2NSMA

Crystal structure of the human carboxypeptidase n (kininase i) catalytic domain
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
399
structure length
390
Chain Sequence
KLAFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNKEALIQFLEQVHQGIKGMVLDQNYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human carboxypeptidase N (kininase I) catalytic domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Carboxypeptidase N catalytic chain
total genus 136
structure length 390
sequence length 399
ec nomenclature ec 3.4.17.3: Lysine carboxypeptidase.
pdb deposition date 2006-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 2nsmA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2nsmA01
2ANPA 4K3NA 1Y0YA 3FMCA 4NGSA 3H8FA 3BI1A 3D7DA 4MRIA 1QQ9A 1GYTA 3CDXA 4NGRA 4P4IA 4UEEA 1TXRA 3B3TA 4CPAA 1NSAA 3GB0A 2V8GA 3H8GA 5JGFA 3H8EA 4W9YA 2IQ6A 3PBEA 2RFHA 4F9VA 3SI1A 4MHPA 1XRYA 3KQXA 5K8PA 1YW6A 2Q51A 1Y7EA 3MRUA 4NJRA 1XBUA 1YSJA 4MHYA 4IAVA 2BCOA 4Q7AA 1VHOA 3LMSA 3FEDA 5ELYA 2QJ8A 2J9AA 3VH9A 1PYTB 1FT7A 3FH4A 4PXDA 1ZG9A 4OKOA 3KCPA 4YU9A 4AXVA 5HVGA 4Z65A 4EFDA 3PB9X 2C6GA 4EWTA 5LYFA 4OP4A 3VARA 4A38A 4R8FA 4R76A 5LYIA 2PJ5A 3GLJA 1CPSA 5HVFA 3ISZA 4P6YA 4MXUA 2ZOFA 2BOAA 5JM6A 3SJEA 3NA6A 3K2KA 3B35A 5J1QA 4ZY1A 2WYRA 2PJ1A 1XJOA 3PB6X 5CPAA 4DJLA 1ELLP 3WT4A 4ZX8A 3CPAA 3QNVA 3IFEA 1ELMP 4U3SB 5K8MA 2PJBA 1ZLIA 2XEFA 2PIZA 3IWWA 5LYLA 1YMEA 3K9TA 4ZY2A 4OMEA 3WABA 2ZEPA 2F7VA 3HLPA 3D68A 4G1PA 2DEAA 3PEIA 3JRUA 4TWEA 2XEGA 3SJFA 3V38A 1VIXA 2AFXA 4P4BA 3KL9A 4PPZA 3SI0A 3RAMA 1F2OA 2QYVA 2C1CA 4YWYA 4KSIA 1VGYA 3D7GA 4NJQA 4MCSA 3TC8A 3VATA 2PJ9A 3D7FA 3B3WA 1Z8LA 3DLJA 1OBRA 4R7MA 1UWYA 1ZG7A 1XMBA 4X3RA 3PB4X 2ZEMA 1AMPA 2GU2A 4P4FA 4UF4A 2C6CA 2V8HA 2ZEFA 4NGMA 2I3CA 1DE4C 5JH9A 4PXBA 3KHZA 1R3NA 2PE3A 5IB9A 3I1UA 1CX8A 3RZAA 3D66A 3SI2A 1H8LA 1JQGA 1LCPA 3LWUA 2HB6A 4PQAA 3FX6A 1R43A 2AFZA 3CPXA 5THWA 1HEEA 5DS0A 5D8NA 4JYWA 4UEFA 2O53A 4OC1A 2JBJA 2ZEDA 3GUXA 2PJ4A 5AQ0A 3KI9A 2AFOA 4FBEA 1Q7LA 1CBXA 2PJ3A 4MCPA 4NGQA 2OR4A 3FF3A 3E8VA 5D29A 1NKGA 2EWBA 3IJ3A 3S9MA 4A39A 3SJGA 3IEHA 1QMUA 4B6ZA 8CPAA 4NGNA 3KR5A 2NSMA 2F8HA 2PJ6A 1TF9A 1TKFA 2V77A 4YOKA 1LAPA 4DUKA 2PCUA 4JZ0A 3B3VA 6CPAA 5G5DB 1F57A 1BPMA 2ABZA 1AYEA 4LQGA 4GM5A 2C6PA 2ZELA 3KASA 4NGPA 2GREA 5I4MA 4OC2A 2HC9A 1TKJA 4FXTA 1Y0RA 4ZYQA 2PJ0A 1LAMA 3PFEA 3T8WA 2CTCA 3IC1A 1IY7A 4ZX9A 4MCQA 4WWVA 4FUUA 4X8IA 7CPAA 1ARLA 1F2PA 1M4LA 1Z2LA 3PB7X 1Z5RA 2IJZA 1YLOA 3NH4A 3TX8A 4MHZA 2Q43A 4OC0A 3BI0A 2QVPA 2PJAA 2PJCA 5HXDA 1PCAA 2PVWA 5CBMA 1CG2A 1RTQA 2XEIA 3NJVA 1LFWA 3MN8A 3PB8X 3RBUA 4ZY0A 2V8VA 5K8NA 2O4HA 3WC7A 4MMOA 2PJ8A 2ZEEA 4RUHA 2XEJA 1EE3P 4MHNA 1BPNA 3DGVA 4OC4A 2G9DA 5K39B 1YW4A 3FJUA 4OC3A 5LRGA 2FVGA 1HDUA 3KHXA 4F8ZA 5K8OA 2IMOA 1LOKA 2PJ2A 4UIBA 2B59B 2JBKA 3N5FA 3G3LA 4WI0B 3PFOA 1VHEA 3FEEA 4X2TA 5LRKA 1KWMA 2Q4ZA 4P44A 2RB7A 2CTBA 4A94A 2EK9A 2CF4A 2PVVA 5LYDA 1HDQA 3V7ZA 4O23A 4FL4C 1ZLHA 3IIBA 3SJXA 4BD9A 4P4DA 2AFWA 1ARMA 4TNUA 2ZEHA 1TKHA 4EMEA 4IHMA 4PXEA 3NH5A 2EK8A 4MCRA 4NGTA 2ZEOA 4P4JA 4EIUA 3NFZA 2POKA 4IK2A 1CPXA 2AFSA 1BAVA 2NYQA 3S9NA 4NFRA 3D4UA 3CT9A 2BO9A 4ZI6A 2CIJA 5F09A 2GLFA 4UIAA 3D67A 2OOTA 2AFUA 3KQZA 4IYKA 1FNOA 1IGBA 3FVLA 4OC5A 3NH8A 5HVHA 4P45A 2AFMA 4DYOA 3BXMA 2PJ7A 3D7HA 4A37A 3ISXA 3B3SA 4FAIA 4P4EA 3NJXA 3KZWA 4OIWA 4PXCA 2V8DA 3BHXA 4UEZA 4WJBA 2PRQA 3KR4A 3KGQA 3B7IA 2JEWA 3PRTA 1CP7A 2ZEGA 3WC6A 4F9UA 1XFOA 1BLLE 2ZENA 4H2KA 3HUVA 1LANA 3HN5A 2WZNA 1DTDA 4OIDA 4ONWA 4P10A 3L2NA 3B3CA 3WC5A 3IO1A 4FWUA 5LRJA 4R6TA 1ZG8A 2ZOGA 1TF8A 3FECA 3PBBA 3S9LA 2GLJA 1CP6A 2VL1A 3B2YA 2XHNA 2PIYA
chains in the Genus database with same CATH superfamily
5I74B 3HC3L 1H3XA 4NLHA 2VR5A 4E9WA 4X7DC 1KCVL 4FDWA 2NXZB 5IROA 3W9EA 1QI5A 3BCFA 2DH2A 1XH2A 2YLHA 4GS4A 1ZE3H 2AJUL 1U3ZA 3GBNH 1JZHA 4N2FA 5B1JA 3MODL 5D7IF 4FXGB 1BYNA 4OZHB 5EULV 3GMMA 1G1CA 5D7IE 3IU3A 2VZYA 4CPAA 4XMLL 4OT1H 4NQEE 8PAZA 3IXAB 1NSAA 2E9JA 1AXSB 3ARSA 4W6YB 4BGLA 1KJ3H 3HZKB 3EFFB 3GM0A 4P2QA 4U1LB 3QR0A 3CZXA 1QQDB 2BW4A 4Y4FA 4HA1A 4ZBJA 1NPNA 3L54A 4FXGA 4ZOAA 1R34A 2VDOB 3IK2A 1G7LA 1ZVNA 1KJ2H 4KI1A 2Q7YB 4NPJA 4I18A 3T0AA 4WTWA 4U6TA 1ZDQA 4MAUH 2VISA 2X88A 5JDJA 3P2FA 2JWYA 2UWEF 1AYOA 1LRZA 3BKCH 4K8RL 4OGAC 3D08A 4E9YA 3P2TA 4N0UE 3ULAB 4N68A 4RIRA 1BF2A 1U8MB 1E9OA 4KRMB 5IJKA 3QJFB 3FEDA 5C07D 1XF3B 1BECA 1W72A 4FQ2L 3ECQA 3DXAD 4HCIA 3AAZA 1QFUH 1IKOP 4NN7B 5ESQA 2HTKD 4NRZA 5TQ2L 4TTGA 4QBJA 5T1MA 5ICZA 3VVWA 1PYTB 5KVEE 3ULUF 1TEGA 2HN7A 3QUXA 3H9SA 5E8NA 3DUHA 3U7WL 1DVFA 4NDMA 3BGFC 1VZIA 5CUSH 3K4DA 2OMWB 2H0JA 5I26A 1S7VB 4HUVB 3EOBB 4HEPG 3UAJA 1MJUL 4FFZL 5HVWA 3ZQXA 4QWWD 5L6YL 4XXDB 3X1BA 1BG1A 3NVQA 4KNUA 3Q05A 2ZYRA 3C08L 4J6RL 3DV4B 2QQNL 4HG4K 4WY7L 2GFBB 2XQYG 4QKTA 1BW8A 4X6DE 3K2KA 1BEYH 2G3NA 1QLEH 2VITB 4PSXA 2BNRE 1UXSA 2ZAHA 2B4BA 3VXNA 5C0JA 1JFQL 4LHUB 2BRRH 3ARFD 4H88H 4MMXB 4IRZH 1FVEA 4L8SC 4YX2L 3VGDA 2BP0B 3LIZL 1AS6A 1CDYA 4PY8I 4TYUA 3DO7B 4G11A 4ZNCD 4PFEA 2NXYB 2QKSA 1AZRA 3QO1B 4HMDA 5HVHB 1WISA 4OM0L 3QEQD 1BAFL 2GCYA 4DP2X 1L3WA 3UJJH 1UM5L 1AO7D 2J8UE 3SODB 1FCGA 3WABA 3L3KA 1SJMA 3M86A 5LN4A 4XMLH 5CLTA 4LBAA 1NBYA 4PGCB 4BK5C 3T9WA 3C5SA 4KOCA 1JYVA 4UTAH 1A7OH 4XC3L 4MY3A 3QAZB 4PJFF 3JRUA 4JCLA 4QRAA 4XPFH 3KPRB 3M1BB 2Y7NA 3A0OA 3AMLA 3RDTB 1SM3H 5DS1A 4DW2H 2WQXA 2O5XH 1Q72L 1KIPB 5IB5B 2X2JA 5CCJA 2PR4H 3P4NA 2H6PA 4U0RC 4OFKA 5DC9B 4PLJD 1NSLA 3HZVA 4FC3E 3X12B 3QHZL 2YNCC 5EUOA 5KEZA 5HHOB 1WDAA 4K7FA 4PJ9A 4N90E 4PJBE 1PSKL 2O5ZL 1R4XA 1TKWB 5KJRL 5CGBA 2Q8BH 2JJVA 4PV8A 1ACXA 5AKVA 3SEPA 4DGIL 2UWEA 5E7FA 3TIDA 1U58A 4EOWL 3ZZIA 3W56A 4JAMA 3WO3B 3NFSH 3GHPA 3HG5A 4RFEA 1J0HA 3D2TA 4K7PY 1I7TB 1T2QH 4PSRA 2UUDH 4AIZA 1IVTA 1TDQA 4TUOA 2ERJB 3MJGX 4JO5A 5DO2C 1HHHB 1MAKA 1SRDA 1U8KB 1T83C 1JFHA 1REIA 2FHCA 4JKLA 3BWUC 4B9CA 1S7WA 1S7WB 2BNRA 2BNRB 3UP6A 1XSKA 3VFVA 3GS0A 1I85A 3OZKA 1O7DC 5E94B 5AOKA 3SI2A 5EU5B 4JM2F 1YNKL 2IPUK 4EN3D 1NFIB 3LKSA 4FMFA 4QT5A 4X5LA 3FX6A 4RDBA 5BV7L 1V54B 2QQNH 2W5PA 4YHLL 1U58B 3AT0A 3T04D 4ELKB 4HD9A 2KL6A 2P48B 2NMTA 3ZKXB 4M1CC 1AKPA 5D8NA 3BFOA 4N2MA 4N2NA 3FTSA 1BVZA 2J8UB 1NJ9A 1QHOA 3QUHA 4Q52A 3ZTJG 3R0NA 3MLZL 1LO0H 4WNQA 1MLCA 3EZ8A 4KO9A 4O51A 4GRWE 3GUXA 4YDIH 2EDHA 4MAYA 3PL6C 3GM8A 4IRJD 3OLDA 3ZTJH 6PAZA 2OH1A 2A6KA 3RFZC 1U8OA 12E8L 3BIKA 4AVHA 5I19L 5D7LD 4XZ4A 4GUPA 1EERB 2K4AA 5FKAA 5C0AE 5C08E 1PZ2A 1IEBB 2DWEA 4NYLB 4WI0A 1RJCA 3S4SG 5H2BB 2YHGA 3PV6B 4KZEH 1NKGA 5D6CB 2XQYA 3CFCH 2YAMA 1DLHA 2PCFB 1FG2B 5F70A 3UZEA 5K9JL 4XNYL 4I3RL 2VXVL 2UZXA 3SDDA 3S34H 3LQZB 4JPSA 5EO0A 4HIEA 1QMUA 4BIKA 8CPAA 1V27A 32C2B 4BKLB 3STZB 1KGUA 3R18A 5F93C 1MH5B 2K9FB 4TUOB 2J20A 3I3EA 1NCGA 3S6KA 3TEZA 1M57B 2RMNA 2NSMA 4Y16A 2F5IA 2SODB 2VAJA 3V6BR 3N1QC 4MA7L 1S46A 3IKKA 2FRGP 4MDJA 4PJGA 1O7DE 5D1XC 1OT4A 3MVSA 2ALWA 1S7XB 1W0WB 1MRCL 2R2EA 1EEUA 5A2FA 5A2CA 2J44A 2OTUB 2XCMC 3ROOA 3FO2A 3LS5L 4OGQC 1JWUA 3NCJL 2CUIA 5IM7B 2X05A 1FZJA 4GH7B 2ZF9A 1HINH 4NM8L 2KUTA 4G3YH 3UYOD 2VQ1B 3HBPA 3DDFA 4FERA 1VEPA 5K9OB 2J71A 4HOXA 5FEBA 4CGPA 5T8IA 2ZXVA 3EFDH 4TOYH 5GRVK 4YBLB 1U8NB 3H42L 2JXMB 1NUFA 2GBVA 4NWTL 4X8GA 4P5TA 2JFCA 4FXTA 1IFHH 1YECH 3EJSA 5IF0A 4APQA 1KTRL 3QO0A 3R19A 3HE7A 3QZPA 4WW1A 3LZLA 4ZX9A 1KYUA 4ODHL 1AQ8A 3FUNA 3ULUD 4NN7C 5FOBB 1AG6A 3WEMA 1FG9C 3P3RA 1ARLA 1KIPA 3C5XA 4NUQA 1TXKA 4MB1A 5EOTB 1T4KA 5TJWK 3RL2B 1M4LA 1OGAB 1W9XA 2E8YA 2KLTA 4KK5C 5EH1A 2AQRA 4R4FH 3UTTE 2ZQKA 4WRLA 5T3XL 2F58H 1E8ZA 1KZYA 4WW1B 3STLB 2OKMA 4QXGL 4ZUSA 2RB8A 3ZYZA 5E5UB 4CN1A 4ABUA 2PJAA 4QO1A 2IOMA 3NCFB 4P3DB 2PXYD 3AQZA 3P40A 2BS8A 4Y9CA 3G8WA 5IHWA 3BRFA 5C0AB 2F15A 3ZE1B 3EOTL 4WO0A 4MTMA 2FJFB 3VG0L 5LVEA 4XVOA 5D55A 1XWVA 1JK8A 4NNYA 1DP0A 4I2XB 4MXWL 1LWRA 2CDGB 5E6ZA 4APXB 1DBKL 1SHWA 3N9GH 5J13C 3DI2B 2OTUA 2GUOA 3P4OB 5ILTL 2O4HA 4UT9H 1JDCA 5EU7E 3V4PB 2H26B 3B43A 4N3TA 4L5FE 4RH4A 3AT9A 3HUJA 4UFVA 4PJ7B 3VWDA 3THMH 1P5UB 3QJUB 3SD2A 3QPXH 4U9ZA 2OMUA 3L2LA 1UXWA 4UU9B 1A7RH 2REFA 2WB1A 1A14H 4GP8B 1JPFA 4YDLC 3GSQB 4Y4KD 3DPBB 3VXPA 3MKKA 1V3JA 4I3RH 4UT6L 2IMOA 4B5EA 1GSMA 1ET8A 1T5WA 5CFAA 4ZOEA 3PP9A 2HMID 3RZCD 4L3EE 4WUUB 3EF4A 4UM9D 4GP4B 5FKAB 3EO1A 2K6YA 3NPSB 5DUML 2F7RA 3IBOA 1H9DA 1CFSB 4P4KC 4D8PA 3EW3B 4RBPK 5KSBA 3U4EB 4KVME 4MAYB 1H5BA 1VSCA 3K0YA 3KM1A 3BP6A 5CSBA 1XGZA 3WFEL 3MBWB 2XN9E 1V7NH 3ARBA 1I7UB 2XPYA 1W72B 4UQ3A 4WI8A 4XBEL 4DN3H 2XKNB 4EMEA 4HHGA 1NIFA 1YNKH 3NH5A 2P0WA 3DIFA 5E56A 4WI7A 1OTTC 2BIHA 1OCWH 1G0DA 2XWJA 3D25B 4IS6A 5ISZE 3CK0L 3TZVB 1WZ1H 3FNCA 4K5NA 2IAMB 4HLJA 1G6RL 3NFZA 2DQCH 2VDLH 1S8DA 2VKXA 2QADD 4CN6A 1KIUB 2CO6A 4MZ3A 5GHWH 3VNZA 2AFSA 3MRHA 1NEZA 2KZBA 4OJYA 5CZVL 4MDJB 1OQOA 4NI3A 4PJGB 4PJ9D 3ARRA 4X7SL 3F7RA 1GGYA 4I9XA 2WQRA 4QHKJ 2FJHA 3OX8A 4I2XE 1RZJC 3TO9A 1ZHKA 4ODUA 4FD4A 4K9EC 5KYXB 4OCNC 3IGAB 2AFUA 1G7QA 1WBYA 5FGBC 3ZHFA 1DLHB 5EBGA 4G8IB 4LVNB 5JMRA 4LLDA 2HRPL 3QULA 2MCPH 3T4YB 1UA3A 2EEDA 1L9NA 5SWZB 4R9MA 3BGMA 1AKJA 2GK2A 2ZG3A 1E8YA 3K2UH 3RWFB 2Y07H 3ISXA 3HJ0A 5B8CA 3SKMB 4JFSA 4WNJA 5I76B 1IEAA 1DVXA 1U92B 3BQUA 3QHFL 4JFHD 3B2PA 4WO4C 1T0NA 4KVCL 1ZLEA 4WUUE 4Y9EA 5FA4B 3F7YB 3O3AB 3VGAB 1INQA 5DMIH 3CSYA 4NBYB 1IV8A 3FCUB 4YFLI 1JERA 4MAUL 4UNUA 5ID1B 3RRQA 1KCSH 4X7CC 5I24A 1ZTXH 4N1CA 2CMRH 1Y6KR 3DURA 1G43A 4H8PA 1SEBA 4W9ZA 2A38A 1LANA 3KD4A 2NX5A 4NPYB 4JZJB 1LO0L 3WXVL 2NYYC 3FUEA 2ZCHH 1I1FA 4JO4H 5TF0A 1J48A 1WCQA 3GRGA 1C16B 3EFDL 4GQZA 2A9DA 1ZIAA 3C5ZD 2G60L 2ZOGA 3P3UA 2YMXL 4BSVA 1VHSA 3ZDZE 4GSXA 4HPOH 3N40F 3NZHH 5C07B 2XN9D 4KK9D 1WFIA 1TLMA 5LJYH 5FGCE 2D7NA 5HDLA 2EVIA 3ERXA 4GMTL 3EO0B 1PCSA 4ACPA 3EDEA 1BXXA 3S5ZA 2Y2WA 3DPDA 2ANPA 5FGBA 3ZIYA 4PW3A 1F2QA 1I7ZB 3REVA 3MFFA 3BI1A 3QI9B 1KULA 2GFBA 1G6RA 1Z9PA 1QLFA 4ODTH 2PETA 3LKOB 1HCVA 4JR9H 2H8PB 4C8XA 1VKXA 2QQKH 3TEXA 4G8EA 1L3NA 1VCAA 1UWXK 1GGIH 3K72B 1KPUA 3QA3B 4UQ9A 3BQUC 3SO3B 4ERSH 2JKXA 4M3JA 3HS0C 5DJYB 1GAFL 1CU4H 3V79C 2YSTA 2J2ZA 2J2ZB 4FTVD 1N64L 1ZS8B 1YMMA 2OP4L 4QHLB 5EOCL 1ZK9A 4ONUA 4R4BA 4K23L 3Q0HA 1PD0A 2D8KA 4FQ2H 4UILL 1M44A 3QHZH 1TFPA 1ID5I 3LRLA 2DYSB 4NUGH 4NSQA 1DQIA 2HJKA 2R4RH 5IB1A 3PWUA 2X42A 5K69A 1QKZH 3I50H 2F0CA 4BQBA 3SPIA 3G3SA 4B95C 1D5BA 2VSKB 5C0AD 2G3TA 4ISVA 1QW8A 2Y07L 2LU7A 1FLRL 5EEVA 4WCYH 3MOBL 5HHME 1TZ8A 1ITBB 3U25A 2EIDA 2PDOA 5ACZB 4F8PA 4WFGD 3BIBX 3VXOB 3V5DB 2VLJB 2AS5M 3FAXA 2Q3XA 3A6CH 3RGHA 3TA3B 4DHLA 3KDMA 5EBWB 1KCRH 1MFCH 3RY6C 2X4QA 3VD9A 3DX6B 3DO7A 2YAFA 3MV01 1ZG9A 1MW1A 2VXVH 3FS9A 3WIIL 3ZE1F 4DGYL 4Z1PA 3FT2B 4AXVA 2ZKMX 4B5PB 4RZCB 1F4YL 4OQTH 2IFFL 3PHQB 5EIVA 1VZGA 4N26A 1A21A 5JXAL 3IWGA 1HI6B 4IRJA 5CEYB 4AK2A 1N5AB 3FHQA 3UJTL 3VG0H 4R76A 4B27A 4IGBC 3QCTL 4PGDA 2VZUA 2HT2D 2YZ8A 4XTRC 5G2NA 4OV5B 4G8FA 4A2HA 1YEJH 3CFJA 5GGUB 2VH5H 4P6YA 3IFLH 4KKQA 4FNPA 5D7JA 3DJ9A 3MJWA 4G1MA 2X6MA 4M43H 1FZKB 4M5ZL 2WYIA 3MRRA 3A4EA 3FU0A 4Y4HD 3LEXA 1RI8A 4G59C 3H0TA 4B60A 4JY6A 5T1LB 4AV0A 3FW6A 4QRRB 4EI5C 1GKOA 3HCVB 3KPQB 4TVPH 1T0MA 4QCIB 3EGXA 2DQEH 3HLAB 1X7QA 3EUUA 1QZNA 3HFMH 3TP4A 1Q2DA 3DOSB 5HJBA 4AUYA 5I8CB 1FYTA 5I8CA 4PVNA 2ENSA 4OB5L 2J12B 4XVSH 2G3XA 4ZAKA 1ED3B 2VZVA 2J4WL 1LO5B 3V0IA 3MV11 3K9TA 4Y2OA 4U1HB 4X2UA 3V4UH 1P0HA 1Q9LB 3O2DA 3GGWA 1G7QB 3OLEA 4XR8C 2ZEPA 4MFPA 1PU0A 4JFZH 2NQCA 3V0VA 3UY5A 2VXSL 3LEXB 3K8KA 1R3HB 2CR3A 3BXNA 2DQTH 4UTAA 2Q4VA 3HHSB 5DRXA 5LCVH 1G7PA 1SNRA 2XT1B 4C58B 5KSUA 1H15B 1KOAA 3HAEH 4JBSA 3CCHA 3GMRB 1IL1B 3APFA 4PJCB 3U2IA 3ECUA 4RDQG 3CLFH 1GZQA 1FNSH 2EXSA 3N0AA 5IWLC 1FFTB 1TJXA 3Q2VA 1W80A 4G7YL 1GGTA 1CGWA 5KS9F 1RU9H 3SCMA 1FL3A 1URLA 2CBPA 1X5FA 2BNQD 1QBLL 2JKSA 4QXWA 3P9LB 4GXFA 1BX2A 2EO9A 1Z8LA 3S6FA 4U0QB 5SWZD 4YDLB 2WKOF 1ZT1B 3P73B 2H0FA 4UTBH 3KL3A 4FXKA 3S3DB 2C9VA 1UYWL 5IEKB 3U6RA 2AK1H 3O9WD 4H0GA 3UO1H 4NRYB 4LNVA 2DJUA 5D7IB 2BNRD 3RGBA 3G08B 1LD9B 4HJIA 2N7BA 3HAEB 1TZOA 1BJ1H 3TYFA 2X4PB 2WZPD 1XF5B 3TCTA 4WUUA 3LNIA 1IQWL 1NGPL 1UEYA 3CFNA 4PSPA 4ZODA 1S7RB 3G6JE 3MBEC 4GUOA 3ET9F 4QXUH 3R0MA 2R4SH 5I75C 1QRKA 4MNGB 1TU2A 1TMCB 4EPSA 1VKXB 2BSRA 1EVUA 4HDIB 5GRZA 3BQUD 1U95A 5CEZD 1CJYA 1A9EA 2CRMA 2AMGA 2N0KA 3HVNA 1CYXA 2O53A 3LN5B 1B6BA 1K4CA 2B4CH 4OTXL 2GITA 2I60L 3EOAA 3L9BA 5C09A 3N44F 3ZTNH 3WS6C 3MJ8B 4PYGA 5EEUA 4PMFA 4JQXA 2DYPA 3B7RL 1AY1L 1G6RH 4L4TD 5AAPA 2Z4TA 3KNBB 4PJCE 4LCIH 3JTSA 4NUJB 2AP2A 1ZLUH 3E8VA 5CLWA 4O2FB 1D5MA 2QEJA 3SDYH 2A7BA 1RK7A 1T7XA 2DW5A 2IH3A 3VFPA 2DQUL 3VRIA 3GSWA 4OLXH 5EOCJ 2WXRA 3LMJL 4EDXA 5HYFA 1DVQA 4HNWB 2OSLB 1N8ZA 4TPRH 3GUTA 4EVYA 4LASL 4WCYL 4CAWA 3OR6A 3AG1B 5D1ZC 3ZMEA 3VUAA 2HMIC 1T83A 1MEXL 1AO7E 2XRAH 1X10A 2C1OA 3FSWA 1YECL 1WD9A 1PKQA 3L5WB 3GJFA 3NK4A 5D5MA 4DUKA 3QEQE 1IKNA 3ARFB 4JKPL 4AG4L 1RZ7H 3TWCH 5DJAB 5TDOA 1YMME 2I79A 2QPSA 2ZOLA 2E76C 2XTJE 2Z3LA 2D7PA 3KR3L 4JANB 4NNXB 2QL1A 5ETUB 3A47A 3BE1L 5A2LH 5LCVA 2O61A 1B4JL 1JZIA 4LSPH 4MVBD 4P4RA 3FO1B 1ZXQA 1G0XA 2BP8A 1T2XA 3O6FB 4WO4D 3S0PA 2XWXA 3TVMB 3FFOA 5I1IL 4AEHH 3BP4B 4X4ME 2H2PC 1GC1H 4JB9L 3I85A 3QJTB 3UAAA 3GIVB 3Q8AA 1HH6B 3MX0B 3MJ9A 4QB9A 1S3ZA 2Z7ZA 6CGTA 3EY5A 3C12A 3LIZH 3I6LD 1J8RA 2YUVA 1UZ8A 1Q90A 1CD8A 3MSPA 2CGRH 4C4BA 5FXCH 4XGZB 3WCYA 4RGMC 4JGJA 3PS6A 1FNEA 2NY4D 2Z7WA 4YSAA 4R5TA 5I6NA 2Q43A 4MSWB 5DZPA 1J87A 5I9QC 4LPTA 1QI4A 4CC1A 1EDYA 5A3ID 3QI9C 3H6JA 3VFMB 4F37F 5B1KA 4AQZA 5C2BL 1E4XL 1RTQA 3K81A 4P2AA 3HI6L 3MN8A 2NR6D 3GF8A 3OJDA 4KV5F 3SDXB 4C47A 1Q0XL 4MA3B 4X42A 5LBSH 5J7CC 1TCMA 1IGCL 1KJ2B 2GTZB 2Y7QB 3U1PA 1J8SA 1MFEL 1AIFA 2PO6C 3ZDXF 4DKFL 1YK3A 3EBAA 5CLZA 2UWEE 1Z4RA 4KMLB 3G6JF 4KUAA 1H6TA 1S7KA 1QFHA 5K9KA 5DMYA 3IDXL 2J5LC 3RZWA 4KPHL 2ZEEA 1A6VL 1JVOA 1M2VA 5KOMC 5I1KH 4JQVA 1YNLH 2B15A 2BZCA 4ENEC 4MA3A 4Q97A 1A6AB 1PEZA 2OX5B 3GSRB 4R2GD 5D9SA 1I8AA 2G9HA 1A4AA 1J86A 2HRHA 3WY3A 3WENA 4YXKL 2ZYIA 5LRGA 3Q8BA 1OD9A 1LWJA 2OCFD 5AKTA 5HDQH 4APQC 4JFQA 1AP2B 1QSEB 4P4KD 1E4WL 1P4IH 3DBXA 3QJVB 1XFPA 3V6OC 3BPCB 3BN3B 3LIUA 4UQIM 1EEZB 2PWDA 3MRNB 3IJSB 2BY3A 1U93B 1TYEB 1JZ6A 4IU2A 4BK8A 2IPKA 3GNML 2UXFA 3TYGH 1ZS2A 3NCMA 1K8DA 3HMXH 4DH2A 2RB7A 5SWSB 5T1JA 2XACC 3MCLL 4KX8A 4A94A 4Z7OB 1EVTC 1PZ3A 1Y6MR 2WP3T 3K3QA 2CF4A 5KUKA 5F71A 4LSPL 2B7DT 4FTVB 5DMJB 4BFBD 4OV6F 1E50A 3C2SA 3KR3H 3LQAC 4BE6A 3WY1A 1ZVSB 1KBWA 4IRZL 1BLNB 5F97E 3W9DA 4OBSA 3QDJA 2AI0L 3RJDA 3A24A 4OLEA 5MEOA 3TA4D 5C0AA 2C3VB 1KPRB 3GIZH 2XWBB 4X4XA 1BFOA 4CGMA 3SD5A 1C12A 2ZX8A 1W6LA 1TVBB 3GSVB 1KBGH 5CEXA 5HYJA 5C0EB 1NCNA 4X4ZA 2VLRB 1W0VA 2NY7L 5FYKU 2QSCH 2MCPL 2X1XR 5F2FA 2EDKA 4L8SB 1K6QH 2WK2A 1IFRA 1NCWH 5DWPA 4F2MB 4PJDF 4R3LA 3F6LA 4KZ0A 2XBTA 2KQMA 4OCRL 5LHDA 1PU9A 5AG4A 1OE2A 3L81A 3MLRH 4JFEB 4R7LA 3KWWA 1XIWD 4K71B 1BMWA 4P2QD 1YREA 1G87A 2CRYA 2MMXA 2JSFA 2W59A 1YPZE 2WJ5A 5K9OA 1A3RL 4RGNE 2FATL 1QBMH 4MQTB 3TF7C 4M6OH 3QDJB 2WQUA 4NEXA 3ISYA 2QQKL 3OKLB 3GO1H 4UCFA 3II3A 2EDLA 5AVRB 1BG9A 4OC5A 4NFBA 1KGWA 4WTQA 2V6HA 5FAAA 5HGHA 5IMMB 1KTDB 2WWNA 4J3XA 2GCYB 5D6DC 5FYLH 3L5XH 3T0ED 1E5CA 3VFRA 2J8OA 5JHDD 3B3SA 3KZ8A 4FHJA 1EZVX 1EJ6A 4FL4B 4OIWA 5DWMA 3FMGH 3VRJB 5JOFB 4X9YA 4DP7X 4NIYE 1IIKA 1DHKA 1WZAA 2FH8A 5DRWB 1CFQB 3UZQB 3MX0A 3LKNB 3RVVD 5AVTB 1UWXH 3E6FA 4LARH 5B1BB 1IGFH 5T1KA 5GJSL 1EMTL 4AM0B 1CLVA 1ZOXA 1N6UA 1XF4B 4JQIL 4MA1B 2YSSA 1JYXA 2ZICA 1S5IH 1VGEH 4K3DL 4YGAB 4BWUA 2EDOA 2ZW4A 3BE1H 2BZDA 3O6FA 2DF5A 4MLIA 3JV6A 4XNZC 4NBZB 2PO6D 2Q8BL 3MUJA 4Q7DA 1U8OB 2IDQA 1UXLA 1XEDA 3LQZA 5E00B 4BH8A 2WIIB 3ZT7A 5I6MA 1DVFB 4TNWF 5F7BA 1M6UA 3B2VL 3HB3D 1RUPL 3PV6A 3FECA 4HH9A 3UYPA 1AIFB 2VLKD 4XE0A 3FB6A 2A9NL 4S1RH 4XVSL 3CQFA 3B2YA 4W9KC 2J8RA 2A6KB 1EK3A 3I3GA 2PPAA 3MREA 4YSDA 1JF1A 3TPUB 4OADA 1EEYA 1UHVA 1BPVA 2ZW6A 1P5VA 3SDAD 4OZ4B 5TFSL 5I15H 4LQFH 1Z7JA 4WGVB 5LNDA 5EV7A 3VMPA 5F3HA 3WNJA 3GWJA 1BF8A 5GQBA 4YHNA 2PW2A 5T3ZE 3FPXA 4L48A 3RB7A 3VTAA 1VGKB 4AZ8B 5I6XB 4K15A 1K4DB 1AS7A 3QUZC 3HPJA 1OCCB 2R8SH 4BSWA 1GW6A 3PWPE 4G9FD 4M85A 1U3YA 1YPZB 2ZXQA 4FTVA 5FO7B 1TXRA 2RHEA 3QZWB 5I74C 1ETJA 1YEDA 5EA0L 5F1OB 4F15C 1PMYA 4IKLA 4ANXA 2VT0A 4IHOA 1IM3D 4ZFOA 2E4FA 3IFPA 3MRDB 4P99A 3UBXG 2W91A 3WUWG 4M6OL 1WLHA 5JHBA 3PBEA 1T6WA 2V5SA 2FIKB 2D0FA 2X70A 4CSPA 4UOW1 1CC3A 5FHAL 3WIIH 1U95B 4DGYH 2VDKH 1IZJA 2GY5A 2WCSA 3HUJF 1TTAA 3V5DA 3MRUA 4KAQL 4YHOL 5L2KE 2NY5H 2WLLB 4HJSA 3UEQA 1M9WA 4MHYA 2IQ9H 3IDXH 3FT0A 3V5KA 1JGDB 3MRPA 4FQLH 3IDNA 4PRID 5DO2D 3MROB 5T1DH 1G7IA 3GFUA 3AITA 4TNFA 3VXRA 4HKFA 1QBBA 4Z5RB 3BESR 3P3TA 4AQ1A 4L05A 1UB6B 2DKUA 4JM2C 3GK8L 3PWVB 1CICC 3H42H 1Y7VA 1J0JA 2BCKB 4U6YB 1JHLL 1HH9A 3BKML 3SDXF 3UYRL 5IHLB 3P4NB 2FBJL 4LO9A 4RAUB 3BVXA 3T8VA 2EDBA 3U0PB 5DD1L 1MJ8L 2ZCZA 4CYQA 4B10A 1TVHB 4R8FA 2AGJH 3WN5C 3GLJA 2CCWA 2VXUL 3UBGA 4OAWA 1W91A 4HWBH 4IBYA 4LDLB 3RPIB 5MERA 3IGUA 4KTDL 2LU4A 3ROLA 1KJVA 1BJ1J 2YC1B 5GS0D 4WV1B 1CR9L 1XSIA 1Z3GH 2QGEA 3CLEL 3HZYB 4NENA 1J0KA 1T20B 4TQPA 2HRLA 3CZUB 5F44A 2UY6B 4HZLA 2IG2L 5MEQB 2MCMA 2VDLL 4H26B 3WKMH 3Q5YA 3X2QB 4KOWA 5L2KD 1J8KA 4P23C 3DNSA 4Y5VC 1IC5L 2Y5TB 2UX6A 3O9WB 3IDJA 2KS0A 2WUBH 2MQ0A 4M5YL 2QBWA 4G6MH 1HKLH 4L29B 5AW7B 3B9DA 1FUNA 3BP4A 1NLBL 2O5NA 3W0WA 2YPLD 4TULL 4AC4A 2IH1B 5A16A 3ZUNC 3EOBA 5I0ZA 1ZA6A 3V6OE 1BMZA 4PLKC 4HMEA 4BFRA 4I0PB 4I4WB 4JFPB 4DAGH 1IBHA 2VWEE 4OUUB 2CJTA 4XZUA 4YHYC 4QRTA 1G9MH 3K46A 3CFDA 3JV0A 4JVUA 2AITA 1YMHB 3PIQB 3EADA 4QJ4B 3FUKA 3WU1A 2W81C 1IBDA 4DVBB 1PYWB 4QRQB 3ARTA 2OPCA 5JYMA 1S7VA 3HAEA 2OAAA 5TQ2H 3ZDZB 2JLMA 2EH8H 3IDGB 3T0BA 1DQKA 2WYHA 1I1AA 4XXWC 2BVOB 1ZA3B 3KAAA 2PCYA 4LF3B 4N6QA 4X5WB 4UT7H 3ARED 1UKQA 1YYML 2XFXA 4XP5L 7TAAA 4HKZA 5HY9A 3WXWH 3C60D 2H1XA 4E41E 3CWGA 3FXIC 4OCYL 5LWYH 4U1SB 1CO1A 1FYTE 2VDMH 4CMHB 3CDCA 2DLFH 3QYNA 1KXVA 1GTNA 2OMYA 4FQIH 3EG9A 4X9GA 1KYFA 4LL4A 3VFWB 4KKCD 4N0FB 5LDSA 3K9UA 5JGFA 1F3DH 3VXSE 2YAOA 1WK0A 3DLQR 3QG6B 4Q4IA 4LLMA 3S5LG 4ODUB 1EAQA 1NDTA 1ZHKB 2QVTA 2WINB 4P9HL 2DWXA 5E9AA 1YNTF 3OC5A 2CZNA 1CYWA 2WXIA 1LK2B 1N7MH 4G6JH 4V1DE 2C6CA 2ZEFA 1PZDA 4FMKA 2WZPA 4WLCA 4ZX3A 5F89A 2KDYA 5E2JA 1XL6A 3V2AR 1R3NA 1NCUA 4X80L 2ATPB 4M61B 2ZSVB 1DDHA 1IGYA 3UBXB 3PWJB 2JJWA 2Z31C 3I9GL 3AC0A 4JFOA 4M1GH 2C7UB 4LNRA 4V2CB 4F33B 3TBBA 3L2MA 5FLUA 1F86A 3ZKMC 4IK7A 1U21A 4PQAA 1HL8A 2YMOA 2N56A 1FO0L 4PJ8A 4PJIB 1FFNB 1NL0L 5HGBA 1HEEA 2CPCA 5AVSB 1VZHA 1XHHA 5JHDE 2G3ZA 1Q9KA 1P1VA 5IJVA 1MCKA 2F54A 1F13A 3DROB 4GI6A 3P0YL 3B2MA 1CTMA 2LR4A 3RGVA 2JBJA 4XT1C 1J0ZA 3BH9B 1I1AC 4HX1B 3BW9A 1KLFA 4LSSH 2ZUUA 3OG6B 2R69A 2IANB 1T1WB 4LKCA 1MELA 1NGWA 1NGWB 4IU3A 2DBLH 2N01B 4AJVA 4ZUWA 1CVRA 5E0FA 1CBXA 3IJ7A 2XTJD 2B5IB 2B14A 4G8EB 4PGEA 2X4SA 4DPCX 5J6GA 2BJMH 3QEUB 1FAKT 3ZHLA 4W4OA 5FUZL 3QIBD 2KH2B 1PF3A 1KEGH 1KACB 3NJIA 4YHMH 3HA0A 4XO4A 4E41B 4I0PA 4NGHH 2WLMA 3O4LD 4FLOA 1IOFA 4I13B 4KVPA 3BGFB 4Y19D 3JQOB 1PZBA 3HJEA 2FH6A 4XC1L 1JK9B 3RVXD 3PP3K 4XWGL 2WLIB 3DX8B 5DD3L 3B3VA 4UWJA 1HL5A 2P4AB 1SOKA 3S37L 1CXEA 1LEKB 4AYEC 2IFFH 1D3CA 3EH5B 3IDJB 3HRZB 3IJYB 2ZIDA 4FFVD 2EJ1A 2YMXH 3IJEB 2X9XA 1PS3A 4J23A 3ULUL 1BVNT 4S0TD 1H3PL 3IKCB 4H26A 2C6PA 3JVNA 2ADIA 1MFAL 2VIRA 4L4JA 4EJ1C 3DUSA 5KJ7E 2EKJA 5KVMC 4CYNA 4FG2A 1XMWA 4F1ZA 3NIGB 5ICYB 5CWSA 5GS0H 4IIZA 5E8DL 2DEYX 5K1VA 3ZHDA 2EE6A 3DOIA 3PWUB 4RAVB 2ED8A 1HOEA 3CN2A 3UJIH 2N59A 1OV8A 3KLDA 1IC4L 5H35B 5JHDA 4K2UL 5JHDB 4M93C 4DFHA 3AM8C 5LNGA 4I4WA 3IDGA 2Y4SA 1T66D 3DRTB 1SDAB 3NEOA 3VWKD 4XBMA 2DJMA 3TTSA 2HFGH 5KTAA 1UEMA 3MBED 4RAVA 3QA3A 4CSSA 2B08A 1TITA 1ODUA 1RUPH 5IW1A 1CK0H 3S97C 2XKUA 2J8MA 1FFQA 4OC0A 3BI0A 3BJLA 3OMAB 4RISL 2LAAA 3PGFH 4LT7A 3CXDL 4KK9C 1M56B 3E2HC 4JFYA 5HXDA 4WTZA 4OLWH 1O9WA 4QRRD 3S36L 4NKIH 3T2PA 5CBMA 3MGTB 5E6SB 1DSFH 2AXFA 4AH2A 1GTFA 1NGQL 2OMUB 2ZX9A 4EDWL 1QEXA 4G5ZL 3Q13A 4EI6A 4IMKC 3TBSA 5KZCD 1F4WL 3NIDE 3O6KL 1AMXA 2DQFA 4PJ5E 4ZW5A 1U4FA 4R7DB 3TO4B 1NC2D 1SLWA 3EDKA 5I1GH 1QO3B 1UB5B 1S7XA 1MCWW 1W0WA 2VRAA 1GJIA 4GSQA 3S8FB 1OP5K 2BSSA 2XWJB 3SDDD 3DGVA 5JXEA 2ZPKL 4JREC 2QQLH 5GZNA 1I8KB 3MMEA 1WZKA 5BZWB 4A2EA 2JMRA 5B1CA 3ZQ9A 2IAAC 1D5ZA 3QXAA 2C3WA 1JOIA 4WTZG 3X14A 1RURL 2QZQA 1Y07A 3N5FA 2J72A 1HSAA 1NFDF 5F7WC 5TF1H 4XNYH 4KX7A 2KQNA 4D9LL 5L88L 5KANI 4KC3B 4NERA 2ROYA 1KY6A 1IYLA 4F6AA 1LL1A 3VU2A 4XCEB 3RE0A 1UWEL 3NAAH 1IBBA 3L4VA 3IU2A 2VN3A 3KPSD 1HIMH 5F7FA 2HTLC 4ZW3A 3W5MA 2ED9A 2QSCL 1HDQA 4GIAA 4DK3A 2XN9A 5KYYA 1D7FA 2FT7A 4QDGA 5IF0B 5H4YA 1NC4B 3SJXA 4P06A 1TJGH 2APBA 2WZAA 3K5SA 4EN2A 5IR1A 2F7OA 4IMLB 1RIVH 3OB0K 4PJIA 3S6GA 2Y24A 2IVFC 4HCGA 4JDZA 3ZZ1A 3US0A 1XXDC 2GK0A 4BDVB 5E8DH 1WK4A 1DQLL 2EVGA 2ICWA 4QHPA 4UOJA 1X5LA 3QCVL 4PBXA 1I8IB 4PJ7A 4P48A 1OXYA 3IGRA 2BNUB 5E03A 4L3ED 3ARGD 1TZIA 1TZIB 1FRGL 3CX5K 3P0VL 3TN0C 3GMQB 1CUOA 3D4UA 4KLWA 4NFRA 5BRQA 4JXRA 2BO9A 2JH2A 4OF5A 4QHNA 2P7TA 3VE0A 4MZRA 1C16A 1YNTB 3RHWK 2L4OA 5KSVB 4K8RD 4M7LT 3UDWA 5K39A 1TF4A 3WLBA 2LU5A 4ZMTA 3TN0D 1T5XB 4MHHI 3BDYH 3EYOA 2J3SA 3ZR6A 4MDRA 1BWWA 3TIDB 2DIAA 4KQ0A 2X1PA 1OCRB 3QRGH 4X98B 2Y5QA 2AFMA 2YGPA 1ZHBA 1ZANL 4G9DA 3DETD 1ZE3C 4K9EL 2MOVA 4UWQB 4M29A 1BF5A 1L6PA 4NN6C 3NJXA 1NAKL 2ITFA 4YEEA 1BQUA 3F5WB 3I6KB 3L13A 3FBUA 4WJBA 1OAXL 1CFSA 4D8PB 1P9MC 3BX7C 4F8TA 3VXUA 1UJ3B 4UDTB 2CLRB 5ACMA 2GTWA 5G5DA 2Z93B 2VC2H 2JEWA 2WB7A 4OCXH 2HLFD 5CP7B 1MDTA 4QHUB 1KSRA 1XFOA 3CVIH 4GXUM 3B5TA 5JDSA 3DYPA 1SYSB 3QXUA 5CGMA 4X5XB 4AXWB 4CVXA 4ONWA 4MJIA 3IGAA 2FIAA 3F04A 1DQTA 4IIQA 3WL9A 4F27A 3NCYS 2Q0YA 3TCVA 4WGWB 4FABH 1YUHB 1U3HC 1PAMA 1LGVA 5E4IA 2DI9A 1DSFL 4Y4HA 5DMKA 1YEIH 2C1PA 2XZZA 3C8KB 3QUMH 4AQAB 2BVYA 2WXGA 2ZXEB 2DS4A 4LB8A 3QIWC 4X99B 1MK4A 2XHNA 4WKZA 4NQDD 1RZFL 2AJVL 3KH3A 3VU1A 1YEHL 3FTWA 2BOCA 4FEIA 2OZ4H 4BE5A 4HJJH 3LD2A 4YX2H 4LPXA 2HKHL 2AEQL 1IQWH 1NGPH 1DVFC 3DJTA 2ZONA 2P42B 2FUTA 3MCG1 4GRLA 5IQLA 5AALA 3WFEH 4X5XA 2ZUSA 1YG9A 3H8FA 3D0LA 3GPEA 3UTSE 1QQ9A 4FZEH 1W8OA 3EDJA 3VXQA 3HC0A 4UEEA 2ITDA 1AXTH 1KYDA 2HG5B 2J55A 2R9HD 1OSEA 5KSAD 4NQVB 5C0EA 2FEEI 3P0GB 5D96C 3ULVD 3NJLA 2C3HA 4XN7A 3JUWA 3LQAH 4KQ3L 4JHWH 4AI7A 3RX8A 4QOKA 3Q2NA 2DMHA 2DWSA 1SDDA 3IT8D 4OLUL 1S60A 3FCTA 1BQ5A 3QHTC 1CL7L 2YGWA 4FNTA 3O41A 4Y1SA 1OGPA 3S5YA 1HC1A 2CIKA 4A1RA 1RSYA 4F7EA 3F83A 5C9JA 4PRIA 2Q51A 1ASQA 4NJRA 3EO9H 4U31A 1T5XA 4XNMA 3VD1A 5I1AA 3L3HA 2LOEA 6FABH 2DQGL 2HVKA 4LFHD 3TCXA 4FXKC 4XNXH 2HCZX 3GDBA 2EADA 2IQAB 4C59B 1VHOA 1ZLUK 3PXHA 2IPKB 1MNNA 5IFAH 1LDSA 1WZLA 2YD6A 3QQDB 2YRPA 1FNEB 5JIQA 1S9VA 3QDMA 4YK4C 4UQDA 1H3UA 4AYFB 4I2XA 3FBKA 3I9GH 2GB2A 3CN0A 1E5AA 1HTYA 1B3JA 3NZHL 5IREA 1VPOH 4OKVA 32C2A 3L4YA 4FGMA 3CIQA 2EDMA 2VZZA 1UXSB 3CVIL 3IXAA 1IC5H 3IJSA 5D9SB 1MAMH 5IB2B 4Z7WF 4OR1A 1B4LA 4JFFD 3EH2A 1B4JH 4Z7VE 1YVLA 3RVXC 4FFWC 5DI8B 4QXTA 4HJUA 3KPPB 4H6UA 1CE1L 4Q9CA 3D0AA 2WXMA 1SBSH 1SFDA 4Q38A 3PP4H 4GUPB 5EUOB 2LQRA 2R1WA 4HUNB 4YZFE 1NC2A 4ZMWA 4OIIL 2G9HB 3O0RH 2DJ4A 2VR7A 3E8UL 3SQOL 5TK2A 2AV1A 3VO0A 3WT4A 4ZX8A 4J4PA 4PJFB 2EECA 3O4OB 4AUJA 4PJHF 1WS7A 4AQOA 4YEFA 4LQ6A 4F91B 4PJAA 2FEEL 3VFMA 1J5IA 4KKLC 1VADA 4NO0D 1SOXA 3FN0H 4UTAL 1QFWI 4ABQA 5I19H 1SLUA 4UILH 4N85A 5LYLA 5FO8B 3LRMA 3GSNB 1XCTB 4DKFH 3KYNB 1S9WB 3K0WA 2Y22A 1ET5A 2NRDA 3CSFA 3FQNA 3M7FB 5BOZG 5G55A 3NIDF 1TETL 4QOKE 1EZLA 1EJOL 4L3AA 3PABA 5D72H 1A1OB 1PDKA 4PV6A 4PG2C 1UGKA 3LD8B 3HI5L 5DJ6A 3LQMA 1Q9OB 4JR9L 3IMSA 1XGUA 3L9RA 3NESA 4OT1L 4R97C 4FA7B 1KIRB 3V38A 4HC1A 1U8LA 4B14A 4ZS7L 1RQ5A 3S37H 1HN1A 4NJAL 1GC1C 2BHYA 3D3VB 5TH2A 1AUGA 5DDHB 1HSBB 4HGKC 3DX9A 4L2YA 3AU1A 4UDUB 2TAAA 5IROD 3HUJE 1AQKL 4HBQA 4O02B 4ZFQA 3D7GA 5DWNA 2A6DA 4D0DA 3VFRB 3C2AH 4AJ0A 5CINH 3WS6A 3ZHKA 4J3OF 2OTWB 3O6KH 2WQAA 4NCC2 2R4RL 1XIWC 4MCSA 4DZ8B 1SYVA 2VGLM 2WBWB 2JCCE 4RDQF 2OA9A 3OKLA 1C7SA 2WKGA 1JPEA 4LOFA 3QZWG 2BW5A 4P2OB 1HZHH 2PR1A 2OMWA 3O2DH 3VSVA 1QAWA 3O3DB 3SDDC 4KOBA 2UUDK 3P4LA 5D4JA 5BMFH 2EEBA 4Y4FD 1SJXA 4NWTH 4KI5C 5CIPA 1GOFA 3L6FA 5C8JA 1CXLA 3EFOB 4MGXA 1WHOA 1JV2B 4D2NA 4FD5A 3GSWB 1J5HA 4K8RC 1AHWA 3N43F 4HSQA 1CX8A 2IPUG 2RC4A 3BMWA 3FB5B 5ANMB 3RJQB 4EZKA 4HBCH 2EICA 1I8MB 1G5GA 3AB0C 2F54D 2E27L 4LK4A 4OCSL 1FBIH 3U9UA 1JCKA 4OIIH 4PP1C 5AEAA 5FW7A 2IWEA 4JJOA 3T77B 3NSCA 1PW3A 2VE6A 2AEWA 4AYMC 1U3JA 3EJRA 5ID0B 2AEQH 2X09A 2A9CA 3B1UA 2NY6D 1KJMA 3ILQC 1KYOJ 5FYJH 5ISZA 2Y7LA 3DXAE 4KO5A 2AK4E 1QSFB 5JYLA 3EYSL 1A7PL 1FL3B 4HCRL 3CDGB 4LHUA 5E2WL 2EXYC 3ZX1A 5HYJE 2AHIA 3UJJL 5AQ0A 4HK3N 4LPCA 1MIML 4LLYA 3PGDB 1JGEB 4I3SL 4OZGA 4Z0BH 3VI3B 3KPRD 1CM0A 3PXJA 2ZG1A 2B3RA 3F5BA 5DSCB 3WEBA 2OR4A 4XBPB 1KB5A 4FABL 3D69B 5LB1A 2ZXDA 5BUPA 1JN6B 1TKWA 5MI0C 3ROLB 5DC0A 5I0DA 1WAEA 4PTTB 3GSUA 1BGXL 4NBXB 1V55B 3VFUB 1CBVL 4GPVA 3CDZA 1I8LC 4M3KB 3TE4A 2NUTA 4WGKA 5I1KL 3HZVB 3X12A 4AQEA 5HHOE 5DQDH 2IDSA 1VIWA 4M62H 1L6ZA 1L9OA 2BS9A 1YYLL 2P6EA 1DE4A 3L5IA 4JFWA 3PU7A 4KO6A 5JHLH 1XF1A 2BCKA 4CAEA 4NQUA 5DK2B 3QEQA 1UACH 4AEIL 1G84A 5CJOH 4PGJA 2EDFA 3DVGA 4KJPC 4JXQA 1TZGL 4FQQA 2G2NA 3Q5TA 3QQ9D 4KROD 4M5ZH 1EV2E 3RWHB 3TNNA 1UD3A 2WNGA 2NT0A 4H0LC 2OSWA 4YL9A 5J9PB 1IFHL 4KJPD 2HFFB 4ODXB 1HZHL 3GSNH 4OW6A 1JRHL 4JHUA 1WF5A 1J12A 1FH5L 4NZRH 4NGPA 3QUMB 3LHPL 3PDGA 4EUPA 5DZOA 3WEXB 2EEAA 3PWLB 2HSIA 4DFIA 2NZ9D 4YIQB 3NTCL 4WHCA 4WI3A 4YSSA 3W0WE 2I5YH 5KVGE 5DT1H 1XGTA 3E9TA 3WBDA 1J5OH 3C26A 3EFFA 4P2QB 1JD7A 3FYEB 1V3MA 1W72H 2VDPB 1QQDA 5KVDL 3BQVA 2Z8VC 3DUUB 3DUUA 3GRWA 4EVNB 3SXOA 4PGZA 5DD6B 4QF1A 2CK2A 4QF1B 4OVUA 5JO5B 3EJYC 4MZIA 2O5YH 2KBGA 4U1IA 4TUJA 4Y4KB 1S7UA 3NSDA 2K0RA 1A64A 2M1KA 1KTBA 1GHFH 3HZYA 4NENB 1Z5RA 4DQOH 1ITCA 3AWEA 4HS3A 2UYLA 4BD4A 3VM5A 2BSDA 1DFBH 5HDRA 3HS8A 1FYTB 1CFNB 2A74B 5I6XC 3AUVA 3VXOA 4RMQA 4NZUL 4HSAC 2YLKA 5KG9A 3HE6C 3UTPE 2PVWA 1O6VA 2XETA 3NJVA 1MWAH 2HUZA 3U0PA 1WEJH 4AYBA 3RBUA 4ELMB 1MI5A 3GINA 4ZY0A 4F7KA 1VDGA 1A7OL 1OEZW 4HX1A 1QBML 4XC3H 1MCHA 3GKZA 3I75B 5TDPB 2MCG1 3R8BB 5JQ6L 5K8NA 3EYQC 4JNXA 1H6UA 1R24B 1MEXH 2IXQA 4X6CA 1E9PA 4NO3B 4MMOA 4XP5H 2N1KA 5FCUH 5GZND 2Q7SA 3FFDA 5GGTH 2TRHA 3GD1C 3MJ7B 1MI5B 3UZVA 1XMEB 3FRPB 3ARUA 4OC4A 1UVQA 1QUPA 4OF8A 1X5MA 2WC7A 3NG5A 5DJ8A 4NQDA 5DHYB 3MJ9L 4PJ8B 5EBMB 4MD5B 5F0LB 2IH1A 4NQED 4U1JB 2FZ3A 1G4RA 2A74A 4M62L 3DGGB 4OFIA 5A16B 2X10A 1MJAA 3PWPB 4K9EH 3NJGA 4GRLD 2IV9A 4PTTA 1QP1A 2HT2C 4OIAA 4J4PD 1GS6X 1W16A 1DUYA 4ZZKA 3NN8B 3VXTB 1Y7RA 1MVFA 1SEQH 2DLIA 4U6XA 1LK2A 3U0WL 3RG1C 1I7ZA 5T3XD 3FEEA 4RSVA 1KN2L 4HUWA 4YDVB 1GJWA 3IU4H 2DMGA 4CGOA 1T2QL 3RTQC 5KWYC 2OU2A 1MF2L 3UZQA 3CDGA 1KYOK 1WZMA 5J6HB 2XWTA 3DSNA 4ODWA 3VH8A 1LP9B 1AJ7H 1E0OB 4IKNA 3GSNL 3WKYA 1G7MB 4H0HB 4WO4A 3VFWA 5CJ8A 1FE8H 4ZBGA 4FL4C 3FUDA 4X6DB 3H3BC 3L45A 4ZFFB 4GI8A 4YAQA 1LEIA 2FWOA 2WNWA 4U7SA 4JPVL 4AGQA 2AW2A 3ARBD 4OIFA 2E56A 3PNWA 5GS1B 1NAMH 4BM7A 5JNYB 4LQGA 4BQ9A 4YHIA 4HKZB 1JF1B 4TSBL 3U4BH 2A83A 4TF4A 1F3JA 4YUEH 4DKTA 4Q6IC 4LVHB 4OCWL 5A2IH 1I1YA 3CAFA 3EBGA 4KMTL 2IXQB 1NMAH 3BSZA 3G5YA 4HH9B 3KXFE 3T2NL 1ACCA 2VUKA 3W1ZA 1H0DA 4UF7C 1HFUA 2PYEA 5HGAB 5AAWC 2Q10A 4ZI6A 1RZ8B 1U8JB 2ESVA 3BZDA 4N22A 1FC2D 3MROA 3P54A 3TA3C 4HISA 3D05A 2DLEA 2CDFA 1A1NB 5I8EA 2QMKA 1MCJA 4NT6A 4YSEA 2FIRT 3FIXA 1YQVH 3V6ZA 1W2KT 3MV8E 1WAAE 1RK1A 5IVZB 4J27A 1PLCA 1MJJA 2IBZY 1OTTD 2VO5A 4LLDB 3D7PA 4DP1X 3M7OA 4RSYA 2ORBH 3BXMA 4LP8A 5EF1A 1NAMB 2XJKA 1RY7B 4P4EA 3RTQA 3VMNA 4FAIA 5MEPA 2A6DB 1HL9A 4V11A 3TOPA 4N5UA 2IWKA 4JGNA 1FO0B 2GC7C 3APNA 3TBTB 3JSSA 2CBQA 2DF3A 1I3GH 3N41F 4XWGH 1K8DB 3RDTD 3KR4A 1UOLA 4XP9H 1W72L 2L0DA 4HGWB 5KVDH 4P5KA 2B1AH 1G1KA 1G7JB 5DMGC 3V4VH 4WFEE 2ZEGA 3OKMA 5ESVA 1GPOH 1WAAA 4UBDD 3WN5A 5DJ6B 2C9SA 2JQZA 3V10A 4N8VG 3L3JA 3C09B 3EXNA 1I7RB 4I85A 4P3WA 1DTDA 3RKPA 4XPBH 4WWPA 2BXZA 2R27A 4XP4H 1C1EH 1TQUA 3MOQA 4YDIL 1EXUA 4JRYB 1GIGL 3MGAA 1ED3A 5DTFB 1SF3A 4LOVA 4R7VA 5B8CB 4DN4L 1DVZA 4HUXA 2WUCL 3QQXA 1UB6A 4Y1AE 5A2AA 2Y3NA 1QD0A 1KXTA 2WCPA 1CP6A 3MNWA 1E6OL 3F7YA 3LEVH 1NWOA 4UV7L 1P4BL 4X4YA 2FQDA 5G1ZA 2H5MA 1C9SA 4TVPL 4S11A 1DQML 5DD0L 1KBVA 2B1HH 2J8HA 4XVJL 5IESL 1T04B 4N2EA 1VRSA 3CU7A 5KYXA 2P43B 3O3DA 3JYBA 2KPWA 2VRKA 3KXFB 3NZ8A 4N0YL 1OK8A 2XZQH 5I8OL 1A7RL 4JFTA 1NUDA 4Y2DA 3IB4A 1BCIA 5J89A 3EXLA 2E46A 4OFQA 4PMEA 3RWEB 1T5WB 3RY5A 1N5AA 2LTQB 4JQIA 3LB6D 4XMUA 5C3IA 5EEYA 3VI3A 2AXHA 4F24A 4RS2A 3TZVA 1SLVA 5D2LF 5B7FA 2BEIA 2IGFH 3GRBA 5GSVA 3ZY7A 1RZIA 4EI5A 4FQHB 1OK0A 5E9DE 1BAFH 3HE7D 3O0LA 3QFDB 4PJBF 1NEZB 4WFHD 2FECL 5EZOL 4A63A 4AVJA 4NC1C 5JPNC 1WJ3A 1ZHLB 3SSGA 2WQVA 1KTDA 1IGMH 1N3NA 3A6CL 4NB7A 4L4VA 4P46D 5EU6A 3T3PF 4JG0L 3QUYA 1U9KA 3T2LA 4N0CD 3HOGA 4LU5L 1C5CH 1XDTT 4ZXBB 1IT9H 3JWNE 1OD7A 4H8WC 3TBWA 1S3KH 4J6RH 4JFZL 3OJVC 1FH2A 3FU5A 5EC1A 1OAZH 5IJBC 3B3IA 3PP4L 5FX3A 3X11A 4FHKA 2X0UA 3F2LA 4R4BB 2ICEA 4OKOA 4L37A 2Y7QA 4MMXC 3X1FA 1Z32X 2WXJA 3VFNB 5C0CD 4N86A 4FLSA 1KN4L 1B2WL 4I9WE 4CSZA 2G2RB 1BVLB 2J25A 2AEPH 4P2RB 1FNGB 3C60C 1QPXA 2APVA 4AT6B 3UL4A 4ZSOA 2QV4A 2D2OA 2R1WB 3ULUH 15C8H 1G1YA 4ORGB 1JXFA 2L7QA 3HIZA 2YQ3A 3MNZB 1FZOB 4DJMA 1BYPA 2NXZD 4JY4B 3Q5OA 4N8UA 2YK1H 1MCNA 4GLRI 5I6LA 4X5KA 1N4XL 2DKMA 3LB6C 4X4MA 4Z0XB 4GMTH 2E7HA 4NHCL 2YD3A 3MUHL 2FQFA 4A7UA 1UD2A 1BEYL 3IFEA 4MAYC 1S78D 4HXAH 1MZZA 1D5XA 2BVUA 1II4E 3LH8A 4KVOE 2TRYA 4BUQA 1T7YA 4OFYD 1VEOA 1QR4A 1R46A 4XPHL 4ZXBC 4KTDH 5DMKB 4POYA 2JQMA 2WGXA 3ESNA 1MJ9A 4MD4A 4TSCH 2EDEA 3U9PH 5J1TC 2VQYA 1S7QA 4JZJA 3HLPA 2OB0A 5T5NF 1AGCA 2V7NB 2WP3O 3WXVH 1IMHC 3IMBA 3NCXA 2ZOLB 4AKPA 1XO8A 4RFOH 3NCWA 1NMCB 4BGDA 1A7NL 3B3IB 4PJ7E 3L6FB 5C8JB 4UV4L 1RMFL 2XRAL 4XBGB 2FJGA 3GSVA 5CEXB 4WU7A 5EZIL 3L4UA 3QIUA 3TA3D 1BO4A 2G2RA 4NZTH 2JLPA 3BWAB 1AQDB 1UC6A 1QUNB 3B7SA 5A40E 1PY9A 5J1AA 1QRNB 4G70B 2J6EH 4H0IA 4L3EB 1OALA 1NGXB 4NKDA 2JCWA 4R84A 1U30A 4U6HA 4M6GA 2WO2B 3SCMD 3WY4A 2QVIA 4QYOB 5CCGE 4FNQA 2XZCH 4LZKA 4YHOH 2BVQA 3OG4B 4KKAC 4W4OC 2BL1A 1C1EL 5HI3D 3HE7C 1CT8A 1NCTA 3OJMB 4GOSA 5DEZA 3L3IB 3GSXA 2OMXB 3CU1A 3MPCA 1NBCA 5DS2A 1R3KB 1OM3H 5FLVA 5FECA 2V37A 5DJ2B 2V3FA 3L95B 5L4FA 3ZL1A 4KORA 1LILA 1LO2L 2FCKA 3SYAA 4TN9A 2P47B 2QELA 3U0WH 1G7PB 4J3SA 4YSUA 2I27N 3GC3A 1BZ7A 1TEYA 4JZJC 4GAYB 2B1HL 3K6DA 4XVJH 4ZSOB 4ZX5A 4AGNA 1NM9A 2GJJA 1T22B 3FT3B 4CVXB 3F12A 1M7IB 4YO0A 1P6WA 2XJLA 5DS0A 2R0ZH 3C6LB 1M2VB 2X3BA 4ATTA 5IFJA 3TT1L 4M8RA 4DP9X 1IZKA 3WFBH 1O5PA 3NSXA 5F1IB 1JV5B 1JPGB 5CGTA 3OAUL 1E4XH 2AJSL 2XV2A 4LCWA 2ZEDA 2ITEA 3F62A 2OI9B 3JV4B 3PQYB 2OSXA 4PYHA 3AACA 3OPZL 2K3HA 2C9QA 4PRPE 43CAA 2Q8AH 1MFVA 4NXYA 1TVDA 4L9LA 1DFBL 5IMKB 3K74B 5J8FA 2V0AA 3KPPA 3MLZH 1D5MB 3ZMNA 1N18A 2Z4QA 4BCZA 3KGTA 4Z7VB 1OOAA 4WWID 3IE9A 1NCCH 5F9AC 5F48A 4CC4A 4Y7MA 3ZO0A 1KELH 1Q9WB 3AY4A 4NUPA 2BOCB 3MA7A 1NCHA 2QSVA 3HC2A 3WI9A 3FC8A 4ANUA 1CLZL 1CQKA 4HFWA 4AYFA 2VR6A 2LLLA 2PJ6A 1EUUA 5EUOF 1JHKL 3OXRA 1VEMA 3JUYA 2DI8A 5EO9B 1R75A 1AHWC 1BAGA 1YEFH 2EIMB 3MOBH 3RPBA 1FNSL 3OLIA 3MHZA 3QQ4B 4OSUH 3QDGB 3OF6D 3HNSL 2H32A 4PR5A 3U4AA 4MB3A 1MJJB 4U2ZA 3WTTA 1QVOA 4F5CA 1J5OL 4YDNA 1AYEA 3HMWH 4OI9A 4AH2B 4YR6A 4K7FB 4J3OD 5AVUB 3BYTA 2JB5H 3GXDA 1FI8C 2WZ6A 3K2IA 3OC8A 4Y9GA 4S0SD 2W65B 1BPLB 1TSRA 5LWYL 4R26H 2MTPA 3MNMA 4UIMB 2OP4H 4K5OA 5EOCH 2AEPL 3OZ9L 1UT1A 3SE6A 2LHAA 1JNNL 3MNWB 5DJXB 1MQ8A 1XF5A 1NDGA 5AB9A 1HQ4B 3VX0A 5EF0A 3HR5A 1DCLA 3E8UH 3SGEI 3WNOA 1OGAA 4XCYA 5KYYB 1FFPB 1U8IB 4LEOA 2C1OB 4Y9BA 3FSVA 2EBJA 4QCIA 3LHAA 1NCWL 4WWVA 2NY4C 4BFIB 2V3EA 4L3FA 2FD6H 3L3OA 5IMLA 3SHSA 2Q44A 1FL6B 4R3KA 4ZI8A 2FL5B 1SOSA 2HG5A 4G6AD 2Q87A 4DKAA 3PJNA 4XCCL 3BO8A 4IRSC 3NDZE 3RDTA 4G9DB 4ZUVA 4P5MB 1SXAA 1N12A 4UCPA 2QT6A 1F1DA 5DLLA 1AD0A 1RFDL 3N6YA 1GKEA 1I8LA 2Q4YA 2L7UA 2TSAA 3CFJB 5F9JA 3P9LA 5GGUA 2BHFA 4CC4C 1NCAH 5CN1A 5BUGA 4OLZH 3O4LB 4N9GA 4J5VA 3ULSB 3QS2A 4UCNA 1KJ2L 4YHIB 1P5UC 3MJ8A 1A1MA 5IHZB 1CG2A 4B13A 3WTYA 4RX4A 2E6JA 4W9CC 1J8HA 3GB7A 1R0AL 4RWYH 4YDVA 1AQHA 1N0XL 2E6PA 4O4YL 3FB7B 1CBJA 4PQXA 5C1MB 1HCFX 2V8VA 1W6WA 3GMRA 2ZCKL 1E27B 3BPOB 2B1AL 5E6ID 4D9RE 2JTYA 2MRYA 2KLSA 2ZWNA 2EC9T 2RD0A 4HLZG 2RAMA 3KH4A 5ILTH 2X7BA 2WAHA 1J0IA 1JGVL 2IAMC 1OVZA 5GIRB 1A9VA 1CICD 4UA3A 1FG2A 2YA0A 3KHXA 2NXYD 1RUMH 2XG4A 3CE1A 4BZ1H 1IBGH 4YWGL 4ZFOL 4FX5A 3CZNA 4PVLA 3BAYA 4AGLA 2OXGA 3T3MB 1UJ3C 3TYFB 1QR1A 5JQIB 1NMBL 1Y1UA 1BZ9A 3MRBB 5C09D 3NJHA 2Q7AA 1HNGA 3A9LA 5AOMA 5ANHA 3EGXB 3S3BB 3KBHE 4FQXC 5C92A 3QBTB 3CZKA 1XZ0A 4JFDD 1UG9A 4MCZB 3OR7B 1GZPA 4RIRB 1IB1E 1BVOA 2PVVA 3IF1A 4XNQA 1UA6L 2PTTB 4Z7UA 3MRLB 4U3CA 3S4SB 1NJ9B 1QR1B 1GH7A 4YHKH 2DH3A 4NRZB 4AOFA 3OKNA 1JZ5A 1A6ZA 2ZSWA 3K8LA 2YA2A 2W88A 4H7VA 3T0EB 4V2BA 1ARMA 2CR0A 1T7ZA 5GJSH 4UQ2B 2EXYD 2XG4B 4IDJL 2Q6WA 4EBQL 2V8MA 4YHLH 1J1OL 3GZPA 2EE0A 4XPLA 5KS9B 1XGQB 1S7UB 4ONGL 3T0VA 5HHXH 3S2AA 5BXFA 3V7AE 3OB8A 3S36X 2FS5A 4P4JA 2XQBL 2M8XA 1WBZA 3MI6A 2CGRL 2CK0L 2Z0ZA 4KOTA 3KG5A 1U3HA 1U3HB 2DDQH 4DGUA 4BINA 2Y5EA 1S7TA 2HT3D 4Z0BL 2IOIA 5BXFB 2IAMA 4POUB 2WGNB 5J11B 5EEWA 1PZAA 1T03H 1NPJA 1B6UA 1XCXA 4C2YA 3GTTA 3CMOH 3C75A 2OOTA 4RWHA 1MJ7L 3TBVB 5I16B 4GAGH 2Q6WB 2VXTH 3SKOB 1JL8A 1LO5A 1L0PA 3L4ZA 4KTGA 3B4NA 3LQAL 4KQ3H 1XH0A 5CS7A 1OTUD 4ZFZA 3TFYA 3RWIB 1MAJA 4YDMA 4EI0A 4AV5A 3DOSA 3ZDWA 2X4SB 4II9A 5C3TA 2YEQA 3CH8A 2GY7B 3VX1A 4HHWA 5BO0D 4MCZA 4ZK8A 5CCHE 5F9OH 1CFBA 4IMKA 4P46B 3TURA 1CLOL 3HCVA 3UTPD 1YR0A 4P2QE 2DQJH 5F7DB 4Z7WA 2RTTA 2QPFA 3NCEB 2Z91B 4OGZA 5DUBA 3RWFA 3S2CA 2R23B 2DLGA 2CBTA 4YDJA 1HSAB 3PIQA 1HIML 3V4VA 2GW5A 2X0VA 2UYLB 2ZENA 2V17H 2EDJA 4ZUUA 3ZHNA 2IEPA 1MHCA 5GZNC 4CA4A 2H3NB 4X9IA 4P10A 3C87A 2BC4B 3P4MA 3DK0A 4FULA 4YN3A 4FNLL 4FTVE 4FYSA 4GUCA 4IBQA 5EOQL 4NAJA 1HNFA 1KIQA 1AO7A 1NBZB 3PGDA 1VPOL 4LLYB 4QTFA 3HG1E 2R7HA 2WOBA 3ZTNL 3W91A 4AMWA 5AGEA 3FO0H 4X6BA 2D4PA 4R0LB 4WHYH 1AVAA 5E2UH 5JPMA 1JN6A 1ZXKA 2WOYA 1E5UI 5M94B 2HLAB 3J2PA 4H1LG 3ZO9A 4B9FA 3KEDA 5AL0A 1AXIB 1YEWA 3KGUA 4WI5A 5F8RC 5C82A 5KTEH 4XNHC 5F1KC 2EZ0C 3JWDL 5FYKH 2IQAA 3MLUL 4HU8A 2VLRE 3PWNA 4UFXA 3B9AA 2JCCB 2Z7UA 2H3NA 1CLZH 1BBDH 4NUGL 4KKRA 5C09E 2PCPB 4JJ5B 3QORC 1G9EA 4H5SB 1AG0A 1ADQA 4X7EC 4BWWA 1MCEA 4AGMA 5GZOC 3BAWA 2MNJB 1EDHA 4YPJA 5HYEA 4U0RB 4XMTA 3FCTB 5IOPA 2FEDD 3DRQA 1B0GA 1SN5A 2KCWA 3TX4A 3DVNB 5AYTA 5JPHA 4A04A 5JQ6H 3CTTA 1AYRA 3MXVL 3U4EA 1G9ML 5LXVA 1P6FA 5CR1A 4Y8DC 5C9KA 1S3KL 3TN0A 4W9YA 3PL6B 2G5UA 4ZO7A 3KWTA 4AL8C 2OXGB 5ALCL 2YNCA 1BIHA 3NA9H 4KZTA 1DN0B 1FO0H 2SEBB 4JREB 1F1AA 4PS3A 1Y7EA 1UD8A 2V3DA 2H4EA 4Y1TA 3DX4A 3TBVA 5I16A 1ZMYA 2W8CA 1OGAD 2G5BA 4W9DC 4A6YH 4FZ8H 3C5JA 2LFGA 4RFOL 1BXAA 1R5IA 2AI0H 4AW7A 5IP4A 4GS7B 4Q7AA 1MIEL 1PCXA 1U8QB 4PR5B 1AZCA 3SIKA 1OM9A 4JPIB 3VXUD 3SOBH 5JUEH 5E2VH 4Z3JA 2OTWA 2CXAA 4JO3H 1EGJH 4FQCL 3MV8D 3KCPA 1HEJC 1BVKB 3HG1B 3UTZA 4AW4A 4CW1A 2ZJSL 4FJZA 5LDUA 1PDKB 1P7KB 3BKJL 4LLMB 3DIVA 1BFSA 2Q0ZX 3RDJA 5H37A 2W94A 5IV0A 1M1XB 4ICXA 1RHFA 3FQUA 3OWCA 3F85A 5FK9B 2Z35A 3BUDA 4UM8A 3PUCA 5ABDE 1KBBA 1U8LB 1WGVA 1A0QL 2PUQT 1S9XB 4G6AC 3RZCB 1OGSA 4G80A 1FIEA 3MOAL 4AZ8A 2W9EL 2XA8H 3MCKA 2BOAA 3WXWL 5B38A 1JV2A 4FCHA 5I73C 2AKRB 1F4XH 1P5VB 1VJSA 2CLVB 4KPHH 4WI4A 3SBPA 4D0CB 2KT6A 3DGCR 1TVHA 1KGXA 3S7GA 4DO6A 5I8KH 2WYRA 4N4YB 2X4UA 2ZOKA 2EVHA 3FQNB 2NNCA 4EBQH 1HZKA 2G30A 3AROA 3FRUA 4N2GA 4HK0B 2DM3A 1U8HA 1M3JA 3TOAA 2YWZA 2PJBA 5KZCB 3F7VA 1DJSA 1UM4H 3T6VA 3WHXA 2PIZA 2GJZA 4MMZB 4W9EC 1QSMA 3CLWA 3B2UD 4KUCD 3CHXA 3SE3A 2BNQE 3Q6GH 4NSKA 1YMEA 3FUIA 5L9DL 1YQEA 3SDXE 3QARA 3V5KB 1NGYA 1TZHB 1CXKA 3T09A 3SDAC 1HSBA 1R3IL 3JV6B 4G1PA 1R17A 4LNRB 2ZUQB 4E0AA 1S9KC 5E94A 1YEFL 1PX8A 3O2VH 3RVUD 1TUPA 3KL9A 4MWFA 4PJ5A 4MJ4A 4UQAA 5CP3H 3CBKB 5I30L 1FVDB 4MRCA 1YYCA 1SN2A 4FFZA 4YQXH 3DX3A 4F57H 3FOLB 1SXSA 3WKPA 4C7IA 3HR6A 4X6CE 4RFEB 3BEWB 4ZDHA 4MJJA 3PFQA 1DJGA 2HVJA 1ZSHA 5IBTL 4Y1AA 3UO8B 5FO8A 3DMMD 2R2BA 1PZUB 3SYQA 2E7MA 1ZO0A 5GGSY 3ALXA 5D6CA 3LTVA 4ZPVA 5AZUA 3T6ZA 2DPTA 3P9MA 3GHBL 4M02A 1OHZA 3VH8G 4QUOA 1R3LB 1VKCA 1PZCA 1MLBA 3QDGD 1N6QH 1HT6A 3L4CA 4NM4H 4KI5F 4P4FA 4H44C 4GEIA 5IW3A 5BS0B 2CM6A 2Y7OA 5FWRA 4UF4A 5HPMB 5L6YH 4F3FB 4NQCD 1J8HD 3MTXA 3QT2A 4FG4A 1RZ7L 2J4WH 1ACYL 3T6XA 3FB6B 3FH7A 4L23A 1WFUA 4U3XA 3EHBC 1TT6A 1A4JB 1DBMH 1DQMH 2IJ0C 3WS3A 4XN2A 4B53A 1MVYA 2UZIL 2HX7A 4P5TB 3RDTC 2P5ED 4OCWH 4XNUL 5EG6C 1RIUH 5IFJB 1P4NA 4FNUA 5HPMA 1AR1C 3Q2LA 4ODHH 3DPBA 3VXPB 1RURH 5DRNA 1QSNA 3P2HA 1DUZB 1S7QB 1Y6NR 2G4GA 3HZ3A 2WLLA 4QGTA 3W9DB 4Q56A 1OF0A 2QZ5A 2BIOA 2D3LA 5J8OA 4AVAA 4I1PA 2W0PA 3E1F1 3KLHC 3TF4A 1AS8A 4ZFGH 5EORL 4EZLA 2HAZA 3QIWD 3OM3B 4APXA 5GS0C 3LZNA 1AC6A 3OV6A 4JY5H 4X8CA 3UPAA 3LKNA 3TIEB 5FM8A 5C2UB 3KI9A 2L3BA 3SCMC 3FU3A 2BJML 2DM4A 4FFWD 4FBEA 1U6AH 1Q7LA 1OLZA 4QNPE 1LXMA 1RFDH 4WI9A 5EA0H 4XO5A 4XP1H 1EPFA 4KJWC 3KYMA 1H9VA 1CIDA 4X9FA 2ODIA 1FZOA 3BAEL 2OV0A 4G7VL 2VZTA 1OB0A 2PW2B 1EHLH 5MI0B 5INDA 2WLKA 4AENB 5B3JF 2G0BA 2J1ZA 3K80A 4JDVA 4Y49B 3MRCA 1N8OE 2RIKA 4PB9H 1BBJA 1C8PA 4RAUA 4XPGH 3O3BB 4UB0L 2IMNA 4B11A 3OQ3B 3OJ2C 1L0YA 3NK3A 1TF9A 4WU7B 3GLEA 1MQKH 4CKQA 1A4JA 2D7QA 2NY2D 4JZ0A 2WO3B 3MLWL 1FHNA 3LRSB 4JO1H 4YHYB 2O5XL 2HH0L 4Q9QH 2OR8A 3UROR 3X3GL 2WKOA 4ZO6A 1SBSL 5DJCB 4WEMB 2H32H 5DTFA 3ZDXB 1S5HB 4OVVA 3UJTH 5CFHA 4WJ5A 2R56H 1HDMA 3GK8H 5H8DA 5L4JA 4TNWK 2AVFA 4NUMA 2VIRB 3KPMA 3MRIB 3TV3L 5EPMA 3FH8A 1GGCL 3RUGB 3KHOA 5D8JH 3W11D 2F2HA 4ZYQA 1ZHLA 3QW9A 3VM7A 3QJXA 4MXQC 3B9EA 4QRUB 2FBRA 2BDNH 4KOYA 1IGIL 3JTTB 4Q6IA 1EO5A 4XGZA 1IAOA 2HVJB 1DQJB 3AREB 4IHOB 3KPLB 1JI1A 3N1FC 5K8OA 3F7KA 3BI9X 1RZIB 3ALWA 1DL7H 4NKMA 1FAIH 4ZD3H 4LAQL 4W4NA 5IBLD 3TV8A 1DQVA 1WZ1L 2CAKA 2MSPA 2P5EE 4OZHA 5DZLA 2V33A 3ULVC 3V4PL 3ZZLA 1KDIA 2I24N 4JCMA 1A6VH 4QXVA 5FFGA 1X7TA 4U49A 4KHTL 3I9SA 5EPMB 2OL3A 2VXSH 4HIQA 4GAJL 4L3CB 1JGLL 4IKJA 4NP4H 3WNIA 3H56A 4JRYE 5D1ZA 5I2IA 1FY7A 1PCAA 2UXGA 1LO3L 3WTVA 3FU7B 4GQQA 4P2RA 3CHQA 3MREB 2BHUA 4XH2A 2H2SD 2CHNA 1C5DA 3RI5K 1GGIL 3T0EC 4ESKA 4AX3A 1DZ0A 4B12A 1JI2A 2XTLA 1WAAF 1KWGA 1JPSH 3C5ZA 1JXDA 1UH4A 1BXVA 4I48A 1UADC 3I3BA 1V3LA 3RFZA 4JPKH 4JRLA 1K5NA 3RFRA 2OR7A 1O5DT 1JZGA 1U8MA 2W9DH 3CXFA 4JRYA 4PV9A 3BUQA 3UTTA 2XSKA 1PTZA 3DVNA 1NLDL 4LPUA 3VRLE 4OZFG 1H3GA 4QRSB 4NQQA 4L4VE 2OZ4A 2WBXA 4OJDH 3EDFA 3ES6A 4PRDA 4F57L 1BZDA 2B59B 3FQ1A 1OAYL 5ABZA 3W0WD 5FV2A 3UIYA 2B5GA 4YLBA 1HWHB 1MCPL 2ZSVA 4HFUL 3ESUF 3OKMB 3P2BA 1WPCA 3CPLA 4S2SB 2J1YA 4P46C 3TBSB 1YEIL 3QUML 1M6OB 4HK3J 3NA4A 4JQIH 4HALA 5B21A 5KJRH 5BWAB 5L0QB 2PW1A 2BVQB 1XH1A 5JHMA 3GNMH 1A3LH 3PQYD 4YFJA 1T21B 5FGSA 3SY0A 4AWJC 3CN4A 3IIBA 3B9VA 1UD4A 2YPKB 4UUJB 2JELH 3VXMD 5L4MA 4P4DA 1FL5A 4Z78A 4NKDB 5FO9B 3CV5A 1I3UA 5HHOA 1A2YB 1MXDA 2X28A 3L7EB 4M48H 2F19L 3RNKA 1WA0X 4MD5A 4YHZL 4OB5H 1JYWA 2KC0A 4TTDC 1AQDA 3LPPA 3JVGC 2GJPA 1B88A 5AD0B 1UUSA 5T3XH 4LGRB 3FFDB 1BM3H 3JT2A 2CU9A 4N0RA 3RIFF 3LZPA 5BO1H 1XL4A 3GMNB 3FHAA 3LKQA 4TQEL 1LD9A 5ACLA 1RULH 4P2RE 3ABMB 5JXEC 4BBWA 1Z2KA 4PRPD 2O30A 4KNTA 5DJ0B 3GPSA 4HG4J 4GAJH 2F6AA 3ATDA 5EC4A 4MQXD 3D67A 3N06B 4LSSL 1SJVA 5TDNA 1CFTB 1HXYB 5E1AA 5F21B 3OXSA 4IYKA 1GA2A 2B8OT 1Z9OA 2I7SA 1E3ZA 2NY6C 3K1DA 5DEFB 1QX1A 2NR6C 5D1QD 1FLTX 2AAVA 1UM6L 2CXKA 5TE4H 2NCEA 4A2DA 1QNIA 3EO4A 2F5AL 1X5ZA 4PJ8D 4JLRA 5IFAL 4S1DD 1DYZA 3O45B 4GW1B 1E2ZA 3PPEA 2XBZA 4OSUL 2ED7A 3VQ1C 3FQTA 5JQ4A 4IGBD 4GG6E 3PRTA 3MKGA 1S9YB 3S34L 3WC6A 5KTCA 3LY6A 1CGSL 3I9PA 4TRPL 3V5HB 2MCAA 4J2XA 2VCOA 2B9BA 4Z23A 3SN6N 1GGBL 3KDPB 1WRFA 3VXSB 3TVMA 2BUEA 2R1IA 4OIDA 4OAWB 3RPIA 3DK2A 3L2NA 3BJ8A 1RHHA 4FOMA 2FQEA 1OAUH 3CXDH 5CF3A 4M7KH 4R6TA 1HXMB 2YARA 4ILDA 2R56L 2ZWSA 3MNVB 1S7SA 3SJVB 1I9EA 3VGHA 5TE7L 2DI7A 3TJHC 3BN9C 5IJKC 2NW2B 4KTEH 2GLJA 1TSHA 4XPDC 1KCVH 2D4OA 2WBJA 3QJFA 2PTTA 4Z7UB 1M2OA 1NMAL 3AG3B 3FNKA 3B56A 4ZXBA 2VDRL 3OJDB 2RR3A 4KXZI 1KUXA 4KHXH 3A67L 3VW3L 2QMJA 4F5CE 3EH1A 2O72A 5F7KC 2GHZA 1MKFA 1G9NL 2DD8L 2JELL 3FYIB 4JM2D 5B4MD 5C0NC 5J3HD 4Z7AA 5KYUB 1HYSC 1P84K 1IC7L 5EIIA 4F7PA 5FHAH 3AXLA 1S7TB 3DTDA 4XVUD 3SPCA 5JPNB 4PRBB 4MRIA 1N59A 1V7MH 3HNVL 3QRLA 4PJDA 3U48A 3WNLA 2Y25A 4LCIL 4HGWA 4XX1E 1CDIA 4Y2LA 4N8VA 4RWYL 3B8YA 2XFGB 4XAKE 5CEYA 3T8XB 4BFEA 3MA9L 2BY1A 5BRZD 1UKSA 4HFUH 3LZFL 3P11L 1BVKA 3HG1A 3UTZB 3QIUC 1UATA 4MB5A 1MWOA 3U2JA 3VSUA 5LGKA 4F9VA 4JFDB 5EN3A 2ZNWA 4LUAA 2VLJA 4MHPA 2KZ1B 5I23A 2MEJB 3TA3A 1XRYA 3MZTA 3VVVA 5CBAB 2Y1ZA 4GXUN 2DWYA 3ETTA 2FCBA 2P5EA 4IIQC 1R5WA 5TDNB 4MJHA 3VYPA 4ZRGA 3NYKA 4ONFH 4TM9A 5HHVL 1JPTL 5CILL 1T1WA 4BXVA 3FRPA 2R59A 2VLMD 2EDTA 5JPMC 1E42A 1IC1A 1S4IA 1XD0A 2A9NH 2J6EL 3CBRA 4S1RL 3CFBA 1E9QB 1NGZB 1OPOA 1TJHH 1ZT7B 4RRPG 1IAIM 4HKJA 1VCBC 3EDDA 3FT1A 1ADQL 3U2SB 3OZ9H 5CLXA 1CD1B 2R8VA 1M1SA 2C9XA 3AQYA 3I75A 3QQ3A 5BV7C 2OXHB 3RL1B 3L3OB 5IMLB 2QGDA 3PGCB 3QDMD 4AQEB 2AC0A 1AGBA 3OKOA 3H0TB 3UCRA 4OZGF 2NNRA 4XP6H 2X40A 3MRBA 4XNAA 1MQKL 1CFNA 2C27A 1F11A 4P2RD 4G6ML 1KC5L 3EJYD 1E40A 2GKIA 4PWIA 3HG3A 4UZGA 3G7TA 3K6IA 3CHRA 4MB4A 4MMZC 4F2EA 3DR8A 4QRFA 1A3ZA 3MXWL 5E1QA 1HI6A 1QOKA 4IRJB 3LKPB 3EC4A 5IVXE 3QDGE 4ZW7A 5TPWH 4QAWA 3QNVA 3O45A 4F80A 1E43A 4HULB 3V0HA 4WSKA 5K8MA