2VI7A 3GYXB 4JJXA 1OYDA 1N5YA 4NXYA 3LAMA 4ZJOA 4B14A 1RP5A 2A1BA 2QSFA 3NG8A 3N0VA 1UZDA 3TUZC 2KG0A 2OZGA 4JYWA 5AXKA 4OYPA 4G1PA 3D7HA 5DETA 3ISXA 3HHDA 1RT7A 5D4OA 4OX6A 1T94A 2WSEC 3WR7A 1YW6A 1PG5B 1HMVB 1C0TB 2EUIA 5H9EJ 3VF0B 4NGMA 3TYTA 3GG1A 2KKHA 1DRZA 3MPWA 3B3CA 4LVOP 2MKCA 1TL5A 2LQJA 3QB8A 2I2YA 3QFHA 5HMYA 2P0WA 3SI1A 1MSWD 4ONUA 2HBZB 2HPUA 1KUVA 2V4JA 4FXWA 4A8SA 4OYIA 2V8HA 3MMBA 3PIOQ 5CZVA 4DV1J 2DGQA 4DR7J 2OEJA 1CLFA 4RW4A 2FY1A 3JSRA 3W9IA 2IC3A 1RJJA 2LXUA 5CCMA 1H2TZ 4F4XA 4WPAA 3EGWB 2H3EB 1TUWA 1Q8LA 1NXIA 2BKOA 1E6YB 4JI0J 1O51A 2Z10A 1KLMA 1KZFA 2FJDB 2WSAA 4DJBA 4FD4A 3Q8UA 4DPWA 1RWUA 2W2PP 2DRBA 1S1WB 4JZ0A 2FC9A 3CWJA 1SJ4P 4L75A 1VLOA 1WG1A 3J81U 1JLAA 1PIEA 1RHRB 4FVMA 4DX8H 2V69A 2KFYA 2GVZA 3IM9A 1ZETA 5AGEA 4PSXA 4ICLA 3A8JA 3VHQA 4MBUA 2QLJB 3LGHA 1FA0A 4IYQA 1CULA 1KBRA 5HH1A 4ORFA 3KK1B 1FWKA 2D69A 4V19J 3O2IA 2OI2A 1HBUA 3VH9A 1N8RT 2NPFA 1RBAA 1FRJA 2I1RA 4NLVA 4FD7A 3M6XA 3M32A 4G1QA 3UNGC 4USKA 2AYEA 3VR1A 2PC1A 1KNZA 2V9KA 3FX6A 3MUVP 2QYVA 1QUPA 2D3OR 5EDWA 4RN7A 1T03A 2HHXA 1Z9UA 1XMTA 1OY8A 4LR7A 4R76A 3T1AA 4M94A 2J6TA 5LMNJ 3IWGA 4ZIWA 1ZM2A 4TXSA 4NXMJ 2MSSA 4DL4A 1X4FA 1URRA 4ZPCA 3G6XA 1HDQA 2OPQA 1CPXA 2RKIB 3AA8A 2VHGA 1B0TA 4ZDNA 2CWKA 4DSJA 1CPZA 3DR6A 2R8HA 4F26A 1ZYQA 1RT6B 4X4SA 2DYAA 1RCXB 3LTOA 4FYWB 4UZBA 2BJ8A 2Q44A 3EWGA 2MKSA 2X1AA 2XNQA 3SSSA 4TNUA 2AJFE 2KDOA 5CH7B 1ZO0A 2D41A 5LXYA 4MKVA 1K44A 4DV3F 2F9DA 4OX9J 5KFUA 1Q95G 3QYYA 2HSEB 5E3QA 1VBXA 1S6QB 5A8RA 3QO9B 1Z4RA 3TAMB 2C1EB 1Z8LA 4ZVFA 1M1HA 4OHYA 2XG8A 4JI1J 2PVWA 1S79A 1UMJA 1JIHA 4OZ2A 2R7SA 4NYZA 2K3IA 1U0SA 8RUCA 4WFZA 4IG3A 1JJ4A 2CIJA 5KT5A 1I3OB 1IM6A 2NZCA 2Z58B 3CDWA 1N48A 4BDPA 4ED3A 2HG4A 4R5PA 2NQPA 4ELUA 4OFZA 1BUXA 4A47A 3K5LA 5D29A 2OPPA 1VQ8S 5JPHA 2X3DA 2HFNA 4NASA 1YBTA 4QOTA 1M5VC 4E98A 1QY7A 1Q2DA 3GU0A 1MLAA 1B0VA 5C25A 2O53A 4J9SA 3CF5Q 1HNXF 2NPIA 4J5OA 3V4IB 2KO1A 2FJXA 3E01B 4XPKA 3N7ZA 3P2HA 4ANEA 1LWEB 4I56A 5D4PA 3RB6A 2EW9A 2YKOA 4G3IA 4X4PA 3JYTA 5IT0A 3QT8A 2MZJA 5EMIA 1U1NA 2DVIA 1IBMF 2Q4YA 3CEDA 5EUHA 2ROEA 2J0XA 3SXOA 1RTIA 3B2YA 4WE1B 4PV6A 4YY3J 4DI6A 2JEWA 4NE9C 1R0AA 1ZAVA 4UOHA 5EWFA 1XMOJ 2QMUB 1VDHA 3IU2A 1A0OB 2QMXA 2E1AA 2QMWA 3CJ5A 1JLFB 1RACB 4F7VA 3C26A 2YPZA 3MCSA 3CIMA 2HK3A 4CGMA 2EKNA 4OMFG 2VC0A 4YR2A 3EICA 2O1PA 3H4BA 3X3UA 1RWOB 5IQQA 3HFVA 2UUWA 2H54B 4OZLA 1MG7A 2ACMA 2H9ZA 4H4MA 3BJ7A 5AG7A 5IB0A 2RUGA 4NJRA 2BSWA 1KEKA 3BPSP 5IV3A 4ZP7A 2OPSA 3G86A 2QA4S 2LMIA 1XERA 3TARA 2Z3NA 2JH3A 1PO6A 1IJFB 2BEFA 5A28A 2ZWOA 1MMNA 2GV1A 2F40A 1RWNB 5HVHA 2WOMA 3HULA 1HLWA 3FNCA 1JLQB 5GADU 2FVCA 4NF1A 1UVIA 3HHLA 4AL7A 3PHTA 1EKSA 1N6QA 1OY6A 4YHHF 2CPHA 2CIMA 1UETA 5H9EK 3LUYA 1Q82T 3IN5A 3AXMA 3UNYA 2K8GA 2IQ6A 5F8GA 2PT0A 2CNSA 3H25A 4EEYA 3LP1A 2HBRB 2ZEGA 4ED2A 4MCPA 4L73A 3S6HA 2Z2MA 4Q0BB 4F8RA 4JI5J 4Z7CA 2VBZA 2W8KA 1DTTB 4RW7A 1RT2B 2FJEB 4X4VA 5DZ6A 2ZBRA 4UEFA 4DUZJ 3BGRB 3GFYA 2CQ4A 5C7PA 1NHUA 1GMWD 3CJTA 2CQIA 2WW4A 3RBEA 2XB2D 2R7VA 4PG7A 1VC6A 1GNKA 5DWMA 5E3AA 1NK5A 1JXVA 4B3SJ 4FS2A 1IKWA 1G1XA 1JNRB 1P0HA 1Z8WA 2HQGA 5LRKA 2POKA 4KR0B 4RNNA 4B3SF 5DRKA 3DHWC 5D0GA 2EO8A 1VRUA 2K1RB 3BR9A 3OXLA 1RT1A 2XBPA 3EZ5A 3H8GA 4URQU 3FJUA 5AXLA 3R6LB 1Z2ZA 4J91A 3CXSA 2JLEA 3LPEA 2VG6A 5CNPA 1QSNA 4ED0A 2LA6A 5FLXU 1GT8A 4ILLA 4J90A 4HNXB 3HZEA 2DY1A 1TKXA 4YRHA 5ETLA 4EFAC 2YNIA 3FB3A 4MIBA 1TMMA 5LRJA 2IAJB 5LT5A 1RUSA 3PR4A 3QZ8A 5KFWA 1NAQA 4O23A 1BGXT 2XTJP 2IJNA 5J1PA 2CJYB 3I6PA 1CBKA 2ZBPA 3A4TA 1FTRA 4JUZA 3ZZIA 4C8MA 2ZH6A 3FDSA 1D8YA 2CNKB 3K5OA 4ZY0A 2E5GA 1Q86T 1VQ6S 1Q5YA 1HBNB 3PW2A 2DPIA 2CQ0A 4OI1A 1W7WA 2KM8B 2GHVC 2D4OA 4J9UE 1XEZA 3GYNA 3W9JA 1KWMA 3FCVA 1RWKB 2G2ZA 4ID5A 4NXNJ 2QL7B 4FF2A 5LRGA 3P4UB 4JV5J 3EXCX 3OR1B 1SV5B 1ZM4A 4E2FB 1NSKL 2DPTA 4KO0A 1YK9A 2NZ4A 1RAJA 2XEJA 2VC1A 4P2XA 4HYKA 5KFZA 5D15A 1XK8A 3DRRA 1KHVA 3W6XA 1YQHA 9ATCB 2E5JA 5B0GA 2HZAA 5DQHA 2Y0BB 2HZCA 4P4JA 1ZTWA 4C3KA 4F4AA 3IAS9 1R0CB 4KYZA 2UVVA 3W60A 4J37A 5A8KA 1QAYA 4RU2A 2YH1A 4WIQA 2DKOB 5LYFA 1AROP 2VQYA 1OJ4A 4CAFA 2GJ2A 2KRBA 4IR1A 4LFAF 4OYZA 2NUUG 3M2VB 4NWBA 2QIRA 1C1CA 2DJWA 4O3NA 3MMJA 1LK7A 1RXTA 3CE8A 5KFGA 1S77D 2BV3A 1O6XA 4HL9A 3M30B 4DDFA 1ZTTA 5DO2A 3VCDA 2DR7A 3MAHA 1PYTA 1M4GA 2HBQB 2ZH3A 4F3QA 4HHJA 5RUBA 4DJLA 1UFWA 1T95A 1TKHA 1FERA 3WT4A 5K14A 1RWWB 4PCQA 4UY85 2DR8A 2RU3A 3WC2A 2MEWA 2XEXA 5GAEU 3FFIA 4F0MA 1K1QA 3BR8A 5C42B 3CCUS 3SQGB 2AFUA 5J1NA 1IXKA 1N5VA 4LIWA 4EWTA 3JUWA 2HQFA 5E2QA 1HPZA 3R5GA 2HIYA 1KLNA 1BWVA 3VQSA 4OJHA 3UQSA 2GJFA 5I3QA 5JM6A 2VUGA 2BUNA 2OUGA 3GSDA 1VRTB 2IM3A 1H6KX 3CCZA 4NA2A 4KOXA 1FFGB 2WONB 2GJIA 1RYSA 3PP9A 1RDRA 3TNVA 3CXPA 3MEKA 4QC6A 4JI8F 4EO6A 5KT3A 3W2VA 3T5JA 1N32J 4MFLA 2F4VJ 1SKSA 4LBPA 2Y1LB 1MU2B 2WAQD 4RZRA 3THVA 4HHHA 2O3DA 4DG1B 4FKYA 3QSYB 4PABA 1O8BA 2ZZTA 3KJVB 2R7RA 1X9SA 4DPYA 2CQ2A 1ZA1B 2W1BA 3QJPA 3EX7B 1T11A 1B64A 3OLBA 3IR6B 3PEJA 2PMZD 4LSZB 4WZMA 3NS7B 1TL3A 3DI6B 4DLGA 5A2QY 2WPWA 4OQJA 4LF9F 2BEIA 4WK3A 1KUXA 1MJBA 3VWEA 3FQLA 4I2QB 2H5IB 4KT0C 3RYLA 1KDNA 3OTOF 4KKOB 4ANDA 2RB7A 4PK2A 4Q2MA 5EGYA 1HW8A 2AU0A 1CJWA 3TOQA 3PO4A 2FZGB 4X62J 4C11A 3AB2B 3OSNA 3TEGA 2Z0ZA 3KLHA 1NH8A 1RXOB 5IWAJ 1L5UA 2B8PA 4DS5A 4BS2A 4U5YA 4CYUA 1NJZA 2NUHA 2DNPA 5C24A 4DR2F 3R9EA 3Q8RB 2W2OP 2YTCA 1W2BR 2GW8A 3AJ1A 4EZ6A 1S0NA 2W9BB 4IQXA 4CAEA 1RTHB 1U7LA 3OW2R 2XS5A 1U2FA 1BO4A 3T1HF 2YNCA 1IIDA 2K5TA 1L3SA 3MM7A 4MY0A 2N4CA 1TL7A 3D1QA 1Y9KA 1S1VB 1QDUB 3SCJE 4WTYA 2HHWA 3O8WA 1R89A 5KFJA 3BYRA 1UEUA 3OVBA 4NCGA 3CCWA 4ZPDA 1FCAA 3KLGB 1HNZJ 3QWUA 2NS1B 3AQOA 4RW9A 1RE1B 2YKAA 2YXLA 4NGRA 2G0JA 3H20A 1Q1KA 3PRTA 3BSCA 2H1YA 3NNAA 1PC4A 2OOTA 1YRUA 2GZOA 3BGFA 2MKIA 4I2PB 2NLWA 4AT1B 3RAXA 1XR5A 2CDQA 1QTMA 3FECA 5G0RB 3V8IA 2YX4A 2LDIA 3TP2A 4A31A 4C9DA 1TELA 2EVZA 2MXYA 4ZX9A 4NYPA 1J5EF 1CJUA 5GAEI 1NPPA 1NJIT 2OP5A 3BJYA 1RHQB 2ATRA 4CLYA 3KHRA 1T02A 5HATA 4JB8B 4LSLA 2HNZA 2LU2A 2FLOA 3OFGA 1H2VZ 5LM7E 4FXVA 1IBKJ 5D0RA 4PUOA 2W01A 3UN5A 1TV6A 2F4VF 2ZUGA 3ULHA 1RWVB 2BM1A 3SV3A 3BXMA 2YQ0A 3TE4A 4CPAA 1VQLS 3JTNA 4C0BA 3BDPA 3BQ2A 3PB6X 4USHA 1M1KT 3FGVA 4IH6A 4PXEA 1LW2B 1YHQS 3BBCA 1RLCL 2DH7A 3H8YA 1RAOA 2ZNYA 2WBRA 4MYTA 1N33F 2M4MA 3Q22A 2J8RA 3KOAA 3FVYA 1X60A 3D4UA 4A32A 3HD1A 2B3VA 5K20B 3KFWX 1BQNA 2MSTA 2BKNA 4QIWD 2OSRA 4DUYJ 5KFEA 2V67A 2BMBA 2QLXA 1I94J 4DZDA 2XQCA 2V9WA 3OUYA 2ZEMA 1B87A 4QB9A 1SKWA 3S6FA 1MNEA 1KUYA 4ZN3A 1DQ8A 3LP0A 1RT3B 3N6NA 4M5LA 4M5JA 1EARA 4DR1J 4JI3J 2BRKA 4CO5A 4RBUA 2AJ4A 3K0JA 1Y4ZB 2DR5A 5KFAA 1N88A 2O28A 1WEXA 4HR2A 3WABA 4AXJA 2IMOA 3M8SA 2ERRA 2GS8A 4JI2J 3UDLA 5EWGA 2JVRA 4OC0A 3G87A 3G9CA 1ZM3A 2YVSA 1N56A 2ZH7A 3BEGB 2J76E 3HZGA 4LJMA 3MWBA 3KR4A 1S6PB 2PJ1A 2HS4A 1R3NA 3DM2B 5CCLA 3B8HA 4I68A 2C27A 3RNZA 4R57A 1QE1B 4R8UA 1ZAXA 1YVOA 3HKZD 5I3UA 5ETRA 1QSMA 3SZ2A 3GYAA 2BE2A 1NKCA 3KDOA 3DLGA 2QYGA 1J27A 2UUBJ 2AJ2A 4ZPTR 4F50A 2GMHA 3DXBA 1KQGB 1RAGB 1HQEA 3FEYB 3QIPB 2FVSA 4LFBJ 2DGUA 1V3SA 3W5XA 4I7FB 2DIUA 2KFZA 2H5MA 4BD9A 2PJ7A 1UL3A 8AT1B 1OYEA 2IRYA 4OAEA 1RAFB 1Z5RA 4UZCA 3LQVA 1NZAA 2FDNA 3J80Y 3ETMA 2B4OA 2FHJA 3CDXA 3NA6A 3TW0A 2WB4A 2J9CA 2V8PA 2ZM6J 4CIOA 3ZXWA 2ZW4A 3LGNA 1S48A 2W4PA 1FJGJ 1Z8TA 1Q8IA 1SVDA 1U49A 1WK4A 4GM5A 3HP6A 5AE1A 1YIJS 4DQPA 2C28A 1XOVA 2L08A 3I5AA 3PJ9A 3DLLQ 3PR5B 3PYGA 5L8RC 1FWLA 1FDAA 5CQGA 1ZZNA 5E7OB 3PO5A 4PEOA 1C0TA 3NOCA 5SUHA 1LWFB 4Z65A 4NGPA 3CCRS 3ZZTA 4RW6B 3B78A 3EJMA 5J2QA 1A7GE 4KTQA 2E5HA 1YZ6A 4XPDC 3DDIA 3IR5B 5HQLA 3R96A 1E6VB 4TU7A 3BQ0A 3FRZA 2BJEA 1DZ5A 5KTQA 4CZCA 5KFBA 2FJBB 2A6OA 5DQGA 2C3YA 2B5GA 4MJ8A 1UVMA 5KFKA 5A8WA 1IICA 4XNHC 3D54A 4B3TF 5F49A 1XIQA 2FVRA 4X4UA 1NRKA 4MFJA 4JYAF 3KG1A 1X4DA 5F8IA 3NAIA 4FD5A 1QSTA 4R0JA 2AYGA 4OZJA 4Y00A 1YRTA 2PQ8A 2KVIA 1IKVB 1PJ7A 2E1PA 4F0XA 1H3DA 1K1SA 4IUSA 5A0YB 4UY8T 1IVZA 2CTCA 2I6WA 2IRUA 3ZFVA 4M85A 2H5JB 1RABB 1LEOA 2GC8A 2FTRA 3M9NB 4RL1A 1UA1A 2DRDA 1CS4A 1HBUB 2GLFA 1S76D 1P1LA 3BO3A 3WC7A 4ZPBA 3M8YA 4NLWA 4IK2A 3CJ4A 1U2CA 1FE0A 3NGKA 3MR3A 1Q8BA 3EC4A 4UQGA 3WIUA 4K4SA 2XMWA 3HVTB 2UXDJ 4F4ZA 3S9MA 1TQLA 4P4FA 3B4MA 4O4GA 3G96A 1U48A 3ILJA 2C2MB 3D0GE 2YQ1A 1WACA 1HYSB 5IZHA 1JJHA 4WFBQ 4FPIA 3BSNA 3DGPB 2E5IA 1YGYA 1MJAA 4EMEA 2PFDA 1H2UX 3QZ7A 1LNQA 2JWNA 1FFWB 1CJKB 1B3TA 4GVBB 3H2UB 4OZ3A 3MM8A 1TL1B 4FDFA 4MIAA 3V6DA 3KHZA 3NGTA 2ZJPQ 4KGVB 2RQMA 4U7UD 2XO7A 1CJVA 3PYFA 4AQYF 5H9FJ 3RZAA 3MTKA 3MEDA 4O4RA 4TVAB 5T7LB 1NK8A 3KZWA 1FO1A 3HHLC 2PE3A 4LF6J 5HJYA 3GB0A 1GXUA 4DPOA 2MY8A 3HJFA 3IO1A 2PJ0A 2FUG9 3MUMP 1NHVA 4UFVA 2XSJB 4I6AA 1CG2A 3DMJB 4NI2A 2BACA 3ISZA 2B7CB 3EO4A 5K8NA 5E0OA 3UWTA 4DV7F 4OZ0A 4MI4A 2CG4A 5JGFA 4WIIA 2CJBA 1K0VA 3J81Y 3MUTP 5KT2A 5J1EA 3NH8A 2EFNA 2QV6A 4C68A 3LH2S 1KTQA 3TA0A 2WB1D 2B56A 2J7WA 4U67Q 2MYFA 4ED1A 4OC1A 2ATLA 4FKXA 1F2HA 3DRPA 4B9SA 4ZVSB 2PIIA 1J5OA 1MN7A 4QZVB 3D3SA 2PJAA 1QSLA 3IG1B 1IR2A 2V2QA 3D67A 2DIVA 3JQMA 2QZ8A 3QLHB 1IN0A 1ZS6A 3W64A 3TO9A 4P6YA 4XPLA 2MQNA 2G4BA 5D77A 4OIDA 3EMTA 4IKAA 5KFCA 2CG8A 1LAMA 2YNCC 2FVQA 5BYSA 4TU8A 1RHKB 3FC9A 1J4JA 3LA0A 4DXLA 4N41A 4CLUA 2GQ2A 1IBMJ 2YX1A 4MFQA 3ETOA 4B9MA 2PSWA 1Q7LB 1VQYA 4BC7A 2BA9A 3C15A 5KFDA 3N4WA 4ZVRB 3D6FB 3H42A 4PR6A 3FSXA 2OIHA 4HT5A 2FZCB 3KXDA 2FHKA 4QIGA 1T3NA 1S3ZA 4KOVA 4KUBA 2YNFA 2B4PA 3CDEA 3EFAA 3LWMA 5KFNA 1WD6A 4JV2A 3PW7A 2F3JA 4NEYA 3S1TA 3QNWB 2VFUA 3J7YU 3AOAA 4ZLPA 2HVHA 2HFOA 2BJ3A 2CPZA 2MGZB 1LQ9A 3GV8B 1MMDA 4M5GA 2V68A 5IC4B 1I1DA 1YREA 4U95A 5IV4A 4WYWA 3F5BA 3JXOA 4M1KA 1F5CA 6AT1B 1FXLA 3B82A 4O3QA 2WK4A 1IKYB 4B5PA 3NGUA 4DFMA 4LUBA 4YMEA 2PJ3A 4ZY1A 3POTB 1QLNA 1WG5A 1WNEA 2I5JA 3BN4A 2M3DA 4KOUA 2G1HA 2CY2A 3ZNUA 3I87A 1HHSA 3VAHA 4PPZA 4B5OA 4CM0A 1REVA 3PG9A 2EBJA 2IM2A 4MY3A 5G1ZA 3P8BB 1ELLP 1ZG9A 2V2VA 4KIAA 1WC6A 4AFFA 2OR4A 2YNHA 4K4UA 2UXCJ 5FJ4A 2Y9HA 2ZPAA 2CNMA 4OJ3A 1NB7A 4TN2A 3T9ZA 4YHHJ 2OZUA 2ZNZA 4UUXA 4FYXB 3UDCA 4MYUA 2EK8A 3NWRA 1XNRF 2APOA 3AB4B 2CTBA 3OJSA 5KG0A 1DTTA 1NSLA 4BHQA 2W2QP 4Y2CA 1UVNA 4NLUA 3ET6A 3D7DA 2MPUA 3M6WA 3DYAB 1WHYA 4RUCA 4AL5A 4MK7A 1RO5A 3C16B 4HI2A 4CO2A 1RWXB 1RAAB 2ZOFA 4YU9A 4MTPA 3FXTA 3R2DJ 1EHWA 3CDBA 2QJ8A 4EMDA 2BQRA 4MFZA 3GWCA 4CT9A 2UU9J 4DCJB 3GPAA 3DNSA 2KYXA 3KK2A 5LSOA 1UWAA 3FBEA 4RO0A 5JUMA 3FCHA 4R25A 1UFHA 1YJVA 3NOGA 3KLFB 1FRHA 3FJ2A 2WVDA 4LRAA 1U8WA 2ZKUA 2OJ3A 4JI5F 3WC5A 2UUBF 1BPNA 4AYBD 1IOIA 3HLUA 2BRLA 5T41A 2ASYA 2EG2A 3UVJA 2XLJA 5HBMB 3MD1A 4LUAA 3FEDA 2HMIA 2DISA 2K7KA 1YVKA 1HL6A 4N5SA 3OR2A 3AT1B 2XS2A 3I3GA 4EFDA 1KQKA 2ACYA 1RKIA 2GAGC 4ENOA 2VBYA 5B0EA 1VHIA 2EEYA 3BPDA 4B3MF 2Q1LA 3M8QA 4CQ1A 3C6UA 3LALA 1CULB 4B02A 2B4VA 1QTNB 1V0CA 4P4DA 2V77A 1WOPA 3JTOA 5JXSA 3VVTA 2C2RA 4G1IA 5KFVA 4J9RA 1D09B 4WWSA 4BWMA 1CJTB 1ZA2B 3OWCA 2RILA 3O3LA 3J7YI 2J6SA 3CJQA 2A10A 3CJSA 4ZCLA 4QU7A 4NSQA 1U4BA 2JBJA 4QWCA 1CQMA 3GG0A 2ZVIA 1UWBB 5K8PA 3ZTOA 5JH9A 2V6AA 4M6GA 1FJ7A 1DHMA 3BBBA 3F44A 2C6CA 4DR3J 3NE7A 1LANA 2AFSA 7FD1A 2UXCF 1SC1B 3KASA 4DQSA 1VK3A 3F0NA 1S4FA 3I9ZA 3FYNA 2VXKA 1IOFA 4TY9A 1GX5A 1R31A 3E8OA 5G4DA 1TF8A 2N7CA 4OP4A 2M7SA 1VYAA 2Y1IA 2IM0A 1B6BA 2HNYA 3RJMB 1HNIB 2XWXA 1BPMA 2RIJA 2MLZA 5F48A 4MHNA 4DUTA 3H5XA 1HD1A 4M5NA 1PJ5A 4ZPAA 4OIXA 2EFGA 2QO3A 4DSIA 1L3KA 2O66A 2BR0A 1TU0B 4LX9A 5LYIA 2AGOA 4BC9A 1XWLA 4NYOA 2R1IA 4NPOA 5F8MA 3PB4X 4MRIA 2CF4A 1RTDA 4FF3A 1OPZA 5KT7A 1KR4A 4JOUA 4DNCA 2J0WA 4IG0B 5IC6B 1YJNS 3IU1A 1U45A 2BO9A 1W26A 2PI4A 1F9FA 3GCWP 3KLIA 4ICLB 1H74A 1YX0A 3GJRB 3D9BA 2A0FB 1SJQA 2M8DB 2CJXB 4B9NA 1XR6A 2HHPA 2C42A 3ZZZA 2NXUA 2XY5A 1AMPA 1BQMA 4QU6A 1F2PA 4I0WA 2CQGA 1OZPA 4E2AA 5HJXA 3BZQA 4G1QB 4DPUA 1H0HB 1WKLA 1I1GA 1H8LA 4B3RJ 4KB7A 4ZPVR 3D4JA 3GSIA 2DB1A 1QAJA 1VRQC 4NA3A 4DFKA 4MHZA 4FPRA 2RS2A 4OI0A 1HPZB 2XSFA 2OSQA 3KJNB 2GHPA 7AT1B 4LQ6A 1DTDA 3H5UA 4UFXA 2OMOA 4JWPA 2HHTA 3DOKB 2FIAA 3CT9A 2OU2A 3CJKA 2YKMA 1NDKA 1FKPA 3QJLA 1H72C 3D7SB 2VA2A 3MM9A 4CYPA 4FF4A 1VQPS 2ZEFA 1DY3A 2D74B 3D1HA 4WP8A 4ZJQA 1JXEA 1ZPVA 2HQIA 2ZXVA 1VJWA 3JYTB 2MZQA 4ZLLA 4M63A 3PX6A 4B3TJ 2MZ1A 1FNMA 2W4DA 4OYOA 1SJFA 4ZP8A 2CNNB 2BE9B 2PGCA 3O44A 3KJQB 2DO4A 2PR1A 1XE4A 1H73A 4WK1A 4F36A 3CCLS 4K4VA 2HAIA 3UD4P 2RQ4A 4EYHB 1BC6A 4LRBA 1VC5A 4KORA 4CGNA 5KG2A 2MQ8A 4N76A 3GP9A 3KR5A 4K2JA 3VGTA 3M1VB 2DXFA 4UEZA 2CPFA 2B3TB 2IL4A 1QM9A 2R7HA 2I3CA 2RNEA 2VFRA 4W4MA 3S9LA 4UCNA 2XC9A 2D3O1 4LF4J 1QMUA 1NK4A 3LP2B 3HSJA 5HLFA 1A2ZA 3BSOA 2AW0A 4U96A 2WOMB 3UW1A 5IFMA 4X2BA 3TQ1A 4ZVTB 2MQOA