2NSMA

Crystal structure of the human carboxypeptidase n (kininase i) catalytic domain
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
399
structure length
390
Chain Sequence
KLAFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNKEALIQFLEQVHQGIKGMVLDQNYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human carboxypeptidase N (kininase I) catalytic domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Carboxypeptidase N catalytic chain
total genus 136
structure length 390
sequence length 399
ec nomenclature ec 3.4.17.3: Lysine carboxypeptidase.
pdb deposition date 2006-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 2nsmA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2nsmA01
3BXMA 2PJ4A 3RBUA 4P6YA 3PB7X 3KGQA 3KASA 5DS0A 3NJXA 4X2TA 4NJQA 3B3VA 4EFDA 3IWWA 1LAPA 1XJOA 1XRYA 2BOAA 2DEAA 2F8HA 3KQXA 3VATA 3WC5A 4A94A 2XEGA 4O23A 3D7GA 2ZEEA 2PJ6A 5LRGA 3B3TA 4MCQA 3VARA 2PJ2A 5CBMA 4ZX8A 4ZYQA 3N5FA 4RUHA 3FF3A 3PB6X 3H8EA 1ELLP 3D7HA 4ZI6A 1Z2LA 2ZENA 3NH5A 4JYWA 3CDXA 2IMOA 4F8ZA 4AXVA 1CP7A 1ZG7A 4UIAA 2PJ9A 1ELMP 4MHYA 4OIDA 4P4FA 2POKA 4W9YA 3RAMA 3BHXA 1ZLHA 4K3NA 3CPAA 3WC6A 4F9VA 3RZAA 1H8LA 3B3SA 4P10A 5D8NA 3FECA 3WABA 1YSJA 2CIJA 1CPSA 4MMOA 4FWUA 2QVPA 5CPAA 1Q7LA 3S9NA 3NA6A 1TKJA 2GLFA 1EE3P 3SJEA 4G1PA 1JQGA 2JEWA 1HDUA 4MHPA 3FEEA 1LOKA 2VL1A 2Q43A 5JH9A 3H8GA 1R43A 4P44A 4NGRA 2AFUA 3IFEA 5HXDA 2JBKA 2GU2A 2V8GA 3BI1A 2ZEPA 5AQ0A 4YU9A 4DJLA 3GLJA 2AFSA 1QQ9A 1IY7A 4KSIA 2WYRA 2QJ8A 1KWMA 4P4BA 3KI9A 1LCPA 2ZOFA 3FH4A 1UWYA 1F2PA 3NH4A 4F9UA 1VHEA 4PPZA 4P4DA 4OC0A 1PYTB 3BI0A 2Q51A 3KZWA 4MCSA 1RTQA 4OKOA 2QYVA 1BPNA 2IJZA 2AFOA 5J1QA 2XEJA 2F7VA 4FUUA 4MXUA 5LYDA 4NJRA 2GLJA 3SJGA 3L2NA 5K8NA 1BPMA 2O53A 2HB6A 2OR4A 1DE4C 3FVLA 3D7FA 3MRUA 4OC4A 4YWYA 1HEEA 4NGNA 4IYKA 4MRIA 5D29A 5LRJA 4R6TA 4A39A 4DYOA 4UF4A 1VHOA 2PJ0A 4OIWA 2G9DA 4NGQA 4MHNA 4WI0B 3JRUA 4WWVA 1CX8A 1Y0RA 3B7IA 2RFHA 1YW4A 4R76A 5HVFA 3CPXA 4OC3A 4X8IA 3SI2A 4U3SB 2O4HA 4P4EA 2HC9A 3NFZA 4OMEA 4FL4C 3E8VA 3ISXA 4ONWA 4R8FA 3K9TA 1IGBA 2C6CA 3HN5A 2JBJA 1AMPA 4TWEA 1DTDA 3IC1A 3KR5A 3PFOA 2B59B 3D4UA 4EIUA 4ZY0A 2PJ8A 3B3CA 4BD9A 3HLPA 3V38A 4PXBA 2V8HA 1AYEA 3H8FA 3NJVA 3SI0A 1VIXA 2ZOGA 4OC1A 3IIBA 1CG2A 4P4JA 2ZEDA 4PXEA 3PB4X 3KL9A 3KHZA 1XBUA 2AFMA 2CTCA 3PRTA 3TX8A 3PEIA 4PXCA 1ARLA 2GREA 2EK9A 8CPAA 1F57A 3PB8X 4Z65A 4IAVA 1QMUA 4P45A 4X3RA 1XFOA 4OC5A 3MN8A 2EWBA 5LYIA 1Z8LA 3G3LA 3B3WA 5IB9A 2AFWA 2NYQA 2AFZA 4Q7AA 2CTBA 3T8WA 2IQ6A 2ZEHA 2J9AA 3TC8A 3SJXA 3GB0A 2ZELA 1CPXA 4JZ0A 3DGVA 1M4LA 2BCOA 5G5DB 3B2YA 4NGPA 4YOKA 1PCAA 3PFEA 4NFRA 4WJBA 1BAVA 2RB7A 1CBXA 4EWTA 2FVGA 3S9MA 4UEEA 2I3CA 3KR4A 5HVGA 3DLJA 5HVHA 5K8MA 1NSAA 4A38A 2PIZA 1FT7A 3V7ZA 2XHNA 3QNVA 4OP4A 2PJAA 4NGTA 5K39B 3B35A 4MHZA 3KCPA 1TF8A 3K2KA 2Q4ZA 3HUVA 1ZG8A 3VH9A 4MCRA 2BO9A 3S9LA 4P4IA 1ARMA 2ZEMA 3IO1A 5LRKA 2PJ7A 2C1CA 3D67A 4UEFA 4ZX9A 4R7MA 3FX6A 1ZLIA 2OOTA 4FAIA 4OC2A 2PVVA 4PQAA 2ZEGA 2XEIA 3WC7A 3D68A 3PBBA 1LANA 1YMEA 4DUKA 3IJ3A 1VGYA 1BLLE 3LMSA 5JGFA 5LYFA 2AFXA 5JM6A 4TNUA 5LYLA 5I4MA 2ZEFA 4PXDA 7CPAA 4ZY2A 1TKFA 4LQGA 2XEFA 2ANPA 4H2KA 1Y7EA 1F2OA 2V8DA 2PJ1A 2PJ3A 4NGSA 2PE3A 1LAMA 3SJFA 3WT4A 1FNOA 5K8OA 6CPAA 2V77A 2NSMA 2PIYA 2PCUA 1TXRA 3FJUA 3PBEA 1LFWA 3KQZA 2EK8A 4UIBA 1CP6A 4IHMA 5ELYA 4ZY1A 4GM5A 1Z5RA 3I1UA 4NGMA 3NH8A 1TF9A 2ZEOA 1XMBA 3SI1A 4FXTA 5K8PA 2ABZA 3ISZA 1R3NA 5F09A 1NKGA 2WZNA 1OBRA 3GUXA 2PJBA 2PJCA 2PVWA 4MCPA 4IK2A 2PRQA 1YLOA 4EMEA 3KHXA 3FMCA 1ZG9A 3FEDA 2CF4A 3PB9X 3IEHA 1YW6A 4CPAA 1Y0YA 4UEZA 1TKHA 4A37A 4FBEA 2PJ5A 3D7DA 3D66A 2V8VA 1HDQA 3CT9A 4B6ZA 2C6PA 5THWA 2C6GA 3LWUA 1GYTA
chains in the Genus database with same CATH superfamily
4ODSL 2CKBH 3BO8A 1TO4A 5LG6A 4Q36A 4KXZI 5I8EB 3V6FA 3QRGL 1CXLA 1U8HA 4LVOC 1JN6A 2FEDD 2YA0A 2K9FB 4I0PD 4PRID 4XGZB 4P2RE 3W38A 1M6UA 12E8H 1GS7A 5D93B 5IX3A 1XGPB 3QUZD 4S1SH 1GAFH 1J05A 1UEYA 3CZGA 4X9BA 5E6YA 4KZDL 4AWJC 2D7QA 2JKTM 5C9JA 3ZJAA 4NDMB 3X2QB 2YQGA 1WK0A 5J11C 4R0LA 5C6TH 1K6QL 2F5BH 1CFVL 2EXYD 2J12B 3GIZL 3MNZB 3TWYA 3WIIH 5C92A 4OU3A 2UWEA 5IEKB 4PG2C 5K69A 1Q9KB 3BAEL 1W72B 4MCQA 5FW6A 2VRQA 1Q94A 2X0UA 4FL4B 4M03A 4TLSA 4XOBA 1K5NB 5FS5A 3BE1H 2F5AL 1L7TH 3ALPA 5GZNA 5LGHH 4FXGB 4PAZA 5H4ZA 1U6MA 3L9RA 4P2RD 4RUHA 1CC3A 1JWSA 1XEDA 2VXVL 4GW1A 2R7EB 1F3DJ 3FHAA 5CUSL 2K4AA 5AOMA 1RULL 3ZGIA 1QHOA 1AMYA 1R1CA 4M6IA 1ONQA 1KWGA 4HXAL 1U2YA 1S7SA 2UZYA 4U1NA 3VWJA 4O58L 4RAVB 1BM3H 1JN6B 4F8ZA 3HG5A 3SGKC 1U3NA 2DM4A 1LEKB 4QJ4B 4WUUE 1II4E 2ZOLB 5I5MA 4GEIA 1NAMH 1GPOL 5FA4B 3KM2A 1ORSA 1U3JA 1R5IA 2A83A 2BNRB 4TTGA 4P23D 3QORC 4NDMA 1WBYA 3ZDZB 2C9QA 1NCWH 1JDCA 2WAQA 4LCWB 4DGWC 1OAKL 4WHDA 3EYFA 3MRPB 3ENEA 5CJOL 3MNZA 2MSPA 5KZCD 5SV4A 3QUKA 2R0ZH 4KKPA 2Z10A 5C0FA 2OL3A 2A77H 4FXGA 3QUZB 3WNPA 2AW2A 3L9RB 4GLRI 1J11A 1WWZA 4H89A 4OCXL 2NSQA 1JWSB 2MTPA 4GW1B 1MCRA 4PJ7E 4K9JA 1IC5L 3DYMA 1F41A 4MMOA 3VDAA 2FVNA 5MENB 1BG9A 3WIHL 1DBKL 2QVPA 2HKFL 4DGYH 4ZZFA 3L8QA 5JLZB 2HT2C 2FT8A 3PGCB 3T0EE 4GXVH 5G1ZA 2C5DC 3VX1A 3GQFA 3KXFE 4ZX4A 3FUDA 4KRPC 4XMZA 3H42H 4E41B 5CLXA 3AQZA 4U1SB 3VVWA 4ZMTA 3PIQB 1THCA 1WBYB 3ESUF 4OZHE 3GIVB 1JGDB 4HWZB 5GZOD 5CXPA 3I3GA 3FFDB 2B14A 5I1HL 3IU3A 1OQOA 4JVWA 2AK4E 3EYFB 3MRPA 3FMGL 2G2RB 1XSKA 3T6VA 3QUKB 2NW3B 4QO1A 4XO9A 3RI5F 4NO0A 4KY1L 5DJ6A 3BX7C 5HJ3B 5IQLA 2IWGA 2PABA 4PS4L 3TN0A 5I6NA 4LIQH 4YU9A 1JZFA 4G9FD 1A6WL 4ZUUA 3EFAA 1JXGA 5DRWB 3BZDA 1HH6B 4JFXB 4XNQB 4F92B 3S3CB 3UTSA 1Q8MA 2IPTL 4LL4A 3HR6A 5GGVY 1NMBL 2HLAA 5A3ID 5M95B 1YEKH 3PIQA 3NFNB 4GG8B 1O5DT 3GIVA 2X9XA 5IFJB 1AS7A 3FFDA 1X44A 3RZCC 2Q51A 2ADGB 2ZXEB 3CN3A 4OKOA 2FQEA 1ASQA 4HLEA 5E08L 1IIDA 3KGSA 3C9NB 3QJQB 3QWNA 4NO0B 4HG4J 5DJ6B 2ADIA 1SN5A 3B6SA 4JRYE 3II3A 2CRIA 1FZJA 1G6RL 2QR0B 4OCMC 2A74C 2WIIA 2Z31A 4PJEE 3RAJH 1OV8A 1KJ3H 4AITA 3T3MB 5DRWA 5EBGA 2YEZA 3PJSB 3GLEA 4FCHA 2CRMA 5D1ZC 2XC8A 2GIMA 5D2LB 5JQHC 4PJ6A 4XNQA 3D7FA 1N64L 4UMSA 3LIZH 5HBBA 2HG5A 4IDJL 1QZ1A 3E0GA 4NQDE 2Q5BA 3HFMH 3JUWA 4UFXA 2HLAB 2DL9A 3V6ZB 4GYBA 4N2GA 2R4RH 2BWIA 5LRJA 3FAXA 4QY8A 3W0WA 1K72A 2WWMC 4L8AA 1B4JH 2PYEE 1LM8V 4UF4A 1ACZA 1KLUA 4WKZB 1OM3H 3ZZSA 2CHWA 4NPYA 4P4RA 2K45A 1WFIA 1G6RH 3PLYA 1J1OH 3TCVA 2FD6L 2NY2B 1HQRA 3WS3B 3O3DB 4FZEH 5FYLH 1NWPA 5AB1A 1JZ5A 3IXAB 4ODSH 4PP2A 4A55A 3AT8A 1BIIA 3QDMD 3N1PC 4JPKL 1QFWL 3LKSB 1N0LA 5FKAB 2R51A 1TQUA 4LCWD 4WZ9A 2WWNA 3NJKA 5D2LA 3RZWA 1KPUB 5EUKB 5AAMC 1JWMB 4WI8A 1NOFA 3AQDA 3CVIH 3MREA 2H3XC 1V54B 3B2MA 1HI6B 3VB8A 3HC0A 1DBML 3KDPB 4N8VB 4CRZB 3D4UA 3TBWB 1F4XH 2Y6TE 1WFUA 4M43L 3WR7A 1DJYA 3SZ6A 2RBLA 4LASH 5FGBC 5I0XA 5FDWB 3JWDH 2FEJA 2P42B 3GI8L 4LSRH 4OQTL 4HCRH 4XODA 3SKJH 3V38A 3VMOA 1KCSH 1EZLA 1WBXA 3M6DA 3UAJA 4EN3C 1YNLH 4NQCA 5BJTB 5ICUA 4YRHA 1KTLA 1DDHB 4LLQA 4RAUB 4RRPA 2CWRA 1OAJA 2X38A 4L3ED 1IAOB 3MJGX 1BREA 4ONFL 5ANMA 1BIIB 1DLFH 4UWQB 4DUXA 2HWZL 1ZLVH 3CU7A 4HHGA 5FKAA 4APXB 3TO4C 3A24A 1YEIL 5J7CC 2KZ1B 2PP8A 3VJ6A 3P3YA 4XNXL 5JIHA 1JDDA 3QYNA 3PCYA 3UTPD 4HPHA 1NWOA 3KH4A 2R7HA 5E6IB 3N44B 1T1ZA 1X9RA 4QXUH 3SQOH 3NEEA 3KPRE 3ZT7A 4LSQL 4WUKL 5AG6A 3KLDA 3D1MC 1Z9NA 2ZP9A 5CGYD 5EOCJ 4DW2H 5CBAA 3QO1B 2EEBA 1EJFA 1XFPA 3Q8FA 1IC7H 1GGIH 4J5VA 1SZNA 4NQCB 4NWTL 2GJ6A 3U4EB 4YHYB 1KTLB 1YEGL 1S6NA 1DDHA 3QSKB 1NC4B 2GTWA 3SJXA 3L48A 5GGSB 1EFXD 3HG1D 1M4LA 4KUBA 3K80A 2Y36H 3DV4B 2GT9A 1Z5LB 3UTTA 5A3IC 3MNMA 4KZEL 3QAYA 5T5FH 4P57B 3FIXA 2XOTA 1LO2L 4TOYL 5E6RB 4Y1TA 4H13C 4OFPA 3QZOA 2CA4A 1QR4A 1CLOL 3R96A 1EHKB 3RHWF 5LO7A 3X11A 3S9MA 5AOZA 2EDXA 2MQGA 4L4VA 2HMIC 3BC9A 1XD0A 2MQCA 2D0FA 5C07B 1MHCA 4MJIE 1TSRA 4LSTL 4N3UA 3P9MB 4RGND 2BVQA 1BZ7B 1NEZA 3QEUA 5F1OB 4G3YH 3UIYA 2GVYA 1WWCA 4Z3HA 5HDLA 3SO5A 4FFZA 3OGCA 1FG9C 2ZSWA 3VRJA 4Q6YA 4QC6A 2IBGA 2JTDA 4L5FE 1W2KT 2J55A 1X5JA 3MOQA 1NC4A 2GTWB 5GGVL 1MJ8H 3LHPH 1P4UA 2AXFB 3SY6A 2VLKA 2PLTA 2XZQH 5B38G 2REFA 4WEMB 2GT9B 1TKWB 4FXGC 2FO4B 1F42A 1IAIL 5FPIA 1RERA 3AU1A 2D31A 3DX0A 5H35A 3ZO0A 2W9EL 1T5WB 1H5BA 4EO5A 1U8MB 3EJYC 3X3GL 1MVFA 1ARMA 1Y1UA 3FT9A 2WTRB 5E94A 3WFDH 1XGUA 3L3OA 5F72S 1XDTT 1MW3A 1IFRA 4APQC 2Z3KA 3RL2A 1X5IA 3LMJL 1WAAE 5BXFA 9PCYA 3B9DA 1IC4L 4L37B 4UBRA 2AJYL 5C07A 4J3OG 1MHCB 2GTQA 4TSAL 1MI5E 3I6SA 1LMKA 3OZKA 1XF1A 4HETA 5G55A 1BZ7A 3EIFA 4B9KC 1BAFL 3QUML 4D3CH 3TLRA 4OC2A 4ELMA 3M88A 1HILA 1IARB 2HPTA 3WUZA 4PV9B 2V8MA 4NRXA 4E9VA 4MKMA 4PBDA 3B2VH 5HGGS 2IDTA 2ZOWA 1X9LA 1UWEH 4JFFB 3H54A 1PFCA 4L4JA 4QRRE 4HJ0D 2MJWA 1IL1B 3RVWC 3E80A 1EO5A 3VFSA 4DH2A 1BLLE 4FQ1L 1SDYA 2FO4A 5FYKE 4A6YL 3U4KA 3S6HA 1Z9LA 3RNKA 5EA0H 2HUHA 5GGQL 5KVDL 3RWDA 4FQXD 1ITCA 4ELMF 5BVJB 1DJXA 3SKOB 4LSSL 3GMRA 3B8GA 1U8MA 2WLIB 6TAAA 1UJTA 2AI0H 3GYRA 3VYPA 4KV5F 3T3MF 5FCUL 3SDCD 3TBYA 2V8DA 1H3XA 2CSPA 4Y49C 4PJ5B 2A6IA 5DEGA 2WYHA 2IO5A 2B1HH 3GS4A 4MVBC 4MXWL 1EDYA 2MCMA 2HX7A 2WVTA 4MJ6A 4HNXB 43C9A 4JFHD 5MI0B 4JFED 3H9SB 1MHEB 2WUCL 2XN2A 4ELMB 2D3VA 4P3DA 2HFEA 1WHPA 1FI8C 3IDMB 4FF9A 2B4CH 3B9KB 3DMMD 1TEYA 3EO4A 2IGLA 4ZFGL 4PGJA 1E5CA 3BGFB 3V4VB 4NNYA 1WZ1H 1NGYB 1Q0XH 2DWEA 2PCXA 3L4UA 1S5IH 32C2A 3CC1A 3MI6A 1KGCE 3QO0A 3LXUX 4XMUA 4MFHA 1ACYH 2V2WA 4DESA 4UNVA 3ZSTA 1J5HA 1JNLH 2ALWA 3GUXA 4X5PA 1KGJA 4ZAKA 3M8OL 5EBLA 4FYTA 1IOIA 3BPOC 4KX9A 4POUB 2GPZA 2B16A 3QIUC 2PO6B 3CVHA 3FMCA 2YA2A 1L6PA 1MREH 4DZBB 1ZCRA 3FQTB 3E0KA 4BFNA 5HGHA 3GI9L 5F2FA 1OW0C 3QDJD 4ZMXA 4G5ZL 2FEDC 4CGTA 3I50H 4PJGF 4G8GE 1T1WA 1ZOXA 3E8UH 5GS0H 3OWEA 4AYEC 1QASA 1JHLL 1YJDL 4AVAA 4NM8L 1MHEA 3S4SB 2BY0A 5JYLA 3H9HB 4QRTA 4N2HA 2WO4A 3QQDB 2HFGH 3CHXA 4S11A 3B9KA 1B0RA 2QELA 4YSRA 1KEMH 2XVBA 4KTDH 4UQEA 1EZVX 1IGML 2P44B 4IU3A 3K6NA 4O02B 3ZN6A 4KOUA 1KPVA 3RYOA 32C2B 3NCJH 1HSBA 3HZMA 3T6WA 4FMFA 3P3SA 2YNDA 2Z3NA 2XQYG 1YEJL 4OZGA 2WOBA 3VG9B 2E8ZA 2F53A 2PTUA 4NQEA 4G9FE 1RAMA 3QUXA 1PMYA 2TSAA 1SOSA 1UA6H 1Y6MR 2XWTB 4HLJA 1U2CA 4G80B 5HXMA 1W72L 5MENE 5IB2B 2DOCA 3IWWA 2W80C 5HTSA 2X2UA 2DIEA 3QDGE 4CGUB 2P8PB 1KG0B 3GJFB 3ROOA 4ANUA 2GI0A 1E4KA 4YE4H 1HC1A 5HGHB 5JUEH 1GOHA 3HKZA 1D2PA 1VKXA 4HCRL 2Y7MA 3EGSA 4XB7A 4JM4H 4W4OA 3BESR 3HN3A 2J8RA 5CINL 3TFYA 4P23C 3QJUB 2AJYH 3W39A 3VFGH 1VCBC 4TXVB 3D0LB 4K3DH 2PCPB 1YQVL 2MNJB 3O2DL 2Z3FA 1EA9C 1OAZH 1FPTL 3PZJA 4OF0A 1KPVB 4N22A 1VPOL 4LAQL 4ANXA 5IMLB 2Y0MA 4JYWA 3EFFB 1U9KA 1UG9A 4AXVA 3CPLB 5KJRH 3D52A 3SHSA 2HTLD 1R33A 3OJ2C 5DYFA 4UIAA 3K2UH 3NK4A 2LTQB 2ENSA 2WXRA 2P80D 3KYKH 1UT1A 2FD6H 5AYQA 4NJAL 4DP7X 2RACA 3JYCA 1LE5A 2H1LM 3KMDA 3NA9H 2DLTA 1TQSA 3WXVH 2WSPA 3TO2A 3BKYH 4NAMA 4MCYA 3BJ91 4EKXA 3LEXA 5IKCA 2BZ7A 1QWUA 2CXAA 5D1QA 3QEQB 4NKDB 4CSPA 1Z4RA 5E1QA 1BAFH 1TJHL 3QUMH 1SEQH 4HS6B 4D3CL 3L9YA 3QG7L 4P2YA 5SWQB 5D8NA 1T21A 1KULA 4TLTA 2B2XL 4UCNA 5HHNA 2H2PC 5IQ9B 4UIKH 4OB5H 4L4TE 2JDDA 3FZUD 2VDRH 2MTAA 4QOKB 1TO5A 1SHXA 4NM4L 5SWZB 2CCVA 1LD9A 3E6FA 2QSVA 2BWDA 3DBXB 1OGAA 4YLCA 1U3YA 3S9NA 2W9EH 3VFMB 4G59C 2EDBA 2BIHA 3C87A 3WLWD 3WDIA 5E8EA 4TUOA 4YLQT 2WVVB 4PJ5E 1CD0A 1S8DB 5BUPA 4Z7UF 4RS2A 2VH5H 4ZPTA 5BV7L 4JO2H 2YKLL 2VDPL 3I6KA 1UM5L 4F0XA 3ZKXC 1ZTMA 2WAHA 5C0AD 2C4FT 4OLVH 2CH8A 2VQ4A 3A4EA 3IJ7A 3OHXA 2WANA 1SEBB 1JF1B 2V8GA 2ZW4A 1T21B 2A6JA 4KJYA 5CU5A 4OLWH 4IBLT 1F86A 1A2YA 5KYUA 4CMHB 4J6RL 1WD9A 1PEZA 2VLRA 3FRPG 4UTCA 2OAAA 4KVCL 1OY3B 5HPMB 1ADQH 4QOKA 3LQMA 1FRGH 2R0KH 5D5MA 5SWZA 1NLDL 1U8QA 1YCSA 4Y19B 1ZANH 3E6FB 1OGAB 1JOIA 1UB6B 3IS0X 4IRSB 2FIWA 2R56H 4Y2DC 3W1ZA 3RY6A 2ZXGA 3B83A 5E8EB 4N86A 2MEJB 4EE2A 4CSSA 1ZTXL 1UWYA 3IMVA 4FXLA 5L2KE 1RPKA 4Q9QH 2CJUL 3IDJA 1VRSA 4XCFL 1HE8A 1A6AB 5T8IA 2E9WA 5EF1A 4N5UA 7PCYA 3RX5A 4U1MB 5C97A 4L3CA 1JP5A 5ESQB 3QNXA 2IH3A 5F0PB 4IHOB 4XXDB 4EUPA 3LB6D 4IKNA 1JF1A 3UPCA 2HVJB 2AFNA 4GQZA 3WG7B 2XPYA 4GPVA 4PRPA 2QVFB 5CLTA 4ZMQA 1N59A 3BD3A 2KZBA 1Q72L 2VERN 5HHQB 2BO0A 1R5VA 4E41E 3BQUB 1U8NB 2JJTA 4XXCC 5F6HI 2DMCA 4M3JA 3BAJA 4PJBE 4M5SA 3NA4A 4WAFA 4O5LL 4LPWA 2DRUA 2EE9A 4L1HA 3R1KA 3ZE0F 3BJ7A 5J6SA 4ZW3A 4HX1B 4MRIA 3VWKC 1RH8A 1DLFL 4ES8A 1GSKA 2B0SH 2C3GA 4OGYH 4OM1L 3V9EA 1VHOA 4EN3A 4B9ZA 4R7VA 1BVNT 1ZLWK 3VO0A 2IQAB 3IWEA 3UX9B 1XQ4A 3LRHA 4PWFA 3MXWL 1AO7D 1Q0YL 4L3CB 2DBLL 3AT9A 4FA6A 4KTYA 2V33A 5HJGA 4DP6X 4X42A 4DVBA 5LVEA 4F2MA 4P07A 1Y0RA 3O45B 4PJ9C 1L3WA 3QRFM 4K94C 2BJMH 4JD6A 3D4YA 4GIPD 5GISH 4JG0H 1OB1B 5DO2D 2XWBA 1CBVL 4QWWC 4FQXA 3NACH 1T03H 1AI1H 2V7HB 1YVKA 1NUDA 3F64A 3AWGA 5IB3B 3DDFA 4OLVL 1M1XB 2ZCZA 4YPGA 2BRQA 1OAYL 2WQAA 3HNVH 3AAZA 2CZNA 3BAWA 4BQCA 1MCHA 1NMCB 2EP6A 2DQHL 4CNIB 3IB4A 4YWGH 1KCUL 5DHDA 1YMMD 4ZAKC 5H4YA 1ZS8B 4IEFB 3F04A 4XPGL 4HHAB 1QSEA 4GKNA 2GW5A 3DKHA 2HT4C 5E9DB 4BQ8A 2DH3A 1AIFB 1ZHKA 2X05A 2DV6A 1GL4B 2OTWB 5KAQF 1BYOA 3T3ME 4YHZH 4WK4B 2QGEA 2C9PA 2NX5B 3B5TA 5BW7A 3VGAC 3TE4A 4JO8A 5A16A 3KM1A 1UQSB 2I07A 5FECA 2ZEDA 4N0CC 2WLLA 4LO9A 1KB5B 2BVPA 3L54A 5ELIA 3KL9A 4LARH 1TUPA 4F7KA 1EHNA 1UXSA 2XN9E 4P5TB 4RISL 2WBWB 2YBRB 3ML8A 2PP7A 3PEIA 1BQLL 4IRZA 4ELDA 1ZDQA 4DCQA 1M1XA 4LHUB 4NSKB 4XWOD 4YPGB 4OD1L 2CY2A 3AAZB 5E24E 5EEVA 1I3RB 1BFOA 2CK2A 5EF3A 3BFWA 2EYSB 2FECL 2CHZA 2PCFA 3NA9L 1WITA 3RBGA 3PGFH 4BZ2A 1EMTH 1S9YA 3ZTCC 3F6LA 2YUVA 4HHAA 5I1GL 3ZDZF 4TL4A 2NXYC 2W92A 5EZOH 3VX0A 4IBSA 2I79A 4WWKD 3NCYS 3T8WA 1XF2B 4KROD 3MJ6A 3N41B 4HGMA 3L3KB 4UNUA 3KVDD 4L4VD 1CU4H 1W91A 3CZFB 2VR9A 3QHZH 2NX5A 3U6XA 4Y2DD 3PG2A 1LMIA 5I0WA 2A0LC 2NY3D 3H7BB 1QFWI 3MRKA 5E0FA 1H8SA 3U30C 5G5DB 1KB5A 2BVPB 1S3KH 2WXLA 2ZCHH 4X80L 5F97E 4E9QA 4F7MB 2AC0A 2ZPAA 4ZUTB 2IGFH 1XV8A 2EZ0D 3VFPB 4H5SB 4EXKA 3OHMB 4NAQA 5C71A 2ZG2A 3MRNA 3OKOA 5CLZA 5DWUL 2W59A 5AAPA 3TURA 1YAIA 4BXVA 4GAJL 5H94A 3IWUA 3HE6B 5JHDA 4PGEA 1I3RA 3Q2WA 2VL4A 4GY4A 4YE4L 4DN3L 1I9RH 4NBXB 2ZNXA 3LB6C 1MFDL 4TUJA 1M6OB 1OK8A 1MRCL 5CCHE 3UYRL 3VI3F 1XH3B 2J8MA 1G5AA 1M05A 2MIZA 3T2OA 4XCFH 2JKRM 2J6EA 3BSZL 3II1A 4M1DL 1TTUA 4A38A 3OB0K 3VSTA 1S4IA 5GGRA 4A7GF 3L7EB 4PJEF 3L3KA 1HYRC 5LCVA 1KNOA 3HOGA 3EUUA 4YNYB 2OULB 4PLKD 4RFEA 4XPKA 4MTMA 1ASPA 2DD8L 1FRGL 3GSQB 3UBXI 4F7MA 3VH9A 5DD3H 4ZUTA 2BZDA 2OH1A 2VSKB 4H5SA 4AKOA 4XNMA 1TFPA 1JHLH 1YJDH 3OX8B 5T1KB 1RZJH 4WWKA 2Z65C 5BPPA 3ECBB 4PJFB 1OCZB 1SBSL 2NY6B 4HUVB 4AEFA 2AV1A 5BQ7B 4N0YL 2ZEMA 1UM4H 3JWOL 4Z7QB 5ALBL 2PJ7A 5AW2B 1RULH 1LK2A 3ZMNA 2CNZA 4HBCH 1BW8A 1BV8A 4XPHL 2ENQA 3DOSA 4OI7A 1UM5H 3BUTA 2UY7A 5BOZG 4JLYA 4KZTA 2OMNA 1LLAA 1OXYA 3M8OH 4PJ8A 4A30A 3REVB 5JOFA 2ZUYA 4NQSA 3T6ZA 2YGOA 3KR3L 1QSNA 4AIEA 5I15L 1DSWA 1E8XA 2DTSA 4LSUH 5GGRB 3Q8CA 4CVWA 3Q48A 1MFCH 3WC7A 1OSEA 3BZ4A 3H3PL 2X7LB 3E3QC 3QQ9D 4UUJA 4BWTA 3M1OA 1TVHB 1U58B 4JFEA 4RFEB 4D7BA 5CGTA 3SKMA 3GXUB 4G6JH 1PKQE 4YK4C 5KANG 1PF3A 4WEEA 1T1XB 5F9WC 2GI7A 2JK5B 1V3KA 4XNMB 5D5ME 3U2JA 4KUAA 5T1KA 2F54E 4G6AC 3BKML 1E4JA 5IK3B 5IVOA 3ALXA 1F2OA 2X9WA 3PB4X 1IC4H 3MA7B 4HOMA 3T9WA 2PJ1A 1LO4L 5TE7L 4JPVL 3DJZA 1OAXL 3HEIB 1Q9WA 3B34A 1OT2A 1IBDA 4OZIF 4U6XA 4NCZA 1NLBL 1ZSHA 3NTCL 4F9PC 1WGOA 3UH8A 1XT5A 4MFLA 5L2KD 4AOFA 1KBGH 1LEIA 1L9PA 3FJUA 1YJDC 4NT6B 1LJMA 3RDTB 3UTOA 1M2OA 4BELD 4IRJC 4XI5C 1P1ZA 1HJBC 3U4BL 3WIFB 1X10A 3ISZA 1FFRA 3WKYA 4KVXA 1U36A 3WEBA 5C0IB 1M7IA 3NP3A 5KUMA 2WZNA 3B8SA 5FVJA 3K71A 4G8AC 2JVUA 2NXYD 1KPRB 2OMUB 1VIWA 1U8CB 2ENYA 1IGIL 1BXAA 3AY4A 4M02A 4NQDD 1CK0H 1O9WA 1UXWA 2BP0A 5TH2A 3MA7A 2FGWH 4WK2B 5D7LB 2PR4H 1S9WA 4WNQA 3U9WA 1EDQA 2I5YH 2OL3H 2W0PA 3FTXA 5FUOL 4W9DC 3SYCA 3SEPA 5A2KH 1WHOA 4WJ5A 5ID0A 1NEPA 3N43B 1OOAA 1LEIB 4BFBD 1ND0B 4YSEA 1HEZB 4ZO8A 3MLTB 1LWRA 4Q6IB 2BC4A 4BHUA 2B4CC 3TVMB 2HH0H 4FI7A 4YDJA 2J6EH 2BW4A 1NOAA 2VTFA 5H8DA 2OM5A 4GUPA 1TJGL 2VW4A 2BP5M 4XPHH 1DVTA 4DJMA 3VXUA 2EIMB 1MJ7L 4K2UL 5DJ8A 3CN4A 5AW3B 4P6YA 4Q97A 1EEZA 4NCC2 1OT1A 3ARSA 2J25A 4G3YL 2WMPB 2H3KA 4IBQA 5DS0A 3QB7C 4DOHE 4XP5L 2JEVA 4JQIL 4XVSH 2H9GB 4BFIA 1XAUA 1HCVA 1A25A 3PWLA 5TH2B 5LBSH 2BP0B 2I60L 4NHCL 3U7WL 3KQXA 1RIUH 3V0DA 5DD3L 3T1FB 3FBUA 3EAKA 2D03H 2WXMA 1WWAX 1U93A 2ZIDA 2JCCB 4FNQA 4JHVA 1I7ZA 4IOSA 3IJEB 5AVWB 4ELKB 3UAJC 2WUBH 5CCGE 4CBPA 4Z95L 3OLDA 3RIFF 4Z7UE 3MLTA 1U3HD 3EJUA 2CIKA 4FTVA 5ACZA 3H8EA 4KNSA 4UTBA 2E7LC 4GIOA 3L9BA 3N50A 4ODXA 2ZTBA 2DTML 3VMNA 3RPKA 4HXBH 3VD4A 2AQQA 2N4IA 1RZIB 3PDDA 5D7LE 5KSAA 3UG5A 5LBVA 4HIXH 3HE7A 3NDZE 1NCAL 5GRVL 2VISA 1SVCP 4GAJH 3PHQA 4NNPH 2DJUA 1SBBA 3LNEA 4FQIL 3P2FA 4G1MB 3PWLB 4XCYA 1MIML 1WBZB 3BGAA 1G7LA 3DX2A 1JZDC 3D39B 4JM2A 4M6NL 4P4FA 1YY9C 4NZFA 4MNHB 2CJTA 4ZG1A 1OSZA 4PGDA 2RTTA 4OCWL 2OI9B 1K4DA 5FW8A 1ACYL 1V55B 1YYML 3CBKB 3GO1H 4IIQC 5D7JA 3UY5A 1UUNA 5A2IH 4GNKB 4NQQA 2EIZB 2ZUSA 2M1KA 3CK0H 1KYOK 3R7QA 5B8CB 4N0UB 3R1GH 1UACH 3TZVA 3LQZA 4PFEA 4ONFH 5DURD 2AK4A 4GRMB 1N5AB 4HKJA 5DC2A 2PR4L 4G6AD 2FZ3A 4IRJA 2VDRL 4W4OC 3L6FB 4EZMA 5LBSL 4DAGH 1ZMYA 3RWEB 1AD9B 2IAND 4ODXB 3E6HA 5LCVL 2DZEA 4PJHF 2ETWA 1A7QL 1KGYE 1BPVA 5D7HA 3OM3B 3SBWA 4YK4B 3HRZC 1NAMB 3KBPA 5DC0A 1T3FA 3WJMA 5J4MA 5KSAB 3FOLB 3FB8A 3PDOB 4JHAL 2GLFA 3MBWB 1UD5A 5EULV 3DROB 2ZICA 1R3JB 2OZGA 5F96H 3O8XC 2ATPB 5F9OH 5E2UL 3HCVA 5I74C 3TPUB 5EBVA 3HS0A 3UTSE 3QZWG 2NR6A 1WYJA 1ZHLB 1XXDC 1SHMA 3CXDL 3FL7A 4LOFA 4PTUA 4TSAH 5EIIA 4Y0GA 1K4DB 4IMKC 2AFUA 1CD1A 4AW4A 5D7JB 3GM0A 5IIEA 3WNKA 4LF3B 2QHRH 5KTEL 2FGWL 1Q2DA 2GU2A 4Z5RB 1TQTA 2BCKA 2I5YL 5J3HD 2ZSVA 1HDMB 3I2CL 3VXOB 1EVTC 1N5AA 1OTUD 2R4SH 2RIKA 3HMWL 4HKJB 4IRJB 3QYMA 3WDJA 3L6FA 4M6HA 4XP9L 4GUCA 1CGTA 1QW9A 3PFQA 1O6TA 3GMNB 2B3UA 5T33L 2CLVA 3RVVC 4ABUA 3MXVH 3BWZA 1QAWA 4JJ5B 4ANVA 1JNJA 3KGRA 4XP4H 1RK0A 5JNYB 1E27B 1EANA 2A6DB 3K6OA 1QRNB 4GKLA 4WFEE 3FH4A 3DROA 1F18A 2FX8H 3CDCA 3DTXB 1NBVL 4M8RA 2EAEA 4ZOCA 4YLBA 2LAGB 2FX9L 3WHXA 2DI8A 4WI2A 2EDHA 2A4ZA 1HHHB 3F12A 3QCTL 3QDJA 4PGZA 5EZLB 2P6GA 3KZWA 5GGRY 5TDOA 2X3CA 5LBSA 4EXPX 1KBGL 3D3VA 2BIPA 3BDXA 2OMXB 4LF3A 1H9DA 4NN6C 3VWKD 3OG6B 5GGVH 5FV1L 1Z8WA 3FUHA 1F2XK 4Z5RA 2BVOA 3SJGA 1FNFA 1YUHA 1PZ5B 3MOAL 1S9VB 1EJ6A 2YRPA 2DQTL 1H0DB 5EO1A 4II9A 1FORL 4IGBB 3HG4A 3DSFH 4PH8A 4NZ8A 4HUKB 5C7ZA 3SGJC 1HH9B 5DTFA 2XQYA 1BCIA 4V33A 3RRQA 4MLIA 2CLVB 2BS71 4K3EH 3CXSA 2XY2A 3HB3C 2H2SC 3UO8B 2Y1AA 1RHFA 1CGWA 4ZX5A 3Q43A 4JLRB 4HZLB 1QRNA 3Q1SL 2GSIA 3CCHB 3IDXL 2UZPA 3DTXA 3SPVA 5HVHC 3VWDA 1T6WA 1DJIA 1NPJA 1VFOA 4PJCE 1XWVA 4JE0A 5CEXB 1ZV5A 1VADB 4UBDC 2J5LB 1HHHA 2FIAA 5I15H 1CVSC 4NZUL 2RCSL 2QADC 1DE4B 2GJRA 2GCYA 3KNBA 3LKRB 2GFBB 2OMTB 3SQOL 3ZT5A 4KITB 3BLNA 4IGBC 2X4OB 3HFFA 2AP2A 2CE6A 3CX2A 3U0WH 5I6XC 4NQCE 4LOUD 1H0DA 5I1IH 2OTUA 4YPJA 4L3EE 5AW0B 1WD8A 5IG7B 3ARVA 1TU2B 2OMVB 4FN0A 5DTFB 3WNLA 3UPRB 1V7NL 4XVTL 2ZX5A 4R5XA 4UCFA 3KLSA 3L3GB 3FB3A 5F7UA 3L16A 5ANME 5F1IA 4PJ9A 1VGKB 4EVNA 2ZCHL 1DQDH 2AEQL 3KPMA 1KTKE 4XOEA 1X4XA 4ZY0A 4QRPA 2VZ1A 4UV7L 3WO3B 4OSUH 5CEXA 4FFZH 4B95C 3T3PE 2WWKT 2ARJB 4V1DE 1S7QA 4B27A 4I48A 1VFBA 2GIYA 4A2EA 4X4XA 1IKNA 4N5ED 1TETL 1VIXA 2I25N 3LKRA 1G7HB 3MCYA 4N0FA 1HXYB 4WFHD 2ZAHA 3CVBA 3C5XA 4JGJA 4DN3H 3HPLB 3KPNB 3LRKA 5CGMA 1KFGA 1LVEA 2QKIC 1MFDH 5CZVH 5GRYA 1Z0MA 3O8XD 1A6TB 2VJXA 2XKUA 4MXVE 5D2NB 1L0CA 5IG7A 2C4XA 4ORGA 1E4XI 5CEYA 3UOAB 5JYMA 5FUCC 3GB7A 4N87A 4Q58C 5A40E 4IMLA 5JDJA 4DGVL 1XR9B 1IGYA 2EYRA 1LNUB 4Y4HC 5D70L 5I66A 1HX0A 2IDQA 1MF2L 4L3AA 2HT3C 2FHFA 3BEVA 4OJEH 4P45A 4PJ9B 4F7EB 2IALB 4UOW0 4J3VA 2EDTA 1TZHB 2VC2H 2EDFA 1WFOA 1T6BX 3VFUA 1CUOA 1WRFA 5AUMB 1OTUC 4WSGA 3DSNB 5B1JC 4AVCA 3FRPB 5ISZB 5C7XL 4X4XB 4MZIA 3EJQA 3EDJA 4N0FB 2J9AA 4AB7A 4QNPE 5E2VL 5DQ9A 2Q8AL 3BH8B 4PJIB 5CUSH 3VXQA 2ZUXA 1MXGA 4ZFQA 2W94A 5KVEL 3BAYA 3AWEA 5T3ZH 1IYLA 3WKMH 3MRFB 4YOKA 3RWIA 2X87A 3VFNB 1BBJB 2WBJA 5JORB 5CEYB 3RFZA 3F7KA 1YRKA 2RH0A 4IMKA 3N85H 3G5XA 3MCKB 2QVTA 2UY6A 4OZHA 1CBXA 1BWMA 5IGXH 2BIMA 4M7JL 1BFVH 2FT6A 1NAKH 5EG6C 1MFEH 5B1AB 2FB4L 1N6QH 3LKNA 1NFAA 2IALA 5F44A 5GISL 3D48R 1X12A 4JO2L 2P7TB 5MP6L 4XTRC 2KQMA 4AE0A 4F15B 3ZDYF 4IBZA 1BBDH 2ZCLH 4JRYB 4RNRB 5E8OB 4BEIA 4N8UA 3FCTB 3GTVA 3V7ZA 3EJTA 1S9XB 3IU4H 4KFMA 1HQ4A 1TVDA 1PBYA 1ZEAL 5IB4B 4NGTA 1E90A 2AZUA 5DQ9B 1HHJA 2Y72A 2JKNA 4KZEH 2F2HA 2W07B 4RRPM 4OZHF 5JW4N 1P7QD 3MV8B 3NCFB 1GVIA 1H3UA 3MNWB 1LO3H 3FB7B 3BWUF 3FC8A 1JGLH 1KCBA 3U46B 5IGXL 3RWIB 3VFNA 2O5XH 2F8IA 4R7LA 2R1XB 3NIDE 4KNQA 2WHVA 3EHBC 4K5MA 4OGXL 2IANE 1SBSH 4LEEA 2OJZL 4H0GA 3RZCA 3MJ9L 2MOGA 4KMTL 3NZ8B 5E96A 2VDPB 5TTRA 4BUGA 3PF2A 2DDQL 1MOEA 4NS0A 1SJVA 3T0XA 3LEVH 4UEFA 1UH4A 4V1DD 1D5BB 1I7UA 2BSWA 5D6DA 3HBGA 4JRYA 2BIIA 2YNCA 4H0LC 3FU6A 2C9XA 4LSVH 2IADB 4TNGA 3U48A 4EUPH 2SEBA 5I1AA 4X9GA 1AD0A 1FJ1B 4N2AA 3MRMB 5IY5B 1VENA 3ZHDA 3A3YB 3O2DA 2NY7L 4C56E 2A99A 5ABDE 2HKFH 3ARRA 5IB0A 3BH9A 5DJDA 4GAGH 3RUGB 1LWHA 4YMPA 1LRZA 1Y18A 2XV3A 2VLMD 4KI5E 2BS9A 3NJGA 5D8JL 3TIDB 2GE3A 4G6FB 3UGXA 3IETB 1F4YH 1HXKA 4MJIB 3MUGB 5KOMC 3F6IA 4XH2A 1KELL 4HWEL 5E2UH 5HGAB 5ITFB 5ABAA 3F0AA 4TUKL 3T3PB 1NIEA 2CLZA 3TYFB 3KS0H 1PLCA 5E9DE 5HYJD 4GEJA 2EC8A 3LKOA 1Q1PA 1TPXB 3I3EA 3KXFB 3SE9L 3UG4A 4YSAA 2PE3A 1RUPL 1W0YT 5FHAL 4DOHB 1FNOA 2NYKA 1D5BA 4DAGL 4YSUA 4FFYH 5FIEA 2JI1A 1G94A 4DNLA 2X6VA 2JLLA 4WDIA 4IW4C 4XO8A 4YVNA 5ICXB 4UIBA 1CP6A 3BUQA 4M5TA 2HA1A 1UA3A 1Z3GH 1PKOA 1PZCA 5CJ5A 3U0WL 3ZUCA 1OP4A 5I8KH 3FUMA 5EZOL 2XNAB 5J1AA 1M42A 1SJEB 2IANB 1M9WA 2VDRB 3DSFL 3MYJB 3BH9B 3GLAA 4PWEA 4UOQA 5DJDB 3R8QA 5L2JB 3D09A 2R2BA 1OL0A 3RFZC 1F3RB 2PJCA 4IK2A 5HYSG 2YD4A 3C5SB 2VITB 5LXGL 4XH2B 5HGAA 1GS8A 5ITFA 2G5UA 3N42B 1ZG9A 2ZUUA 4J3WA 4NZTL 3B9EA 5HGDB 3LKOB 5FYJD 3D3VD 3P11L 5EOTA 3WU1A 2FBRA 4E0RB 2K70A 4MMYA 1NGPH 3I9IA 4WV1C 3EC4A 1K4CB 1YW6A 1Y0YA 1T83A 1OP5H 5JZ7D 4WDIB 2O5YL 2QZQA 3MV9D 2MNWA 3ZDWA 3QZLA 2EEFA 4AYSA 4EZKA 2CR3A 1GW0A 1PZ2A 2JB5L 4LNRB 4IOFD 2WUUA 3S2CA 4M9OA 5DWMA 1AUGA 3QEHB 3OGOE 3RIAF 4NQVB 4HAGA 2P8LA 5K93A 4Y9CA 3S97C 3HAEH 1SLVA 4XZUA 1NCCH 3VXTB 4FQJH 5D55A 5AZ2L 1TQBB 3C60C 1PLGL 1DJGA 1GHFH 3QISA 1ETA1 4PRAB 3ETTA 2VITA 4R97C 4GQQA 3S36X 1QSMA 2XXCB 1SUJA 4OV5A 4JRXB 1HHIB 4PLJD 2VLKD 2Y7LA 2BX5A 1FNEA 3G04A 4IS6A 4KXCA 1ZO0A 1IAIH 2VZ3A 2GUOB 4OLXL 5HGBA 5TDNB 5JTWA 3IYLW 3FW6A 2IBZX 2VM9A 3MOAH 3LS5L 4YHLL 2Y25A 4J4PA 5EOTB 3RYMA 2G2PA 3TC9A 1UENA 4E0RA 3D2UD 3BKYL 1OF2B 1JS4A 2HJLB 3IJSB 4P2OB 1K4CA 4PG9A 1D9KA 1QSEE 3HR5B 4MDJB 2EVFA 4QUOA 3GJFK 2XWJB 4HUXB 3TNNB 4UILL 5IROC 4NQXB 1RY7B 4OZGE 2Q8AH 1PAMA 4NRYA 4ODVL 2YN3A 4Y2LA 4AVKA 3WFHB 4PM1A 2BNQA 4M5YL 4EQ2A 3QARA 5D9SB 1GYAA 5DHVB 5DGQA 3C12A 1JE6A 2ZENA 2EKJA 2QHRL 1FVDA 2UWEF 3ZXAC 4DO6A 3IWGA 1D5XA 1KIUB 2V0AA 3UZQA 4JM0A 4AQOA 4L2YA 1QO3A 4P48A 1KXVA 4BFKA 1WUZA 3CXHJ 1MRDH 1UOWA 1IGFL 1HHIA 1HS6A 3ZVVA 3GMOA 4GI9A 5F9OL 2V9RA 1K3IA 5H2BA 3WUWB 5D7KD 4PJXF 3PP4L 1NDMA 3MUY1 3WIAA 1FG2A 3MUJA 5AW8B 3IJSA 5JA9A 3GYAA 3BGMA 3HZKB 3QHTC 5HVFB 2X4TB 4AQ8A 2Z7WA 5FC9A 3TNNA 1BEYH 2WP3T 4WI4A 3MGDA 1UATA 4GKZB 1T2XA 3DVNB 4P2RB 1TNNA 3MR9A 4HXBL 1ETB1 4LE8A 5DRZA 4FWUA 5TF1L 3VQLA 1CMOA 1DQMH 2JCWA 5DHVA 4H40A 2H1PH 5EOCL 2APXA 1E8WA 3T2LA 1PY9A 1JV5B 3D7PA 2FL5A 3IJYA 3PRZA 4FFZL 4AE1A 2VZSA 1R3IH 5ENWB 2KQNA 1VKCA 2J1KA 4XXWA 4WGWB 3DI2B 1MI5A 1MW1A 3X13A 4AIZB 2VUKA 4MHPA 2A1WH 4ZOBA 4NGHH 2Q7NA 1CCZA 1S5KA 2OW6A 4IKKA 5HHXH 2VL1A 1CIDA 1KLGB 1IB1E 2OP4L 3KLAA 4I0PB 5AENA 4NGRA 1A7BA 4PJ7A 3V5KA 3SOBL 3JVFC 3KJ4C 4NFBA 2AJ3A 3F7VB 4KQ3H 3BGMB 3HZKA 4O58H 4XP5H 3TBVB 3QXVA 4F1SA 1XBRA 2DKUA 5A1AA 1YN7A 2VLJB 1F4HA 2ERJC 5JDSA 3NSCA 3SCMA 1XIWC 4MB3A 4TVPH 1FZOA 4Z77B 4BH8A 2CJ3A 2VW7A 2XQ0A 3FSAA 1ET8A 1UZGA 1RP8A 3ZDXF 3O0RL 2OXGA 2VDMB 4Y49B 1IM3D 3NJHA 3ZKXB 1K2DB 3QI9C 3W5NA 3QDGD 1JV5A 3IJYB 4HPYH 5KVDH 2D4OA 3JV4A 4JDTL 1JNLL 1UH2A 4EDXA 1TSHA 4Y5YC 1YPZB 2J6WA 5LNEA 4LUAA 2OSYA 5E8DH 3VQ1C 1RJZA 5DRXB 3EZ8A 1CDJA 5D96C 3EJCA 4AKPA 1YGHA 3QZNA 1E40A 4BQ9A 1PYWA 1CVRA 1TTGA 4H1LA 1XXFC 2NZ1A 4B7IA 1KLGA 2ADYA 4ZBGA 5J8OA 3AU0A 1VSCA 3ZYJA 1GAFL 3LH9A 4WV1B 3V5KB 5IJVA 4P05A 2YJLA 1VACA 3BIKB 4I0CC 4ZUSB 2XEJA 4LVNB 2AVFA 1AMXA 5AW9B 4ZK8A 5IV2A 3M17B 1BLIA 2ZJSL 3WO4B 5IVXA 4HIJA 4NC1C 2CO6A 1MI5D 4OY9A 3CH1B 4RMSA 2BSED 4XC1H 5HYFA 4JFSA 3LKQB 4LT7A 5K8NA 3HBZA 4HG4K 2V2XB 4KK9D 3BI9X 2OXGB 4CDGC 3MV01 1D5RA 3UYRH 1K2DA 1U8PB 1MY5A 25C8H 3IKCB 5E4EB 2EE2A 1TEGA 5M94B 3L3DB 4HZAA 4NKOB 4EDXB 3CV5A 4P4KB 3MO1B 4EOWH 2Q44A 4L1SA 5AWNL 2QL1A 3TJHC 4RI1A 4M48L 2BFGA 1P53A 3QC5X 5DZVA 4R6TA 1D2OA 1KIQA 3LPFA 2VCOA 4DYOA 4ZFFA 3DX7B 4KOSA 3VXNB 2FRGP 1BLNA 1RK1A 4FYRA 1FFQA 4MA8H 2EDYA 5SX4I 4NGQA 4ZXBC 2BNUB 35C8L 3QJZA 1ZVHA 2CGZA 2OCJA 3QJXA 2ZP0T 4LPCA 3IFOA 4EI5D 2JKSA 3TTYA 4N85A 3HE6D 4WI0B 3VACA 2BHZA 3ZGHA 2IGTA 5CCKH 1IGFH 1TEFA 5ICZB 3L5JA 4NUJA 2VKWA 3EOTH 5CINH 2ZUTA 3S37H 5KZCB 1I3VA 1SFHA 4ILDA 1MVYA 1U3ZA 3QIWB 4ENZA 2F7PA 3SD2A 1RUAL 5AKSA 5EU7C 1K3ZA 2GTZB 3ISXA 3FT2B 5EPMA 2V2XA 3VSVA 4ONWA 4K5OA 2ED7A 1VFAB 2EO1A 3FOMA 4JL1A 3G5WA 2QQLH 1U8PA 3NG5A 3IKCA 2X3AA 4YDNA 2AJUH 4HNWB 3L3DA 5F48A 1QLEH 3PFOA 5CS7A 4OD1H 5CSGA 2FR4A 4J39A 4UOZA 1FZMA 3I6GA 4XVUD 2HSIA 4NQTA 1GZQA 1BOGB 1OP9A 4ZFFB 1MCFA 2CK0H 5F6IB 4P23A 4JJOA 1A7QH 3R9FA 5DT1H 3PDGA 2BNUA 4R7NB 2V8HA 5C3LD 3JTSA 1A6VH 1KEGH 4KO5A 5I30H 1IM9B 5A2JH 3QFJA 2EACA 3L5WB 4H0HB 4S1RL 5ICZA 4OC1A 2X4PB 4QYOA 5EIVA 4JKWA 4NUJB 5EEZA 5AOJA 2XPGA 3TZVD 3C2AL 3U6XS 4M8UA 4ETYA 3WFEL 4R4BA 3FHQA 3LNGA 4I5BA 3W3BA 4C2YA 5FOJA 1J9SA 4BDVB 2MMXA 2NY6C 2YD2A 4U3SA 2VXQH 3POCA 4OT1H 4WUUA 2ZONA 2Y24A 3SZKC 4FABL 1BYNA 3TX8A 4X6CF 1MW2A 2DIAA 2J4WH 3V4UH 1ITBB 4FKEA 1IKNC 2EK9A 3GMMA 3NCBB 2BXYA 1JK8B 1QSFD 3V4PA 3FT4A 1AOZA 3TZVC 5J9PB 2QV4A 4JZNA 4WKXA 4U9YA 1TCRB 3JZ7A 2GSGA 2CUAA 1XD1A 3CUPB 1UWGH 1W0VA 4L8BA 4QDGA 4YSCA 2XZCL 3SKNB 4JX0A 1NGPL 5IFHH 3MRGA 1UURA 3UYPB 3PV6A 1FVCB 5IWLA 2LV4A 4K9EC 4Z3EA 4GS7C 4C2ZA 5EBWB 1INEL 1FFOB 1GGIL 2G0LA 5JQ6L 2Z4QA 4P2OC 3ZRFC 4WW2F 3SE6A 5F7MC 3VFTA 1AGCB 3VXRB 5LXGH 4JRLA 5J13B 4XNYL 3BKCL 3C5JA 3KBHE 5DI8A 3L3OC 3V0WL 1E4XH 1DBMH 3OXRA 1YEIH 4X80H 4IU2B 1KXQE 4WWNA 4XX5A 1CS6A 1WDAA 3KWTA 1FL6A 4BKLB 5BMFL 1TF9A 4LQFL 1I85A 2X70B 3U7WH 4EWTA 4H6ZA 2AJ6A 5JIQA 2D9QB 3L4ZA 2WPWA 2PKDA 5D1XC 1L9SA 3WBDA 1P4LA 1QKZL 5IQNA 3HAEB 3X17A 5KEZA 2DF3A 2PYFA 3OHXC 4H6UA 2IEPA 4A6YA 2OR9L 3RVTC 2G3MA 5EORH 2G60H 5I1JL 4BFJA 3O2VH 1NCNA 3O3BB 1P7KA 1B2WL 4JWPA 2LU4A 4WIQA 4M6ML 3IBEA 5F71A 3UACA 1O75A 4QTFA 3G6JE 3U9PH 1EZSA 3H8NA 3ATBA 1DL7H 4A66A 2PJAA 5F7EL 5C0EB 1QLFA 4TQHA 3BVXA 1IGCL 2XZAL 3QW9A 1I7RA 1SY6L 2VZUA 5LHDA 2X41A 4CGMA 3H2QA 4OGZA 3NAAH 3UERA 3Q0HA 1LO3L 2FWOB 4WEUD 2IAMB 1XGPA 4QRSA 4JO3H 4ICXA 3B7RL 3ZKSD 2X70A 4YUEH 1J1OL 4P46A 4G9DB 1NCIA 2HLFD 2DYSB 3TJPA 1MPAL 3ARGB 5IEKA 5A6MA 2YUZA 4GT0A 4AYGA 1W72A 4A6YB 5EC1B 4NN7C 1ZLIA 2HVKB 3N1QC 1RSFA 1DFXA 2BK8A 5ETUA 2OOTA 1IKFL 4PRPE 3ZE0B 3W0WD 3FRMA 2JB6B 3KPQB 1PU9A 2O61B 3FSZA 2D8KA 3SE3A 1YMEA 1DQJA 3V4VL 1AGDB 2ZYIA 3ET9F 5KBKA 4APQA 1I7RB 3ES6A 1UKQA 4RAVA 1CBVH 2FWOA 4OFDA 3K2MC 1IBBA 3D08A 3KWWA 1SMDA 2IAMA 5AW7B 1AKPA 1N64H 2CO4A 4ZY2A 2BOLA 4JPQA 2F5AH 1AGEB 5KSVA 2E9IA 1I1DA 5IR1B 4WFGE 5DEJA 5E2VH 5F7WC 3INUH 3MRIB 4LCWA 4WCYL 4PUBL 3HC2A 4G9DA 4LEOA 2IPUG 4MAYD 3GMPA 4YWGL 1PZBA 3D87B 3STZB 1QEWA 3LH8A 1FAIL 4I3SL 3BH4A 4YGAB 4FD5A 4N2EA 5EC1A 4HIEA 2AK1L 2WJ5A 1EZVY 4BGDA 2YGWA 3QUZA 4HCGA 3PAUA 1GW6A 5FK9A 4TSBL 1KJMB 1HWGB 3MRRB 1PKQA 5CEZD 3APFA 1PG7W 2F19H 4J23A 1DANT 1TZGL 1BFVL 3KPQA 4G7RB 3GSWA 3QORB 5DJYB 2Q2EB 2O61A 4DNCA 5KYYA 2FJFB 4GM5A 3NIDB 1FDLL 2ZOOA 3APCA 4EUPG 4PJDB 3ARTA 3MDJA 5SWZD 1I9IH 1ZV9A 1IJ9A 5F0LB 4HHWA 3RWGB 1AQ8A 5DHMC 1P2CB 4GSUA 3DUUA 4M6MH 4ECNA 2BEIA 4X7SH 1G7IB 1TJIL 2XQYK 3HNVL 1U0QA 2CA3A 1YLOA 2PVWA 4MCPA 2EADA 1VAHA 2C4FU 1U8IB 4HUWA 5C8JA 1MCEA 4KY1H 5KS9A 1SQHA 3SDAA 3DK0A 3EO9L 3RWFB 1ET7A 2G2RA 4PS4H 4JPWL 1JNHB 3P77A 2OZ4L 4NP4L 2AXGB 5MEOB 5GS3A 1I12A 2XXFA 2ZUQC 4LQFH 2WD0A 5MEQA 3VWEA 3HMXH 3HC4L 4TL5A 1QSRA 5AD0B 2LVCA 4CC4A 2XBDA 3RUGE 1NJ9B 1R17A 2EINB 5FKPA 1PKQB 3CT9A 1KTRL 1NIDA 3WY1A 3S48A 2OLDA 1MCIA 2D4FA 1DFBH 4BZ1L 5IREA 4OUUA 4GLRH 2ZWLT 2OJEA 1MJUL 3NUKA 4G42A 3KCPB 3K3QA 3SGEH 4X4KA 2X1QA 4PJDA 4W9FC 4PSPA 3WTWA 4I1PA 4U1KB 3OC5A 1M9SA 4PJEB 4B9FA 2WXGA 4QR7A 3HG1A 1EQWA 2XTJD 3VDCA 1YDPA 1GS6X 4JW3A 3NFNA 4ZPVA 4NHUA 3ATEA 3O6ML 5C8JB 5IFJA 5K59E 4L9LA 3RX8A 1O6VA 3FFCB 3R0MA 4JRXD 5D1ZD 2ADGA 5MHSD 1TTBA 4NIKB 4KAQH 4BSVB 1JNHA 2M26A 1NINA 3FU5A 3NBNA 2ZEEA 2YFNA 2Z35B 4X4ME 3MV9A 4RWHA 4W81A 4AYID 5L6YH 1BBDL 4ZYQA 4N0RA 1JV2A 3TGXA 3S34L 2WXHA 2DJSA 5FKPB 3QHZL 2F53E 4Y9BA 3B8YA 1I85C 2CO7A 4OQ1A 3TESA 4OUUB 5DMIH 1T7WA 1YC7A 2OJEB 4G42B 4A7TA 1CO1A 3D7HA 2NQCA 1FAIH 4I3SH 3ZT6A 2RQ8A 5C0CB 2HG5B 3EXNA 1IBGH 3KW7A 4U1KA 3WTVA 2HMID 2DM2A 4CS0B 4KZ0A 2OSLB 3V6ZA 3HG1B 4HMEA 2BSTB 2VZOA 1S7TA 4GKOA 5ITBL 4ZPVB 5CM1A 1MUJB 4A2ZA 5KVGH 3LS4L 5ESAB 3LS4H 4S1DD 3V5HB 1JYXA 2JKIS 4QNPF 3FFCA 2F68X 4XRCB 1A6ZA 3X14A 4XNBA 3QIUA 4ABVA 4F9VA 1DO6A 4L0YA 4X6DB 3O4OC 3EO1A 4QRRB 2GK0B 2C26A 4QHNA 1X9QA 3CQPA 1PD6A 4X6CE 1OE3A 2RFXA 5CLYA 1MCWM 5E6ID 3PUCA 4UFVA 2CO7B 2Z4TA 3ZE1B 1H6EA 2OXHA 4U1HA 5EHFA 2ICEA 1F5WA 7CGTA 1U6AL 1WF5A 1CE1H 2VWEE 1S7FA 1B0IA 3IF1B 3MRJA 4PS7A 2FJGA 1DANU 2VM4A 4DGVH 4MAYC 3BUBA 3MREB 5F9AC 4CBZA 3PQYB 2VN4A 1DQKA 1T89A 3HC0B 4N8VA 2MNUA 4MQXC 1S7TB 3B37A 3CXHK 4GFTB 2M8XA 2QADB 4Z0BL 2Q6WA 2C1PB 3F8UB 3IVKA 3DURB 4HW6A 2B4DB 2Q43A 3TEYA 4DZ8A 1WBXB 2OR9H 1J7VR 5TE4H 2FHBA 3L2MA 4YHPA 3X1BA 3RWJA 2YGNA 5M7QA 3QIUB 1YN6B 4KJQC 5C86A 3CC5B 3BZEA 4UQAA 4H8UA 5AVQB 5K1VA 4X6DA 1P6WA 2X40A 4QRRA 1GGYA 5C0GA 1JSYA 1IAOA 1ON0A 4MHHI 2E4FA 5ACLA 2K8MA 5GRJH 3CZKA 4CU6A 2CBTA 5EU5B 4U1HB 1JD9A 2WXQA 5FAAA 4AG4L 2DW5A 4HIPA 3SDCC 3HVNA 1I1RA 3BDBA 1JD7A 3HB3B 3PWPE 4KUCD 3LH2L 1YNTB 1LCPA 3JQOB 2IWFA 1KY6A 4KJPC 5DUPH 5TQ2L 1A4JB 1KTCA 2R15A 3VFOA 5F0MB 4QRUB 3NH4A 3T71A 5IFAH 1X5LA 5CZVL 5B21A 1SYVA 3DURA 5H86A 2NQ3A 4KI5C 1X7SA 1N4XH 3LIUA 3WFBL 1G9EA 3BI0A 4ZUVA 2EH8L 2YXMA 4FD0A 4I9XA 4KPHH 5HJBA 2HXAA 3FSWA 5FLUA 3P2HA 4OCLC 2AFOA 4AEIL 2WCSA 5C0GB 3TJHD 1ZIAA 3WENA 4FQIH 4QRAA 3KYOA 3DV4A 3THML 2XFGB 1VZIA 3UMNA 3UTTB 1FFNB 5IT2L 5F70A 3DNSA 4ZXBD 4LPUA 4FJ6A 1I8KA 1L9MA 1ODAA 3FVLA 3QS3A 3NIFB 3FQRA 4NOBA 4O2CA 5GRZA 4PRDA 2FQFA 1UWXK 3R8BB 1FO0A 1QUNB 1EAQA 1FNSH 2ITDA 4IYKA 4D0CA 3J8F7 5CKAA 3VFOB 5L7XL 2DWXA 3DBSA 3UBXG 4MNGE 1LO5B 1O7SA 4LCCC 2MH4A 3M7OA 5FHBH 1XF4B 1SYVB 3UC2A 3QCVL 4OIWA 5D4QA 3R9GA 1FCCA 2W0FB 3C5ZC 3LZPA 1ZLUK 4L9DA 1N6VA 2NY0C 2XRAL 3I85A 3F2LA 4OJDH 4ZUWA 4CJ1A 4MRCA 1WK4A 4W9ZA 4APQD 5D4IA 3QQ4B 4PW9A 4JQXA 2F6AA 4OH2A 4B10A 1E6JL 3PGPA 1I7TA 5TE6H 1L7TL 5LGHL 4M5ZH 3CPXA 3JBG7 4ZTEA 4GJTB 4QXGH 3QJFB 2UZXB 4GKSA 1X7TA 1VFMA 4FL4C 1OCOB 4OI9A 5HDQH 1YK3A 4YXKL 4PK3A 5C09E 4OZ4B 1RO5A 1ERNA 5JXAL 2BSCA 2EDLA 3WDHA 2QQKH 2YFOA 3LN9A 2X4RB 2A9NH 2NT1A 4RDBA 4EN3D 3P4LA 4PR5A 1JZ7A 5CILL 3S37X 4TSCL 3VXMA 4F27A 4OAEA 2AJUL 4PV8A 2Q86A 4D0CB 4W9GC 1WIOA 3RL2B 4S1QL 5BXFB 1G9HA 2CGYA 5ABZA 2F54B 3IMBA 1WV7T 2B1AH 1S7RA 2OX5A 3D9AL 5DO2C 1AZVA 2DLFL 1FL5A 3HLPA 5IW6A 1Y0LA 2UXTA 5HI4D 3DX8A 3FCBA 4UZSA 1GGUA 1J1XL 2Y7QA 3ILQC 5GGQH 4FTVE 5CHNB 4PV9A 4ZUWB 3LH2H 4H26A 5AVRB 5KW9H 4PBWD 3IIBA 4IIQB 4ZJ9A 4OIBA 5CJXA 1F4AA 2FLBT 4M5YH 2I9LA 1P5UC 1KIRB 4KRPD 1BFSA 5HHMB 4F3FA 1E30A 7TAAA 3BWUC 3D30A 3ZQXA 3LRSA 4CAXA 4Z3JA 5DEZA 2L7UA 5ADPH 4CVXA 3K1KC 1VFUA 2EC9T 3GZQA 4P5KB 3UP1A 3BP7B 3IMRA 4MNGB 1WP6A 1KGIA 3C8DA 5GZOC 3GMRB 4OD2B 4WW2B 1A4KA 3BXNB 4YHYC 1Z0NA 3N91A 4CYQA 4CRYB 3FO1A 1QFUH 3V5DB 4BINA 3IDUA 4B0MB 4NJAH 5DMKA 2DWDB 1IU1A 2Q86B 1M3IA 2EKSB 1BZQK 1MNUH 3NABL 1EWHA 4LL1A 5I5JA 3A6CH 1UASA 3PV7A 4Z3GA 1GCYA 1G1CA 3BAKA 2NUPA 3FQXA 2A9ML 5BZZA 4MX7B 2ILLA 4GBXB 2NYQA 3DX8B 5DVNA 5AVUB 1MZZA 3IDMA 5CR1A 2WXPA 3UTPE 4H26B 2UWEE 3MBEB 4KKCC 1S7XA 1Z7JA 5IB1B 3BKCH 4QGTA 5JW4R 1WSST 2BOCB 3CDGB 4WUUD 1IICA 3DVFA 3LRSB 2UX6A 2ADJA 2Q76B 1R46A 3IGFA 1JCKA 5HDOA 1L9NA 5HYIA 3PWUB 5L0QB 2DYPB 3VYNA 1A4KB 2BSDA 5JR1H 5I5RA 3TVMC 4KUCF 2R0WL 5LN4A 1OPGH 3V5DA 1SXZA 4X5WB 1F8TL 3N41F 1GKOA 4FMVA 4EIZC 3W9DB 2DLIA 4LDEB 4PJAA 3OJMB 4KKQA 4MX7A 1OSPH 3CPUA 2FQDA 2PRBA 2VLRE 5DS8B 1L7IL 1L7IH 3PWPD 3BN9D 3MBEA 5GS1B 3M1BB 4UZUA 3GNMH 3NIFE 1A7RH 4HS8L 1HSBB 3GSRB 3HZMB 3QA3B 3BVTA 2BOCA 3CDGA 4OZGB 1G6RB 4XPFH 3RU8L 2F53B 2X9YA 2JDCA 1NCAH 3MNVB 3ZTDC 1YC8A 1OAUH 3ILEA 1A6VL 4J7RA 5ECJE 3SDXB 5IB5A 3PWUA 4FQPA 4AVBA 4JDEB 1QTYT 3ZO9A 1KG0A 1E6JH 3MBXH 1P5UB 3SHPA 2WLYA 5E8NA 1NDTA 1ZE3H 2HT2D 1TLMA 1IB5A 2OYMA 4UM9A 2PW1A 5BV7B 4EIBA 3AM8C 3BP4B 4YXLH 4KRMB 4WW1A 5IP4A 4GRLB 1F11B 3QCVH 4I18C 3ZDXE 1S7NA 1EXUA 1KB9J 4R57A 3FQNB 5E99H 2PCPA 2UXGA 4X6DE 3GXMA 4XPFL 2MHAB 3S37L 5LQBH 5DJ0A 2AEWA 5LYFA 4JDVA 3W56A 5SWSB 4XPDC 2P45B 3ARED 1DVXA 2AEPL 2O4EA 5GZOA 4KKAC 1BPLB 1R24A 3VD9A 4MZ3A 1YYCA 1TKFA 2H2PD 5IB5B 3SDXA 4UILH 1OSPL 3PWPA 4L18A 2P46B 4OCYH 4X5XA 2HWZH 4L4TD 4E42A 1Q9OA 3LEXB 4PVBA 1W8NA 2CR0A 5G22A 4AGPA 4H25A 4QTIL 5CR8A 4FG4A 2H0JA 6CPAA 2ZE0A 4AJVA 5GS2H 5DMJB 4WFED 3RPIA 5LNDA 3FU7B 5E51A 5BRZA 1FV1A 3QXDB 5F1SA 1YNLL 2OKMA 1J12A 1HAUA 3BYYA 4N2MA 1OLZA 3MLRL 4XC1L 4R8WH 4EDWL 2NNRA 4PLOB 4HJGB 4J2QA 4R90H 4U1JB 4XMTA 3IFNH 3DBXA 1B9ZA 4FXTA 1A2ZA 2WXOA 3IFPB 4UM9D 1C5DA 5I1CH 5LDSA 1OB0A 5CIPB 4JNXA 3NN8A 4LBEB 4FQ2H 4FLQA 2J8UF 5FYJU 5D7SH 3BUYB 4TUOB 4YDIL 5T1LA 3WEMA 5B1BB 3KH3A 5F7HA 4EMEA 4TSCH 4HKFA 1IQWH 4DWHA 1R5WA 1HZKA 4YGVB 2AQNA 1I1AD 1NEUA 1ZLEA 4V1DA 4YZFE 3I6KB 1FH2A 3NZHH 4F7TB 1QLRA 2ZF8A 3UBXA 4E42B 4PRIA 2CF4A 3EKCA 2H0FA 4K5LA 1MNUL 3IEHA 4HEMA 9CGTA 4JS7A 5AFAA 1Z9PA 3TXAA 4F6AA 4CVZB 1KENL 1BAWA 2UUDK 4NO3B 5EBMB 1NPNA 2XTJC 4ISVA 4ZXBA 1NBZB 5AOLA 4AKQA 3MUZ1 3PWJA 2IJ0C 1F45A 3GIUA 1N2RA 3RAJL 3F83A 5C0NC 4X4MA 3BZFB 5D5MB 3NE7A 1U8QB 2D4DA 4Y19A 1C8PA 3OKYA 2EVHA 3RJQB 3O0LA 3TBTA 4NEXA 2Q0YA 3V8IA 2GC4C 1WS8A 4N4YB 2QGDA 2X28A 3GZPA 4C59B 2R2EA 3VATA 3DMMA 3S88H 4S0HA 4DTGL 2LR4A 2L3BA 3JVNA 1SMOA 1JUFB 3UBXB 2A6KA 3W81A 4OGQC 3NMEA 4X6FA 4XP1L 5HHOD 4R83A 4AL8C 2PJ2A 4EUPB 3OR7A 3X3FH 2X2JA 3G9VA 4DK6A 3MACL 4ZW7A 1J9CT 1E28B 2UZIL 3CFTA 1SY6A 3T5WA 3BDYL 4H7VA 4L05A 1R5VB 1T7XA 3GBEA 2HQYA 4WHYG 1DVFC 2M2DA 4OFYD 4Y1AE 5DUML 4NZTH 1XOVA 2WB1A 3LAFA 3TBTB 2PXYC 4POYA 2QVMA 3F6JA 2VXTL 3P73A 5LLIC 4WW2C 3QEGL 4M4PA 3MLYL 1AIZA 2R2HA 4XB3A 3WN5B 3MLVL 1CICB 5D7LD 4N6QA 5DWPA 5KVFH 1XE4A 4E2OA 1S78D 2DEYX 1CFQA 3BHXA 1HSAA 4OJFL 3WOVA 5HYQB 4K3NA 1DEEA 1A4CA 4G1EB 2HP4A 4QHUB 2IQ9L 4OM0L 4QXTA 4W1TA 2WSAA 4X6FB 3MKGA 43CAA 3D8MA 4YZFF 1QSZA 2J8HA 4AGNA 4C56B 3L45A 1J8SA 3FECA 1ETJA 1YLEA 3WE6B 1OB1A 4N90D 4CW1A 4QKTA 3EJRA 1SNRA 4ADIA 1E28A 3LN5A 4CN4A 1S78C 5CD3A 3F7QA 3VTMA 3ZPDA 2FYVA 5CJBA 3CLFL 1P84J 2DQJL 3LV3A 4DGIH 1KCRL 1H19A 4O2EA 1AKJA 1RZ8B 1A1OA 5AGEA 1CDYA 3JWDL 2RCSH 1JWUA 1T04A 2X9ZA 2C8NA 4ZNEE 4JZOB 1TR7A 2AV7A 2J21A 4JREB 2ODFA 1QYGH 1ODUA 2OJZH 1TZGH 2DF5A 4OCSH 3WN5A 3QK0A 1GZPA 1OAQH 1BGXL 1GYUA 4FX5A 3HS9A 4WTZG 2CPUA 3QP3A 2BHYA 1DVQA 1UD4A 1HL8A 2J5LC 4ZNCD 3M1CA 4MCMA 3CVHH 4KH9A 1EPFA 2IC2A 4R2GB 3ZUNC 3SYOA 5L9DH 1U8LB 2NY4B 5I9QC 5IJKA 1A7PL 2EIDA 2J4WL 3WSQL 5FECB 2LU7A 4JFEE 3MV7D 3PP3K 4LEXL 1Z32X 1PIGA 2OSXA 4J3TA 3JWNH 4UQ3B 4HWBL 5CD3B 1JPGB 3DVGB 1T20B 1B9KA 1PZUB 1JHTB 1QSVA 1TCMA 4PW4A 2VBQA 2F74B 1F0LA 1KUYA 4M7LL 5BOPA 2HZHA 1F6LL 1I9IL 2VLKE 4YHIA 1A7NL 1KWMA 1E5UI 1JWUB 1T04B 4M6OH 4HJ1A 4J1UA 4WU5B 4X99B 3BD4A 1U95A 2VZZA 3D06A 4DPAX 1TJHH 3N04A 2DWYA 1NBVH 3B43A 5TE4L 3P4OB 3HE7C 1GZPB 1N68A 2J1XA 3MU3A 5EZPA 5L88H 4P59L 1RUKL 3ZQ9A 4MQSB 4TNWF 4HJSA 4S1SL 4B5EA 4KUZH 2JXMB 4LKXB 1IFHH 3DGGA 4NWUL 1T22A 3DXAA 5C3IA 5IJCC 4GS4A 3FQWB 4DP0X 2Z93A 2R69H 4HH8A 5AVTB 3Q5TA 3QIWC 1HZLA 4WTQA 3T2QA 4PTTA 1K8IA 3BPNB 3C09B 3WIIL 2Y7NA 5C6TL 2EE3A 3DVGA 1Y7RA 1K9TA 1QPXA 2J88L 3OKOB 5HYJB 4Y16D 5DJCB 3DO3A 3O4LA 3JWDC 3MQIA 4PYGA 5EO0A 1JHKL 1E4KC 2COQA 3VFGL 4YWYA 1JZHA 4J1UB 4WU5A 1UC6A 5F7EH 3P9LB 2OYPA 3HG3A 3L3JB 3L5XH 4FG2A 3DJRA 3F05A 2QDVA 3SDXE 5KVEH 2PJ0A 4RQQB 4UV7H 3KEHA 2IV9A 4RIRB 4UT7H 2HFTA 2AEIT 2W5PA 3O3AA 5LAXA 1AQHA 1KMGA 4XNAA 2DBLH 3AG1B 3CFEA 3MHZA 2R1IA 2CUMA 3ZL4L 1T66D 2JXMA 2GFQA 1NIBA 2XDHA 1CX8A 2W65B 2PXYD 2JJVA 2PSWA 5I1LB 2VE6A 3KYKL 4O00A 1RZPA 3RY5A 2HTLC 3UDWA 4XBPB 5BRZE 5KG9B 4TULL 4YDKL 5KSUB 1T7VA 1FZKB 3VTAA 3MGTA 1B4LA 3E7JA 3OX8A 4AI7A 3FMGH 4IBVA 5ESVA 2D7OA 2ITCA 3U2SA 1QSTA 4WWKB 4ONGL 3RTQB 2HT4D 3HC3L 4PJFA 2CG9X 1LGVA 4XBEH 2AXJA 2O93L 4KHXH 1D5ZB 3FO0H 2AV1B 3ZE2F 1ORQB 3TN0C 1CL7H 3VI3A 2JLPA 3HN5A 1HCFX 4WY7H 1H5BC 2B59B 3SE8L 2D0HA 4EIUA 3WFCL 1S2EA 4PRPD 3ASOB 4EMZA 3ZKQD 3OKDA 4IK6A 3UBFA 4NQSB 4X6CB 4PXBA 2E6PA 3CMGA 4K23H 4B3EA 1MCQA 4M7LT 3RBSA 1GIGH 1OAUL 1HHGA 3KPRA 4JDTH 3Q2VA 1TETH 4M5ZL 4QVTA 1PY4A 4J3OF 4YHKH 3LPWA 4XCEB 1A14L 1XSOA 2YRBA 2VDPH 1BJ8A 1TVHA 2E6JA 4AGMA 2G9HA 4ZAKD 3LQAC 1CGYA 2X1WL 4FCAA 5BV7H 3CFDB 4Y4FB 1KBWA 2GJ6E 3MGTB 3GK8L 1T1XA 2VERA 1M4IA 1YAZA 2F58L 2DKMA 3IU4L 3BOVA 5FGSA 5EEYA 4MS8C 1KCVH 2YSSB 4AC4A 3RTQA 1E50A 3ULSB 1GY2A 2PYEB 3B7TA 1D5ZA 4J3XA 4PS3A 3SJVD 1N0XH 4LU5L 3SQBB 4IAVA 3MLYH 4LLVB 1QQDA 1ADQL 4OC5A 4G7VL 2QPDB 1CB4A 2WVSA 4KKLC 2OZ4H 4NP4H 3GSUA 4FC3E 3E8UL 5GS0L 3BEWA 1U30A 2N3JA 3QDGA 5FR3A 5HDRA 5AZEH 1KGWA 4FOMA 1S7VA 2AJZB 1HEHC 3BPCB 4MMZC 4XP4L 4XCEA 3TEUA 4JY4B 5I8OH 4DKFL 2DIJA 3HHSB 3WIFA 3N1MC 2ZXAA 3FNKA 4L1LA 5C0IA 2VXSH 2XG4B 4KWUA 2DQDL 5HJDA 2G3TA 5L0QC 4JAMA 4Y7OC 4HFUH 1X5XA 1KPRA 4NFRA 2WGXA 2ICES 2H8PA 3N42F 4ALAH 1SMAA 1UWEL 3H4HA 4PVLA 1MWAB 2CU9A 4UDUB 1BXVA 4A1RA 4BQ6A 1SF5A 5B1CA 5KSBB 2I3CA 1NFKA 4AG7A 1QQDB 4S1RH 4LSPL 3VGHA 4NPJA 4TNWK 1JRHL 3FUEA 5TPWL 1VHSA 2YPLA 1ZK9A 3RX7A 3STLA 2BFVL 5IV0A 4Z7IA 1TQCC 2PNDA 4WJG3 1MN4A 1OE2A 2VO8A 4BA0A 3JUYA 3MOBL 4MWFA 4Y2NA 2CKBB 4UDTB 3UCRA 4RFNB 4YDJB 2YGQA 1FN4B 2ZUVA 3AS0A 4GUPB 2F18A 2GJPA 2X42A 4XX1E 3UTTD 2VN3A 4F5CA 1BD2A 4HPSA 3E1F1 4M1GH 1J18A 3C6LB 3CFNA 3UBGA 1IRAY 1TYRA 4B5PA 2XYCA 3DGDA 1JIBA 3V4VH 4DN4H 1TOXA 2XG4A 2R0LH 1OZTG 2YAPA 1A1MA 4HJIA 2GB2A 2A7BA 1J1XH 2ZKHH 4G6FD 3IFLL 4LKCB 5IW3A 2C3WA 1BECA 4L48A 4AVHA 4QTHA 3D85B 1F97A 3UO1L 4YFDB 3V0HA 4XO4A 4FQCH 1YQVH 5E6SB 4Z7VB 4HD9A 2YPLB 1KCLA 3BGFC 3OQ3B 4FQ2L 4HK3J 2C1CA 5I8CB 3V0WH 3QYCA 4JFOA 4RRPG 4MFJA 1U42A 4PRBA 1XGQB 1K8DB 4L1DA 5GRUL 2LVEA 2CKBA 4BKSC 4PGBA 1OQXA 3AY4C 3OB8A 4QCIB 3A23A 4HIXL 4TRPL 5DZNA 1EERB 3IRCA 1SF3A 2VZTA 4NSQA 4LAJH 4POZD 4IOIA 3DJSA 1KUVA 3L3HA 2KH2B 4WHTA 4MSWB 5IFHL 5KSAC 4LFHD 5KBLA 5IUSA 3WUWG 4PWIA 4ATWA 1NL0H 4UINL 4Z7QF 4LEBA 1S5HA 4G1MA 2QQKL 2XTSA 2ZWNA 4XCYB 2MQ0A 1JZJA 4H8QA 2VYRE 3WJLC 4BJLA 5D72H 4LFHG 1DTUA 1KLFB 2JJSC 4IRZH 4AM0B 4HWNA 2KPWA 4Z7VA 1WS7A 3NCEB 2VXQL 1FBIL 2G9KA 5I8CA 1ID5I 3PYCA 1MEXH 4N1EA 3NEOA 5FM5M 2WTOA 4R96B 1E9PA 2PPAA 2V5SA 4QRPD 4XHQA 3C5ZB 3SB3A 4AUJA 4W4NA 4G7VH 1QFHA 3KQZA 1XCQA 2ZP8A 2CGRH 3I74A 4J12A 5AKRA 1F90H 3LVEA 4AENA 4C83B 3T0ED 4QOKD 3G6DL 5B7MA 3LOWA 3LYRA 4HEME 5CNHA 1UJ3C 3Q1EA 3RWEA 1FE8L 2VR7A 5AG7A 3WY3A 3KDMA 5I1KL 1NAMA 3WJMB 4CN6A 5I2IB 3KGTA 4HH9A 3T8XB 3PDOA 4G71B 1JG9A 3VQMA 3EOAB 1JGVH 1XH2A 1XGTA 2ZYRA 3LEYL 1MJ9A 5E00B 1R3LA 4OF3A 2YO3A 3MRQB 3L7FA 4TPRH 1BEYL 1AHWC 3MRDA 2K9UA 2YEVB 5C0AE 5HYSA 4KQ3L 3QWQB 1VESA 3ZW3A 4YR6B 3QHFL 3NDYE 1MLCB 2VIRA 5CN1A 5AL0A 5EIIB 4JANA 1FFTB 4OGAD 2DICA 2MCG1 1CD1B 1WPCA 4G9FA 2DY2A 4EI6B 5IIEB 4P3CH 2D2OA 4KGJA 2R9HC 4OTXH 1G1YA 3MGAA 5AAWC 5E5UB 1Z9UA 3D69B 1NDGA 4UAOB 3C5ZA 2J7LA 5IOPA 2GUYA 1MCDA 2BCKB 5JXEA 2V6HA 4ICWA 4C83A 1HDMA 3VXOA 1I9JL 1J10A 1AANA 1GYTA 4AC2A 1ICTA 1O0VA 2YOCA 4FJZA 4XVOA 4B11A 3BXMA 3FBKA 1XF8A 1JFQH 2CKNA 4JJ5A 1I1FB 1W9XA 2VRKA 3NEXA 1NFIA 4GW5B 5CSBA 4KVME 2EIKB 2UX7A 2R69L 5GSRB 3B3VA 4K9EL 3H56A 3MRDB 2BOAA 5HYSB 4D0DA 3CSYB 3CMOH 4IOFC 3RWHB 4O23A 2IXQB 1PFOA 1IT9H 3EHBB 4UAOC 3GI8H 4LSRL 3N55A 3WXWL 4EI6A 2WZAA 4JHAH 4HFWB 1O5PA 4LLYA 4JFHE 4PI2A 4PLKC 4YE0A 3SYPA 2ATAA 3VARA 4YL4A 1WA2X 3CN0A 1A3ZA 1TJXA 3FYEB 4OZFB 5IOPB 2CAKA 5CEZE 3BUIA 1SJHA 3NH7H 1P7BA 3AXHA 4GP4B 5BUAA 1GMEA 3RVUD 1YLBB 1YY9D 5EEUA 3APNA 2FSEB 1PVHA 2PWEA 3R0NA 4ZX6A 3D2MA 4GP8B 2H7WA 1X4ZA 5LN8A 1ZG7A 4B9CA 3GBMH 2Z7ZA 1VB9A 4GW5A 3CCHA 1CYGA 4AUUA 1QSED 4OUOA 1ES0B 3S4SG 4FLSA 5D4HA 3ULUL 5FCSH 3VFWA 4H20H 4AH2B 5KVGL 1A5FL 4MJ5B 3RAMA 3ZHLA 4ESKA 1EH9A 3OWCA 4LLWB 4YXKH 2OYKA 2YD7A 3EF4A 2VDOH 4ZD3L 3LSOA 4YDLC 4FD4A 2K3TA 1P4BL 4JFFE 1IC7L 7PAZA 1MJJA 1KBVA 3F8KA 3RDTC 1H15A 2E74C 5T5NG 1J0YA 5J57B 4E9LA 3V8CA 2FIKA 3K4ZA 3TA3B 3LODA 2H6OA 2XWEA 4Q9RL 4XPBL 1G87A 3ETSA 5F3FA 1KCRH 2JELL 3LXBA 3CIAA 1S7SB 2C7FA 1GC1H 4ZMAT 2VAJA 2FNWA 1ZT4B 4XN4A 2P6EA 4IF5A 4IOSD 1ASOA 3V9FA 3EO0B 4AEHH 4HIHA 4ZSOA 4BMHA 4EVNB 4PJ5D 1TVBB 5IHBA 2CM6A 3SJEA 4XC3H 1ORSB 2A83B 2J1ZA 3Q3GA 4P5MB 2I32A 2QVIA 4LCYA 3C6SB 1XCXA 3RILA 3T4AA 2XJKA 4TTDC 3JTBA 4OM0H 3WNIA 4KRNA 2F7RA 2Q3AA 1R43A 2BSSB 5D1QD 3JT0A 4LLWA 1HHKA 2EH7H 4JDZA 3DVIA 1G84A 4P5TC 4NRZB 5B1KA 1S60A 4O9HH 2JBKA 2YD0A 3V6OC 2YAMA 3ARXA 5D1XA 4C4UA 5J5EA 1DL7L 2E3VA 1PSKL 2V3DA 2FCBA 2ZXWB 1INQA 4EI0A 3S9DB 2KBGA 2FJHB 3C75A 1G7MA 4OIIL 3ZX1A 4OZIB 4RETB 4ZS7L 2I85A 4TM9A