5DWNA

Crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa <structure_details =
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
181
structure length
181
Chain Sequence
HHMPVIRDFQPADIETITAIYTQAVLTGTGSYEIEPPTMDEMAKRFAAFADQGFPILVAEADGRVLGYAYASYFRVRPAYRWLAEDSIYIAPDAKGQGIGKLLLRELIARISALGFRQLLAVIGDGEHNIGSVKLHESLGFTHCGRIEGSGFKHGRWLDTVLMQLPLNGGRSTEPGPSPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphinothricin N-acetyltransferase
publication title Crystal structure of Phosphinothricin N-acetyltransferase from Brucella ovis in complex with AcetylCoA
rcsb
source organism Brucella ovis (strain atcc 25840 / 63/290 / nctc 10512)
molecule tags Transferase
total genus 57
structure length 181
sequence length 181
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5dwnA00
2B4BA 3FIXA 4KVOE 3BLNA 4MY3A 1PUAA 4R9MA 3R1KA 2P6FA 2WPXA 5DWMA 4F0YA 5C88A 4R3LA 4QVTA 4NSQA 2VZZA 4R3KA 1NSLA 1YGHA 4H89A 3ZZIA 2X7BA 1YVOA 1M4IA 2H5MA 3QAHA 1K4JA 4CS0B 5J8FA 1IYLA 2CY2A 1IICA 5IB0A 2ZXVA 2FSRA 2G3TA 4GS4A 2R8VA 3LODA 3NE7A 2Z11A 3PGPA 2PQ8A 4RI1A 4AVCA 4Y49B 4ORFA 4KVME 2D4OA 2AE6A 4H6ZA 2G0BA 2ZW6A 3TOBA 4JXRA 3UY5A 2FS5A 2QIRA 3TTHA 3D2PA 1CM0A 1PU9A 3FNCA 1Q2DA 3GY9A 1GHEA 4OAEA 2IL4A 2B3VA 3DR6A 4KOVA 1Z4EA 3EXNA 3I3GA 1MJBA 2ZW4A 5F49A 4FD6A 1YVKA 4Y49C 3TO6A 3JUWA 4KOXA 5JQ4A 3D3SA 1KUVA 1R57A 2JDCA 2J8RA 4KZTA 4MI4A 5EC4A 3I9SA 5ISVA 4CAXA 1KZFA 4YRHA 1UFHA 3VWEA 2REFA 2P6EA 2KCWA 3KKWA 4U5YA 3FRMA 5E96A 2C27A 1SQHA 1QSMA 1YREA 4PK3A 4AVBA 1OZPA 1I1DA 5F48A 3P2FA 2JLMA 3F8KA 4JJXA 1U6MA 2ATRA 3WR7A 3CXSA 4M85A 1S60A 5H86A 1IYKA 3FXTA 2WPWA 3TFYA 2FL4A 2K5TA 2J8NA 2HV2A 3FYNA 3R9GA 5H84A 3S6KA 1QSOA 4HNXB 2B5GB 2PR8A 2REEA 1MJAA 2PRBA 3B8GA 4U9ZA 4RS2A 2F5IA 4KOTA 1YK3A 2VQYA 2B3UA 3TO7A 4UWIA 1TIQA 4CRYB 1VHSA 1S7KA 2CNMA 3TCVA 2FIWA 4HKFA 2ARHA 4CRZB 4H6UA 2FCKA 1L0CA 3CXPA 3R9FA 1M44A 4UA3A 1M4DA 4HNYB 2G3AA 1FY7A 4JWPA 2FT0A 5HH1A 2A4NA 4YGOA 2HQYA 1RXTA 4NXYA 1NE9A 4IF5A 4X5KA 4E0AA 2BL1A 2Z10A 3N7ZA 2PC1A 1WK4A 4KLWA 4AG9A 4OADA 3DR8A 3EY5A 1XEBA 2EVNA 5F47A 4UWJA 3T9YA 2Q44A 4JLYA 4CAVA 4R87A 1YR0A 4HNWB 2PSWA 1BO4A 4MBUA 3GKRA 2VEZA 2CNTA 4KUBA 2PR1A 3IGRA 2R7HA 5C82A 1I21A 5J8CA 5EBVA 4E8OA 3SXNA 1XMTA 1Z4RA 4QC6A 2EUIA 1P0HA 4FD4A 1QSRA 3SHPA 2PDOA 4YFJA 1IIDA 4FD5A 3QB8A 1S3ZA 4NF1A 1KUYA 4XNHB 3S6GA 4MY0A 1P4NA 2ZW7A 1S7LA 4KOWA 3K9UA 3BJ7A 3SXOA 1S5KA 4KVXA 4U9YA 3TT2A 2JEVA 2OZGA 4QB9A 2Q4VA 2B4DB 4M3SA 3EFAA 5I0CA 4XPDC 2B4DA 4E2AA 4ZBGA 4AB7A 3FBUA 1S7NA 3C26A 5JPHA 1YX0A 5CNPA 3BJ8A 4KOUA 3R9EA 5F46A 2ZW5A 4DNCA 2I79A 2BUEA 1MK4A 4CAWA 4AG7A 4PV6A 1XIXA 1VKCA 3G3SA 4XNHC 3G8WA 3TO9A 3E0KA 3ZJ0A 2B5GA 4R57A 3DNSA 4B5PB 3T90A 3W6XA 1BOBA 2ZPAA 2P6GA 4B5PA 2AJ6A 4PK2A 4QUSA 4OLLA 2JDDA 4L8AA 1Y9KA 3W91A 1XE4A 1QSNA 4MHDA 5IV0A 4EVYA 1B6BA 3EC4A 1Z9UA 3TE4A 2VXKA 1M1DA 3D8PA 3CXQA 1S7FA 3IWGA 4PSXA 2VBQA 4NEXA 4II9A 3OWCA 2RC4A 2Y0MA 3JVNA 3GYAA 2I00A 2P0WA 2Q7BA 2BEIA 4KORA 2J8MA 3R96A 1LRZA 1V0CA 3PZJA 3P2HA 4F6AA 2OB0A 4MJ8A 4B5OA 2OZHA 4XPDB 2R98A 3S6FA 4KOYA 3S6HA 2Q04A 4QBJA 1IB1E 1RO5A 4FD7A 2OZUA 4LX9A 2BSWA 3MGDA 4XPLA 4BMHA 4UBRA 2OH1A 1I12A 2Q0YA 4J3GA 2FIAA 3PP9A 1Y7RA 1MJ9A 1QSTA 1Q2YA 1N71A 1XF8A 2B58A 1NMTA 3H4QA 4JD6A 5HMNA 2DXQA 4AVAA 3LD2A 4PSWA 4IUSA 2CNSA 2GANA 4NCZA 4LUAA 3D2MA 1B87A 1ON0A 5KTCA 4ONUA 5FVJA 3VWDA 2QECA 3F5BA 1WWZA 3EO4A 3F0AA 4K30A 1Y9WA 2VZYA 5KTDA 1CJWA 4L89A 2O28A 3DSBA 2R1IA 1J4JA 1Q2CA 2FXFA 2D4PA 4JXQA 4KUAA 2VI7A 2FE7A 2HUZA 3RYOA 5KTAA 4XPKA 4KLVA 1KUXA 2NMTA 3TOAA 5IX3A 2QMLA 2Z0ZA 2GE3A 2OU2A 5DWNA 3V8IA 2GIVA 3R95A 3W6SA 3FB3A 4I49A 4KOSA 2Q4YA 1M4GA 5GCNA 3DDDA 1YLEA
chains in the Genus database with same CATH superfamily
2B4BA 3FIXA 4AXVA 1YQEA 4KVOE 3BLNA 3GB0A 4NGRA 2PJ0A 2YGWA 4DUKA 4PPZA 3SJFA 1CX8A 4MY3A 2YNCC 4KSIA 1PUAA 4C2YA 4R9MA 5BWAB 3R1KA 3B2YA 2P6FA 2WPXA 5DWMA 1FT7A 4A32A 2AFZA 4F0YA 5C88A 4R3LA 1TF8A 3PBEA 4UEZA 3SJGA 4QVTA 1LANA 4K3NA 4NSQA 2VZZA 4R3KA 3WC7A 1NSLA 4IAVA 1YGHA 3B3WA 4H89A 3ZZIA 2X7BA 3NE8A 2ZEDA 5JGFA 1YVOA 4MHNA 1M4IA 4Z65A 2H5MA 3QAHA 4B11A 1K4JA 3QAYA 4CS0B 5J8FA 1IYLA 2CY2A 3S9NA 1IICA 4P4FA 4NJQA 2PJ3A 5HXDA 5IB0A 4O23A 3PB8X 2ZXVA 1EE3P 1Y0RA 2FSRA 1ZG9A 4MFLA 2G3TA 3H8EA 4GS4A 2R8VA 2GREA 3CT9A 3LODA 1TKHA 3D7FA 3NE7A 2Z11A 3PGPA 2PQ8A 5G1ZA 4RI1A 3WABA 1YSJA 5JH9A 1ZG8A 3B7IA 4AVCA 4UFWA 4F0XA 3T8WA 3KQZA 4A30A 4H2KA 4Y49B 4ORFA 2YNEA 4UCMA 2ZOFA 1ZLIA 1Z8XA 3N5FA 4ZY2A 5HVHA 5HVFA 3WC6A 5KTAA 4KVME 4FAIA 2D4OA 5D29A 2JEWA 5K8NA 4R7MA 4JZ0A 4P4IA 2AE6A 4H6ZA 2HB6A 2G0BA 2ZW6A 3TOBA 3PFOA 4JXRA 3UY5A 2FS5A 3FVLA 3LMSA 1R3NA 3RNZA 2QIRA 3TTHA 3D2PA 4OMEA 3SJXA 1CM0A 1PU9A 3FNCA 3KASA 1Q2DA 2PJ2A 2ZEGA 3IO1A 3MN8A 3KR5A 4A31A 1QMUA 3GY9A 3KL9A 1GHEA 4OAEA 4UF4A 2IL4A 2PJ5A 4MFPA 2F8HA 4FBEA 3TC8A 4MHPA 1JQGA 3S9MA 4M6HA 2B3VA 3FH4A 3DR6A 1IU8A 4OC5A 2DF5A 2V8VA 4KOVA 4TWEA 4UFVA 2PJ8A 4OC3A 4ZGYB 1IY7A 3NA6A 1Z4EA 4C2XA 4CGPA 3EXNA 2Z3OA 3I3GA 4MHZA 1MJBA 2CF4A 2ZW4A 4KSFA 2IJZA 4WJBA 1TF9A 2PJ7A 2ZOGA 4B10A 3B3SA 5F49A 4FD6A 2C6PA 5AG5A 2CXAA 2PJBA 1CPXA 1YVKA 3V7ZA 1HDUA 3SI1A 4Y49C 4NGPA 3TO6A 3JUWA 4NGMA 2V8DA 4KOXA 4B12A 5JQ4A 3D3SA 1KUVA 1R57A 2XEFA 2JDCA 2J8RA 2ABZA 4P44A 4KZTA 3RYOA 4MI4A 2PCUA 5EC4A 3I9SA 5ISVA 4F9VA 4CAXA 1KZFA 2F7VA 1UFHA 4YRHA 3VWEA 1FNOA 2P6EA 2REFA 2KCWA 3KKWA 4U5YA 3FRMA 5E96A 1ZLHA 2C27A 3B3CA 1SQHA 2IMOA 3H5ZA 1HEEA 1QSMA 1YREA 2BOAA 2PJ4A 4M6IA 4PK3A 2ZEHA 4P4JA 3SJEA 1OZPA 4AVBA 2PJ1A 1I1DA 1JWQA 1X12A 2EBJA 5IB9A 5F48A 3P2FA 2JLMA 2DPSA 3F8KA 3SI2A 1BPMA 4JJXA 1U6MA 2ATRA 5AG6A 3WR7A 3CXSA 4M85A 4RN7A 3IC1A 1S60A 3I1UA 4MCQA 4UIAA 3IEHA 5H86A 4EMEA 1VIXA 2IQ6A 3FF3A 1R43A 1IYKA 3FXTA 2PE3A 2Q4YA 2WPWA 3TFYA 2FL4A 2EO8A 2K5TA 4BINA 2PJ9A 4CYOA 2J8NA 2HV2A 3CPXA 4F9UA 1XOVA 2Z3PA 3FYNA 3JTKA 1BAVA 3R9GA 2PVVA 5H84A 4PQAA 3GUXA 4B6ZA 3S6KA 1DE4C 1QSOA 2POKA 3RO0A 4HNXB 2B5GB 2PR8A 2PRQA 2REEA 4ZY0A 1MJAA 3NH5A 3ISXA 2PRBA 3B8GA 4U9ZA 4RS2A 2F5IA 2Z3MA 1M4LA 3BXMA 4KOTA 1IGBA 1YK3A 2VQYA 4OC4A 4UIBA 2B3UA 5LYFA 3TO7A 4UWIA 3H8GA 1TIQA 4CRYB 1VHSA 2XEIA 4UCPA 4B14A 1S7KA 2CNMA 3TCVA 4A2ZA 2FIWA 4HKFA 2ARHA 4CRZB 5LYDA 2EK8A 4H6UA 8CPAA 4ZY1A 4C7HA 4ONWA 2FCKA 1L0CA 3CXPA 2Q43A 3R9FA 5A28A 1M44A 4UA3A 4RUHA 1M4DA 4NGNA 2ZEOA 4HNYB 2C1CA 2G3AA 1FY7A 4JWPA 2FT0A 4MFKA 5HH1A 4CGNA 1Z5RA 2A4NA 2GU2A 4X2TA 1YMEA 1Q7LA 5G20A 1ELLP 4YGOA 2HQYA 1RXTA 1Y0YA 2AFMA 2GFQA 4NXYA 1NE9A 4IF5A 4X5KA 4GM5A 4MCSA 4E0AA 2O4HA 1M4GA 5DS0A 2AFSA 3VATA 2BL1A 2Z10A 1ZG7A 3N7ZA 2PC1A 2AFXA 1WK4A 2NYQA 3BI1A 4KLWA 4OADA 4AG9A 4ZX9A 3FECA 3FEEA 3K2KA 1LOKA 3DR8A 3EY5A 3PRTA 4R6TA 1CP6A 1CBXA 1XEBA 4MRIA 1RTQA 2AFWA 2EVNA 3LACA 4UWJA 5F47A 3D67A 3PFEA 3T9YA 1XFOA 3FMCA 3FJUA 4GXHA 4WWVA 4TNUA 2Q44A 4FWUA 4JLYA 4CAVA 4R87A 1YR0A 4HNWB 1BO4A 2PSWA 4MBUA 2V8GA 3A9LA 3GKRA 1Z8WA 2VEZA 2CNTA 3RAMA 2I3CA 4BD9A 4KUBA 2QYVA 2CIJA 2PR1A 3D68A 1BPNA 3IGRA 2R7HA 4A37A 1GYTA 2ZENA 5C82A 1I21A 5EMIA 5J8CA 3H8FA 5EBVA 4E8OA 4P45A 4CGLA 3SXNA 3DGVA 3NFZA 4EWTA 5J1QA 1XMTA 1Z4RA 4UEEA 2C6CA 2WUUA 4CPAA 1YW6A 2PJ6A 4QC6A 2EUIA 5A27A 1P0HA 1XBUA 1HDQA 2OR4A 4FD4A 2DPTA 1QSRA 3SHPA 4FUUA 2PDOA 4YFJA 1ZO0A 1IIDA 3NH8A 4FD5A 2DEAA 4R8FA 4X8IA 4F8ZA 3QB8A 2PIYA 3IIBA 1S3ZA 4IK2A 4HPSA 6CPAA 3VH9A 4NF1A 5THWA 1TXRA 5JM6A 1VHEA 1Z2LA 2GLFA 4YU9A 1KUYA 2RB7A 2VL1A 4MFJA 4XNHB 4MMOA 3S6GA 3HUVA 3IFEA 4MY0A 1P4NA 4A38A 2ZW7A 2WZNA 1S7LA 4KOWA 4MFZA 3K9UA 1PCAA 3BJ7A 3JRUA 3PB7X 3SXOA 1S5KA 4MCPA 4KVXA 2RFHA 2ODFA 2Z3KA 4U9YA 2PJCA 3TT2A 1Z8TA 2JEVA 2NSMA 2PVWA 2ZEPA 2OZGA 4QB9A 2Q4VA 2B4DB 4M3SA 3EFAA 5G22A 5I4MA 5LYLA 5LRJA 5I0CA 3S9LA 1VHOA 2CTCA 3KZWA 4OP4A 4XPDC 4A95A 5LYIA 2B4DA 4E2AA 4ZBGA 3QNVA 4AB7A 3IWEA 4Q38A 3FBUA 4Q7AA 1S7NA 3B3VA 5AG4A 3C26A 5JPHA 1YX0A 3KI9A 1F2PA 3BI0A 1CG2A 5CNPA 2AFUA 3BJ8A 1Z8LA 4KOUA 3R9EA 2C6GA 5F46A 1XJOA 1XMBA 3KQXA 5CBMA 5ELYA 4LQ6A 2ZW5A 4CYPA 4DNCA 2I79A 1IOIA 1ARLA 1H8LA 2XEJA 4NGTA 4P4EA 3MRUA 2ZEMA 2Q4ZA 2BUEA 1CP7A 2ZEEA 1MK4A 4CAWA 4AG7A 4PV6A 1BLLE 3WT4A 4ZI6A 5F09A 5LRKA 1XIXA 4PXBA 1VKCA 1ARMA 3G3SA 1LFWA 3G8WA 4XNHC 2EK9A 3TO9A 3E0KA 3ZJ0A 4OC1A 2B5GA 4R57A 1IOFA 3LWUA 3DNSA 4PXEA 4B5PB 3KGQA 3PB4X 2V8HA 1QQ9A 3T90A 3W6XA 3KHZA 1XRYA 1BOBA 3PB9X 5D8NA 2ZPAA 4MFQA 2P6GA 1OBRA 4C68A 4B5PA 2AJ6A 4KSAA 4PK2A 4MHYA 4QUSA 4OLLA 1F57A 2JDDA 3D7GA 1Y9KA 3PEIA 4L8AA 3W91A 1XE4A 1QSNA 1TKFA 4MHDA 5IV0A 4EVYA 2GLJA 1F2OA 1B6BA 3EC4A 1Z9UA 1KWMA 3TE4A 4NJRA 5HVGA 2VXKA 1M1DA 4CGOA 4OC0A 3D8PA 1S7FA 3CXQA 3CPAA 3IU1A 4A39A 3IWGA 2AFOA 4PSXA 2VBQA 4NEXA 4II9A 3IWWA 3OWCA 5G21A 2RC4A 7CPAA 2Y0MA 2ZEFA 3JVNA 3GYAA 2HC9A 2I00A 4MCRA 2P0WA 4CYNA 2Q7BA 2BEIA 4JYWA 3KHXA 2PIZA 2YNDA 3KR4A 4A94A 4PXDA 3B35A 4KORA 2JBJA 2J8MA 3R96A 1LRZA 1V0CA 4M6GA 3PZJA 5LRGA 1LCPA 4R76A 3P2HA 1LAPA 3B3TA 4C2ZA 4F6AA 2WYRA 2OB0A 4MJ8A 4OIDA 4DYOA 3PB6X 4P10A 2OZHA 4B5OA 4XPDB 3V38A 2J9AA 2R98A 3D7HA 2QVPA 3S6FA 4KOYA 4BBHA 1YLOA 3S6HA 3D66A 4NFRA 3PBBA 2Q04A 3HLPA 4QBJA 2PJAA 4P4DA 4YWYA 1IB1E 4UEFA 1RO5A 2Z3NA 4FD7A 4DJLA 4CYQA 3IJ3A 2OZUA 1AUGA 4LX9A 4P4BA 2BSWA 3MGDA 4W9YA 1A2ZA 4UBRA 4XPLA 4A33A 3D4UA 4BMHA 2OH1A 1I12A 2G9DA 2Q0YA 3CZXA 2ZELA 1YW4A 4J3GA 2BO9A 4Q36A 2FIAA 4KS9A 3FX6A 3PP9A 3ISZA 1Y7RA 1MJ9A 4B13A 1QSTA 1Q2YA 1N71A 1XF8A 2B58A 1NMTA 3CDXA 1ELMP 3H4QA 3RZAA 4UCNA 1Y7EA 2BCOA 2OOTA 2O53A 4JD6A 2V77A 4CAFA 5HMNA 4OIWA 5K8MA 2DXQA 4AVAA 3L2NA 3LD2A 3BHXA 4PSWA 4IUSA 1AYEA 3GIUA 2XEGA 2CNSA 1TKJA 2GANA 4NCZA 2Q7SA 3D2MA 4LUAA 5K8OA 1B87A 1VGYA 1ON0A 5KTCA 4OKOA 4ONUA 1UWYA 5FVJA 3VWDA 2QECA 3F5BA 5CPAA 1WWZA 3WC5A 2YNCA 2Z3LA 3EO4A 2JBKA 4IHMA 3TX8A 3F0AA 4K30A 3K9TA 1Y9WA 4ZX8A 4C7IA 1LAMA 2Q51A 4LQGA 2VZYA 4CAEA 5AGEA 1DTDA 5KTDA 1CPSA 3VARA 2QJ8A 4NGQA 1CJWA 4L89A 4P6YA 2O28A 3DSBA 4EFDA 2R1IA 4G1PA 1PYTB 1J4JA 3D7DA 1NSAA 1Q2CA 2D4PA 2FXFA 4JXQA 2VI7A 2FE7A 2HUZA 2WSAA 4KUAA 4OC2A 4PXCA 4UFXA 4NGSA 2FVGA 4XPKA 4KLVA 1KUXA 2NMTA 3TOAA 5IX3A 2QMLA 2Z0ZA 2GE3A 2OU2A 3FEDA 3IU2A 1X10A 5K8PA 2CTBA 5DWNA 4CGMA 3V8IA 4X3RA 4MXUA 2GIVA 3GLJA 3NH4A 4ZYQA 3SI0A 3R95A 3W6SA 5AG7A 3RBUA 3FB3A 4I49A 2EWBA 3DLJA 4KOSA 2ANPA 1AMPA 5GCNA 3DDDA 1YLEA
chains in the Genus database with same CATH topology
2B4BA 3FIXA 4KVOE 3BLNA 2YGWA 4MY3A 2YNCC 4C2YA 1PUAA 4R9MA 5BWAB 3R1KA 2P6FA 2WPXA 5DWMA 4A32A 4F0YA 5C88A 4R3LA 4QVTA 4NSQA 2VZZA 4R3KA 1NSLA 1YGHA 4H89A 3ZZIA 2X7BA 1YVOA 1M4IA 2H5MA 3QAHA 4B11A 1K4JA 4CS0B 5J8FA 1IYLA 2CY2A 1IICA 5IB0A 2ZXVA 2FSRA 4MFLA 2G3TA 4GS4A 2R8VA 3LODA 3NE7A 2Z11A 3PGPA 2PQ8A 5G1ZA 4RI1A 4AVCA 4F0XA 4UFWA 4A30A 4Y49B 4ORFA 2YNEA 4UCMA 4KVME 2D4OA 2AE6A 4H6ZA 2G0BA 2ZW6A 3TOBA 4JXRA 3UY5A 2FS5A 2QIRA 3TTHA 3D2PA 1CM0A 1PU9A 3FNCA 4A31A 1Q2DA 3GY9A 1GHEA 4OAEA 2IL4A 4MFPA 2B3VA 3DR6A 4KOVA 4UFVA 4ZGYB 1Z4EA 4C2XA 4CGPA 3EXNA 2Z3OA 3I3GA 1MJBA 2ZW4A 4KSFA 4B10A 5F49A 4FD6A 5AG5A 2CXAA 1YVKA 4Y49C 3TO6A 3JUWA 4B12A 4KOXA 5JQ4A 3D3SA 1KUVA 1R57A 2JDCA 2J8RA 4KZTA 4MI4A 5EC4A 3I9SA 5ISVA 4CAXA 1KZFA 4YRHA 1UFHA 3VWEA 2REFA 2P6EA 2KCWA 3KKWA 4U5YA 3FRMA 5E96A 2C27A 1SQHA 3H5ZA 1QSMA 1YREA 4PK3A 4AVBA 1OZPA 1I1DA 5F48A 3P2FA 2JLMA 2DPSA 3F8KA 4JJXA 1U6MA 2ATRA 5AG6A 3WR7A 3CXSA 4M85A 1S60A 5H86A 1IYKA 3FXTA 2WPWA 3TFYA 2FL4A 2K5TA 4CYOA 2J8NA 2HV2A 2Z3PA 3FYNA 3JTKA 3R9GA 5H84A 3S6KA 1QSOA 4HNXB 2B5GB 2PR8A 2REEA 1MJAA 2PRBA 3B8GA 4U9ZA 4RS2A 2F5IA 2Z3MA 4KOTA 1YK3A 2VQYA 2B3UA 3TO7A 4UWIA 1TIQA 4CRYB 1VHSA 4UCPA 4B14A 1S7KA 2CNMA 3TCVA 4A2ZA 2FIWA 4HKFA 2ARHA 4CRZB 4H6UA 4C7HA 2FCKA 1L0CA 3CXPA 3R9FA 5A28A 1M44A 4UA3A 1M4DA 4HNYB 2G3AA 1FY7A 4JWPA 2FT0A 4MFKA 5HH1A 4CGNA 2A4NA 5G20A 4YGOA 2HQYA 1RXTA 4NXYA 1NE9A 4IF5A 4X5KA 4E0AA 2BL1A 2Z10A 3N7ZA 2PC1A 1WK4A 4KLWA 4AG9A 4OADA 3DR8A 3EY5A 1XEBA 2EVNA 5F47A 4UWJA 3T9YA 2Q44A 4JLYA 4CAVA 4R87A 1YR0A 4HNWB 2PSWA 1BO4A 4MBUA 3GKRA 3A9LA 2VEZA 2CNTA 4KUBA 2PR1A 3IGRA 2R7HA 5C82A 1I21A 5J8CA 5EBVA 4E8OA 4CGLA 3SXNA 1XMTA 1Z4RA 2WUUA 4QC6A 2EUIA 5A27A 1P0HA 4FD4A 2DPTA 1QSRA 3SHPA 2PDOA 4YFJA 1ZO0A 1IIDA 4FD5A 3QB8A 1S3ZA 4NF1A 1KUYA 4MFJA 4XNHB 3S6GA 4MY0A 1P4NA 2ZW7A 1S7LA 4KOWA 4MFZA 3K9UA 3BJ7A 3SXOA 1S5KA 4KVXA 2Z3KA 4U9YA 3TT2A 2JEVA 2OZGA 4QB9A 2Q4VA 2B4DB 4M3SA 3EFAA 5G22A 5I0CA 4XPDC 4A95A 2B4DA 4E2AA 4ZBGA 4AB7A 3IWEA 4Q38A 3FBUA 1S7NA 5AG4A 3C26A 5JPHA 1YX0A 5CNPA 3BJ8A 4KOUA 3R9EA 5F46A 2ZW5A 4CYPA 4DNCA 2I79A 2BUEA 1MK4A 4CAWA 4AG7A 4PV6A 1XIXA 1VKCA 3G3SA 4XNHC 3G8WA 3TO9A 3E0KA 3ZJ0A 2B5GA 4R57A 3DNSA 4B5PB 3T90A 3W6XA 1BOBA 2ZPAA 4MFQA 2P6GA 4C68A 4B5PA 2AJ6A 4KSAA 4PK2A 4QUSA 4OLLA 2JDDA 4L8AA 1Y9KA 3W91A 1XE4A 1QSNA 4MHDA 5IV0A 4EVYA 1B6BA 3EC4A 1Z9UA 3TE4A 2VXKA 1M1DA 4CGOA 3D8PA 3CXQA 1S7FA 3IU1A 3IWGA 4PSXA 2VBQA 4NEXA 4II9A 3OWCA 5G21A 2RC4A 2Y0MA 3JVNA 3GYAA 2I00A 2P0WA 4CYNA 2Q7BA 2BEIA 2YNDA 4KORA 2J8MA 3R96A 1LRZA 1V0CA 3PZJA 3P2HA 4C2ZA 4F6AA 2OB0A 4MJ8A 4B5OA 2OZHA 4XPDB 2R98A 3S6FA 4KOYA 4BBHA 3S6HA 2Q04A 4QBJA 1IB1E 1RO5A 2Z3NA 4FD7A 4CYQA 2OZUA 4LX9A 2BSWA 3MGDA 4XPLA 4BMHA 4UBRA 4A33A 2OH1A 1I12A 2Q0YA 4J3GA 4Q36A 2FIAA 4KS9A 3PP9A 1Y7RA 1MJ9A 4B13A 1QSTA 1Q2YA 1N71A 1XF8A 2B58A 1NMTA 3H4QA 4UCNA 4JD6A 4CAFA 5HMNA 2DXQA 4AVAA 3LD2A 4PSWA 4IUSA 2CNSA 2GANA 4NCZA 3D2MA 4LUAA 1B87A 1ON0A 5KTCA 4ONUA 5FVJA 3VWDA 2QECA 3F5BA 1WWZA 2YNCA 2Z3LA 3EO4A 3F0AA 4K30A 1Y9WA 4C7IA 4CAEA 2VZYA 5AGEA 5KTDA 1CJWA 4L89A 2O28A 3DSBA 2R1IA 1J4JA 1Q2CA 2FXFA 4JXQA 2D4PA 4KUAA 2VI7A 2FE7A 2HUZA 2WSAA 3RYOA 5KTAA 4UFXA 4XPKA 4KLVA 1KUXA 2NMTA 3TOAA 5IX3A 2QMLA 2Z0ZA 2GE3A 2OU2A 3IU2A 4CGMA 5DWNA 3V8IA 2GIVA 3R95A 3W6SA 5AG7A 3FB3A 4I49A 4KOSA 2Q4YA 1M4GA 5GCNA 3DDDA 1YLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B4B A;  3FIX A;  4KVO E;  3BLN A;  4MY3 A;  1PUA A;  4R9M A;  3R1K A;  2P6F A;  2WPX A;  5DWM A;  4F0Y A;  5C88 A;  4R3L A;  4QVT A;  4NSQ A;  2VZZ A;  4R3K A;  1NSL A;  1YGH A;  4H89 A;  3ZZI A;  2X7B A;  1YVO A;  1M4I A;  2H5M A;  3QAH A;  1K4J A;  4CS0 B;  5J8F A;  1IYL A;  2CY2 A;  1IIC A;  5IB0 A;  2ZXV A;  2FSR A;  2G3T A;  4GS4 A;  2R8V A;  3LOD A;  3NE7 A;  2Z11 A;  3PGP A;  2PQ8 A;  4RI1 A;  4AVC A;  4Y49 B;  4ORF A;  4KVM E;  2D4O A;  2AE6 A;  4H6Z A;  2G0B A;  2ZW6 A;  3TOB A;  4JXR A;  3UY5 A;  2FS5 A;  2QIR A;  3TTH A;  3D2P A;  1CM0 A;  1PU9 A;  3FNC A;  1Q2D A;  3GY9 A;  1GHE A;  4OAE A;  2IL4 A;  2B3V A;  3DR6 A;  4KOV A;  1Z4E A;  3EXN A;  3I3G A;  1MJB A;  2ZW4 A;  5F49 A;  4FD6 A;  1YVK A;  4Y49 C;  3TO6 A;  3JUW A;  4KOX A;  5JQ4 A;  3D3S A;  1KUV A;  1R57 A;  2JDC A;  2J8R A;  4KZT A;  4MI4 A;  5EC4 A;  3I9S A;  5ISV A;  4CAX A;  1KZF A;  4YRH A;  1UFH A;  3VWE A;  2REF A;  2P6E A;  2KCW A;  3KKW A;  4U5Y A;  3FRM A;  5E96 A;  2C27 A;  1SQH A;  1QSM A;  1YRE A;  4PK3 A;  4AVB A;  1OZP A;  1I1D A;  5F48 A;  3P2F A;  2JLM A;  3F8K A;  4JJX A;  1U6M A;  2ATR A;  3WR7 A;  3CXS A;  4M85 A;  1S60 A;  5H86 A;  1IYK A;  3FXT A;  2WPW A;  3TFY A;  2FL4 A;  2K5T A;  2J8N A;  2HV2 A;  3FYN A;  3R9G A;  5H84 A;  3S6K A;  1QSO A;  4HNX B;  2B5G B;  2PR8 A;  2REE A;  1MJA A;  2PRB A;  3B8G A;  4U9Z A;  4RS2 A;  2F5I A;  4KOT A;  1YK3 A;  2VQY A;  2B3U A;  3TO7 A;  4UWI A;  1TIQ A;  4CRY B;  1VHS A;  1S7K A;  2CNM A;  3TCV A;  2FIW A;  4HKF A;  2ARH A;  4CRZ B;  4H6U A;  2FCK A;  1L0C A;  3CXP A;  3R9F A;  1M44 A;  4UA3 A;  1M4D A;  4HNY B;  2G3A A;  1FY7 A;  4JWP A;  2FT0 A;  5HH1 A;  2A4N A;  4YGO A;  2HQY A;  1RXT A;  4NXY A;  1NE9 A;  4IF5 A;  4X5K A;  4E0A A;  2BL1 A;  2Z10 A;  3N7Z A;  2PC1 A;  1WK4 A;  4KLW A;  4AG9 A;  4OAD A;  3DR8 A;  3EY5 A;  1XEB A;  2EVN A;  5F47 A;  4UWJ A;  3T9Y A;  2Q44 A;  4JLY A;  4CAV A;  4R87 A;  1YR0 A;  4HNW B;  2PSW A;  1BO4 A;  4MBU A;  3GKR A;  2VEZ A;  2CNT A;  4KUB A;  2PR1 A;  3IGR A;  2R7H A;  5C82 A;  1I21 A;  5J8C A;  5EBV A;  4E8O A;  3SXN A;  1XMT A;  1Z4R A;  4QC6 A;  2EUI A;  1P0H A;  4FD4 A;  1QSR A;  3SHP A;  2PDO A;  4YFJ A;  1IID A;  4FD5 A;  3QB8 A;  1S3Z A;  4NF1 A;  1KUY A;  4XNH B;  3S6G A;  4MY0 A;  1P4N A;  2ZW7 A;  1S7L A;  4KOW A;  3K9U A;  3BJ7 A;  3SXO A;  1S5K A;  4KVX A;  4U9Y A;  3TT2 A;  2JEV A;  2OZG A;  4QB9 A;  2Q4V A;  2B4D B;  4M3S A;  3EFA A;  5I0C A;  4XPD C;  2B4D A;  4E2A A;  4ZBG A;  4AB7 A;  3FBU A;  1S7N A;  3C26 A;  5JPH A;  1YX0 A;  5CNP A;  3BJ8 A;  4KOU A;  3R9E A;  5F46 A;  2ZW5 A;  4DNC A;  2I79 A;  2BUE A;  1MK4 A;  4CAW A;  4AG7 A;  4PV6 A;  1XIX A;  1VKC A;  3G3S A;  4XNH C;  3G8W A;  3TO9 A;  3E0K A;  3ZJ0 A;  2B5G A;  4R57 A;  3DNS A;  4B5P B;  3T90 A;  3W6X A;  1BOB A;  2ZPA A;  2P6G A;  4B5P A;  2AJ6 A;  4PK2 A;  4QUS A;  4OLL A;  2JDD A;  4L8A A;  1Y9K A;  3W91 A;  1XE4 A;  1QSN A;  4MHD A;  5IV0 A;  4EVY A;  1B6B A;  3EC4 A;  1Z9U A;  3TE4 A;  2VXK A;  1M1D A;  3D8P A;  3CXQ A;  1S7F A;  3IWG A;  4PSX A;  2VBQ A;  4NEX A;  4II9 A;  3OWC A;  2RC4 A;  2Y0M A;  3JVN A;  3GYA A;  2I00 A;  2P0W A;  2Q7B A;  2BEI A;  4KOR A;  2J8M A;  3R96 A;  1LRZ A;  1V0C A;  3PZJ A;  3P2H A;  4F6A A;  2OB0 A;  4MJ8 A;  4B5O A;  2OZH A;  4XPD B;  2R98 A;  3S6F A;  4KOY A;  3S6H A;  2Q04 A;  4QBJ A;  1IB1 E;  1RO5 A;  4FD7 A;  2OZU A;  4LX9 A;  2BSW A;  3MGD A;  4XPL A;  4BMH A;  4UBR A;  2OH1 A;  1I12 A;  2Q0Y A;  4J3G A;  2FIA A;  3PP9 A;  1Y7R A;  1MJ9 A;  1QST A;  1Q2Y A;  1N71 A;  1XF8 A;  2B58 A;  1NMT A;  3H4Q A;  4JD6 A;  5HMN A;  2DXQ A;  4AVA A;  3LD2 A;  4PSW A;  4IUS A;  2CNS A;  2GAN A;  4NCZ A;  4LUA A;  3D2M A;  1B87 A;  1ON0 A;  5KTC A;  4ONU A;  5FVJ A;  3VWD A;  2QEC A;  3F5B A;  1WWZ A;  3EO4 A;  3F0A A;  4K30 A;  1Y9W A;  2VZY A;  5KTD A;  1CJW A;  4L89 A;  2O28 A;  3DSB A;  2R1I A;  1J4J A;  1Q2C A;  2FXF A;  2D4P A;  4JXQ A;  4KUA A;  2VI7 A;  2FE7 A;  2HUZ A;  3RYO A;  5KTA A;  4XPK A;  4KLV A;  1KUX A;  2NMT A;  3TOA A;  5IX3 A;  2QML A;  2Z0Z A;  2GE3 A;  2OU2 A;  5DWN A;  3V8I A;  2GIV A;  3R95 A;  3W6S A;  3FB3 A;  4I49 A;  4KOS A;  2Q4Y A;  1M4G A;  5GCN A;  3DDD A;  1YLE A; 
#chains in the Genus database with same CATH topology
 2B4B A;  3FIX A;  4AXV A;  1YQE A;  4KVO E;  3BLN A;  3GB0 A;  4NGR A;  2PJ0 A;  2YGW A;  4DUK A;  4PPZ A;  3SJF A;  1CX8 A;  4MY3 A;  2YNC C;  4KSI A;  1PUA A;  4C2Y A;  4R9M A;  5BWA B;  3R1K A;  3B2Y A;  2P6F A;  2WPX A;  5DWM A;  1FT7 A;  4A32 A;  2AFZ A;  4F0Y A;  5C88 A;  4R3L A;  1TF8 A;  3PBE A;  4UEZ A;  3SJG A;  4QVT A;  1LAN A;  4K3N A;  4NSQ A;  2VZZ A;  4R3K A;  3WC7 A;  1NSL A;  4IAV A;  1YGH A;  3B3W A;  4H89 A;  3ZZI A;  2X7B A;  3NE8 A;  2ZED A;  5JGF A;  1YVO A;  4MHN A;  1M4I A;  4Z65 A;  2H5M A;  3QAH A;  4B11 A;  1K4J A;  3QAY A;  4CS0 B;  5J8F A;  1IYL A;  2CY2 A;  3S9N A;  1IIC A;  4P4F A;  4NJQ A;  2PJ3 A;  5HXD A;  5IB0 A;  4O23 A;  3PB8 X;  2ZXV A;  1EE3 P;  1Y0R A;  2FSR A;  1ZG9 A;  4MFL A;  2G3T A;  3H8E A;  4GS4 A;  2R8V A;  2GRE A;  3CT9 A;  3LOD A;  1TKH A;  3D7F A;  3NE7 A;  2Z11 A;  3PGP A;  2PQ8 A;  5G1Z A;  4RI1 A;  3WAB A;  1YSJ A;  5JH9 A;  1ZG8 A;  3B7I A;  4AVC A;  4UFW A;  4F0X A;  3T8W A;  3KQZ A;  4A30 A;  4H2K A;  4Y49 B;  4ORF A;  2YNE A;  4UCM A;  2ZOF A;  1ZLI A;  1Z8X A;  3N5F A;  4ZY2 A;  5HVH A;  5HVF A;  3WC6 A;  5KTA A;  4KVM E;  4FAI A;  2D4O A;  5D29 A;  2JEW A;  5K8N A;  4R7M A;  4JZ0 A;  4P4I A;  2AE6 A;  4H6Z A;  2HB6 A;  2G0B A;  2ZW6 A;  3TOB A;  3PFO A;  4JXR A;  3UY5 A;  2FS5 A;  3FVL A;  3LMS A;  1R3N A;  3RNZ A;  2QIR A;  3TTH A;  3D2P A;  4OME A;  3SJX A;  1CM0 A;  1PU9 A;  3FNC A;  3KAS A;  1Q2D A;  2PJ2 A;  2ZEG A;  3IO1 A;  3MN8 A;  3KR5 A;  4A31 A;  1QMU A;  3GY9 A;  3KL9 A;  1GHE A;  4OAE A;  4UF4 A;  2IL4 A;  2PJ5 A;  4MFP A;  2F8H A;  4FBE A;  3TC8 A;  4MHP A;  1JQG A;  3S9M A;  4M6H A;  2B3V A;  3FH4 A;  3DR6 A;  1IU8 A;  4OC5 A;  2DF5 A;  2V8V A;  4KOV A;  4TWE A;  4UFV A;  2PJ8 A;  4OC3 A;  4ZGY B;  1IY7 A;  3NA6 A;  1Z4E A;  4C2X A;  4CGP A;  3EXN A;  2Z3O A;  3I3G A;  4MHZ A;  1MJB A;  2CF4 A;  2ZW4 A;  4KSF A;  2IJZ A;  4WJB A;  1TF9 A;  2PJ7 A;  2ZOG A;  4B10 A;  3B3S A;  5F49 A;  4FD6 A;  2C6P A;  5AG5 A;  2CXA A;  2PJB A;  1CPX A;  1YVK A;  3V7Z A;  1HDU A;  3SI1 A;  4Y49 C;  4NGP A;  3TO6 A;  3JUW A;  4NGM A;  2V8D A;  4KOX A;  4B12 A;  5JQ4 A;  3D3S A;  1KUV A;  1R57 A;  2XEF A;  2JDC A;  2J8R A;  2ABZ A;  4P44 A;  4KZT A;  3RYO A;  4MI4 A;  2PCU A;  5EC4 A;  3I9S A;  5ISV A;  4F9V A;  4CAX A;  1KZF A;  2F7V A;  1UFH A;  4YRH A;  3VWE A;  1FNO A;  2P6E A;  2REF A;  2KCW A;  3KKW A;  4U5Y A;  3FRM A;  5E96 A;  1ZLH A;  2C27 A;  3B3C A;  1SQH A;  2IMO A;  3H5Z A;  1HEE A;  1QSM A;  1YRE A;  2BOA A;  2PJ4 A;  4M6I A;  4PK3 A;  2ZEH A;  4P4J A;  3SJE A;  1OZP A;  4AVB A;  2PJ1 A;  1I1D A;  1JWQ A;  1X12 A;  2EBJ A;  5IB9 A;  5F48 A;  3P2F A;  2JLM A;  2DPS A;  3F8K A;  3SI2 A;  1BPM A;  4JJX A;  1U6M A;  2ATR A;  5AG6 A;  3WR7 A;  3CXS A;  4M85 A;  4RN7 A;  3IC1 A;  1S60 A;  3I1U A;  4MCQ A;  4UIA A;  3IEH A;  5H86 A;  4EME A;  1VIX A;  2IQ6 A;  3FF3 A;  1R43 A;  1IYK A;  3FXT A;  2PE3 A;  2Q4Y A;  2WPW A;  3TFY A;  2FL4 A;  2EO8 A;  2K5T A;  4BIN A;  2PJ9 A;  4CYO A;  2J8N A;  2HV2 A;  3CPX A;  4F9U A;  1XOV A;  2Z3P A;  3FYN A;  3JTK A;  1BAV A;  3R9G A;  2PVV A;  5H84 A;  4PQA A;  3GUX A;  4B6Z A;  3S6K A;  1DE4 C;  1QSO A;  2POK A;  3RO0 A;  4HNX B;  2B5G B;  2PR8 A;  2PRQ A;  2REE A;  4ZY0 A;  1MJA A;  3NH5 A;  3ISX A;  2PRB A;  3B8G A;  4U9Z A;  4RS2 A;  2F5I A;  2Z3M A;  1M4L A;  3BXM A;  4KOT A;  1IGB A;  1YK3 A;  2VQY A;  4OC4 A;  4UIB A;  2B3U A;  5LYF A;  3TO7 A;  4UWI A;  3H8G A;  1TIQ A;  4CRY B;  1VHS A;  2XEI A;  4UCP A;  4B14 A;  1S7K A;  2CNM A;  3TCV A;  4A2Z A;  2FIW A;  4HKF A;  2ARH A;  4CRZ B;  5LYD A;  2EK8 A;  4H6U A;  8CPA A;  4ZY1 A;  4C7H A;  4ONW A;  2FCK A;  1L0C A;  3CXP A;  2Q43 A;  3R9F A;  5A28 A;  1M44 A;  4UA3 A;  4RUH A;  1M4D A;  4NGN A;  2ZEO A;  4HNY B;  2C1C A;  2G3A A;  1FY7 A;  4JWP A;  2FT0 A;  4MFK A;  5HH1 A;  4CGN A;  1Z5R A;  2A4N A;  2GU2 A;  4X2T A;  1YME A;  1Q7L A;  5G20 A;  1ELL P;  4YGO A;  2HQY A;  1RXT A;  1Y0Y A;  2AFM A;  2GFQ A;  4NXY A;  1NE9 A;  4IF5 A;  4X5K A;  4GM5 A;  4MCS A;  4E0A A;  2O4H A;  1M4G A;  5DS0 A;  2AFS A;  3VAT A;  2BL1 A;  2Z10 A;  1ZG7 A;  3N7Z A;  2PC1 A;  2AFX A;  1WK4 A;  2NYQ A;  3BI1 A;  4KLW A;  4OAD A;  4AG9 A;  4ZX9 A;  3FEC A;  3FEE A;  3K2K A;  1LOK A;  3DR8 A;  3EY5 A;  3PRT A;  4R6T A;  1CP6 A;  1CBX A;  1XEB A;  4MRI A;  1RTQ A;  2AFW A;  2EVN A;  3LAC A;  4UWJ A;  5F47 A;  3D67 A;  3PFE A;  3T9Y A;  1XFO A;  3FMC A;  3FJU A;  4GXH A;  4WWV A;  4TNU A;  2Q44 A;  4FWU A;  4JLY A;  4CAV A;  4R87 A;  1YR0 A;  4HNW B;  1BO4 A;  2PSW A;  4MBU A;  2V8G A;  3A9L A;  3GKR A;  1Z8W A;  2VEZ A;  2CNT A;  3RAM A;  2I3C A;  4BD9 A;  4KUB A;  2QYV A;  2CIJ A;  2PR1 A;  3D68 A;  1BPN A;  3IGR A;  2R7H A;  4A37 A;  1GYT A;  2ZEN A;  5C82 A;  1I21 A;  5EMI A;  5J8C A;  3H8F A;  5EBV A;  4E8O A;  4P45 A;  4CGL A;  3SXN A;  3DGV A;  3NFZ A;  4EWT A;  5J1Q A;  1XMT A;  1Z4R A;  4UEE A;  2C6C A;  2WUU A;  4CPA A;  1YW6 A;  2PJ6 A;  4QC6 A;  2EUI A;  5A27 A;  1P0H A;  1XBU A;  1HDQ A;  2OR4 A;  4FD4 A;  2DPT A;  1QSR A;  3SHP A;  4FUU A;  2PDO A;  4YFJ A;  1ZO0 A;  1IID A;  3NH8 A;  4FD5 A;  2DEA A;  4R8F A;  4X8I A;  4F8Z A;  3QB8 A;  2PIY A;  3IIB A;  1S3Z A;  4IK2 A;  4HPS A;  6CPA A;  3VH9 A;  4NF1 A;  5THW A;  1TXR A;  5JM6 A;  1VHE A;  1Z2L A;  2GLF A;  4YU9 A;  1KUY A;  2RB7 A;  2VL1 A;  4MFJ A;  4XNH B;  4MMO A;  3S6G A;  3HUV A;  3IFE A;  4MY0 A;  1P4N A;  4A38 A;  2ZW7 A;  2WZN A;  1S7L A;  4KOW A;  4MFZ A;  3K9U A;  1PCA A;  3BJ7 A;  3JRU A;  3PB7 X;  3SXO A;  1S5K A;  4MCP A;  4KVX A;  2RFH A;  2ODF A;  2Z3K A;  4U9Y A;  2PJC A;  3TT2 A;  1Z8T A;  2JEV A;  2NSM A;  2PVW A;  2ZEP A;  2OZG A;  4QB9 A;  2Q4V A;  2B4D B;  4M3S A;  3EFA A;  5G22 A;  5I4M A;  5LYL A;  5LRJ A;  5I0C A;  3S9L A;  1VHO A;  2CTC A;  3KZW A;  4OP4 A;  4XPD C;  4A95 A;  5LYI A;  2B4D A;  4E2A A;  4ZBG A;  3QNV A;  4AB7 A;  3IWE A;  4Q38 A;  3FBU A;  4Q7A A;  1S7N A;  3B3V A;  5AG4 A;  3C26 A;  5JPH A;  1YX0 A;  3KI9 A;  1F2P A;  3BI0 A;  1CG2 A;  5CNP A;  2AFU A;  3BJ8 A;  1Z8L A;  4KOU A;  3R9E A;  2C6G A;  5F46 A;  1XJO A;  1XMB A;  3KQX A;  5CBM A;  5ELY A;  4LQ6 A;  2ZW5 A;  4CYP A;  4DNC A;  2I79 A;  1IOI A;  1ARL A;  1H8L A;  2XEJ A;  4NGT A;  4P4E A;  3MRU A;  2ZEM A;  2Q4Z A;  2BUE A;  1CP7 A;  2ZEE A;  1MK4 A;  4CAW A;  4AG7 A;  4PV6 A;  1BLL E;  3WT4 A;  4ZI6 A;  5F09 A;  5LRK A;  1XIX A;  4PXB A;  1VKC A;  1ARM A;  3G3S A;  1LFW A;  3G8W A;  4XNH C;  2EK9 A;  3TO9 A;  3E0K A;  3ZJ0 A;  4OC1 A;  2B5G A;  4R57 A;  1IOF A;  3LWU A;  3DNS A;  4PXE A;  4B5P B;  3KGQ A;  3PB4 X;  2V8H A;  1QQ9 A;  3T90 A;  3W6X A;  3KHZ A;  1XRY A;  1BOB A;  3PB9 X;  5D8N A;  2ZPA A;  4MFQ A;  2P6G A;  1OBR A;  4C68 A;  4B5P A;  2AJ6 A;  4KSA A;  4PK2 A;  4MHY A;  4QUS A;  4OLL A;  1F57 A;  2JDD A;  3D7G A;  1Y9K A;  3PEI A;  4L8A A;  3W91 A;  1XE4 A;  1QSN A;  1TKF A;  4MHD A;  5IV0 A;  4EVY A;  2GLJ A;  1F2O A;  1B6B A;  3EC4 A;  1Z9U A;  1KWM A;  3TE4 A;  4NJR A;  5HVG A;  2VXK A;  1M1D A;  4CGO A;  4OC0 A;  3D8P A;  1S7F A;  3CXQ A;  3CPA A;  3IU1 A;  4A39 A;  3IWG A;  2AFO A;  4PSX A;  2VBQ A;  4NEX A;  4II9 A;  3IWW A;  3OWC A;  5G21 A;  2RC4 A;  7CPA A;  2Y0M A;  2ZEF A;  3JVN A;  3GYA A;  2HC9 A;  2I00 A;  4MCR A;  2P0W A;  4CYN A;  2Q7B A;  2BEI A;  4JYW A;  3KHX A;  2PIZ A;  2YND A;  3KR4 A;  4A94 A;  4PXD A;  3B35 A;  4KOR A;  2JBJ A;  2J8M A;  3R96 A;  1LRZ A;  1V0C A;  4M6G A;  3PZJ A;  5LRG A;  1LCP A;  4R76 A;  3P2H A;  1LAP A;  3B3T A;  4C2Z A;  4F6A A;  2WYR A;  2OB0 A;  4MJ8 A;  4OID A;  4DYO A;  3PB6 X;  4P10 A;  2OZH A;  4B5O A;  4XPD B;  3V38 A;  2J9A A;  2R98 A;  3D7H A;  2QVP A;  3S6F A;  4KOY A;  4BBH A;  1YLO A;  3S6H A;  3D66 A;  4NFR A;  3PBB A;  2Q04 A;  3HLP A;  4QBJ A;  2PJA A;  4P4D A;  4YWY A;  1IB1 E;  4UEF A;  1RO5 A;  2Z3N A;  4FD7 A;  4DJL A;  4CYQ A;  3IJ3 A;  2OZU A;  1AUG A;  4LX9 A;  4P4B A;  2BSW A;  3MGD A;  4W9Y A;  1A2Z A;  4UBR A;  4XPL A;  4A33 A;  3D4U A;  4BMH A;  2OH1 A;  1I12 A;  2G9D A;  2Q0Y A;  3CZX A;  2ZEL A;  1YW4 A;  4J3G A;  2BO9 A;  4Q36 A;  2FIA A;  4KS9 A;  3FX6 A;  3PP9 A;  3ISZ A;  1Y7R A;  1MJ9 A;  4B13 A;  1QST A;  1Q2Y A;  1N71 A;  1XF8 A;  2B58 A;  1NMT A;  3CDX A;  1ELM P;  3H4Q A;  3RZA A;  4UCN A;  1Y7E A;  2BCO A;  2OOT A;  2O53 A;  4JD6 A;  2V77 A;  4CAF A;  5HMN A;  4OIW A;  5K8M A;  2DXQ A;  4AVA A;  3L2N A;  3LD2 A;  3BHX A;  4PSW A;  4IUS A;  1AYE A;  3GIU A;  2XEG A;  2CNS A;  1TKJ A;  2GAN A;  4NCZ A;  2Q7S A;  3D2M A;  4LUA A;  5K8O A;  1B87 A;  1VGY A;  1ON0 A;  5KTC A;  4OKO A;  4ONU A;  1UWY A;  5FVJ A;  3VWD A;  2QEC A;  3F5B A;  5CPA A;  1WWZ A;  3WC5 A;  2YNC A;  2Z3L A;  3EO4 A;  2JBK A;  4IHM A;  3TX8 A;  3F0A A;  4K30 A;  3K9T A;  1Y9W A;  4ZX8 A;  4C7I A;  1LAM A;  2Q51 A;  4LQG A;  2VZY A;  4CAE A;  5AGE A;  1DTD A;  5KTD A;  1CPS A;  3VAR A;  2QJ8 A;  4NGQ A;  1CJW A;  4L89 A;  4P6Y A;  2O28 A;  3DSB A;  4EFD A;  2R1I A;  4G1P A;  1PYT B;  1J4J A;  3D7D A;  1NSA A;  1Q2C A;  2D4P A;  2FXF A;  4JXQ A;  2VI7 A;  2FE7 A;  2HUZ A;  2WSA A;  4KUA A;  4OC2 A;  4PXC A;  4UFX A;  4NGS A;  2FVG A;  4XPK A;  4KLV A;  1KUX A;  2NMT A;  3TOA A;  5IX3 A;  2QML A;  2Z0Z A;  2GE3 A;  2OU2 A;  3FED A;  3IU2 A;  1X10 A;  5K8P A;  2CTB A;  5DWN A;  4CGM A;  3V8I A;  4X3R A;  4MXU A;  2GIV A;  3GLJ A;  3NH4 A;  4ZYQ A;  3SI0 A;  3R95 A;  3W6S A;  5AG7 A;  3RBU A;  3FB3 A;  4I49 A;  2EWB A;  3DLJ A;  4KOS A;  2ANP A;  1AMP A;  5GCN A;  3DDD A;  1YLE A; 
#chains in the Genus database with same CATH homology
 2B4B A;  3FIX A;  4KVO E;  3BLN A;  2YGW A;  4MY3 A;  2YNC C;  4C2Y A;  1PUA A;  4R9M A;  5BWA B;  3R1K A;  2P6F A;  2WPX A;  5DWM A;  4A32 A;  4F0Y A;  5C88 A;  4R3L A;  4QVT A;  4NSQ A;  2VZZ A;  4R3K A;  1NSL A;  1YGH A;  4H89 A;  3ZZI A;  2X7B A;  1YVO A;  1M4I A;  2H5M A;  3QAH A;  4B11 A;  1K4J A;  4CS0 B;  5J8F A;  1IYL A;  2CY2 A;  1IIC A;  5IB0 A;  2ZXV A;  2FSR A;  4MFL A;  2G3T A;  4GS4 A;  2R8V A;  3LOD A;  3NE7 A;  2Z11 A;  3PGP A;  2PQ8 A;  5G1Z A;  4RI1 A;  4AVC A;  4F0X A;  4UFW A;  4A30 A;  4Y49 B;  4ORF A;  2YNE A;  4UCM A;  4KVM E;  2D4O A;  2AE6 A;  4H6Z A;  2G0B A;  2ZW6 A;  3TOB A;  4JXR A;  3UY5 A;  2FS5 A;  2QIR A;  3TTH A;  3D2P A;  1CM0 A;  1PU9 A;  3FNC A;  4A31 A;  1Q2D A;  3GY9 A;  1GHE A;  4OAE A;  2IL4 A;  4MFP A;  2B3V A;  3DR6 A;  4KOV A;  4UFV A;  4ZGY B;  1Z4E A;  4C2X A;  4CGP A;  3EXN A;  2Z3O A;  3I3G A;  1MJB A;  2ZW4 A;  4KSF A;  4B10 A;  5F49 A;  4FD6 A;  5AG5 A;  2CXA A;  1YVK A;  4Y49 C;  3TO6 A;  3JUW A;  4B12 A;  4KOX A;  5JQ4 A;  3D3S A;  1KUV A;  1R57 A;  2JDC A;  2J8R A;  4KZT A;  4MI4 A;  5EC4 A;  3I9S A;  5ISV A;  4CAX A;  1KZF A;  4YRH A;  1UFH A;  3VWE A;  2REF A;  2P6E A;  2KCW A;  3KKW A;  4U5Y A;  3FRM A;  5E96 A;  2C27 A;  1SQH A;  3H5Z A;  1QSM A;  1YRE A;  4PK3 A;  4AVB A;  1OZP A;  1I1D A;  5F48 A;  3P2F A;  2JLM A;  2DPS A;  3F8K A;  4JJX A;  1U6M A;  2ATR A;  5AG6 A;  3WR7 A;  3CXS A;  4M85 A;  1S60 A;  5H86 A;  1IYK A;  3FXT A;  2WPW A;  3TFY A;  2FL4 A;  2K5T A;  4CYO A;  2J8N A;  2HV2 A;  2Z3P A;  3FYN A;  3JTK A;  3R9G A;  5H84 A;  3S6K A;  1QSO A;  4HNX B;  2B5G B;  2PR8 A;  2REE A;  1MJA A;  2PRB A;  3B8G A;  4U9Z A;  4RS2 A;  2F5I A;  2Z3M A;  4KOT A;  1YK3 A;  2VQY A;  2B3U A;  3TO7 A;  4UWI A;  1TIQ A;  4CRY B;  1VHS A;  4UCP A;  4B14 A;  1S7K A;  2CNM A;  3TCV A;  4A2Z A;  2FIW A;  4HKF A;  2ARH A;  4CRZ B;  4H6U A;  4C7H A;  2FCK A;  1L0C A;  3CXP A;  3R9F A;  5A28 A;  1M44 A;  4UA3 A;  1M4D A;  4HNY B;  2G3A A;  1FY7 A;  4JWP A;  2FT0 A;  4MFK A;  5HH1 A;  4CGN A;  2A4N A;  5G20 A;  4YGO A;  2HQY A;  1RXT A;  4NXY A;  1NE9 A;  4IF5 A;  4X5K A;  4E0A A;  2BL1 A;  2Z10 A;  3N7Z A;  2PC1 A;  1WK4 A;  4KLW A;  4AG9 A;  4OAD A;  3DR8 A;  3EY5 A;  1XEB A;  2EVN A;  5F47 A;  4UWJ A;  3T9Y A;  2Q44 A;  4JLY A;  4CAV A;  4R87 A;  1YR0 A;  4HNW B;  2PSW A;  1BO4 A;  4MBU A;  3GKR A;  3A9L A;  2VEZ A;  2CNT A;  4KUB A;  2PR1 A;  3IGR A;  2R7H A;  5C82 A;  1I21 A;  5J8C A;  5EBV A;  4E8O A;  4CGL A;  3SXN A;  1XMT A;  1Z4R A;  2WUU A;  4QC6 A;  2EUI A;  5A27 A;  1P0H A;  4FD4 A;  2DPT A;  1QSR A;  3SHP A;  2PDO A;  4YFJ A;  1ZO0 A;  1IID A;  4FD5 A;  3QB8 A;  1S3Z A;  4NF1 A;  1KUY A;  4MFJ A;  4XNH B;  3S6G A;  4MY0 A;  1P4N A;  2ZW7 A;  1S7L A;  4KOW A;  4MFZ A;  3K9U A;  3BJ7 A;  3SXO A;  1S5K A;  4KVX A;  2Z3K A;  4U9Y A;  3TT2 A;  2JEV A;  2OZG A;  4QB9 A;  2Q4V A;  2B4D B;  4M3S A;  3EFA A;  5G22 A;  5I0C A;  4XPD C;  4A95 A;  2B4D A;  4E2A A;  4ZBG A;  4AB7 A;  3IWE A;  4Q38 A;  3FBU A;  1S7N A;  5AG4 A;  3C26 A;  5JPH A;  1YX0 A;  5CNP A;  3BJ8 A;  4KOU A;  3R9E A;  5F46 A;  2ZW5 A;  4CYP A;  4DNC A;  2I79 A;  2BUE A;  1MK4 A;  4CAW A;  4AG7 A;  4PV6 A;  1XIX A;  1VKC A;  3G3S A;  4XNH C;  3G8W A;  3TO9 A;  3E0K A;  3ZJ0 A;  2B5G A;  4R57 A;  3DNS A;  4B5P B;  3T90 A;  3W6X A;  1BOB A;  2ZPA A;  4MFQ A;  2P6G A;  4C68 A;  4B5P A;  2AJ6 A;  4KSA A;  4PK2 A;  4QUS A;  4OLL A;  2JDD A;  4L8A A;  1Y9K A;  3W91 A;  1XE4 A;  1QSN A;  4MHD A;  5IV0 A;  4EVY A;  1B6B A;  3EC4 A;  1Z9U A;  3TE4 A;  2VXK A;  1M1D A;  4CGO A;  3D8P A;  3CXQ A;  1S7F A;  3IU1 A;  3IWG A;  4PSX A;  2VBQ A;  4NEX A;  4II9 A;  3OWC A;  5G21 A;  2RC4 A;  2Y0M A;  3JVN A;  3GYA A;  2I00 A;  2P0W A;  4CYN A;  2Q7B A;  2BEI A;  2YND A;  4KOR A;  2J8M A;  3R96 A;  1LRZ A;  1V0C A;  3PZJ A;  3P2H A;  4C2Z A;  4F6A A;  2OB0 A;  4MJ8 A;  4B5O A;  2OZH A;  4XPD B;  2R98 A;  3S6F A;  4KOY A;  4BBH A;  3S6H A;  2Q04 A;  4QBJ A;  1IB1 E;  1RO5 A;  2Z3N A;  4FD7 A;  4CYQ A;  2OZU A;  4LX9 A;  2BSW A;  3MGD A;  4XPL A;  4BMH A;  4UBR A;  4A33 A;  2OH1 A;  1I12 A;  2Q0Y A;  4J3G A;  4Q36 A;  2FIA A;  4KS9 A;  3PP9 A;  1Y7R A;  1MJ9 A;  4B13 A;  1QST A;  1Q2Y A;  1N71 A;  1XF8 A;  2B58 A;  1NMT A;  3H4Q A;  4UCN A;  4JD6 A;  4CAF A;  5HMN A;  2DXQ A;  4AVA A;  3LD2 A;  4PSW A;  4IUS A;  2CNS A;  2GAN A;  4NCZ A;  3D2M A;  4LUA A;  1B87 A;  1ON0 A;  5KTC A;  4ONU A;  5FVJ A;  3VWD A;  2QEC A;  3F5B A;  1WWZ A;  2YNC A;  2Z3L A;  3EO4 A;  3F0A A;  4K30 A;  1Y9W A;  4C7I A;  4CAE A;  2VZY A;  5AGE A;  5KTD A;  1CJW A;  4L89 A;  2O28 A;  3DSB A;  2R1I A;  1J4J A;  1Q2C A;  2FXF A;  4JXQ A;  2D4P A;  4KUA A;  2VI7 A;  2FE7 A;  2HUZ A;  2WSA A;  3RYO A;  5KTA A;  4UFX A;  4XPK A;  4KLV A;  1KUX A;  2NMT A;  3TOA A;  5IX3 A;  2QML A;  2Z0Z A;  2GE3 A;  2OU2 A;  3IU2 A;  4CGM A;  5DWN A;  3V8I A;  2GIV A;  3R95 A;  3W6S A;  5AG7 A;  3FB3 A;  4I49 A;  4KOS A;  2Q4Y A;  1M4G A;  5GCN A;  3DDD A;  1YLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...