2V8HA

Crystal structure of mutant e159a of beta-alanine synthase from saccharomyces kluyveri in complex with its substrate n-carbamyl-beta- alanine
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
431
structure length
431
Chain Sequence
b'LSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNAEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGHQFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-ALANINE SYNTHASE
publication title Crystal Structures of Yeast -Alanine Synthase Complexes Reveal the Mode of Substrate Binding and Large Scale Domain Closure Movements.
pubmed doi rcsb
source organism Saccharomyces kluyveri
molecule tags Hydrolase
total genus 159
structure length 431
sequence length 431
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2007-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v8hA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2v8hA01
3TC8A 2GLJA 1Z2LA 1F57A 3KQXA 2GREA 3FECA 4P4IA 3GUXA 3BI1A 1LFWA 3SJFA 3K2KA 2AFXA 4MHZA 2POKA 3V7ZA 4AXVA 3FX6A 3IC1A 4X8IA 1Z5RA 5CPAA 2F7VA 5K8PA 4Z65A 1BPMA 5ELYA 1DTDA 3FMCA 2I3CA 2F8HA 2ZEMA 3FVLA 5HVFA 3PBBA 4ZX8A 1OBRA 2VL1A 3D7FA 3B7IA 2ZENA 1GYTA 3KI9A 4NGTA 2QYVA 3WC5A 3ISXA 2C6GA 2PJ0A 3JRUA 2JBJA 2PJ9A 4YU9A 1VHOA 2Q4ZA 4DUKA 3D7HA 4MCRA 2PJAA 3NH8A 2OR4A 3PB6X 4RUHA 3D68A 3KZWA 1HEEA 4IAVA 3D4UA 2C1CA 4O23A 2V8VA 2ZEGA 3D66A 4F8ZA 4B6ZA 1CP7A 4ZY2A 2BO9A 4NFRA 1Y7EA 3RZAA 4MCPA 4WWVA 5LYIA 3S9MA 3WC7A 5JM6A 1PCAA 5LRKA 2V8HA 2PE3A 2AFZA 2ZEHA 5K8NA 3VARA 4NGNA 2CTCA 2NYQA 4DJLA 4PPZA 2WYRA 2PJ8A 5HVHA 2WZNA 2JBKA 1YMEA 3HUVA 3GLJA 2DEAA 1PYTB 1YLOA 1TF9A 4MHPA 3S9NA 2AFOA 3SI1A 1QMUA 4JYWA 4Q7AA 4UEFA 1CBXA 4OC1A 4MHYA 1IGBA 2ANPA 2PJ7A 3B3TA 3HLPA 1LAPA 3MN8A 1NSAA 3B3CA 3FEEA 4ONWA 1TKFA 3B3WA 4F9UA 2PJ1A 4OIDA 4ZYQA 2ZEPA 3SI0A 2O53A 1ARMA 4NGPA 4MHNA 4MCQA 1YW6A 1XJOA 2ZOGA 1HDQA 3KR4A 3PFOA 1ZLHA 3PFEA 1FNOA 2ZEEA 1R43A 3SJEA 4R6TA 2RB7A 1AYEA 4P4DA 5DS0A 4MXUA 4A37A 1BLLE 1FT7A 4EMEA 1ZG8A 2XEIA 3PB9X 3PBEA 1CPSA 1F2OA 5IB9A 4NGSA 3DGVA 5LYDA 3D67A 3PB7X 2CIJA 4OC2A 4KSIA 4ZY1A 5JGFA 2PRQA 4MCSA 3PEIA 1KWMA 3KHXA 1HDUA 1M4LA 4BD9A 4OP4A 2C6PA 3IWWA 4OC0A 2RFHA 5I4MA 5F09A 1LAMA 2IQ6A 4NGRA 4MRIA 2PVWA 1TXRA 2EWBA 4JZ0A 3VH9A 4A94A 4FAIA 2ZEDA 2O4HA 4P4JA 3BHXA 2AFWA 2IMOA 1XRYA 6CPAA 4NJQA 4OC5A 2GLFA 3NFZA 2C6CA 2PJBA 3D7GA 4OC3A 4NGMA 1CX8A 4WJBA 4OKOA 4NJRA 1Y0YA 3VATA 2BCOA 3KQZA 2V8DA 3FF3A 2PJ4A 2ZOFA 4IK2A 3LWUA 2OOTA 4PXBA 1CP6A 3B3SA 3KGQA 2V77A 2PJ2A 2ZEFA 5K8MA 4A38A 2IJZA 5LRGA 1XBUA 4UEEA 3IEHA 1F2PA 4YWYA 5HXDA 3DLJA 3RBUA 3B2YA 2PIYA 2FVGA 5CBMA 4H2KA 4ZI6A 2Q43A 3S9LA 1ARLA 4OMEA 3KASA 3WABA 3PB4X 4F9VA 4EWTA 3QNVA 1R3NA 3NH4A 4EFDA 3BXMA 5JH9A 4PQAA 3H8GA 4K3NA 2QJ8A 3IFEA 4PXEA 1Y0RA 3D7DA 1LCPA 5LYLA 2EK9A 3NH5A 1ZG7A 2HB6A 2G9DA 1BPNA 3FEDA 4LQGA 3CPAA 2XEJA 1RTQA 3ISZA 2XEGA 3PRTA 1VGYA 3KL9A 3TX8A 3CDXA 4ZX9A 2ZELA 3V38A 1CPXA 2PJ6A 2J9AA 3FH4A 2PJ3A 5D29A 3SJGA 4P44A 3L2NA 4P4EA 2PVVA 4OIWA 3CPXA 2PJCA 3WC6A 2EK8A 1JQGA 3LMSA 4X2TA 2ZEOA 3I1UA 2HC9A 2QVPA 4FBEA 1XMBA 4PXDA 3KR5A 4DYOA 1EE3P 3H8FA 3RAMA 1BAVA 2CTBA 1TF8A 1ZLIA 1H8LA 4R8FA 1Z8LA 3BI0A 1TKJA 3K9TA 4G1PA 2NSMA 3IJ3A 2AFUA 4P10A 4GM5A 4FUUA 8CPAA 4PXCA 1AMPA 4R76A 1LANA 1CG2A 2CF4A 4OC4A 5K8OA 1ELMP 3SI2A 1YSJA 5HVGA 3IO1A 3MRUA 4NGQA 1DE4C 4P4BA 3T8WA 2JEWA 4P6YA 3WT4A 3CT9A 1TKHA 4ZY0A 4TNUA 4P4FA 1ELLP 5J1QA 3SJXA 2BOAA 5LRJA 4UIBA 1Q7LA 4UEZA 4CPAA 2XEFA 1UWYA 4IHMA 4W9YA 3H8EA 4A39A 3KHZA 4FWUA 2PIZA 7CPAA 1VHEA 3FJUA 4MMOA 3B3VA 2AFMA 5LYFA 2PCUA 4R7MA 1XFOA 1LOKA 2Q51A 4TWEA 2AFSA 3NA6A 1QQ9A 4P45A 3PB8X 3GB0A 1IY7A 2PJ5A 1YW4A 1ZG9A 3N5FA 4X3RA 4UIAA 5THWA 2GU2A 2ABZA 4UF4A 2V8GA 3B35A 3IIBA 5D8NA 1VIXA
chains in the Genus database with same CATH superfamily
2KJWA 4LIWA 1MW7A 1REVB 4DSLA 4P4IA 2FVRA 4UOCA 3O5TB 3LO3A 4LFAF 4DPOA 2BMBA 5H9EK 5L1JA 1E6VA 2CNKB 5I3UB 2IYIA 4U6PA 1UW4A 4USMA 3FVLA 1DQ8A 2P5VA 2ILYA 3LA0A 3JVNA 3MEDB 1C2PA 1GTHA 4M5LA 3IWNC 4I2QB 4OZLA 4NLOA 4NLTA 3TUZC 4NF1A 1WHYA 1TMMA 2K2PA 4DUKA 2V69A 2C3OA 2GJ2A 4BCAA 1YLEA 2C22A 1H74A 3D68A 4I2PA 4IG0A 3DLLQ 1M4GA 5C24A 5CYMB 4K5RA 4PUOA 1H2TZ 5F3ZA 2ZEGA 1KONA 1XE4A 1N5VA 1SJ3P 2VZYA 3A9LA 2C2OB 3R1LA 4HKQA 5IFMA 1CC8A 3GP9A 4MK8A 4MFBB 2AYBA 4RW8B 3LUYA 1MJ9A 4IG3B 3GV5B 4JXRA 3TVKA 1L3VA 4BWJA 3AT1B 5AE3A 1S7LA 5C25B 5JVGQ 1RU2A 1VQOS 5JUMA 1M5OC 5GMDA 3S6GA 1Y3KA 4ATNA 3HLPA 5KFKA 1A6LA 5HK4A 2FPHX 4ETXA 2OEKA 1HYSB 2MLYA 4LX9A 2BJ1A 3R5DA 2IL4A 2X1BA 4KOVA 1Y7RA 2G0IA 1HFEL 5D15A 1X5SA 1N8RT 2MGZB 5ETRA 2F9DA 3A13A 4OLOA 3DRRA 1YZ6A 4U7CA 4ENOA 3PFEA 3F0NA 1S1XB 4FDFA 1GFWB 4AD6A 2BKPA 3TAQA 4D3GA 3K0JA 4USWA 3PNIA 1EARA 1VQ7S 3FRYA 3R2DJ 1PG5B 4C8LA 1WI6A 2BKOA 3UD3P 4KOSA 1KWMA 4KHPJ 2U1AA 1KBRA 1W2IA 1K1QA 4LSNA 1RT3A 3CXQA 1RT2A 4AVCA 1U8SA 1Q81T 2Q79A 3W9HA 1RE1B 3IWWA 4OC0A 2YNIA 1BQNB 1TZ0A 1IOFA 1QM9A 4NLQA 4W4MA 1WSVA 2B9WA 1D9DA 2G0BA 1RTIB 1M1DA 4C8OA 5CXTA 2EFOA 3FZBA 4L76A 2KH9A 2MZSA 5IS2A 1FFSB 1QUPA 1VHSA 4DX7A 2WSFC 2BYCA 3T5HA 3W61A 4OFZA 2XYHB 5KFDA 4R5PA 1SXLA 5L39A 5HLFB 2PJ2A 2X51A 1NBEB 1D0EA 2YX4A 3GSDA 3Q8YA 3TTHA 2HIYA 3MXHP 4A8XA 3HVTA 3JB9k 4CO0A 1RLDA 1U47A 1RT7B 4RNMA 1JLAA 5HANA 5KOWA 5BYSA 2C2RA 2DD8S 4H2KA 1L0CA 4H4MA 5J2NB 3W6XA 1GAOA 4Q36A 4UT4A 1NDLA 1JIHA 4DV4J 4ICLA 5G0RA 4LRAA 2OGUA 2DF5A 1E6YB 2P9GA 2R7UA 4PK2A 5IWAF 2XEJA 1RTQA 3ISZA 1OY9A 3RRKA 1N4LA 2QA4S 2J76E 4ED3A 1CJKA 2WONB 2XZTB 5KFUA 1K0VA 5D78A 3NMRA 1RYSA 3W62A 3TRGA 2NXUA 5ETOA 2R7TA 3HVRA 1NSPA 5KFFA 4I7FA 1LEOA 3LMSA 2ZEOA 1QVFR 4B3RF 4N8NA 3PZJA 1LFPA 3DU5A 4C8YA 1H8LA 4X5KA 3BI0A 4J9KA 2HQDA 1X10A 2ZFHA 3KHHA 5ETPA 2MXYA 1TKTA 2ZBQA 1DE4C 5KTQA 1TL1A 3SSRA 4NXYA 4EBEA 1XBWA 3FKBA 2IAJA 2DGXA 3VZIA 1UVNA 4NI2A 1LRZA 3UVJB 2QFIA 5KFZA 3QJJA 1KLMA 3M1VA 2DRBA 1ZA2B 4UQGA 2YKAA 2ZH2A 4CLTA 1RQ0A 1WHVA 5GVQA 4V1Ak 2VPXB 1U48A 1VQ8S 2PIZA 2DJWA 1S5ZA 3DLKB 4QZVB 3JSMB 3K57A 3O1LA 1OPZA 2F65A 2N4DA 3N28A 1QLNA 4ED5A 4FXVA 2MKSA 1YTYA 2Z58B 3D1OA 5D4OA 1XOVA 4ILLA 1YKWA 2GC8A 5LT5A 5KG5A 5FJ4A 4ZVTB 2BUEA 2DNQA 4R0JA 4I49A 3W91A 2BW2A 3ZTSA 1IKXA 3B82A 2OPRA 5B0CA 1UWBB 1WC6A 2GW8A 4P2MA 3BI1A 3KWMA 2EUIA 2KCWA 3PJWA 5J8FA 2C3YA 1IICA 2LDIA 1WOOA 3E01A 4PWDB 5F8IA 2W4PA 4DN0A 1BQMA 2ZEMA 1MN7A 3G6VA 3TZXA 2AD9A 2YNFB 2YWWA 4PPDA 2XQCA 2K7KA 1JLBA 5DG9A 4FKYA 2HNDA 1QSLA 3IRXB 3IRWP 1SKWA 2L48A 3ILIA 4ZPVR 4IAVA 1C0TA 3TUIC 1Z2ZA 3FCVA 4U9RA 3MMBB 2EWHA 8ATCB 2XZWA 4D3HA 4ZVSB 3VAFA 1RAEB 4N77A 4FF1A 2V34A 3UWTA 4LF4F 3N6MA 4X65F 1UA0A 4LREA 4B3MJ 4JI7F 2AZ1A 3MEEA 3TCVA 2YKQA 1RP5A 2RRBA 2ROEA 3U7JA 4F8RA 4K4ZA 2LXIA 4EBDA 4V19X 4HR2A 1RWKB 2H5MA 3DR6A 4L3NA 4RW9B 3MI7X 2AEFA 2DEAA 2KXHA 4QU7A 1RWPB 3LACA 5KFIA 1YLOA 3TT2A 4OX6A 4DQPA 2HKEA 2CQBA 4B3OB 3MFHA 1JLEA 2PRBA 1X8DA 4DL4A 1Y00A 2VBZA 4YDXA 2R7SA 1F60B 2HS3A 1RHMB 3D2WA 4DV2J 4JV5J 4ONWA 5ETSA 4ECTA 2FGOA 2V2QA 1PBAA 1S6PA 2PA3A 2C2DA 2CYYA 3WBZA 4FVMA 4QIGA 3HMJG 2CQ4A 2YTCA 3JTOA 2BEIA 2I5JA 3JUWA 3UN5A 4K4UA 2COLA 4UCPA 4JI2J 3EICA 5J2QA 5D8HB 3KHRA 2XI3A 2B8QA 3VWDA 1HKAA 2F63A 1HHSA 4R6TA 4TKTA 4P4DA 4UWIA 4PCQA 1CPZA 3KJQB 1SQGA 4BINA 4MFLA 2AZ3A 2D74B 2DNPA 1T94A 1KHWA 3TEGA 3HX9A 5JGFA 4DR6F 4ZK7M 2QMWA 3DNCA 3T1YF 2KU7A 3MUMP 4F2SA 1Y0HA 4CDIA 2JEIA 3GIUA 2HVIA 4DCOB 2ZM6J 5F47A 1JNZB 4KHMA 3G8QA 3NP5A 5HJXA 3CD5A 2KO1A 2A1BA 2CG8A 1Y9KA 3W3SA 2ZEDA 1F3VA 1WHXA 2DK2A 2HFSA 2HPUA 2VBYA 6CPAA 4O3PA 2VB6A 2Y3YA 3QT7A 3UR3C 3HFKA 2ZKTA 3JYTB 1JX4A 1MU2A 4AUKA 2XM3A 2YWGA 2M3DA 1NCLA 3VHQA 3OXLA 1RCXB 2IJZA 2DKOB 3R3TA 1N33F 2GMJA 2R7WA 2DNNA 3DLEA 4DPXA 4KOXA 4W90B 3NS5A 2ZJQQ 3IWEA 1C1CB 3IGNA 4EO8A 2ALZA 2UUTA 1S0MA 4RX6A 3QGPA 2E7WA 2FHOB 1MK4A 5KFPA 1WTFA 2EK9A 2ZZNA 1ZAWA 5ADZA 1NK6A 4P75A 1TIQA 2C2EA 2VZZA 3O2IA 2HNZA 3M2RA 3HJVA 2Q7SA 2UXCJ 2FHMA 4MT1A 4DQQA 3GCXP 3I87A 3L2NA 2XSJA 3UDCA 1RT1B 2J6UA 2EK8A 3MAAB 5T41A 4UQTA 1CS4B 1BWEA 4F4ZA 2DNMA 4OI6A 3G8SA 2LCWA 1HQUB 1EE3P 4LRBA 4F0MA 2WSAA 1X7VA 3IS9A 2MYFA 4MFPA 3S6EA 2IJRA 5DS7A 2B0GA 1VOMA 2CQHA 3DYAB 3UCZP 1HNVA 5C88A 3ETMA 2APOA 2B8PA 1Q53A 3MM6B 1HBUA 2YNGA 1JLGB 2VG5A 4P4FA 3MEKA 1HWLA 3CC2S 5LRJA 5I3PA 3ZZYA 1LW2B 3LTOA 3HHKA 4C3MA 3F56A 1EETA 2AYGA 5HSPA 2PC1A 1P0HA 4C7HA 2MEWA 2HWHA 3C15A 3ENQA 2AKWB 4RS2A 1VBKA 4L8AA 1LOKA 1MG7A 3LP2B 1SJ1A 1DTQB 3MAHA 2Z3LA 1TV6A 4CNZA 3R5CA 1FVSA 5ETLA 3C6TB 4B08A 2F1FA 1S1VA 2EVNA 5JQ4A 1AXQA 3OUYB 3HPOA 4WFZA 1S9FA 2Y1IA 2AEMA 5E7OB 2IJNA 5T14A 4CP5A 2W4DA 1O6XA 2VC0A 3ELHA 3R96A 2OP5A 2CPDA 1ZO0A 2M52A 2EG1A 5E3CA 5LMUJ 4TY9A 4JV2A 3KLGA 2A2CA 4K4SA 1OBRA 3NGTA 1TMJA 5CH7B 1ZAVA 4FZVA 4FPIA 4JI8F 4FD4A 2EBEA 5EUHA 3JAMY 4X4TA 2DITA 2XCPA 4X66J 1UZHA 4WU2A 2HRUA 2Q6CA 4MCRA 5A8KA 2ODFA 2XO7A 4LFCJ 2QC3A 3L09A 1QSYA 3D4UA 4C2ZA 5GADI 2PGCA 4LF8F 3EPIA 4W92B 1WDTA 3M2VB 2WAQD 3BN7A 4IFYA 1GXLA 1XMOF 3Q0AA 2OTJS 1LNQA 1NHKL 4QPXA 2AF6A 2CVIA 1XIXA 1RT6A 2OPSB 3I96A 1L3KA 2YWHA 4BWMA 3HK2A 1ZYQA 3KJVB 2P6GA 3UQSA 2CTCA 1X4GA 2NPFA 1I1DA 1WC4A 1IVZA 2JNJA 2C3MA 2ZH6A 1AFIA 2JBKA 4P52A 2RC4A 4P2XA 4RU9A 4P73A 1UVIA 2HNYB 2J8RA 3GY9A 1VQNS 2WUUA 3S9NA 2AFOA 3SI1A 2QG9B 4ECVA 4KV8B 2VHGA 2Z2ZA 3BGRB 4WXOA 1T05A 4ALZA 4WZMA 1UCNA 4XDDA 4IR9A 4Y00A 4NASA 2EPIA 2KHCA 2RHSB 2R2UA 2O53A 1DLOA 4M6IA 4TU9A 3FMBA 2ACYA 2GS8A 4MHNA 3JAMU 4OLLA 1LQ9A 3MPDA 1RCOB 4FF4A 5CHCB 2LQBA 3UW1A 1QTNB 4AFFA 5F8GA 3H5YA 1R43A 3GU0A 3WC2A 4B9NA 1AYEA 3BM7A 2FDNA 2BABA 3BH7B 3EZUA 1BLLE 4CRZB 3PB9X 3RW6A 3HSJA 1RHQB 3BQ0A 3TR5A 3DGVA 1FVQA 4OI4A 3G8TA 1VRUA 3C16A 2A3JA 2LDYA 4EFAC 4X4UA 1HMVB 3CJ0A 5LXYA 2ZD1A 2C2ZB 1RTDA 1QE1B 1X4HA 2MJUA 1S79A 4QWDA 3FRMA 1J4JA 1FDNA 3FNNA 1GTEA 5IZHA 4YEAA 4KSFA 1UPMB 1R89A 3C6UA 1T9XA 3TNVA 2FCKA 3ZJ0A 4MFQA 3GR0A 1FF2A 1PSDA 1P9QC 3QZ8A 2JH3A 4NGMA 2MSTA 4K7QA 4O3OA 3LD2A 4NJRA 1X5OA 4Y49B 3M8PB 4RLEA 4NE9C 1TL7A 3SBMA 4BBYA 1KUVA 3NBPB 4LRFA 2JWNA 2ZKUA 2AP6A 2B56A 4UEEA 3J7A1 1Z1ZA 1RDRA 1UETA 2BDPA 3PKMA 2BE2A 1FNMA 2WVEA 3M8WA 4OV1A 4QIEA 3PB4X 5L38A 1BLUA 1UA1A 1NDPA 1S7KA 4NLVA 3GFXA 2WPXA 1RAIB 2HHWA 3EGWB 1TELA 3JS9A 1IWAA 4UFVA 1NAQA 5H86A 2OSRA 4ANEA 3FEDA 2VDIA 4LR8A 2IFXA 4GS4A 2E9RX 3KL9A 1GT8A 3D8PA 2P8IA 2ZELA 5AG7A 1ZM2A 4TY8A 2ZH4A 1U25A 5HROA 3BSOA 4WIQA 2YKMA 4KC5A 3WC6A 3GCWP 2CPIA 5LMNF 5F8HA 5F8LA 2VFSA 5AJ3F 5F9NA 2HC9A 2CNMA 1FRXA 3GG1A 2W25A 3HF5A 1FEHA 2ZHAA 4LF5F 4IG0B 4A47A 1C0UA 2ILZA 1X4FA 1U6ZA 1QD1A 4G1PA 1WOPA 1PC5A 1KUYA 8CPAA 1NH7A 1AT1B 1ELMP 4JV5F 1YSJA 4YDDB 3KLHB 5AG6A 5LOQA 2FIUA 3M2UB 1QAIA 4R9MA 4KQZA 3D1HA 4LF6J 1Z4EA 2A6OA 3WT4A 1TKHA 3M9MB 4TNUA 3BPSP 2GGPA 4ID8A 5G4DA 5H9EJ 5BYQA 3PKYA 2IM1A 4JI2F 2EFGA 4HTIA 3B78A 1JWWA 3MD1A 2LKZA 1S49A 3ZNJ1 3KHZA 2JC1A 3M8QB 1EB0A 4II9A 3U27A 2UXDJ 1WWZA 2VFRA 5LYFA 2D9OA 2AJ2A 3DU6A 3EDRB 1U1QA 3KNGA 4CYUA 3MM7A 5LSOA 5FD1A 3FVYA 5KTAA 3NGUA 1N36F 1KFSA 3EXNA 1PO6A 1BHNA 3WHIA 1IB1E 1NEEA 1X0PA 3VAKA 4PZVA 3SDEA 2ZM6F 2AJQA 3KQXA 1SH3A 1S6QB 4USJC 2R7OA 1M1KT 1CJWA 2BJ7A 2KFYA 2HVEA 4C4WA 4URGA 4AXVA 3IC1A 3GYNA 2OFGX 4DMZA 4NLXA 4ECWA 1RT5A 4ECXA 4CRJA 1U1RA 3J7Z5 2NS1B 3ISXA 4NXMJ 4EGLA 1K8AT 4QWCA 2GANA 1FDAA 3GIJA 4OX8A 3NH8A 1RO5A 2F4FA 4LSNB 3W2WA 2CNNB 4XK8C 5AE1A 1RT2B 2GMHA 4GKJF 5KG2A 4OX9J 3MECB 2DNHA 4UUWA 5J8CA 2AT1B 2CPXA 3DXSX 1TTHB 4F8ZA 1FERA 3PZPA 4KRWA 1RTHB 2UUAJ 1KVKA 3P4UB 3C2PA 5LXRA 3FDSA 3F0AA 1Q86T 3AA8A 1XNRJ 2KL8A 3G71S 3DHWC 3P5TL 1N0VC 5KFEA 2ZXVA 3NCQA 5F49A 4CTAB 2E7VA 4UZBA 4HI2A 4WZQA 1TF9A 2C27A 4CLLA 1OYDA 4USUA 4R3LA 3DRXA 4HNYB 3TQEA 3EX7B 2ANPA 2BRKA 1JLAB 2BJ9A 2EVZA 1L3TA 1FJGJ 3U1MA 1FWLA 3FFIB 4B10A 1DTTB 4O4GB 4K50A 3BR9A 3OHBA 2PIIA 4LJMA 5FDLA 4GRSA 1U24A 2GIQA 2HHHJ 4JJXA 5IV0A 2VG6B 3VQSA 1R57A 2OTLS 1YW6A 1T9TA 3RB6A 1WF2A 4IOAQ 2JLEA 3LOUA 2DGUA 4KGKA 2J6SA 4MIWA 1CJKB 2Q0YA 4CGMA 2N4CA 1ZG8A 2XEIA 2ZITA 2BW7A 1Y9WA 3TZYA 4PEOA 5DM6Q 2B4VA 3IWLA 4I7FB 3PB7X 3OT9A 1SC4B 1QTMA 4HHHA 3GV7B 4A8KA 1FJEB 2PRQA 3R6LB 2E9ZA 4K2XA 2ZNZA 3WX8A 4B12A 2JFKA 3TAMA 4GKKJ 1S9GA 3ZZOA 1TXRA 1KRPA 1TKTB 3VH9A 1TL1B 5DZ6A 3AD8C 4CAVA 1Q8IA 4NI2B 2O4HA 3FCHA 3FSXA 1XRYA 3M32A 5E2QA 3SQGA 4DUZJ 1KLMB 3EVWA 2W8KA 3N7ZA 3M1VB 2PJBA 3K59A 2IMWP 1JB0C 1Y0YA 3TFYA 3MPWA 2NCKL 2XGPA 2V4RA 3I32A 2A0FB 1PKUA 4FF3A 4C3KA 5ETNA 2G1DA 1FKOA 2Z3PA 1FE0A 4MHDA 3UD5A 2PO4A 2UU9J 1P9YA 5KG4A 4E8UA 3DHXA 4C2XA 3VCDA 4ECQA 4X66F 4QC6A 1SQEA 2ZZTA 3KHGA 5HXDA 2AYEA 3CEDA 2DR5A 3B2YA 2A6MA 1N6QA 4F4YA 4WK3A 1HBMB 1K47A 2DBBA 2IVFB 3IGRA 4TQSA 4DFKA 1R3NA 5JH9A 1P4NA 4KH1B 2OPRB 2OEMA 3QAYA 3D7SB 3VZHA 3DRPA 3DSBA 4WFAQ 4O0IA 1SJ4P 1Q8KA 5AG4A 3EC4A 1BPNA 3NCRA 1XMQJ 3QIPA 3CPAA 4KGMA 1B0TA 3H42A 1N34J 2ZVIA 3V6DA 1BQMB 3CJKA 5C42B 1WK4A 2PI5A 5EX0A 4NYZA 5IT0A 2AWZA 1YHQS 2E5GA 3NAIA 2CKWA 4A8YA 3RGIA 2Q4VA 3BBCA 1WKJA 1RWMB 2K1RB 2GO9A 3V6HA 1JNRB 6FDRA 3N79A 2E5JA 2IVMA 2RRNA 1Y4ZB 3QT5A 1TVRA 1Z8LA 1M90T 1RTJA 4C2YA 4P10A 4QR2A 2OI2A 2I00A 4EMDA 2J7WA 3KNAA 3QAUA 4OC4A 3PTWA 1R8BA 2PSZA 1WJ9A 2YH0A 5F0UA 3ZNUA 1RT4B 4KVME 1JXEA 1FEEA 3SCIE 2ZW6A 2JEWA 3MEEB 2YWKA 3QGIA 5GAHU 1X9SA 1UWYA 1VQYA 4RR5A 4KIAA 5EN1A 2OAUA 3FJUA 5G22A 3TZWA 1HR0J 4QR0A 2HIQA 2N82B 3N5BA 3PB8X 1HD1A 3MF5A 5J2PB 2DISA 4NZ0A 4WKRA 3U02A 3TA0A 3GMGA 4UIAA 3M8YA 1YRTA 4DF4A 5BR8F 1UKUA 3B54A 1VISA 2L9WA 1XNQJ 1KP6A 3QJLA 4HACB 2V8GA 3QPIA 1S6PB 2VJVA 3TUPA 3E0KA 4HHUA 2XTJP 2KB2A 1TK0A 2PC6A 4QW8A 2WW8A 2I5JB 2KM8B 1LV5A 2GFFA 3UN2A 2GVZA 5IV4A 4E0DA 1I51B 3P2HA 3V7ZA 3CCMS 4DUYF 2LEBA 3FZ2A 3W8GA 3OL6A 3MUTP 3FEYB 2DY1A 2HLUA 1S0VA 2VDHA 4IRKA 1HD0A 2AJ4A 4KGXB 3HFVA 1WHWA 3Q83A 5DLGA 4OYWA 4CAFA 3BB5A 3MR2A 4NCBA 1HPZA 2HQGA 5KFQA 1U1PA 3GSIA 4LFBJ 4U7UD 2Z0ZA 1OIAA 1WUUA 4G3IA 5IM0A 4DI6A 1F6TA 4KB7A 4ITSA 3BGUA 4ANCA 2BO9A 4PSXA 2WK4A 2DXFA 3BDPA 3CD7A 3IN5A 5I42A 5LYIA 3WC7A 4HT5A 3D6FB 1JLFA 3OTOF 3D2MA 2ZWPA 2P0WA 2RF2A 4USKA 3Q8SB 1IBLF 1O0PA 3R9LA 3C46A 3TO8A 2NYQA 4PPZA 3NS7B 4YGOA 4UOGA 1BC6A 4JI1J 4FD7A 3ZZUA 3MPVA 2YQ0A 2XY7A 4YN3B 1QMUA 1APSA 3ILLA 4NLDA 4RUBA 1Z8TA 5E41A 2KDOA 5AXLA 2M9KA 3B3TA 4ZHRB 1W25A 2ZBCA 3D3SA 1Y7PA 4MKAA 5KTCA 1T02A 2IBOA 3N4WA 1MSWD 1X9WA 2ZEPA 3SI0A 1FK9A 5HO4A 1RK8A 1ICEB 2ASJA 4QWAA 4IFVB 3R27A 3BDEA 3TJ8A 5D0EA 2YKOA 2GQCA 3KR4A 1D09B 4LF6F 4DV0J 4ZPDA 1FNOA 4UW2A 3H5XA 3M2RB 2ZW4A 2JVRA 1YWXA 4AQYF 3CCWA 3MCNA 4FYXB 1FDBA 3VALA 5D3GB 2CIJA 3NNHA 4J5OA 5F8MA 4CNYA 3NGSA 3DLGA 3JTKA 2UXDF 3GE9A 3PRBA 3KHXA 2Z3OA 3IS9B 3QRRA 2CQ2A 1GXUA 1CJUA 1CJVB 2P6SA 1IXKA 1HNVB 3S6HA 4DR5J 5FLXY 3V2UC 1N5TA 1PUAA 4JD6A 4KORA 2PEBA 2CJKA 2R8JA 2BJDA 5EWEA 4H4OA 5EMIA 1XN9A 4RW7B 2C6CA 1S99A 5KFTA 2H9ZA 3M6WA 1EETB 1P1LA 1URRA 3KQZA 1WC3A 4XPDB 3M9OB 3LP1A 3H20A 2RUGA 3C15B 1PYSB 1IKVA 2PN6A 4O3SA 3PW0A 2DNKA 3I3GA 2JL9A 1TV6B 4FD5A 1F2PA 5KFBA 5GAGI 4ED8A 3VVUA 4WKYA 4ZVGA 1RHUB 1QJHA 4K4YA 2VONA 4OMEA 2OLWA 2GZOA 2B5GA 1YQHA 5E3RA 4K5SA 4FS1A 4F9VA 3TO6A 4OX9F 5EWFA 1AB8A 2XZDB 4LF7J 4YQWA 3SSQA 2ATCB 1D9FA 1IJEB 2O01C 4DLGA 1R6YA 3BJYA 3PYDA 1HNWF 3BO3A 4DEZA 4EUVA 1FT8A 8RUCA 3BO4A 3KLGB 1S12A 4DHVA 4PAAA 1XNRF 3SFUA 2W8LA 1F5BA 2CQ0A 5D29A 1RKJA 2VG7A 1SV5A 1DZ5A 1WKLA 2DNLA 4N5SA 5FLXU 4X2TA 4LRCA 1GMUA 1S0OA 4DCJB 3W5YA 3H8FA 3MMCA 1TF8A 1ZLIA 5KT5A 3EY5A 3JTNA 2V5HG 4USHA 3NNAA 2I38A 2RDJA 4NZ7A 2E5IA 1FJGF 2Z30B 4M5DB 1T03B 2HFOA 2MZJA 3SHPA 2HHHF 2WBMA 2XWXA 1RT6B 1ZM9A 2FJEB 1NZAA 4R57A 1TK5A 1PBUA 5J1QA 3BN4A 5LL6d 2GVDA 4QJVA 3W2VA 4UY85 1OYEA 3QLHA 4A8SA 3DGPB 2DR7A 3M8RA 1RABB 2GIRA 1YJTA 5KFLA 4F3MA 2XEFA 1RZMA 3POTA 3PHTA 4Y49C 1NHUA 4DV7J 1KNZA 3X1LB 2PR1A 3LAMA 2OZGA 3SEOA 4CH7A 1IKYA 2JEVA 3W63A 1B7YB 1LWEA 1KZFA 1RBOB 3C14B 4P2SA 1J27A 2DO0A 2JDCA 2GU2A 1W7WA 1U2RA 1JLQA 4LUBA 4OYPA 2REEA 4ECSA 5KG0A 1K0TA 2RE1A 4GKKF 3A3PB 4ERDA 3QIDA 2H4WB 4OYBA 2GREA 2Y0MA 1U2FA 4FBTA 3GUXA 2Z11A 2PFDA 5GCNA 2D3ZA 1F5CA 4DV6J 1Z5RA 4HDGA 5K8PA 2YNEA 2UVUA 3IBWA 3PBBA 2VZ9A 3QWUA 4FXWA 4M5IA 3MMAA 2XB2D 4XNHB 2UZAA 1KS2A 2C6GA 1VRUB 2KT2A 2PJ9A 3VAIA 5CD4H 1CQMA 4RN7A 2UP1A 3A8IA 4W98A 1UVMA 2UU9F 2OIHA 2LEPA 2D3O1 1H6KX 5K14A 2HFZA 2X1AA 3TOQA 2ZH3A 2VPZB 1LW0A 2NZ4A 2Z2MA 1ACMB 4WP8A 5H1SV 5EDWA 4X4QA 2J8AA 5EBVA 1S1WB 4LBHA 4K4TA 5HATA 3MUVP 1BMQB 3Q23A 3L9ZA 3MZIA 4LFAJ 3I82A 5A0YB 3OFEA 1KQFB 3K89A 2DH8A 1NNDA 4KOUA 5CQGA 3EE3A 3R7BB 4CM2A 1TR0A 1TL7B 1N34F 5J1EA 1FCAA 2CRLA 1GXTA 1S7HA 3QMQA 3CXPA 2U2FA 5DGAA 3LGHA 3RO0A 4AYBD 5DGBA 2AX0A 3GQCA 1U45A 1HWIA 2CPEA 3HVAA 3PRDA 1HNIB 5G20A 2PEHA 4DX8H 5KFCA 1RI7A 4KUAA 3PGPA 2BQ3A 4CAXA 3CCVS 2MHEA 2KKHA 2HHTA 1CBKA 1RHRB 3AAWB 1SUQB 3FC9A 2F9JA 3S6FA 2DXQA 2UVWA 1FRHA 3L4BC 2EC0A 1UFLA 3VV2B 3GIKA 1N54B 5K5MA 5CABA 1AUDA 2ZBRA 4ELTA 4DU8A 1KKHA 2JVOA 3QAHA 4I56A 5DZ7A 1T11A 2RUSA 3WX4A 2IM3A 2XLJA 2C2MB 1SKUB 4PG6A 1YREA 4HKFA 1V5VA 3T19A 1X12A 2MQOA 4O44A 4JV1A 2FIWA 2XULA 2CQDA 2JC0A 1HR0F 2AEJA 2IC3A 3TO9A 4QCLA 2E1MC 4O3RA 2O28A 5KG3A 3RNZA 1NJWA 2XMUA 1V6HA 1VLYA 2LVWA 1XNQF 4DL0C 2ZH5A 4A8WA 4L72B 2EKYA 1DFDA 4ZP7A 2RT3A 4P4JA 2FLLA 4OI0A 1XWLA 1YK9A 1CX8A 1S7FA 3QWPA 2KJVA 3ITHB 4M8LA 3FF3A 1NSLA 3K5MA 1FD8A 4JI6F 2VC1A 3KGQA 4NEYA 5DETA 1U26A 3PHEA 2QMUB 4CYUB 1WNEA 2C42A 2CG4A 1DAXA 2PR8A 1NO8A 3VAMA 3K8VA 2PIYA 4ZI6A 3HHDA 5D4LA 4LFBF 1N56A 4DWIA 2KZZA 1BXNA 3TARA 3IU1A 2DCLA 1JMTA 3PM9A 4C3LA 5A6PA 4RNFA 2R8IA 2IYGA 1JXLA 2HB6A 1CLFA 1YR0A 2XS2A 2YPZA 1VGYA 3MGDA 2W7PA 1BD6A 1RXTA 4YB5A 4CWBA 3TI0A 2HQFA 2B6AA 1S1UA 2J9AA 3BQ2A 2EBGA 3NGDA 4NMXA 2VIHA 3VF0B 2DXDA 4H54A 4RW4A 1D8ZA 4HPSA 2DRAA 2VA2A 4IH5A 4JI1F 2OFHX 4M95A 2RH3A 1Z8WA 1NM2A 4FBEA 3S8SA 2ERRA 3H40A 1GMWD 3W2WB 2P2CB 4OZ3A 2I6WA 2MPUA 1BWVA 4N7TA 3BKFA 2NSMA 3PIOQ 1RWVB 1U0SA 1FKPB 2CQPA 3R9EA 3DOMA 2C3PA 3I31A 4BLGA 4N41A 4I1TA 2PT0A 3G9CA 4J9MA 1YVKA 3DMJB 4A31A 2J7KA 1HI8A 4QU6A 5C2CA 3SMZA 2Y1RI 4G6VB 2NR0A 5IWAJ 2RVJA 2WBRA 1L3SA 4FP9A 5KTDA 4P7VA 3V81B 1DRZA 1OQ3A 2N3LA 4MK9A 4DV0F 4ZPAA 4RL1A 2FUG9 3S7RA 4TVAB 3MURP 4FWUA 1VHEA 3DDNA 4F02A 4MFJA 2B5JA 2IRYA 2GJFA 4R7MA 2AFSA 4B3RJ 4I69A 3GB0A 2EK1A 4WFYA 1PAUB 1YW4A 1EIYB 4X3RA 4KTQA 3QO9B 2M2BA 4KZTA 2AX1A 5FDLB 3WR7A 2FVSA 3GPAA 4X84A 1IIDA 3FUYA 5E3AA 3IIBA 4I64A 1HW8A 2BKNA 3E2EA 8AT1B 5GMEA 2WTFA 3BGFA 4Z7YA 2PQ8A 3M30B 1IR0A 3S6KA 3F8KA 2WHOA 5ISVA 3UN3A 1Q2CA 1K9MT 1VQ9S 4X8IA 1XMTA 2E1CA 1BPMA 5KT2A 3KMQA 2DHXA 1YBUA 3WIVA 4OI3A 3ZZTA 2AHOB 3FXTA 4NGTA 4CLKA 2PJ0A 2QEXS 3GJQB 4RNOA 5DDQC 3G6ES 1I12A 1OMSA 4JOUA 3CIMA 2B3VA 2RQKA 1NK7A 2QRRA 4R25A 3MCMA 1IU8A 2WB1D 3EXYA 3DCAA 3PX4A 2MQQA 3MM5A 1UTAA 4B6ZA 2X7BA 2QX0A 4NRUA 1CP7A 4BC9A 4FF2A 4FBUA 1JJ2R 4NFRA 2H5IB 2K7JA 4MKVA 3RZAA 2WZ1A 4WWVA 4K2JA 3OTDA 2V50A 1FJCA 1B99A 5J2MA 2PE3A 2ZEHA 2QA1A 2UUWA 3FGVA 2IDLA 5L1KA 4MYUA 1YITS 4NZ6A 1NK4A 4DJLA 2WYRA 3GFYA 5HVHA 5I3QA 3QB8A 3FSIA 2Y8YA 3R5GA 3CCJS 3MR5A 1FRKA 3JQKA 3DDKA 4CYOA 1VC5A 4TU7A 1QSNA 2W01A 4ZVEA 1QUVA 5JVHQ 2B4DB 4DL6A 1N6QB 4EO6A 4GVLA 2ATLA 1JKHA 3FCWA 5CCLA 1WD6A 3LF0A 3MM9A 3IG1B 4RJVA 4F4XA 4LF4J 1YK3A 4JI7J 2IA6A 4OJHA 2KM8C 2GFQA 3S1TA 2Y8WA 3QIPB 2RKIA 5M2PA 4ZJOA 3M6UA 3RBZA 4KOTA 2MQMA 3CJKB 3MDFA 2ZEEA 2H51B 4MXUA 2VKRA 4OJ1A 2ZE2B 1V9OA 4NGSA 4DPUA 2FZCB 3OQ2A 4DV7F 4J9VA 2AE6A 2G0JA 2FXFA 1Q16B 4DZ6A 1RTJB 2XHCA 4BD9A 4ZPBA 1UFKA 3FEXB 4GMKA 1LAMA 2IQ6A 5KFAA 2QLFB 1G7CB 2PVWA 3QNWB 2IHR1 4DSFA 4ZVOB 2LFVA 5A8RA 1R31A 3CE8A 5B0EA 2YGWA 3A1YG 2AFWA 5ETVA 4DSIA 1Y5NB 2V4JB 2AIRB 3GIIA 3D7GA 3PXGa 4QR1A 3BLNA 2D69A 1A7GE 2OOTA 1S1TB 3B3SA 1PILA 2BM0A 1PYTA 2XLIA 2CXEA 4OZ5A 4ED7A 1U2CA 4DR6J 2LA6A 3T1YJ 1TKXB 1NDKA 3KDNA 3LP0A 3R97A 1ITPA 3THPA 1SC3B 2HGLA 3U1LA 3DM2B 3DRSA 5GADU 4Q5VA 2R8HA 3KASA 3W60A 1Q4RA 2J9EA 2ZJRQ 1H2VZ 2I1RA 4Q0BB 2MLZA 4P72A 2V68A 3CXSA 3F73A 1G2EA 2ZOMA 4H4KC 2J7UA 2GVZB 3MM8B 3O44A 4X4PA 3W8PA 2XY5A 4X4SA 2DEIA 1JJHA 1XQIA 1TKDA 1OWXA 5I0CA 2AJ0A 4F25A 1MROA 4J91A 3TJAA 4NX9A 4E2FB 4MTPA 4I2QA 3CSKA 3PR4A 1S6OA 3FH4A 4KSEB 4P4EA 3I9SA 2L3MA 4OJGA 2PI4A 1FDDA 1TL3B 3G2XA 1JQGA 2R2TA 4Y2MA 3QFHA 1N33J 4EVYA 3TP2A 2YQ3A 4AB7A 2ROPA 1WC1A 4YB1P 3EGNA 4DYOA 3RAMA 1NKCA 5CYMA 2J0WA 1HIYA 3FSYA 2K3IA 3KXDA 2KXFA 4FUUA 2WSCC 4QWBA 4NSQA 2JEFA 3HHEA 3QRQA 5K8OA 1R0CB 3DDDA 1A9NB 5D4NA 5I42B 1WEYA 2YX1A 5EHHA 3TUJC 4CLPA 3ZC4A 3T8WA 1RA7A 2OZUA 1G6BA 3TW0A 4Q44A 3B6BA 2Z56B 4OMFG 4B17A 4MFBA 1H0HB 1FXLA 1FE4A 1Q7LA 1OSDA 1S9EB 1Y3JA 4CPAA 2IY5B 1TL5A 4IG3A 4IHMA 4XPDC 3H8EA 4GC7A 2EC2A 3VTIA 4MMOA 1KVIA 5C25A 4IH6A 4Y0FA 1PJ5A 1FY7A 2XMAA 4P45A 1L3UA 3O3LA 2H3EB 2GA7A 1LXNA 4LSLA 2ZH1A 2ZH8A 3FB3A 2UVVA 1HYSA 3ETOA 1EP4B 2ABZA 1NPKA 1AW0A 3NGKA 4C0HA 3C66A 5A2QY 3DDIA 3NAHA 3TC8A 3W5XA 3ZZRA 2GLJA 3KK3B 4FNHA 2MGZA 1YJ7A 1AZSB 1HI0P 2QLWA 6AT1B 1W2BR 1UVKA 4K4XA 1I21A 1TKZA 2F7VA 4Z65A 4Q43A 1DTDA 4NL5A 2ZWOA 2R7RA 3T1AA 3D7FA 4B5PB 3WQPA 3G6XA 3W6SA 3TVYA 3KJFB 4GXHA 1TUGB 1N5YB 3D7HA 3PY8A 2BSWA 2CQIA 2C28A 3Q24A 2JJ4D 3DC2A 1CULA 1CJUB 3HULA 1BQNA 4IDKB 4F4AA 3PRVA 2X3DA 5JJBA 1RTIA 3NE7A 3ZFVA 2OD4A 4OHXA 3SZ2A 3M8ZA 3B4MA 2G2ZA 3NNCA 4HEA9 4FS2A 5LRKA 4J3GA 4H4OB 1FKAF 4KT0C 1ZS6A 5ETMA 1Q0NA 2R42A 2IBKA 5IXUA 1ZOTA 4JI8J 2HQCA 2V0NA 5HLFA 2HGMA 1U8WA 3W66A 2BOPA 3VGUA 4F26A 2NQPA 2DH9A 2H1YA 5CA5A 2NZCA 4XDCA 5A2QU 4XPLA 4JYWA 2CXAA 1EQMA 1AUSL 2QSWA 3IMQJ 2BACA 1IGBA 4LVNP 2QIRA 5J2NA 4LF8J 3CGIA 3I5BA 1B0VA 1I5OB 4U8YA 5DM7Q 1F1BB 1HQEB 1HBOA 1XMOJ 3QGHA 2Q1LA 2G1HA 4LF9F 3P45B 1K44A 3LWMA 4FD6A 2CAJA 2OPQB 4PR6A 4DR1F 4E2AA 3A8KA 4B3SJ 1F5AA 3V8IA 1NPPA 4WK1A 4RBUA 4AVBA 4M85A 2MTLA 2M70A 3T6BA 4J9PA 4Q8FA 4XNHC 4QYZK 4EEYA 3AODA 1LWCB 5DQIA 3RR8A 3OW2R 3OL9A 3GYXB 3K8WA 3D54A 3D5MA 3ILOA 3AB2B 2ASYA 4MFZA 2BXJA 4TYBA 1UJ6A 5GAEI 2DNOA 4PWUA 1RBLA 5I4MA 3K17A 3K2YA 3RYLA 2REFA 3UVJA 4JI5F 4ZMMA 1EZZB 2YNCA 2GLFA 3W2VB 2X7IA 1QAXA 1N0UA 3D0IE 3HT3A 4F3QA 2PJ4A 2RQCA 1ULRA 2DGQA 4C11B 1RWUA 4Z37A 1DURA 2V77A 1M5VC 4ES1A 1GH8A 1DJ0A 1VQMS 2HUZA 1XBUA 3KOAA 4NMLA 3K7RA 1JLCA 3IEHA 4N76A 2OELA 1ZZFA 3RU0A 2XS5A 1FWPA 2C3UA 3AA9A 4LF2A 4HLBA 2J0XA 5DQGA 2HFNA 5LSLA 4ZS6A 4EWTA 3BXMA 4J9OA 1Q82T 1UWBA 1HNXF 5E3QA 1VBZA 2MKKA 4PXEA 5BWAB 3NLCA 4OYMA 1UMJA 5LYLA 4OZ0A 1RHKB 3SYZA 2Y1JA 4TNOA 1ZG7A 4KPCA 4PWDA 4LQGA 2W9BB 2FQQB 2CQCA 1S77D 4ZX9A 4CIOA 2YNFA 1JXVA 4CS0B 3CJSA 2VKZG 2Z57B 2V8PA 3EFAA 3QSIA 2HFVA 3AXMA 2PJCA 3IRXA 2MMYA 3CJ3A 2UV8G 1KC8T 5IT4A 2HMIB 2FL4A 4M63A 1EX8A 2EFVA 2QA2A 2X3GA 2B4PA 3MMBA 3FNCA 2LYVA 2BANB 4F2RA 3K9TA 2KTQA 4Q2MA 1N71A 2KT5A 1LW0B 2E44A 2V2ZA 1RWXB 2KVQE 4DFJA 3BV8A 5KFGA 3OWCA 3I5AA 2FB0A 1S3ZA 2QN6B 2LXFA 1LWXA 3W5ZA 4WCEQ 4NLSA 5CYQB 2Q66A 5D0RA 3SJXA 3G86A 1N32J 4DL5A 3ZZIA 4ZJQA 2DNRA 4OYZA 4M5KA 3Q8QB 1U6MA 3H59A 3EPGA 1SL2A 7CPAA 2R8VA 5LMNJ 1QSMA 1SJRA 5AJ3J 2Q51A 2FGCA 4LF5J 3NG8A 1ZG9A 1N52B 2JOQA 2RSQA 3R6GB 3PX6A 1FRJA 1IYKA 3CCRS 3VWSA 2DIVA 3OSNA 1DHMA 4OYIA 4UF4A 2D1CA 1VRTB 1FO1A 3H2LA 2MDAA 4U96A 3AB4B 1B70B 3DOKB 3MFIA 3G4SS 3P8BB 3CJ4A 2JX2A 2NSCA 2FZKB 1IUJA 2LQJA 1LFWA 2DGOA 4MHZA 4ZN3A 5HQ8A 2R1IA 4ZJLA 3ZZ0A 3TA2A 2O5DA 4DS4A 1AUGA 3H5ZA 3FMCA 1X31C 3PYFA 5HVFA 4ZLPA 2PSWA 3ISNC 3DI6B 2DNZA 2JFDA 4G65A 2ZENA 4I6AA 3OV7A 2BJ8A 5FIIA 2DR9A 5IOLA 4O44B 2BJEA 4YU9A 2BX6A 3FBFA 2UUBJ 2Q4ZA 2HZAA 5F0WA 5D6GA 4ZPCA 4J7CA 1EQ0A 2IC3B 1S97A 3MCSA 4RUHA 4C6AA 3PEJA 3UE2A 4MK7A 1N36J 1T9YA 1YLXA 4PWWA 4U67Q 3Q2TC 4L3KA 1FRLA 2QV6A 3PJXA 2IRUA 1TFYA 1D1UA 3SSSA 2VQFF 2R9LA 4NEZA 4HVZA 5JM6A 3P2FA 3PO4A 2HVHA 3TZZA 3GJRB 1WEXA 4E98A 3BKUA 2L41A 2E29A 3HDSA 3CPWR 4PG8A 3RB3A 3JYTA 4EYHB 2XNRA 2GNKA 5H9FK 3O8WA 2CDRB 1XTZA 3OR1A 3T5JA 4R3KA 2FJDB 2CA9A 1TAQA 3DXBA 2HHQA 4Q7AA 2YX7A 1K4JA 4RNNA 2HYIB 4GKJJ 4RKUC 1KEKA 1C1CA 2Y1LB 2PFFB 3FEEA 1VQPS 4NLPA 3BYPA 3B3WA 4F9UA 4ZYQA 1ZPVA 3IAM9 2DNYA 3RAXA 2W2OP 1ARMA 4ZGYB 4KVOE 3PYEA 4C8KA 1FFGB 3AOBA 5HP1A 4DFMA 4DL2A 4UFXA 4H6UA 3OBIA 3CXCR 2XMVA 4RU2A 1T95A 1RT1A 3AXKA 4PQUB 1IR2A 1CS4A 1FX2A 2KFZA 4MKYA 2J6TA 1TL4A 2FY1A 3QT8A 1M4IA 1UEVA 3CJ2A 3BJ7A 1NLKL 1WF1A 1VFJA 3D2PA 2HAFA 1YX2A 5DWMA 1TP7A 2FHJD 2I0XA 4EBCA 3LGNA 2A4NA 1VRQC 3DYAA 4F7VA 3DNSA 5H84A 3G82B 3CO0P 3NE8A 2QECA 3OVSA 4A4JA 2BUNA 4A94A 4NYOA 5L1LA 1NK9A 4NLWA 3FEZA 1LW2A 4OI1A 4C8MA 2K06A 4FYWB 2H48B 1XR6A 4EK2A 2DHSA 2R8KA 4IK2A 3OTEA 3V4IA 2QL5B 4RW6B 1H3DA 4DQIA 3LP2A 3T1HJ 3CC7S 1DTQA 2ROGA 4ED2A 4M1KA 3MOJB 1T3NA 2LQ8A 5KFXA 3DLJA 1H7WA 3DLHA 3C6TA 1JJ4A 4JYAF 4RWWA 3VAGA 3V6JA 1WELA 4IRCA 4ZN1A 3KUGA 5EC4A 4M5GA 2V4QA 4J9UE 1Y0RA 4DXLA 1LCPA 2B7BB 3NH5A 1S59A 2HGNA 1M0SA 2XGQA 4DR4F 1UFHA 2O1PA 2PJ6A 1B4SA 2MKYA 4JI0F 9RUBA 2PJ3A 1RGVA 4YY3F 1TQLA 2Z2LA 1M44A 1HWUA 3CMAS 2DPTA 1WSRA 2VOOA 1NJXA 1ZETA 5CZVA 2CADA 1VK3A 4DPYA 4RI1A 3OFGA 4DG1A 4X64F 3MM5B 3NRBA 4O4RA 4AXIA 4X4OA 3OFFA 2W7OA 4NA1A 4DV5F 4A46A 4P4BA 2R7HA 3FK4A 3CVKA 1DBDA 1G4CA 5J2MB 4P6YA 3CT9A 4ZY0A 1N48A 1T3OA 3KJVA 2UXBJ 1NMTA 2HHPA 2FTRA 5CNPA 2BOAA 2XMKA 2VICA 3GJSB 3I0SA 4MIAA 3R2CJ 4UOHA 4B3SF 3V6KA 3VGVA 3T9YA 1N5SA 2HNYA 4XO0A 3CB4A 1QVGR 3A4TA 5D0GA 2DTJA 4KV8A 3BGRA 2YNHB 2GCFA 1F9EB 2LEAA 4HYKA 3K58A 2FYXA 1RADB 4ZIWA 2CPYA 3HM9A 1N88A 3SXLA 4ZIVA 3RTVA 3MM9B 4ZVQB 1SL1A 3HSZA 2XWYA 1FFWB 1IBMJ 1OY8A 1T9WA 1MJAA 1QSRA 3HHLB 4KY3A 2K8GA 3BQ1A 2RD5C 4F0YA 2BRLA 1AROP 3Q89A 1D9AA 3EM1A 5CPAA 1HBNB 1X60A 4OI2A 3NMAA 1KQGB 4QVTA 4DV3F 1IM6A 4MJKA 3KLFB 4FYVB 4B13A 1U0HA 3THVA 4PV6A 2QYVA 3WC5A 1IN0A 2Q04A 1HMVA 1J5OB 2PJAA 1QE1A 3NOGA 1Y9OA 5AT1B 2VV5A 2NSBA 2EG2A 5BR8J 5KOXA 5GAGU 1KD1T 1S48A 4G1IA 3WIUA 2GAHC 5E33A 4B9LA 2MQ8A 5CZXA 1M4DA 1Y7EA 3ZTOA 2XYPB 1NJIT 1MWQA 3BSCA 2FLNA 4DUYJ 2PDOA 4C0BA 3CJ8A 3M8PA 3M6XA 4Y2AA 1S6UA 5IQQA 2PD1A 1IOIA 1PYTB 3P3DA 4PSWA 2JSXA 4WWSA 2OUGA 3THTA 1U4BA 4MHPA 4ID5A 2IPOB 2VUGA 4K8RA 4NCZA 4OC1A 1RSCA 4MHYA 3LP0B 4KE5A 1NZ8A 3IBCB 2HQIA 4BDPA 2Z2YB 3TYTA 3CD0A 2HW3A 4DV1J 3WZ0A 1RHJB 1UEKA 3G87A 2DPSA 1YRXA 3CJTA 1HNZJ 3OTOJ 3R7NB 1EHWA 4J9LA 2AGQA 1ZM3A 1FRIA 3N0VA 1IBLJ 1FJ7A 4XIUA 1ZLHA 4OYOA 2ZW7A 1I94J 1MROB 2MY7A 1WACA 1E6VB 3CNQP 2UUCJ 4YMEA 3CW2C 3HJFA 1N32F 1U6BA 1FT7A 1J2VA 1QAJA 3KUEA 4F0HA 3OR2A 3N01A 3H2VE 4PK3A 3ZTPA 4M5JA 2DHHA 4UWJA 4X4NA 2NXEA 1S5KA 1AFJA 4YS2A 1SKRA 1GX5A 4HT7A 4HH1A 4I2PB 2FJBB 4OHVA 1URNA 3AJDA 3U1NA 3FBEA 2BV3A 5C24B 5HN0A 3KLHA 1MMNA 4KLVA 4PUOB 2EWBA 3M2UA 2CJBA 3BS9A 4DL3A 1RB0A 3DR8A 1H98A 2F8MA 3RR7A 2VFUA 2F40A 2RJZA 3BEGB 2MZ1A 4BHQA 4WFXA 2QE5A 3K5OA 2CY2A 2IMOA 4WXWA 4OC5A 5HI7A 1Q7LB 1Q79A 2EBJA 4A2ZA 4ED6A 1X5PA 4RNHA 4AQYJ 3M8QA 3EDQB 3T90A 1Q5YA 2B4OA 3IM9A 1KTVA 5K8MA 1BGXT 2RILA 3CTRA 1QY7A 1FD2A 1CVJA 1F9HA 4LSLB 1RAHB 2KYXA 2UUBF 3JTPA 3IA0A 2FVPA 3R5AA 3PW7A 1NSKL 1CJTA 3KFWX 4J9QA 3LALA 3A12A 1NSQA 4C2MA 1FHTA 3QNVA 4PQAA 2QJ8A 3G3SA 4BBHA 1S6QA 3QSYB 2K5TA 1TKZB 2EEYA 3CCQS 3DRRB 4MFKA 4F67A 3TOBA 3CDUA 5ITHA 3SJGA 4P44A 2GX8A 2OB0A 2D41A 2CJQA 3FBCA 4OIWA 3HKWA 5B09A 2AU0A 2AQ4A 2KFNA 3A8JA 3NS6A 2PMHA 1VHIA 1RAAB 1Q5VA 4PXDA 3NCPA 1CULB 3L7UA 3MECA 3UFCX 4R8FA 1TKJA 2CJAA 1RT3B 2NXCA 1D3WA 3IJ3A 2AFUA 2BL1A 1CEZA 5GMKa 3W9JA 2KVIA 2YNIB 1RTHA 3PVXA 4B14A 5KFYA 3QATA 2RIJA 3MRUA 2QT7A 4Y6IA 4C9DA 2GHPA 2E9TA 3DFEA 4CO5A 1WG4A 2Z3KA 1HNWJ 1S76D 2RU9A 4B9TA 2VBXA 1ZTWA 3ZXWA 5KG1A 1XR5A 5AE2A 3QT6A 1IBKJ 3B8HA 4W9YA 4R5PB 4CTAA 4A39A 4UOFA 3PO5A 4KFBA 5F8JA 4HTJA 3GJTB 5JPHA 3W9IA 1ZH5A 4CAWA 5B7WA 5HL7Q 3HVTB 2D9PA 3KJNB 5KT3A 3N5FA 4C97A 3DKDA 2ZH7A 3BGOP 3FFIA 1DTTA 4O4GA 5M2UA 2EO8A 3OSPA 1HBOB 4H4MB 1EJ7L 2XMJA 1SPBP 2VG6A 2WPWA 4LRDA 3V5RA 4CM0A 4ICLB 5G0RB 1YJUA 3UR0A 3UDEA 3K2KA 2E1AA 2AJFE 2G0CA 2HURA 1OJ4A 3S01A 2GQ2A 2DR6A 3AHPA 3EVOA 1UJ4A 2B58A 2W9CA 2FD2A 4MJ8A 1GX6A 1MWZA 2CNLB 3CULA 3T1HF 2OR4A 4G1QA 2HVZA 3KLIA 3EGZA 3IR7B 4RZRA 1KUXA 5HBMA 2FT0A 5B0GA 3VAJA 3BPDA 3H8YA 1D8YA 2C2NA 2CWKA 2OKQA 2WW4A 5AXNA 1NHVA 5SUHA 2HRTA 3PACA 2HAIA 2AJ1A 2IAJB 5A8WA 2IJFA 2WRMA 3EZ5A 2NREA 2RQ4A 3R5BA 4GVBA 1B87A 1Y11A 1SC1B 4DSJA 2ATRA 1TUVA 1IWGA 4UBRA 3NGRA 2VPYB 3HXMA 5EGYA 1ZZNA 1BOBA 4U5YA 2FJXA 4QYZJ 3I6PA 4ECRA 2NXNA 1ZTTA 1CBXA 1JLCB 4JV0A 4YB7A 3GIRA 4ZITA 2XBPA 4ZCKA 5KFJA 4KLWA 4AVAA 4RPFA 4LBPA 5F3TA 1HBMA 5DDRC 2G3AA 2HHVA 1FNXH 1RU1A 3RRHA 4X62J 2OSQA 3CDBA 4CYQA 1VIOA 3DN9A 1U6FA 4NGPA 2XI2A 1RAJA 2OH2A 3ZTQA 3OJSA 3OXFA 1IKXB 4P2FA 2HWIA 3BO2A 3E3XA 2FSRA 4M94A 2IM0A 5C42A 3AOCA 4PG5A 3E01B 2UXBF 5A28A 2UVRA 4M5MA 1LWFA 4PABA 1V3RA 2QMLA 3EJMA 1YI2S 3MEGA 1HI1A 4UA3A 4QUSA 2K1RA 4AG7A 4UCMA 4J37A 3HLUA 1WC0A 2FJAB 1JLBB 2DR8A 3I55S 5F9LA 2HNDB 1OQ6A 4N8OA 4YR0A 4LQ9A 1RXOB 5A27A 4CT8A 3KLVA 1VQ6S 1JJCB 1C0TB 2RRAA 4ELVA 4NGRA 2VF3A 4O3QA 5K9FA 1KDNA 1FWKA 2YVSA 1DQ9A 1RT4A 4KAIA 2N3OA 2VBQA 1LK5A 1IBMF 4NJQA 4H89A 2D4PA 2HFUA 2M4MA 2FJWA 3PJ9A 4WU3A 4OKOA 4B9MA 1RWOB 5EWGA 1MMLA 2R4FA 1M5KC 4LQ6A 1KOHA 3SIPB 4KO0A 2NXJA 2MZQA 5MLCV 5KG7A 2XNQA 3D3CJ 3HVWA 2ZEFA 2C2KB 4DR2J 1KQKA 2EFNA 5A76A 5J2PA 1ZAXA 4LMZA 3EMTA 4C8NA 3KLEA 2YWFA 2EKNA 1JLEB 4HL9A 3CC4S 2B9XA 2ARHA 4HACA 4WTOB 2Q43A 1RBAA 4DF8A 4OJ3A 5BJRA 2P9EA 1FI4A 4J9RA 4EFDA 2KZMA 4IRDA 1YGYA 3H8GA 5DJBA 2DB1A 3R9GA 3D7DA 5DRKA 3Q8RB 2R8GA 3H98A 4X4VA 4B3TJ 1EKRA 4NOHA 1FTRA 2XC9A 3BKTA 5J2QB 1FRMA 3KKFA 1YJNS 3CDWA 4YP3A 4JI6J 3MTKA 1Q2DA 4TLRA 3PDNA 1RWWB 2PVVA 1C1BA 3CPXA 5E0OA 1F0XA 2WVDA 2W2NP 4YFUA 1R0BG 1UFWA 2ZJPQ 4OZ1A 1P27B 5IC6B 2X1FA 1J5EJ 3KR5A 1UP1A 2MHNA 4NXNJ 4ZA1A 1VI7A 3J7YI 2BVZA 3GYAA 3C19A 1HHTP 2LQ9A 4WF9Q 2FLOA 4GM5A 2J8NA 4PXCA 4ILMA 1RACB 3H4BA 3IO1A 4NGQA 5DDPC 2ZHOA 4URQU 4CI0B 4DV1F 4DOZA 3VGTA 3ZZPA 5AXMA 1HNZF 1CC7A 1O51A 4DR7J 3E8OA 2NLWA 2LA4A 2E5LJ 2E66A 1I94F 3ET6A 3OR1B 4I4BA 4PKDB 2A10A 2F4VJ 2UUCF 1U09A 1MU2B 4DUTA 2CWXA 2G3TA 2PCUA 2GJIA 3OHAA 3NA6A 3TEHB 1OO0B 3KG1A 2FC8A 4ZHRA 3Q86A 3DLEB 3H90A 3OXGA 4P6QA 3SXNA 4IFVA 2HK3A 4H4KA 2FS5A 2W2QP 5D8NA 3MPYA 4NEXA 2GIVA 1F57A 4A32A 3HI9A 1U49A 4XTTA 5HP1B 4XAKA 4CO4A 2ZDPA 3SJFA 4OZ2A 1Q95G 1FXRA 2QGFB 3K5LA 2HZVA 3FX6A 3D28A 2H4YB 3HT0A 5E96A 4IOBA 1VR6A 1VC0A 2H54B 2XMTA 3BJ8A 2FJVA 2F8HA 2XSFA 3BGLA 5H9FJ 4ECZA 4QYRA 2HNZB 3T6JA 1FTCA 3KI9A 2BE9B 4YUDA 5D3GA 3SXOA 3NXZA 2XSJB 4DPWA 2A18A 2PMWA 4CT9A 1RKIA 2OHDA 2YQ1A 2L9DA 4IQMA 2QIFA 3PB6X 1P8GA 2OMOA 1HEEA 1CJVA 5SZTA 2Z8QA 2GHWA 2XMWA 2V8VA 5J1NA 5A6WA 4ZBGA 2CJYB 4FYYB 4Y65A 1T9UA 4EZ9A 2E7XA 1B7FA 4DQSA 2DHGA 5ETKA 1RAFB 4M3SA 1HBUB 3ZZZA 2V8HA 2YNGB 1H7XA 4RW7A 4M6GA 2AFZA 4WE1A 4QOTA 3LH2S 1Q78A 2LECA 3E51A 2RHQB 2VG5B 2V9KA 2ADBA 2KG0A 4P74A 2AMCB 3I0RA 2HBQB 2H5JB 3ENVA 2E1RA 3CMES 2WZNA 1HHQA 3HUVA 3V4IB 2CQ1A 3D6HB 3KG4A 4FKXA 1F3FA 1U1KA 5B0BA 4ZVPB 4UEFA 3JQMA 3D0HE 2BR0A 1T7PA 3US5A 2KRRA 4KHPF 4F0XA 3J80Y 2P6FA 3B3CA 4XPEA 2GO8A 4ED1A 2DXEA 1R8AA 3R1HA 1U1LA 3F5BA 2E1PA 3LGMA 1S1VB 1SC6A 3EZOA 3IP0A 2A2DA 4OHZA 3AQOA 2BJ3A 2XG8A 3HHLC 3W7BA 1HDQA 2VEZA 4YHHJ 4O0NA 1NH8A 2VFTA 3UNGC 2GAGC 3SJEA 3D9BA 5LM7E 1NB7A 1S7IA 4OQJA 1R0AA 1IBKF 1N5QA 4B9UA 1C4AA 3EGVA 5LYDA 3RBXA 4M6HA 2YPYA 1I6JA 3BH6B 4WFBQ 1U7LA 5G21A 4MCSA 2W9AA 2P9CA 5A8KB 4QIFA 3EXCX 2JEGA 3GTYX 3TAPA 3JSRA 5IX3A 4DG1B 1R8CA 2J0SD 1B0PA 2ZBPA 4M5DA 3TJ9A 4WTYA 1AA1B 3IU2A 1T03A 3RYOA 4LQ3A 2CVEA 4B02A 1S10A 2HHSA 2VQEJ 2OPPA 4DV4F 2MLXA 4IFYB 5JXSA 5HMZA 4JXQA 1TFWA 3P6YC 3H25A 3UY5A 4KUBA 2H65B 4ES2A 1QDUB 4OHWA 4A8QA 3DGPA 3I0SB 5T7LA 4CGPA 4NYPA 2EFQA 2BCOA 3A3NB 4RBTA 4Z2XA 1WC5A 4CH0S 3J80U 1XEBA 3VR1A 1X4BA 3P96A 1FA0A 2IDEA 5M2RA 2QJ3A 3QFWA 3HFZB 1FESA 7FD1A 4AG9A 3H7HB 3BZQA 1YJ9S 3A8EA 1Y5IB 3C14A 1U1MA 5IV3A 4YR2A 3SFGA 3L7PA 2XCAA 3RBUA 2CQ3A 3FYNA 1X0FA 3EUNA 3IR6B 2RAQA 1T05B 3GWCA 2G2OA 2MSSA 3LANA 2MY8A 2JDDA 4K3NA 5IC4B 3I4HX 1SKSA 4FNIA 1DLOB 4DQRA 4F4KA 3KK1A 4K0KJ 4ECUA 3H4QA 2XEGA 3PRTA 3MOZA 3CCTA 3K5PA 2FY8A 1XJWB 4MI4A 2NYHA 4R87A 4OZJA 1U0HB 2HQ3A 2KXNB 1WOSA 4FN5A 3P5BP 2JLFA 4NLUA 5B0FA 2MZTA 1IKWA 4F4WA 3C16B 3W1YC 4CAEA 1XMBA 2M5YA 1BAVA 2ZD1B 3Q8PB 3MR7A 1RTDB 1X4CA 4C48A 1YVFA 1CG2A 3OFHA 1HQ2A 1S1WA 1G3OA 4OZNA 5HVGA 3C6UB 4X62F 2KG1A 2BEFA 2Z3MA 2VOPA 1KTQA 2OJ3A 5A0YA 3KKWA 2H5EA 3NL0A 2J9DE 3LW5C 4NLRA 2PDAA 4WYWA 5MAOA 4UIBA 4UEZA 3OLAA 3AY0A 3GG0A 5ETTA 2R2SA 3FJ2A 2J9CA 4Z7CA 4NPOA 4KPYA 3T9ZA 4ID5B 3I56S 4ZPWR 3D4JA 3GONA 2DVIA 4LVOP 5C5JA 2DNGA 2CNTA 4CRYB 5DG7A 1HNIA 3DOLA 1IY7A 2PJ5A 5DWNA 2B43A 4E8OA 4JI4J 4RWXA 5GAEU 3VWEA 2BE2B 4HDHA 2Q6BA 1SUQA 2MQPA 6FD1A 2CIMA 1YDLA 1VIXA 1M5PC 4C98A 1Z2LA 2B3TB 3KYLA 1LKZA 4GO5X 1NE9A 4B3MF 2QYCA 2B51A 3JQJA 2CPFA 1B6BA 3MAQA 1UEUA 2V2KA 3HZEA 4ZX8A 2VL1A 5DQHA 4ELUA 5B0AA 3OR2B 1VCTA 2YY3A 1X4DA 2V94A 4TY8B 3LPEA 2C1EB 3Q8VA 4ZLNA 5HROB 2YKMB 4AT1B 4KR0B 1Q8LA 4P9SA 4YR3A 4DR2F 3PIPQ 4YFJA 1NJZA 4ZCMA 1C0UB 4DV2F 4QB9A 3H0PA 5LJ3Y 2DRDA 2ABYA 1SVDA 3FBBA 2XS7A 1PJ7A 2HBRB 1ZBTA 1Q7YT 3OTBA 3Q8UA 1VK8A 3OVAA 3TQ1A 2QL7B 2Z0GA 2DYAA 3L7OA 3Q2SC 3VARA 3ITHA 3TOAA 2GGPB 4LSZB 2SXLA 4NGNA 2DO4A 2LMIA 3AH6A 1S7NA 2CUYA 2CNSA 4B3TF 2PJ8A 2XY6A 2ZC3A 1MJBA 2KN4A 2W4CA 5JMNA 4QW9A 1YQEA 2BQUA 1NKEA 4Q8EA 3SV3A 1CSJA 3ISND 3ICLA 1H72C 2G2YA 4R0EA 1M5SA 5KAKA 3F41A 1Q1KA 3TA1A 3MM7B 1NK0A 3MN8A 3I9ZA 2XYGB 1CJTB 5RUBA 2NYIA 1J5EF 3HO1A 2J0QD 4NXNF 2DHAA 1VQLS 2ZEJA 4U9ZA 1Z4RA 2AYMA 2KRBA 2MQLA 1RAGB 5KFWA 1VKCA 3SDEB 1KQSR 1OZPA 3GILA 1XJOA 2ZOGA 2CJXB 1BO4A 4Q45A 1OS5A 2VXKA 1VQKS 1X5TA 5CCMA 1U1OA 4YOEA 4PRFA 4MKBA 2HS0A 4DR7F 2R3VA 2FE7A 4V19J 1F2OA 2E5LF 1RT5B 1QSTA 3OLBA 1ZA1B 1SJQA 4KSIA 2W24A 2F4VF 4U7UK 1WKKA 3R5JB 1YZ7A 4UTGA 2KHDA 1M4LA 4Y2KA 1FKPA 2IIHA 3SV4A 3T9NA 1HWKA 2CZVC 3D1QA 3DMJA 3FMWA 2WVBA 4LF9J 5G1ZA 2Q7BA 5E5NA 5F8NA 5C7PA 2YKNA 2ASDA 2DEJA 3AJ1A 4DR1J 2JRSA 2YNCC 3V81A 4OC3A 1TU0B 4Y28C 3LQVA 3MR3A 4K59A 4MBUA 2HEKA 4I0WA 3KDOA 3CUNA 2ZOFA 4ZPTR 3LWUA 2R7XA 2UXCF 3NWRA 3N6LA 4KFBB 3H2UB 2ADCA 2Y9HA 1GMWA 4EZ6A 3I4PA 3PYGA 5DDOC 2BM1A 4DX6A 2NUUG 4A38A 4F50A 1V3SA 2NMTA 3QO9A 3QYYA 4YWYA 4ZP8A 3D6TB 4KGVB 5HH1A 3DLBA 3S9LA 3M8SA 4M5HA 1T8EA 4DJBA 3NH4A 2JZ5A 4ZVHA 1SQFA 3M30A 4JI5J 3TX0A 2P6EA 1YJWS 1I3OB 2M88A 2G9DA 4CCHA 5L8RC 2NUHA 3LAKA 3C3LA 4TXSA 1CPXA 2EW9A 2HWTA 4ECYA 4XPKA 1NXIA 1OSCA 1T0TV 4R8UA 1VQSA 2W9CB 5BXIA 2OH1A 3UCUP 3BSAA 1KR4A 3M9NB 4C8ZA 2YKPA 2MKJA 4G1QB 5AXKA 3KLIB 4A30A 2N7YA 1VYAA 5HBMB 1HWJA 7AT1B 3G96A 1HLWA 4DCPB 1RUSA 3TAMB 4KOYA 1S9GB 1HNXJ 4YB6A 3IGVA 3KK2A 2MKCA 3A3OB 5F46A 2HHUA 4J9SA 4L6V3 1WG5A 1ROFA 5A8WB 5IQ6A 3M32B 3SQGB 1K73T 4DNCA 1R8PA 2ZC4A 5LMUF 1PAEX 2V67A 4GVBB 4YHHF 4IQXA 2GMLA 4PG4A 2EFPA 3TWZA 3J81Y 2QMXA 2HHXA 3RB0A 1UZDA 4DN9A 4UUXA 3AJ2A 5DLFA 1VBXA 1YBAA 1FKOB 4TWEA 5KFHA 1VHFA 4CYNA 3KG0A 1GHEA 1RWNB 3T5KA 1G1XA 2B4DA 1Z8XA 2O66A 3FBUA 4LFCF 2Q4YA 5THWA 3QRPA 5HQLA 1MLAA 3IG1A 4RO0A 2ALYB 3PP9A 4OYXA 4NLGA 1XEZA 4NCGA 4KH0B 2J9DA 3G6YA 4F36A 3CCZA 5C2GA 4I6WA 4JBCA 2R98A 3DRPB 4KKOA 2AFXA 2VQEF 4BS2A 3SI8A 2POKA 2QLXA 4EI2A 5ELYA 2V6AA 2I3CA 4OHYA 3V6DB 1LWFB 1UVLA 1QAYA 2ZE2A 2RDIA 1X4AA 3MEGB 2GHVC 4DL7A 2GE3A 1KVJA 3JRUA 2GV1A 2F5GA 1YVOA 5IB0A 3GZ7A 3KZWA 4DX5A 1WI8A 1BUXA 4O23A 1TVRB 2W7AA 3GFZA 3AOAA 3ENAA 1YX0A 2CFXA 1NK8A 1OPIA 3J81U 4I68A 3OL8A 1S4FA 4L73A 3W64A 2WOMA 4LR9A 2V4JA 1PGZA 3PCOB 1UW9A 5E3PA 2ASLA 1I1GA 1XR7A 4ES3A 1MWYA 4KOWA 4A33A 1S0NA 4K0KF 1PIEA 1S1TA 2I8EA 1IQTA 2M8HA 4KO0B 2LQ5A 2UV8A 3ADAC 4KHRA 4JUZA 1SBRA 2DPJA 2BZ2A 4MY0A 3PW2A 2F3JA 1H38A 3N6NA 3NOCA 1TKXA 1WF0A 1BY9A 3KLEB 1O8BA 3HHNB 2NPIA 4CYPA 1S4EA 2ZBIA 3QGGA 4CLWA 3TVZA 3DM2A 3HD2A 5CAAA 1TKFA 4Q0BA 2EI5A 3IWXA 1NKBA 4DR3J 1ON0A 2VQFJ 3MM8A 1FXDA 1DY3A 2M8DB 4N47A 1REVA 1NJYA 3IBFB 1UAWA 1VQ4S 4HNXB 2CQGA 2PA8D 3CJRA 1HA1A 4WP9A 2HRYA 4DSEA 5I3UA 1WG1A 1F2HA 1UL3A 2FIAA 2RB7A 3FQLA 2G13A 2MKIA 4OL8A 4IO1A 4I6YA 5KFRA 1UJ5A 1CPSA 3MEDA 1C1BB 4Y34A 3QJPA 2BA9A 1TL3A 5DG8A 2HLTA 4OC2A 1GEHA 4WBFA 2IM2A 2GIFA 4KSAA 1HPZB 4KJIA 1HDUA 2XHWA 3HZGA 3HSDA 3P49B 3UNYA 1BQXA 2XEXA 4LF1A 1XF8A 4OP4A 3D0GE 1K1SA 1KN6A 3PG9A 5F09A 2MJNA 5IM0B 4JI4F 3VVTA 3QAEA 4L74A 2Q44A 3LODA 2QFJA 2W1BA 2W2PP 4DFPA 4X4RA 2QTWA 3PW5A 3BHXA 4ZCIA 2I2YA 1JLFB 3CJ5A 3ULHA 4ZP9A 2J8MA 1S9EA 2RF2B 2M7SA 2QZ8A 2V8DA 3ET6B 3RUBL 1KHVA 3H5UA 4RW8A 4WYLA 1CP6A 2VPWB 1A0OB 4IO9Q 4OADA 5KFOA 2W2MP 1B3TA 5HMNA 4IKAA 4ORFA 1SCJB 4AL7A 4EYIB 4L75A 3SCKE 1BE4A 1EP4A 3GKRA 2FC9A 3FQKA 4NA3A 4CGOA 4KYZA 2Y0SD 4RUCA 2LXUA 3TO7A 1W26A 1FK9B 4DBQA 3KK3A 3IFEA 3OPKA 1AZSA 1OY6A 3W65A 3RJMB 4Y3CA 4IH7A 3KTQA 4L89A 1DARA 1M5HA 3PEHA 2CZ9A 2B9EA 3EYZA 1S1XA 2ZVSA 4B5PA 2V63A 2VU5A 4ETZA 2XMMA 2B4UA 1ZM4A 3L95X 4KBIA 1N5YA 4A48A 4TN2A 4ANDA 1S57A 2QVPA 4AL5A 4P7TA 3C26A 3DLGB 1NDCA 4ZOSA 3B4DA 4ZP6A 4IDKA 2LU1A 3WDOA 1WWHA 1DQAA 3MWBA 1SIWB 3MD3A 4JYAJ 3MTJA 2MZRA 2WSEC 4OX7A 4R76A 2CF4A 5FVJA 4IR1A 4J9NA 4WFNQ 3LPYA 3RG6A 2ZDOA 4WE1B 3MR6A 1NU4A 1VJWA 3UDLA 1X9MA 2QLBB 1X4EA 1ELLP 4DR4J 4J90A 2ZUGA 2E5HA 4ILRA 2VBWA 3I0RB 4LBIA 4LUAA 3QQCD 4IYQA 3X3UA 4JI0J 2DGTA 4TU8A 4YY3J 3LP1B 1NB2A 3J7ZT 2OZHA 4NXMF 3M4XA 3H4DA 2DCUB 1HARA 1IKVB 2D3OR 2BE7D 2BQRA 2KYZA 3V4MA 3HKZD 1RT7A 5KT4A 3CDEA 3CD6S 1RAOA 5B0DA 4KS9A 4UZCA 4IUSA 1QSOA 1HQEA 4X64J 2CPZA 4JI3J 3R1KA 1YJRA 3B35A 2B5GB 4USVA 5HMWA 1XIQA 4DV5J 2HK2A 2RU3A 2UUAF 2OPQA 3FECA 2QO3A 3GIMA 1ELOA 1E6YA 5KFNA 5D4PA 4KVXA 2Q3PA 4OYAA 4A8FA 1RISA 2G4BA 4X2BA 4C68A 3SQOP 1TK8A 3UPFA 3AD9C 4MY3A 1CQNA 1R0AB 2WONA 3CCES 2VFVA 2DGSA 4URSA 1RYRA 1MNEA 1LWCA 2VG7B 1SV5B 2VJUA 2JBJA 1SB6A 2RS2A 2L9NA 1R8HA 3R7SB 4CO2A 1PC4A 5L9XA 3QZ7A 4QBUA 3EO4A 2OEJA 3MMCB 1Z9UA 4HI1A 2B9YA 4O3NA 3NKYA 2L08A 3D66A 3M6VA 1O5JA 4ZY2A 4JWPA 1P6TA 2B3UA 5C82A 2OPPB 2JEJA 3O6QA 4MCPA 3BR8A 1UWAA 3CCUS 2LLZA 1VDHA 5L9NA 1SQHA 3SCJE 2XO6A 3VAHA 5T7LB 4P71A 1S60A 4DSKA 5IT9Y 4MYTA 1NMEB 2GVDB 4C11A 2JHEA 4DV3J 3QLHB 1YMEA 3GLJA 2P6TA 1KSPA 4ZLJA 3POTB 4WPAA 3DLKA 3JSMA 3UCGA 2M0GB 3GR1A 4OAEA 3VQTA 3I9V9 1RJJA 3CMQA 1RLCL 1IKYB 2D7SA 4FXDA 1LWEB 3JXOA 1LAPA 1NSAA 1LOUA 5EX3A 1TAUA 1PYOB 3ENWA 1WORA 3I5CA 3QBCA 3D6MB 2KI2A 1MMDA 1RTZA 5HJYA 4USIA 1JLQB 3C8YA 3BBFA 2R2RA 1IBCB 1VMBA 4MIBA 2LP4A 4MCQA 3KK1B 2W9BA 2QLJB 3RRGA 4DUZF 5LSRA 4CGLA 5AG5A 1PU9A 4JP8A 5DS0A 4A37A 3PBEA 4ZLLA 3M05A 5IB9A 3MMAB 4CLSA 3D67A 2HMIA 1IKWB 3CJQA 3HP6A 2R7QA 2RMLA 2RNEA 2J5AA 2OU2A 1WEZA 1GK8A 3FIXA 4CH1A 9ATCB 2BANA 3T5LA 4FPRA 2I79A 2C6PA 1R7IA 5K14B 2RFHA 4C0OC 5IT9U 4JLYA 2VASA 2VH7A 2ZHBA 3IWGA 4QQBA 4DLEA 1Y5LB 4PYDA 2B7CB 4AL6A 5CYQA 1SL0A 3CZXA 3NFZA 2RS8A 3EVMA 1XMQF 4WJBA 2HV2A 2WVFA 5KT6A 3VATA 2DH7A 2VD3A 3OTCA 2CNOB 1VLOA 4CLUA 4RW9A 1L5UA 5J1EB 1HW9A 3T3FA 4QIVA 1IM4A 3PX0A 4S0MA 4GO7X 3DOLB 2VI7A 4B3OA 5LRGA 1V0CA 4OV6A 1LK7A 4B11A 2FHKA 4CZCA 2FVGA 5CBMA 4F3OA 1VRTA 4Q2LA 4AE5A 1R27B 2DGWA 3DOKA 2J8SA 2WCXA 2Z3NA 4A8OA 5HMYA 4OLPA 4WP3A 5KG6A 4CO1A 4Y2CA 4MH8A 4B9VA 5F48A 3HD1A 3MHYA 4LIRA 3R95A 2AGOA 2F8EX 2DIUA 2AW0A 4TQRA 3TX8A 3DI6A 3CDXA 4DPTA 3HSGA 3CO9A 4LT6A 2R7VA 1SH2A 3J81j 3NY0A 2V2VA 5KT7A 2ZPAA 3OL7A 1GNKA 1H73A 3BYRA 1P1TA 2CTBA 2FLPA 2IA0A 3IAS9 2X1GA 3CCLS 1LANA 4RUAA 4A95A 1CM0A 3KUHA 3IM8A 2HSEB 3TE4A 4FYDA 5F41A 4DR3F 2B4BA 4JB8B 4K30A 4TLQA 3CF5Q 2Y0BB 4YRHA 4H6ZA 1Q8BA 3RW7A 1YBTA 3LWLA 4KGZB 4LR7A 4DU7A 1U02A 3B3VA 4NWBA 2AFMA 5CD4A 1SH0A 1QQ9A 2D4OA 3FRZA 3MPUB 2O3DA 3PW4A 5J1PA 3UDVA 3RB4A 2QYGA 2K3KA 5LJ5Y 2N7CA 3NEKA 2OO4A 3J7AN 3UI3A 3M7VA 5HQMA 3D3BJ 2EK6A 1LXJA 3ONQA 2OD6A 3KHLA 3BREA 2PMZD 1YGHA 2DT9A 4ED0A 3TANA 1VC6A 3L3CA 3JSBA 4PG7A 5KFMA 3B7IA 1GYTA 2B6AB 3R9FA 1S1UB 4PQUA 1VS3A 4ONUA 2PE8A 4RW4B 1VHOA 1Z4UA 2KT3A 3MAAA 2DGVA 2YWEA 2AGPA 2EXUA 7FDRA 4I67A 4AXJA 3HCXA 1HQUA 5CYJA 3G8WA 4C7IA 2C1CA 4Q38A 1NK5A 1Y10A 2Z10A 4FVCA 3G82A 4A8MP 2JDJA 3DOMB 3UO0A 3OJUA 2YKNB 3SCLE 2CPJA 3MM6A 3S9MA 3AQPA 2DPIA 3RAQA 2VODA 1PCAA 1V5IB 1KFDA 3CWJA 5KFVA 3K5NA 1JLGA 4F6AA 4HH0A 5K8NA 1JK9B 4E0AA 1UVJA 2VA3A 1Q2YA 1GQEA 1YJVA 3CDAA 4RW6A 2ZH9A 1KLNA 4ZDNA 4ED4A 1UPPA 2XLKA 4RBVA 4CQ1A 3GV8B 1IR1A 2Z4PA 2F5IA 2FHJA 2ZUAA 4B9SA 2B5JB 3PV8A 4F0KA 4PYAA 2PJ7A 1RA6A 4NLYA 3ILJA 1SIZA 4ZKAA 3J7YU 2PJ1A 2JLGA 4OIDA 4CO3A 2ZW5A 1EAYC 4BC7A 2IVYA 3AD7C 2RDDA 3OUYA 4DR5F 2HG4A 4NA2A 5L46A 3OVBA 3DRYA 4CLYA 3F44A 4U8VA 1C4CA 4ZVFA 4DDFA 2LU2A 5GAHI 2AJ6A 2DY9A 3PFOA 4MAKA 2FVQA 1VBYA 4UCNA 3R8YA 1PJ6A 2I9SA 3H5SA 3T41A 4EMEA 3BBBA 4R8UB 5HAOA 4IUFA 1HL6A 4QWEA 2IRXA 5B08A 4Y2IA 4K4VA 4ZY1A 2YH1A 4B5OA 3PEIA 4U9YA 3AFGA 5KFSA 3Q22A 4M5NA 2D3UA 2CZ4A 3BF4A 4USTA 4QBJA 4MRIA 2FVCA 2O67A 3M2VA 2G9OA 4JZ0A 2V9WA 3KK2B 1YG0A 4JI3F 2JLMA 5D0HA 4LF7F 1EKSA 4FAIA 2QA4G 3RBEA 2ZNYA 4IOCQ 1V3ZA 1IJFB 2OPSA 1SI9A 2OMLA 3ZTRA 4N56A 3HHLD 3RBDA 3IR5B 1H2UX 2GQQA 1JWQA 4DS5A 4PXBA 3K9UA 2YNDA 3KMSA 4UFWA 4BMHA 5HMXA 2YNHA 4WIIA 3CCSS 2AV5A 1NRKA 1YRUA 4GC6A 5K20B 2BBEA 5L1IA 4ZVUB 2MB0B 1ARLA 3MCOA 2CDQA 1JKHB 3WABA 2WB4A 1S72S 4K4WA 4NCGB 4X65J 2YXLA 1QSSA 1R6VA 2HQYA 4ZVRB 3HHLA 2QSFA 1WTBA 4NCAA 2CJ9A 3BSNA 4KKOB 4XPCA 1F9FA 1HBNA 1REGX 2RKIB 4QPTA 2ACMA 1XC9A 3V38A 3KLFA 4UY8T 2HZCA 1F2GA 2WVCA 4U95A 2FZGB 4C7QA 2MQNA 4OIXA 3CIZA 1YIJS 1J5OA 1U1NA 1MN9A 3I1UA 4IF5A 2HBYB 4CGNA 1GMVA 3VGSA 1XK8A 3NWGA 1NPRA 2HS4A 3OD2A 4CLZA 2ZZMA 3ZO7A 1M1GA 2RQMA 2QL9B 1M1HA 1AMPA 5AGEA 3SI2A 3MMJA 3EWGA 3WC0A 3PR5B 2HVDA 2WOMB 3MGJA 1VJQA 1NUEA 5A8RB 5U47A 4F04B 1B64A 5D77A 1A2ZA 4HNWB 1FX4A 3GFHA 3IXQA 4DV6F 2CPHA 1SJFA 4CLFA 1KOOA 4ER8A 4ZCLA 4DZDA 5ETQA 3NBPA 5DO2A 1ZPWX 1XFOA 3B8GA