2NSMA

Crystal structure of the human carboxypeptidase n (kininase i) catalytic domain
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
399
structure length
390
Chain Sequence
KLAFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNKEALIQFLEQVHQGIKGMVLDQNYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Carboxypeptidase N catalytic chain
publication title Crystal structure of the human carboxypeptidase N (kininase I) catalytic domain
pubmed doi rcsb
source organism Homo sapiens
total genus 136
structure length 390
sequence length 399
ec nomenclature ec 3.4.17.3: Lysine carboxypeptidase.
pdb deposition date 2006-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 2nsmA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2nsmA01
1LAMA 4A37A 2PJCA 3S9MA 4NGNA 3NH8A 3S9NA 1XRYA 2AFOA 2G9DA 3D7GA 3D68A 4RUHA 3B7IA 3I1UA 3VARA 2ANPA 3B35A 4NGSA 2AFWA 3NH4A 4PXBA 4TWEA 3FX6A 3SI1A 4PXEA 4YWYA 3D66A 1QQ9A 1M4LA 3KASA 1R3NA 1LFWA 3PB7X 2RFHA 1TF8A 2ZELA 2PJ6A 3DLJA 1VHOA 3GUXA 5THWA 3WC7A 4OC4A 2ABZA 1XBUA 4MHPA 4IAVA 2Q51A 5K8PA 4OMEA 4ZX9A 4MCPA 2V8DA 4NGPA 1HEEA 2WYRA 1TKHA 4FL4C 2ZEGA 5K8OA 1TKFA 1Y0RA 1XMBA 2QVPA 2QYVA 2V8HA 2JEWA 4A94A 4Z65A 2IJZA 4OC5A 2ZEEA 1BAVA 3H8GA 2C6PA 3NA6A 4MHNA 1FT7A 1FNOA 4GM5A 3FJUA 2NSMA 2PJ0A 2F8HA 2GU2A 2C6GA 5LRGA 3D7HA 4A38A 4MXUA 7CPAA 3HUVA 2AFZA 3SJGA 4IYKA 2J9AA 4WWVA 3LWUA 3NJXA 2PVWA 2B59B 3KR4A 4NFRA 3CPAA 3IWWA 2FVGA 2PJ8A 2AFMA 1TXRA 5JH9A 4UIBA 4F9VA 2XEGA 4O23A 2ZEFA 4YOKA 1CPXA 2ZEPA 3KQZA 2F7VA 4FUUA 1CG2A 3PRTA 4FWUA 3DGVA 1QMUA 5CPAA 4B6ZA 4P10A 4U3SB 4MHZA 3IJ3A 4CPAA 3LMSA 4AXVA 4UEZA 4MCSA 4UEFA 2RB7A 2XHNA 2JBKA 5LRKA 1KWMA 4F8ZA 4NJQA 4NGTA 4UIAA 1XJOA 4PXCA 4TNUA 3BXMA 1Z5RA 2JBJA 1GYTA 1Q7LA 1LAPA 5JM6A 3BHXA 3KHZA 1Z2LA 3SJFA 2ZOGA 4PPZA 5LRJA 4DUKA 3GB0A 3KQXA 1HDUA 3N5FA 4X3RA 2PJ3A 3S9LA 3D4UA 4W9YA 3CT9A 2PCUA 3PBEA 2DEAA 2CTCA 5K39B 3VH9A 2BOAA 3WABA 5LYIA 3SJEA 1NKGA 3L2NA 5J1QA 3BI1A 3FECA 5JGFA 4Q7AA 2V77A 3B3VA 5HVFA 1IY7A 5F09A 3KI9A 3PEIA 1ARMA 4ZY2A 2IQ6A 2PJ1A 4FAIA 3B3CA 1VGYA 3D67A 8CPAA 1BPMA 1YLOA 3KZWA 2PJ7A 4JZ0A 2PJBA 2XEJA 2Q43A 2PJ5A 3FH4A 3ISXA 4JYWA 1ARLA 1ZLIA 2QJ8A 3GLJA 3FF3A 4OC3A 4P6YA 4MHYA 3PB9X 1BPNA 4MRIA 2PJ9A 4R6TA 2ZEMA 1ZG8A 4EFDA 3MRUA 1DE4C 3B3TA 3RBUA 4ONWA 1ZG7A 4DJLA 2V8VA 2ZEDA 4OC1A 3MN8A 2WZNA 5ELYA 2PJ2A 3HN5A 3K9TA 3HLPA 4LQGA 4P44A 2EWBA 5LYFA 3IO1A 1YW6A 4WI0B 5K8NA 4WJBA 1HDQA 1XFOA 3FMCA 1DTDA 1NSAA 1VHEA 3PB6X 1PCAA 4P4BA 2CTBA 2NYQA 3D7DA 2O4HA 1PYTB 3NH5A 3B3SA 4P4IA 1F2PA 2GREA 3KL9A 2PIZA 2C6CA 1Y0YA 4ZI6A 4P4JA 1H8LA 3D7FA 4H2KA 2POKA 2XEIA 2ZENA 4OC0A 3FEEA 3H8EA 4YU9A 1RTQA 2BO9A 5DS0A 5I4MA 3G3LA 4P4EA 3FVLA 3PBBA 3ISZA 2PE3A 4ZY1A 4NGQA 2EK8A 4PXDA 2GLJA 1CP6A 1TF9A 1OBRA 5K8MA 2XEFA 4OP4A 1F57A 5LYDA 4K3NA 5AQ0A 4UEEA 5LYLA 1ZLHA 2IMOA 1R43A 1LOKA 4OC2A 3SJXA 1LCPA 5D29A 3RAMA 2ZOFA 3KGQA 4MCQA 1JQGA 2C1CA 1ZG9A 2I3CA 3KCPA 2V8GA 5D8NA 3V38A 1AYEA 3IC1A 4UF4A 4ZY0A 1AMPA 3TX8A 1Y7EA 3SI0A 1YW4A 1CBXA 1YMEA 2BCOA 1ELMP 4X8IA 4IHMA 3NFZA 3QNVA 2PVVA 4X2TA 2CIJA 3PB8X 1LANA 4OKOA 4FBEA 6CPAA 1EE3P 2PRQA 3WC6A 1Z8LA 2PJ4A 2Q4ZA 4G1PA 3V7ZA 3K2KA 3VATA 3CPXA 4FXTA 5IB9A 3PFOA 4P4FA 3IFEA 4F9UA 4EWTA 1CP7A 4ZYQA 1TKJA 5HVHA 4A39A 4OIDA 3WC5A 4NJRA 3E8VA 2ZEHA 4EMEA 1CX8A 3SI2A 4R76A 4MMOA 3JRUA 4BD9A 2VL1A 4P45A 2O53A 3B3WA 1ELLP 2ZEOA 4PQAA 1YSJA 4OIWA 2CF4A 3B2YA 4EIUA 3FEDA 3IEHA 5HXDA 1IGBA 4NGRA 4DYOA 4P4DA 4KSIA 3CDXA 2PJAA 4ZX8A 2AFXA 3H8FA 2EK9A 3KR5A 1CPSA 5HVGA 4R7MA 4R8FA 3KHXA 3IIBA 1BLLE 3RZAA 2OOTA 2AFUA 1UWYA 2HC9A 3T8WA 2OR4A 5CBMA 3NJVA 3PFEA 4NGMA 3BI0A 2GLFA 4MCRA 1VIXA 3TC8A 2PIYA 3PB4X 5G5DB 2HB6A 1F2OA 2AFSA 3WT4A 4IK2A
chains in the Genus database with same CATH superfamily
1QRNA 3DVFA 5E8EB 1L7TL 5ALCH 1NL0H 3GGWB 2PJCA 1S9YB 2RD0A 2D2CC 4AXWA 5DA0B 4FG6C 4F9PC 4ORGA 5E7BA 4JG0L 1Q0XL 3QPQD 5FO9A 5BV7C 1NCBL 2CGRL 4BHUI 1RZGA 4G7SB 2EH7H 2ZUWA 1RLBA 2ANPA 4AW4A 4JFHD 4RGMB 2MH4A 3GB7A 4JQIA 4NQVA 2JDCA 2GSIA 2IWKA 4B0MM 2HVKB 4R97B 4KJWC 5ADPH 4M5TA 2AQ3A 3P0YL 1JNNH 2O5NA 3TBSA 5K33A 4YNYA 3R1GL 1DFBL 1K4JA 1AHWC 4QRUA 2HH0L 2PXYD 1HL4A 2WJ5A 5EZLA 1TF8A 2WKGA 5EIIG 4G6AD 4GKZA 2OTUB 3ARZA 3D48R 1P1ZA 2EZ0D 3NIFB 5IHHA 3OX8B 3SO3C 1Q9KA 3VXQB 4XVTL 5K59E 2V9RA 2B39A 1WTLA 4MMZC 3SGEH 3K1KC 2DPSA 2YXFA 3VSUA 1F41A 4MS6A 1R3IL 2DD8L 3O4LD 4E0AA 2Q3XA 2HKFL 4NB7A 1BJMA 2W88A 2HVJA 4MD4B 4Y4HD 3VTMA 4W9HC 3CPLB 4F7TA 1IAIM 2A6JB 1UACH 4HIHA 2X4TA 3IN2A 4OVUA 2P4AB 1JHKH 1YX0A 1U3YA 1AGEA 5DUJA 2BP3A 3FRMA 1CFTA 2Q76B 4URTB 3GRWL 4UDTA 1CFBA 4IRSD 5EOCL 5BRZB 1LK2B 3LKSA 4ZNEA 1FNOA 1VFAA 3QUML 4LGRB 3FTUA 3ZRFC 1OGAB 5IB4B 3RRQA 4D9RE 1CFVH 3UH8A 5E8NA 2H8PA 1W2KT 2N3JA 2G4GA 3HPLB 4Y7MA 4P2OC 4L3CA 3KAAA 4W6WB 5D6CA 5E2TL 4UCPA 5I0ZA 2VDRH 3SHSA 3E7JA 1HXYA 4DKFH 3ALPA 5KBKA 4IHBA 2B59B 3WS6C 4BYHA 1WFOA 4KMQA 2H3NB 1XEUA 2DTML 2E47A 4ODSL 3Q7JA 3RX9A 2GC7C 3MV8A 2D73A 1RZIA 4NRZB 3PWJB 4G83A 4OGXH 4G43B 4MYPA 3TX4A 2R2BA 4DGIH 4JFOB 4R7VA 4NO2B 3VWJC 2Y7LA 1KEMH 1N10A 1NBYB 3S5LG 3WFHA 1C5BH 1N68A 2ARJQ 3DTXA 1TJXA 1VSCA 4PSPA 3H3BC 2FIKB 2VQ4A 3ZE1B 2NXZC 4XWOC 2BSCA 2Z91B 2NY0B 4UA3A 4CRZB 4FWUA 5IKCB 4TNVK 4H8QA 3VRJA 3S6KA 4JKWA 5GGUB 4JMXA 4YSTA 5KSBA 3Q0HA 2Q4VA 1JF6A 1U8CB 1E6JL 4XMUA 1GIGL 2XACC 5BRQA 3UFIA 5CCJA 3U36B 4XN5A 3GYRA 3BESR 4P5TC 2CO3A 3SKUD 1JK8B 3MFGB 1IC1A 2GJRA 2ZUTA 2DEXX 4K5NA 3V0WH 4JBSA 3STZA 4UIAA 1CICD 1U8QB 4DP5X 3SXOA 1EFXA 3VD9A 2IIJA 5DLML 1Q7LA 3GSRA 4JQIH 4OGYH 5C0GA 5EG6C 3DHJA 2JKSA 3TCVA 3HNSL 2R0LH 1CLZH 5CUSH 4C47A 1A5FL 5I1JL 1ZE3C 1AGDA 3B6SB 3MROA 5ETUB 1II4E 3QQXA 4G6JH 4H25B 2QPEB 1QBLH 1D5BA 1E4XL 5BZWB 4HHGA 4GQ9H 1MH5B 5EO1B 4HNXB 3BSHA 3UC0L 2P6GA 5DHVB 5AG4A 3I50H 4KQ4L 4M7JL 4D9LH 4HMCA 1AS7A 4LP8A 5GSRA 1IC4L 3TV3L 4IOIB 4K9EL 3WXWH 5D7SL 1S7RA 5DJAA 1GMEA 2V9UA 4U1SB 4WTXA 1P5UC 2H2SC 3QHZH 3KH3A 5A28A 3QEGL 5JGFA 3D52A 3FMGL 1NBQA 2UXVA 1M42A 3QH3B 3KI9A 4AT6B 5ALCL 5EBLA 1BAGA 3CSBA 4ZY2A 4FQ2L 4M93B 3FO9B 4I0PB 4NRYA 5IK3B 4NIKB 4NQSA 1XIWA 1AZVA 2VWEC 2J6EA 4HDIB 4M5SA 2VLMD 5DD3H 5JPNB 1DUZB 4AYID 3ASOB 2EH7L 2PCPA 4WV1B 4NKDA 5DF0A 4L05A 5MEQA 1VGYA 3RO0A 2Y72A 4XAWH 4Z7QB 2AQ1A 2XQYG 1SN5A 1AQDA 2Y7MA 4DN3L 5EV7A 2WYTA 3VACA 1XMTA 3DJSA 5DQ9B 5ADPL 4NYLB 4LF3A 3V0JA 2VN4A 1M1XA 5E24E 4LGPB 4U0RC 1JNNL 2VE6B 3V5DB 1CFSA 3IDJB 4U1GC 2DQIH 2Y23A 1QTYT 3MACL 4H8VA 2CJUH 1KYAA 3VFUB 1RK0A 2VLLB 2UZIL 5GS0C 3ALXA 7FABH 3KWWA 2P1YA 4B5EA 1J5IA 4OI9A 4KXDA 2QV2A 4UIMB 3ZSSA 2DXQA 4F6AA 3H9SA 2VSCA 3TBCA 2Q8BH 3QYMA 3D7PA 5B22A 2P26A 1T7YA 2JNZA 4XTRD 4KROB 2YMXL 5KSVB 2DBLH 2WBJD 4B9GA 4FABH 4ZUWA 4BSVA 5GCNA 2Q86A 3BP6B 1BOYA 2A9DA 4O58H 3WL9A 3IJYA 1TJIH 1T5XA 1W72L 3CDZB 5DZAA 4AX3A 3EBAA 1JE6A 1KUMA 2WSKA 3CDFA 4NPJA 3N1MC 2KUTA 3WIHH 1H15A 4UZSA 4MJIE 4KX9A 4UINH 3QFJA 4YLQT 4ZDHB 1DQQA 1M7DA 4HALA 3L9EA 1I8AA 1N0LB 4L29A 3S4SG 3ULVF 1KXHA 3AITA 3QIBC 4KNTA 2XX1A 1WZKA 4ABQA 2ZUSA 2PO6A 3LZLA 2JVUA 2W38A 3KYOB 2OTWA 5JQIB 1H5BB 3OLEA 4G2AA 1IGIH 2FQFA 5LYFA 1QATA 2VDRL 2Y5TA 1CT8B 1KY6A 5I74B 3JTSB 4Z7WE 2V7HA 2XWBB 2FWUA 3IJEB 1Z3RA 1KCSH 5JW5A 4PRBA 5F7AA 1FBIH 3HAEG 4B9CA 3OAYH 4WI7A 4CYQA 4OGXL 2X3BA 5HHXH 1XEDA 1MW0A 4KXZI 4N1CA 4RMUA 3ZSTA 4P4BA 3G6JF 4RDBA 3TVMD 5EMYA 5HHOE 1M4DA 1OAKL 2NY5L 2X4SB 1C5BL 1L9QA 3VXPB 5ID0B 3WGUB 2O4HA 4ZW3A 2ILLA 3CVHB 2KDYA 4MMYA 5E4AA 3KDMB 1T0NA 2P47B 5EMIA 1HCFX 5HSFA 3MJ9H 2HUZA 4OV5B 2SEBB 2Z93B 1TSRA 4KFMA 2EKSA 3NOIA 5I66B 5I8KH 2CNZA 3OAZK 4S1SH 4FTVB 1EHLL 2O93L 4BXVA 1RPUA 3HRZC 4PQXA 3K91A 3ARTA 2E9BA 5FDWA 4ORZC 2G4EA 4XP5H 4XGZB 3MJ7B 2J6EH 2ED6A 4GRLA 3B2PA 5IHWA 1U8LB 3D4ZA 2JV6A 1JZ6A 5GSVB 3NIGF 2EK8A 4JQIL 3WDIA 4AZ8A 4E42B 2W81C 5GS2D 3WFBH 2G75B 4GAGL 1E4XI 1HXMB 4OSUH 4PH8A 4ANUA 4QHUA 2AAAA 1CLZL 2R0LL 3PGCB 4M7KL 5CUSL 4KOTA 1QW9A 3CLFL 4K94L 3PXJA 1S8DA 5F6IC 2D4PA 3IEAA 1A25A 1QBLL 3A67H 3QCTL 4MKTA 5LYLA 2W80C 2WC7A 4IK7A 4DVBB 3UTPE 4G6KH 4OGZA 2JIXD 3AU1A 5T3ZH 2IAND 2ERJC 2VLJB 4JDZA 3V38A 1RIHH 2VEZA 1R47A 4UYPA 2JB5H 4PS7A 1Z6JT 1ID2A 4ZMQA 3OSVA 2FBRA 1GPOH 4IOSD 3W0WD 2R2EA 3VYOA 3WSQL 5E56A 2IALB 3T4YB 2BNQE 3G6DH 2J8UB 3GS7A 4NP4H 1TMCB 4N0UE 4AMWA 2VDKL 1IBBA 4OLWH 1N59B 3H6AA 3FU3A 5L0QC 4PHZA 5DJDB 5HGDA 4I1PA 2V7NA 5BVPL 1LANA 1UYWH 1MFCL 2A6KA 1RZKC 4R0LC 5DD3L 2Y07L 1DBML 2BSDA 2Q4ZA 1DP0A 1JK9B 2NZIA 2ZCHH 5GGSA 3BGAA 4HUVA 2PRBA 3TO9A 2OJEB 3B56A 1QR4A 2J44A 2P5WD 5C0DA 1I1AA 2VLME 4MJ5B 1L0CA 5LNGA 2QGDA 2EEDA 5GJTH 4WJ5A 5AVYB 1CIUA 1DJZA 4H0GA 2WQUA 3QO0A 4QRPB 2ZKWA 1CI5A 4PJFA 1NCCH 7FABL 1R19A 2QPUA 2O6EA 3NCJH 3RL2B 1FC1A 1MEXL 4FI6A 4PLNC 1XXDC 3QIUC 3QI9A 3S7GA 4PJ9C 4Z76A 2EACA 1FL3B 4KZ0A 4PUBL 2J1YA 4YHIB 2HFTA 1I4FA 4XBPB 2P48B 5EOQH 4PW3A 4TNEA 3AG1B 3LKQA 4TQEL 1VFBA 3ZQXA 2G2RB 4CVZA 2VAAA 4O2EA 5DI8A 4LOVA 1E90A 2Y7SA 3Q8BA 3NACL 4LDLB 4WQOA 3I9SA 3W5NA 3CQQA 2YWZA 4EI6A 1BFVL 4M6AA 4GQPH 2B77A 2FJGA 2A4NA 3IPBA 1NANI 1TF4A 2VDQH 3LIUA 1UOKA 2DY2A 4IGBD 3U2IA 3SDAB 2R0KH 4KI5C 4LLQB 3CFJA 1VZGA 3RBSA 4F58H 1EERB 4YZFE 2KHAA 1CGSH 4OFIA 3SD5A 4HS6A 3IIBA 2LTQB 3RZAA 1OP5H 3RIAF 1BXVA 5JNYA 2JLMA 3ULSB 1QSED 3ARYA 3BKYH 5F72S 4HQQL 4L9DA 2WSPA 1IGIL 5JPMC 3FB6A 3UYPB 3BI0A 3FU6A 5DD5L 5AB2A 3L2MA 5HPMA 4JKKA 4MYWB 1LO3H 1T6VN 1QFWH 1T2XA 2BIHA 4Y1AB 5IR1B 4KSFA 1ODUA 3JWOC 4AEEA 4LZKA 2DEYX 3MGAA 3MRQB 4P23D 4N2DA 5HPOA 5HHXL 2FX7H 2ZCKL 2C8NA 1A9EB 1MKFA 4PTTA 5IMKB 2BVOB 4GFTB 1AO7D 2VN6A 1FYHB 1JYNA 4UBRA 3QWRA 5C71A 4DGYH 3RY6C 3VRLF 3V6BR 3AT0A 2FR4A 3RY5A 4I48A 4PRAB 1F6LL 4Q6KA 2XWZA 3MJ9L 2R7EB 3W9DA 2Q2EB 3GMNB 1LDSA 4P4RA 3U6RB 3FX6A 5LNEA 2WTPA 4S1SL 1WWCA 5IMOB 1DJWA 2AZUA 3AWFA 3BEWA 4XN9A 5EWIH 4H8WC 2VMJA 5FUOH 1FV1A 4BBHA 5C0CB 4NC1E 5HYJA 3KNBB 3QEQA 4HX1B 1DBJL 1G7QB 1L9SA 5I24A 1U6MA 4B11A 4NNXA 3L08A 2J71A 2EE0A 3LRSB 3QHFH 3UP6A 3KJ4C 1YGHA 4Z9KB 3WUZA 3O8XB 1WK0A 1DUYA 1GY2A 5HDBB 4RDQG 4BA0A 4Y9CA 3SBWA 1E3ZA 2AJ3A 3FXTA 1G7MB 3U0WL 4WHYG 3ROLA 4G6KL 3C60B 2OW6A 4K15A 2F5IA 5TPWH 1DJGA 3P3SA 4OD1H 5DC4B 1YDPA 2IADA 4G3YH 4M7ZC 5EPMA 1ZT7B 3U7WL 3FJUA 4GM5A 2XTLA 5FF6B 2AKRA 3MLPA 2XTJC 5IQOA 3QNYB 3PWUB 5BRZD 1GPOL 1MJJA 2IANE 4IU3A 4NGHL 2BZCA 3N85H 4AJVA 2OYMA 2G2PA 3RVUC 4S1QH 1XR8B 2W65A 4NQTA 4ZW8A 3G6DL 5DEGA 4NP4L 5HHVH 5BW7A 1KJ3H 3GMOA 4XI5C 3HUVA 1OGAD 1LK3H 4OLWL 2ATKB 1PZ5A 3QDMA 4PJCB 3E3QC 3OV6A 2HKHL 3DETD 4EBQL 4WWVA 5C0BE 3MOAH 3UTOA 5BO1L 5IB5A 1E28B 2FBJH 3UP1A 4KXBA 1CFMA 2ZT9C 2ZCHL 1SOQA 4GKOA 3D1MC 4ZAKC 2GAZA 1F18A 1WRFA 3Q8FA 2VR7A 3QORC 5CWSA 3K6FA 1WVZA 3EAKA 1YEFH 1KB5A 5I1CH 3JQOB 3DUSB 4CL7A 4K7PX 1YEHH 2P5WE 4X6DA 3PDGA 2K5TA 1H6TA 1P53A 4RAUB 15C8H 1JZ8A 1HWGB 4C4UA 1XWVA 2XV6B 3I74A 3ME0A 3OG4B 4MHHG 4FERA 1RZ8A 3WFEL 5AYQA 5DS1A 3VFOA 4MCYB 4A30A 3M17A 5C6TL 4ZTOH 1U95A 1LWJA 2YNCA 4Y19B 2CIKA 2MHAB 1IAOA 4AQ1C 4FQJH 2K45A 3FPYA 3LHAA 4I87A 2WQWA 2NY0D 4U3SB 2YGOA 4L8SC 3VMPA 3PG2A 4LO9A 4CPAA 3CCHB 5EOQL 4UEFA 2H5UA 5HGAA 1FO0L 1XB3A 5FA4A 4AV5A 1B0RA 4UQ2A 5AB0A 4FLQA 3MUY1 4KZDL 4FFTA 5JHLH 1XJOA 1JD9A 1IIKA 3BH9A 3RWGA 3W9EB 1E4KC 3MBWB 1LEKA 4QKTA 3FB7B 4ZXBC 2VDQL 4JRXE 3V0VA 1BQHA 2R0KL 2CDEA 2EH8L 4N2KA 5JYMA 4QOKB 4PSRA 4F58L 5LRJA 1Z0NA 2Y4SA 1JPST 1NC4A 3L5IA 2VZVA 1ITCA 2VMCA 5AZ2L 5TD4A 4JFQA 5FYKU 4AVIA 1AE6H 4GMTH 2WIIB 4JB9H 5H4ZA 2GBTA 2XKUA 2A74C 3S5ZA 3T1WA 2CALA 1KFAH 2OSLB 1MW2A 3BKYL 5BVJB 2GYSA 2QQKH 3ECBA 1S7QA 1H6UA 1RURH 3A4FA 4AEIH 5C7XH 3GSNA 3IDXL 3RDTC 4H0HB 5E8OB 3CZFB 5HI4D 1LO3L 4MB4A 5ALBH 2AK4B 3HN8A 5H4YA 5E9DE 2XXCB 3R8BB 4S0HA 1IJNA 3F65A 2R15A 3QFDA 5J1QA 2AJVL 3O9WC 4GP4B 2WP3O 4OZIE 1ZGLB 5K9QG 2FX7L 5AB9A 5AVQB 3VI4E 4CVUA 1JFHA 4WUKL 3FQNA 1OW0C 4HP5A 1A7RL 2A83A 4CC4C 5EC2A 2YN3A 1RLWA 4L2YA 5IIEA 4FI7A 3KEDA 5EBGA 4I0PD 5E8PB 2ZUXA 1JN6B 2P8LA 5AW2B 3D50A 1VAHA 1D5XB 2MOVA 5IVNA 3L3OB 4L4VA 3GMQB 4N8CH 3L1FA 4XOCA 4X7CC 5C07E 4HOXA 12E8H 2X09A 4LLWA 2PJBA 4V1DA 4GMSL 5FUOL 1AUGA 2H4EA 5E1IA 4KDTC 2NUPA 4AEFA 1IAKB 1E6OH 5I73B 2YNDA 3KWTA 4QJ3B 2UXFA 2AAVA 1BQSA 1CF8H 1UB6B 5I8CB 1OTSD 5D1XE 2QJ8A 2ESVA 3QHFL 4WEUD 4B60A 2Z35B 5B1AB 4OFVA 5JW4N 1U2CA 1P4IH 4JD6A 3D87B 5IB3B 2A77H 1KB5H 2HN7B 2F7QA 3MLZH 5JHAA 1BM3H 5HYSB 2IGFL 1X6LA 1ZLVK 4U6XA 1YSOA 4M3SA 1TTAA 3N41B 4AV4A 1J12A 1IVLA 4KROD 4ODHH 3NIFE 2QSCL 3G9AB 4YDJA 1ZXQA 5DMJB 1ZIAA 4Y2OB 4OD1L 4WO4B 4AYEC 1U58B 4E5XG 4EN3A 2XJKA 4JKPH 4NC0B 3BWUF 2QL1A 4LSSH 3U6XS 4OLEA 2BY3A 4YS4A 3N2JA 3BMWA 3K6IA 3SQOH 9CGTA 1T03H 4Q2ZB 2GTQA 3R06B 3MRJA 1EFQA 4HD9A 1AGCB 3U0PA 2OX5A 4HJTA 3N85L 2CIIB 3SJVB 4HKJA 3GK8H 5GJSH 4FQPA 5LBGA 4KJPC 3ZMRA 5TF0A 3EH5B 3IDMB 3MNVA 3MUGB 2CNSA 3GNML 1NCWH 4N2HA 1LWHA 4WEBH 4FA7B 1ML0A 4GG6F 1HCZA 3I3EA 4CAWA 4YSOA 4WJKB 3D33A 3CLEH 4HZLB 4CGUB 4PJGF 4JFTA 4ZUUA 1WHOA 2BXZA 3MLSH 1OGAE 1FG2A 1UT9A 3DTDA 3HE7B 1P2CB 5D8JL 1A6AB 5DZPA 5CEZE 1HXKA 3GZOA 4LLUB 4WTZA 4ENZA 2Z4QA 3FYIB 4PGBB 3FO0H 4OJDH 4PJ5B 4GP5B 2Y36H 4QO1A 1Y6NR 2Y3NA 3QJOA 4UQ9A 3QJZA 3VYPA 2FUTA 4LAQH 2VDLB 5KVDH 4BHUA 4P57A 3HVNA 4XPAH 3BHBA 3GSNH 4ZW5A 3CZLA 2D31A 4Y5YA 2E27L 1I8MA 1WP6A 1DQVA 3EOTL 2PWFA 4MBUA 2BNRB 1XL4A 4WI6A 2Z3FA 5MI0B 4KKCD 1UFHA 2R1IA 1J05B 3GPSA 4DVRL 1FFTB 4C83B 2WQAA 4GQRA 4PJ7B 5JOEA 3UTZA 4NPYA 1U8PB 2PCFB 4HS8H 2YSSB 2LQRA 2FNWA 4UV4H 3BVTA 4TSCH 4H20L 3VGHA 1G9MH 4BKLA 1P0HA 3C75A 1AP2B 4FTVD 4N0CC 3MLYH 5HVGB 4CMMB 2I9TB 3V4LA 4UAHA 5SV3A 1P6WA 3O3DB 1Q9OA 4JFPB 4JX0A 4P4EA 2YKLH 5JHLL 3RPBA 1AR1C 1FSKB 3PGDB 2VXTL 3VXSB 4NGQA 4ANVA 1M53A 4YH6A 1UHVA 2DDQH 5G20A 3BZDA 4XPBL 1NGXA 3QYCA 4YGVA 3L54A 3I9GL 5FV2A 2OR7A 4Y4FC 2XA8H 4XMWA 4GMTL 4JB9L 2JJUA 3TN0B 4AKPA 2IDFA 3FCSA 5TQ2L 3RWEB 1LOKA 3L3JB 1KFAL 2HTLD 3FTGB 2Q20A 1CG9B 4XNYH 4GO9A 3GMPA 1J88A 4FXGA 4JJ5A 5C09B 4ETQB 4HIJA 4J4PA 2WNGA 4AEIL 5C7XL 1JQGA 2C1CA 2XDHA 2ITEA 3ES6A 5D2LF 3X11B 4QLRA 3HE6C 3FUFA 3V6FA 2V8GA 2AQSA 4PRNA 4X6EB 4C7IA 3VQ1C 4ALAH 3CH1A 3A6BL 1WH0A 4MNGE 5BJTA 3B8GA 2HFEB 5TDPA 3CUPB 3HZVA 3UC2A 1Y7EA 2VLJD 3P77B 1AGBA 4UOQA 3M7FB 1A9VA 4YDNA 3T2LA 4H13C 4KUAA 2SODB 1BZEA 1CE1H 4A2DA 1A3RH 1ZJAA 4ACPA 3VFMA 4Z7WF 5CD5D 1FNEA 3ELQA 4TVUA 3SCMA 2GHZA 2BJML 3E6FA 1BA9A 5DJXA 2I5YL 1OTTD 3CFCH 3LKPB 4PGJA 5C3TA 4ELKA 4WNQA 3R9GA 4XT1C 5F1NB 3K2KA 4JO4H 4MS8C 2HYMA 3KLKA 1Q9WB 1KIQB 3JBG7 5AYUH 3EJCA 4MI4A 5E6IA 12E8L 3OF6D 2A0LC 2D4FA 3GC3A 1PYWB 2V5YA 5AKSA 3WV0A 3MRNB 4EAEA 3F7RA 5LAXB 3WC5A 1E6OL 2ZEHA 1QPKA 3OXRA 4DUWA 4Z7QE 1G7HB 5B1JC 2C7FA 1CF8L 4BD9A 2O26U 1KGUA 1MY7A 3DVNB 3FB8A 3LN5B 4QRPD 4FCAA 1CGYA 3E8UH 4OGQC 3B3WA 4K55A 3MRPA 1J86A 2DWXA 2TRHA 4N9GB 3ATDA 3D85B 4IMKC 4GG6A 1YSJA 1YVOA 4PRHB 1JZIA 5IVXB 3KBFA 4M8QB 4D94A 3ZZ1A 1S9WA 1V3KA 3I6LD 2FJUB 5LN4A 3H7BB 2FSDA 1QUNB 4M4PA 2WPXA 1F13A 4LU5L 2DH2A 1AC6A 2FX9H 1F45A 2NPLX 4ODHL 3WN5B 2ETWA 1L5GB 1OPGH 4KS9A 4RISH 5FV1L 5DC0A 4Z6AT 4ZX3A 4GUOA 3OLDA 3P9MB 3EADA 3W57A 4ZX8A 3AJ7A 5J6HA 4BZ2A 4MLSA 2EK9A 3KR5A 1T2JA 1UM5H 1JV2B 2VLRB 3P73A 4LSSL 3MKGA 4X4YA 4R7MA 3DOSA 3MLXH 3SQOL 3QDGB 3QW9A 1IGTB 3SDAD 2HT2D 2WANA 4FQHA 1ADQA 1P7HL 5I71B 4AG7A 3X17A 1S46A 3K0YA 2EDLA 3CFEB 4M6HA 3AROA 5KW9L 1E5AA 3NG5A 5GJSL 3BJLA 3D39B 1QFHA 4MB1A 4X9YA 3GSXB 1TCRB 4WEBL 3RY4A 3UGUA 3DHMA 1P6FA 2G5BB 3CLEL 1DBKL 5DD6A 4R90H 3RE0A 3MLSL 4B7IA 2VXSH 3CVCA 2VXVH 1DVUA 5B8CA 4Y1AD 3FUEA 4FD6A 4AMKH 2AFNA 3RVVD 2I60L 4DGVH 1H3GA 3N91A 3ABZA 1ZGLM 1EVTC 4UIKH 4MA1B 1ZWIA 2EEAA 1QPXA 5HGBB 2CNYA 1GY1A 1VGKA 2DQJH 5KVDL 3QWQB 4ZS6C 3CX5K 3TCTA 1N5AB 3GBNH 5FW7A 4N3TA 3CSTA 3LNGA 2GK0B 5I2IB 4UAOC 2QKIB 4AIXA 1GAFH 3DO7A 3K9UA 4MJIA 1TNMA 1IKOP 1MHCB 2DQTH 5DZVA 2O4EA 4GW1A 4Y2LA 3T6QC 1IZJA 1OTUC 2CK0H 4HS8L 2Z11A 5D2LA 4TSCL 1U3JA 3BSZA 2CHXA 3T8XA 4CMHC 1ZSDA 3DGGB 4FJYA 5EORL 3C6SB 3WNJA 4AQEB 2GSGB 4IRSA 4F2MB 4G80A 4L8CB 4K07A 1MI5B 1F6AA 3HJEA 2YKLL 4JL1A 5B1CA 5C0CD 4B10A 2R59A 5B21A 3RLSA 2WB7A 1XIWC 3INUH 1JWSA 4FTVE 4PJXB 4KK9D 4W70A 5BV7B 4Z7WA 1QFUH 3OJMB 4EZKA 2XLLA 4G5ZH 4OMEA 3BJ91 4JRWA 2V8DA 4MCPA 3MO1B 2VDMH 4PREB 3TPKA 4JEGB 1RUAL 2AP2A 5IMLA 2XA8L 3WAKA 5DK3A 2OMZB 1U92B 2WLLA 2WXFA 3FFCA 1IMHC 3O8XD 2ORBH 3GIVA 3P4MA 3ZJAA 4UQBA 4NN5C 3NA9H 2D4OA 4XNYL 5HHOA 1YPZF 4WU5B 1UXSA 4OC5A 1LEIB 2ICES 2Q44A 4YAQB 1QPPA 2CO7B 2XKSA 3ZDXE 2Y22A 3C60D 3MNZA 1XBDA 2FT8A 4G70B 1QA9B 2HLEB 4Y9GA 2NY7H 1X12A 1CDHA 3SO3B 4XVUC 3NCWA 3RWFA 3UACA 1LE9B 4U3HA 5AZEH 4JHAL 2ADFH 3DRQA 4KOUA 5FKAA 5C08B 3QZBA 1JYXA 3BEVA 4MMZB 3P3UA 4A2LA 1NMAH 2K4AA 1CE1L 4FA8A 2AVFA 1A3RL 2XZZA 3AQXA 2B5GB 4KOVA 1JPFB 2DW5A 2J9AA 3GBMH 4BZ2H 4YQXH 1T83A 3QC6X 1SF5A 3EGXB 5F7FA 2V37A 1K6QH 4GW5A 2DF3A 2AFMA 2F9BT 4W93A 1FJ1A 3BDXA 1NFIA 2CBQA 3TWCH 1BEXA 2C3WA 1E40A 1DJXA 1NSNH 4F0XA 2J8UE 2OKMA 2XA3A 5IW6B 1CICA 5DRXA 4X4ME 1TYEB 1WTGT 1BFOA 3SBQA 4ONUA 1DBAL 5CHNB 3EW3B 3KQZA 3ZDYE 3FH7A 1BX2B 3RDJA 4Y0GA 2PO6C 3BDYL 3CFTA 3WY1A 4UWJA 4JPKL 4P2OB 3PZJA 3VCLB 1LQSR 2L3BA 5EO0B 4JDEB 4HUCA 4DP4X 3RWIA 1VACB 3E8UL 5J6SA 1JXGA 1PZSA 5JO5A 4G72B 1YY9C 4Y19D 4K3EH 3S96B 3LD8C 5LGJB 2B4DB 4QRPE 1M44A 4YXHL 4RZKA 1I8IA 5FO8B 3AC0A 3WN6A 4FNRA 3D09A 3ZQWA 3KWUA 4NJQA 4HPOH 3BZFB 1MNUH 3NPSC 3BVNA 2BNQA 1WZAA 4QRQA 4HISA 2F53B 4N0UA 1OPGL 3U9WA 3VFTA 2I27N 4JY5H 5FW6A 4CDGC 2RJMA 3TYFB 2MMXA 2NXZB 5JM6A 1YEKH 3CFBA 4JVUA 3T2OA 1USZA 1BQLL 2XETA 1SJEA 3ARDA 4NWTH 4DK6A 2V5TA 4PPZA 3PDDA 5DUML 2EE6A 3BSZH 3MLXL 4X99B 3CWGA 3UG4A 2BRRH 3NFPA 3X2QB 1CQYA 1KCVL 4UOW1 4MB3A 4P5KB 3CT9A 4L3EB 3B2UC 1A7NL 4NEXA 2I7OA 1T22A 2D0GA 1KCWA 4LPXA 3LKOA 3GHBL 3BPCB 3VH8A 3PIQB 3LQZB 1DVFA 3NH7H 1H0DA 3MRBA 4NQDA 4UZGA 1PZAA 3GEFA 3WS3B 5IEHB 2YJQA 4QR7A 2WTOA 4R90L 3MGOB 5INDB 2VXSL 3PY9A 5JLZA 2IG2H 2VXVL 1NGYB 3TFBA 2VDOL 4PI0A 1UA6L 3O6ML 5DWMA 5JXEA 2JMRA 2OFQA 2AK4D 5ISZB 4KNSA 3HCVB 3ZTCC 4AMKL 2GTWB 4LMQE 3P9LB 2YUVA 4DGVL 4J3OF 2CQVA 1UWEH 3CXFA 4DETA 5L4FA 4UIKL 3MZGB 3FSVA 1RK1B 1SHSA 4I3GA 2PJ1A 2BP5M 3CXDL 1FH2A 2A38A 1MRDL 3L4XA 1S78C 3CSYB 2A5UA 3SKMB 1AKJA 4K8RD 1AS8A 1CR9L 2A9ML 2G3XA 4LLMA 3D67A 1IGCH 2J25A 1GAFL 2WAQA 1GGCH 4FQ1L 3LH2L 5CINL 3LIZL 2WZPA 1N12A 4M43L 3RQ3A 3S36H 4U6YA 2DQTL 4XAKD 2PYEB 4R57A 2BIPA 2C7UB 2ZKYA 4ZUTA 2CK0L 5EUOE 4KLWA 1N6UA 1P5UB 3NP4A 2IV9A 1AZBA 1EPFA 3QUKA 1N0XL 4A1RA 5J8OA 2MKLC 2ZOOA 2OZ4L 4LSDA 5FKPA 4RRPM 1FNHA 4XZUA 1N18A 2A1WH 5ADOL 2ICWB 4PJHF 2CXKA 3OMNB 4CU6A 1QFUL 3D34A 1KPRA 2RACA 3WJMB 2R29A 3ULAB 5C92A 4G5ZL 4FS0A 5CKAA 3VU1A 4HV8A 4J3SA 5HYFA 1BF2A 2ZNWA 4I2XE 4E9WA 1I1AC 1WZMA 4JDTH 3SHPA 5IQLA 2CO4A 1OO2A 3HHSB 3G8WA 1TJGH 3IMRA 1SYVA 1X3DA 5IUSA 1WZ1L 3OWRA 4U1GB 4JE0A 4WY7H 1NC2B 2NNAB 2QR0B 3Q6FB 4KOWA 2OYKA 1CDBA 3VXTB 2PCYA 2ID5A 1EIBA 2FS5A 2E6PA 2NTFB 5GS1B 4M61A 3X12B 1IZKA 3QI9C 1TZIB 3D4CA 3OD3A 4Z0XB 4IBYA 4FFYL 4BZ1L 4WO4D 1IX2A 4BH8B 5JIDA 5AZEL 2PJ2A 2GIVA 2ADFL 3KBHE 4G8GB 2JE8A 3T04D 5JHBA 2JK5B 1NMAL 1TZOA 3O3AA 4IMLA 3BCDA 3II1A 4YSCA 5LLIC 3LB6C 3UIYA 4MCZB 4MQXD 2NY3C 2VQUA 5ICZB 3SJVD 5CIPA 1BOGA 5JR1L 1BQ5A 4YQXL 2HUHA 2APBA 1YLEA 3FL7A 3N40P 3REWB 1FHNA 1QKZH 1P6AB 1G6VK 4XO9A 2WW8A 4DHLA 5FECB 1GJWA 2DLTA 3P4OA 2IDTA 1NSNL 3MJ8A 1Y18A 3PRZA 3CXQA 1NLBL 4R7DA 1T1WB 3KYKH 3AFLA 3HE7D 4H1LB 3D7DA 5E03A 1ZS8B 1SLVA 4LCIL 5E1AA 1SYSB 1NMBH 3AY2A 4IHOA 5IOKA 2FIWA 2QMLA 4N5ED 3ZE2E 4BDVA 1QO3B 2PMZA 2BPBA 4PJ5D 3ISRA 2RB8A 4ZFOL 2D4DA 4ES9A 3K71B 4M7LT 1TJHL 2BO0A 1OSPH 4JFZH 3DV6A 5DC2A 3LY6A 5E1QA 1H8LA 2FX8H 5T1KA 4H8HA 4XR8C 2YBRB 3I6SA 2ZENA 3C26A 3IMUA 4ZSOB 5E51A 1L9MA 2BNRD 4OC0A 3TH2T 3GM0A 5I6OA 2Y69B 2PETA 5IVOA 3EYOA 4I0CC 1NCUA 1PJ9A 4HT1L 5DS0A 1MCRA 1MNUL 2MCMA 3PWVB 2XBDA 4DZ8A 2UWEF 1IJ9A 4KGLA 3PBBA 4JM2F 5BOPA 1FVCA 3F5WB 3O3BB 4IBVA 2AABH 2GLJA 4MXVF 5C0BA 4G1EA 3MYJA 2CDFB 3UROR 2W1NA 4ZW6A 3WXVH 1PUAA 3VXSD 4G7RB 2BRRL 4UEEA 5DURB 2AJUH 2IMOA 5LG1A 3DV4A 1JJUA 2B3RA 1AD9A 3QZMA 3HRZB 5BZXA 4OC2A 1X9UA 1IARB 1MAJA 3SYOA 5EZOH 3VVVA 4F37F 4AWJC 3K5SA 5ISVA 3P0VL 3TN0D 1CF1A 1BLIA 1WWAX 2N59A 3NH7L 1SY6L 3EFOB 2BCMA 4RMTA 4RZCA 2Q0YA 3CMGA 2GIYA 3GXPA 1XGRA 3BFQG 4P48A 3VDCA 3C5JA 2DPTA 4CAXA 4N0RA 5C09D 3SE8H 4LLAA 1FL6B 2APWA 3V8IA 2YAFA 5SWQA 3ZTEA 3L7EB 2IH3A 1UA3A 5F6IB 4W6XB 1UWEL 2EDRA 3O6KL 4X0KB 3SBWC 5F6HJ 2J1KA 4TSBH 1MQKH 1FLRH 3CMOL 3B7RL 3L4VA 2BVQB 5F9DC 5IBUB 1HC1A 3SPIA 3T0WA 4ZOCA 3DBXB 1GGCL 2ODHA 4JRXA 1G7PB 2ERJB 2YPLB 4XXDA 5KYWA 2KLTA 2R4RH 4XNMB 3IGUA 2YGWA 4I4WA 3T90A 1P7KA 1SDDA 3VXRB 5HI5C 5CP7A 5MERA 2OXHB 3OPUA 4MAUH 3SDXB 1OZUA 1UFGA 3A4DA 3KPPB 4IGBA 3U7YL 4NZTH 3LEVL 4OIDA 5A16B 4XAKE 1LO4H 2GE3A 4P49A 3ZKXB 4HUUA 4ZMVA 1KFGA 2X1OA 2A1WL 2DWSA 3PJNA 5CGYD 3PPEA 1HYSD 2YFOA 1MVFA 3HZ3A 1I21A 3KPTA 4R0LB 4FRWA 5DUBA 5AUMB 2XNAA 4ZO7A 1U93A 3BWZA 4DEPB 3LQMA 2ZW4A 5E9DA 4OIWA 3SKJH 3TTSA 1E27A 3MLRH 4JY6B 4JDTL 1G7JB 4PD4J 4KKBD 4Z7NF 4B95C 3FEDA 4OZIA 3D85D 5GS2H 5IQ9A 1OANA 3FT4B 3GY9A 1TJGL 3HPJA 4ZX5A 4PRHD 4FFVC 4JO5A 4RX4D 3TT3H 3IFLH 5T1JA 4XB3A 2HPOA 1JGLH 4KNQA 1HJBC 4DYOA 1WITA 4WY7L 3VI4A 1IUZA 3MLVH 1V3LA 3CDXA 4NNPL 1YY8A 5CXPA 3O0RH 4UQDA 1JTPA 3SEPA 1ICTA 4KXAA 1LP9B 2BX5A 4PR5B 5GISH 5J12C 2DKUA 3TCLB 5C0RH 5DQJB 4WKZB 1G0XA 2CRZA 4XXCA 3CXHJ 2BH0A 1PSKH 2N7AA 2VLRD 3BZ4A 4OIIL 4YPGB 3ABKB 3EGSA 1CZ8H 1UWYA 5FLUA 5C07A 4YMPA 3ELAT 3LZFH 3T1FA 2QIRA 4Y8DC 3QDGD 1ZLSH 5CBMA 3NJVA 2H0JA 5HDRA 3ZHNA 1ZPUA 2HZHA 3AWEA 4J3OH 4P2RE 1KTLB 2JCCB 3SPHA 4EZLA 5DT1L 1E9QA 5AOIA 3D39D 3UJIH 1XF8A 4OQTH 1QKZL 1VIXA 1WA0X 2HVKA 5DJ6A 4LVOC 3FTWA 3SJVE 5D1XA 4HSCX 4MA8L 1XF3A 2A73B 2A99A 1RO5A 3N04A 4J27A 3KYKL 4L5FE 4V33A 5LBSH 2R27A 3IJHB 4A37A 2B8OT 3OMAB 4WGWB 3FUDA 1NMBL 1ZHBB 4P59L 3WUWB 4MNQB 4L18A 1Z9PA 4ONHA 4NUMA 2BSWA 1CGXA 5DVPA 2G9DA 5I1AB 6FABH 4FA6A 3GSVB 4HMDA 4HW6A 1EXGA 2D03H 1P9MA 5I6MA 4NJ9H 2FO1A 3BUYA 2E5EA 5JPMB 3NH4A 4RCAA 1KYOJ 1OSPL 4JFZL 2I9LB 3LKNA 4PJ5E 1HH9B 4RMVA 2WLIA 4YBHA 3IWVA 1OALA 4XVOA 4IIQC 1FZKA 2OYLA 4FI8A 4NI3A 4CNIA 5M94B 2J6WA 2PW2B 3FHAA 4MD4A 1ORQA 4JFEB 4LB8A 3MBEA 2F7PA 1UVQB 3EJSA 5C8JB 1QSFB 3L9RA 5SX4H 3REVB 1WYJA 4GSDH 4XPHL 1G9MC 3ZTNL 2WO4A 1OLZA 4U1MA 2O61B 2VABA 3UAJA 1MI5D 5AWNH 2AABL 2AEIT 2ED8A 4TXVB 4Q14A 3WG7B 3BT2L 4LNVA 4KKLC 5DVKA 3GXDA 4NQXB 4N8VB 1IAIL 2ED7A 5DD0H 4FG6D 2K9UA 5I1EL 3TA3A 4X6CF 5IBLD 1OB1A 1TKFA 4Y2DB 3G04A 3L6FA 1PAMA 2W07B 5GRVK 2AJUL 3OKOA 4AKQA 5CILL 1XMBA 4GH7B 3N44B 4MCNA 1X5LA 3DSNA 4PCSA 1IC5L 3HRPA 3OB0H 5DJZB 2V8HA 2OMVB 4KJWD 2FO4A 2KZWA 4RQQA 5DK0B 4XE0A 1HAWA 3CHPA 4HEPG 1M6UA 1ZK9A 3WTTA 1R3JB 3PWJA 4AIEA 3GUTB 2KPNA 4A2GA 2J5WA 5GGTA 3T2PA 1AD0A 3EDFA 4NO2A 4ODUB 2WPWA 1FN4A 3HI6L 3KJ4B 4LX9A 4JNXA 5F48A 3C9NB 1MJUH 2R51A 2X89A 3DGDA 2ZOLB 1X4YA 3QARA 4HCFA 4LT7A 1U8MB 5JOPD 5C09E 4LRNL 1NUNB 3EH2A 4E36A 1DQKA 1T1XB 3FAWA 4XP1L 5C08D 1YNLL 2MPVA 2ZIDA 3TESA 5F0JB 3KDPB 3MLTA 2VN5A 3MRCA 1MQKL 5L2KB 1FLRL 5L8KB 1J1OH 2UX6A 4Y4KB 3AT8A 3NJHA 1MUJB 2HVBA 4MJ6A 4EN3C 1TXRA 5JH9A 4AYFA 2Q9OA 4OTXL 4U1LB 4OT1H 2Z6FA 5L8JB 5J1TC 4BINA 4M7ZB 4AE1A 2R4RL 4M5YH 4POZC 1P4UA 1AXSA 3T4AA 1QOKA 2J1WA 4YOKA 1LE5A 2WUCH 2FQGA 4GUPB 3JUWA 3NQIA 1U8QA 2OXGB 3F62A 2Q7NA 5F9JA 4U4IA 2WSDA 3Q43A 3SE6A 1EJOH 3AT9A 2CA3A 4HWNA 4B6ZA 3EJUA 5B38A 4TL4A 2CG9X 1YUKB 4ODWA 4P2OD 2B1HL 3IXTA 4R83A 5KVGE 3K8LA 3L2LA 4W9DC 3KYMA 4ZAKB 2AK1L 4RIRA 4KMTH 4X2UA 1W0WB 1H8OA 3SKJL 3VQMA 1XAUA 1C12B 4MNGA 3QORB 4FHKA 3FONA 3NCCB 3ZL4L 2ZAIA 4UILH 5B39B 3IFLL 3T65B 1S7SA 2LU3A 4HUMB 5DMIH 3WY4A 1T7XA 5TE6L 5G4MA 1UJ3A 2K3HA 4XNHC 1XSJA 2ZCLH 5IVXE 2EDXA 3DECA 3VSVA 4JANB 4Y5YC 3P40A 5F9WC 4ZO9A 2X10A 2F53D 2YSTA 2Z65C 4ZBJA 4DN4L 4YXLL 3SJFA 4FNTA 1WA2X 3AXIA 1VA9A 4AQ1B 5C0RL 3P4NA 2NXZD 3MQIA 4XWOD 2BSSA 2L4OA 3N5FA 4X3RA 3ZK0A 1BQRA 2LAAA 2DQFB 5AVVB 2K7PA 3LDBB 4XP4L 4LEOB 1CZ8L 2UY7A 3PHQB 1Z8XA 4K2UL 4JCMA 2X2YA 3U4BL 1Y0LB 1ZLSL 5FOBB 1FE8H 5E5RB 3KMDA 5K39B 2VLRE 5HHQA 3VH9A 1NEUA 1UH4A 4L3ED 3TO4A 3WTVA 1OZPA 2YAHA 3UJIL 3QDGE 2OM5A 2PWHA 3E9UA 4OQTL 3U4EB 4BKSC 3II3A 1WV7T 4DP1X 1RD6A 2APFA 4ZXBB 5CEZH 1CDYA 5DHYA 3L16A 1BYNA 1A1MB 3DNKA 3WTUA 4HJUA 3O11B 3DX7A 4L23A 2H2PC 5LBSL 4UQ3B 1BAFH 3JVFC 3VWKC 4U1HB 5FM8A 1TVBB 5HJ3A 2A74B 4L1SA 4X6CA 5ISZD 1SQHA 2IQ6A 3EXNA 4H89A 1BQUA 3PDOB 1YQVL 2EDQA 2XN2A 4R96B 3AS1A 3LS4H 4PJBE 4FXGC 2QKSA 1TU2A 3MCG1 2CLVB 1XH3A 1R3KB 4J4PC 3FTSA 3HKFA 4PG9A 4OF7A 4YSRA 5HP5A 4AC4A 2NZ9D 3BP7B 4HK0B 3IXAA 4JQXA 4DWHA 3UPAA 1KXVA 2AF2A 1JNJA 3GTNA 4MQSB 4YBQD 5HDQH 1WAAE 4JZ0A 1JGDA 4JN1L 3L5JA 4ODVL 5CEXA 3OZKA 4Z77A 1EZSA 1OGTB 1RQ5A 3DIFB 1T21B 1R24A 4HIEB 4QB9A 2PYED 1GYUA 2YFNA 2FSEB 1WAPA 5D7LE 5H35A 1QSMA 1IAII 4J7RA 5I6PA 1KCRL 4BQBA 1FZMB 4PM1A 3WDJA 5AWNL 2HX7A 2VTFA 2WHVA 3MRIB 2P52A 1AIFA 2N4IA 1NOAA 3TGXA 43C9A 3PB9X 3U9UB 1UENA 2KS0A 4B9FA 3LKRB 3EG9B 2ITFA 5E6IC 1R75A 4J6IA 3WNNA 4TUUA 4QRRB 3CBRA 4I18C 4B41A 5J6GA 1VKXB 3SKOA 2C1OA 2XIBA 1JUFB 4APXB 1IU8A 1G1OA 1DZBA 2XWBA 5JQ6L 2YHGA 3K72B 3MUHL 1IE5A 3GIUA 1N2RB 2EYTA 5HGHA 4QHMA 4Y8AA 1JPGB 1SBBA 5DDHB 5F0MB 1NC2D 1SZNA 2RALA 5GS0D 1GJUA 3S6GA 5J9PA 4MXWL 4N1HB 2H9GB 2VW4A 2FEEL 1WGVA 5DHVH 2OZHA 4XNZB 1VHSA 1SJVA 2WD0A 2WP3T 5CZXD 4F1ZA 1URLA 4YC2C 1J9TA 4G8GD 4KKZA 2W9DH 3H6JA 3NEXA 4WUUE 1JZ7A 3WKPA 3EY5A 1FAKT 4FQXB 1J1OL 4NNYA 4YR6A 4NSKB 1JZDC 5C08E 43CAA 4FTVA 3KVPA 3D06A 5KSAA 4AYGA 1Q9LB 4OT1L 1ZV5A 2DQMA 3CN2A 5PAZA 3QC5X 1MAMH 1IGJB 3MVSA 3MJ7A 3FUHA 3QPQC 2BIIA 5E2UL 3T0VA 2JI3A 5A43C 3TU6A 2QTVA 1U8LA 4JN2B 3Q3GA 4P4IA 3DX6A 3EO4A 3KLAB 5AOZA 3ULUD 3CE1A 1XGQB 2CPCA 2XG5A 3QRGH 2XXGA 1EJOL 2YPVL 1URIA 1KB9K 1Z66A 5HYSG 1Y0YA 1XCTB 4PJAF 3QJTB 4P9MH 3OKKA 1HHHA 4P5MA 4GAFB 5EUOF 4JAMA 1JNHA 5FO2A 2R9HD 2VR8A 4HJSA 1C5CH 2PXYC 3UTTE 4CAVA 4DW2L 3IU4L 4KMTL 4MDJA 5DJYB 5DR5H 4BFRA 1B88A 2XICA 4DTGH 7PAZA 4HKZA 3TFYA 2EZ0C 3A6OA 3BE1H 3IJ8A 2B9BA 4PJEB 4UILL 2ZW7A 1HE7A 2Y5EA 2ZG1A 2NX5E 5DMIL 3HC0B 1AY1L 1FL5A 1ZLWK 2E7BA 1KWGA 3MA9H 1R0AL 1DN0B 4ZPTB 1CP6A 2E86A 5F3HB 2UV3A 4GBXB 1HHIA 4J6RL 3EUDA 3TCXA 2KT6A 5KS9B 4QF1B 2IPKA 3SYQA 1WBYA 1V10A 4Y4HC 5BO0D 3B2DC 2Z8WC 2J88H 5F89A 5C0IA 3WNOA 1TYJA 3BAJA 5CSZB 1EHKB 4X4MA 5H8DA 1D5MA 1HNYA 2DWDB 1KIRA 4X4XB 2XUWA 3BO8A 4O9HH 4Q6IB 2PR8A 5E94A 1LCPA 1J0ZA 3K4DA 1FE8L 4IRSC 2FCKA 4F2FA 5DURD 1QRNB 4MB5A 3ZTJG 2R8SH 3KGQA 3BZEA 1H9DA 2ZWSA 2I3CA 1A02N 1AR1B 1EEZA 4HG4J 4AXWB 5D8NA 2O28A 5E9AA 4ORGB 5AAMC 4MJ5A 1XD0A 1TQWA 4Z95H 5FO9B 3M8OL 1RZGB 4JXQA 1IBHA 1OL0A 5DHMC 1HL5A 2JB6A 5FYLD 4Y9BA 4HCIA 1ELMP 4X8IA 3GB7B 4NQVB 4IHMA 1BAFL 3AXLA 3VB8A 1P1VA 1JGVL 2R2HA 3RL2A 3TJEL 3QXDA 1SLWA 5EU7E 1HKLH 4IOFC 3TBSB 4FBEA 2EQDA 4KPHL 4TV3A 4YNYB 3O6FA 3ZDZE 2PRQA 1XZWA 4QRUB 5EZLB 1G7IB 3V7ZA 3DDFA 4ETYA 4WK0B 1IGML 4GKZB 1QI5A 2FH6A 5FWRA 1X4XA 1P1ZB 3ZE0F 1AC0A 3S8GB 4TNVF 5CJ5A 5HDQL 5JYLA 2NR6A 3C5XA 2VDPH 3EH4B 1Q9KB 2ZOWA 1Z9UA 2YPLD 2ZSVA 4CU8A 1TT6A 4U3XA 1LMKA 3SE9H 4HFUL 3VXRD 3N7ZA 1FRGL 4JR9L 1O9VA 3EH3B 3NJIA 5J13B 2HVJB 3CIAA 4LLQA 4GXVL 4F7TB 1T83C 1BVNT 4HIHB 2X4TB 3GMMA 1T2QH 4MTMA 1FP5A 5IQNA 2GY7B 1AGEB 4EXPX 2JH2A 3R9FA 4HH9A 1E0OB 1FNGA 3BVDB 1A6TA 3L4ZA 4K3JH 1FFQA 4UDTB 4BQ8A 3PAUA 1CICC 3LKSB 2BVPA 5IX3A 5MEOA 1Q1JH 1T1YA 2RCSL 3X1EA 1JZ4A 3C5ZA 4ZX6A 1MJ7H 1VFOA 1K3ZA 5E8NB 3F8UB 2H8PB 1BMGA 5F1OB 3T6ZA 2Q7AA 2PJAA 1Q2DA 3JVGC 4OLLA 3ECVA 1J10A 4L3CB 2C4FT 5D6CB 3UGXA 4QHKI 1HXYB 4RWHA 3ZIYA 3GS4A 4XC3L 5FYJU 4DCQA 2ZSWA 1CYWA 1WQVT 4FMKA 4DO4A 2PYFA 4H40A 3DX2A 2A3TA 3MV8B 1RZIB 5DWPA 5EUOA 2ZF9A 1BWMA 2LLLA 4W81A 3H3KA 2R2BB 4PRIE 5AOKA 4QHPA 4J5VA 2P7TA 2W9DL 3KPSB 2KCWA 4NQQA 3WFHB 2GFQA 2R7EA 3PV7A 3GMNA 3DTXB 1ZV9A 1IB1E 3N1GC 3BH4A 4RRPG 4WW2F 3V4VB 1RIVH 5C0FA 4KH2A 4AJ0A 2IOIA 3WT4A 4RFOL 4Z7UE 1GMIA 3H9YA 3VRJB 3VA2C 1FNAA 3DUHA 5KSBB 3KNBA 1MAML 1DQLH 1CXFA 4I2XA 4AJYV 2B4CL 3EC4A 4OD2A 2MJWA 3TJHC 3BRFA 4F8NA 4DPBX 3I1UA 1MCOH 3QRGL 5FGSA 4MNQD 2W91A 3QPXL 1O5PA 4OFDA 1PZBA 4P9ML 3RIKA 3STZB 5JOFA 4PXEA 5E1GA 1OP9A 3O8XA 3ULUE 3P30H 1EFXB 3QEUA 2PP9A 5F8RC 1AACA 5DYOB 1QQ9A 1I1RA 5AW4B 3KPRE 3GSRB 5C0GB 1AQMA 1M4LA 1QHOA 6PAZA 2RFHA 1RPQA 5HHPA 4O51A 1BGXH 4Q58C 3HS0A 2WLKA 3RI5K 3WJLC 3DOHA 3BQVA 1J7VR 3BIBX 4ONFH 1PW3A 1AGDB 4RLDA 2ZELA 3MROB 2LVEA 3VXNA 1L6PA 3GTTA 2ATPA 4GG8A 4JFED 2HPTA 4E0RA 1D5BB 3BFOA 5IZ7A 5AVZB 2V4LA 4XO3A 1G84A 2JI1A 1QSFD 5CGMA 2X4QA 2EDYA 2WBJC 1F58H 4O4YH 4P04A 1JP5A 3V4PA 4EMZA 4UAOB 4NGPA 3F8KA 2GW5A 3QXWA 5GSRB 4AK1A 1CK0L 2CD0A 2J88L 3FQTA 4K5MA 1N64H 1S7RB 2RQEA 5DJAB 5AB1A 5DZJA 2X4UA 2NQ3A 1T3FA 1B0GA 4CMHB 5IFAH 3CZSA 3GLAA 4Y2DD 1BAWA 5LDSA 1R5IA 1WCQA 4CSTA 3EO1A 5EBLB 1VPOL 3VO0A 1RZFH 3P02A 1KYDA 4UTAH 4MSWA 3SZKC 4NRYB 3EYUH 3TNNA 4NM8H 4NQSB 1X5AA 2ROXA 4NHCH 2Z8RA 3W81A 1OAUL 1Z5LA 3U6XA 1MCEA 5AL8A 2PCPB 1ACXA 4NKDB 3SE4C 1EO8L 3V6ZA 5MEQB 1KACB 3SO5A 1P7BA 4RBPK 4BSWB 1AQDB 1J11A 5KBNC 3DVGA 3SJGA 2XZAH 4LF3B 5I5RA 2R23A 1M1XB 3BUIA 2TRYA 5FYLE 1HKLL 4NN5B 1CFSB 1M05A 1A4CA 3IWWA 3D3SA 3F58H 1RK0B 4HCRL 2WXIA 3C8DA 1JDCA 1VZHA 3A6CH 4MRIA 2R1YA 5DJ2A 4TRPH 4W4OC 5CJOH 1OD9A 3WNKA 3KWWB 4OF3A 5L2KD 5ES4B 3MRDA 4Z3FA 4Y4KD 5I0XA 2W92A 3H9SB 1HQRA 2DM3A 1K2DA 4V2BA 1XTLA 4QYOA 3CVHL 2X6CA 4OZGF 3O4OB 3OMIB 2X9YA 3TTHA 1VERA 4RDQF 1JXDA 3N3EA 4QDGA 3D8PA 1KT2A 3OKNA 4PV9A 4ZUWB 4BSVB 5FYKE 4Z5RA 1TETH 2YPLE 4NC1C 2REEA 2C1PA 3WL9B 3IJYB 1TEYA 1UZ8A 5B7EA 1T5XB 1EAPB 1T2QL 3SDXE 4XI5D 3B5GA 1D5ZA 2Q7SA 1H15B 5K9KA 5CLXA 1TEFA 3FBKA 4K3JL 2RB7A 4U4BA 2JBKA 3QFJB 3FQWA 1NFAA 4BK8A 1DQQB 1Z1WA 1M7DB 2OSLA 3BKMH 3CFUA 4RN7A 4PB9H 1Q1JL 4WW2A 4ZAKD 4L29B 3TOPA 1MCHA 2XWJA 3QORD 4FQLH 4A2HA 2JBJA 1A64A 3G5ZB 2CO1A 2PO6B 5GXBB 2OTWB 1HI6A 3NSFA 4EQ2A 4HHAA 3L95A 4LPCA 3MCLL 5F1IA 2Y5TB 2JTYA 1CGVA 3GB0A 3QBTB 1HDUA 3DOIA 7PCYA 5DZOA 5EU3A 3UTSD 3DJRA 2XQBL 3CK0H 5F3BA 3BVXA 5F2FA 2W9EH 3LNFA 3WFDH 4KV5F 3RWDA 1KBBA 5JW5B 4PRBB 2DQUH 3LD8B 4DPCX 4EZJA 4YL9A 1YVKA 2LHAA 2P9RA 1NDGA 2CTCA 3P2DA 4IKNA 1M9SA 4BE6A 2JKTM 3C2SA 3NPSB 5E8PA 3ZBMA 4IF5A 4FG2A 1KTBA 1YAZA 1AANA 3V4PH 2N56A 4HLJA 4MMYB 4JPSA 4U6VL 3GMQA 4A6YA 1FH5L 1YN6A 1T0NB 2H47C 4WI5A 1DL7H 3SDCA 4YDMA 1YVLA 4OCWH 3KBPA 3N43F 1BVZA 5L88H 5DMGC 4RA3A 2WXOA 1ZS2A 2GT9A 4KVPA 4DUXA 3GPEA 4LOUC 4ZXBD 2EKSB 5LDUA 1DQLL 1NIDA 2HMIC 4N2LA 3KPLA 2JQZA 4XCCH 1HEHC 2WQVA 3MV7E 2EO8A 3BRGC 1MCOL 4BSJA 2EDEA 3NESA 4LRIA 2YD3A 4IBTA 1ZA6A 4GRLB 3ZO0A 3P30L 3EXJA 3G08A 2JLLA 1EHNA 5KAQG 3QA3A 4AZ8B 4UOJA 3FBUA 1ND0A 2EO7A 3Q9PA 1BGXL 3JZ7A 4QHUB 4ONFL 4JZNA 4GYBA 1S8DB 3FH4A 2XN9D 1YG9A 3HBPA 4MFHA 1OHZA 5FUZH 4P2RA 3JV5A 1VGEL 1F58L 4TUKL 3S34H 4O4YL 3VXMA 3AU1B 4LGSB 2V8LA 1YNKL 1RV6X 5L9DH 4LKXA 1QSFE 2FLMA 3C5SA 2F19H 4I49A 2ZEMA 3PGFH 1DEDA 2WWKT 4JDZB 3ML8A 1XVSA 3FU5A 4BUGA 3CFKA 1N64L 5KVFE 3CX5J 1DBBL 4ZX4A 3R0NA 5IFAL 4IGBC 2NZ1A 3RBUA 3RVTD 1OKEA 3GLDA 1KDIA 4WI9A 5BWAB 1NCDH 2V8VA 3UEQA 3VM7A 4QRRD 5GGVH 1RZFL 2ZJSH 4UF7C 4UTAL 2G30A 1KXQE 1DEEA 4NM8L 4ONGL 2GFBA 4NHCL 5HGDB 2V7NB 2A6IA 4YLCA 1OSZA 4YDIH 1AS6A 5GGSB 2YXWA 4HUVB 2B3VA 3F3HA 1KC5L 3IWUA 4WI8A 1I1AB 2X38A 3CC5A 5C0DB 1T4KA 2EWBA 3IGRA 4MFPA 3WEXA 1V27A 4ZD3L 1XCQB 1YEEL 1W8EA 3X3GL 4WJ5B 2UZYA 4QRSA 2B1AH 3BW9A 3QAQA 3VQ2C 1A22B 5CJOL 3W1ZA 2H1PH 2HG0A 3QI9B 4FQXD 4K8RH 1BJ8A 4Z76B 1XR9B 4JG5A 1Z3GH 2YD5A 3WMSA 3HNVL 1FC2D 3FTXA 4Z3EA 5I6XB 1I4FB 3KPNA 5CJXC 2V9TA 3VWDA 1Z5YD 3OHXB 4CYOA 3LKQB 1VFBB 4F8LA 4WNSA 1KZFA 2GREA 4CVZB 2VAAB 3EO9H 4O2EB 1DLHA 5DI8B 3SGDI 1TETL 1TUPA 2NY3B 3GI9L 4JGJA 4XMLL 4BMHA 5DA4A 1XMWA 2WINA 4FFZL 2IPTL 4RGMC 4EI6B 3D7FA 4H2KA 1NEPA 3OC5A 4N0FB 2EIZB 4EI0A 3QDHA 1UM6L 3CSPA 2FJGB 4R97C 5DGQA 2UY6A 5D7IF 1D2PA 3RTQA 4MHDA 5D1XC 1GYWA 3SPGA 1YEIH 3CFJB 1C5DA 4R5VA 4XODA 3QQ9C 5KBDA 3BKML 1CG9A 2DJSA 4A7TA 3MJGX 1GYAA 1HHKA 4HS6B 4JM4H 3NGBC 2QTEA 4TVPE 4ETQA 5JXAL 5JNYB 3X11A 4DP9X 2RTTA 3SSGA 1JIBA 1WFMA 2VC2B 3GSWB 3QCVH 1P9MC 5E99H 3DDGA 4BFJA 3NAAL 3FB6B 3P77A 2C3VA 4TUJA 3OZ9L 2Z3LA 1OSEA 1XCXA 4F1SA 3K1DA 2YC1B 4GBXD 2V2XA 3WFDL 4HS3A 2F74A 1GZPA 4RMSA 4S1RH 2CHDA 4P4KA 1K4DA 5DFWH 3UTSE 5A6IA 3NIGB 4OU3A 2BSED 2WGNB 4JVWA 1FZOB 4MFZA 1X6NA 1N6QL 3HB3B 4H1LG 3KCPA 2Q0ZX 1J1XH 4OZHE 2ICEA 3UAJC 1MHHA 3QCUH 2BM3A 1QRND 3KM2A 2FR4B 4GAAA 3SODB 4MLIA 4I48B 3TX8A 1WF5A 3N9GH 1AR1D 2QQNH 5I16A 2AANA 4L5FH 3TA3C 3W9DB 4P4RB 3FUMA 5J3HC 3VTAA 2BCOA 4PJIF 1RSYA 2H7WA 4UT6A 4PIRF 1FORH 4OBSA 4NAQA 3ESVF 4WWID 4YXKH 1HOCA 1NBCA 4MA3A 1G7HA 1D6VH 1EGJA 3BEWB 3BN3B 1FV1B 3F7LA 2NNCA 3DVNA 2AVGA 2E4FA 1LO0H 4WFFE 1PJWA 5DZLA 3T8VA 4C4KO 5HYJB 2XWRA 3ZTJH 2ZKMX 1X44A 4RMQA 5IB9A 3T8MA 3DPBA 4NNXB 5IV2A 1IM3A 2WN2A 5IVXA 1XO8A 4RMBA 1S60A 2DH3A 4XMTA 3MRGA 3WJJA 1J1PL 6PCYA 2YEZA 3QXUA 3M07A 2WWMC 1JDAA 3GM8A 1DUYB 4AW7A 2EAEA 3WNMA 1NOFA 3GDBA 3LPOA 3HMXA 3JRUA 2AJ3B 1I7TA 2L0DA 4FLOA 4ZOAA 3ROLB 5E7FA 5FUZL 2R69A 2OMTA 3K80A 2EO9A 3HZKA 3C08H 3EKCA 1MDAA 4M1GH 4M3KB 2XN9E 1AOZA 1YDPB 5FO7A 2IADB 1BD2E 2X1XR 3T0EE 2CRYA 5EPMB 5C1MB 1JWMA 1M4KA 2J73A 2AKRB 3S9DB 4BRVA 5D6DA 1TLMA 4L8DA 3T4AC 3OR7A 4LE8A 4ZTPH 4Q56A 1MJJB 2NYYC 3O2WH 4IU3B 2F1EA 4LL1A 4PI2A 4X8JA 1YC8A 2VL5B 1MLCA 2W65B 5DEGB 5FK9A 2A0LD 2IDSA 3GMOB 2WUBH 4ELME 1PZ5B 3QDMB 1MCWM 3H8NA 4PJBA 2XPGA 5IB5B 3ARGA 4JPVH 2KZKA 1AZCA 2NOYA 2GAZB 1WAAA 5GGRB 3CQPA 1TTGA 5IBUG 2HC9A 3NT0A 5AVUB 2M26A 1K9TA 5IT2H 1SEQL 5CWSB 4NGMA 4NF1A 5HI4C 3TIDA 1T0OA 2PSWA 4R6UA 1A4KA 1KB5B 5I2IA 1JPSL 2QKIA 2YAEA 3MV8D 4L3FA 4X6DB 5D7LA 3S3PA 4J2XA 1MREH 3P69A 5AOLA 4OCRL 1BYPA 3GBDA 3KPSD 3ME0B 1S7VA 1RZ8B 2B2XH 2BS9A 3VFOB 1RUQL 1UH3A 3M17B 5D7KD 1J8RA 3GJEA 1U95B 2YOCA 3VD7A 2CIKB 4K8RL 4O2FA 1IAOB 5J12B 1Z3GL 1Z32X 3MNWA 3DIDA 3I02A 3M88A 4P3DA 5CBAA 4QXGH 4QXTA 1NWPA 2BIMA 1WS7A 5J57B 1N5YL 1FFNA 4OLVH 1XRYA 4IKIA 1Y9WA 3ZDZF 4N2GA 5GRVL 5HGAB 5J1SC 1KCUH 1MCNA 4L1BA 5FA4B 3ZGHA 1B0RB 3R95A 4UQ2B 2B4CC 3EO9L 3MXVH 5IW3A 5JPNC 3FS9A 4RWYH 4D2NA 5JQHC 4JJOA 2AFWA 4PXBA 1F1AA 4WV1C 4G9FB 2Z7WA 5CNHA 4PREA 3FU7A 1HSBA 1U8KA 5H94A 5KVGH 3BH9B 3RWGB 3DYPA 1LEKB 1TNNA 4KNUA 2WVUA 1B4LA 3CFNA 4UT6H 2OB0A 3V0VB 1BQHB 2JELL 2RAMA 4NQUA 2CDEB 1EFXD 4J1UA 1C16A 4GOSA 3AM8C 1NC4B 2VXUL 1ZAGA 2DQEH 2E9IA 2IWFA 2K8QA 4JFQB 4K7PY 5I19H 4YAQA 3ATEA 3UJTL 4MMXA 1MPAL 3U82B 2ABZA 3DSFL 2RMNA 4MHPA 1NBVL 1MFNA 4I1NB 3GJFA 4WUUA 2Z0ZA 1BBDH 5EZIL 1LQBC 3EYFA 2DPKA 4JY4A 3ECBB 1LE9A 1S7QB 4NUJA 2AV7A 3UAAA 3VVWA 1B6DA 5MP6L 1S9XA 3GSNB 1WUZA 4PJEE 1EAQA 1U4FA 4Z7VF 1Y0RA 5GRXG 4EVNA 1NCJA 4M1DH 4S1RL 5DHXB 3NJGA 2J3SA 2BDNH 3HZYA 5KS9E 3S36X 1HHJA 2R69H 3D3VE 1HK6A 2X4RA 2B20A 1EDYA 1RP8A 3FQNB 3BISA 3WUWG 5DFAA 3QCUL 5EBWB 2A83B 1EDHA 5EC2B 4FQIH 5IIEB 1CIDA 2QQNL 2P8LB 2P24B 3TBVA 5EEXA 1QLEH 1QRNE 3MLWL 3UTTA 1FORL 4YJZL 4E68A 2EXYD 4L4VB 1I8LA 3T3MF 2DS4A 2NW2A 2QECA 4LLWB 1RY7B 4A63A 1T6WA 1BZ8A 4TOYL 3IRZA 3CPAA 2NUPB 2NX5A 3H2WA 1OV8A 3H3PL 2EIMB 5DSCA 4JFWA 4AVCA 3K6DA 2AGJL 4K7PH 5CBEA 5F3FA 4QRTA 1P4LA 2VDLL 5FO8A 1MJ8H 3U1SH 4M48L 2ESVB 3BZFA 4MCMA 1XGPA 2ZWYA 1J0KA 2FO8A 3H9SD 4N8VG 3I3DA 4TLUA 1OVZA 4UQEA 4UUJA 4LXFA 4S10A 4XVUD 5T3ZD 4KKCC 4U6XB 1BO4A 2Y2YA 3US1A 3FOMA 5DVLA 2EVGA 2X0WA 2DOCA 3UPCA 3MXWH 3C08L 5JHDD 4M1GL 4YDJB 3BD3A 2GG1A 5KSAC 2P8MA 1L0YA 2IO5A 5EA0L 2Q6WB 3B9VA 5DVOA 4PV8A 3NJNA 1M2VA 3BWSA 2YD1A 3MRJB 4ZTPL 2F5AH 4NKIH 1BXAA 3U0PB 2YEQA 2OX5B 2DLIA 4TNUA 3FTYA 2IQAA 4HKJB 4HIIA 4HETA 1VIWA 4GT7A 4QWWD 5DJ0A 1FLTX 3C6LA 3MNVB 4FD0A 2WUBL 5HJBA 3IT8D 1PY0A 2BHFA 5ESAA 2PO6D 1JRHL 5KOVC 1CD1B 3H55A 2HTLC 4R7LA 4ZUUB 5EU5A 1FG2B 4N3UA 1SUJA 4ZQKA 4UANA 1YNTF 5I1LA 5IT2L 2Z4QB 4JCWA 2AJSL 5DS8A 4QO1B 4Q36A 3TASA 2IDQA 3GJFH 5G4NA 2BOAA 1JS4A 5LYIA 1MREL 2J72A 1HZHL 3D9AL 4P57B 3THMH 5IJVA 3BHBB 4IBSA 4YIQA 3HLKA 3FECA 2W8CA 2B2XL 4Y5YB 3ILQD 5HD8D 4FYSA 1I8MB 4OIAA 5BZDB 5CD5C 2IOOA 4CGNA 3P3RA 3IAPA 4RSYA 3KPSE 3QJXA 2JXMA 5DYFA 4Z78A 1OTTC 3UTZB 4ZGYB 4NPYB 4ZQTA 2HAZA 3R0MA 1KCUL 4M6ML 4BKLB 3B4NA 4Z7VA 3MXVL 1TKWB 3EFFA 4HU8A 3WJMA 3CN4A 2VXQH 3WELA 4CU7A 3A21A 5B39G 3M7OA 5KVGL 3D0AA 4XO4A 4AQAA 1XOVA 2I00A 1VENA 2OP4H 5JW3H 4GRLD 2REFA 1NGXB 1PAZA 4H4NA 1YJDL 4YGVB 1KUXA 1JZFA 3DARA 1JTOA 5CCGE 2DQEL 2Z1PA 2H1LM 1G9NH 3Q6FA 1AZRA 5KN5A 3DXAA 4JZJA 5I19L 1FAIH 4D0CA 3FCSB 1DVXA 4KOCA 5D9SA 4PRIA 5IHLB 5CJBA 4Y9FA 5A2IH 1KIPA 3OWEA 5E2VH 4Z0XA 4OIBA 1AXTL 3O6FC 4AENA 1G43A 1UT2A 3GMPB 4FXGB 5EDSA 4JJ5B 4HIJB 2KZBA 3IDUA 1NKRA 1UKTA 1ZEAH 3ES6B 4GNKB 3Q1SL 4HXBH 3V6FB 2PTVA 1LWRA 2AXFB 4PRNB 5MEND 4Z7UA 3CH1B 3ZE1F 1R0AH 5FWQA 4J28A 3L5XH 5TDPB 5BJTB 3HZVB 4N2IA 2PWGA 5I8EA 4JXRA 2VUYA 5FM5O 3BKCH 3WEMA 4EZMA 2ZXVA 1RJCA 1E42A 1Z7JA 3VFMB 8PAZA 1F11A 1LJMA 3SDAC 2HT2C 1T5WA 3SCMB 1E8XA 3E6FB 3KGRA 4W1TA 5DJXB 4PS3A 1NFDF 3ZYOA 4ELKB 4WNQB 2LTQC 4GO8A 4S1DC 1FIGH 1INQA 4XMZA 5BCAA 3KPRA 2PC1A 2WXLA 1WBXA 3ILEA 3SDYH 2F5BH 5E6IB 2YN5A 1U9KA 3S2AA 1PZ3A 3EDKA 2VDMB 2YD6A 4A04A 1SOXA 4L4TA 3TEWA 1I1AD 3GI8H 4YHOH 3Q2VA 3NJJA 4OCXL 1CL7H 1KGYE 3OXRB 4XVJH 5HGGS 1J8HE 1OAYH 4K7PL 1RZJH 3RWJA 2N1TE 2F8VA 3FB8B 3RL1A 3ULVD 2NYQA 1MJ8L 4NOFA 3MRPB 3WMPA 1UT1A 1DQML 4F9LC 1S7TA 4GG6B 4LEXL 3QI9D 3JV4A 3F5WA 3O2DH 3FN0H 3F7QA 3KW7A 1S9WB 1R5VA 4ENEC 4ZFGH 5JORB 2OU2A 1PKQE 2H41A 2VGLM 2VISA 3HFMH 4FHJA 1QNZH 2VO8A 3W3BA 1CVRA 3BUBA 1CXLA 2R0ZH 2PN5A 1E8ZA 2NY3D 1I1YA 3WO3B 3QIWB 4OVVA 5J6HB 3WFCL 3M86A 2R98A 3B9DA 2VM9A 2LFEA 4YU9A 5J1AA 4X4YB 3P73B 4B96A 5GZOA 1CTMA 3KCWA 3IF1A 3NUKA 3ZRSA 2ITDA 4WFHD 3E0GA 2OCFD 4KITB 2VERA 3G5VA 4KK9C 3C8HA 4FQHB 2O6DA 2F5AL 3I9IA 4M8RA 4NKIL 4U33A 4FNLL 5BV7L 3CIQA 2VO5A 4Q8BA 1HDMA 3RUGF 1O6SA 2PCXA 2ZPAA 1EJFA 4XP6H 5D7EA 1JRHI 1MK4A 3IDYB 1Y6MR 3OAUL 2V3EA 5G4OA 2Y0MA 4GLRI 4NO3A 3FT9A 4OD3H 2YUXA 4ICXA 3KWVA 1T5KA 1FY7A 3KPQA 1UWGH 4AG4H 1CXIA 3JYBA 3O8XC 2W59A 3D0LA 5DD6B 1UEMA 3MRKA 4E9QA 4EIBA 4X0KA 1J8KA 4ZUSB 1CD0A 5B8CB 4CW1A 5DHEA 1RCYA 3PAVA 5GGQL 4A7GF 1MHEA 3HS0C 3PWNA 4DEWA 4H6UA 1ZD6A 2CO6A 4P9HH 1JXJA 4XBEH 1SQ2N 5GRJH 5EU4A 2CO2A 1LO5A 3S3CB 1KUVA 1KBVA 2XSKA 4HZAA 1VGKB 2YPLA 1DANT 4APQA 1ECYA 5I30H 3TBWB 1GTFA 1F2XK 3RYMA 3OAYK 2VIRA 4LSVL 5E6ZA 3HB3D 3SE3A 1AYOA 3QWRD 5L6YH 3F83A 3UYOD 1YMEA 2H0PA 3DO7B 3ARBA 2OJZH 4TQPA 4MJIB 3QJRB 5KBMA 4CUCA 5IF0A 2XZCL 2E8YA 2V0AA 4GW1B 2B9AA 2M8XA 5GRUL 5D2LB 4TKWA 2I32A 2EDOA 3QQ4B 3JZYA 3T8XB 1ZSDB 3NABL 4G80B 2Y24A 3ASWA 1Q0YH 1FNSL 1UM4H 1F6AB 1DQDH 4XMVA 1DZ0A 2OSXA 2VXQL 4PAZA 3OR6A 5IFHH 4XO8A 3ULUH 4F93B 5HYJD 1LHZA 4KVCL 2B15A 4JY6A 1JWSB 4AGPA 4DKEH 4OLYL 2OP4L 5JW3L 1AZZC 4OFKA 4WI0A 2BOBA 4Z7WB 3G6AA 2X12A 3F85A 4A39A 3OTTA 5DC9B 2E6QA 1AMYA 3ZKSD 3OVUB 3BRDA 4K30A 3IE4A 3QULA 1NFDA 5JTWA 1G9NL 4EMEA 1DCLA 1AI1H 1FAIL 4MMOA 5AYTA 2WLLB 2HTKC 3FFCB 3GIVB 3P4MB 1L6XA 2O53A 4WHCA 2Q4YA 4J8RA 3QDAA 5HHOB 3NIDF 2FGWH 1UXSB 2X87A 3Q06A 4AQ8A 4YXHH 3EHBB 4X5PA 5ENWA 3HFFA 3OJVC 3MNZB 4HXBL 4OB5H 1U91A 2P80D 1PG7W 3IBEA 3VSQA 3MV9B 2B58A 1X5YA 1PD6A 3RWFB 1MJ9A 2E3VA 4R8WH 3DRQB 5FKAB 3FQYA 1NGPL 3TT2A 4KSIA 5LJYH 4PVMA 5MENE 2DM4A 3UOAB 4F33A 2WBXA 1JGEA 3EOBA 4W68A 4LCYB 4XPFL 1AG0A 1KV7A 3CHOA 1B3JA 3MV7A 3MUZ1 5J8FA 2CA4A 1BFSA 3J7HA 1X5FA 2F2HA 2PABA 1KEGL 1Q72H 2WXNA 4KOXA 1BLLE 2XJLA 5D1QE 4GW5B 3SBRA 4TNWK 3KYNB 7TAAA 1FJ1B 3QDMD 1NFIB 1FIGL 3LPGA 5FCUL 2FJFA 5C0AE 4GQZA 2UYLB 4GXFA 4XB7A 3QK0A 1CICB 1IILE 2F5BL 3GSVA 2IWGA 4OLUL 3SDYL 4GXUN 4BJLA 1SXBA 1BFOB 4KAQH 2F15A 5FYLH 2F6AA 4YLBA 4L89A 4KY1H 3AGWA 3GI8L 4YHOL 3NEOA 1CL7L 3VFGL 1GKEA 1OAYL 2A9BA 2AFSA 3RUGA 2CJTA 4PYGA 4NUPA 3RWIB 1MQ8A 1E8WA 3WE6A 5JO5B 1QSFA 2CY2A 3QUXB 2NY2C 4K8RC 4C2ZA 1WDAA 3QJFA 3D7GA 3O2DL 1ZK5A 3FN0L 3FW6A 3ULVE 3OXSA 4ERSH 3D4YA 1I8IB 3NSJA 2WLJA 2NT0A 2X4NA 3N1QC 5FYKH 3B35A 1XGZA 1BP3B 4HFWB 3T5WA 4F8TA 1FCCA 1RK7A 2BNQB 2E7HA 4JQVA 4YWYA 2YQGA 2LU7A 3LAFA 3LPFA 4N0UB 4QRQB 3VFTB 1H3PH 4A7GA 3EBIA 5ILTH 2R0ZL 4PIBA 4CS0B 3L3OC 5HHNA 5JIKA 1UWXH 3CFBB 3GHEH 4G9FD 4PRPA 4KVNH 5G2NA 1SJEB 4KXCA 3ARDB 1QQDA 2BRQA 3ISYA 1HJCA 4Q9RH 3FT1A 4ELDA 3WC7A 3NFPB 3BPOC 3WIIL 5DK0A 3IDIA 3G6JE 1NC4D 1T22B 2EXWD 2DIBA 4WFHE 4XP6L 3KD4A 3LHPH 3LKOB 3PV6B 4I0KA 1J5OH 3SOTA 1LLAA 4OD3L 4LOFA 2BY0A 3DK0A 1DVFB 4UTBA 4B0MB 5AW8B 1H0DB 1UWGL 3MRBB 4NQDB 5C9JA 1Z4EA 4NAJA 2ZOLA 1OP5K 1QSTA 3II2A 2FH8A 2HT4C 5I76A 5JLZB 2DB8A 5GS0L 4M9OA 3K74B 3D07A 5LGYA 4P9HL 2CJ3A 5GRJL 2ARHA 3G3SA 1MUJA 4WDIA 4MHNA 3BZ5A 4WO4C 4OCYH 4D8PA 1OM9A 2HXAA 1MRFL 1E8YA 4QTIL 4UBDD 1ZT4A 1AKJB 1OARH 2HP4A 2C6GA 3IVKA 5LRGA 1CC3A 4LLMB 1WJ3A 3AMKA 3NIGE 4KZCA 4MQXC 4CJ0A 4MXUA 4IW4C 4PBWD 1YPZB 2OXGA 4HIPA 4U6YB 1MFDH 2R4SL 5T1LB 1SXCA 4ANWA 5KVEE 5BS0A 4IYKA 3F6JA 4M8VA 4ZUTB 3OGOE 1CU4L 4G7QB 3I85A 1LD9A 1S3KH 2OCJA 3QUKB 4L4VD 2PJ8A 4UFWA 1SMDA 2EDFA 3QUYA 5FKPB 3HE7C 1DQDL 1GZQA 4XZUB 1C08A 3ULUL 3U83A 1D5IH 2XOTA 4JWPA 2DLGA 3NZHH 5CU5A 2MCG1 5I17A 1KJVA 4CC1A 1B2WL 2KQMA 3L5HA 1KYFA 3MRLA 2Z10A 3DI2B 1AI1L 1G0DA 3BDBA 1PPIA 3UTSA 4RGOH 1MRCH 2P5EE 1ZHKA 1SYVB 2WVVA 4XNXH 1PLGH 4OZHA 1GSMA 1F42A 2ZW6A 4AXVA 4N87A 1TZAA 2F1AA 4MCSA 1UGNA 1BM7A 4NKOB 4M61B 2XC8A 1YLBB 4NGTA 3LXCA 2VLKE 4N22A 4U2YA 5KVFH 4A95A 4QD2E 3MUUA 2Q8AH 1Z5RA 3BXMA 2X1QA 1A3QA 4OY9A 1L0PA 1FSKC 1LAPA 3S6FA 4POZD 1PDKA 3O3AB 1S3RA 1G1KA 1WFUA 1A1NB 4CRYB 4U9ZA 35C8H