2NSMA

Crystal structure of the human carboxypeptidase n (kininase i) catalytic domain
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
399
structure length
390
Chain Sequence
b'KLAFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNKEALIQFLEQVHQGIKGMVLDQNYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxypeptidase N catalytic chain
publication title Crystal structure of the human carboxypeptidase N (kininase I) catalytic domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 136
structure length 390
sequence length 399
ec nomenclature ec 3.4.17.3: Lysine carboxypeptidase.
pdb deposition date 2006-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 2nsmA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2nsmA01
4EMEA 3KQXA 3FX6A 2GREA 2V8HA 4IK2A 5LYFA 1TKFA 2XEGA 3GLJA 2HC9A 5I4MA 2AFMA 4ZY0A 2ZEPA 2ZEGA 1PYTB 3KCPA 1ZLHA 2PJ8A 5K8NA 2ABZA 3IFEA 2ZEFA 3G3LA 5JH9A 4OC4A 4FWUA 2XEJA 4EIUA 4JZ0A 2AFXA 3ISXA 4B6ZA 3FJUA 3PFEA 1IGBA 2CTCA 1TKHA 4OIWA 3SI2A 4PXEA 3KQZA 4OKOA 4MHYA 1CG2A 1IY7A 2QYVA 3IJ3A 4FL4C 2RFHA 2OR4A 3TX8A 1CX8A 1VHEA 2NYQA 3PRTA 3D7DA 3D66A 3PEIA 2POKA 3B3VA 3HLPA 4UIBA 4YOKA 2ZEDA 2WZNA 1ZG9A 1XMBA 2WYRA 1HDUA 3D4UA 4P4IA 3MRUA 2PE3A 4A94A 5J1QA 4ZYQA 2PJ0A 4P44A 3MN8A 4F9UA 2EK9A 3SJGA 2ZOFA 4PPZA 5HXDA 1YLOA 4ONWA 1NSAA 2AFOA 4P4FA 3B35A 4UEFA 4BD9A 3NA6A 1DTDA 2PJ1A 3H8EA 5D8NA 7CPAA 1Y0YA 1ARLA 3PB9X 3WC6A 3IIBA 2RB7A 3NH4A 4X2TA 5K8PA 1UWYA 3CT9A 4P45A 1CPSA 4CPAA 4NGRA 3NFZA 2PJ5A 2PJ6A 4MRIA 3TC8A 4AXVA 3PBBA 2ZEHA 4P10A 1YMEA 3L2NA 4UIAA 3CPAA 3WABA 3IO1A 2I3CA 4K3NA 2XEIA 2EWBA 2GLFA 3IEHA 2J9AA 3D67A 3SI0A 4TNUA 4A38A 3RZAA 1BPNA 4OP4A 1FNOA 1YSJA 3D7FA 5DS0A 5JGFA 4TWEA 3SJXA 2PJAA 4MXUA 2PCUA 4UF4A 2AFWA 5K8MA 2JBJA 4OC5A 3PB7X 1PCAA 2B59B 5HVHA 5CBMA 6CPAA 2PIYA 1Z2LA 3KHXA 2BCOA 2QVPA 1XJOA 2AFSA 5G5DB 2GU2A 3H8GA 3B3WA 4NGSA 5HVFA 2PJ7A 5THWA 3KZWA 1LAPA 1VIXA 1NKGA 3HN5A 4Q7AA 4EFDA 4MCSA 4OC2A 4FAIA 4FUUA 4MHPA 2GLJA 2Q51A 5K8OA 2BO9A 1DE4C 3GUXA 5IB9A 2PRQA 2C6CA 1Q7LA 5D29A 2OOTA 3S9MA 1M4LA 3RBUA 3N5FA 1Z5RA 3NJVA 2JEWA 2ZEEA 3B7IA 1HEEA 2IMOA 3PB4X 3SI1A 2ZELA 4DYOA 4IYKA 3E8VA 3IWWA 4NJRA 3B2YA 4WWVA 4R6TA 2PJ3A 2C1CA 1ELLP 3RAMA 3FH4A 3FF3A 3CPXA 1AMPA 3PB8X 4Z65A 3FECA 4DJLA 4NGNA 3QNVA 4ZY1A 1XFOA 3NH8A 3B3SA 1ARMA 4NGMA 1BPMA 1XRYA 2CTBA 1ZG8A 2PJBA 3KGQA 2ZOGA 4ZX9A 1GYTA 1TF9A 4MCRA 1JQGA 4LQGA 4A39A 3DLJA 4WI0B 3D7HA 2PJ9A 5K39B 1Z8LA 2ZEOA 3NJXA 3CDXA 1R43A 3DGVA 5LRGA 2C6PA 3IC1A 2JBKA 3KR5A 4NGPA 1LAMA 1F57A 3S9NA 3SJEA 3BHXA 4KSIA 1LCPA 2FVGA 1H8LA 5JM6A 3BI0A 1F2OA 4NJQA 5LRJA 3WT4A 2F7VA 3SJFA 2PJ4A 3HUVA 4P4EA 2F8HA 2V77A 1CP7A 2BOAA 5LRKA 5LYDA 4NFRA 1CPXA 2PVVA 4MHZA 1Y0RA 2XEFA 3I1UA 1YW4A 3BI1A 8CPAA 2HB6A 3V38A 3BXMA 2VL1A 4YWYA 2CIJA 4MMOA 3LMSA 4IHMA 4OIDA 4NGQA 4X3RA 2DEAA 4MCPA 1LFWA 3PBEA 2PJ2A 4ZX8A 4UEZA 1R3NA 4PXDA 4RUHA 4YU9A 2XHNA 2EK8A 3PFOA 4F9VA 3JRUA 4NGTA 4P4DA 4WJBA 5ELYA 1RTQA 2AFUA 1CP6A 2V8GA 2O4HA 4P4JA 1F2PA 1QQ9A 1LOKA 4F8ZA 4OC0A 5HVGA 3NH5A 1BLLE 2QJ8A 3B3TA 3KR4A 4OC1A 1HDQA 4P4BA 3FEEA 1Y7EA 2ZENA 4O23A 4ZI6A 3K9TA 4P6YA 1ZLIA 2PVWA 2ANPA 1VGYA 2O53A 2V8DA 3WC5A 3B3CA 5CPAA 2Q43A 4PXCA 1KWMA 1TF8A 1QMUA 1AYEA 2ZEMA 4MCQA 1BAVA 4GM5A 4PQAA 4FXTA 3WC7A 2AFZA 1ELMP 4G1PA 4PXBA 1VHOA 1FT7A 3D7GA 4JYWA 2NSMA 2V8VA 4W9YA 2Q4ZA 3ISZA 3LWUA 1EE3P 4MHNA 3VARA 4X8IA 4FBEA 4R76A 1YW6A 4R7MA 3D68A 4IAVA 4ZY2A 2CF4A 3FMCA 5F09A 4U3SB 2IQ6A 5LYLA 3KHZA 3KASA 3VH9A 3FEDA 5AQ0A 2IJZA 4DUKA 3PB6X 3GB0A 3KL9A 4UEEA 3K2KA 4OC3A 2C6GA 4H2KA 3T8WA 1OBRA 1TXRA 3V7ZA 2G9DA 1ZG7A 5LYIA 1CBXA 1TKJA 3KI9A 4R8FA 3VATA 2PIZA 4OMEA 3FVLA 1XBUA 3S9LA 2PJCA 4A37A 4EWTA 3H8FA 1LANA
chains in the Genus database with same CATH superfamily
1J8SA 2VB5A 5C0ND 3DPDA 3KQXA 1H5BA 4L2LA 2A9NL 4DGYL 5BZWB 3SDXF 2YMTA 2HMID 4IHBA 3N43B 4FQ2H 3KPOA 4G9FB 4PREB 2UV3A 2XV6B 4PRPD 1RERA 3U4BH 3SCMD 1JGUH 1JDCA 4I0PC 4XP1L 4IK2A 5CJOL 4JZOB 4BH8B 3LRGA 3B6SA 4LLMA 4Y1AA 1NJ9A 2P6GA 3L5JA 3VXOA 1DJSA 2BMKB 5DO8A 2RB8A 1JWUB 1DJXA 2ZEPA 4A6YH 4XNDA 4KPHL 4UQBA 15C8H 1SUHA 3GY9A 1RK1B 4PJ7A 4ODVL 4IKKA 4PG2C 1AS6A 3WFZA 2Y6SC 1EH9A 5AFAA 3TN0B 4GP8B 3W2DH 3CDGA 3LD2A 3VCLA 1R19A 3F7RA 2DQIL 3HZMB 5JH9A 1IBFA 3L7EB 2DAVA 1A9EA 1NFAA 4CYNA 4I18B 5CHNB 4J4PA 3SKNA 4LAJH 2IBGA 2MOQA 3VFTA 4AMWA 3N1MC 5HGDB 1RVFH 5CEYB 1NLBH 5EOCJ 2LW3A 2W60B 2REEA 1MPAL 4BFBD 3EADA 4ACPA 1JWMA 2NNXA 4JE4B 1YYMH 4MRBA 5AG7A 4GIOA 3SI2A 1GGBH 5DD5H 5EMYA 3DO7A 4WUKH 2EDYA 4TSCL 5DU7A 1MHCB 2BOBA 3N42B 5AB2A 3PP3H 2NW2B 5D1ZC 4WW1A 5IB3A 3S9DB 1VHSA 2GSGA 3QWOA 2RFHA 4HNWB 3TX8A 3BH9B 5ETUA 5DEFA 1I31A 4C2XA 1F58L 3VFMA 2X1WL 3ARSA 3N50A 3VUAA 3N1FC 4P46D 2A99A 2HUEA 2X1XR 4CBPA 1UHVA 2OJ1A 3MGTB 2E3VA 3HLPA 3KBEA 5T1KD 1I3GL 4I49A 3CHXA 3BPNC 3ARGA 3G9VA 3RLSA 2WYRA 5HDQH 3VXPA 2CGRL 3MCLH 4PRPE 3FUMA 3HZYB 4TQEL 1ILSA 3B9DA 2HVJA 5ID1A 2B1HL 4JZNB 4N0FB 1JRHI 3QIWA 4PSPA 3WKNA 1UWXH 1WBZA 3LQZA 1LK2A 3CPUA 4PJIB 4YDNA 1I85A 1XIWB 3HAEH 4YS4A 4NEXA 2ODFA 1MUJA 1NDMA 1FHNA 1MLBB 3QJFB 1OARH 4ZMZA 3Q48A 2JK5A 1GS6X 1QO3B 1YQEA 3CXPA 1CLCA 1VEMA 1EVUA 4MDIA 4QHLA 3E6HA 1IGCH 2B9BA 3OBAA 4R7LA 3RPIB 4Z7NE 1KIPA 2C5DC 3ECQA 4HIEA 5DHVH 5GGTA 5LBSH 1GKOA 3V6OC 1CT8A 3UZEC 4O2FB 5IK3B 1A0QH 4ZUUB 4NHCL 4X4ZA 2SEBB 5IJVB 4Y88A 2PJ5A 5LBGA 2NY6B 4L4TD 1T1YA 3U9PH 2ZWSA 1EIBA 1FZKB 5CR8A 1PNCA 2ZONA 4WV1A 1KFAL 3PWJA 3OV6A 1SOSA 3Q05A 3LKPB 3PJNA 2KPNA 4PB0H 1BGXL 1MFMA 2AQPA 2CUAA 3FHAA 1T1WB 3HI1A 1HNYA 2X4QB 4U1HA 4R83A 1CGSH 1IAII 2BNUA 4JGNA 2YPVL 4MAYB 1S9KC 1YSJA 2AKRA 3PDGA 4AEIL 4PJCE 4EUPG 5L0QB 5E8OB 1UXLA 1OK0A 3DMMD 3BLPX 2AJVL 2PJAA 4ZFFB 4Q9QH 1IAKB 4L0PB 3BZEB 3MJ7B 4ZTOH 5KANG 2JWYA 1LVEA 4PW4A 5JDSA 4OI8A 1U8CA 4IRZA 3GMLB 1B6UA 1OPGH 1NMAL 2CO2A 1HT6A 2Z35A 4NO2A 1MJ7H 1N10A 3PS6A 2FT6A 2CRYA 2YSTA 3WEBA 2BVEA 2JSFA 3HZKA 2BVPA 4N2AA 3VG0H 5KYXA 5KOMC 3VQ1C 2FECL 3ME0A 1CBVH 1HX0A 2XX1A 4HC1L 3TO7A 2X4RA 4PRIA 5EUOA 1SJEA 1CBJA 1UD3A 5KJRL 2FS5A 3MRPB 4FNLL 4EFDA 5D6CA 4DVBB 1SHSA 2WZ5A 4MJIB 5B3NA 2CBOA 2PW1A 1UGKA 4UF7C 5CLXA 5DR5H 4ODWA 1KCSL 3G9AB 3ZE0F 5IV2B 4A2DA 4AYDC 1RD6A 5LNEA 4L4TE 5CGTA 3VFRA 5J11C 2HV2A 5EU3B 3HFML 3UGEA 4R87A 2ZUTA 4PV8A 4N6RB 3ZZIA 3QDAA 1F00I 4PWJA 1F45A 2DWEB 4AMKL 2EAEA 4L9LC 5ID0A 2PRQA 3QHZL 5JPMB 3MLXL 2VLRD 3QB7C 2CHDA 5PAZA 3ISRA 3ECBA 5HGGS 4CSZA 5JYLA 1IQDB 1GZPB 1B0WA 4YX2L 1KXTB 3UH8A 2EUZA 3WEMA 1YQ2A 3CFNA 5GRZA 3UTQA 5TK4A 4M5YH 1BD2A 5D7LD 2VDNH 2X4NA 3D6GA 4ZFZB 4A7TA 3IWWA 3IMSA 2XIIA 4XMTA 3DROA 4BSWA 2HLEB 4E68A 3C5ZC 3LN5A 2A6JA 4M7JL 4WAFA 4OFDA 1A5FH 2WXOA 5DURD 5F70A 1IBZA 3MRCB 4P2CG 2WP3T 1DVZA 3BRFA 4ZXBD 4JRLA 5AW9B 1OF0A 3W81A 4R90H 2X42A 4IOIB 1VSCA 4NSKB 3NSCA 1PMYA 2V3FA 4ADIA 5I16B 1Z4EA 4QRRD 4KVNH 5K59F 2A9DA 4OJEH 3ESMA 5L88H 1NMBH 4QVTA 4KKZA 4GAAA 2COVD 3DC0A 4LU5L 4BQ9A 5BRPA 2XBTA 1YNKH 5D2NA 1MJ9A 5E2TH 1CD1B 2HAZA 2X9WA 3GMNA 3L3IA 3T09A 4AVHA 1CTNA 3MCYA 5IOKA 1NDGB 4OF6A 5T8IA 2NW3A 2KCWA 4GB9A 5CMAA 4GEJA 1GXEA 1WO2A 1XGUA 2OCFD 3BZ5A 5DJ6B 3MRMB 3EC4A 3O4LA 3GXIA 1IC1A 3WFCL 4AVJA 1GOFA 4RESB 1KCVH 4CKVX 3HNSH 3NT0A 1DJYA 3O4OB 1BW8A 2O5ZL 4MCYB 1S7WB 2NY3C 3WG7B 1PKQA 1KELH 4KXZI 3SDAD 5I1IL 5F6IB 1F57A 2VLRE 4X4XA 1CDHA 1WIOA 5DLLA 1TNMA 1W91A 2EE6A 3RPKA 4KHTH 2Z34A 3O2DH 3O8XA 4Q6IA 4N0YL 2D0HA 2YC1B 3C8KB 5JPNB 1E4JA 3FN0L 4ZS7H 1QKZH 5D7LE 2PPCA 3HRZB 4MJ8A 4Z95H 2G3ZA 1URZA 5DRZA 1MFCL 3K0WA 2OMVA 4ZW3A 3RWFA 1UFUA 2DQMA 4GUPA 1HQ4B 5JHAA 5LNGA 4EAEA 4F6AA 4JPKH 2YEVB 3FL7A 3WNOA 2KQNA 4KDTA 5E2WL 3DKHA 4AE0A 3EBAA 5FS5A 3DNSA 3S36H 1H6FA 5KTCA 4QRRE 3VWJD 5A6MA 3L81A 5CKGA 4DAGH 4JFEA 1OPOA 5MI0C 4E2AA 2J43A 1NZRA 4QNPF 1BQHB 5HDBF 3FU8A 2CZNA 5I1GH 3WJJC 3HIZA 5L9DH 3TOAA 4BBWA 1J5HA 4NIYE 5KSAC 5INCA 4ZMTA 2O6PA 2Q86B 2Y06L 3QEHA 2C7UB 1OSPL 3G6JF 3STBA 4FXKC 4AQ8C 4BZ1H 2YD8A 4DVRL 3TZVD 3AG1B 1KJ2H 3Q6GL 1G6VK 2APXA 2IWGA 5FGBA 3WXWH 3D3VA 4PJAF 2XVKA 3MCKB 1DFBH 3W9EB 4JQIL 5FKPB 1U8HA 3VD0A 1NSNL 3EJRA 4NENB 1LO4H 5EBMA 4H0HB 2C1PA 3GLEA 4PXDA 4C56D 3L95A 4YE4H 5ADOL 5L6YH 4I4WB 1MFBH 3CNKA 1TNNA 2VLKA 4WEEA 4K94L 4P4DA 5BZDB 9PCYA 5FB8A 5KANI 5FO8B 3MBXH 4XPAL 4FLSA 3OPZL 2R29L 4A63A 3FHQA 5IHZA 3D0LA 4LEOB 3ATDA 5HJ3B 3ERXA 2Q76A 2JKJA 5ICUA 1QQ9A 3EW3B 3FQ4A 4E5XA 1LOKA 3VFVA 3DURA 2HJLB 4UT9L 1B3JA 2GSIA 4LP8A 2J44A 2VZTA 2AK4B 3TEWA 3HR5B 1IT9H 1S6NA 1E50A 43C9A 3ES6B 4WGKA 2LU4A 1EFQA 4PV1C 1BFTA 1GC1H 2IQAB 4O23A 2ZENA 1S7QB 2QMKA 4X6CF 2WSAA 1VIWA 3MLZH 2ZNWA 3UACA 2QKIC 3P4MB 4W9LC 2PWGA 3HUJA 2EIDA 2PVWA 5HY9A 4CSTA 1EHLH 5HD8C 3BH8B 3WKML 1KENL 4MD5A 5FGSA 3PZJA 2ZD0A 1A2YA 2AANA 2GB2A 1FVCB 2X2JA 4CVZA 1QSEB 4PV9B 1IAIL 2YOAA 4PJGB 1QBLH 3FDWA 2DIEA 4Z7VA 2HXAA 1H3VA 5GRUH 3TBSB 3ULAB 3VFWB 1Z9PA 3RNZA 3TO4A 4HXBH 1YEGH 3NIGF 4IU3B 1DYZA 1T0MB 2PYEE 2HFEB 1IFHL 1N5YH 3LHPH 2HLFD 4W9CC 3K6NA 2VR6A 3ABLB 2VIRB 4P3CL 1ELMP 4H8WL 2Y1ZA 4XCYA 4PXBA 4CSSA 1F3JA 4FG0A 1KZYA 4X98B 1E4KC 1G0XA 3QNZA 3K6SA 2Q44A 1QWHA 2IAMD 2JLPA 1QSFD 2CO4A 3MSPA 3BP5A 2PW2B 2AHIA 3QIBA 2CO7B 1QPXA 3INOA 4C56E 2CIIA 1CPUA 2GAZA 2GBVA 2WBXA 4HJ0C 4CU6A 3O2VL 5AD0B 1WAAF 5F9JA 3T3PE 4MHNA 1FORL 3QJOA 3CFTA 3KLKA 1YW6A 1Q9WB 2XN9B 4BQ8A 3L5WB 4ONFL 2NLJA 4ZY2A 5CJ8A 4AG9A 4X5RA 1NMTA 1M42A 2C9VA 2V5YA 3T0WA 1ZHBB 4Y9FA 3QDMB 2AC0A 1K8DB 4OZGB 4QRUB 3WKQA 3IKKA 3VFSA 5KBLA 1KBPA 1BEYH 3FUNA 3ZIYA 3X3GL 3FCTA 3HI6L 3LHAA 1ZGLM 4FQHA 3QEQD 4J3TA 2VXQH 2Z8RA 4HIXH 3TN0D 3MODL 4F58H 4RZCB 4G8FA 1F0LA 3DVNA 3NZUA 4KUZH 2JTYA 3Q3GB 2VAJA 4GQ9H 4F37K 3QAZC 3LQAC 5KVGH 4Z1PA 1KJMB 1S9YA 3HBQA 4OGQC 2R27A 1ASPA 3OX8A 3UG4A 1MWAB 4K71B 4RFOH 4CKQA 4TUKL 1YYCA 1BOGA 1YQVL 3QG6B 2QJDA 2NUPB 3AY4C 4AJ0A 3DO4A 2PIZA 3MLYL 4OMEA 1KC5H 2AZUA 1H5BB 2P80D 4ODXB 3RDJA 1I75A 4OAEA 2IADB 4AXWA 1K3ZA 2FZ3A 5IT2H 2VL4A 3KPOB 1HXYB 2MNJB 4XPGL 1CFBA 1MIEH 4GO9A 3JYCA 3MMEB 2YD9A 1H9DA 4Y1AB 1R5VA 3B6SB 1DBJL 4LLMB 1TETL 5E8DL 3BDBA 3VXOB 2J5LC 2QMJA 3LNHA 3V52L 3PGFL 4J12A 1WRFA 3CD4A 1C5CL 4NO0A 3RVXC 4HKFA 1U92B 2YLKA 5BQ7A 4PP1D 2FTAA 4JLRA 5I15H 4PJ7B 1QSFE 3NIDE 5TQ2H 2E6QA 2FYYA 3ZDWA 4G9FE 2YZ1A 3CDGB 4GKZA 3VCLB 3HE6D 3ZYOA 1NANH 1FUNA 3MRQA 1A9EB 3JWNE 4MWFB 4NNPL 4WKXA 2WWKT 4NZFA 4QXTB 4G1EA 4CC4C 1W0YT 1E2VA 1CZ8H 1XIWD 1FGVL 2WKOA 3LS5L 3KYMA 1IAOA 4Y9GA 4K5OA 5E6ZA 4YDKH 2YKLH 3RURA 4AGQA 3RWGA 4KUBA 3RWCB 3R8BB 1JWMB 4R3SA 2NYYD 3NE8A 3QEQE 3X11A 1YEJH 1EJOH 4LSRH 1AGCA 1JNJA 1IJ9A 5A2IH 1IOIA 3GZOA 1E4WH 3OAZK 3DO7B 2X6MA 3MBEC 4JM2C 2BDNH 2BOBB 4YPGA 5IB3B 1VADA 4HK3N 1DLFL 1NFIA 1O75A 3CWGA 4N8VA 5ETUB 4TNWK 1WISA 5DEFB 4XBGB 1ACXA 3VFMB 1OSYA 2D73A 4M4RA 1VENA 2OR4A 3II3A 4M7ZC 1LO5A 2GABA 3ARGB 3SJVD 3PRTA 4HHGA 3VXPB 4JRXB 2MKLC 1QABA 5ID1B 1Q72H 4XP9H 1UOVA 1NEZG 2P52A 3QIWB 4AEEA 1WBZB 3LQZB 4YEEA 5DFAA 4F9PC 1RUAL 4N2DA 3DVGA 2PE3A 4MAYD 3AQXA 5I5RA 1MUJB 2H47C 4EOWH 1GL4B 1NDMB 2H26A 2X4TB 1G5GA 4JFZH 1F4XL 3HHSA 2EH8L 3ET9F 5IVXB 2FJUB 2JK5B 1I3VA 2OMWA 4L4VD 1AZZC 5C7XH 3BT0A 4MDIB 2VAAA 2F8VA 1HINH 3E6HB 4QHLB 4X6DE 4RRPG 2AJXL 5FXCH 1N18A 1O6SA 4HIEB 4HUXA 4Z0XA 5GGRA 3TBTA 1Z0MA 4QTIL 1CT8B 2WWOA 1QOKA 2Z1PA 4MHHG 3BSZH 5BUAA 4NRXA 3FCSA 5IVZA 3W37A 5GSVA 4X6FA 5CWSA 5FYKU 4X9IA 1KUYA 1NUFA 1RUQL 5ISZB 3CT9A 1CM0A 1N4XH 3TFBA 3UAAA 3ASWA 3SE9L 5KUKA 4BKTC 1DQLH 3WV0A 4RMQA 4JFXA 1RULH 4LCYA 4JFYA 4KJWD 4ODTL 1LK3L 1ND0B 3QCVL 5IF0B 1H8OA 4KFZC 2PR1A 2YD1A 3HA0A 1KTDA 3WCYA 1ZY9A 2YGPA 3Q8FA 4PPTA 1Y0LB 4U1HB 5GRYA 3VXRB 1JGEA 2X6VA 1LRZA 3LRKA 2BNUB 3INUH 5IWLA 5E4EC 1JIBA 2C7FA 2AKRB 1M44A 1K4JA 1R3LB 4J3OH 3S34L 3FIXA 1JWSA 3SJVE 4QKXB 4FQJL 4O4YL 3QWRD 4M1CD 3TOBA 4NQSA 2Z3NA 4UUJA 3O3AA 3S5ZA 1XR8A 2K45A 1N64L 5JORA 1U8CB 1XEBA 4LSUL 1YREA 1G4MA 5GS0C 1YR0A 4P3DA 1MLCA 2QPEB 4OFKA 4MXUA 3HE7A 5F9OL 4NO2B 4WTWA 5SX4H 3HZKB 2NSXA 5IJBC 2NMTA 1M1XA 4DP5X 1VFBA 5KYXB 4YXLH 4KXBA 5E1HB 4MQTB 3KHXA 3ME0B 4L4VE 5JW5A 1PYWA 2X4RB 1MQKL 3M46A 5DT1L 1PL3A 5DD0H 1XJOA 5EUOB 1SJEB 5K9JL 4XWOC 1QFUH 2VQYA 2MH4A 4FL4B 3VW3H 1KIRA 4NGSA 1K4CA 3RTQC 2HT4D 1T7YA 1D5ZB 4CYPA 5FHBH 2CDGA 4ODWB 1IC5L 5CILH 1UJ3A 5HP5A 5DD3L 3PWPA 4AL8C 3MACH 2AQSA 4HWBL 3AW5A 4I48B 3VFRB 4OC2A 2CD0A 1ZLSH 5JLZA 4PV8B 4R26L 1CICC 1ZS2A 1QAWA 4PQXA 5ID0B 1YVLA 2AE6A 2IPTH 1CFSB 2YPLB 4KI5C 2CMRH 5DJYA 3ECBB 3IFNL 4RWYH 1D5RA 1ZVSB 5LWYL 3ULVC 4PK3A 1TCRA 4WJKB 2VO8A 2JJUA 3UTQB 4V1DD 1BD2B 1SFDA 4FLHA 2EADA 4Y4HA 4O02L 1BMGA 2LVEA 2X4NB 3PL6C 4L9DA 3PWVA 3WY3A 3D69B 3LN5B 3V0DA 3S35H 2A6JB 4U33A 4KNQA 3QFDA 5T1LD 1E67A 2Z1KA 3E8VA 3VI3F 1KCUL 1U8PA 3P2BA 4JREC 4MX7B 3LODA 3BQUA 1Z9NA 4PHZA 2R0ZL 2VZOA 3TH2T 4P9MH 2XV0A 5IIEB 4ZRGA 1IQWH 4NKQB 5BOJA 3RVUD 1ZLVK 1OAKL 4Z3IA 2GT9A 3SKJH 1SY6A 4G6KH 1SDAB 4PJEA 4KY1H 3NH8A 2NZIA 2YPVA 3GBML 3MX0A 3VRJA 4DUVA 2GITA 4K15A 2GC7C 3V6FA 1KACB 4RVBA 1A65A 4XPFH 3GMNB 1XRYA 3HBPA 1KB3A 2HX9A 1AYOA 3MRKB 2XJKA 2NW3B 4NQCA 3CDZA 5CMAB 5C6TL 3RVTD 5I66A 2JCWA 1A6AB 1XGUB 4UQIM 3O4LB 1GYTA 4E36A 3EYOA 4EJ1C 1RHFA 3F04A 5ITFA 4Z78B 3FQNA 3PGPA 5C0AD 1F4HA 1FH5H 1I7ZA 1PKQB 2MOVA 4NAMA 4JHBA 4XWGH 2E7BA 3FUIA 4X4XB 2ZYRA 4KITB 3MGAA 1J88A 2OMBA 4E9SA 1IGFL 1UT1A 4NYLB 4HC1A 4IDLA 3UX9B 4GS7B 4Q6IB 3S6KA 1V3JA 3HJ0A 4B9ZA 1R3IL 1UB6A 2EVIA 1UXMA 4V1DE 2VSKB 4CVWA 3BHXA 4XXDB 4NM4L 1XSIA 4AOFA 4NBZB 3L1OH 1OKEA 2OMVB 2FGWH 3RWFB 4HOMA 4GUPB 5G21A 1B2WH 5DHYB 4HGMA 1GRWA 1F2OA 3AS1A 3JTTA 4F1SA 3S96A 5JA8B 1KSRA 5TFSL 2Z6FA 2OJEA 1JHLL 3KM1A 2GPZA 4O2EA 3Q5OA 4UT7L 1G7HA 2Y2YA 3TL5A 3ILDA 2VEZA 4XMXA 1Q38A 3KPLA 4WNQA 2MHAA 3RGVC 4KZDH 2FDBP 1ECYA 1O7SA 2BH0A 5B38A 5EZLA 5MENA 2XXCB 3B7SA 5HBBA 2NXZB 4MHHI 1WS7A 1A4BA 3NTCH 1M05A 4AGMA 1JFQL 1FBIL 5DC0A 5JHDA 4KQ0A 3ZHLA 1MZZA 3QB8A 3EJPA 5DWUH 1Y07A 4QRBA 5T5NG 4NF1A 3LZFH 1CLVA 3PUUA 2WYTA 2VDMH 1OQOA 5J13C 4LCCA 3QEHB 4OLYH 2F15A 2PPDA 5CO1A 2P24B 3ZE1F 2YXFA 3TNMA 1QUNA 3BLBA 3U25A 1OOWA 3LMSA 2PWDA 2WXLA 5LNDA 4J3VA 5EO1A 1AGDA 1U6AL 1U8HB 3H3PH 2VDPL 5C0AE 3X1FA 3JWDL 5A2KH 2WK2A 1QSED 3EYUL 4WK2B 5T5NF 1OV8A 1GH7A 2JB6A 2C1PB 4BFGA 2DICA 2CH8A 1BJ8A 3NCFB 2FWUA 4LFHG 2QADC 2LGNA 4XMWA 2PR9A 1UUSA 2VLKB 3FT3A 5HHVL 5FB8B 5I17A 2BOLA 4KH9A 3QUKA 4Q9CA 5IHZB 1V05A 2WNWA 1GGTA 2EC9T 5AZUA 4UTAH 5IUSA 1WUNT 1ZPLA 1U8MA 1PEWA 3QQNA 2OYPA 3CVIH 4JBSA 43C9B 3TPUA 2F19H 2FX9L 1DCLA 3DOIA 3GGWA 2KZKA 4JO4L 2F54A 1XGRA 1I4FB 1ADWA 3QC5X 3HUJB 2XN9D 1N59A 2BX5A 5HY9B 4A2LA 1X5IA 2RALA 5ICZA 4G59C 1WH0A 3EBGA 4WCYH 4MD5B 4M3JA 3JXAA 4HSAC 3UTSA 1DQDH 1GOGA 3QDMD 4NKIH 4H88L 4CVZB 4LVHC 1J8HA 1KB5A 2AVGA 3D85D 3JQOB 3N41B 4LLDB 3CFIC 3IJEA 3GMOA 4G7RB 2FQEA 3CHPA 2XKUA 3V9EA 5DS2A 4J7RA 4IBUA 2CA3A 1YEEL 2NY7L 4U9YA 5AVSB 1WJ3A 1XF3A 2JKTM 4LL4A 4U6VL 2MOGA 5HYSG 4HW6A 1FNSH 4JFFB 3T2OA 3RIFK 3U79A 1QMUA 2X1PA 3QUML 4N2KA 1IKFL 3PUCA 3QNZB 1QSEE 3K6SB 4MA1C 1S7SA 3DSNA 5B39G 4PJGE 3BP5B 1INEH 2JKWA 1ZEAL 3L4TA 3QIBB 3PWLB 2NUTA 1VHOA 2CIIB 2GAZB 3HBZA 5ERWA 3RBSA 3NQIA 1KBVA 3C60D 5F9JB 1J9RA 3HI5H 4JYWA 3UTTA 2CK2A 3WGVB 3E2HC 2DLEA 4R4FL 3F7VA 3MNDA 2Q4ZA 4IKIA 3SPIA 3W82A 4ZNEE 3TTHA 4PUBH 4CGOA 4U2ZA 4CAXA 2J1WA 5LN8A 1CLYH 1DBML 4UCPA 3L8QA 1TTFA 2EDDA 5EOQL 1JTOA 4XCEA 3VFSB 4P2YA 2PRBA 2ZCZA 3HR6A 1XF8A 3BYTA 2B5IC 1ZV5A 4FYQA 4FQHB 1SBSH 4JQIA 3KYNB 4KGJA 1ZGLA 4NC1C 4ZTPL 1YY8A 3BVWA 4G8FB 3KHZA 3VH9A 5IJKC 1L9SA 3QCUH 2Z3OA 2HTLD 1QEWA 3ILQD 4RAVA 1ACYH 2XN9E 3MV9A 3F65A 2ZAIA 3KL9A 1QHPA 2CNZA 1AFVL 4HCRL 3OX8B 3A21A 1L9OA 3L4ZA 3WSQL 3NPSB 4XNQB 2DQDH 4HIJA 3RJDA 1BOGB 2C6GA 3RQ3A 5J0BA 3OLEA 3QDME 3UTZA 5IHLB 4LK4A 4W4NA 1OAXL 4OZGE 4GAYA 2R29A 2VDLL 1HKLL 1ZG7A 3BAEL 4UAOB 5DD1L 5E08H 1BMWA 4LPCA 2DQEH 4K3DL 4UT9A 2ORBH 3SE3A 3SQOL 1WZAA 1MCPH 4HUWB 5C0CA 2Z3PA 4J3SA 2EO1A 3TEZA 3ZTJH 1CYXA 1MNUL 2A1WH 2HFGH 2IC2A 5FM5O 2JKLA 4TVUA 3OKLA 4HKJA 3TJEL 5CJBA 3S3DB 2ATKA 4HULB 2PJCA 5I76A 2WUUA 4DGIH 1U3YA 1LANA 2C9QA 2UZIL 4NO0B 1O7DE 4B53A 4HU8A 5BQ7B 3LPOA 1OEZW 4B12A 4GW5A 4HS3A 4JLRB 5AB1A 1FH2A 4N68A 1JD9A 1ORSA 32C2A 2EZ0C 3MGOA 4YLCA 4JRXD 4PJBF 4GKZB 3PFUA 5D2LA 3V5HB 5SWZA 3NFNA 4B9YA 3MRQB 1AZVA 5C70A 2J7LA 3QIWD 2IGLA 1AS7A 4RMBA 3O3EA 3DXAB 4XNZB 5TK2A 4HT1H 3KYMB 1TYRA 3UGUA 3TASA 5D1QA 3GT6A 5CZVH 3L3DA 4A2MA 3RWGB 7PCYA 3ZHKA 4LP4A 4Z7OF 3WMQA 4Y2LA 3X11B 5GRVL 1AGCB 1A3RH 4UYQA 4NPYA 1Z5YD 5CGYC 4NZRH 1KN2H 2Z91A 3L13A 1DVFD 1IU8A 1S7VA 1VADB 4N2BA 5LBVA 1J9QA 3CSTA 4N8VB 4EDXA 1L7TL 1MI5B 4GQRA 3PFEA 2NNCA 2W80C 3AUWB 3DHPA 3HG2A 1PSKH 5KJ4A 2P5WA 3OQ3B 3I6KB 1H3PL 1AXTH 5ISZD 1Q2CA 4H5SB 2E9IA 2EVNA 1LO5B 5GRJL 4IIZA 3W5MA 3KW8A 4BQBA 4MRIA 2ZP8A 4YZWA 4YHPA 5CLWA 1OB0A 1CG2A 1KGJA 4WIQA 1QX1A 3BDXA 2BPBA 5IESH 1TVHA 2AJSL 4RQQA 1PGRB 1OVZA 5BV7C 5FUOL 4M93B 1JN6A 3TPKA 3AQZA 4UILH 1OZUA 3VXRD 2XWXA 3UYRL 1IVLA 2WVVB 3H53A 1Q94A 3DVGB 2XKNB 5AAWC 4YOKA 1M6OB 5KWYC 3H0TB 2H26B 3QJQB 3HHSB 3L3KB 2F1BA 5HPOA 3EHBC 3UBHA 1AZBA 1XO8A 1PG7L 4D0CA 3HLKA 3ZKMD 5J1QA 2DY2A 2EECA 2VAAB 4JRXE 1FDLL 2WNGA 4TULL 4CYOA 2DI9A 1G9MH 1O6SB 1NC4D 3KPPA 4HUXB 2JJTC 3NA4A 5GGRB 4P44A 2H32H 2DYPB 3N3EA 3QWQB 5D5ME 4LNRB 4G8GA 2WUBL 4RGNB 4NRXB 3FCSB 5IVZB 1IC7L 2VLMD 1KWKA 3S8WA 1HSBB 1I8UA 3IGKA 1WD9A 5CWSB 5L2JA 1HILA 4HSQA 4OVUA 4AZ8A 2YA1A 3VNYA 3KPMA 2LTQB 1Y0YA 1Q0XH 4NX0A 5IVXE 4DFHA 2WC7A 5A16A 1WPCA 4JG9A 4LCYB 3BFOA 4CGUB 4E41A 2VYRE 4F7MA 3L9EA 4BDVA 4ZX6A 4P45A 3VGGA 4XN8A 4DQOH 3HVDA 2FR4A 1HI6B 2WBJA 4FG6D 1KTDB 4JKPH 1AP2A 2ZKXA 4ELDA 5DLMH 1JGEB 4PIBA 3DRQA 2XWTA 2LFEA 4AZUA 2ZEHA 4HS6A 4RSVA 4X5XA 3CPAA 1JI2A 2GUOA 5ISZE 3VGDA 4AGLA 2X0UA 3A47A 1Z66A 3NH7H 1JWSB 5ANMB 2XEIA 1MCCA 4NQSB 2YPLD 4KRPC 3QRGH 4UUJB 3X14A 3BAIA 4XNHC 1XR8B 1WT5A 1QLRB 3LKOA 1H8NA 2UZXA 5JORB 4NQDA 4HBCL 2V9QA 3GRGA 4XN7A 1MLCB 4AQZA 3U7AA 2R56H 4JN1H 4PRBB 1SDDA 3VXRE 5B8CC 4L1TA 4ZO6A 4U1SA 2XYCA 5IFHL 1VFBB 2WW8A 4F7PA 1ZLWK 4KXAA 2BP0B 1IGYB 5JW5B 1PYWB 2F8OA 1PFOA 1ZS8A 4GG6F 5D71H 4HUVB 5H4ZA 1AY1L 1MFAH 3VA6A 3AREA 2IGFH 1TYJA 4DP2X 1K4CB 2KLSA 3TO2A 5A27A 1OT1A 1XOVA 2QVPA 2R4SL 2VXUL 3TU6A 2VLME 5EF3A 2APWA 1UJ3B 3ZDXF 3OLIA 3TV3H 3PWPB 1A7PH 1KXQA 3M17B 3AS2A 1G7PB 5I23A 4F0XA 3MLUH 1IBYA 3HN5A 1ZA3B 4P9HH 3CUPA 4LL9A 1P84J 3US1A 1QVOA 1ZA6A 3U6XA 1Y18B 4M5ZH 2ZCLL 4HALA 4C4BA 3TCLA 2IDTA 4PGEA 4ZBGA 3D07A 4PJXE 1A7QH 2FX7H 2FQDA 1TCRB 2AJUL 3JWOC 4GSQA 1AHWB 3X3FL 5FDWA 1NBZA 2JQZA 2YBRA 5J6HB 3ARBA 1QNIA 4Y4HB 5I6NA 5CUSH 4FXGC 3EO0A 1URIA 3FQRA 3PWVB 4PEEA 5DYFA 3T2LA 1F6FB 2BHFA 2AITA 5D7JB 3K6OA 4H2CA 5F71A 2DQHH 5CNPA 4PLJD 2YPLE 3QFDB 1HTYA 1QNZL 1U8PB 4TVPH 2Z4QA 4FYTA 2ICCA 3IDIA 1ZANH 3B7IA 4UQ2A 4P2OC 1SZNA 4GG8B 5DMGC 3PB4X 4NZ8A 2EIKB 4LCWA 4K7FB 4ELMA 3A3YB 1K85A 2GT9B 5DQDH 3NEEA 4JHUA 4Z7IA 2HT3D 3EXLA 3KR3L 2XWCA 2UVEA 1NGZA 3THMH 1RK7A 1T5WA 1UM6L 2ICEA 1J5OH 5EORH 3PB8X 2YGVA 3VRJB 4KO9A 4Q4IA 1SYVB 2Z31A 1TEGA 5T33L 3RGHA 4F24A 4ODHH 3BUBA 2CA4A 4KO5A 3LRLA 4NQCB 1JZ2A 2EYTA 3CDZB 5F3FA 2GIXA 5C0GB 5B4MC 4JK0D 2CALA 4UQCA 2FUTA 3BUPA 2CGZA 4MS8D 3EYOB 5FA3A 3B3IA 1FJ1A 1AGFA 3FRUB 2JB5H 5JIIA 3KGQA 3QFGA 3FQNB 2G3NA 2MPAH 1Q2YA 4JHWL 1PIGA 1CR9L 4F93B 3VVWA 1JZ6A 4RFNC 4M85A 5C0DB 5EU6A 4ZMXA 2CTCA 2LU7A 3POHA 3PHOA 1WG3A 1X4ZA 3MO1B 2Q0YA 1EAPB 3MLTA 5DCCA 5T3XL 2ZUWA 1TUPA 1JMXA 3GPEA 3IF1A 1UB6B 1VFMA 3KJ6L 2BVQA 2DMGA 4MMZA 1NOAA 3SO3C 4GXVH 3S0PA 1SOXA 1Z9OA 2Z4TA 4K3JH 2Q7SA 1NGQL 3IE4A 3KR5A 1G0YR 2GBTA 1JMZA 4JKLA 4MJHA 1G87A 2BZCA 1FVEA 5J12B 1G84A 4HWBA 1XVSA 4QGYA 3JTTB 1EXGA 1KEML 1WGVA 5DC9B 3S96B 3ZL1A 4GOSA 3ZXAC 3UBXA 2FIWA 3MLPA 1ZWIA 4ZS6D 4CN4A 4O2EB 4NCC2 2M2DA 2R23A 2XA8H 1A02N 2ZYHA 3KPLB 4WNQB 2MHAB 1TZHB 5MENB 4YK4C 5B38B 5EZLB 5HYQA 5E23A 4HFUL 4DKEL 1N5AA 4LVEA 4JDZA 5DMIH 3O9WA 5SV4A 4Z8FL 5JHDB 1KB9K 1FYTD 1M7UA 4FQXC 4NO3A 4ZAKC 4EIZC 3R4RA 4UNIA 4O02A 3VWKC 2DQCH 3FPXA 3GK8H 4PJ6A 2P3YA 1XSKA 4XNXL 3RX5A 1COBA 4KKCC 4PLOB 4DKAA 1L0CA 4LCCB 5CLTA 3QPQC 3IWEA 1NLDH 4PJ8A 3L4VA 3V0HA 1Y0RA 1K2DA 4KROC 3TNMB 3NCCB 2GI7A 1PTZA 4YDIH 2PWFA 1OF2A 1XAKA 2GTZB 2YIHA 1QUNB 3AC0A 5I1AA 3PU7A 3NIFB 4UFVA 3VXUA 2J8UF 3IAPA 3U4EA 5MP6L 4PV6A 2YD7A 3E8UH 2X2IA 4U1NA 3ZHFA 1RJYA 3TF7C 5AVUB 4YWYA 2JB6B 2K8MA 5EZOH 2DQJL 2QVMA 4AM0A 1BIIB 4YSAA 2DH2A 4AI7A 3FT3B 3CC5A 1BYPA 1G6RB 1I9IH 4NJAL 5I17B 1SQMA 3BGFC 3RZCC 4JFFD 5AZ2L 5J06A 1NCAH 1DBKH 3TBVA 3WNKA 1A6UH 3Q8AA 3OR6A 1I7UA 3QUZA 3D9AL 3QEUA 2YEZA 3KYAA 1U8MB 3KVQA 3S8GB 5T1DH 3TPUB 2QR0A 4PS3A 5B1JC 5HGAA 2DS4A 1MRFH 3T5WA 1J1XH 3LDBC 3GGWB 3DSBA 1UURA 2VLKE 3Q0HA 1A7RH 2F54B 3VWDA 2QSTA 1OAQH 2G3XA 4ONUA 1XGRB 2O4EA 2R0KL 4L8SC 3F83A 4K9JA 4EKJA 1EXHA 1N59B 1AMYA 2XG5B 5ICZB 2VXKA 2DI8A 1GKEA 2WOBA 3HNVL 4HLZH 2XXMB 1FYTE 4LMQI 1J8HB 1KB5B 5JDJA 3GDCA 5BW7A 3S5LG 3RWDA 4A95A 3IJEB 3B37A 4F8PA 4AIOA 1UD4A 4DP6X 1QSZA 3QE5A 2A9ML 3G6JA 5LG1A 5HJDA 4MJ6A 5JIQA 1T7WA 3L3OB 3HUJE 3S8FB 1ZCRA 2XN0A 3BKYH 4PJAA 4OB5H 2P5EB 3GJFA 4JFTA 3HG4A 1XZ0B 2R0LL 1UT9A 1TTBA 2A73A 1S7SB 4MA7L 3RVWC 1BSIA 4KLVA 1J5IA 4FYRA 4NKOA 2NUTB 3T6VA 5ERWB 4BD4A 4HPOL 2V17L 4N5ED 2ZEMA 2V5TA 2XZAL 5F0LB 3GSUA 4KOYA 1IM9B 1GGIL 3F7VB 1CDBA 4DPBX 3DIFB 1NC2B 2UY7A 4H44C 1J05A 4JFFE 4TV3A 5TE7H 5JXAL 4LIQL 3RO0A 1TEFA 3U30B 1PCSA 5I82A 4ZBJA 2C3VA 1XFPA 4X2UA 2J4WL 4AIXA 4Q14A 4XCEB 4GQPH 2FO4A 4KTYA 3N06B 5GGTH 4HDIA 4LEBA 2R2HA 1CGXA 2HN7B 1ZGLB 4YSRA 4AUYA 1EJFA 3K3QA 1KCLA 4A68A 4I77H 1B9ZA 1QEWB 4UB0H 4Z76A 2EXYC 2LT9A 4RAVB 1PF3A 3MV9B 4JG0L 1DQVA 4XZUB 3ARRA 1MREH 3DXAD 4OFVA 5TQ0H 1AO7A 2VXVH 4HIJB 5KAQG 1KCWA 1UGNA 3ATBA 1DJIA 3IGLA 1HCFX 3N5AA 1JNNL 1LL1A 1U93A 3SPVB 1UH3A 1UYWL 1Z3GL 3K4AA 2OI9C 3SD2A 4BFKA 2J8RA 1TQTA 2PKDA 2YAPA 3QHFL 3QZPA 1NCBL 5C0CB 3RHWF 4IJ3C 4MAUH 4FI7A 3GRBA 1VACB 1OWRM 3BVUA 2FBJL 3B9KC 3BW9A 4H13C 3OKLB 2ATKB 3MZGB 1MI5D 4B96A 1B0IA 3TYFB 2Q8AH 3CU1A 2YUVA 2Q7AA 1BQLL 2H6OA 1W8OA 1CU4L 2R8VA 3GBNH 4HS3B 4GRLC 3QO0A 5KVDH 2IPKA 4ABWA 4NWTH 3H7LA 6PCYA 2ODHA 1ORSB 2OMNA 4FJYA 3MGOB 1SN2A 4IRZH 3CXHK 4YDLC 3IMWA 4WO0A 3WJLA 4IS6A 4M6NH 1B3IA 4G72B 4J6RL 4PBVC 4PBWD 4HH8A 3EXJA 3O3EB 3H42H 1T5KA 4LOUC 2H5MA 3D51A 3QORD 4UNTA 5I1LB 2HC9A 3TT3L 4KK6D 1Q1JL 1FVDB 5E2VL 4MYWB 2I5YH 5D1QB 2W0KA 3NCEB 2KUTA 2BVYA 4X80H 3QUMA 1BG1A 3BDYL 3KW7A 3LEYL 3RFZA 2XFGB 2JH2A 1ZLHA 4NPYB 3MRLA 3QDGD 1PZCA 4DKFH 2Z91B 3D34A 5JOPD 1USQA 3TFKC 1S7VB 3H9YA 2DYPD 4X5PA 1S46A 4TKWA 4V33A 5J1AA 1GJIA 4WO4A 4RGND 2W9DH 3OB8A 2X2UA 3FYNA 4NXSA 4ATWA 3DXAE 3UDWA 3A4DA 2P5WB 4HK0A 4HUCA 2WXQA 1WP6A 3F3HA 4B6ZA 1OTUD 5C2BH 2MEJB 2B9AA 3NVQA 4IMKA 2E8ZA 2X89D 3QUYB 4DUWA 5JZ7D 3QUXA 3GO1L 5CINL 2PDOA 4YHPB 1F6AB 3CFDA 3WE6A 2HQYA 3LN4B 2EP6A 4MDJB 4IRSA 1DQJA 1YJDH 1B0GB 4G70B 1TVHB 3SGKA 3WFDL 4YDZA 5C0IB 1WV7T 3GNML 5EN3A 1LEIB 1S8DA 3KQZA 5FV1L 1JN6B 5TD4A 1MI5E 1JJUA 3B34A 4P2QB 1YVKA 1Q94B 5DDHA 4PJHF 4WHYG 3U0TB 3MJ9L 2WNXA 2F7OA 3CZGA 4ERSL 3D7DA 4F33B 3NK4A 4D0CB 1OSEA 4U0RC 4PJ5A 1CIUA 2AI0L 3KPPB 5TPWL 2E5EA 3F01A 1QUPA 4HFWA 3KPNA 4K5PA 5E03A 5JW3L 3KPSA 3NE7A 3WLBA 4OI9A 2Y2TA 1I1AC 4G8GB 4JANB 3BJ91 3TFYA 2WUCL 3E38A 4Y5VA 5L2JB 1HILB 2VI7A 4WWKB 2QVFB 2FYVA 2ZPAA 4X9FA 4BA8A 3WNMA 2IWEA 1EO7A 3AQYA 3KPMB 3A5VA 3TTSA 4OZIA 1QTYT 5A16B 3WUWA 5HHMB 43CAA 3K71A 4E41B 5ESAA 2P4AB 2TSBA 2C9AA 1YNLL 4H0IA 4MLIA 3QDGE 5G2NA 4F7MB 4HPHA 5JOPE 4OR1A 3FUFA 3QPKA 3H8EA 2FR4B 2HMIC 2WBJB 3AXHA 3GRWL 3S3BB 4YQXL 5JXED 4RGNE 3SCMC 3MTRA 3CZJA 4HXAH 4PRDA 2XWTB 2J5WA 4OJCA 3GTVA 1YEFH 2B08A 2GUOB 1U42A 4JM2F 2WTPA 4IDJL 5K69A 3NFZA 2TSAA 2DD8H 4R0LA 5GPRA 2Z10A 5I18H 3WNNA 1X9QA 2DPSA 2MPVA 4NUGL 2RHEA 1HZHH 4LSQL 2IDSA 3IO1A 3LKOB 4ETYA 2ARJA 4NQDB 4XTRD 4M7KL 1S5IH 1C8QA 1SDDB 2AK1H 3GZKA 3RGBA 4ALAC 4U1SB 1IC4H 2WLNA 3QZBA 4MMXA 4Y4HD 2AMGA 3IPEA 2WWNA 3D7FA 5D7JD 5ANME 4AYEC 4EI0A 3BSHA 1KN4L 1YK3A 2BCKA 4G5ZL 2K4AA 2H2SC 3AREB 2F5BH 1K4DA 2D03H 1KCRL 4H1LG 4N0UA 4JDTH 3RX9A 3PRZA 5HVHA 1EHNA 4NN7C 1JSYA 3U46A 1Z2LA 3S88H 3GIZH 3MXVL 1TZGH 4BJLA 1RIHL 1QSTA 4N2LA 2FGZA 4I2XA 1QVOB 2AV1A 2XPGA 3HB3D 2PJ7A 5THWA 4GIPD 2EXSA 3R4DA 4RMSA 1IGTA 1OCOB 3ZE2F 1UFHA 4FZEL 3T9YA 3B5TA 1E9QA 4X4ME 1AKJD 2GTQA 4E0AA 2A38A 3CVHL 2L0DA 3FO9A 1NBZB 2YBRB 1NBVH 3GKZA 2VN4A 1WS8A 4G7VL 4QXUL 4YHYB 3WL9A 3FQRB 3FB3A 4ICXA 1U41A 4TUJA 5HYJA 2RD0A 4GSXA 2IO5A 1VLXA 1G0DA 1W0WA 3CHSA 2R7EA 1CQYA 1S9VA 2OR9L 3UERA 1GHFL 3CPLA 1T0NA 4BFOA 3CVCA 1DUZA 1U8LA 2VZSA 2VDRL 1Z9SB 2H0JA 3IDIB 4AQOA 4UQ2B 4NHUB 1M4LA 1HL8A 1DJWA 3N5FA 1AXSA 2GYSA 2CCVA 3NA9H 2JEWA 1ZV9A 4XN4A 3OZLA 3UAJA 4ELMB 5L4IA 2ZKMX 2H0FA 4H6UA 3CZFB 1SOKA 2E8YA 1T5WB 1F13A 4H8VA 3RUGF 5A7BA 4F15B 2FX8H 1F41A 2Z31B 1LO2H 4JEGB 3DA0A 4KBPA 1C12A 1UM5L 3MR9A 4KOWA 1KJVA 4JPVL 2VQ1A 2EDTA 2ESVA 2EYTB 5HHXH 3ABGA 4V2BA 3JBG7 5F93C 1X9UA 2BXYA 1NWOA 4NN5B 4PS4H 4WWID 3ZE0B 3LXBA 4TTDD 4L1HA 5FA3B 1F18A 3B3IB 4LARL 3V0AC 2N7BA 3PAYA 5KVFH 4NQQA 4NUJB 4JFDD 4UV4L 4A67A 4LE8A 3F7PC 4JFVA 2OW6A 4JHVA 2PTTA 4TYUA 1U8IA 2OL3L 4DZ8B 2WO2B 5EU6B 3ZOAA 4Y16B 4YBQD 3O45B 2YMXL 3EO1A 3FN9A 3OAZH 3PHOB 4NBYB 3DMMC 3MLTB 2KC0A 4F2MB 4MNHA 3SGEH 3AT9A 2QSQA 2FQFA 3F85A 4ONWA 3D7HA 2BVQB 1L6ZA 1XR9A 4ZI8A 4KI5F 2R2BB 1CE1H 3MLVL 4KMQA 3GIVA 4TQPA 1KTBA 1WLHA 5BMFL 4XPDB 1FVEB 3ULVF 1R43A 4U3XA 1ET8A 4OM0L 5EA0L 1DQML 3GHBL 3VI3A 2BFGA 2BIQA 2C6PA 1FI8C 2FATL 3KH3A 3UBXB 3ARDA 4E42A 4ZMNA 1ZWIB 3HC0A 1UXSA 2R23B 5FYLH 4GT0A 3IDXH 5HYQB 2XG4A 2H0EA 2IV9A 3ROLA 4FXLA 35C8L 3O9WB 3C9NA 1JPSL 4OCSL 2BLFA 2F7VA 5DZOA 5DZPA 2ITEA 5DQ9A 1AQHA 2QVTA 1LMKA 2Y07H 5ISVA 1YPZB 3KDMB 2GJZA 2XUWA 4BSVA 4N26A 2BFVH 4HA1A 4PJ8B 2H6UA 3GSRA 1JV5A 5FC9A 1K2DB 1FL5A 3R95A 5ABZA 2ENPA 5IB2A 5D4JA 4NFRA 4I3RL 1OF2B 5TGBA 1G94A 2NY5C 3WY1A 5I1AB 1CPXA 1L7IH 4TSAH 3TA3B 1A22B 3BX7C 5IROA 3VXUB 4M6MH 1KY7A 4JFDE 2HZHA 5MERB 1P1VA 4M1DL 1RJYB 4QKTA 4S10A 5E6SB 3U9UB 4DN4L 1JNLL 3OJMB 4AM0B 4LLYA 3SBQA 5DMJB 2QQLH 3VXMD 2O5YL 1F4WH 5F0MB 4ZW6A 4DP4X 2G4EA 1A4JA 2D0FA 1I8KA 5FHAL 4HF5L 4OQTL 3STZA 4OIDA 3C6LA 4ZXBC 4BFEA 4XBPB 1AVAA 2AW2A 3NIFE 2PC1A 2P5ED 2W9LA 4L3CA 4URKA 5EU4A 3OR6B 3U36B 2J6EH 3QUZB 3P9MA 3PE9A 2YEZB 4APQA 5B22A 4DP8X 2Q04A 3F12A 5GJSH 5IKCA 5D1XA 3IU2A 3BPLC 2QR0B 4ZPTA 1N2RA 2GKIA 3GWJA 5JW4Q 2NPLX 1USZA 2PXYA 1II4E 1RO5A 3S6FA 5ELIA 3CN1A 1IM9D 1JVOA 1EAQA 2CR0A 3DWTA 4O58H 5H84A 4HKBA 4F9VA 12E8H 1JK8A 1NC2D 3Q5TA 1G7LB 4XP5L 4XO3A 3DUSA 4M43H 1CTMA 3QPXL 2GW5A 5HDBB 4XCFH 2HPTA 3VGFA 1RZJH 1I7RA 3FUHA 2EDNA 3DDDA 4I13B 4ZYKB 3W9DB 1XMEB 1UWGL 2HRHA 5F6HI 5FWQA 4BCZA 2QJ8A 4WEBH 3SDAC 3ARTA 3MLSL 1CXEA 3G6JB 4IGBA 4NQTA 1PG7X 4MJ6B 4B95C 1NFDF 3MV9D 4ZI6A 1KTLA 3K9TA 4PJAB 2VMDA 1J1PH 1N70A 3FTUA 2BUEA 4MYPA 1AIFB 2A73B 4FCAA 4Y19D 3WC5A 1V55B 3EFFA 1MJUL 3FMGH 4NKOB 5DWPA 1U8QB 2FH8A 3ARPA 3LS4L 1QTSA 2X28A 3VXME 1BQKA 1HL5A 2N1KA 1Z5LA 3GSUB 4W9GC 1FZOA 3ZDZF 4PXCA 2UX7A 1DBAH 4XMUA 1TF8A 4AG4L 4U6XA 3TBYA 2UY7B 1J05B 2J73A 2W5PA 3C6EA 3MV7D 4KO6A 5LDUA 2HYMA 1YEKH 3WFBH 2OKMA 4B9PA 4GM5A 3DBXA 3LKRB 2P5EE 2H0PA 4ZMYA 2C3VB 2E9GA 3VWJC 3QQ3B 4G1PA 5D9SB 5EWIH 2FO4B 2DKUA 1B4JL 2A9NH 4DGYH 2R2HB 2X4UB 2VDPB 3TVMA 1FL3B 4WTQA 4R4BB 1WEJL 3OKDB 2FCKA 3ULUD 1MCIA 4EO5A 3S37X 3K7UA 1ZV2A 2K8QA 1MHPH 4Z76B 2A77L 4XP1H 5CJOH 5D72L 1BF8A 4IIQC 4PK2A 3GLZA 1N8ZA 2L4OA 4IRJD 4R9MA 5FO2A 1BVLA 3QXDA 1ZLVH 4EN3A 1AO7B 2EBJA 1F2QA 3TZVC 1YDPA 3IFPA 4XNMB 3ARQA 5D1QD 3K6IA 4KPHH 3SB3A 4AYBA 3FMCA 2EUXA 1PPIA 3Q1SL 1U93B 4ODVH 3IFLL 2YD0A 4G6ML 2IJZA 4DUKA 3PB6X 2HVKA 3GC3A 1B90A 1R3JA 2OTUA 3DPBA 4L3FA 2DQIH 3PHSA 5KZCD 3K2KA 3BW9B 3MV9E 1TZIA 4YXHL 5KSVA 1OBRA 1WC7A 4K07A 2A7BA 3P4OA 2G9DA 2ZW7A 1T1XA 2XCMC 1TKJA 1WHPA 2Y25A 4I89A 4Y19E 3VATA 1MPAH 3QUYD 4IW4C 4C83B 1ETZA 5KSBE 4Y5YA 2V37A 5E5UB 1AQKL 4XMPL 1ZSDA 3BZFA 3FB8A 1PLAA 4IS6B 4TLKA 1UATA 2VW6A 4TSCH 3H8FA 4P5MB 3MV7E 4W9KC 3BP7A 4F20A 5F44A 3LQAL 4P2QD 2VERN 1CFQA 1BREA 1F58H 2EXTA 5DJ2A 4XOCA 1ZK5A 5B39A 2QSVA 1R33A 3OG4B 1I3GH 3QUMB 4TL5A 2YGOA 1DQQA 4HKZA 2OMTB 3MRLB 1JZ7A 3G5YA 3ULUE 2R8SL 2BO0A 2CGRH 4TQEH 1EO5A 3U7YL 2DTML 2R1XA 2B1HH 3CMOL 3JV6A 1TTUA 5J1AB 2BSBA 4WO4B 5FYKD 4JS7A 4U1IA 4A6YA 2HLFC 1BZ7B 4RCAA 2HWZL 4HK0B 1F1DA 4WWKD 3GMRA 4C59B 5D1QE 5CZXD 2YXMA 3I50L 2V2TA 3QUXB 5HHMD 5A1AA 3FONA 2JI2A 3CFDB 3ZPDA 2IAMC 4IRSB 4KU1A 5IEHA 3BT2L 1I8LC 2HLAA 2WBJD 1S8DB 1Q9KB 5CN2A 4R96A 1I8MA 3EIFA 4HLJA 3D5OF 5C3LD 4ZJ9A 5DDHB 2WAHA 1CTOA 3DOSB 3JWNC 5LAPA 1AIZA 5J8FA 1RUKL 1J8KA 1HOCB 4KK8D 2CDEB 1EQWA 1KFAH 2VERA 4PJ5B 3ZTCC 3WTUA 1ZLEA 5C97A 2E9WA 3KCWA 3X1NA 1W72L 1HFUA 1XF1A 4HFWB 1BGXH 1A7OL 3KPSB 3TN0C 3MV8D 3FO0L 1SY6H 1SXNA 3I6SA 4P2QE 3KAAA 3NABL 4Y5VB 3S7GA 1A9VA 3KL5A 2YPVH 2YD3A 4OCRL 1OW0C 4I18C 5CJXA 3MNVA 3S5YA 5BPPA 4AEIH 5L4MA 4OZIB 3APCA 3DTDA 4N28A 3T65B 3WUWB 3K71B 4RLDA 5ESAB 1R5IA 2ZKWA 2AJVH 3HG5A 2EACA 4OQ1A 2O93L 5HXDA 1AGBB 2H1XA 2WV3A 3DSFL 3RWJB 1EZVX 1U8OA 4AKPA 5FYKE 3ZQWA 5KS9A 1NMAH 2EO7A 5GJTL 4PRDB 4BD9A 4J8RA 1DTDA 1INQA 4MB1A 4TSBL 1SMOA 4HYTB 4KAQL 1JZ8A 3KKWA 6FABL 5D6DC 3LH9A 4R0LB 3NFPA 2JI3A 3F64A 5HHME 3DX1A 4HC1H 2AVFA 3H9ZA 4LBEA 4N20A 4WK0B 5IW6A 4ZO7A 2AV7A 1N6VA 2BSTA 3MAWA 4HZLA 3QZMA 3UTPD 5KJRH 4MJ5A 2ARJB 1QR4A 4EF3A 4FNLH 3IM1A 5L4JA 2UWEB 3HE6C 4P59L 3FH8A 2G2RA 5J8CA 3L2NA 2IAND 2F2HA 1KCSH 5A43C 3ETTA 4I0PA 4UYPA 4K73A 2AJZA 4BCYA 3HFMH 1XIWC 3IDUA 4OZFH 3E80A 4UAHA 2LQRA 4MA8L 2XV3A 3ML9A 4LSVL 4WU7A 1JERA 5DZNA 3SPHA 3BRGC 4AMKH 2X2HA 4YSEA 2O30A 3EO9L 3QHZH 5FLUA 3MLXH 4N0UB 4NQDE 3MV8E 4PS7A 4YX2H 5I5IA 4PG2A 5F88B 5FOBA 5JGFA 2Y72A 3SJXA 1BCIA 5HVHB 1M4GA 2BSSA 1G1CA 4I0KA 2PCUA 5TF1L 1DO5A 3U46B 3ECUA 2B77A 4KVCL 3EJZD 3GB7B 4NRZB 5CKAA 2Y3NA 5CEZD 2NY6C 1FNLA 2AV1B 5B1CA 3MJ9A 4RDBA 3NMEA 4M7JH 3S2CA 1DE4A 4KRLB 4TPRL 2YWZA 3GYRA 5E1QA 2HFFA 1G1OA 5C07B 4GRWF 1RH8A 2ZWKA 4B9IA 2VDOL 4QOKB 3U6RA 5CD3A 1W8EA 2XWZA 2MFNA 3FO9B 1OD7A 4ZODA 4QAMB 1KXQE 3UCQA 5G4OA 1DJHA 4UDUA 3RDTB 4U31A 2EEXA 2ERJC 5D1ZA 3WL9B 3V10A 4TUJB 2ZWZA 4MAYC 4LU5H 1A4KB 2ALAA 4X4KA 1GY2A 2VN3A 5GXBB 1G9NH 1W0WB 1XCQA 1PFCA 3PP3K 4B60A 1EV2E 2R7EB 4E9YA 1S9VB 3CPLB 4ZMWA 4Y16D 4BE5A 3UTPE 1C08A 2FJGA 2GLJA 3ESUF 1OSZA 1Q9LA 1XGQB 2IANE 4GIAA 3ML8A 4II9A 3UC0L 3WFCH 5HHOA 3NJLA 3D0AA 5B7EA 4AW7A 1O0VA 3AJ7A 4AL8L 4GRMA 4W81A 1Q7LA 4M6HA 1BX2A 2OCCB 1JCKA 3VM7A 2O5ZH 4KJYA 3NJVA 3BHBB 3CSFA 3TTYA 3UG5A 4GG6A 5JYMA 3V2AR 5I1IH 4ZO8A 4XO4A 3D48R 2EEAA 3MR9B 4HWZA 5AKRA 1LNUA 2Q6WA 5C71A 1KJVB 2IMOA 2B2XL 3MOAH 2ZELA 4KJWC 4P23B 5L7XL 4JKNA 5JQ4A 3DTXB 1O5DT 4F7TA 3ULVL 4N0YH 2TRYA 4ELME 3FN0H 1KB5H 1V27A 4CN1A 3V6OA 3UZEA 3V79C 3ZW3A 1AYRA 5SWSA 1QA9A 4EXKA 4S1QL 3DI3B 5CEZE 1MFCH 2Y7MA 5J1SC 5BXFA 1KYAA 2PTTB 4KO7A 2P9RA 1U8IB 5I19L 5BJTA 4OCLC 4YNYA 1JL8A 1XTLA 1ZVNA 3EO1B 3BWZA 1L9NA 4M1CC 4QYOA 1SDYA 1A1NB 1CDUA 4PJ8D 5K1VA 4GBXA 3T1FA 5E2WH 5JPMC 5E4IA 1DANU 1IKNA 2VZ1A 3KS0H 1FLTX 1B88A 4YN3A 2YK1L 3TA3D 4FADA 3MGDA 3VXUD 4ZX9A 3R1KA 3MUGA 3GIVB 5SWQA 3FJTA 3F6IA 4CADB 1OT4A 3P30L 1I9JL 1X5JA 2D0GA 4QRSA 3RNKB 1WIUA 2FHFA 3FO2A 4XPLA 1IC0A 3VI3B 4HMDA 3ARDB 4CVUA 5KUMA 4F2ME 1FCCA 3PAUA 1E9OB 1G7MB 4KKQA 3SD5A 1X5GA 2BP3A 2BNQB 2HT4C 4NCC1 1L9PA 2OQJA 2WLKA 3Q6GH 3QQ4A 4JFOA 1U8NA 5C82A 1SJHB 4PB9L 2AJYL 3CVHA 3ATAA 1RZIA 3ILPA 4JQIH 1NSNH 4KSIA 4A7GF 5DQ9B 4X8GA 1LCPA 4FAAB 1DHKA 4XGZA 1M57B 2GJZB 2BWDA 4FG2A 5ADOH 1UOWA 4YL4A 2Y36L 3GXMA 1N7ML 3QIUB 2EH7L 1JV5B 3GSRB 4K94H 2QV2A 1FL5B 3A6CL 1RPQA 4YJZL 3MFGB 5IB2B 1GMEA 4M5SA 3L1GA 5JIHA 1P5VA 4XPAH 3TCTA 3OPZH 2R29H 2PP8A 1IE4A 4GH7B 3FTYA 1ZT7A 3CH1A 2CBMA 4OW6A 3E3QE 4UT9H 3CQQA 4WQOA 4RMWA 3O4OC 1YPZE 1BAWA 1XD0A 4S0SD 2XWJB 1LQSR 4PW3A 2CCLA 1BQUA 2G5RA 4KSFA 3BKJL 1L3WA 5F6IC 2AJ6A 1BXXA 1I8KB 2J3SA 5E7BA 3O81A 1RZ8B 3KPQA 3U6XS 1T89A 1OY3B 3QH3B 2HB6A 3VXUE 3WKMH 3HAEG 1S5KA 1KENH 4L3CB 5JPNC 2H7WA 4FG4A 5EU4B 1U58B 4S1SL 3RVUC 3P9MB 4APQB 4S1DD 3F12B 3D4GA 4U6YA 4UINL 4A7SA 2EIZB 1RPUA 1CK0L 4WLCA 2WZAA 1LFWA 1T80A 4Z7QB 4WK4B 5I8OL 2NY4B 2NR6D 2PXYB 4PWEA 1TTCA 3EJUA 4UT6L 5FYJD 2OL3A 3C5ZA 3N55A 1KJ2A 1IFHH 2YAQA 3IE9A 2OA9A 1S7RA 1XGTA 3MUZ1 3RVTC 2D3JA 1YNTF 2BY3A 4P3CH 3JV4B 5GGVL 1DVYA 4H8WH 4UOW1 2OAAA 4HG4K 5JUEL 3SYPA 1XL6A 3PFOA 4NGTA 1ZLWH 4GXUN 3AITA 3AAZA 4TNVF 2E7LC 3GJEB 4G3YL 4LLVA 4M5ZL 4YPJA 5IQ7L 5L4FA 1KLUB 2E9BA 4XAWH 3O2VH 4IGBB 1OM3L 1PAZA 5I2IA 1FORH 4Y7MA 4HJTA 4DTGL 4MQ7A 2QQNL 3AFLA 2ICES 1KTLB 4ONFH 2J8UA 4OD1L 4RIRA 3MOQA 1A4AA 2EIJB 3FTZA 4NZJA 3UJIL 5GS0D 3P2DA 5IMMA 4Q36A 3UPAA 2C26A 3PWNB 4M02A 1YX0A 3EFFB 1ZLIA 2VTFA 3QZWG 2BSEA 5E1AA 1EFXA 3HI6H 5GS2D 3SPCA 4P04A 3X3GH 1REIA 3MODH 4NQED 3V0VA 2JJSC 1FZOB 1D5MA 5ENWA 2AJ3A 2D7TL 3NSDA 4FQQB 4U6XB 4AVAA 3KXFB 3CTTA 3EH5B 2NY0B 3VXTB 1KWMA 1T21A 4PJ9D 3GSNL 5E2UL 4TUKH 4ZMLA 5FFLA 5IOPB 1YQVH 2R0WL 1J0HA 3H85A 3W39A 4B13A 2ZE0A 4NZUL 3MLYH 4GKOA 2DLIA 4ODBD 2I24N 3AB0B 1JZIA 4Y4FB 2B4DA 1TJMA 2JTDA 3ZTDC 5H2BA 3OKEA 2WPGA 5FYJE 1JZEA 4XPGH 3EGDB 4JL2A 1N19A 2W94A 1YMMA 3GS7A 2O26U 4JZJC 5E8DH 1DBJH 1N8ZB 1TETH 4ZFOL 1BVLB 1YUKB 3LB6D 3QXDB 3UFIA 1U6MA 4EN3B 4CC0A 3V52H 3VSUA 3ZTEA 3PGFH 1EE3P 4B5OA 1C5CH 1YDPB 2WB7A 4ILDA 4OQTA 5E9DD 5J9PA 3VARA 4X8IA 3FFCA 1FZMB 1WBXA 2C4FU 4YWGL 5LN4A 1WWCA 2EVGA 2BVOA 1CFMA 3FTSA 5BRZA 3E1F1 4BUHA 4R76A 4R7MA 4LDCA 4N8CL 1ORQA 2OMYA 2HVKB 1R3JB 3DPBB 1SLWA 5LYLA 1B4TA 3LIUA 3WJJA 3ZN6A 1TZIB 3VXQA 4AGPA 5KSVB 4JRFA 4WO4D 1Z8XA 4OJDH 4H6ZA 1WC7B 2DL9A 3BWUC 4NNPH 2H1PL 3P4OB 4F57L 3IPBA 3S3PA 1T1XB 3VDCA 1G7JA 1FGVH 3LS5H 4LPVA 2CWRA 2A4EA 2YNCC 4AQ8A 4CAWA 2X87A 4EZKA 1W6LA 2CO6B 1RFDL 1UWEL 3NGBB 2CDFA 5DUBB 2E7CA 3QUXD 3BVTA 4Y5YB 4ZD3H 2RFXB 3OKYA 3T3MB 1ZSDB 3FB8B 4IRSD 1SQ2N 4NQEE 2V3EA 4KXZH 3W0WA 1DLFH 3LRSA 3WOVA 2A6IB 2IJ0C 4J6IA 5ABAA 4ZMVA 5EIQA 5ALCL 3DK0A 5DYOA 2ADFL 1CFQB 5IMLA 2EUIA 4I5BA 4GI8A 1QPPA 2QPUA 3DJ9A 2W9EL 3IJSA 1MCSA 3DHMA 4G43A 2DH3A 3FQ2A 4Y2DD 3GBDA 2EDXA 4N22A 1FNEA 1XGZA 1JBJA 5L8JB 4HKZB 3CX5K 4XPBL 5H37G 1NBQA 3KVDD 3CZEA 3P9LA 4HK3J 3T1WA 4BH7B 4MQXD 3R18A 3S4SG 3I6GA 1E27A 1EWHA 4NDMA 2WBKA 2R1XB 2ROXA 3R9GA 4HOWA 3P0VL 4GINA 4HCIA 3F58L 2Y5TA 5LB1A 4N8UA 4UM9A 3VAEA 4U1IB 3IJ9A 1SHWA 4F1ZA 1RJLA 5D93B 1OP3K 1RUAH 2NTSP 3L45A 4A6YB 1IICA 5A7EA 2JCCF 5E9DE 2ZSVA 4U6HB 4EVNB 1OGAA 2Y1VA 2QKIA 1CWVA 4K71C 2NTFA 3BC9A 1F4XH 2V2TB 2EH8H 3QQXA 1EXUB 1O7DC 3CVBA 1KNOA 4OLWL 3FONB 5BO1H 3A4FA 4FFYL 1T0PB 2FNBA 3Q6FA 2FB4L 3VRLF 2AJXH 4OC4A 5F0JB 3B2VL 4FWUA 1O7VA 3C08L 4QTIH 1N0XL 5FCUL 4R96B 3C60C 1I8MB 3EOTL 3S36X 1EGJL 3O2WL 4KQ4L 1TYEB 1EERB 3OWCA 4ZOCA 1ZTXE 1PLBA 4OTXL 3V8CA 1UEYA 1Z6JT 3T0XA 1WCBA 3VRIA 1RUQH 2XWEA 3RGVD 2HJKA 4DEWA 2YGQA 5IR1B 1MCKA 4AK2A 1X10A 4FD7A 3SE9H 1KUXA 1TQUA 3LXUX 4W9ZA 4N5UA 4MD0A 3V5DA 4L5FE 1MK4A 1S3ZA 2WZ0A 2E9JA 4ODTH 1LK3H 1MHHB 3QCVH 4Z3HA 2CJSA 5EOTB 5DHXB 5JW4N 3VFNB 2CLVA 3ILQC 4LQFL 3L3HA 4ZQTA 5CEZH 3UYPA 1SVBA 1UZ6E 1LDSA 3MNVB 3PNWA 2APFA 4KKPA 2ZXAA 4KZCA 4MMYA 3S34H 1VEOA 3BAXA 1R5IB 2VXTL 4FQJH 4O4YH 1ROCA 1JK9A 2KKQA 2Y5EA 1N64H 1C5BL 2COQA 5E6IB 2YA2A 4LSUH 5BV7L 5KS9B 4YHZL 1S2EA 2WXIA 4F27A 1KYOK 4JB9L 4J8RB 1INQB 2LU5A 4WVRA 1QSNA 1UH4A 3H3BC 4WSKA 4ATTA 2J88L 3P3RA 3ZKXB 2PCYA 4OZIE 3AXIA 1PY0A 3NA6A 3B8SA 2ZUVA 3V4UL 7CPAA 4X8CA 3ZKND 3EFAA 4LBEB 5DT1H 1MQKH 1KGXA 3PB9X 5K9JH 4HZLB 3AY4A 2BSTB 3L6FA 1A6PA 4PBDA 5C0JA 3Q01A 5C07D 2VMCA 4X2TA 5K8PA 2JJVA 1MAJA 5EO0A 1S3RA 5CU5A 4QOKD 5D7EA 1IC5H 4NGRA 5JMRA 5DD3H 2GK0A 4N0RA 2ZXGA 3QIWC 3UJTH 4I0PB 5BOZG 1M2VA 4HWBH 2AJZB 4HJIA 4ODSL 4YDJA 3RDTD 2ZW4A 3ABKB 3AMKA 1YCSA 4P10A 3EFOB 4LPYA 4WU7B 3PIQA 2XKSA 4R26H 4MFJA 3FRPG 1HDMB 4XHQA 3H54A 1MVUB 2DDQL 3LKNA 2VC2L 4U5YA 5C2UB 4M3HA 1FLRL 5DUJA 4M62L 4Y4KB 3IFNH 3VXSA 1R5WA 2UWEE 5FOBB 5LWYH 4M48L 4AWJC 2A9BA 4FFVD 1DVFC 4JDEA 5GGSY 1UENA 1NBYA 2BSSB 1TTRA 3V7AE 3UAJD 3D1MC 3QFJA 3B56A 4ABQA 4O02H 2H6PB 1ITBB 1N12A 4GSDH 3L17A 3RHWK 2WWMD 1KPUA 2O6FA 1JZFA 3I9AA 1DE4B 2X7LA 4GW1A 1KCUH 1V3KA 2DMBA 5AW0B 4BE6A 2IH8A 1Z4RA 2AQ1A 2HFFB 2KDGA 4P5TD 4P23D 3CZKA 2R0ZH 5IQ9A 5CSZB 5CD3B 3OWRA 4ZSOA 4N2NA 3P11L 2C3GA 2GU2A 4UDUB 2I32A 1P4IL 1OAKH 3MBEA 4JM2A 5JIPA 5D1ZB 3U4AA 7CGTA 1HJCA 5C0FA 4NLAA 1GYUA 2KHAA 2WN3A 1LAPA 3GXFA 1M3JA 3GSWA 2IOOA 1E65A 5AVTB 3U1SL 3UXFA 3GBMH 1J8RA 3OGOE 3QR0A 5H8DA 1C08B 3N44B 2FJGB 4WZ9A 2DMHA 3ZKMC 2Q4YA 5C07E 4KKAD 1OSZB 3VD9A 1Q9LB 4QOKE 5C6TH 5AOLA 5C1MB 2D2CC 2EDHA 4I1NB 4PI0A 2KLTA 1HJBC 2IBZX 4GRMB 2BINA 2DIJA 1GCFA 2BO9A 4HLEA 2OK0L 4Z7NF 3TH3T 2AQTA 2DLFL 4F9PA 3Q7JA 4HJEA 5IB9A 3F84A 1UD8A 4HWZB 2VDKL 3TBBA 4JHAL 2DKSA 4HUUA 2EYRA 3ARDD 2VXSL 2Q6WB 4EN2A 5HSFA 1IGFH 1VGKB 3SPGA 4DGWC 3D2TA 4F7TB 1E28B 2Q7BA 1MJ8L 1YZZA 3MU3A 1R3IH 2BNQD 3JWOL 4FG6C 3TJHD 1HEEA 2IIJA 2B5GA 1ZJAA 1DVQA 1YEHL 3IDNA 3NACL 4RZKA 1DQIA 4NM4H 1E5CA 1QA9B 1KDIA 4BM7A 5DWMA 2ADIA 4D0BA 3D2UD 3GI8L 3ENEA 4KK5D 5EEUA 2CUHA 3UL4A 4WI6A 4YNYB 2ATPB 3LPPA 4H1LA 1P53A 5TFSH 5TDOA 1A21A 4FOMA 1ZT4B 1JHLH 4QYOB 4Q52A 1S5HA 3T1FB 3QIUD 4GBXB 5I6PA 15C8L 4UT7H 2WANA 3GJFH 1CGTA 3B3SA 3BP6A 2KPWA 1VPOL 1P7QA 4KVOE 4PJCF 3WN5B 1RZKC 2ZUYA 1E40A 3MUGB 5SWQB 4TL4A 3W2DL 2X9XA 1JFQH 1FBIH 2WLLA 2EDKA 3FTGA 1ZHKA 3SYQA 3FO2B 3KL0A 1P84K 3BKML 3ELAT 4Q8BA 2O5XL 1MIML 2R9HD 2ZPKL 4LQGA 1GAFL 2VE6B 3HMWL 3L7FA 5KTDA 5E8PB 1IEAA 4CUCA 1MAKA 4KOUA 2OQJB 3QQ4B 2NY1B 3Q9PA 5K1JA 3DGVA 1U8NB 5ILTL 5DZVA 1U6AH 1RZIB 3ILPB 2VDPH 3FNKA 2V9UA 2F9BT 3JWDH 3EYUH 4P5SA 4HISA 2Z7YA 3R7RA 2AERT 2PXYD 3VD7A 2OSXA 5CR1A 5HHVH 4R5XA 5JM6A 4Q4EA 2BNQE 3DO3A 3BI0A 3NESA 4EI5B 4FFTA 3U4KA 4ZQKA 3SJFA 3DDGA 1ZT7B 3RTQA 3CH1B 5IUCA 3HUVA 4Y1SA 4C7HA 1MCOL 2M8XA 4CMMB 1XE4A 1A6ZA 5K9QG 4K8RD 4UZUA 5AKVA 4ZGYB 2J12B 2KZ1B 1FNGB 3KS0J 2PTUA 4OZHB 3VGEA 5LYDA 2FX9H 4IGBD 2I60L 4PLJC 2ZG1A 3CDYA 3ZDYE 2A4CA 1CICA 3MTXA 5DK2A 3C2AL 3U83A 2ICWA 1NGPL 2XZCL 4E9TA 1X12A 3V9CA 1WWAX 4GS7C 4Q6IC 5F1IA 2MQ3A 1CLOH 2VM4A 4ZG1A 2EE2A 3Q9QA 2D3NA 2IMMA 3BI1A 5DJZB 4EMZA 4U6YB 4H88H 4MNQD 2EKSA 3PHAA 3SKMA 2HT3C 3VMPA 1X5ZA 3PL6A 2EQDA 5EO9A 3NP4A 5E6YA 4KVME 2C4XA 2OJZL 1JD7A 2Z0ZA 1QD0A 2NZ9D 3U9PL 1KJ2B 1YEEH 2NY7H 3KXFD 2YJLA 4U6VH 1P6AB 1S7RB 1P69B 1ID5I 1P7BA 2QQQA 4MA3A 3QUMH 3T04D 4MS8C 1R3NA 1IKFH 2C8NA 2DMCA 1KPRA 1SLXA 1PIFA 3IDMB 1KGWA 1JF6A 3CSYA 4YGVA 3AAZB 1H19A 4LLVB 4RUHA 1VZGA 1GTNA 2HCZX 4Z7QE 4Y4FD 2EEFA 2EK8A 1AACA 1NGWA 2GHZA 4WI7A 5EIIA 4MQ7B 4ESKA 2OW7A 1OM9A 2JKNA 3WAKA 4AKQA 1F2PA 5T3ZD 4O2CB 4JM4L 5H86A 2J8UB 2NRDA 4UZGA 4NUPA 4RIRB 4GW4A 4DKDC 1DBMH 2ZUXA 4HAGA 4XBEL 5AVRB 4L8BB 4W6WB 5DQJA 5IMMB 5EOQH 2I25N 4J3OG 2EE9A 1V5JA 3SZKC 2PN5A 2AZAA 4LLQB 5EZJA 1CFTA 2IDUA 1EFXB 1J9TA 2B39A 2WGXA 3KBPA 4L29A 5E1AB 4QRPA 4I87A 4ZTPH 1AGEA 3V0VB 5ENWB 4UQDA 1D5MB 2NY3B 4AYMC 3SGDI 2AJ3B 4PY8J 4B9KC 2QDVA 1UCTA 3MA7A 3R7QA 3UADA 4A2GA 4ZS6C 5M7QA 1AFVH 5ESVB 1U3HA 4KSAA 4HCRH 2O53A 3WSQH 1T21B 4HS8L 4MCNA 4IEFA 3CFJA 4J3OF 1M71A 4MNQE 1OAXH 3W39B 1ASQA 4JY4A 1HKLH 3BAEH 3CFUA 5DRWA 1I1FA 2F74B 3LEXA 5DD1H 5FGRA 2XJLA 1UD2A 3EDEA 4OV5B 1OP4A 4K3DH 5T5FL 2OZGA 2B4DB 4X5KA 2BY2A 5H2BB 3SQOH 3L5IA 1BXUA 3WLWD 5EMIA 2X41A 1EUUA 2YUWA 3KXFE 4FQLL 5HJBA 1GYCA 3D30A 2VO5A 3TJEH 1PDKA 5F3BB 2V33A 3U9WA 2ZOLB 5E8NA 2J1ZA 4WSGA 1YA5A 3OSVA 4TLTA 2UZIH 5FVJA 4MFZA 2XBZA 3D7GA 1QBAA 2BVOB 3FT0A 4NO5A 2DJMA 2F1EA 1T2JA 1T66D 1LGVA 3P3SA 4NQVA 4I9XA 1ORQB 3VD1A 1NAKL 4GAJL 1HS6A 4M5YL 1UD6A 1NFDA 4HHWA 4IU2A 2UZYA 5FO7B 4LP5A 2VQ4A 1C7SA 4LDEB 5T3ZE 1KBGL 4UT6A 1P4BL 2OZ4L 5MEQB 1A5FL 1WZLA 2BRQA 1KYFA 1RUML 5DJ8B 3GKWL 5IB4A 5I6KA 3LX9A 4YMPA 5CN3A 2F5AL 2CDFB 5FX3A 1QPKA 3ZT7A 2YOCA 1UXWA 3JT2A 2OYMA 3K8LA 3ETBF 2WYIA 3QIBC 1TXRA 3LVTA 3O6KL 3W0WB 3R0NA 4GO6B 3LRSB 4WGWB 5B21A 3J7HA 3G5ZA 4E9RA 5INDA 1L7TH 1NANI 4XHJD 5DYOB 3MNZA 2H3KA 2FEDD 3DJZA 5IMLB 5TDPB 2WXHA 2F5IA 4YHML 1J0IA 1H3PH 1TJHL 4KDWA 3IJSB 4FTVD 1H6TA 4G43B 2EILB 1V54B 2DQUL 5GRJH 5K9OB 5CN1A 3S9LA 4UWQB 3T3ME 2UZPA 4EWTA 4NJ9L 4DQAA 1E27B 4NDMB 1MFVA 3HNSL 5I1JL 2YN3A 1I9EA 5FUOH 2Y5TB 3CCHA 5F3HA 4UWIA 3I6LD 3UYRH 1BIHA 4APXA 2ZSVB 4YFEA 1OGAB 3UO8B 1NIFA 3GUFA 3UJJL 4DHLA 2QKIB 2W07A 3NPSC 2DWDA 3B5HA 1E7UA 1PG7H 3GSNA 4OUUA 3DX8A 5K9QI 4UAOC 1FDLH 4TRPL 4TULH 5C09A 2ZAGA 1U91B 1R1CA 2H3NA 1M7IA 2C9XA 4BA0A 5FDYA 4N5EC 1WDAA 2EKJA 5E6ID 4HWUA 4JY6A 2WUBH 1WIPA 1IC7H 3CZSA 1OE3A 3EUDA 4IOSD 3VFPA 1WICA 1WCBB 1L0XA 2F68X 4ZFOA 3IU1A 3VRIB 1JG9A 3EZJB 3T3PF 4K7PY 3C12A 1DZBA 1G4RA 4MD0B 3FYIB 3V5DB 5ABDE 3D4ZA 3OKOA 1IGBA 1HKFA 3TT2A 1CC3A 4Z7WE 4OIWA 3C8DA 4PJFE 4Y1TA 4YHKL 2YNDA 1J0ZA 4B9FA 4RNRA 3FXTA 5I1GL 4A7QA 2CLVB 5DO2D 1BQ5A 1FFRA 3K2UL 3L3HB 2Q87A 3SY6A 3PNWB 4NZTL 4FTVE 2VMJA 3MNWB 2CG9X 4XNBA 4XNZC 1RUPL 4TTGA 4MMYB 5BZZA 2WQUA 3CHRA 3D66A 3B3VA 4POZD 4KUAA 1JK9B 2O1AA 3BPCA 1DSFL 4Y4KD 1KB9J 3NSJA 2D7PA 3Q44A 4HBCH 5F7FA 3LKSB 2PMZA 2BZDA 1VERA 4BUQA 1FG9C 3I6LE 1OK8A 4QXWA 4OAWA 4WHDA 3VG9B 5B3JE 7FABL 1XBDA 4UZSA 3JSSA 3ZRCC 5JO5A 5IFHH 3BUTA 1ZHLB 2EK9A 3U1PA 2ZOFA 3EXNA 3B8GA 5D4HA 2XVGA 4MTMA 3KPRA 4WU5B 4AUJA 2GJ6D 1U4FA 2Q8BL 4QT5B 1ZHNA 4ZT1A 1AY1H 3WELA 5C0JB 1VCBC 5EO0B 5CCHE 5KS9E 4B0MM 2VXUH 3CN4A 3GSQB 4LF3A 1VAHA 1OL0A 2VBQA 1NCGA 3WC6A 2XWBA 2GK0B 1QFHA 4M93C 5A3ID 3NIDF 4GKLA 5TE6L 3LKQB