2NSMA

Crystal structure of the human carboxypeptidase n (kininase i) catalytic domain
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
399
structure length
390
Chain Sequence
KLAFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNKEALIQFLEQVHQGIKGMVLDQNYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxypeptidase N catalytic chain
publication title Crystal structure of the human carboxypeptidase N (kininase I) catalytic domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 136
structure length 390
sequence length 399
ec nomenclature ec 3.4.17.3: Lysine carboxypeptidase.
pdb deposition date 2006-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 2nsmA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2nsmA01
3BHXA 4DYOA 3SJGA 3ISXA 4RUHA 1Y7EA 2DEAA 3CPXA 2PRQA 3IFEA 2ZEOA 5ELYA 4IHMA 3VARA 4R7MA 3HUVA 4MCSA 1TF8A 1BPNA 4YWYA 3KR4A 4P44A 4A38A 2V8GA 3IIBA 1VHEA 3D67A 3KCPA 3D7DA 2ZENA 2ZOFA 1LAPA 5F09A 3MN8A 1TF9A 1CP7A 5K8PA 2XEGA 3FX6A 1ARLA 3NFZA 4R76A 4MRIA 3KASA 4P4JA 4O23A 3D68A 3WC5A 2PVVA 4FXTA 4FAIA 4BD9A 6CPAA 1NKGA 3KR5A 2JEWA 3PEIA 2ZEDA 3N5FA 4EFDA 3FVLA 5HVFA 5LRKA 2PVWA 3E8VA 2V8HA 5JM6A 3SJFA 4NGRA 4OC3A 1LOKA 4P4BA 4LQGA 1DTDA 3PBBA 3G3LA 5LYDA 2QJ8A 2V8VA 5LYFA 4U3SB 2OOTA 3B7IA 2GLJA 4DUKA 4X2TA 2Q43A 4Z65A 4WWVA 4OC1A 2XHNA 3D66A 4IK2A 2PCUA 2POKA 1TXRA 2PJ0A 3JRUA 4OC5A 2PJ8A 3LWUA 5HXDA 1TKJA 4OP4A 4UIBA 3GB0A 2ABZA 1ARMA 3D7FA 2GLFA 3KHXA 2AFOA 2HB6A 1UWYA 3B3VA 1ZLIA 4MCRA 1Z2LA 4ZY2A 2QVPA 2C6GA 1VHOA 4MCQA 4F8ZA 5K8OA 1XMBA 3V38A 3NA6A 4H2KA 4WJBA 5I4MA 3RBUA 1VGYA 3HN5A 2PJBA 1CG2A 1PCAA 1M4LA 4OC4A 4ZI6A 2ZOGA 4B6ZA 4F9VA 4PQAA 3PB9X 2CIJA 2ZEPA 2G9DA 4ONWA 4PXDA 1PYTB 1H8LA 1VIXA 3PFOA 3H8EA 4ZY0A 3IC1A 4PXCA 3PFEA 4EIUA 4P4EA 3IWWA 3BI0A 4ZYQA 1HDQA 2PJ1A 3SI1A 2PJCA 3PB6X 4IAVA 3DLJA 4PXEA 4CPAA 2BCOA 5DS0A 4X3RA 3IO1A 2AFXA 5JGFA 5LRJA 4TWEA 3TX8A 3D7HA 3SJEA 3NH8A 4MHZA 1Z5RA 4K3NA 2FVGA 2IQ6A 1XFOA 2J9AA 5LYIA 3GLJA 2PJ2A 1ELMP 4NGPA 5IB9A 1TKHA 4Q7AA 1LANA 3GUXA 4OIDA 2F8HA 2AFWA 2HC9A 4NGMA 5K8NA 3KGQA 4A94A 1Z8LA 4G1PA 2PJ9A 5G5DB 3V7ZA 1XRYA 5CBMA 1YMEA 3PB4X 4P4IA 4NJQA 3VATA 3ISZA 4ZX9A 4NGTA 4PXBA 2IMOA 1NSAA 1YW6A 1ZG9A 4NJRA 4A39A 4P45A 3RZAA 1XBUA 2I3CA 2CTBA 2V8DA 4UEEA 3FF3A 3WC7A 1CP6A 2ANPA 3PB8X 4YOKA 4GM5A 4DJLA 1TKFA 3B3SA 4JYWA 4YU9A 1IY7A 4IYKA 3B3TA 4NGQA 4ZX8A 5AQ0A 3BXMA 2GU2A 1CBXA 1HDUA 3SI2A 2AFSA 4FBEA 4EMEA 2PJ3A 4P4FA 2CTCA 3T8WA 4MHNA 2RFHA 4X8IA 2JBKA 2QYVA 3QNVA 1BAVA 4OC2A 2EK9A 3H8FA 1R43A 3B35A 1CX8A 3NH5A 3K9TA 3D4UA 1QQ9A 2ZEHA 2ZEEA 3SI0A 3KQXA 1GYTA 2JBJA 1FT7A 3S9NA 1F57A 2PJ7A 2VL1A 2IJZA 1FNOA 2ZEFA 2BO9A 2Q51A 5D8NA 3D7GA 4R8FA 1F2PA 4MXUA 4OIWA 5K8MA 4UF4A 2C1CA 4KSIA 2ZEMA 5J1QA 2XEJA 5CPAA 2AFMA 3KHZA 1CPSA 2ZELA 1ZG7A 2AFUA 3FH4A 2O53A 4UEZA 3IJ3A 1R3NA 4FL4C 4W9YA 3HLPA 7CPAA 4NFRA 4MMOA 2XEIA 3FECA 4OKOA 1HEEA 1F2OA 1RTQA 4JZ0A 4R6TA 1YW4A 2PJ4A 4NGSA 2PE3A 4F9UA 2RB7A 2Q4ZA 1DE4C 3VH9A 1YSJA 2PJ5A 1Y0YA 3SJXA 2EK8A 2V77A 1BPMA 1OBRA 3WT4A 4NGNA 3PRTA 5LYLA 4FUUA 1LCPA 4MHYA 3K2KA 4MHPA 4MCPA 3LMSA 2PIZA 3B3WA 3KQZA 4UEFA 2B59B 3MRUA 5HVHA 3CPAA 1QMUA 4AXVA 5LRGA 1ZG8A 1EE3P 1AMPA 1ZLHA 2NSMA 3CDXA 1YLOA 4FWUA 4P4DA 3KL9A 2AFZA 5THWA 3PB7X 4A37A 2WZNA 4PPZA 3TC8A 3NJXA 3BI1A 3FMCA 3FEDA 4EWTA 2EWBA 4UIAA 2ZEGA 1CPXA 3NJVA 3FJUA 3S9MA 2CF4A 4P10A 3S9LA 3RAMA 2OR4A 2BOAA 4OC0A 2PIYA 3B2YA 2C6PA 4TNUA 3B3CA 2WYRA 2O4HA 2XEFA 5K39B 1BLLE 5HVGA 1XJOA 2GREA 1ELLP 2PJAA 1JQGA 1IGBA 1AYEA 1Y0RA 4WI0B 4P6YA 3DGVA 8CPAA 2NYQA 4OMEA 3WABA 1KWMA 3KI9A 3L2NA 3NH4A 3H8GA 5D29A 4ZY1A 5JH9A 2C6CA 3KZWA 3IEHA 3CT9A 3I1UA 1LFWA 1LAMA 1Q7LA 2F7VA 3FEEA 3PBEA 3WC6A 2PJ6A
chains in the Genus database with same CATH superfamily
1KJ2H 4I3SL 5HYFA 3EF4A 5I1IL 1MW2A 5GRUL 2J1ZA 5DHVH 5AVSB 4PGDA 2EXWC 4OADA 2K6YA 2X4PB 1I1FA 1N26A 4PN6A 3D39A 3QPXH 4S2SA 5HDBE 3WKPA 5DRNA 2RFXA 3QWRD 3SGDI 3JVNA 3VARA 5GZOC 1AKJD 2YAMA 1KIUB 3KYMB 1TF8A 4FJYA 5EZPA 5LLIC 3TA3A 4K94C 1PDKA 4MS8D 2YXMA 5CUSL 3GJFH 4XTRC 4L0ZA 4OCYH 3IIBA 2H1PH 3JT2A 1S9VA 4FNQA 2NSXA 3GSOB 1YX0A 3H54A 2QPUA 5E94B 5D6DA 4DKDC 3KXFE 3CDFA 4JFDE 4ZJ9A 1ZVSA 3M17A 1NINA 4FD7A 5INCB 2EDDA 4ZUTB 5FK9B 3AXLA 4FRWA 5IFHL 3D68A 3TF4A 1INQB 1XDTT 1LP9A 1FHGA 2HLEB 6CPAA 1NE9A 1KPRB 3LB6C 1V5JA 3BVXA 3IM1A 3QG7H 1TZ8A 4X5WA 3DGGB 4APQA 2VZVA 3PEIA 4EUPH 5KSVB 1DQVA 2Y2TA 2WZPA 3MKKA 1OGTB 3MNVB 3P4LA 3SB3A 2P49B 4XC1L 3Q6FA 3QUXC 1C5DA 5AKSA 5EH1A 5GGRA 1F4XL 1FN4A 3ZYJA 4P07A 4LXFA 2Z4TA 4Q0XL 1EH9A 4F8OA 4WWID 1IE5A 3PBBA 4TOYL 4WU7B 5DHMC 1QSNA 3MLTB 1CFMA 2D9CA 5HDBF 3T0XA 5LGJB 2P44B 1E8YA 2R69L 2Y6SD 3N0PB 2Y6TE 4HH9A 4QEGA 3SIKA 3EOAB 5E8PB 3TIEA 3IAGC 1FLTX 1RZFL 2AMGA 1M1DA 4GFTB 2J4WL 4LL1A 2P8PA 2NR6A 4UYPA 4XPGH 3ETSA 4KDTC 3ZVVA 4CS0B 4XMKH 3F64A 3W9EB 4PW3A 3QJHB 4LDEB 4MJ6A 1YEIH 3SEPA 4IJ3B 3L9BA 3IU4H 3QFGA 4PAZA 1YNTA 3B3IB 4EIGB 1IZKA 3K9UA 1LDPL 4N0YL 5D1QB 1EHKB 1WFJA 4QRPB 4XXDA 5FYJE 4AW7A 2DBLH 3R8BB 1BD2D 1BFOA 1S9XA 3DHUA 5C09B 2Y1VA 3FL7A 5JW4N 1QSTA 4MCYA 2QVPA 3D4YA 3D39E 3EDFA 4R3SA 3BWAB 5DZPA 3K8KA 4H20L 5A2CA 3OKEA 1MVUA 1RURH 1I7UB 3UL4A 3GMLA 5HD8D 4YSOA 3GS4A 3ISYA 4R2GB 2ZOLA 5IM7B 2W8CA 2CXAA 4WJBA 2ZICA 4GBXD 4UCFA 2DQDL 3ULVH 4U9YA 2Y24A 3OGCB 4JHUA 2XDHA 3SJVA 2ICEA 2EIZA 1NWPA 2VQUA 5LG6A 3WTUA 4L8CA 5HYEA 1X5IA 4HSQA 2OMNA 3FO2A 4GXFA 1HZLA 4A32A 4U1NA 1QG3A 3N55A 1QSMA 1TQUA 1PCAA 5KG9B 1M4LA 1D5BB 4LPXA 5ADPL 1XGQB 1LP9E 4QRRE 1JDCA 2O1AA 5JOEA 3DO7A 1YEJL 4H8PA 1AD9B 4JM2C 1N8ZA 4YZWA 2G9DA 2EDQA 5FO8B 1M6OA 1U8LB 1NGPL 5HHXH 1QRNE 5KJ7E 1HZHH 1IEBA 3RNZA 1NGYA 4N8VA 2Z7WA 2OXGB 3V8OA 4KK6C 1HIMH 2IAMB 3CVCA 3QEHB 1H3GA 3P40A 1MCNA 4PJAA 2AJ6A 1KCLA 1UT2A 5FO9B 1DVSA 5M95B 1C9SA 3E3QC 2C1PB 2CK0L 3BI0A 3P3SA 4HIJB 1IVTA 2CRZA 1JCKA 3IMSA 4RRPM 4CAXA 2Z8VC 5DHYA 2X44D 3G9VA 1AGDA 2CZNA 5SWZB 5IIEA 4L05A 1QWNA 1GKEA 2X4SB 5C0CD 4MY0A 4NGHL 3ARSA 5IF0B 1B2WH 4UIMB 4UZSA 4QRFA 1WLHA 4YSCA 2FDBP 5ESQB 4FQXA 1HXKA 5KVEH 4K8RD 3RIFK 4XP1L 2FATL 2BHYA 3O3DB 3QO1A 1JZEA 3BH8A 4FQ2L 3ZYIA 4RIRA 4FQJH 1UEMA 3L2LA 2APXA 1NKOA 2V5RA 5IOKA 3W9DB 4AENA 2XZAH 1LP9F 3MMEB 1TEYA 1HH6A 1S7XB 2GJRA 3ZTJG 1OCZB 4YBLB 2GJ6D 5A2BA 1Z2KA 3CAFA 4PGZA 4S1DC 4D9RD 5I6KA 2IDCA 2ZYIA 4O02H 1O6SA 3P73B 3S3JA 2AK4A 5E4OA 1BAFL 4JQIL 4M00A 2PJ9A 5F7DB 1RL1A 1JZ3A 3LAFA 5CBMA 5AG4A 4X6DA 3N43B 3PL6A 1D2PA 3V0DA 1QSOA 1QKZL 4NRYB 2FZ3A 3LRHA 4S10A 3SJVE 4DTGH 5JPHA 4NGTA 5CJQL 3AADB 3CVIL 3ALXA 4QHKI 5ILTH 2LAGB 5F9AC 2I7OA 1MCSA 1NSAA 2QZ5A 4LU5H 4JO8A 1E3XA 3QIWC 2P52A 3HC4L 4Y19D 2XJLA 4XPBL 4XPAH 1MEXH 5LG1A 1UEYA 3QH3B 4F7CB 4XPKA 4P06A 5DZNA 1QLRA 1YNTF 5DEGA 2IWEA 4OLWH 3OR6B 2WHVA 5FYKH 1UJ3B 1HHHA 4MJJA 2A0LD 2C7UA 4G6AD 3LDBC 4KQ0A 4FZ8H 4XAWL 4DJLA 5F7EH 4FQCH 2AMUA 4E9TA 5I6MA 4PJAE 1O7SA 1AZCA 4YGOA 5MEQB 1IYLA 2OMYB 1ZLUH 3CWGA 5I8KH 4TXVB 1QPXA 2MHAA 4I89A 4LP8A 5JPMB 2BOBA 1N59A 4L8SB 1JWMA 4UUJB 3BE1L 1Z3GH 3VD2A 2VKXA 1AGBA 4DEPC 3H9HA 1Q9WA 4OCSL 5GGUB 4K94L 1U3HB 3CFEB 1E5ZA 2CGRL 5CBAA 1CFQA 2N59A 3MA9H 2IBZX 1OB0A 3APCA 1HE8A 3SE8H 2F1AA 4KJQD 4JE4B 1EQWA 4MFQA 2YJQA 3BVUA 3SPCA 4OZGA 3I9IA 1WWCA 2PF6A 3UTQB 3QUKB 5GGRY 3SDDB 3W0WD 4PJ9C 3B2VH 3GSNH 4B9GA 2O93L 3MVSA 1BMZA 4HETA 2YQBA 3MRHB 2JKWA 4LSDA 4QKXB 3GI9H 1NCGA 5F9WB 5TPWH 3U1PA 1R3HA 1QSEE 2ENQA 5IHZB 3IFPB 3SOTA 4AQOA 1P4IH 2VMCA 2AK4E 3Q8FA 1LTXA 4NNXB 1UATA 4FLRA 1IEAA 4PJAF 5EZIH 1N5YL 4OFQA 3BYYA 1E27B 2VDLL 4CKVX 1YEKH 3SO5A 2BO9A 2K3HA 1HXYA 3U2JA 5D8NA 2BC4A 2APWA 4PS4H 1FDLH 3ARPA 2DF3A 3DWTA 4S0TD 2IPKB 3SPHA 5HPMB 4GO8A 5IBTH 2PQ8A 3BP4A 5IGXH 3QDMD 2VE6B 3P4MA 1IYKA 2X10A 1XZ0A 1MCHA 2BS71 1RUPH 4H25A 5TH2A 1EMTH 2VDKH 3QO0B 3WEOA 4ABUA 4EI5C 3U6RB 1B6BA 1T20A 3VFMA 1AR1C 4M7ZB 5CJXC 1O9VA 4MA1B 1OE1A 2VITB 4NZTL 3O3EB 1T4KA 3ZRCC 2VLRB 3LSOA 3LRKA 5ABAA 3H7LA 2VZUA 2ZOOA 4X8GA 4WFGD 5HJGA 1MRFH 1XOVA 4TQ8A 4AYBA 5FCUL 1E4WL 3BWUF 4ZFOL 3UTZA 4QB9A 3MV7B 3VQLA 1C8PA 2EH7L 1LJMA 7PCYA 5J9PA 2BW4A 1R3NA 1OCWH 4P0DA 4EXPX 5KBLA 1E9QA 3C5JB 4LEOB 3US9A 4MNGB 4A7SA 2XKNA 7CPAA 4NFRA 5KSUB 1U42A 4PRDA 5HYJE 2NY3B 2VLLB 2W0FA 1UD8A 3HCVA 2OV0A 1RTQA 3PJSA 3OC5A 1JZFA 3MXVH 4Y5VB 4H0GA 5TDNB 1VZGA 2ZCZA 5JHBA 4LSUL 2YLHA 5IEHB 3B9KD 4F9UA 5EV7A 1NC4B 2PTTA 5IBLD 1EK3A 2Q4ZA 1YJDL 3U4BH 4Y4KA 3HZMA 1A6VH 1KLFA 1NLBH 4A55A 1C12A 1QTPA 4HUXB 5KSBB 2B4DA 4PJIB 5T5FH 2X4NA 5E1AB 3O3BA 2BSRB 4NUPA 4NGNA 1GZPA 1I9RH 2OMUB 2G9KA 4GKSA 4IOSA 3V4PB 3CH1A 5JIIA 1EVUA 1KEGL 2WQXA 1LCPA 1EJOL 5J1AA 3QG6A 2F1EA 3VI3A 1IIIA 1KUXA 4FGMA 4PB0H 5KVDL 1SQHA 1QP1A 3WEMA 4HPYH 5BCAA 1MCIA 4OIFA 3EJCA 1RHHB 1OZTG 5E8EA 2D0HA 3F7KA 1X3DA 5E6IB 5GZNC 1M9SA 1NCAL 5I76B 2ENSA 4G42B 3T90A 2WKLA 3LNGA 1TETH 1IZJA 5I6OA 4I18C 4Y16B 4E42A 5D7SL 1KFGA 5A7EA 1F1DA 2BOLA 2VJXA 3CU1A 5HY9A 2C4FU 2CLVA 4LCWD 3KBEA 4QWWD 3UOAB 2Z3LA 4PRIA 3HNTL 2Y9RT 3LKRA 4Z5RA 2IIJA 4L3EA 5C0EA 5KVGL 4GINA 3W56A 2UZIL 5EF0A 5HHPA 2PR1A 5HHME 4P2RB 2NSMA 3SXOA 4Z0XB 1KT2B 1RUML 1YLOA 2VDPH 2X6UA 5AG8A 5G20A 5GGTA 1T7VA 4NYLA 3ULVC 4YO0B 4E2AA 5C0DB 4L9LA 3UACA 1EJFA 2EEAA 3GYRA 2VDNB 4HC1H 1EAJA 4KAQL 5DLMH 4DAGL 2WZNA 5JA8B 2ODHA 5EU6B 5FDWA 1QD0A 2AGJH 3KVDD 3I75B 4BZ1A 1NIAA 2FK9A 2JB5H 3X1GA 4YHNA 3MJ7A 1PJ9A 1RSFA 2K9FB 3ESVF 2VBQA 4XMXA 1JXDA 3U7AA 4X2UA 2CF4A 2OULB 3QUHA 1FNSL 2OR9H 2WZ6A 2ZW7A 4KVME 3V4VA 3GXNA 4KQ3L 4RGND 3TOAA 1DEEB 3C09B 1F18A 1GXEA 1MAJA 4N2CA 4KFMA 1BLNA 4LKXA 4P46C 1U33A 1W8OA 3RU8L 1H6EA 1JRHH 5INDA 3UG3A 4XMTA 1E5BA 3FQUB 2WQSA 1KG0A 4BUHA 1MF2H 5KZCB 4LLWA 1BIIA 2DQUH 2Z3NA 3WE6A 35C8L 4C8XA 1B4TA 1OE3A 3QE5A 3VX1A 3VI3E 1RK0B 1X4XA 4FQQA 5KW9L 4N3TA 3P3YA 1AZZC 1KBVA 1V7MH 3DX2A 3HRZB 1YY9C 2CM6A 3P9LB 2JIXB 4LLMA 3VFUB 2HV2A 4HS8H 1YVLA 5JDJA 3PP9A 1M56B 2EUZA 2G3AA 3GMNB 4XR8C 4I1RA 5G4OA 2F8OA 2XXFA 4ES8A 1T83C 4L48A 1WWZA 3FCGA 3BISA 2HN7B 3AAZB 3P9MB 3V5HA 4B5OA 1PS3A 2C7FA 1WFOA 5J12C 4PRIE 2NXYB 3EDKA 2I32A 3ARDD 3FB7A 5C6PB 1G7PB 3MC0A 4L3EE 4RMRA 3KXFD 4K73A 3HN3A 4ZS7H 2WJ7A 1YN7B 3VH8G 4JFDD 5LO7A 3SJGA 4RUHA 5G21A 3QFDB 3VFNB 1EFXD 4D0CB 3EYOA 4ZMQA 2C4FT 4UFWA 2PCFB 2ID5A 3MRMB 3GRBA 1CUOA 4OTXH 3EGDB 1F86A 1BZ7B 1NGXA 1V55B 4YEFA 3ULUH 5CKGA 4ZOEA 4F15C 5A1AA 4AUUA 2V8GA 4OD1H 3L1EA 4UM9B 1J12A 1F00I 1Y18A 3VI3F 3L3JB 3NPSC 1YMHA 3FTZA 3GY9A 1PX8A 1N10A 1ZGLM 3W11D 4BHUI 3LKPB 1ARLA 1JGLL 2E4FA 2EYTA 2VDML 1NEZA 2ADIA 3RFZC 2HVJB 3JUZA 3TVMD 5I0DA 1RUKH 1SUJA 2Z0BA 4C58B 2HTKD 1P53A 2W9DL 3DOSB 3T3PE 3OMNB 2FTAA 1IFGA 1ZTXH 3BESR 3C5SA 5HSFA 4MQTB 3QXDB 5CIPB 4A7TA 3MLPA 2G0KA 3DV4A 3EYSH 3C9NA 3MSPA 4BQ8A 5HVFA 2X1XR 1G94A 4JHAL 4R90L 2QVMA 3BIKA 3B34A 4P4BA 2VSDA 3UBFA 4WKZA 4OCYL 1BM7A 3G3LA 5A40E 2DQFA 1S6NA 4ZTPH 2NNAB 4DF9A 1SDYA 6FABH 1V3KA 1IKOP 2MMXA 2ZKXA 3C75A 5FYJD 1HWWA 2BSTB 2LV4A 4XP6H 1G84A 1FFPA 3L9YA 5C0GA 1UFGA 4KMTH 3TCVA 3U1SH 1M2VA 3D39D 4P23A 4KJYA 4AQ1C 2Z7UA 3ZW3A 3T4AB 2YQ3A 4YK4B 4I1PA 1YPZA 4IEFB 1P7KB 2BNRE 1RZQA 2IMNA 2GK2A 3BPCB 5IMOA 3JRUA 3LWUA 2YS4A 5D93B 2ZOUA 5AVTB 1NMBH 1BSIA 1GGUA 3AS0A 1TCRA 4UQ9A 2OZ4A 4C59B 4LVNB 1UKQA 5AW5B 4HCRL 2GITA 3PXHA 4WV1B 1PZDA 3WBDA 5DEFA 1I7ZB 3FQNB 3K6DA 5BV7C 5DJ2A 1PGRB 4LLYB 5C3IA 3T3PF 1ORSB 1A7QH 4LVEA 3FYIB 3JZ7A 2C6GA 1MLBA 2JI2A 4CGMA 2B14A 4FZEH 2AXGA 4QRRD 3IKKA 2G2RB 2ZUXA 5LBGA 1XR8B 3MCLH 4UTBL 3NFPA 4APQD 2J72A 4PR5A 3SGEH 1CLVA 3BPLC 4RMQA 1WGOA 4XPGL 1QRND 3LKNB 2WZPD 2FT6A 1JWUB 5JHDB 2ICWA 4HSCX 1ZD6A 2PR4H 3BT2L 1YEIL 4GO6B 2AEQH 3HG1B 3IU4L 5M94B 4ORGB 2A7BA 3TONA 3RUGA 4ESKA 4YSAA 3DX9B 1KJVB 1WAEA 3O6KL 2HG0A 4JVPA 3Q43A 1FJ1B 3V10A 4XPFH 4U1LB 5KTEL 3CU7A 3L3OB 4FFYA 5D70H 2YUXA 2BP5M 5DD3L 3ZK0A 3LV3B 1XIXA 3KL3A 4P2OC 3S8GB 4BBHA 2YAEA 1KLUB 5SX4I 3LKQB 4Z3TA 2OL3A 1HEZB 1J0JA 3LRSB 3BPOB 1PBYA 4MZIA 4UINH 5IT2H 3F7VB 3MGAA 2FEEL 4KC3B 4GEJA 4LHUG 4KJPD 4BQCA 1NCDH 5E1HB 4DK6A 1JGIA 4FP8L 4LPVA 2ERJC 3SE3C 3WG7B 4V33A 1S7RA 4O00A 5D1XA 3O9WD 4AT6B 2PTVA 2PWDA 4JHVA 4OAWB 3ULSB 3PLYA 4RFEA 4KDWA 5LRJA 3D5OF 1YPZE 4KUAA 2WSAA 3KDMB 1J0ZA 3BZEB 5DJDB 5HHXL 4E41E 4YVNA 3K5SA 1DBMH 2Y7QB 2AJZB 3SJVD 1CYXA 3X14A 1AHKA 2X4TA 1HIML 3S88H 4Z77A 4Y4FC 3M7FB 1BQUA 2CDEA 4XWGH 3UAAA 1RZKH 2W9LA 1LWHA 4ZYKB 4FERA 1UD4A 1CVRA 1HOEA 2Q2EB 5LCVH 1DCEA 2UWEA 1T2JA 1YECH 2I07A 2IQAB 5DC4B 3FUJA 3EFAA 1H3WM 3UX9B 4U3CA 4ZFZA 1GPOH 5EZJB 4M4PA 2AJXL 3DJTA 1KIRA 4A2MA 5EU5B 2Y22A 2EIMB 2ZUSA 4P4IA 1B2WL 2G3ZA 1YNKL 1QQDB 2QSVA 3MNWA 1ASQA 1N0LB 1BFSA 1TQTA 5GXBB 1HH9A 2GHWB 4OFVA 1OHZA 3C5ZC 3CVHL 3T3MB 3VDBA 4BCYA 3OXSB 5AVYB 4M5YL 4PVBA 4UB0H 1B6DA 2YLKA 8FABB 1F11B 2Q1EA 4FQJL 4XPHH 3LZFL 3PHQA 4D94A 5BZDB 1P84K 2XZAL 4I3GA 4L89A 3P4OB 1DQDH 1YPZF 4JRYA 5GRZA 2N7AA 3IDNA 4X5KA 5BZWA 3K72B 4UWJA 1N2RB 1QA9B 3LKOA 5IB9A 3L3IA 5AVXB 1KC5H 2JTYA 2Z1PA 4R8WL 4O02L 4RAUA 4TULL 2D31A 3HLAA 1WJ3A 4UCNA 3B3SA 32C2A 2MPAH 2XV3A 4KKQA 4JYWA 4A2ZA 4JM4H 1A6AA 4P5SA 4HX1B 4MYWB 2IEPA 2P5PA 4PLJC 3WY2A 2ZXAA 2HT3D 5CFAA 1FH5L 3T0VA 2IQ9H 4N2DA 4CVUA 1I1AB 2ESVB 3Q2CA 1WC7A 5F6IB 2Q7YA 3WHE1 4YIQB 3T6QC 5AOZA 1QSED 4LLVB 3EJQA 4NO0B 1QFOA 4MHNA 1J10A 2WM0A 4LU5L 4ZAKB 5GGVL 3THMH 1G7QA 1I9JH 3FRUB 5ADOH 4HIQA 1OAZL 3QUYC 2AK4D 2XWTA 5DMYA 4J2QA 4MMYA 4XPAL 5IBUB 1HHJB 4HV8A 5B38B 1JVOA 3RAJH 3NACH 4N2FA 4PI0A 5FYKL 1NCBL 3PL6D 4Y2NA 3AQZA 4I4WA 1KBGL 3UTSB 2YNEA 4FZ8L 4FQCL 5JOPE 4ZW5A 5KTCA 4XNZC 2YAFA 3QIBA 1XGUA 1NAML 1X44A 1W0VB 5EZOH 5F96L 1NBYB 1JGDB 5GRVK 1HI6B 1NDGB 2XG5A 4TLSA 4ZAKA 2AXFA 5ICYB 4MJ5A 2VIRB 3EJSA 1BGXH 3KLKA 5C86A 4YZFF 3LN9A 4J8RA 1FVCA 3DPBB 3P0VH 3EY5A 1WWBX 1J9QA 2VDLB 1IT9H 1SHMA 2PR9A 5FPIA 2NY7L 4NUQA 1WS7A 2P48B 3BKYL 4PWHA 4JXQA 3PWUB 5C0RL 4NLAA 3S5LB 5MEOA 4R7DB 5L9DL 3VM5A 1R3KA 3SXNA 4IOIA 2R29H 3ARGA 1RUAH 3GSNL 4GIAA 4JN1H 3AXHA 4WWPA 2HT4C 1WH0A 2VSCA 1ZA6B 2UZYA 3ZTDC 2DWDA 2BY1A 4OB5L 4Z9KB 5I8CA 1NEPA 5KVFH 1B6UA 2ARHA 3FB3A 1QEWA 5TDOB 5AB0A 5TK4A 3GI9L 4JRYE 4NUMA 5J1TC 5L2JA 1DE4A 1FO0A 5HYJD 4OLZH 2KH2B 4PG2A 2OX5A 1PVHA 1FNLA 3KCWA 1P4IL 4M5ZH 3NJIA 1NL0L 1G7JB 1T0NA 2WMPA 4POZC 4RBPH 1BZDA 1PLBA 3ARRA 3VNZA 5BV7L 1O75A 4HIHB 4ZFOB 1MPAH 1NBCA 1Q9OB 4N2EA 3AMLA 4FNPA 1VB9A 1WP6A 1XVSA 4RMWA 1YEKL 1U8MA 3AREC 5I18L 2FEEI 1U8PB 2VDRH 5H37H 4HOXA 4W9YA 1F6AA 2J5LB 4IMLB 5KS9B 4OR1A 5AW6B 4JCLA 3EYVB 1Q94B 4G43B 2R0WH 3E38A 4AL8C 1KGWA 4JS7A 2CR0A 2VZSA 4EPSA 3ZMEA 2Z31C 4M6OL 4FA7B 5KBPA 3JTBA 3KPLB 3T1WA 2FJGB 4ANXA 3C2AH 3V6OE 3WENA 1AQDA 2X09A 3ZHDA 4A2LA 1BCIA 2NUTB 2PYFA 2R9HD 2APBA 3HE6A 2VJ0A 4KQ4L 4NC1E 5EOCH 4RWYH 4ADJA 1L9OA 1IAOB 1HYSD 1OBRA 2ATKB 3KLHC 4JM2B 1S7LA 4PJHA 5C7XH 1QZ1A 3MBXH 3PRTA 1KUMA 4JK0D 3SDAA 3IU3B 3WNJA 4LCYB 3K71A 3A5VA 4PJ5B 5IMKA 3S3DB 1NCOA 1P6WA 1M71A 2WTRB 5HHMD 3QCUH 4JFZL 4EN3A 1JYVA 4HJJH 4KVPA 4NHUB 1NANH 2EP6A 2P42B 3ESNA 3Q0HA 3FOMA 4C2YA 3MXVL 3ZDXB 1JF1A 3ZT5A 4Q6IA 2B59B 2QV2A 3RIAK 5I1LB 1KZFA 2VQYA 1EEZB 2QHRH 2IMMA 3ET9F 4JFXB 1DVFA 4JRXE 4PTUB 3QQ4A 4UWQB 1QMUA 3O2DL 2FB4H 5DLLA 2PRBA 3BFQG 4G70B 1OKEA 1KXVA 4GS7B 2OK0L 1NLBL 1YEWA 1MXGA 4JFUA 3FQTA 2OXHA 3CHPA 5F88B 4PREA 1TCMA 4TTDD 1HXMB 5T5FL 5AZEL 4XX1G 3F01A 2BUEA 1LE5A 1EAOA 5L8KB 5IB2B 3WJLA 4OCWH 4M5SA 3TX4A 5FYKU 1DQJB 1SY6H 5DJ8A 2AV1A 2A77H 2HRGA 1ZK9A 3PB7X 2R8SH 5EO0A 2C8NA 2P45B 4JAMB 4AXWA 1A4KA 2KPWA 1PZ2A 4PY7B 4U2YA 5BO0D 2O5XL 4NPYB 1ZANL 2CHZA 5ACLA 3TIDB 2RR3A 4I48A 1ODUA 1ZSDB 2AEWA 2Q3ZA 3ZSSA 3BZ4B 5GHWL 3W91A 1KUVA 2R0LH 3DMMA 4F92B 1YREA 2J6EH 1U91A 1CJYA 4IOSD 4BK5A 4UBDC 4J2XA 3KPNA 2C3XA 1RK1B 3HPLA 3BCDA 3HUJA 4KI5E 3SKJL 3SOBL 3ZOAA 4OUUB 1L6XA 1LHZA 5DVPA 1J9SA 3JWDL 4XGZB 1RU9H 3G5VB 4JG0H 2CO3A 2TSAA 5DFVC 4NPJA 3E9UA 5E00B 4U1IA 3VG9B 1FL5A 2GTZB 2MNJB 3TS8A 1ILUA 3KYKH 3QIWB 3BAXA 4UQAA 1ICTA 1YR0A 2YD2A 4HMDA 3GMOA 5T33H 3FS9A 2X70A 1A6ZA 4HC1L 5DLML 5KYYB 1LXMA 1EX0A 2XN9B 4PJHE 2AGJL 1EJ8A 2ZOWA 5LN8A 4PRID 1LEIA 5CZXD 5IVXE 5L4JA 3AB0C 3HZKA 4L3ED 5D7LA 5DUJA 3LIZL 1D5XB 3KPSB 1XEDA 1LYQA 4OZFG 5DUMH 1J1PH 1I21A 1KWMA 2XJKA 4QY8A 4U6XA 3KI9A 4X6FA 3KLAA 3UPAA 2CDGB 2YOAA 4ODSH 3NK3A 4NRZB 1FY7A 1JNNH 3SBWC 3HG3A 2Y0SA 1LD9A 1QI3A 3O8XA 4AEHL 4DEPB 5I1HL 5EF1A 4IDJH 1M42A 2IFGA 3IEHA 1RZKC 1JRHL 1ZT7A 5EO1A 1IAIM 2BXZA 5FM5M 3CT9A 3WC6A 3U0WL 4ONHA 2JB6B 3GO1L 2DLGA 4KI5F 3T0EB 2VQ1B 3NJLA 4B13A 1P0SE 4DYOA 2DQUL 4MAYA 4CC1A 4XRCA 4X80H 5IJKC 4X0KA 3DUHA 5E5UB 4PJ9B 4K8RH 1CDUA 3D2UB 2BCKB 5AW8B 2OW6A 1NJ9B 2ITCA 2HTLC 1DLHA 4G1EA 2JKIS 1SN0A 2RB8A 3IXTA 4TSCL 43C9A 5EIVA 1TSRA 4YWYA 1WD8A 3VJ6B 4PJHF 1XO8A 3IWVA 1QWUA 3CVBA 1U93B 4WUKL 4Q74A 4LSQH 5IVXF 2ZSVB 1AQ8A 2ORBH 2QT6A 4TNVK 2ZUVA 2NUPA 3F7LA 4EUPG 4KROC 5GRYA 5T3ZE 2WNWA 2Y5TB 5EEVA 2VDMB 4YDNA 2EBJA 1KN2H 2YQ2A 3NFZA 2XN0A 5EOTA 4L8BB 1YY8A 2CJTA 3QPQD 1V0CA 1IFHH 3CHQA 4K5PA 4FAIA 4JGUA 1LO2L 2IXQB 4ZS7L 1MI5B 1XCTB 5ACZB 2LE9A 4Q52A 4KK5C 4X6BA 1CB4A 4TQPA 3PXLA 5H94A 3SKMA 3VWJC 5LXVA 5I66A 2R8VA 4YJZL 5MERB 5TGBB 2OFQA 5F7BA 3SO3C 5E2TL 3P2FA 4GJTB 2XWJA 4R3KA 4OTXL 4N2KA 2B9BA 3OKOB 1K5NB 2PN5A 4R9HA 1AR1B 2HUEA 4PJXB 1H15A 2BNRD 5EBWB 2ETWA 1ANUA 3MRLA 5E23A 1IQWL 4DJMA 4HZLB 1IAKA 4HH8A 4P57A 3H3KA 5I8OH 2A6JB 5AW4B 5JXED 4JR9H 4M85A 4R96B 2ODIA 4I3RH 3I02B 2YBRA 1B0GB 3GD1C 3ES6B 3Q3GB 4OT1H 1KPUB 1L9SA 4PEEA 1QW9A 4UQDA 5DD5H 4DP7X 4H1LA 5FHBL 5AYQA 3UCRA 4PJ6A 4F37K 2GCYB 2LW3A 3P0YL 4U7KA 1NIFA 1XF5B 4Z65A 1YRKA 3HN8A 1RUKL 1NMCB 4RH4A 5HGAA 4HIIB 1CYWA 5IB5B 2JK5B 5DHDA 2NY6C 3VAEA 3GUTA 3WTXA 3ARXA 4KORA 4EUPB 5IHHA 4AL8L 5J11C 4XMPH 4MLSA 5J6GA 3EYSL 2P47B 1JPST 3H55A 4QTFA 2NY0C 2XY2A 4S11A 2XZZA 5HDOA 2HB6A 4JPWH 4NFDA 4OQTL 2WXIA 1YN6B 2F7QA 1OF2A 5ITBH 1IKNA 1A9BB 4PP1D 6TAAA 1MHHA 3I6GA 4HXAL 5DJZA 4ODUA 1G7IB 2J88L 3DUUA 1XMBA 3ARBC 5D7IE 4U9ZA 3MCG1 3UAJD 5EUOE 4KMTL 4ONFL 3QQ3A 2X5PA 2FX9H 3O41A 4P5TD 3DVGA 1OARH 4G82A 2DYPB 2J57A 5D55A 5IQ7L 5AUMA 2Y7MA 3RPBA 3KGRA 4X98A 1CN4A 3HN5A 2I5YH 1NMBL 4HF5H 4IIZA 4PLNC 1I1FB 4IRJC 4JQXC 4OFKA 3OAWA 3L5WB 4P5RA 4RISL 1JHLH 1T1YA 1I12A 1CIUA 2UZXA 4UAOC 2BY2A 4FXKA 1Z4EA 1PDKB 1VHSA 3VGAC 2ZEPA 1A7QL 4XMWA 4FEIA 4AEFA 1LO4L 4BFFA 4ONWA 3NSXA 4KUBA 2HVKA 4P23D 3UERA 1MCWM 1QBAA 2YD5A 3CGTA 1S3RA 2B4CH 1WRFA 5IHBA 1CICA 4QHUA 2BRQA 5ICUA 3H7BA 1KIQA 4NQCB 3S3CB 3UZQA 3IJHA 4CDGC 3KPOA 1EANA 4GMSL 4E41D 4QJ3B 2X89D 2YPLA 5EG6C 3AACA 4IAVA 3QA3A 2AEQL 1XZWA 5D7IF 2WQ8A 1G7MA 4X5WB 3BDXA 3IMUA 5EUOF 5L2KA 3OJVC 1JXGA 4WO4A 2WC7A 3AWFA 4M6NL 2XWRA 3AJ7A 3Q6FB 4NZUH 4W9HC 4TWEA 2DY2A 5JGFA 2N4IA 3ZHKA 4XPFL 1OPGL 3CFDA 4NWUH 3VXSA 5D70L 3L95A 4ZQTA 1ND0A 2YPVA 4UDUA 3RGVC 2XKSA 4JY4B 4KFZC 2GUOA 1JRHI 3VI4B 4P99A 1SLXA 4DZ8A 1XFOA 3EXNA 4KRPD 3NFNA 4KK8D 4HH9B 5IT2L 1E4JA 1X5XA 3K6IA 1UWGH 3MGOB 3TJEH 3WIHH 2PPAA 4ZZKA 2EYRA 5HVWA 1CDGA 1ADQA 2ZD0A 5I1AB 2I7SA 4OIDA 5CLYA 3FTSA 3V4UH 3BEVB 2ADYA 4YSEA 2CR6A 3STZB 1KJMA 2I60H 5KVMC 3S35H 3QDJA 1MHEB 2OB0A 1LMIA 3B7TA 1EZUA 3P1VA 5F1NB 3FMGH 1XMEB 4XXDB 2FBJH 2IOIA 3AUVA 3CVHB 3II1A 3ILQD 4JFPA 4LPCA 3NCJL 2I00A 2FWOB 1MKFA 3S6CA 3GB7A 4R3SB 2J1WA 2CHXA 4HOMA 1MVUB 4WNQB 3X13A 1A4CA 3S88L 1Q72H 1WYJA 3TT3H 3D8MA 3VTTA 4KNUA 4XWGL 4WW2C 3RZAA 5L4IA 1HHIA 2H2PD 5D2LA 2V8DA 3D69A 4W9IC 5DEJA 5LCVL 2OTUA 4O02B 3IYLW 2GIMA 1UVQA 2ENYA 4YE4H 2DTMH 2ICEB 2EIZB 5AWNL 4IOFD 4N0CD 5FOJA 1LO5B 1CFTA 2XZQL 3M8OL 4L8CB 1RO5A 3OKLA 1YNLL 5DK0A 5ID0A 2CGYA 2YPLE 4GBXC 4O2CA 2XWDA 2CE6A 4MDIA 5JOPD 3L17A 3VMOA 1O6VA 1ZS8B 4P59L 4TUKH 4LCCA 3DO7B 1Y0LA 4WSKA 2H1XA 2EIJB 1ZXKA 4NWTH 5CJ8A 1IEBB 3NPSB 1INDH 4JDEA 2DOCA 4N8VB 2DQGH 3T77A 3UGXA 2PMZA 1DQDL 3VXSE 3GRGA 2AJVH 3FUFA 3EW3B 1B2YA 5IESH 3CSFA 1Q0YH 1WQVT 1KC5L 3I50H 4L4TE 5D8JH 5DHYB 1NAMB 2MPAL 1R1CA 5SX5K 1I1DA 3FQYA 3SQRA 1J0HA 3CBKB 2H7WA 5DCCA 1FYTA 1KTLA 1IBHA 4WTZG 3WN5C 5JPNC 3CVDA 2NTFA 1F3RB 3APDA 1IM9A 5EC2B 1D5MA 5EU7C 4JRYD 5DYOB 3RP1A 4CADA 1MWAH 3BH8B 5IB4B 5DJXA 4UQBA 3D4GA 2RD0A 3THML 1OD9A 2E7BA 4HAFA 1ZLWH 5ADOL 2IANA 2I25N 2WSPA 4AENB 3ZYOA 3CFKA 3RG1C 5AL8A 1FA4A 4OZHA 4H2AA 2OI9B 2P4AB 2GC7C 4CC4C 3GSNB 5DC0A 5IJDC 4CGLA 5DTFA 2WLIA 4X7CC 3QZMA 1MFAH 4PJGE 3D87B 1WBYB 4PD4J 3UDWA 3EO9L 4J6RL 3LY6A 3TBBA 4XPTH 4KTGA 1X9QA 4MDJB 1TJGH 4OSUL 1OP5K 3J2PA 2EVHA 3EJYD 3DTXB 5F7WC 2EVFA 4X6DB 3FTYA 3O4LA 4PS3A 4HKFA 4MBRA 5T1LD 3E6FA 1BGXL 1W72H 2WXJA 2XIBA 1SEBA 2YSSA 3MKGA 3V0VA 2XXCB 5DFTA 5BV7B 3IBOA 2NNXA 2VMFA 3F58H 3CCHB 4AV5A 4UBRA 1I8IB 2ROXA 2D8KA 1IT9L 3IJ3A 3LEVL 2FUTA 4W4OA 2IH3A 4Y49C 1HWHB 2VXQH 3MRIB 3MUUA 4KHXH 4L3FA 4O51A 2B58A 1OP4A 3QIBD 2WXPA 1W0WA 4IQHA 4ENEC 3MLSL 1AC6A 4Q9RH 4P2QB 3OAYK 3TYGH 1OD7A 1RUAL 3GBEA 4ZAKD 3UTPE 2RTTA 2C7UB 3K2UH 4GRMA 5FLUA 1GJWA 1YYMH 3TBCA 2DLEA 1QZNA 3KBFA 4K9JA 3FB8A 4IS6A 2EZ0C 3SKUD 4OLZL 3CZEA 3VH9A 1JIBA 4U6VL 3AM8A 3PDDA 4PJGF 4U0RB 1WAPA 1AGBB 2A0LC 1FFNB 1MFDL 3H9HB 4G6AC 4JRXD 4LPYA 4N2MA 3U30C 3OMZA 4D3CH 1MPAL 4XBPB 1CFQB 4AM0B 2FE0A 3ARGD 1FYTE 5D2LF 2R2HB 4YPJA 4K71C 4BQ6A 1RMFL 1TMQA 2OQJB 1E90A 2W9EH 2EJ1A 5AVWB 1PD1A 5K9OB 4QXGL 1BLIA 1XGRB 3D52A 2GI0A 1F13A 4OZGB 1R0AL 2OR7A 5C0JB 4CKQA 4N9GA 2R0WL 2ERJB 1PNDA 1XIWA 1SJHA 5C8JA 4E0AA 1S4IA 3ASNB 4ZT1A 3WFDH 3UFIA 4AV4A 2R1WA 1J4JA 2ZYRA 2EVIA 2D7OA 5TTRA 1TYRA 1S7QB 1WFNA 4G9DA 5FYJH 5HHVH 3C2AL 1A3ZA 3WSQL 2J43A 4Q58C 3WAKA 3TEWA 2D4OA 3UIZA 3AWGA 4XVSH 3SYQA 1ZTMA 4HFWB 2YRPA 5EOCL 1L7TH 4JKMA 3BVDB 1BO4A 3F85A 1SYSB 4PK2A 4PWGA 2QQNH 8CGTA 4N2LA 3MBXL 3JTTA 1I1YB 3N44B 3BLBA 1S60A 4FQPA 2W60B 3DK2A 1H3UA 4KI5D 3O4LE 4URKA 2NSQA 4Y4FB 5CD3A 3W39B 2E7MA 5DSCA 3WFHB 4PPZA 2BC4B 4GAJH 2YD8A 4PUBL 5LDSA 3BN3B 3N9GL 1VPOH 1HOCA 3BKCH 2PW2B 5G4MA 4ZNEA 4UCPA 3H9SB 3NVQA 4F8QA 1XMWA 4JKPH 5JZ7D 5HGDA 2R7EA 5KBDA 2FB4L 3MREA 3AQYA 2EDTA 5EORH 4JPQA 2R0KH 1YHPA 5MI0B 2B4CC 2YNCA 2V33A 2XPGA 5KSAC 1PYWA 3COOA 4O9HL 4DQAA 1NCHA 3RNQA 1TFHA 5EN2A 1I8MA 4OCWL 2ZWSA 3UTZB 1F4WL 3G08A 3FHEA 3SZKC 4E5XA 3DOHA 2WWMD 4XHJD 3CFJB 4XX5A 3TXAA 2RQEA 5BRZB 1KELH 1SFHA 3MRNA 1T2QH 1N70A 4XNUL 1AANA 4F8LA 4H40A 4LRNL 3UXFA 4BMHA 3J07A 1AS8A 1KYOK 2W0FB 1KFAL 4V1DE 5C07A 1R6VA 5ANMB 1OF0A 2XSKA 5AVQB 2XX0A 3C5XA 1HAUA 4OD2B 2D4FA 5HHQA 7CGTA 5HGBA 1R3JB 3L6FA 1C8QA 2JKRM 3ZE0E 3I84A 4JPVL 5DK3A 4Y4KB 3NH4A 1KLFB 4M93B 1C12B 4OGXH 2NY1D 4BWTA 2PXYA 3VWDA 1MRCH 4F27A 5CWSB 4AITA 2X4NB 3JWOH 4RGMB 2WXMA 4E9VA 1GZPB 1DVZA 3KZWA 4JO1H 1OAJA 3FF8A 5J1AB 2LHAA 4A2HA 4ZSOE 3ME0A 4C83B 3LTVA 3IDXL 3MZTA 3QUYB 4NQDB 2PDOA 4U4IA 3HI1A 2EKSA 1DJHA 1Q2YA 3GMMA 3NGBC 4N5UA 5T3ZD 3VFPB 4B97A 3VSVA 1AXTL 4HIXH 2M8XA 1U3JA 2AABL 4R7VA 4G7VL 2XTJB 1KB5L 2OR8A 1AQHA 4JDTH 3TPUB 1J1PL 2EQDA 1R3IH 5F7NC 2OZNA 3FB5A 4NKQB 1IGCH 4R4BA 1BFTA 1VHEA 1QNIA 1TZHA 2D3LA 4QHLB 5EZLA 3OR7B 4G8GA 3VNYA 4IDJL 3D7DA 1TVBB 5ALBH 2QGEA 2Q76A 1JJUA 2CRMA 2HFEA 3ZE0F 4IGBD 1OWWA 4L9LB 4QWWC 4O23A 3SODB 1MFEH 5D7LD 3WNIA 3MROB 4Z7OE 2WVTA 2TRYA 3ARYA 2HX7A 1FZJA 2A9AA 1BVNT 3BAEH 2ARJA 3D0VA 4FLOA 3WY1A 4Z95H 1XL6A 4MA8H 4QF1A 1QBML 2FD6L 1UFHA 5LNDA 2E9BA 3DA0A 1TXKA 3O8XD 1CM0A 2Q9OA 3R9FA 3N85H 5FFLA 1MREH 2IDFA 3PFUA 3KLDA 4PWFA 3V7AG 3ZE2E 1EXUA 1U6MA 5IQLA 3V4VB 3PIQA 2G0LA 2OPCA 2AVFA 3H0TA 5E6UB 4FA8A 4YBHA 3LPFA 1TDQA 3FFOA 1UXSB 2N7BA 2HFGH 4U3SB 1UM5H 1BLNB 1U4FA 2NT0A 2FH8A 4IBQA 5INDB 4DUKA 4IHOA 1KN2L 2P5WA 3AREB 1P5VA 1DJSA 5D5MA 1NIEA 4OC1A 2N0KA 4RGNC 4UQIM 3WJMB 1DBJL 3O3AB 3IF1B 1ON0A 4F80A 4MJIE 3ZKSD 3QJVB 5LGHL 2VN5A 4OC5A 1NOAA 2D7NA 4MASA 2PJ8A 4TNVF 1SVBA 3K6SA 1U30A 4OP4A 2WCSA 3D7FA 2GLFA 1XGPB 4NX0A 5DU7A 3CZGA 4GQ9H 4Z7OF 1MLCA 3FQXB 1HX0A 3FSOA 1NBVL 2DQIH 3V0JA 1A25A 5EB9A 2DPKA 9PCYA 2ZCHL 3RIKA 1WV7T 4OT1L 4PD4K 3SD2A 1LQBC 1CTMA 2ZJSL 4DP4X 4O2EA 4C56E 3V5HB 4NSKA 1RIHL 3PWPA 3VSQA 3ZE2F 3L54A 2P6FA 2OJ1A 3FB7B 3HB3B 4R4ND 2JV6A 1NDTA 1NANI 4G8GE 4CJ0A 4K5LA 1IGFH 2I9LA 4NO3A 4LAJH 4CAWA 4DGWC 1NFAA 2OCFD 2Z1KA 4NT6B 4NO5B 3S35X 3EYOB 4RMBA 1WD9A 1N5AA 2E7CA 4OM0H 4OC4A 4F37F 4ZI6A 3ARDC 5JR1L 1V3MA 3GZQA 4MMZC 1NGXB 4QRAA 1NCCH 3L7FB 5I74C 1UCBH 2VC2H 3GRWA 5CXPA 2GIVA 5CR1A 1PYTB 3GXPA 3QQ9D 3QNYA 4JQVA 5SWQA 5D96B 1YDPA 5F89B 4B95C 3MR9A 3IJEB 5EBGA 3S37H 3IKCB 2WWKT 4JRFA 4XMUA 1PAMA 1KCRL 3HBZA 2Z3MA 2JI3A 1MFUA 2FX9L 3DRQA 3MBWA 3GMPA 4U3HA 3SSGA 3U46B 1PL3A 1UENA 3NQKA 1OARL 4PJDA 5ID1B 5EMIA 1OGSA 2WYIA 2PW1B 1HDQA 2V2WA 5AD0A 5AL0A 4X4YA 1VENA 4HS3B 4HF5L 3T08A 1OY3B 2GUYA 4L0PB 3W11C 2W1NA 2C9AA 5DQDH 3DV4B 5D5ME 2G30A 3C9NB 3KWWA 4L18A 1F8TH 1KGIA 3UBXI 4R5XA 3LS5H 4QRTB 3BIKB 3VA2C 1EJ6A 4GSDH 3ROLA 4EQ3A 4Y2DA 1OAQL 2NY2B 3BP7B 5H35B 3U7WL 4QKTA 5E70A 3VW3L 3FCTA 4G3YL 4ZW6A 1UM4L 1Z5HA 3OAUL 1FFRA 2J9AA 2WXGA 1E30A 4Y1AB 5C82A 4KU1A 2OSXA 5GSVB 4HU8A 3FBUA 3CC1A 1K8IB 2X4RA 3ZL1A 1N19A 4XP4H 1JK9B 3QWNA 1O7VA 2DIBA 4LMQI 5DZ9A 3IFLH 1USZA 3ARFA 5I26A 1Z8LA 3NAAH 4QXWA 1DR9A 3UTOA 3PWPE 5DRXA 2DQEL 3BEWB 1TCRB 2YRBA 3SKOA 4NZUL 4GW4B 2ZW6A 1RI8A 2BVOB 3FYEB 3DLQR 4NWUL 1CICD 2O6CA 1PG7L 2C1OA 4MD0A 5EBMA 5I1CH 2RJMA 5DJ0A 4CAEA 1WG3A 1MLBB 3KYOB 4J3OF 2AXGB 2NDGA 2YPLD 3AT8A 4HKBA 3MJ9A 5D5MF 5AAWC 1W9XA 4DCQB 4LHJB 2W92A 4HHAB 2QBWA 3C60A 5D7JA 3WIHL 1UWGL 4WEMB 2Y3NA 1OP3K 2DL9A 1VAHA 6PAZA 3S6FA 2OMVA 1P0HA 1XGTA 2K78A 3TO4A 3PWJA 1VKXA 4WO4D 5DD1L 3RPKA 5HJ3A 2IH9A 1VDGA 1DEDA 1OGAA 4IK7A 5CJBA 2Y5EA 5EU3A 5AB1A 2AJYH 4P3DA 5HVGB 1FVDA 2JXMA 2X05A 3VXSD 5D71H 3W2DH 3S35L 4DO4A 4OUOA 3WN6A 3LZQA 3RUGB 2IALA 3MRBB 2BVQB 3WUWA 5KTDA 4WEEA 3FU8A 4APQC 2MQCA 4PJDE 5I2IB 3JV0A 1J18A 1FGNH 4CRPA 4DVRL 4L4TD 2CDFA 3N04A 2B8OT 4MFPA 2NPLX 4AIOA 4HJ1A 4WZ9A 1G43A 3V6FB 4UNTA 3Q13A 2QFPA 1JK8B 1A3RH 1Q72L 2LVEA 3BQUA 3QIUA 1VRSA 4YSTA 3B3BA 2D7TH 2HMIC 4N1CA 5G2NA 2AAVA 1SHWA 4KGJA 1QVOA 5PAZA 2DTML 4CGUB 4XNXH 4HISA 4Q2ZA 5D1XB 1P7BA 1UWEH 4GAAA 2BVEA 4XODA 3EYQD 4EF3A 3Q01A 4NQEE 3SO3B 1AUGA 4WHYH 4NJ9H 4WAFA 4KJPC 4S1SL 3WGUB 1FT7A 1WHPA 1Z3RA 3JWOC 1DO6A 1PFOA 4GG8A 3TM6A 3VFVB 6CGTA 4N6QA 5L88L 3G8WA 1S7SA 3O9WC 2BP8A 1SUHA 2YPVL 2Z64C 5A2LH 1INDL 1ORQA 4ZXBA 1S3KH 3HMXA 4PJDF 4DNCA 2X4TB 4MB5A 5A43C 1ZHKA 4UIKH 5T1KB 3IJYA 2DQCL 2MRYA 1NA8A 1O9WA 3K7UA 1BFVL 4IU3A 5IESL 1ETA1 6PCYA 3OZ9H 4E9XA 3L3HB 2C9UA 3QORB 3WNLA 2UWEB 1UACL 2I07B 5D8JL 5GGTH 1A7OH 4JM0A 4AVHA 4IRSB 5JQ4A 4FFTA 3CN3A 1KIRB 1IL1A 3MTRA 5IB1B 3ZZ1A 3D2TA 3ENEA 5H37G 4QOKB 2C1CA 3UTPD 2NY0B 5C0AA 4LOFA 5E2WH 1HH9B 5A7BA 4M7LL 4J4PA 1A14H 4CYPA 3HBQA 2BCMA 4B5EA 2Z35B 1MWAL 4WHTA 5F72S 5D2NE 4R7XA 2X3BA 1MIEL 2DI8A 4FYTA 3LEYH 1CDCA 2P46B 1D7DA 3ARBB 1DZBA 3B6SA 7TAAA 3E80A 5B7EA 2QEJA 1G0YR 3MBEA 2CPCA 2QZQA 4QRQA 5BZWB 5F9JA 2WN2A 4PP2A 4TNWK 1ES0A 1FYTD 4LHQB 3FECA 1QHOA 1D9KD 1MCDA 1IM9D 4OZIE 5F9OH 2NZ9D 3MLRH 3ZDWA 4IRJB 3NOIA 5MEPB 1WBXA 2DBJA 2FGWL 2B15A 5E9DE 3W3BA 1W72L 4UAOB 3SPVA 3GINA 1WC7B 3F58L 4QMEA 3HC3H 1G4MA 2K70A 1HCVA 1IC5L 2O72A 5I19L 3HE7A 2DLTA 2AEOA 4MHPA 4K0OA 2HT3C 4RVBA 2HJFA 4GEIA 1AKJB 3MOAH 3U4KA 4MVBD 3RDJA 4PRBA 3TYGL 5DVOA 3IDUA 5IFAH 4KKAD 3A67H 3BWUC 4I4WB 3O4LD 1IC4H 1OM9A 2WKOF 3FHQA 2J2ZA 4F2MB 4G6JL 2FQDA 3FRPB 1XB6A 1JTOA 5F47A 2VXSL 1NCTA 3AZUA 2H8PA 5BOZG 4FMKA 3DGCR 3MRQA 5DRWA 4E0RB 4FXGA 3N06B 3TBWA 3TV8A 3D3VA 2I9TA 2F5AH 4D3CL 3RGVB 4OZIF 3CDGA 3QI9D 1B0RA 4J28A 2R98A 4NRXB 1DJIA 4ZPTA 1CFVH 5IVZA 4FWUA 3FN9A 1MJ9A 2W9EL 3REVA 5KBMA 2ZNXA 5I1DB 3UBXG 4BFKA 1R3KB 2L7JA 2R39A 4LSVL 3FEDA 3SZ6A 4HNWB 4U1KA 3WFDL 2O4EA 2C9QA 4PVMA 2WBJC 1AP2A 5I8CB 3HLKA 4KKRA 1M4GA 4AOFA 3NIFB 3T8XA 2CKNA 5FYJL 5HHVL 3RX7A 4Z3HA 1FO0B 5E56A 3TEXA 3MRFB 4WEBL 4V1DD 3BKJL 1CL7L 3BUYB 2A1WL 1FFOB 3PXJA 1DVQA 3RWGA 43CAB 2UUDH 4B9FA 1DBAH 3CV5A 5BXFA 5JW4M 4Z1PA 5BZZA 1FLRH 1OAUL 2QQNL 2EEDA 2DL2A 2F54B 2ZWNA 4LK4A 1MCPH 3ZE1E 4A7UA 3BKMH 4XXWA 1XIWD 2VTFA 4LCUB 3T2QA 3VWKD 1XSKA 1YG9A 1B4LA 4GW5A 3QEUB 4GQQA 4HEMA 4J12A 3RJQB 3BXNA 4JZOA 1TZGH 2VRQA 4FG6D 4JFYA 4PSXA 1YK3A 3O2WL 2VMEA 5IUCA 1F58L 1VPOL 5HJDA 3BJ91 2FUQA 1S7WA 2KBGA 4FNRA 5DMIL 4MNQA 4CU6A 2K0RA 4OMEA 4JRLA 5E2UH 3UBXB 5EORL 3GSXB 1AQDB 4H2CA 3TLRA 5BJTB 3OWRA 3AG4B 5D29A 4KXZH 5HHOA 2GEQA 5CINH 2EXTA 1S3ZA 4WCYL 4NKMB 2BVPA 4HAKA 3BSZH 5ETUB 1WFUA 3ZDYB 1LFWA 3LD2A 2N7SA 1EO7A 4ANVA 2YSTA 5JUEH 3K71B 1BF5A 2A6DB 4PJ8A 5JNYA 4GKNA 1KELL 1E9OA 3D3VE 4ICXA 4APXB 4MYPA 3W82A 1M71B 4EN3B 3ML9A 1HYSC 3KM1A 3CZJA 4HQQL 4Y4HC 2WXKA 3T6WA 4I2XE 3ZE1F 2F19H 3FOMB 3MU3A 3GHPA 5FO7A 3CPXA 2XU9A 1ZHNA 3DVNA 2VM3A 3FB6B 1KB5B 3IDGA 4R84A 2WOYA 1IKFL 4JJ5B 1E50A 1DVFB 4HK0B 1Q1JH 4QXUL 1N0XL 4PBWD 1YEDA 4AKPA 1AYRA 5F3HA 1UA7A 2LFEA 2UXTA 5JPNB 4OGXL 2E7DA 4CW1B 1BQLL 4MQSB 1D7BA 1L4IA 4PREB 4D8PA 2TSBA 1U8QB 1X5LA 4X6EA 1E8WA 2DZEA 5C71A 4WU5B 4LOUD 3MHZA 4IK6A 3EGSA 1EXHA 4FFYH 4TTGA 4AG9A 1B4JL 4M3SA 5DJ8B 5HDLA 2AV1B 4JZJA 4W6XB 5C2BL 1YYLH 2OL3H 4Z0BL 5EO0B 5J6SA 3DSNB 4TTDC 1NKGA 3PAUA 3KR5A 4EJ1C 4JFHE 4EO5A 1WO2A 1T21A 2P8MA 4ZD3H 1H9VA 2K5TA 5LUMA 2DLFH 2PXYD 3OLDA 1B9ZA 5J3HD 4JDTL 4HEME 1CLOH 3MNZA 4JFWA 2BZ7A 4MJID 3TT1H 3EGXA 3DMMB 3OKYA 3WDHA 5CJ5A 1A1OA 3HUJB 5D4IA 4FHJA 2YMXH 2GJ6B 3TA4D 3L3DA 1OSPL 2B1OA 3DXAA 3ZQ9A 3VE0B 4N1EA 4LFHD 2B9AA 4MNQE 1OTSD 1CXIA 4YLQT 3S37X 3DURA 2AS5M 1OSYA 2V7NB 4ZUSB 2YNDA 4M61B 1A5FL 4LL4A 2WCPA 1XB8A 2WVSA 1GCFA 2BHFA 5HHOE 4NQVA 4AQEA 2VL5A 1IQDA 2X70B 2X1WL 1TVHA 3GSVA 2EE6A 1S7UA 4C56D 5L4FA 4M7LT 2DQJL 1CT8B 1JHTB 3DRTA 3WS6A 3RWFA 1LEIB 4OVUA 1FZMA 5ABZA 1QBBA 4X7FC 4G8GD 1CI5A 4YLCA 2FHBA 2WZ5A 3N85L 1YMMB 2LLGA 3FAXA 4U6XB 4X6FB 5T3XL 1FORH 2ZPKH 2DTSA 5IMLB 2XA8H 5EF2A 1BP3B 1Z2LA 4M6MH 2Y7NA 4FYQA 1LD9B 4PMFA 1P4LB 2UYLB 1FNEB 1H0DA 2HFGL 3CHRA 3X1NA 4Y1TA 5EO1B 2D2CC 1L7IH 1OB1B 1RZGA 4QRUA 4K71B 4R3LA 1HHKA 4YUEH 4IMKC 4C7IA 1VERA 4UQEA 5JHLL 3EO4A 2H2SD 2GE3A 2CXGA 4PYGA 5KYUA 4MAYB 1GZQA 1A64A 3RTQA 3TN0A 1J86A 1DQMH 4AGPA 3HVDA 3BAJA 3T4YB 2ITCB 1DLHB 3MTXA 4DO5A 4GO9A 3GJEB 1CL7I 3CLEH 3IXTB 43C9B 4B60A 4CRZB 4F9VA 4G5ZL 2CIJA 2OMZB 5DR5H 4J3OD 3FONB 5AYTA 1W8EA 3PFOA 2CBMA 3MFFA 3IC1A 2ODFA 4WRLA 5CGTA 5BMFH 1GGYA 5EIIB 3GUFA 1AQKL 5C9JA 2Q20A 2EXYD 3DXAE 3KW8A 1MCLA 1SHXA 3NZ8B 4WWKA 5FECB 2PJ1A 2OJEA 4K7PY 1IGFL 2FYYB 2NLJA 3MLUH 1MJJA 4MA7H 1IGIH 2LQRA 5IJBC 4LBEA 4TL5A 5DDHA 5F7AA 2NTSP 3ESOA 4WTXA 3VXMB 4ODHH 2AFXA 3ILPB 3DNSA 3CIAA 1B90A 1G9HA 1H15B 1SJEB 2CLRA 3MRLB 1NCCL 3DX6A 3B1UA 4HGMA 2NW3A 1UCBL 2VC2L 3PWPD 5FLVA 2DMGA 1QFWL 3WJJC 1TTGA 2IGTA 1FZKB 1Y6MR 3FO9A 1Z8XA 4YDVB 2PYEB 3JTSA 1YCSA 5KSAB 1JZ7A 4GUPB 3S37L 5SWSB 2PJ2A 4NN6C 4M8RA 2W88A 1S9YA 3TNNB 3V0GA 5GS0D 2V2TA 1RJZB 2JLPA 3NIDE 2DMBA 2VW4A 5HGAB 5JXEC 1KV7A 3BGFB 4BCXA 2H0JA 5E5LA 1BQ5A 2CKBA 3UYOD 3UJTH 2N1KA 4BM7A 2W0KA 2YPKB 1NMAL 1UKSA 2PWHA 3G04B 1HK6A 1F8TL 3L45A 4I0PB 4N0FB 4D0BB 2K7PA 2JFCA 5LNGA 3F05A 2W94A 3VXNA 1OF2B 3ZMRA 2VSMB 3GMQB 2YD3A 2VDOB 1S46A 4Y2OA 2P7TA 4L1HA 2X2IA 1K4JA 2Q3XA 3S6KA 4DN3H 3WEXA 1CURA 4V2CB 3MLWL 3V7MA 1H19A 1XB3A 5D6CB 4XNHC 2RIKA 4ISVA 4M8UA 3DVGB 3WC7A 4MRBA 2X4PA 2VMJA 4ZS6D 4YHYB 4PP1C 3VA6A 3I3BA 3PB8X 4X98B 1SJMA 1BQHA 5HYSA 1A21A 4JO4L 1KIUA 3KYMA 4Y2DD 5DWUH 4DP9X 4JO2H 1RIVL 4NAMA 3UAJC 2BSWA 2R15A 5AQ0A 3OPUA 3R7RA 3IDIB 1HJCA 4KLVA 1QYGL 1C5BH 4P5TC 3T2NL 2EDXA 3EUDA 3NIDF 1CBXA 5IROA 2Z3OA 1NDMB 1I8AA 2AV7B 5E94A 4L5FE 4NQED 2PJ3A 4P3WA 4DEWA 4LARH 1KYFA 4ZUTA 3IFOB 3CXDL 5FK9A 3TJHD 1INQA 1FE8H 4QHUB 5BWAB 3ARFD 5I24A 4Y5YB 5EU4A 4JGMA 1KPRA 4AX3A 4ZGYB 3K9TA 5GS1A 3RNKB 2KDYA 5BRPA 4P23C 3QA3B 1A6UL 1OGTA 3MNVA 5D71L 4RN7A 3LZLA 4R0LA 4OCXH 3FQWB 5L2KB 2ZEEA 2NZIA 2QFRA 3ZKXC 4U6HB 3KL5A 2V37A 2B1HH 1W2KT 1FGNL 3ZBMA 4WU7A 1GYTA 1CD8A 3MLTA 4ZO9A 1CTOA 3CFDB 1E67A 5DGRA 3C60D 5D7JD 4YFLI 3S36L 1ND0B 4CBZA 3SDCC 3PHOA 3TO4D 3EOAA 4YHOL 5E8PA 5EFIA 2E9JA 2GUOB 2Q8BL 4M48H 3HMWH 2IJZA 4IBYA 1U8CB 4K23H 3WKMH 3IBEA 2D3NA 3W9EA 1T04B 2J1YA 3HZYB 2D7TL 3S0PA 1J5DA 1TZIB 2IPUG 2COVD 1PKQB 3B3IA 5E5MB 4PIRF 4U7SA 2CBTA 5D1QA 2CRIA 2RMNA 3PDOB 3QDJB 4QRPA 1FGVH 4KRPC 5DVMA 4G83A 3GIZL 3A9LA 3EOBB 1FAKT 4NJ9L 3A23A 2OM5A 5C09A 5HH1A 5J1QA 2XEJA 3BWAA 1MIMH 4FDWA 1ZEAL 3TCLB 3QIUD 1MWAB 1I7UA 2BW5A 4CU7A 3U2SA 4MGXA 2OZHA 5EO9B 5EWIL 3GB7B 5T3ZH 2O53A 3FH4A 1OAKH 3IAQA 5IM7A 5E9DD 3JVFC 1S3KL 4L8DA 1WIOA 4ALAH 4UIKL 3QNFA 3WMQA 3OGCA 5FUOL 5K39A 4AYFB 3DSBA 3B2XA 5E1QA 3HLPA 2AI0H 3OZ9L 2RHEA 3ILQC 4PLKD 3FUEA 5E6ZA 4DGYL 3VGEA 4MMOA 3NDYE 2JELH 1A7OL 2QMKA 3C6LC 4PCYA 3ZGHA 2VR4A 5KG9A 1D5BA 1E6OH 2VWEE 1WCQA 5B1JC 1XGQA 1Z6JT 2BMKB 4KTYA 1BG9A 2NYYD 4FD0A 4TQEL 3OKLB 1MDAA 4JPSA 3GWJA 1O9ZA 3L13A 3VYPA 5FVJA 1CLZH 2H2PC 2HWZH 3QDGB 4ZO6A 5E2WL 5FYLL 5FO8A 1U8LA 1M3IA 2CO6B 4MMZB 2PJ5A 2VAAB 3KXFB 1A14L 3IPFA 1JNHA 3BN9D 3ECQA 5AVUB 5I74B 4JFDB 2OXGA 1TQBC 1TFPA 4IOFC 4B9YA 3WT4A 1Y07A 3QEHA 1EO8L 3PQYB 1EFXB 4X6CB 1S5HA 2Q8AH 3BAWA 3A6BL 3LEYL 5FO9A 4EKXA 4BDVA 2C1PA 4B9CA 4HIJA 1OK0A 2OYPA 1Q1PA 3FSWA 3NZUA 2E9GA 2FYVA 5SWZA 2R56L 5CKAA 1DQLH 1L0YA 4WF7A 2X4SA 1AXIB 1OHQA 4P5MB 3N2JA 3S5ZA 3OWEA 4UIMA 4J4PD 1ZDSA 1A22B 5ALCH 4ZMAT 3FCSB 3D7PA 1MCWW 5ESQA 5CLXA 3JUWA 1EDHA 4F1SA 5IQOA 4ECNA 4YBQC 4W9ZA 1EE3P 3O3DA 3IN2A 5CSZB 3MYZA 3FFCE 3GFUA 3QUZB 4JB9H 5D1QE 3H1ZA 4TNWF 2VISB 1QNZH 4QRPE 3WLBA 1UASA 3W9DA 4XVJH 1L5GB 4KKCD 1BVKB 3MMEA 5LQBL 1S7XA 4F8NA 5C09E 5K9JH 1OZPA 5I6XC 1BV8A 5ESAB 3MOAL 4OZHB 4P9HC 1WA2X 5E9AA 2E74C 3VSUA 1UOVA 5IFAL 5F7DA 1VGKB 3A67L 3V9CA 2HLFD 5FFGA 1DN0B 2XUWA 2ZX9A 3J7HA 2A9BA 4GMTH 4NRYA 4LPTA 3L5JA 3KHZA 5GSRB 3TESA 2JSFA 4JFEE 1WK0A 3RWDB 3FT0A 4BA8A 4LPWA 2E7LA 1EEQA 1L9PA 5D4JA 3HE7D 1I53A 1TZAA 2F18A 5KJRH 3ZKMC 3OHXC 3PABB 1ETJA 1SF3A 1INEH 4NBZB 4IU2B 4KZEH 4TNUA 1UTDA 4F7CA 4RFNC 3QH3A 3PRZA 4TQIA 4ZUWB 3B3CA 4UT9L 4YRHA 3WIAA 1M1XA 3OR6A 3SGJC 4ANWA 4K30A 4BFRA 5E1IA 3UC0L 4XN7A 1W0WB 4TNEA 4N2GA 3DDGA 3VXUB 3ZPDA 1JL8A 1UB6B 4H1LH 3P3TA 1JHKH 4FKHA 4XNYL 5MEQA 4OAEA 2EIEA 1KTDA 3V6OC 2CY2A 4GRMB 4OH2A 4YNYB 3B7UX 3BVWA 4ELME 5JPMA 1IEHA 3D3VD 2HUHA 4L8SA 4NC1C 4NCC1 4UUJA 4FLQA 4JJOA 4IS6B 1CK0L 3UMTA 4MD5B 3F5BA 4ZG1A 1J1OH 2BLFA 4L2YA 5GGUA 1U3HA 2LVCA 3CFEA 3TT2A 1AS6A 3QYNA 3LNIA 5TJWK 3D9AH 1FLRL 2YAQA 1J5OL 3Q8BA 3QZWG 1MCPL 2C3WA 4R5VA 1MHPH 2ZX7A 3I1UA 4GXVH 3A6CH 1UD2A 1XHHA 4JFFA 3TJPA 3FCUB 4FG4A 1GGTA 3QUKA 3SDDA 2ATRA 1BECA 3F5WA 1TZGL 3FU5A 1UT1A 3C12A 2AJUH 3N7ZA 4KVCL 1G1OA 3MRHA 1Y7EA 1SN2A 1HWGB 4UQCA 3U9PL 4O2FB 5IHZA 3ARGC 3IFPA 5J1SC 5ELYA 3OV6A 3L81A 4HUUA 2JJSA 1KTKE 4G9DB 3TBSB 4NNXA 3K2MC 4WI7A 1CXEA 4JFHD 3CN0A 2QKIA 2SEBA 1BF8A 2A74C 5EBVA 5CINL 4MBUA 1E27A 1A4AA 1DSFL 3BSZL 3EJUA 1PLAA 1LAPA 3GZOA 3MN8A 4EI6B 2D7PA 2O6FA 3KGUA 3QRFM 3EYFB 5JUEL 1SXSA 1BPVA 3QUML 1AYOA 3GHBH 5CD3B 2IPKA 1PCXA 4RSVA 4ZFGH 5HPMA 1IBGH 2VE6A 4HWBA 3GKZA 4MNQD 3T65B 4J3GA 1A2ZA 2XQBH 3PPSA 4Q9QL 2F19L 5K5YA 3U6RA 1Y9WA 2JCCA 4H0LC 2YD4A 1EGJA 1SN5A 1QI4A 1UFUA 4ONUA 2VITA 1ECYA 2VXUH 3EFFA 3G5YB 4LF3B 4KI5C 3O3EA 4RRPG 5HHOD 1Q1JL 1UGKA 2VLRA 1YSOA 1MUJB 4FC3E 1F6FB 1QR1B 4D7PA 4PM1A 1PEZA 2XPGB 1PYWB 2GFBA 2FHFA 2VXTH 1QFHA 2Q2LA 3RNQB 5EN2B 2GLJA 3C5JA 2AANA 2PWFA 3G08B 1E3ZA 4MNGA 3KL0A 5KSUA 3EDEA 2Q43A 3RY6C 4F0XA 5HI4D 1JPGA 3BZFB 5FGRA 4N85A 3N43F 1ZT4A 4N9OB 4XXCC 5TDNA 1JPFA 4CMHC 4LDOB 4BFIA 3VDAA 1E42A 3I6SA 3ZX1A 5CLWA 2C9VA 5IEHA 25C8L 1GH7A 5AYUH 1T2XA 1VFAB 3BVTA 5C07B 1ADQH 3W37A 1XSJA 2DLFL 1OXYA 1E6JH 3BUQA 3OQRA 1QSFA 2F5BH 4HBCH 1CLOL 1II4E 4Q6IC 4XHJC 4HUXA 5D1ZB 5KSBA 2AFOA 3DHMA 3ZIMA 3KPRB 4PJIA 2F8XC 1I9IL 5E1AA 4AZ8A 2A9NL 4PRHE 4ZY2A 3MAWA 3L2MA 1MN4A 5B1BB 3RPIB 5AFAA 4PTTB 1L9MA 4U6YB 4JFSA 1KPVB 1F5WA 1B3JA 1XGYH 3GBNH 5JO5B 3S4SG 3RJOA 1MCKA 1SDDB 2L7EA 1KBWA 4UANA 5LBVA 5L0QB 3ME0B 2GT9B 1KZYA 4HPHA 5FA3B 4NZ8A 2EDBA 4LVOB 5I76A 4J3BA 4UCMA 2NY1C 4G42A 5B1AB 4M5TA 3QQXA 2IVFC 2F58H 4Y16A 3GDBA 1DVTA 3PWLB 2V4LA 1QSEB 1K6QH 3B5TA 2A6IB 3DXAD 3JZYA 3UMNA 5A6LA 2CUMA 3WOVA 1L0QA 4FNUA 4QBJA 1ZV2A 1M4IA 3FB5B 4OFYA 4EBQH 1REIA 2ZPKL 3ZT6A 4P2RA 4AYID 1X4YA 4Z0XA 1KT2A 2DQHL 5EZLB 4JPIA 1RIUH 1SLVA 1NFDA 4WFHE 4ALAC 5C0DA 2VLRE 4HCGA 4KOWA 2Q76B 3FJTA 2IWGA 4AEEA 2XYBA 1GJUA 1JNLL 4OBRA 5EU6A 4HUVB 4Z7NB 4YUEL 3RFRA 1JZIA 4LRIC 1XBRA 4X4XB 3MV7E 1BMGA 4FFZA 1MFCH 1OM3H 1DUZB 3S4SB 2YO3A 5TE7H 3QHZL 4P9HL 3ZZLA 3GPSA 4MNGE 3MRGB 3UYRL 2WBJB 5KWYC 1GHFH 3CN4A 1QO3B 2H32B 4IGBC 1MVFA 5E51A 2EDKA 1OCOB 2HJKB 1DEEA 3ZTNH 2DJMA 3D7HA 3UROR 3FRMA 4DPAX 4AQAB 3PIQB 4MXQC 2IQ6A 3R4RA 2JJTA 4JY5H 4XCCH 4HMCA 5CZKA 2Y23A 4HLJA 1J87A 3LPOA 3K4ZA 5BMFL 5KSBE 4E9QA 4M6HA 4UDTB 1FCCA 3RTQD 4A2FA 2ZUUA 1Q2CA 2NY4D 1AZBA 4K2UH 1ZLVK 3GUXA 1P5VB 4M6AA 4NM8H 3MLUL 2DIJA 3NDZE 4KVOE 4X5PA 4M8QB 3V8IA 3FAWA 2VQTA 1USQA 4IRZL 3P9LA 2JIXA 2KL6A 1PQZA 4C55A 5SV3A 2VZZA 4A7VA 2A4CA 1CI3M 1HESA 4NNYB 5A2IH 3HR5B 3MCKA 2ZSWA 2HYMA 2VH5H 1E2ZA 3P9MA 1H8OA 2HN7A 3AAZA 3WCYA 1JYNA 4LO9A 4FI8A 4CVXB 1NSNH 2MCPH 2HLAB 4WWKD 4BK8A 3RZCC 1G7PA 4NSKB 5TQ0L 3GBMH 1BQRA 3ATBA 4OJDH 1YN7A 2CXKA 1KYAA 4ZDHB 1AZNA 4P2RE 2DWYA 1PKOA 2HFFB 2WP3T 3VFNA 4F7MB 3E6HB 5GCNA 4EVNB 2BSBA 4D0CA 3D50A 4JL1A 3MRMA 4XO3A 2R4SH 3D25A 2APSA 1EHLH 2JDCA 3IT8D 4Y4HB 3EGDA 1N12A 7FABL 1BZ7A 5KSBF 3DSFH 4YWGL 5EU6E 3UJTL 2ICWI 2W0PA 1N5AB 2BH0A 4QHMA 4BBWA 3GDCA 1XL4A 3WYRA 4R4NC 5E4EC 1MFBH 3TU6A 4QAMB 2H0PA 3ZJ0A 4P4FA 3VX0A 3QNYB 2CR3A 3LKPA 3CQPA 3LIUA 1YDPB 4UQ3A 2HVJA 3Q8CA 1XH3B 1MQ8A 2FWSA 4KITB 1NPNA 1R17A 5C08B 3H8FA 4WHYG 2HXAA 2HKFL 1ODAA 3DOSA 3QAYA 1KN4H 2XLLA 3QQ9C 5CIPA 2PUQT 5GIRB 1Z8TA 3R9GA 4EEEA 1BMWA 1AFVH 3TNMB 1CLCA 1JZ8A 4JO2L 1TIQA 1DANU 2PABA 3VQ2C 3VO0A 4L1TA 2QSTA 1C5BL 2JBJA 5ES4B 5JYMA 2FT8A 3VUAA 1OTTD 2NNAA 2R23A 4IF5A 4L8AA 4U1SB 2R69A 3IFNH 3SY0B 1CGUA 1N71A 2BSTA 1AXSB 5B8CC 4TUJB 1JXJA 2IJ0C 4IBSA 2W07B 4TMPA 5E2VH 4UFVA 1CWVA 1COBA 2WLHA 4Y7OC 5DURB 1TPXC 2F74A 3LN4B 3X3FH 3H2WA 4M7JL 4AH2B 4LGPB 4IEFA 1P7KA 5F44A 3D7GA 4XPDC 3BPCA 4ADIA 4M1DL 1JZGA 3GBLA 2FXFA 4NKDB 4R97C 4Y5XB 5IROD 4DKAA 3N40F 4A6YH 4HXBH 4X5XB 3BLNA 1UWXK 1OPOA 4WV1A 5DRXB 1KCSH 3EO1B 3FQNA 3HNSH 4LLYA 3ZO9A 2D7MA 5AB9A 5E4AA 3GTVA 3HI6H 1H3PH 2C1OB 4MD0B 2Z4QB 3RZWA 2Q5BA 3UYPB 3WKNA 2G2RA 4H8QA 1XR8A 2Y1ZA 4FXKC 5DJ0B 1RXTA 3GK8L 3WUZA 2EUIA 2XVBA 1ZE3H 1KTRL 1GAFH 3L5XL 3O11B 4NP9A 1HNGA 4AG7A 4HKBB 1NLDL 1UH2A 4K23L 3PGFH 1TR7A 4WW1B 3WKML 1JWUA 2W59A 3NTCH 5JHDA 1EZSA 1CICC 4IJTA 3I9GL 3HG1A 2B3VA 5IOPB 4ORGA 4D9LH 4OKOA 2CNZA 4AGMA 3DX9A 1MJAA 1CGSH 4P3DB 1KJVA 1XD1A 1BF2A 4UOW0 1B87A 2Q0YA 1FJ1A 1KXHA 2R4RH 2IALB 2X0VA 4OFIA 3L3OA 4U1LA 1GW0A 4ONOA 5A28A 2BIPA 4NQQA 3LV3A 2YHGA 4L3AA 4U1GC 3ZZIA 2CDFB 3OD3A 4OLVH 1KLUA 1MIML 1Y0YA 5EA0H 3LKQA 5HI5C 1DFBL 1A7PL 3GJFK 3FXTA 2XWCA 1IU8A 4L0YA 1HEZA 3LRSA 3LD8C 1IGJB 2C4XA 1ECZA 1OAKL 4JPKH 2AQ1A 4LIQL 4HHWA 2V2XA 3LZNA 4OJCA 4ALAL 2KC0A 3FFCD 5D1QD 1NAKH 3WKYA 2B1AH 2J3SA 3BQUB 4QRPD 5I1GH 4MCPA 3UJJH 1N4XH 4AT6A 3RVTD 4POYA 2E9IA 4LSTL 3QHFH 4UILH 5C09D 5E08L 1Y9KA 1DANT 4KTEH 3DPDA 4Q2ZB 5GRJH 3ULSA 1E6OL 3WO3B 2APFA 4LDLB 5AW7B 2IBBA 2OMBA 2YGOA 4G80B 3Q1EA 2XTSA 4WI5A 3RA7H 4WQOA 5E8OA 1I7RB 4YDJA 1IO4C 4LL9A 3CHSA 5DHXB 2HWZL 3L1OH 3BZEA 1JS4A 2WWNA 1WTLA 4G8IA 4JG1H 4KUCF 4PRNB 4PJBE 2V5YA 2Z8WC 1Y7VA 2AJZA 3T9YA 2CSPA 4URTB 4YE0A 2WLLB 4U3XA 2BP8B 4EE2A 4JFED 3EYQC 4LEBA 3WLWD 4ZYKA 4W4NA 1NEZG 1ZPUA 3QR2A 4Z7IA 4JREC 1C5CL 1RULH 2E76C 3KL9A 4RGOH 1G1YA 4FL4B 5F6HI 3HA0A 2RBLA 4NN6B 4NP4H 2IQAA 4FQIH 3QAHA 2BNRB 4JQIA 1R5VA 2NY5C 3ALPA 1KDIA 1T03H 5EZJA 3A47A 1K2DB 3G6JA 4LHUA 5EU5A 3NIGE 1AY1H 5BQ7B 2EWBA 4W93A 3UIYA 1AI1L 4DKEL 2FS5A 3HW7A 1Q9KA 1X6LA 2IAMD 3X2QB 3S34H 4P10A 1IAIL 3HG1E 4PSPA 3OXSA 3RO0A 2E9WA 1RJYB 2EIDA 3P11H 3RAMA 4JB9L 3UO1H 3ZKNC 4KXCA 2FX7L 5BZDA 4OGAC 4X5QA 2OLDA 3AABA 3P4OA 4LCCC 3B2MA 3P02A 4UTAL 3K72A 3VD3A 4BKLA 5AB2A 1N2RA 3B6SB 2WUBH 2FLBT 3D06A 4PY8I 4PJBF 5LB1A 1KLGB 2BSED 1PZ5B 4QRQB 5DT1H 2ATAA 5DI8B 4AWJC 3M1CA 1DDTA 1FUNA 1A9EB 2G5RA 1S7VA 4HX1A 1HU8A 2A73B 2DJSA 1EEYB 4J3OH 1RP9A 4GMTL 1ONQB 5AW3B 4WI0B 5GZOA 3V0WH 1EUUA 1HEJC 1ZGLB 1PPIA 8CPAA 4RZKA 3GS0A 2VGLM 1I1AA 2ESVA 3WABA 3AU1B 3QYMA 3L2NA 4P5TB 1Y1DA 5DMGD 1G9EA 4NO0A 1RZJL 4LLVA 4UZGA 3H42H 2FLRT 1MJ8L 2BPBA 1D9KC 3PGPA 1G6RA 1R34A 3FRUA 1YUKB 4XWOD 2M1KA 5HHNB 4H6ZA 1T7ZA 3JUYA 5AG5A 4XC3H 1G7HB 1BX2A 2NZ9C 1HHJA 2NMSA 1P1ZB 3F12A 4TYUA 3HC0B 1NSLA 2A6KA 4PGCB 1E2VA 4GIPD 3UTSA 5DF0A 3U6XS 4PRBB 2HRHA 3JYBA 4TF4A 2GSGB 3UY5A 4NKOB 1JHKL 3ISXA 5CSBA 1W0VA 1KUYA 1EV2E 2WUCL 4LEXH 1NBYA 1JGDA 2VZ3A 1NDGA 3N1PC 3MNMA 3QUXA 5ICYA 2VIRA 4W68A 3MFGB 3RY5A 3ZKXB 1XSIA 4HDIA 3NSCA 1RERA 4HJUA 3DPBA 4YX2L 1RFDL 2W91A 4KKAC 5DRWB 5GS0H 5GGQL 3TBWB 1V3JA 1PLCA 5DHEA 3BO8B 3SHSA 4K5MA 3SE9L 1UXMA 4CSTA 3PWUA 2AITA 2Y06L 3SDCB 4OZ4B 4E36A 3D2MA 3T3ME 5I0ZA 3S5LA 1CP7A 3GI8H 3QUMB 1A6PA 3A6CL 4R6UA 12E8L 4L29B 2YD9A 4KDTA 3AQDA 1ZA6A 4YDKH 5FWQA 1CU4H 4LASH 3TH2T 3PNRB 3FQRA 5TDOA 3QI9C 1U3HD 3SE4C 2BSCA 1T89C 3LN5A 2KYIA 4O4YH 3I2CH 4ONGH 1NGWA 1XT5A 2AAAA 2V9TA 4LT7A 4WTWA 4KRPB 4MDRA 2FL5A 2V8HA 3Q6GL 4MBOA 4JKNA 4KPHH 3JV5A 5JIQA 4ZFOA 4HIHA 1M44A 1Q9OA 4MD4A 2YN5A 4BUQA 1BXXA 2BHZA 2QJ8A 4BHUA 1U8PA 2EDMA 2ZCKL 4YQXL 3B7IA 2ESVE 4IMLA 4NC0B 3V9EA 4BFGA 2YRLA 3U1QA 4PRHD 2ZKMX 3EYVA 3S8WA 3L4UA 2AKRB 2WGXA 1J0KA 4GW5B 1IBGL 1M6UA 2XHNA 3CXHK 5CU9A 2XQBL