2NSMA

Crystal structure of the human carboxypeptidase n (kininase i) catalytic domain
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
399
structure length
390
Chain Sequence
KLAFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNKEALIQFLEQVHQGIKGMVLDQNYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxypeptidase N catalytic chain
publication title Crystal structure of the human carboxypeptidase N (kininase I) catalytic domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 136
structure length 390
sequence length 399
ec nomenclature ec 3.4.17.3: Lysine carboxypeptidase.
pdb deposition date 2006-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 2nsmA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2nsmA01
4IHMA 4X8IA 3NA6A 2ZOGA 3VH9A 3FJUA 1TXRA 4P4IA 3NJXA 1Q7LA 3MN8A 3IIBA 3PB8X 4MMOA 5D29A 6CPAA 5K8NA 3B35A 4EWTA 2V8GA 4OC0A 4ZX8A 1YW6A 1YLOA 1BLLE 4UF4A 3CPAA 3PB6X 3PFEA 2GLFA 1VGYA 3VARA 3DGVA 1ZLIA 3G3LA 2BO9A 4FAIA 4A38A 2PVVA 2FVGA 4P6YA 1XJOA 4G1PA 8CPAA 3D7GA 4P4BA 1BPNA 4PPZA 2XHNA 2ZEGA 3D7HA 3LMSA 4P4EA 4A39A 2AFUA 4MHPA 1CX8A 4ZY1A 5HVFA 2ZEHA 4NGMA 3D68A 1CPSA 3B3VA 2ZEDA 2RFHA 4IAVA 1LCPA 4EIUA 4B6ZA 3PFOA 2BCOA 1ARLA 1Y0YA 2PJ3A 1ZG7A 1ZG9A 2Q4ZA 1XMBA 5CPAA 2V8DA 3ISZA 3NH5A 4W9YA 1TKHA 2CTBA 1Z2LA 3S9MA 1VIXA 1LOKA 2WZNA 3KL9A 4NFRA 4ZYQA 1M4LA 3GB0A 2POKA 2QVPA 1JQGA 4FXTA 3KI9A 4YU9A 1XFOA 5LRKA 5K39B 5G5DB 5LYLA 3CT9A 4PXCA 2ZEPA 2C6PA 4JZ0A 2ZELA 2CIJA 1ZG8A 3KHXA 1BAVA 4U3SB 1QQ9A 2AFWA 2ZEMA 3E8VA 1DE4C 2GU2A 2ZEOA 1LAPA 3PBEA 2F7VA 2XEGA 4F8ZA 3SI2A 4R8FA 1HDUA 2ABZA 4NJRA 2G9DA 2JBKA 2XEIA 2HC9A 3SJEA 2PIZA 2PCUA 2V8VA 1CG2A 2O4HA 4TWEA 4H2KA 4WI0B 1CP7A 3KQZA 3PB4X 2ZENA 4NGTA 4OC2A 4NGRA 4OIDA 2PJ8A 3I1UA 2PJ7A 4PXDA 2IMOA 2RB7A 3SI1A 3FF3A 1BPMA 5AQ0A 3K2KA 1ELMP 3KHZA 3WABA 5IB9A 5LRJA 3JRUA 2NSMA 4P4DA 2JEWA 1F2PA 4OP4A 3BXMA 1IY7A 3PB9X 2GREA 2PJ9A 1PYTB 1FT7A 3V38A 2AFOA 3TC8A 3NH8A 3B3CA 3FEEA 1GYTA 4R7MA 4YOKA 2ZEEA 3KR5A 2XEFA 4K3NA 5J1QA 1AMPA 2OOTA 2NYQA 4P4JA 4MRIA 2IJZA 3BHXA 3QNVA 2PJ4A 3IC1A 3FECA 3D7FA 2PRQA 4NJQA 2C6GA 1TF9A 5JM6A 3WT4A 3NH4A 5HVGA 2J9AA 1R43A 2AFZA 3D66A 5K8MA 3CDXA 4CPAA 1Z5RA 2PIYA 2C1CA 3GLJA 4PXEA 3B3TA 4NGQA 3IJ3A 3NFZA 1HDQA 1H8LA 1VHEA 4ZX9A 5THWA 3HN5A 3BI0A 3PRTA 2IQ6A 2PJ5A 4ONWA 2DEAA 3ISXA 4DUKA 5JGFA 4MHNA 1YSJA 1R3NA 3SI0A 2I3CA 4F9UA 5HVHA 4FL4C 4MCQA 1NKGA 1PCAA 4P45A 4MCPA 3IWWA 4UEFA 4DJLA 4ZI6A 3FH4A 3RAMA 3PBBA 2C6CA 3IFEA 2CTCA 2PJ2A 3KQXA 4MCRA 4WJBA 5D8NA 3B3WA 2XEJA 4OC1A 4OIWA 1XRYA 5K8OA 3D67A 3V7ZA 3H8FA 4IYKA 1DTDA 2GLJA 4RUHA 2AFMA 4OMEA 4MXUA 1Z8LA 4NGSA 2PJCA 4A37A 1QMUA 3B3SA 4JYWA 3BI1A 3D7DA 2PJ0A 4P44A 2HB6A 2PJ6A 4OKOA 4Z65A 4UIAA 4OC3A 2PJBA 3FVLA 3HLPA 4O23A 4MHYA 2CF4A 3GUXA 3KASA 2PE3A 3WC7A 5F09A 1AYEA 4UIBA 2EWBA 2OR4A 4FWUA 4PQAA 3S9LA 3L2NA 3KGQA 2O53A 5LRGA 4YWYA 2PVWA 2Q51A 7CPAA 4NGNA 3SJFA 5I4MA 2V8HA 2B59B 1ZLHA 3N5FA 4EFDA 2EK8A 1CBXA 5LYFA 2ANPA 3IO1A 3KR4A 4A94A 4PXBA 3H8GA 3FMCA 1TKJA 4R76A 3K9TA 3HUVA 4FUUA 3SJXA 2PJ1A 5DS0A 4X2TA 2V77A 1HEEA 2ZOFA 5LYIA 1LFWA 1KWMA 2PJAA 4OC5A 1TKFA 3IEHA 1EE3P 3KZWA 4DYOA 5LYDA 5JH9A 1RTQA 4AXVA 1Y7EA 1F2OA 3B2YA 1VHOA 3S9NA 3KCPA 1YMEA 4OC4A 3MRUA 3WC5A 3WC6A 1CPXA 4P10A 4KSIA 4MHZA 3RZAA 2Q43A 3SJGA 2WYRA 1Y0RA 1UWYA 4UEZA 2EK9A 2F8HA 1TF8A 3PEIA 3VATA 3D4UA 3RBUA 4GM5A 4BD9A 3H8EA 4P4FA 1FNOA 3LWUA 3PB7X 4WWVA 5K8PA 3NJVA 1ELLP 4IK2A 3T8WA 2JBJA 1NSAA 4MCSA 2ZEFA 1OBRA 4NGPA 2BOAA 3TX8A 3CPXA 1LAMA 1F57A 4LQGA 5CBMA 5HXDA 4FBEA 1CP6A 2AFSA 3FX6A 4X3RA 1ARMA 2AFXA 2QYVA 3B7IA 4TNUA 1LANA 4F9VA 5ELYA 4UEEA 1IGBA 4EMEA 1XBUA 3DLJA 2VL1A 4Q7AA 2QJ8A 4R6TA 4ZY0A 3FEDA 1YW4A 4ZY2A
chains in the Genus database with same CATH superfamily
2FT8A 4NSKA 3BEVB 2W65A 4X8IA 2LAGB 2HUZA 3A4EA 1A2YB 2I26N 2VDOH 2WXKA 3FFDA 3QAQA 5T1KA 4OAEA 1KB5H 2FSEA 3KS0H 5MEND 5H84A 5IQOA 1JYWA 1KFAH 1JV5B 5IROD 4MA1B 1X9LA 3D18A 4H8HA 5DEFA 3UH8A 1TO4A 3VFGL 4MMOA 2BMKB 1KIQB 1JPSH 2BVUA 5IHUH 3B35A 2NCMA 5GIRB 4OZFH 4ONFH 1PQZA 1ZCRA 4XNDA 5KVGH 3VARA 3QJOA 1IILE 2OX5A 3EFFB 4AG9A 4CSZA 2GSIA 4MMXA 3B7SA 3C26A 4UCPA 1YYLL 3ZTNL 2R98A 2BVEA 2VXTL 3M17A 2YPVH 5EU4A 4O58L 5E7BA 1XJOA 1EEQA 1LEGB 1E3XA 1KLUB 1KZYA 3I3EA 1OF2B 1VCBC 4KXDA 4YE4H 3RGVC 3TNMA 3JTKA 4ZW7A 4U4IA 3VFUB 3STLB 1KGXA 1H19A 3EUUA 5ABDE 4M62H 3KHOA 4ZFZA 3MRDA 1URIA 2NY2B 2Y07H 3OGOE 1N67A 4J3XA 1AGFA 1OHZA 4TSCH 2K8QA 4CILA 3VXPB 1LMIA 5HDBE 5KSUA 3DKHA 3P9MA 1IOFA 4ZW6A 4AGNA 4I48A 2R83A 2NY7H 2YD4A 4XO4A 2ICWA 4KC3B 5SWQB 5CJOH 1PAZA 4U3HA 1F6AA 4XN4A 4XN9A 3S37H 3S35H 3KGUA 3ZIYA 4ZMQA 4NUJB 5GHWL 4PREA 1YYCA 2UX7A 3BWAA 4QXVA 3ATAA 3E3QE 2P24B 4KVNL 1XMBA 1MHHB 3KWWA 5DVPA 1UZGA 5JHBA 4M56A 4NENA 3C2AL 5C08B 1N3NB 2HJKB 4O2EB 2H6OA 3TVMB 3ZL4L 4AKQA 4G6JH 2CTBA 1HI6A 2JF1A 3ZE2F 2EVGA 1AD9B 1J1OH 5D4QA 3ZDZB 1OLZA 2ZCZA 3WIIH 2BNRE 2YD0A 1G6RB 5IHLB 1L7IL 1J9CT 2DWXA 1JERA 3CH1B 2D4OA 3PWVA 2HLAA 2WXLA 3RIFF 2QVPA 35C8H 4OCSL 1RZJH 2K0RA 5FUZH 4LDEB 3K72A 4TTDC 4Y1AD 2VXQH 4A2MA 5IP4A 1LE5B 4KTDL 1WWZA 4ETQA 4PJGF 5DR5H 4U6HA 3TGXA 1TFHA 1TZIA 2XVKA 1IRAY 1D9KC 1KPRB 2IPUK 1HZLA 4N0RA 1FHNA 4CSSA 4K5OA 2C1PA 4P5TA 4HS3A 2BOCB 2DQEH 3EXNA 1MLCB 2D7NA 5C0JA 1JV2B 4JZ0A 2VE6A 5DZPA 3AT9A 5DHMC 4Q4IA 3RHWK 1FH5H 2C7UA 4UQAA 5FO7A 4WNQB 2B4BA 4TOYL 3Q0HA 1YC8A 4MA1C 3AFLA 2Q2EB 1MDTA 2VDNB 4E9VA 4HUVB 5FHAH 1AXSA 5FF6B 2D9QB 1NFDE 3FCSA 1PG7W 1MFAL 3QZMA 5DJ2B 2GJ6D 2XUWA 3KW8A 4GKNA 1QBAA 4L3FA 4Z76B 1XGQA 2VEZA 3T2QA 1VB9A 4H88H 3QNXB 4YHOL 3UZQB 1IAKB 1HXYA 2ITCA 1UFUA 3O3DA 8CGTA 3P11L 1YMMA 1FZJA 2OR9L 5F3BA 1GJIA 3MJGX 2XEIA 1TOXA 3FRUA 1RUQH 2HC9A 1Y1DA 3A3YB 4E42A 1P6WA 5HHXL 2J8UF 3MRQB 2HXAA 2D3VA 3DBSA 1LEKA 4KOUA 1S9VA 3GNMH 4X7TB 2IQAB 5CR8A 3CFKA 3RYMA 2VJ8A 2J6EH 1AQKL 2NY2C 4LSQH 4APQD 3MC0A 3U9PH 1UH2A 3IJSB 2MSPA 1RJYB 5T3XD 3D85D 2Q76B 2X9ZA 4HHAB 3QRLA 1YRKA 1NGWA 4AQEA 1NC2D 1XFPA 2ZCLL 4MB4A 2G4EA 4UM9A 1VFMA 5DQJB 2ZCHH 1MF2L 2QGCA 3MRRA 3CSBA 1SVBA 2VLRD 3QR0A 3LRMA 4QOKB 5ESQA 4P4DA 2ZXBA 4HWZA 1ZLVH 5B8CA 1A9VA 4HPOH 2XZAL 4B0MB 3NCMA 1UWGH 1OPGL 1VZGA 3TVMC 3R96A 2WXMA 3JWNC 4K3DL 1S9KC 4Q89A 1OT4A 3WUWG 4HMCA 2Y24A 1M05B 5I16A 1PUAA 1JNLH 3DVNA 5D5ME 4ELDA 3VFWA 2E3VA 1RIHH 1QNZH 2MKWA 3FN0H 4HDIA 2AGJL 5AKVA 2WWOA 2CR0A 4ZX5A 3L9EA 3VRIA 1UVQA 4PGJA 3IC1A 3QNVA 2AJXL 2F5AL 4KTEH 1RMFL 2J5LB 4H0IA 2OCFD 3TFBA 3H85A 4OGYH 4WW1A 1IM3D 4M61A 4Y16A 4NM8L 1JXGA 3CH8A 5JM6A 3KPMB 3MLVL 4EZMA 4OGZA 1WC7A 1QFOA 4TLTA 2OMZB 4N22A 5E6RB 3ALPA 3NN8A 4RH4A 1QLFA 3EYSH 2W9DL 4JHWH 4NT6A 5CD5C 5JHDB 4BBHA 3S96A 5DS2A 3L3IA 1Q8MA 3ARFA 3LEYL 5JIHA 1TQWA 4HG4J 4KVPA 1RZIA 2DD8L 3GRGA 2YO3A 1SVCP 4WUUB 3GLJA 1JZFA 5E9DE 1W80A 1NCDH 2HT4D 2GUOB 4HP5A 3DRTA 2A9MH 3PWUA 3V5HB 3DSBA 2F5BH 1I9IL 3Q3GB 1DQLH 1JD7A 1MW3A 3D2UD 2DAVA 1IGML 5CJXA 2R0ZH 4CW1A 2EDJA 4HIIA 4GQQA 3D52A 5E00A 2G3ZA 2N1TE 2YKLH 1VPOL 1EZSA 2NLJA 3PHOB 2D7TL 1W91A 3KVDD 1WZLA 3MR9B 3NP3A 1FH2A 1FYTE 5EZPA 2YARA 2R2CA 1FG2B 1MNUL 3OZKA 1EK3A 3CZFA 2DIJA 4JY4B 3RIFK 1GJWA 4FFYL 5GGQH 1TTUA 1I85A 2P47B 2XLLA 1QI5A 2XBZA 3Q6GH 3WSQL 3Q5TA 4PBWD 4AQOA 3APNA 2H2SC 2XWTA 1XAKA 2WYTA 2ZNWA 3D48R 4S1SH 1DN2A 3TO2A 2NY5H 2OXHB 4BRVA 5JYMA 1JTTA 3K6FA 4IOSD 2NY4D 3ZX1A 4KRPD 3O3UN 1ND0A 1CGTA 3OB0K 3GBEA 4P3WA 1A14L 2R4RL 4F7EB 1QFUL 4XPFL 2WHVA 4UQIM 2VDQH 4HD5A 3VDBA 3SPGA 4OJFH 3ARED 5DMGD 1KB3A 3R19A 5FYKE 5IVXA 4UIMB 4XOBA 4MAZA 3SSGA 4BXVA 5HVWA 4D9LH 3DX6A 4XHQA 1MCHA 1UWEL 4NQEE 3NT0A 4DO4A 3MV8A 4N9OB 2YQBA 1PZDA 2X9YA 1DQJA 3FH7A 1KN4L 1QSED 1I1FA 5KYUB 1MCPH 3BD5A 4OMEA 2C3XA 3CUPA 4CNIA 1U8NB 5JZ7C 4A7SA 1OE2A 2PJCA 4XBEH 4NZRL 1TPXB 3O81A 2NNAB 5AG6A 3S34L 3BI1A 3SCMD 3HMXA 5E2TH 5E1AA 3L1OH 2AQNA 4X6BB 1E28B 2V2XA 2J5LC 4CN6A 4OGAD 5CCHE 3QO0A 4TQ8A 2LVEA 2OAAA 2N59A 4QF1A 4RSYA 5G4OA 2RH0A 3RWCA 4BSVA 4O23A 5EORH 5KJRL 2FIKB 4G8GA 4ANXA 5IW6A 1ADQA 1JF1A 1WTLA 3B9AA 4J3WA 3V0AC 5I76B 5TE7L 2IGLA 2ZXQA 2AQ3A 4AXWA 3K0WA 4AIXA 5F09A 2VLKD 1MZZA 5GZOA 4WK2B 2VDNL 1QAWA 3TWYA 3W9EB 1FNSH 4GP4B 2MCAA 5AEAA 1ICTA 3V0JA 3WTYA 1MWAA 4YR6A 3SKMB 4L3AA 1X4YA 1JCVA 4UU9A 3UTOA 1BQHA 4XOEA 2Y1VA 1FNHA 1ZD6A 2XRAH 2C4FT 1ZLHA 3ZTJG 4M6GA 3BAYA 4KI1A 3MFFB 1WK0A 4OLWH 3SE9L 4P23B 3IO1A 1A7NL 2DQ6A 3DURB 3MV7E 1GH7A 3PP3H 3S0PA 3RI5F 3BP4A 5E8OB 1ZLUH 5E6SB 3IXAB 5FUOL 2KLSA 3AGVA 1J12A 2R29L 4FF9A 3IE4A 1T5WA 4PB0H 4YWGH 2YD5A 5J1AB 1WFUA 2JI2A 4NPJA 1OP9A 1XF5B 4UUJB 1S3RA 2WVUA 4W4OA 1PSKL 2VH5H 3HR5A 1IVTA 2G5RA 4OGQC 3IEHA 4DQAA 4CJ0A 1BHGA 5EG6C 3SKJH 3LV3B 4OZ4B 3FKUS 3G5VB 4PTTB 5D1XD 2GITA 1RUAH 2H7WA 2F53B 2ICCA 2ZX7A 1RIUL 3SDYL 3WDHA 3LQAC 3MVSA 3ARVA 2DV6A 2QPSA 2R0WL 1H3XA 2BXZA 3QCVL 5EO0A 2R2HB 2VXVH 5IF0B 3RIAF 2VYRE 5I1KL 3MODH 3QDJD 3UZEA 1GW0A 4PAZA 4F58H 3C8KA 5A27A 3KPPA 3PL6D 2EDXA 3S6GA 1T21B 1LP9B 4ZAKD 1Y6MR 2BFGA 5T3ZH 5CZXC 4YJZL 5B3JF 1EZVY 1U36A 1ZGLA 5DRZB 4NXSA 5DVMA 4I2XB 2PPCA 4CUCA 4YPGB 5E99H 3V0VA 3F58H 4XZ4A 1Y0LB 3UPAA 1JZ5A 2KL6A 3DGCR 1F8TL 1W72L 1H5BA 4FFVD 2Q4VA 1DTUA 1NCGA 2YR3A 4UEZA 1D6EA 4TSAL 2HLEB 2ZYSA 3OX8A 4Y5XC 3TN0D 1NFDF 2CJUH 3B8YA 5CEYA 4GM5A 3T3MB 1FNOA 1B6BA 3HG1B 1TPXC 3LXBA 3ABKB 2O6FA 5DRWA 4ZW5A 4JQIH 5L7XH 5DD0H 4GBXD 2KLTA 1E4HA 3T2NH 1NKRA 5DMKB 5IX3A 3BLKA 3BVWA 3HFML 5L8KB 5JXEC 1NL0L 4FYSA 1OSYA 4ZTOH 1ORSA 2J2ZA 3NZUA 4XHJC 2ZEFA 5IQNA 3EH5B 4UQEA 3FT9A 4TUKH 4C68A 4QHMA 2PW1B 3R1KA 1MCEA 2C3VB 3VXSA 1L9PA 4DH2A 3FUJA 2E56A 4R7VA 2FT7A 2OPCA 3OMAB 4L4JA 4XNYH 4N2CA 1ED3B 1KIPB 3IT8D 3X14A 5I1CH 3LKPA 4BH7A 2WZPA 1ARMA 1HKLL 1NEPA 3NABL 4MGXA 1E9OB 4QRUB 4Z77A 4JDEA 3WFEH 4ANUA 1M7DB 4Q2ZB 4GI8A 1JPEA 4HAGA 2ZE0A 1CD1A 3RWEA 5C0CB 2HX8A 1RVFH 2IQ9H 1S7KA 1JK8B 4MLSA 5GS3A 1I4FA 3F83A 4IBWA 4P23C 1CGSH 3KPOB 5F7EL 4DGVH 4ORZC 4BIKA 3OWCA 1KCBA 2FGWH 3ZYJA 3O6LH 4DPRA 2Y06H 2BWQA 2UXGA 4M7JH 2ADFH 5IJKA 1QI4A 3T0VA 1IGYA 1N0XL 5FXCH 3LQAL 1AYRA 2HVJA 2R0KH 1YLBB 5IR1B 3G04B 4LPXA 1PW3A 4XMLH 1RLBA 1D7CA 4MSWB 3DIDA 4PY7B 5L6YL 1LRZA 1FAKT 1GAFH 3B6SB 4PGEA 3Q2CA 4NO5B 3HC0B 2G3MA 1GYAA 2AABL 3RUGE 3D09A 4JPKL 5I15L 5IB3A 2N4IA 5KVDE 1KBVA 4JKNA 2K6YA 3ZKQD 2HKHH 1PMYA 3V6FA 4B96A 3N42B 3DO3A 1NKOA 3LXAA 4LLDB 3WIAA 3TJHD 3HS0B 1MCFA 3QUMA 1DJYA 2OL3B 5DTFA 4YXKL 3WTVA 4XPTL 1M6OB 3QUYB 3B3BA 4GS7B 5HVGB 4WTWA 1YMHB 4TL4A 3GJEA 5SWZB 4TF4A 2PPDA 1JHLL 2W0KA 4HKBA 5AAPA 3FPYA 3O6FA 2JXMA 3LB6C 1FFQA 5DJ8A 1LK2B 4QTIL 2BNQB 3DMMA 4X8XA 4AMKL 3P54A 1ZT7B 5IB2A 3C6LB 3BGAA 1N18A 3LTVA 2H2PC 2YMXH 3ULVL 3A23A 1T6WA 1WHOA 3ILPA 5I19H 3O4LD 2VITA 1QPPA 3CIAA 4ELMB 1CK0H 3ME0A 3IMVA 4MXVE 5JO5A 3W11D 1HYSC 3W2DL 4KFMA 1IGCL 1PKQB 2ZUQC 4N3UA 2AK4D 4JFZL 4NX0A 1KTLA 2EEXA 5EZOH 3RAJL 1OTTC 2M26A 1W0WB 3MV01 2C9XA 4W4NA 3MOBL 1UTDA 3IJHA 3IKCB 1HH9B 1X5HA 4N24A 3GSQB 4U1HB 2LABA 5F96L 3MXWH 2KPWA 3F5BA 2WINB 4Z0XB 5J8FA 4JGMA 4HKJB 1BVZA 2CLRB 4UOW0 1I8UA 2CLVA 1S3ZA 5LGHH 2FIAA 2WP3T 1FFNA 3B2XA 3LD8B 4JW3A 5I6OA 3JV6B 1AD0A 3WIFB 1A25A 4J3TA 2R7EA 2H32A 1OOAA 4LF3B 3BAEH 3KPLA 3CSGA 4NQCE 4RWHA 4BE5A 4OSUH 4FULA 4YU9A 3FXIC 4JXRA 5ID0A 3X13A 1ONQB 3RLSA 3HI1A 1P1ZB 3MRMB 1JMXA 4P5KA 1DBML 1G0XA 1TCRB 4XNBA 5I2IB 1EVTC 1EFXD 2RCSH 5IMOB 3HOGA 2F54B 2JIXA 2WOYA 2Y5TA 4AEHL 4BEIA 4OB5H 4OFDA 1ZG8A 1H6UA 3NFSL 3SJVA 3HFFA 4IU2A 1CI3M 2YK1H 1QQDB 5E2WH 3W6SA 1F41A 5F3HB 3PAYA 3CHSA 4NZ8A 4YHIB 3WR7A 5AOZA 1HK6A 3ZGIA 2HN7B 4RNRA 2ZEOA 1XOVA 4A7TA 2QZ5A 2VB5A 2IDFA 3D4YA 2ZUTA 3VNYA 4DZBB 3GK8L 4LZKA 4X4KA 1S7XB 4F8ZA 3E6HA 1JVKA 2BWDA 1VKCA 4ODTH 3IKKA 5I8CA 2EACA 1VEPA 4OADA 2BRRH 4IBVA 1DQQA 1V05A 4NEXA 4R8FA 3QFJB 2VLJA 1RZKC 3HLAB 1EA9C 1INEL 1XZ0A 4JY6B 2FL4A 4DGYH 3H56A 2BP5M 1KTCA 1N59A 2OTUA 2YUWA 1ZHKB 4PWJA 3HS0C 3P02A 3US0A 2WANA 2PYFA 1EEYB 2W1NA 3QZPA 3HG5A 4FMKA 4RDBA 3B34A 1CG2A 1ODAA 3QUYC 4GS7C 3FUFA 2AXFA 2PYEE 5D7JD 5F1IA 2R7HA 4JG1H 3NFPB 3T9YA 1OB0A 1ZKAA 2FSEB 1CP7A 4ZT1A 3SPJA 3V7AE 5BV7L 2A9NL 1F58H 3PGFH 1YECH 4M1GL 3FQUA 3A67H 3GMQA 4F20A 5HYJD 2C3GA 3K5RA 3C6LC 1TKWB 3ARUA 1CJWA 4LQFL 1HU8A 1WFNA 1QEWB 1PQZB 4NUMA 3NCBB 1KCKA 4JQVA 4B5ZA 3LKOA 3ARDD 1LWJA 3DUUB 1JSYA 3WNKA 1BZOA 1M2OA 3II3A 4YHKH 1FO0L 4UT6L 3APMA 3M17B 4G7RB 3GHBH 2I07A 4DPBX 5KBNC 3G6AB 4Z7UE 2D03H 1C8QA 4NC0B 3TIDA 4CYNA 1CZ8H 4JFEB 3UG5A 1BX2A 4AUYA 3IN2A 1JBJA 4FI6A 4N8VG 3WNJA 1OVZA 3HLKA 3LNDA 3UJIL 2TRHA 3QQ9D 4ESKA 2IADA 4JPIB 3LD8C 4ZFZB 4DUWA 4YO0A 3MRDB 2IJZA 1WGOA 4LSRH 4MRIA 1YPZE 1ZTMA 3QUXD 4KXZH 2C26A 2JFCA 3RKDC 4Z7WA 1X4ZA 1M1SA 2YNCA 1UM4L 4MWFA 5SWSB 3WTXA 1T0OA 1MCOH 3CPLA 3MGOA 3H53A 1JK9B 4B50A 4JO2L 2QADD 3IAPA 4ERSL 3JT0A 3QIWD 5DU7A 2VZZA 5JQ4A 1KCVL 2L7JA 4HPSA 3US9A 4H1LB 3RWHA 2YQGA 3BWAB 3UP1A 2BHFA 3CMOL 4N2DA 1UA3A 1AXIB 3AY4A 3ESMA 3T04D 4MFZA 1OM3L 2Z4QA 4ODVH 1PCXA 4YDJB 3U46B 4JM0A 3R9FA 2GJZB 3LZPA 5DS8A 4MQXD 1NEUA 3LCYA 1B2WL 4HIEB 2J20A 1HDQA 4GAGL 3MLYH 1Q2YA 4A1RA 4F2FA 2YSSA 3KXFE 2RTTA 2NYYC 3HZVA 4K3EL 5IVXF 1A6UL 2OZHA 4CAWA 3TJEL 5ANHA 1UH3A 2H6PA 3IMWA 4KX7A 3T3PB 4AE1A 4QKXB 3CVHL 3BI0A 2BCMA 4YPJA 3K72B 4GW5A 3QIBB 3BVDB 2FZ3A 3S36H 1XCQB 3IWUA 1H15A 3QEUA 2BSSB 1FORH 1T1YA 1WD9A 4U6HB 3O9WA 3KGSA 3WJLA 3WY4A 2KCWA 1TZIB 4NHUA 3T8XB 2Z1PA 2BNRD 2CHDA 2VABA 4FG0A 1IARB 4XPBH 4Z8FH 2FEEI 2QFPA 4YXHH 1CBVH 2YGVA 2X1PA 3NCJH 2OYMA 5LB1A 5EU6B 3NEOA 1GMEA 2B20A 4U1MA 3UBGA 1DSYA 2AC0A 3N41F 3WNLA 4BFRA 1O6SA 3HG3A 3THML 1NMAH 1TTFA 5B3SB 1BXAA 1U93B 2ITFA 5DSCA 4XXCC 4EQ2A 1UD3A 2ARJA 4CKVX 5DHVB 3U7AA 4UAHA 5IQ9B 3B9VA 1RZGB 2K78A 3RWJB 4ISVA 2Q86B 1DVXA 1MPAL 2D31B 4LESA 3UJTH 4OLLA 5B38B 1IEBB 3RPIB 4B5EA 4PWEA 4NWUH 1XGQB 5IESH 2Z93A 3B3WA 3P0YL 4XVSH 4YEFA 5CLZA 1AO7D 2FBOJ 4ZUUA 4F8OA 4HKXA 4KVOE 5K8OA 4NJAL 3UTSE 4U7KA 2MTAA 1F4XL 3UPRA 4P59H 4KNUA 3RUGF 1A1NA 4LU5H 5ADOH 4A31A 4RRPA 5EEUA 2WM0A 4DFHA 3T4AA 5BW7C 2BVTA 4M4RB 4Q6IB 2YXFA 3P4MB 1YJDL 2JB5H 2GT9A 3O6KL 4NZDA 3D7DA 5FM4A 2X1WL 4E2AA 4F2MB 3GRWH 4OBRA 5KG9A 2COQA 3EH2A 5GS0L 5T1KD 4C2ZA 1WA2X 1UT1A 3RWFA 1S9WB 1SDYA 4G2AA 3SBWC 4GSQA 3OMIB 3SYQA 3H9SE 1Z5LB 3CZXA 5J6SA 4EKXA 1BYPA 4G5ZL 4N2MA 3ARGA 4ODWB 1IL1B 3V0HA 5FGBA 4QRPB 2D4PA 3KVQA 3MROA 4ZW8A 4HWZB 5B8CB 4LNVA 3IBOA 3IDXH 3IGUA 4F7CB 2NYKA 4H2AA 3ES6B 4JFYB 1WICA 2O53A 4PM1A 4CAEA 4JN2A 2EH7L 3SGDI 3ZZ1A 4YWYA 3UC2A 7CPAA 1GYCA 3SDXA 1EH9A 1DVZA 2Z8WC 2ICEA 2O5ZH 3FU5A 2XXMB 3HI6H 4HCGA 5ELIA 2AJVL 4FKHA 4MDIA 4WWOA 1OTUD 2JCCA 4UT9L 5AB2A 4KLWA 1HCZA 2ANPA 2Y72A 4TXVB 4A94A 3CHXA 1TQSA 2G0LA 3IBEA 1ZANL 2J4WL 2CRYA 1NPJA 1F6FB 1F00I 4TUJB 2QPEB 3QIBC 4U1SA 3MGDA 4TNFA 3C87A 1KCWA 5DS0A 1O7DC 3OAUL 3QVAA 1JZ3A 1I8KB 1O7VA 3NN8B 1HQRB 4JZOB 4U5YA 5FB8A 5A2KH 1GGUA 3DX0A 5HI3D 3L3IB 3F7RA 4LVOB 5CF3A 3LXUX 4A2ZA 5EIIA 1DDHA 4GSUA 2VO8A 2EXYC 3WNOA 3ATFA 1P1VA 4MMYB 2MKLC 2YPKB 5EBLB 3HMXH 4F80A 1HSBB 4JE4B 1DJHA 3QJUB 2ZP8A 5HGDA 5G21A 2JELL 1QBLH 2FX7H 3VWJD 3DXAB 3QCUH 1JI2A 3KCPA 4S1RL 3C08H 3UBFA 3HHRB 1HWGB 4FS0A 4GI9A 3ELAT 5D1ZA 5C0IA 3F62A 1T5KA 5EOCL 4BQBA 1ADQH 3OHXA 3GXDA 3AQDA 2Y6SC 4EIBA 2QQKH 4JCMA 3R9EA 4MNGE 1ZA3A 4AVKA 5HHOE 1SNRA 3V52H 2CE6A 3I9GH 4ZMLA 3J07A 4ZD3L 1H6FA 1SXSA 5E8NB 1OT1A 4GNKB 3VI4E 1D5ZA 5BVPH 4YX2L 3FCTA 4RESB 4GT0A 4Q6IC 1JXDA 4KKQA 2QPFA 3FFCA 2B4CL 3CZUB 3ULSA 3X3GL 4RIRA 2X4OA 1CIUA 1FYTD 3NJVA 3NJJA 4LCIL 1S3KH 3ECVA 3EH3B 5TE4L 2XN9B 3TEZA 4OIBA 4RN7A 4C47A 2APSA 3B9KB 3UTPE 2AXGA 4CAFA 1GPOH 2VZVA 1SJVA 2GI0A 2K70A 3QCTH 2DW5A 3KCWA 3VG0L 2P8LA 3FU8A 4JGUA 1OAQH 4PRID 1SXAA 4IRJB 3LD2A 3EH1A 5FS5A 4NQTA 5LJYH 4QJ5B 4NDMA 3NJGA 2B77A 1IBFA 5B8CC 1J7VR 2SODB 3K6IA 1OWRM 3VFTB 2I69A 3DX6B 4OW6A 4QHUB 1S7SA 1IEAA 3NIFB 5ICZA 2V17H 4WK4B 5F89B 3VXUA 2P28B 3KPTA 2VZOA 1MH5A 4LAQL 1I1FB 3NSYA 4Y5YB 2DLGA 4LEXH 1C5DA 1NDGB 1VGEL 3N9GL 5MERA 4OLVL 2PTTA 2P5ED 2IPTL 3PNWB 3VFPA 3TBTA 3HPJA 4PJEB 2ZIDA 2ADJB 2V2TA 3UC0H 1BM3H 3P73B 3EFAA 2XKNA 4B0MM 1P5UA 5DFAA 4XN7A 2FWOA 2Z92A 3L4TA 2A9CA 1G9NC 4LGSB 3BUIA 1QTPA 4XE5B 5DJXB 2V7HB 5MI0B 1PKOA 2DQMA 3P4OB 2VDKB 1SXNA 3GSUB 5AOIA 4YHYB 4WWNA 4LVOC 3NGBB 4ZQKA 4JRYE 4P57B 3BEWA 4JM4H 4K4KA 4TRPH 2Y1AA 5L88H 2H5UA 1MWAB 4LCCB 4QHPA 4CC1A 3QO1B 5FA3B 2WVSA 2XQBH 3I50H 1RUPH 3K5SA 4MY0A 1T1WA 4NNPH 5ETUA 3OPZL 3ARBA 1FLRH 3KPSB 4Y5VB 4FQQA 3F85A 4GIOA 3B2DC 4A95A 3FT2A 2Z35A 3CD4A 4XO8A 4I9XA 1KUXA 2YPLA 2Q9OA 1SOSA 1D7BA 2JQMA 2P9RA 4GMSL 3BP4B 4KPHH 4N68A 3ROOB 3WELA 4AQ1A 4BK5A 1NCAL 1UA6H 4R9HA 3VXMD 1WQVT 3IK2A 3V7MA 2JK5B 1XIWA 2ERJB 3D7HA 4RMQA 4LHUB 4L8SA 1AOHA 2MCPL 4K2UL 5J12B 3S9DB 5B7FA 3L7EA 1WDAA 1GTFA 1OE1A 1FFPB 1NWPA 2PLTA 1MHCA 3HR5B 1A6VL 1I85C 5IKCA 1TZOA 1DBAH 4LKCB 4ZUTB 4UOJA 2BHZA 5E5RB 2FTAA 2ILLA 1CLOH 3LZFL 1MFVA 2P26A 4CC4A 2ZOUA 4IAVA 1NCTA 5HGHB 3ARFD 5I0WA 3ZO9A 1E4KA 4NIYE 4UV4H 4X4YA 1KPVB 1PNDA 1JGLH 5ESVA 4O2CA 1RZFH 2GJJA 4LL4A 3SY0B 3ZZSA 5EO0B 4GAFB 1F3JA 4OZHE 2F68X 2R0LH 5DHXB 1NSNL 4K0OA 3S48A 4X7FC 3B9KC 2F7OA 4HBQA 4OGXH 3WY1A 4KKLD 2BSWA 1OAXH 2GCYA 4I9WD 4IRJC 3EJJX 3MUJA 4ONUA 4JZNA 3HNSH 1F02I 4WHDA 2P6GA 1SBSL 5FOJA 3V0VB 3KL9A 5DVOA 1MCWM 5HJ3B 1ZV5A 2OSYA 1HDMA 2ZYHA 4Y2DA 5IB5A 4NCC2 1FGVH 1NIFA 3ZXAC 4Y5YC 3OKEB 7TAAA 1FNLA 3ALXA 3B83A 4M6OL 2DEXX 4R8WH 1FN4A 4KDTA 1UEMA 1M3JA 2NZ9C 1EO5A 3K2UL 5I8EB 1USZA 3QUMH 4LHUG 3E9UA 5KVEE 4KOCA 2YOCA 4H4NA 1ORSB 1U3ZA 2YLHA 2C34A 3KS0J 5C9JB 2H3NA 4WY7H 1FNGB 3V0WL 3QSKB 2VZUA 4QHMB 4AYID 5LBVA 2X6BA 4EXPX 5MI0C 1VESA 4CN4A 2G0KA 2YIHA 4YHYC 3UACA 1WFTA 2N7SA 3NGBC 3PREA 3E8VA 3QRBA 3MLRH 1JCKA 3GM0A 1BIIB 3NVQA 4U1IB 3NRPA 2ZTBA 4EF3A 4RFEA 4NCDA 2ICWI 4LCCC 3AC0A 4E0RA 1MW1A 3U1SH 4JDEB 3RNQB 5BRPA 1L0PA 2X3CA 4KGLA 4L3CB 1I53A 4RMWA 2ZX8A 4KI5C 4GXUM 1N6VA 4TVPE 3MV8D 1CGUA 2J88H 1MWOA 4Y5VC 5C0NC 1DBBH 1CD9B 3C9NA 5EFIA 4LLWB 5DMJB 4F24A 2X28A 5I8OL 3VH8G 1W0VA 1IZJA 4FNQA 2Y5QA 2ERJC 4IIZA 1NAKH 2FYYA 2KZBA 2OS7A 4TWEA 2QQLH 2JQAA 2K6ZA 5J12C 4OIFA 4W4OC 4P2YA 1XSKA 4NOFA 1KB9K 3IU3B 3NA4A 4KHTL 1HVXA 2H32H 2R51A 4GG6E 2XN1A 1UD4A 4XBPB 4Y19E 2DJSA 1A9EA 3S5LB 3D3VB 2MRYA 1TTRA 5KJ7E 4X9IA 4OLEA 3T2OA 2VAAB 3K2KA 5IHBA 3UBXA 2ZW4A 1HWWA 5FGSA 2GTWB 4HK3N 1PZSA 3MV9E 2FL5A 4M5YL 4BSWB 3EYOB 4H8VA 3UZEC 4CA4A 4UA3A 1G9MC 1Z6JT 4QRRA 1OCZB 3U7WH 4ODUB 2X1QA 3JWOL 3NFNA 2B3IA 2VDRH 2WXPA 4LHJB 5I1AA 3WD5H 1R3IH 1IT9L 4CGOA 5DTFB 1EUTA 1H0DA 4IDJH 2YAEA 3QXAA 3RFZB 4F9LA 1ZHLB 3ZHNA 5I0ZA 4HKBB 3GSOB 1SYSB 4L9LA 3ULUE 2DKUA 3O2DL 1ZS8B 5EHFA 3CHOA 2GFBB 3LH8A 4NLAA 5FCSH 2WTRA 4PRBA 1K5NA 1S46A 5CWSA 3W38A 2QHLA 2YEQA 3V6BR 2WBJA 1JPST 1Y7VA 2MQ3A 3IDGB 2VDKL 4IBLT 5EULV 4FXGB 5DI8A 5K8MA 1MAJA 1KUVA 2AEQH 2HWZH 5A7EA 4YBQD 4WTZG 2X2IA 1RZ7L 4UIKH 1FZOB 2HVKA 2H3KA 2FATL 2NY6D 2X40A 1ZV2A 5KYWB 2CXGA 1FCCA 2PIYA 2A5UA 1SHMA 5EA0L 4GW1B 3VI4F 1QKZH 3BJ91 2XXCB 3FTUA 4HFUL 4OAWA 4MD4A 4X6CB 3C60D 3TYGL 5BPPA 1XAUA 3S7GA 4I1PA 4FD7A 5B1BB 2OMUA 1DFBL 4Y1AB 2WB1A 3EF4A 4ONOA 3S5LG 5KBKA 1GS6X 1MJBA 3MXVH 2A7BA 4HS8H 4LP8A 1QEXA 4RMUA 5FK9B 2OMYA 4Q74A 4HC1H 5D2LE 4JJ5A 4FD6A 3QDME 2CLZB 1FWXA 1C16B 3T4YA 2KYIA 1IBGH 1AHKA 4ZSOA 3DDDA 2FWSA 3U2IA 5FO8B 4YNYB 5JUEL 3TEXA 2EDRA 1LEIA 1PLGH 5IREA 5ID0B 4IKNA 1VACA 4DP5X 1R3LA 2G2RB 1M9SA 5KUKA 2J43A 3HI1B 1BMGA 3R4RA 4AJYV 5IROC 4B14A 1GHEA 5IJKC 2EKSA 1D5MB 1G7PB 1Q0XH 4RAUA 4AVAA 2NT0A 1BCIA 2D2CC 4ZFOL 5GJTH 3RX9A 1CL7H 1MK4A 1U6AL 2V2WB 2F9BT 1T4WA 2GJ6B 5K39A 1OAKL 3O45A 4M02A 4LSSH 3SJVB 2O30A 3FB5A 3CZLA 2DEWX 4RGNE 3IF1B 1NBZA 1OK8A 4IRSB 4K73A 4WWPA 5G5DA 3V4VL 3VXSD 4RA0C 2EE9A 4X6DB 4DJLA 2WQRA 4JKLA 4C2XA 1N2RA 3DX4A 4FLHA 4HA1A 4NUQA 4Z5RB 3L2LA 5AZEL 4OH2A 2M83A 2UXVA 4CYOA 4M3KB 2ZOKA 4P2OB 3PWPE 3IAQA 1DQQB 5DJZB 5BMFL 1DEDA 4XMZA 1QR1A 1INDL 3SDXF 1WCQA 3TPKA 2HJFB 3UTTA 3QEQE 1S7UA 2UY6A 4XCNA 4APQB 1HEHC 5F3FA 1KZFA 3H8FA 1SQHA 5K33A 2JCCF 2OTUB 3LS5H 3MUHL 3D85B 4PPTA 2PYFB 1PU0A 1CD8A 5F9OL 1I9RH 4KDVA 1C08B 2CHXA 4UOW1 3RFZC 5C07D 5F1NA 1FP5A 4R5VA 4JYWA 4AVBA 3G6JB 3H42L 2PJ0A 4M6NL 3P9LA 1N12A 4FTVA 4DPCX 3BWUF 2L7EA 4JB9H 4XPAH 3WGUB 4EAEA 4Z65A 2VLRB 4GRWH 3GMQB 2CGRL 3L5XL 3WI9A 1KJ3L 2FS5A 3MMEA 1YY8A 3N40F 4BELD 2CNSA 4EBQL 1HJCA 3KASA 5AUMA 4FXGC 3LKSA 5F9WB 1BW8A 1JGVL 1WE5A 4KJPC 2CK0L 3F64A 3LKOB 5LBSL 4H25A 5HHPA 5F0MB 3GMLA 4HGKC 2X4SA 2ZUXA 1RP9A 5TH2B 2YWZA 2ROYA 3KPRE 2WUCH 3I3DA 2B59B 3MTXA 4NN5B 4LNRB 1HOEA 3HW7A 4ZO6A 4W9KC 4A55A 4Z3HA 2EICA 2JB6A 2K45A 3WFDL 2EEAA 1MJ8L 4XZUA 1R0AH 1HILB 2FGZA 5LXGL 1B4LA 3VB9A 4GS4A 1GHFL 1L9OA 2DQUL 3BE1L 4Z7WB 3LRLA 1KWKA 2NRDA 5CZKA 3GLEA 1HEZB 4CN1A 2IFGA 5LYIA 1M1XB 4KHXH 4OIIL 4OC5A 1KPUB 2YXMA 4FZEH 1UZ8B 4UQDA 1R5IA 2PWGA 1JGUH 3D2UB 1MJUL 3VGFA 1HINH 1WZ1H 2MHAB 3GKWH 3MLXL 5BRZA 1AGCB 2F1EA 3PUUA 3PP4L 3OKLA 5DLML 1U95B 3UROR 1QRKA 6PCYA 3P2FA 2ZP0T 3MGTB 4UQ2A 4IRSC 4MTMA 5KSBA 5GRJL 5E9DA 3TH3T 1YMEA 4PJ7B 1TEGA 4JFOB 1BBJA 3IXTA 3TBVB 2XQYG 5JLZB 2CO2A 1VFOA 3HAEB 4U1LA 4P2OC 4N5EC 5FKAB 4UOZA 4LVHC 4L1HA 1CFSA 1H15B 3R7RA 4I3RL 4NRZB 1XEDA 4RZCA 3K1KC 1VF5C 4APQC 3GUTA 5A6MA 4PJHE 4UT7H 2BERA 3HBPA 3S8WA 1DVFB 2NY4B 3VWKA 5C0FB 2IAAC 1IGTA 2X4QB 4FQJH 1O5DT 3M1OA 3ZSSA 3T2LA 4WFEE 3QZWB 2HAZA 3EO9L 4PWKA 4XP4L 5K8PA 1UACH 1T1ZB 3AREB 3OR7A 5GRYA 4IK2A 4AG4L 3PY9A 3H4FA 3JTSB 4PV8B 3TESA 5KS9B 3VG9C 4MJIE 1T1XB 3DOSA 3DJTA 2ARJB 2ESVE 4FD4A 5JW3L 2XNAA 1MUJA 4HFWB 1MEXH 3QNFA 4UDUB 4JKPL 4W6XB 5TDOB 2WLNA 3T9WA 5F9WC 4BYHA 2DKSA 4JPWH 4NKDA 1QSEB 4F7MA 4QXGH 4FQXA 4U1KB 2Z93B 4XN8A 4FQ1L 3IPBA 3OG6B 2PP8A 1UOLA 4XPHH 3X1GA 1I8AA 4YQXH 3SCMB 4E9YA 3TTHA 2A77L 4ZG1A 4QVTA 2CKNA 2YZ8A 4F9VA 2RFXA 4NQEA 4NWTL 4NN5C 2XKUA 5EUOB 4PJ5A 3TO6A 3U25A 5HYEA 5ECJE 4L0YA 1UJ3B 4DP0X 5BOJA 3UJJH 1MLBB 2ZUUA 2WQSA 3D39E 4G9FA 1QBML 3LZQA 1RIVH 1LO4L 4EQ3A 2A6JA 2VLKB 1IKNA 3BIKB 5EU3A 2OP4H 4Z0BH 2E46A 3UTSD 4F57H 2A4ZA 3ABZA 3CVIH 3DETD 3IDIA 5CHNA 4LCUA 4KK9D 3UO8B 4NI3A 3WTUA 1GA2A 4B41A 1EAPB 1E5UI 1M42A 1UUNA 1ZSDB 4HK3J 4PUBL 4RX4A 3FB6A 1OE3A 4L5FL 3SOBH 3OSKA 3MROB 5FHBH 1DE4B 1DQTA 2X70A 1HIML 4RBPK 1WA0X 2ZKHL 4GKZB 2VISA 2BNUA 2XWRA 3BUTA 4ORGB 1MCKA 2W60B 3AQYA 1BLLE 3WL9A 4JLRB 3ZY7A 1JJUA 5DO2C 3WLBA 4MDIB 3SKUD 4CAVA 1IGJA 4NUGL 2E9IA 1ACYL 4JFFA 2WLZA 3REVA 4ZNEE 3C6SB 3SXOA 2ZX5A 2WIMA 5HYQA 5T3XL 3GSNL 3RJDA 1HFUA 1NM9A 2X10A 1FNEB 3S6FA 3UGXA 1SYVA 4QDGA 2RJMA 3F65A 3L5HA 3LHPL 4L4VE 3WJMB 5D1XB 1BPLB 1TZAA 2X9WA 1CX8A 2VXKA 3WFCH 4Q9QL 5DJ0B 1CPSA 3FYNA 4XAKE 5HYIA 3U82B 1DVFC 2NY4C 4K9EC 4MKMA 4ONHB 1J5OH 3AADB 1WEJH 4X9YA 3UYPA 3I2CL 2ZEDA 3QDJB 3AQZA 5AD0B 1SMAA 1PEZA 3ZKXB 4HK0B 4MYWB 1A4BA 1X5JA 3MBXH 3AREC 4OZIB 3CSPA 1AE6L 4AH2A 4Z7QB 4RVBA 5G55A 3P30L 4HU8A 1U8OB 3LRKA 3CFDA 1YEKH 2YRPA 1EPFA 4OJEH 3TTYA 2CO7B 2BSTB 1FL5B 1KELL 4TPRH 3UEZA 2ZF8A 4WCYH 3VI3E 1VIXA 4HZLA 2EYTB 1LOKA 1JGDB 2X4PA 1AKJA 3KM2A 4WI7A 1ZA3B 4HZAA 3ZDYE 15C8L 1S7FA 1LD9B 3SCMC 4WUKL 3KDMB 1SDDB 1JQGA 1DJGA 5DJCB 4KAQH 2P6EA 1D5ZB 4HSAC 1OW0C 4PRNA 4S0TD 2YD3A 1UJ3C 1IC5H 1ZVSB 3QJXA 3WYRA 2WLIB 4TS6A 3RP1A 2YHGA 4Q58C 1IJ9A 5J1SC 3IGLA 5HHOD 2IG2L 4P5MA 4FX5A 1E2ZA 1QWUA 4QNPF 1GGCH 2YD8A 4YLQT 3V79C 4G11A 3F8UB 3V6ZB 1TVBB 3DHMA 1I3VA 2VDOL 4E9LA 1D6VH 1JWUA 4HPHA 4Y9EA 2HTLD 5CP3H 4B3EA 5KSVA 5K9KA 3TBWB 3JTTB 3TV3H 3CSYA 5KEZA 2Y7SA 4NDMB 4WFHD 1DE4C 5CEXA 2F1BA 2W0FA 4A2DA 1OSZB 2A74A 3BCFA 1BREA 1JZ8A 5JDSA 2DPKA 1JPSL 3VXUB 1N5AB 4PJCE 4A67A 1KJ2B 4U1GB 3RL1A 3UTPD 1GTNA 4ONFL 3UG3A 1G7LA 1G7MB 1XGPB 1C5DB 5KVGL 3QDGE 1MI5E 5T1JA 1GCFA 2UZXA 3W56A 4C56E 3SBRA 3RL2B 3UAEA 2YPVL 2R1XB 2HFEB 4AM0A 4YHLL 4IEFA 1N6QH 3KVPA 5CN2A 3A47A 5D1XC 4J4PD 3HG2A 4YE4L 1AHWB 3CFCL 4GRLA 3I3GA 1AG0A 4UZSA 4UBDD 3BJ8A 1ZRUA 4NHCH 3VA6A 1SOQA 4M62L 1JPGB 5I24A 4PJAB 4OC2A 2DJ4A 2Y5EA 5AOLA 3NCFB 4HUKB 1Z8WA 2J56A 1QSFA 2VMFA 3DX8A 4TSCL 5DQ9A 4XX5A 5A2JH 1BOGA 3X11A 1P7QA 3UIYA 3ZKXC 5DHYB 1J18A 4HAFA 1M7XA 4P46A 2DM7A 4Z7AA 3HE7B 2NY7L 4R4NC 3IDYB 3KMDA 5AG4A 1NUFA 4HUUB 5CJOL 3BUPA 4GW4B 2EO8A 1FNAA 2NSMA 3QYMA 1XMWA 1YNTF 4M3JA 1OTSD 1N4XH 1OGAA 3S35L 3CCHB 2PR4H 5AAWC 1T20B 2NUTA 2UV3A 2YPLB 5DUMH 4FFVC 4AQ1B 5J11B 3DSNB 5E94A 3VXRE 3RX8A 4LSDA 3MRPA 4UZGA 3TBSB 1HE8A 2IPKA 1Q9KA 3C5ZD 3U6XA 4CMMB 4G6JL 5J1QA 5LGJA 1J1OL 2VN4A 4QAWA 1KMGA 3WIIL 4M3SA 1MHCB 5IBTH 1EANA 3D87B 3HKFA 5GGUB 1CXIA 5ICXB 2PCFB 1YEHL 3QW9A 2AK4B 35C8L 1H9VA 1RZJL 3EDJA 3G9VA 5FUZL 4R4BA 5I73B 4J3SA 2VXQL 2ZW5A 1ID5I 3MLTA 4GY4A 4BGLA 2BIIA 1T7XA 1R43A 4EO5A 5DR5L 5FUCE 3BKJH 4PCYA 4PY8I 2EH8H 1VDGA 2I79A 1G9HA 4DQOH 4X4XA 5ENWA 5E8PB 5GCNA 3HCVA 5TF1H 3VXNA 3SQOH 2BY3A 4PJHF 2C1CA 5HHNB 4G42B 2WK2A 4KQ4H 3EYVB 5TJWK 1U8IA 4ES9A 2F8VA 1G4RA 4R83A 3A4DA 5CEZH 1PU9A 3IVKB 2LFGA 1FH5L 1Z66A 2ICWJ 4NEHB 1H8LA 5HGGS 3F2LA 4MNHA 1GVIA 3O3AB 3IWGA 1NWOA 5FHAL 3BESR 4U1GC 3PE9A 1S7TA 5CUSH 3B9DA 3OLEA 3S4SB 1G87A 1V0CA 2BJMH 3QRGH 2PJ5A 1GS8A 1S7VB 5KAQF 4JY5H 3BHBA 4H88L 4PJ9B 2WN2A 2DH2A 1J5IA 4KTGA 1X5XA 3LKNA 4MHNA 1FZMA 5CIPA 3FFCD 3QJSB 1LHZA 2IAMA 1OM9A 4PJFE 4BFGA 5C86A 4E68A 4QUSA 1YN6A 3VFVA 1RUQL 1P5UC 2H3NB 1CT8B 1VEMA 1CL7I 1AHWC 1OO2A 4YGVB 1C12A 5D71L 4BQ6A 4UWIA 4JRXA 1I3RA 5DEZA 3QJHB 1AMXA 2J6EL 2DQIH 2F7PA 4LSQL 5C09D 3U9PL 3FU9A 4JQXA 3FMGL 3ARQA 1N8ZA 4U6VH 4YDLB 1QPKA 5HPOA 1JFQH 4JRLA 1K2DB 1FV1A 3R18A 3U0WH 1TLMA 4PCKA 5ALBL 5FIEA 4X4MA 3HE7C 2K7PA 3IDYC 3VGGA 3N0AA 4DESA 3E7JA 2GK0A 1CF8L 1ET7A 2IV8A 1T89A 5KSAD 3C9NB 1NDTA 3WOVA 4F8PA 4ZFFA 2WXOA 1CICA 3MNZB 4FFTA 4HPOL 4AQ1C 5J11C 1CYXA 5F1SA 4BCZA 1CLZH 1UWGL 2EUIA 1DTDA 4Z7OE 1AY1L 1XIWC 2DQCL 3EGXA 1M3IA 4HWUA 5EBVA 2R1WB 5F1KC 1JTPA 5H2BA 3F7QA 2AEOA 4MXWH 4B5PA 3QPQD 1JNLL 2CXAA 3B3SA 4Y8AA 2IO5A 1RIHL 1LO2H 1QNZL 3FN0L 2PYEA 4FYRA 2H8PB 3ARDB 3TV8A 4AGOA 3SDCB 4WKXA 2P7TA 1TENA 4V1DA 1Q9OB 5F7YC 5AVWB 2MCMA 5AVYB 4OGYL 3VYOA 3B5HA 4BE6A 2VLME 3VB8A 5FOBB 4M8UA 5BJTA 1XSOA 2YJLA 3EYSL 3GMOA 4IJ3B 5EN3A 1Q9LA 4A7UA 3ULVE 4XPDB 3AVEA 4ZYKA 1IICA 3OJVC 2Z11A 5CCKH 3ARBD 4R7DA 3V0GA 1KJ2L 5PCYA 5KSBF 3BIAX 5I23A 2QL1A 3QUXB 5E23A 4W9JC 1D7DA 5E2UH 4I4WB 3HB3D 4ZUSA 3HHSA 4EFDA 2EK8A 1KV3A 1NCDL 3BVNB 5CINH 1CBXA 1AGEA 3AAZB 3FBKA 2A9ML 3MV9D 3LEVL 5IJVA 3E0GA 4U2ZA 1M1DA 2QADB 4L4TE 4L9LB 2XYBA 3FO2B 2R0ZL 1LXMA 2IALA 1RLWA 3QIWB 2V5YA 4YN3A 3RBSA 5BQ7A 1RAMA 4M93B 3FMCA 1G6VK 2OTWA 3KLAA 4PRBB 3HUVA 2LW3A 1YLEA 3JYCA 4PJ9C 1JIBA 5HDBB 2WBJB 2G30A 5E6IA 3MRNA 3VXQB 2WNXA 1F4YH 1CR9H 2VZ1A 5H4YA 3X17A 4C4KO 2J8RA 2G3TA 2PP7A 1YUHA 3QQDB 5GGQL 3S98A 4AEIL 5HYSB 3Q6GL 3VAEA 5SV3A 4EN2A 2VMDA 1L9SA 1N6UA 4NO0A 2Q3AA 2FEEL 2BY1A 4LO9A 3GTTA 4MBOA 4Y4HD 4G6KH 1JF5A 4H6ZA 1E6OH 3Q44A 2IDSA 2IWEA 3GMMB 2HSIA 1YEGH 4S1SL 4PLOB 2OMUB 1GC1C 3PABA 2TAAA 4A6YH 2NY5L 2BP0B 4OCYH 3BQUA 5HGBA 4C83B 4YDLC 1LYQA 2R39A 3GGWA 2FJFB 4NQDE 4GXHA 4B9JA 2Q0YA 3CK0H 4N8CH 1GOHA 4PR5B 3KXFA 7PAZA 3WE6B 2BNRB 3L54A 4HKZB 3Q8AA 1SJXA 5J4MA 4OJFL 1JN6B 4J3OD 3FTGB 3VXTB 4P2RE 4A2HA 2D0FA 2DQFA 3GBDA 4LLYA 1EHAA 4JMXA 3N50A 3CDZA 4MJ6A 1A1OA 2V3FA 1YN7B 3V10A 4HEPA 3V6OC 4D9LL 4Z7NE 2UYLA 3BUQA 5IOKA 1G7HB 1TF8A 3GSRA 1MVFA 4MHHI 3QDMD 4RAUB 2C27A 5TQ2H 4JEGB 4JJHA 3UCRA 3CTTA 4X7DC 5D6DA 3T8WA 4E9RA 5E4IA 2IBZY 3FB5B 4EVYA 2VUKA 4DIXA 5I28A 3L1OL 1A6WL 4L0PB 3SDCC 3OAZH 4Q9RL 5JIKA 4DZ8A 2HRLA 4NKIH 4OLYL 3VD4A 4JVUA 2PMZA 3L3DB 5EORL 1PZ3A 4F33A 1X9UA 5FO2A 2AV7A 4FBEA 2Q87A 3GMNB 2ZOKB 1NFDB 3ZUNC 5L0QB 3GXFA 4IJ3C 1L9TA 2VNCA 1P5VB 2AAVA 4XPDC 2Z7UA 1AJ7H 1FNSL 4RGND 2KKQA 3GT6A 5L4MA 4XCNB 5E5LA 5ANMA 1L9MA 3EHBD 4FLOA 4R7NA 1CFBA 4AI7A 4D8OA 3TJPA 3QUXC 4NPYA 4KS9A 3NSCA 1S9YB 1WWCA 5D2NE 2R27A 4JR9H 4XBGA 2XRAL 5CLXA 5D1ZI 1GKEA 3SD5A 1ZPUA 2Z31A 3PWLB 5F1NB 4Q6KA 4TLUA 3U9UB 5LNGA 4ZY0A 4OLWL 4L9LC 3P9LB 4ZS6D 2A6IA 4NO2A 2HFFB 1V8HA 3ZE0F 4CADA 3QIWC 3RWGA 4O02A 4FJ6A 4M93C 1NUNB 1YAZA 5IVNA 1YY8B 2V4LA 2BOBB 3UGUA 2VSDA 5EU5B 4PB0L 2WBJC 4YWGL 4KJQD 5CEZD 3OAZK 1NEZB 4MQXC 2Z0ZA 4H5SB 1AMYA 3BAJA 4I1RA 2VH5L 4ZX3A 1GGBH 1FQ9C 5HHPB 3PB8X 4QI3A 4UINL 2MCG1 3H3PH 1S7RB 1JTOA 1R6VA 1W16A 3SKJL 5I1LA 4EWTA 1JPTH 5HHVH 3SPIA 1NBYA 4S2SA 2VR3A 1RUAL 3E3QC 5DYOA 4TNVF 5EWIH 5AWNH 3PFEA 3K4ZA 3F00A 4QRRD 5G22A 1C8PA 4IK7A 3VNZA 2AVFA 5AVSB 2BO9A 5AYTA 3BFOA 3BKML 3TZVB 2VXVL 2N01B 2YBGA 2YD6A 1QFWI 2XZQL 5DJYA 3MODL 5CAYB 2UWEF 4F58L 5D5MB 1HHIA 3HEIB 5T3ZL 1YNKH 5EC2B 5EEVA 2G0BA 4LLQB 1LNUB 4L1TA 4WWKA 2XHNA 3TH2T 3NCYS 5L4JA 5DK3A 3QPXH 3KPRD 4YZFF 3NH7H 3NIDE 1KDIA 5E99L 3WLWD 3HUJA 5LKNA 3QNZA 3T77B 1QSMA 3MNMA 4PVBA 4WKZA 2GYSA 5H94A 4DK3A 4YSCA 1Z8TA 2VDLB 1R5IB 3O11A 5D96B 3OGCA 3VWJB 2Y0MA 1JUFA 3O3EA 3WS3B 2E7CA 4MVBD 2CJUL 4H26A 5CXPA 4EI5A 3DK2A 4P4KA 4PJ8A 2EIZB 4OU3A 3EGDA 5F71A 3NSXA 5CJ8A 2ZAGA 4JQIL 4K5MA 5L7XL 2GJPA 3FPXA 4B3VA 1HSAA 3EJQA 4Z9KB 3HI5H 5LCVA 2BC4A 3N1PC 2P48B 2WLYA 5ACMA 4YLCA 5K1NA 5E9DB 4LRIC 4Z78A 3UZVA 2RQEA 1GY1A 2Z8VC 4ZTOL 3HZKA 1VIWA 3ISZA 5JQ6H 2B5IB 5FWRA 3RWDA 4YHMH 3RQ3A 2W8CA 4AYGA 1NOAA 3VRJB 3CXHK 1RK7A 4U1LB 4IMLB 1Z2LA 5L0QC 3K8LA 1SFHA 5F93C 4NFRA 2WMPB 4XNYL 1AIFA 1I8MB 3PHAA 1R57A 3POHA 5HHME 2N3JA 2ROXA 4NFBA 1FYTB 1J0YA 3RTQD 4NFCA 4N2EA 3WFEL 4J3GA 3VWKB 1S5HA 1I8IB 3SXNA 2XACC 3TTSA 2XBTA 1IYLA 1RVFL 2IQ9L 1XQ4A 4O00A 1CGSL 4IF5A 4DGVL 3OR7B 2FGWL 4PBDA 1BLNB 3O6LL 3L4XA 3QQXA 1MFEH 1S78C 2Y06L 4DF9A 2XA8H 3DOSB 4M7JL 2ADFL 1DJIA 3I75A 3NCYP 5KBPA 4N6RA 1CD0A 2P6FA 2FK9A 2JCWA 3PHSA 3F8KA 4KRLB 4POZC 2HG0A 1WK4A 3GB7B 5I82A 2R0KL 1P7KB 2YA2A 3DWTA 5D7IE 3PFUA 4F7MB 4ZMYA 3ISYA 1S5KA 1YREA 4GI6A 2CCLA 1OTUC 3FJTA 3L9RB 4P9HH 1GAFL 1XH3A 2IXQA 3I02B 1OD7A 5IUSA 4MFKA 3RJOA 5EZJA 5I1GH 1CFVH 3BX7C 3G08B 3MRJA 3UTTD 1I1YB 3MAWA 4NQEB 1ORQB 4NNYA 1BVNT 1ZHNA 1A3ZA 2OMBA 3TZVC 1L4IA 5E1QA 3GXNA 4FABH 3U0PB 5JOEA 2HKHL 4OQTL 2E74C 4L37A 2BVPB 3QQ4A 5LXVA 2BY0A 3SPVA 2YAMA 3QFDA 5KJ4A 4FTVD 5CHNB 1JHTA 1RK0A 1U8CB 1VFBB 4LCUB 4OCWH 3GBNH 3MRCA 3DX7B 1QA9B 1R47A 1BEYL 5JHAA 3WDIA 1IOIA 5TPWH 3O2VH 5LUMA 4MAYA 5AL0A 4HLZH 5JHMA 4XTRD 5DYFA 4EVNB 4Z23A 5D96C 3BKCH 3OVUB 3VWJC 1DSWA 5HJBA 3ZTDC 3GSVB 5GXBB 3FU7A 2VR9A 3K81A 3L6FB 3WIHA 2WLLA 2UY7A 1ZMYA 4HH9A 1Z32X 2VISB 2IV9A 1BOYA 4XVJH 1UENA 3FSVA 5D7EA 5I19L 2PQ8A 1U8HB 4PN6A 4I3SL 1BMZA 3WLBB 1CK0L 2Z91B 3SGEI 3PDOB 1OP3H 5K9OA 1U91B 3S37X 4OFQA 2CGYA 1AP2A 3REVB 1NJ9A 5FYJH 4TNVK 4BKLB 2B5IC 1PYTB 1YUKB 3L3OB 2EDQA 3TO4B 4M7KH 1NFIB 1TG8A 2DWEB 1CGXA 3K91A 1HL8A 3MV7B 2AEIT 3B3CA 1S7WB 1GYTA 3KH3A 1AQ8A 4G8FA 4Y4FA 2QPUA 1MNNA 2P5WA 4HCIA 4PS4H 1EGJA 4XP5H 5DS1A 4AZ8B 3MRKA 2R9HD 4MI4A 5GGRA 3ECBA 5LGHL 3H9HB 3KWTA 5K69A 2GEEA 4IHBA 3VWKC 2WUBL 4LCWE 1VGKB 3GMRB 5LDUA 1NE9A 3MLUH 4G59C 5F9JB 3WT4A 5EF3A 3QHFH 4JANB 4WFFE 3BZFA 3SGJC 2FLRT 4Y9FA 1KB9J 4AH2B 1BJMA 4G43A 1EFQA 2WZ0A 2KH2B 2ZG3A 4XAKD 2YNDA 3II1A 2RQ8A 1QLEH 4G8EA 3ML9A 4EI6A 1DBKH 1G7JB 2RCSL 2WYHA 4OZHA 2VR4A 3FYIB 1EAQA 1OP3K 4D3CH 2IDCA 2J8NA 4OB5L 3VM5A 3L45A 3UTZA 4GSDL 2YK1L 3CC5B 4PJIE 5E2WL 5AVVB 2Q8BL 2B2XH 2Q04A 4FLRA 3UBXI 1VHEA 3BXNA 3E38A 4L8BA 4ACPA 2EDNA 4A7VA 3HN5A 1IKOP 2K7QA 4X8CA 1G7IA 3PRTA 4ODTL 1N70A 1UOVA 4HUNB 4PRNB 3U4EA 3OZLA 1F2XK 4KOTA 4FG6C 3BIBX 2DEAA 3FHEA 3CFUA 2EJ1A 1E9QA 3OD3A 2BY2A 1IM9D 3MKGA 3NAAL 2E4TA 5FAAA 4M6HA 4DGYL 4NQXA 3MA7A 1IEHA 3FQNA 1VEOA 3HRZA 4ICXA 1OARH 4LMQI 4UZUA 3DBXA 5AG9A 4KGJA 1PCAA 4JG1L 1JWUB 1TZHA 1KTDB 2ZSVA 5K9KB 2VN6A 5E6UB 1XF3A 1DDTA 5CSZB 3SDDA 1SJEB 4ZI6A 3PGFL 1QRNA 1A7PH 3CWGA 4W9HC 1RJLA 4HUCA 4PGZA 2XTJE 2YUZA 2X88A 4FQXD 5JDSB 1RKRA 1UADC 1TETH 1U3HD 3P3RA 3MCKA 1KXVA 4LEEA 5CSBA 3F6JA 5E24E 1IX2A 3IDMA 4G6FD 1RFDH 1NGZA 3J8F7 1RULH 1CURA 3MRIA 3N43F 1E30A 1MG3C 2Q1EA 4PJ5D 3FB7A 5I1HH 4YHKL 2K1MA 4WHTB 3L3OC 3TO4C 1QSTA 3GHBL 2VWEE 2AFMA 1EBPA 2D03L 5T5FA 4UI2A 3P3UA 2B1HL 3IFNH 2FE0A 5F6IB 1L5GA 1XGZA 2EIDA 3QDGD 5CMAA 1HYRC 1MI5D 2W88A 4X5QA 4E5XA 1CDCA 3A6CL 1NGPH 4TNGA 1UWXK 4FQLH 5FKPA 1BMWA 3OKDA 4JKMA 4RX4D 1W8OA 4EN3A 4GG6A 2VAJA 5DZNA 4JKKA 2NUPB 3V0DA 5L2KD 3BDXA 3FO0H 3OB8A 4KKLC 1MCOL 4DWHA 4PMEA 4KJYA 1KXTA 3RUGB 5CIPH 3O8XA 2C9SA 3LNIA 3NIDF 2UXFA 5EBMB 2IOOA 4XNAA 1I9JH 2ZT9C 1ZLWH 3V5KB 1Q38A 1LO3H 3CFIC 1ODUA 3BVXA 3MRBA 4WI3A 1AGDA 2V3DA 1X12A 1QUNB 1KJVB 2UVEA 3NCCB 1E0OB 4JFPA 4QRPE 4ODVL 4R96B 5DC9B 1EXUB 4AYSA 1UQSB 4WU5B 4JFXA 5HYFA 1CVSC 3Q2LA 3MLYL 5DK0A 2Q7YA 4J1UB 4HWBH 4RI1A 3QEGH 4PXBA 5T33L 3RZCD 2PW2A 2JTYA 3FQXB 1TKJA 1IKFL 3VGDA 5GGRY 1FVDB 3VXRD 2PJ1A 3S36L 4JFDE 4R4BB 3PJLA 2CUAA 2HMID 4ADIA 4BFJA 1QX1A 1H3PL 2EYRB 4B9CA 1FORL 1BA9A 4UCNA 1HHGA 1H3GA 4PCSA 1TKFA 4UQBA 4X9GA 1IE4A 1M71B 5F88A 3T0ED 5I66A 3LSOB 2E27H 3EJYC 2DH3A 3JQOB 3LACA 2LTQB 4XPBL 5BO1H 1CBVL 1Z9LA 4YXHL 4RGOH 1YDPA 3TX4A 5DD5L 4U1NB 1J11A 2A6DA 3N3EA 1JP5A 5CLTA 2W07B 2J12B 4I1NB 5ITFA 3QA3A 3RVXD 5E2JA 1NMAL 4DEUA 4LPUA 4AYFB 3MFGB 3Q8CA 4R26H 1I3GH 4MNQE 3KLQA 2D73A 2YFOA 2Y7QA 3UJTL 4XRCA 1UATA 3T2PA 3B7YA 4TUOA 1QYGH 1N71A 3QUKA 4NWUL 2ZPAA 2Z10A 3HN8A 4AQ8A 3GTVA 5G4NA 4XVSL 5GZND 4YFJA 3HIZA 4NQCB 1HOCB 3I6KB 3TT2A 3KBPA 5E7FA 4S1QH 3RG1C 3TBBA 1ZAGA 2A73A 4KORA 3KNBA 3DVFA 2E7MA 4F1SA 4P59L 1MAMH 1ZDQA 4P4FA 1RJZA 2HRHA 2X2JA 4LU5L 3PB7X 4HETA 2B9BA 4AK2A 5CILL 2Q7SA 2O6DA 5F6IC 4WWVA 2VC2B 3QXDA 3MBWA 5KZCD 1KIRA 1I3RB 1T0MB 5KW9H 2JB5L 5EUKA 2ZPKH 3DTXB 4WV1A 3GRWL 3VFNA 5FYJD 5HHQA 4ZXBB 2P45B 2WIIA 1OBRA 4B9YA 5KOVC 5HI5D 4ZPTB 3ZE1E 2BOAA 2DQDH 1BP3B 1L7TH 4XP9H 2B4DA 1FV1B 1U8MA 5DQDH 3W82A 3EOBB 5EO1A 5DA4A 3T0XA 3D25A 5HTSA 2OJZH 3I6GB 5HGAB 2X7BA 4YSPA 3AB0B 3BP7B 1G5AA 4QGYA 1PIGA 3PWPA 5T1LA 4TNWK 5FM5O 1AAJA 5EZLB 3IDXL 3QEHB 2Q44A 1MFCL 1LANA 3IDNA 4GXVH 3EGXB 2CPCA 5C8JB 1XEUA 1O6TA 3QYNA 4PJBE 2OKMA 2O5ZL 4FQIH 5FWQA 2YXVA 2P5PA 3QRFM 2O5NA 1XH0A 2OZNA 4GP5B 3X1NA 3I84A 3KPQB 2PYEB 3N1MC 2OMTB 43C9A 2VDMB 4L89A 4GRLD 4YBQC 5JW5A 3AT8A 5KYNA 4QYOA 3NRQA 4QMEA 3QJTB 4YSSA 3N44B 3TOPA 1PG7X 4HD9A 4ATWA 1QSFD 3VW3H 2Z3OA 4QPEA 4R3LA 2YEZA 1NSLA 1NC4A 2A4EA 4P46D 1O9WA 1C1EH 1P9MC 2CH8A 3WS6C 4H89A 1XD1A 2KDYA 2XG5B 4GINA 5ISVA 1SLXA 2A3TA 4R7DB 1OGAD 5E4OA 4YC2B 4UTAA 4JUTA 3D0LA 4YLBA 3HHSB 4XBMA 4Z7UB 2Q6WA 1URZA 3MRLA 4ZOBA 2ODIA 1AGEB 2ARWA 2PVVA 1QBLL 3VCLA 2FX7L 2G3XA 4B9GA 4EDXA 3QCUL 3C08L 4L8CA 2F61A 3D9AH 5DD6A 1CFQA 3CFMA 4AQAB 4AYDC 1BPNA 2IALB 1ADQL 4PPZA 5BQ7B 2ATPA 3LMSA 1SXCA 3GBMH 1YPZB 1AKPA 2EE2A 2BW5A 1BZ7A 4M8QA 4XCEA 5F46A 2WNKA 5IMMB 3VU1A 2QQKL 1YEJH 1RERA 3ILEA 4OLXH 2ID5A 1K6QL 3L3JA 5JW4N 3I9GL 2HKFH 1YUHB 2NY1D 4Y2OB 4YSOA 1TJIH 4X6FB 2DY2A 2WPXA 4OKVA 2IH1A 3A24A 2V8MA 5I1IH 1IC1A 1B88A 5D9SB 2CRZA 1X4XA 4O02H 1NCUA 3ABMB 5KVDL 2YAQA 3PABB 4HGWA 3VJ6A 2Q4ZA 3IS0X 4ZXBC 1S3KL 4OZGE 1EHLL 1UFGA 1XSIA 5C92A 3J7HA 3S3DB 3GGWB 3IJ8A 2XKSA 4AX3A 5CLYA 1QTYT 3KXFB 4DKAA 1GPOL 2O6PA 2XBDA 3QCTL 1TKHA 1W9XA 6TAAA 3G7TA 4LOEA 3AB0C 2B0SH 3GS0A 3BZ4B 1CICC 4J3BA 1ZEAH 3TA3B 4V2CB 2DTMH 4JREB 4MJ6B 1B9ZA 3FCGA 1UB5A 2GABA 5ABAA 5IFJB 2CKBA 4F7PB 1S60A 2BVYA 2ZKYA 3SBPA 3PQYE 4NQDD 4P2QE 2BS9A 5F0PB 5HVHB 3P4NA 3QQ3A 3RGVA 1XR9B 2D4DA 2Q4YA 3W9DA 4LEXL 1KJMB 1EEZA 4PWFA 4L3EA 4P2RD 5C6TL 2V9QA 4D7PA 2CBTA 3UC0L 5IHZB 1BM3L 4DZ8B 1BG9A 1N0LB 1WG3A 2EADA 3MBEB 5F7BA 1IIKA 4M48H 2A83B 1HHJA 2YD2A 4PRPE 4X50A 2JJVA 2ESVA 3MACH 3NYKA 1UZ6E 3FQTA 4K8RH 1J8RA 5HXMA 2VXUL 2ZEMA 5BS0E 3PV6A 3ARSA 3IYLW 4S11A 5FPIA 4BKSC 1IAOB 1QSZA 2X2YA 4HUXA 3HS8A 3D7PA 2B8OT 2F7VA 4JM4L 4TRPL 5JORA 5L88L 4R7NB 4YC2C 3QI9B 2HQYA 5LCVH 2XQBL 3UTSB 1RUPL 1J1PH 4NNPL 4D0BA 2R1YA 3K4AA 1R3JA 1WIOA 4HIXH 4KK8D 4NJRA 2APFA 3GKRA 4R87A 1FLRL 2FT0A 5J3HD 4ANVA 4YK4B 1RZ8A 3QIUA 3EJPA 1KCSH 2K9UA 1P0SE 4KPHL 2WO2B 2IMMA 3OAYH 5G2NA 1UA6L 5MENE 2O4HA 3HE6B 3M8OH 1EWHA 4E41D 1G1YA 2VC2L 4H2KA 1X9RA 1KLFA 1MVUA 2W5PA 4BFFA 5ACZB 2ZENA 3JVNA 2XIIA 5ISZA 1T7VA 1D9KA 1I1DA 3H9SB 3RY4A 2B58A 3BCDA 4WSGA 2PJ8A 1F11A 5I1EH 2HLFC 5AKSA 4OVUA 1DBAL 3BEVA 3FZUD 1ELMP 1A2YA 3HG0A 1CLOL 1NBYB 3HC3L 5FEBA 4GP8B 4OVVA 5CKGA 1MRCL 3ZMNA 3DDGA 4Z7VE 5L8LB 3INUH 4UV4L 1JV5A 1NGXA 4JCLA 1JGLL 1B4RA 1AQDB 1RZFL 5EMYA 4R4FH 2BMKA 4M3HA 1U30A 1KIQA 2H9GB 2R0LL 4D7BA 1O75A 5GIRA 1TZGH 3NH8A 2ENPA 5LAPA 5ICYB 4R7MA 1C5BH 3EFFA 1OAXL 3T0DA 3MYZA 4D9QD 2CA3A 4NM4H 3HNSL 1V3LA 2D7PA 1XCTB 4WFGD 3RVUC 3TA3C 4KZ0A 4L4VA 2OOTA 4JREC 3OAYK 5JOPD 3UAJD 2I60H 1OPOA 2BHYA 2JH2A 3A6OA 4WKZB 5FFLA 1LEGA 2FD6H 12E8L 1KLUA 4ZFGH 5HVHC 4XMVA 1OF2A 5E6ID 2GEQA 4YFLF 3EG9B 4IDLA 2C9RA 2WCGA 2NNXA 3VFUA 3STLA 4H26B 4L1BA 1WAAA 1KV7A 3CBJB 4P4KB 1LMKA 1MCQA 1TJHH 4LSVH 43CAB 3HKZA 4NO0D 1HSAB 2BC4B 1CYGA 4FFYA 4XNMA 4AYEC 3BDYL 3QUML 3T8VA 3UZVB 3MBEC 4XH2B 3HZKB 2QMKA 5FV1L 1JDAA 3BQUD 1NIAA 4WY7L 4LPWA 1AH1A 2OW6A 5DLLA 4NBYB 4NGQA 5JW4R 1TSHA 3JT2A 3TYFB 2ZUSA 1FL6B 4EEEA 4NUJA 1AIFB 3D4CA 3WIHH 4K3GA 2E7LC 2G2NA 3MLRL 2P24A 1F1AA 2Y1YA 4M9PA 3VI3A 2E75C 3BMWA 5JR1L 4YMPA 4MNGB 1HHHA 3QI9C 2OYLA 1P4BL 4O2EA 3TVMA 5HHOB 5DFVC 5AW7B 1ZS2A 1GZQA 2EUXA 3DETC 3LODA 1AD9A 4KK9C 3JWDH 3U30B 2YOAA 3VI4B 1G6RA 2J88L 2YXWA 1DBBL 4YK4C 5K93A 3BPOC 2YA1A 3CH1A 1U42A 4JHAH 4QJ4B 2Y3AA 5J8OA 3SI0A 3HE6C 1A0QH 2FUTA 2HVBA 1LE5A 3VSUA 2HRGA 1NAKL 4MCNA 4IGBD 2EILB 2HJLA 2QQLL 3JYBA 4P45A 1DQDH 4PJDE 5J56B 4PJBF 1OAUL 5FO9B 1E5ZA 1BIHA 4ATTA 2D0HA 1SDAB 1SF3A 3FQYA 2DL9A 1AC6A 4PW9A 3KYKH 3PBBA 1XR8B 3WKMH 1T22B 2BOCA 3IFPA 1MLCA 4MJ5B 1TTCA 4ZRGA 1UG9A 3CXQA 4Y2LA 1PY9A 4LSUH 1UT9A 5K9JH 1KIUB 4L5FE 1FNFA 1IFHH 4NIKB 4WNQA 3EBIA 3K6OA 2XEJA 5HP5A 1ZHNB 2EUWA 4PJCA 1AXTL 2N0MA 1NPNA 2FO1A 4N0UE 32C2B 4PLKD 1WPCA 4HUVA 5FF6A 3U7WL 5DJ2A 1NIEA 4X42A 3WEOA 1DHKA 3CZGA 3QJVB 3D5OF 4WWKC 2VDRL 2AI0H 4Z76A 5LLIC 4B9KC 1R3IL 1DQKA 2QJDA 3QNXA 1FFRA 2EDDA 5EC1A 3S5ZA 1IAKA 5DZJA 1Q1JH 3MOAH 4IDJL 4RWYL 4TKWA 5T3XE 5DRXB 3NACH 2WUUA 2C3HA 4BINA 1WBXB 3TT3H 3VX1A 4TSBL 4WZ9A 4XOCA 3FVLA 4MFHA 3MRQA 3FU7B 4LDCA 4H13C 2WLLB 2VM3A 3NIGE 2F18A 4X7TA 4JRYB 1KXQA 4P0DA 1HT6A 4P4KC 4R0LB 4EPSA 2OMWA 4NQQA 3KLHD 4UIBA 2EVHA 5FV2A 2WQWA 2Y2TA 2OR4A 4HIJB 3C5ZB 5EF2A 2AEQL 1J8HD 2HWZL 3H4HA 4HHAA 4UNIA 4UIKL 3IEAA 3MYJB 4YVNA 1TO5A 5DQJA 2EVFA 1QKZL 2XWZA 4DJMA 1VJSA 3KL5A 3WNIA 2CQVA 4QOKA 1IAIL 1OSEA 4RRPG 5D7LE 1YO4A 4Y4FB 3TONA 3HBGA 3MXVL 4HS8L 4TL5A 4HC1L 2QR0B 1ERNA 1TYRA 3GJFK 3H7LA 3MRKB 3QJRB 4ZO7A 5B4MD 4EOWL 1YQEA 4MFQA 1YGHA 2AANA 1A65A 1IBGL 1ACZA 2I00A 1M05A 3U30C 4K8RD 1T5XB 1PLGL 2GY7B 4M03A 5A6IA 5LDSA 2EP6A 3DV4A 1LFWA 2HTLC 2VDPH 4N6QA 5J06A 1OIOA 4PRDB 4EI5D 1W8EA 5DZ9A 1U8JB 4EIZC 4AC2A 5T5FH 1W8NA 2XI9A 5JMOC 2LU5A 4J27A 4KDWA 1Q0XL 4H20H 4WGKA 4OZHB 3MLPA 3BVTA 4KVCH 1ANUA 4LCWD 5GJTL 3ZHLA 2NOYA 1MVYA 2R2EB 3LIZA 5JHDA 3U0TB 3ZKNC 1UD8A 4ZTPH 5GGSB 3GJFB 3VD1A 4MHHG 3KG5A 1I1AD 1M7IB 4OTXL 2BSED 1BGXH 4WUUA 4R97B 3SN6N 4YFDB 2UVFA 5DJAB 4R3SB 1GMIA 5EO9B 3LYRA 5I5MA 2GUOA 4P10A 4II9A 3QQNA 4M43L 3V5HA 4IOFD 4MFLA 2KBGA 2QLYA 3Q3GA 2H0EA 2ZXAA 5F21B 3IGAB 2WWMD 4LUAA 5I0YA 1UWYA 1WZMA 4XXDA 5E8EB 3FHQA 5CFAA 2E4FA 3FQNB 2X3AA 1QVOA 5IBLD 3K6SA 3L2MA 3V0EA 3D4UA 2BK8A 5KVGE 5MEQA 3LS5L 2QPDB 3DBXB 2MWCA 2C4XA 3PHOA 4I5BB 4ANKA 3MR9A 4FAAB 5K9QI 1JWSB 1I9RL 1MELA 2IFFH 3Q5YA 4X8JB 5FX3A 1FG2A 4LX9A 2L3BA 4LGPB 4JY4A 3V55A 3ZLQC 2FR4B 3NJLA 1XF3B 3W1ZA 2AFNA 4AL8C 2VJXA 4JB9L 4XPAL 4MCSA 5EDSA 4PYHA 4ORFA 1RJLB 5GS2D 4FKEA 3ZHDA 2IANE 2JJWA 3U1QA 3CHPA 1E7UA 1KGIA 1V10A 1N7ML 2A99A 1AACA 2P46B 2R4SL 2OXHA 2GJRA 3FX6A 3C5ZC 4Y4KB 4FJYA 4AENB 2F08A 1B4TA 4CU8A 2W92A 4PVLA 2E8YA 2GBTA 4FCHA 5IMKA 4F7EA 2CDGA 4NAMA 2XN0A 2PWDA 1MXDA 4WU7B 3PGPA 3RDTB 2FX8L 2XPGA 1ZA6A 4QWWC 1CE6A 4GJTB 4UIMA 2WUCL 3D4GA 4Y4FC 4O9HL 3WV0A 3V2AR 4S10A 2X42A 3P2DA 3ZN6A 2XWJB 1B87A 3OKDB 3CBKB 5CJBA 2BS8A 2I7SA 4MAYD 5BOZG 1U8NA 4EN3B 4GG6B 1I9EA 4Y19B 1SJMA 4BFKA 3NPSB 3BFQG 2NNAA 3G5ZA 5ERWB 5G4MA 4M85A 5KYXB 5F48A 4P5SA 3MO1A 2A0LC 3O8XB 4X6BA 4LLVA 1FE8H 2XVBA 4P05A 1E28A 1QTSA 2QT6A 4XNUH 2NR6D 2AZAA 3TP4A 5JXEA 3MV9B 5GSVB 4TM9A 3VD5A 4ZW3A 1B6DA 1BFOB 1K8IB 3NA9H 1CB4A 4PJXE 5DMYA 1HINL 2FIKA 2HPTA 3VE0B 3GKWL 4WW2B 4KKCD 3QJQB 3CFBB 5I76A 1RHHB 3T0AA 1CPUA 5HDOA 1QW9A 4JDTH 2AEPH 1KENH 2CK2A 5DZOA 1WF5A 2NX5D 3WY3A 2Q7YB 3II2A 4S1DD 5IHHA 3SKMA 1QW8A 4R97C 4KUBA 4PG2C 4EUPB 3BO8B 3DTDA 2P5WD 4HS6B 3DJRA 4POUB 1JVLA 1NOFA 1U2YA 4XE0A 4BQ9A 3IPFA 5C0AD 3SZKC 2ATAA 2NTSP 3MU3A 3PIQB 4BFIB 3DURA 2F15A 2VUYA 2B5GA 2WZ6A 3TFKC 3WFHA 1JE6A 1OGSA 3IXAA 4UT7L 5AOJA 2ZW6A 5A6LA 4HX1B 3GM8A 4TV3A 4FQJL 4EIUA 2BIOA 5C0GB 2BX5A 2R2BB 3E6FB 5J1AA 3ZTNH 1XF5A 2BW4A 3DGDA 2ITDB 1ARLA 4JFDD 1ZTXH 3QDJE 4KX8A 1UACL 2P4AB 3QA3B 3MUUA 1ASQA 3LV3A 3G5VA 5LQBH 4XAWH 1SN2A 2GSMB 4PTTA 4I88A 1GOGA 2F53A 4OD2B 3VQLA 1I31A 5D2LB 1MEXL 2H1PL 1KXVC 5B21A 1B0WA 3QDMB 2EIKB 2JVUA 4JO5A 4PP1C 4Y4KC 2L7UA 4TUOB 4JPWL 5IF0A 3BAIA 3GS7A 1AYOA 1A4JB 5E70A 4H8WH 2NY0D 3CN1A 1T21A 1LP9A 3L95A 4UTCA 4UTAH 2VIRB 3RDTC 3KNBB 4FQ2L 4YQXL 4FXTA 3WMQA 4RGMB 2Q2LA 1GZHA 4CGUB 5DRZA 4MNQD 3KI9A 1XFOA 4YPGA 5GHWH 2EYSA 4PGBB 2DDQL 4RSVA 1ETZB 3RB5A 4CSPA 4EUPG 3PU7A 1CWVA 4I0PD 4N20A 5F7LB 1Q2CA 1XF4B 1M2VB 1ETA1 3MV11 3BN9D 1ZE3H 4LEOA 1RIVL 2XICA 4KH2A 4U6TA 5HHQB 3OXRB 2NW2A 3VACA 1OZPA 4IQHA 4EN3C 3RVWD 2R1IA 2OP4L 5D1QE 4RGNB 2BCKA 4XPGH 1LWHA 4CSTA 1HL4A 2B4DB 2CGZA 3NPSC 3ZE2E 1L7IH 5CO1A 2I9TB 3C5XA 3GIZH 1E8ZA 3O8XC