5DWNA

Crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa <structure_details =
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
181
structure length
181
Chain Sequence
HHMPVIRDFQPADIETITAIYTQAVLTGTGSYEIEPPTMDEMAKRFAAFADQGFPILVAEADGRVLGYAYASYFRVRPAYRWLAEDSIYIAPDAKGQGIGKLLLRELIARISALGFRQLLAVIGDGEHNIGSVKLHESLGFTHCGRIEGSGFKHGRWLDTVLMQLPLNGGRSTEPGPSPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphinothricin N-acetyltransferase
publication title Crystal structure of Phosphinothricin N-acetyltransferase from Brucella ovis in complex with AcetylCoA
rcsb
source organism Brucella ovis (strain atcc 25840 / 63/290 / nctc 10512)
total genus 57
structure length 181
sequence length 181
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5dwnA00
3OWCA 4AG9A 2FE7A 4MY0A 3TCVA 3RYOA 1S5KA 2B5GA 3NE7A 1QSNA 1VHSA 1NE9A 3K9UA 4KLWA 1S3ZA 2A4NA 2Q44A 4JJXA 1QSOA 3CXQA 1XIXA 4CAXA 4UA3A 1KUXA 3IGRA 3T9YA 2P6FA 4EVYA 4XNHC 1YLEA 3F0AA 5IV0A 4PSXA 3QB8A 5DWNA 1I1DA 4MBUA 2FIAA 2HUZA 3W6SA 5F46A 2FXFA 5KTAA 3EO4A 4K30A 4KOUA 3G8WA 3B8GA 4XNHB 2QIRA 4JWPA 2J8NA 4AVCA 2ZW6A 4ONUA 2B3UA 3S6FA 2VEZA 4NEXA 2B5GB 5J8CA 4KOWA 4RS2A 4AB7A 1XF8A 1PUAA 2B3VA 3FIXA 3LD2A 2D4OA 4IF5A 2PR8A 5H84A 1CM0A 3SXNA 3W6XA 1UFHA 4I49A 2JLMA 2PR1A 2FSRA 5FVJA 4KOTA 1XMTA 3JVNA 4PV6A 2PQ8A 2OZUA 2BEIA 4QBJA 1OZPA 4H6UA 1XE4A 3TO9A 5E96A 4FD7A 1YVOA 2R1IA 3PZJA 4OADA 2I79A 2B4BA 2FT0A 2X7BA 2FL4A 4KUAA 4ZBGA 2ARHA 2Q7BA 4NF1A 1TIQA 4GS4A 4KLVA 4UWJA 4OAEA 1R57A 2FS5A 1IYKA 4KORA 2R8VA 2Z10A 2ZW7A 1B6BA 5F47A 2CNSA 1Y9WA 4R9MA 2J8MA 2G3AA 3WR7A 3EY5A 5JPHA 1LRZA 4JXQA 1L0CA 2REFA 4JLYA 3TFYA 3PGPA 1S7KA 3EXNA 2I00A 3VWDA 4CS0B 1S7FA 4LX9A 5I0CA 3BJ7A 3FRMA 2D4PA 5KTDA 3EFAA 4U9ZA 5F48A 3R95A 3TTHA 4CRZB 3C26A 3E0KA 1K4JA 3S6KA 3V8IA 1U6MA 1IB1E 1M4IA 3FBUA 3DSBA 1XEBA 5KTCA 3TOAA 1MJ9A 2P6GA 2F5IA 4LUAA 1NMTA 4U5YA 4F6AA 3CXSA 4QB9A 5JQ4A 3ZJ0A 2GANA 5IX3A 2Q04A 1IICA 2FIWA 1M4DA 1YGHA 2FCKA 3EC4A 2GIVA 4JXRA 2G0BA 2Q0YA 2JDCA 4L89A 1RO5A 4NSQA 3KKWA 4NXYA 3R9EA 2WPXA 3IWGA 1QSMA 4HNYB 2IL4A 2QMLA 3DNSA 2OH1A 4KVOE 2Q4VA 2VZZA 4XPLA 3H4QA 4PSWA 4E0AA 4MJ8A 3VWEA 5ISVA 2WPWA 3FB3A 3CXPA 4II9A 5CNPA 4E2AA 2H5MA 1KUYA 3TE4A 5F49A 1KUVA 4HKFA 3R96A 3P2FA 1V0CA 4AVAA 3G3SA 3MGDA 4KVXA 2VBQA 4B5OA 3DR6A 4J3GA 2CNMA 2PDOA 4FD4A 2VI7A 3GY9A 2GE3A 2G3TA 1QSTA 2ZW5A 3BJ8A 1YVKA 4KOSA 1S60A 2OZHA 4CAWA 1I21A 2B4DB 3N7ZA 5GCNA 1M1DA 3F5BA 3S6HA 1QSRA 1RXTA 4B5PB 3P2HA 4BMHA 2R7HA 5H86A 4AVBA 2BSWA 2KCWA 2CY2A 4HNWB 2Q4YA 4QVTA 3W91A 5HH1A 1Y9KA 1BOBA 2P6EA 1S7LA 3F8KA 3TOBA 5HMNA 2AE6A 1Q2YA 3LODA 2VXKA 1Z9UA 4QUSA 1VKCA 4Y49C 3UY5A 4R3LA 4R57A 3DDDA 4JD6A 1B87A 1WK4A 2ZW4A 4KOYA 4MHDA 4U9YA 2QECA 3GYAA 2HQYA 2BL1A 3FYNA 1GHEA 1ON0A 4H89A 4MI4A 4OLLA 3R9FA 5C82A 4XPKA 4DNCA 4M85A 4Y49B 4HNXB 2PRBA 1M4GA 1YR0A 4R87A 4NCZA 2REEA 4X5KA 4M3SA 3DR8A 3D8PA 1BO4A 1J4JA 5IB0A 4KVME 4L8AA 4PK2A 2ZPAA 1KZFA 1P4NA 4UWIA 2NMTA 1FY7A 2Z11A 4RI1A 4KOXA 2B4DA 1N71A 3FNCA 2AJ6A 4MY3A 4B5PA 4CRYB 3TT2A 4KOVA 1I12A 2VQYA 2Y0MA 1Q2DA 2R98A 4YRHA 1Z4RA 2OB0A 3SXOA 2RC4A 2PC1A 4FD6A 2Z0ZA 1Q2CA 2DXQA 4UBRA 3GKRA 2CNTA 4CAVA 2OZGA 3S6GA 1YX0A 4QC6A 1IIDA 5C88A 3I9SA 4XPDC 3T90A 3ZZIA 2BUEA 2JEVA 4YFJA 2JDDA 4FD5A 2PSWA 5J8FA 4KUBA 5DWMA 2HV2A 2O28A 1YK3A 3QAHA 5EBVA 1SQHA 4R3KA 3D2PA 2B58A 4XPDB 1IYLA 1Z4EA 1MK4A 3I3GA 3TO6A 2OU2A 2P0WA 3JUWA 4YGOA 2J8RA 4AG7A 3PP9A 3FXTA 4E8OA 3BLNA 1PU9A 1WWZA 3SHPA 4F0YA 2ATRA 1NSLA 3D2MA 5EC4A 3D3SA 1CJWA 4ORFA 2VZYA 4PK3A 2EUIA 3R9GA 1S7NA 1M44A 4KZTA 3R1KA 3TO7A 1P0HA 1Y7RA 2C27A 2EVNA 2ZXVA 1MJBA 2K5TA 1MJAA 4H6ZA 4IUSA 1YREA
chains in the Genus database with same CATH superfamily
4ZGYB 1Y0RA 3OWCA 2EK9A 4AG9A 4ZY0A 5K8MA 3BHXA 2FE7A 4MY0A 4R8FA 1TF9A 3TCVA 4BBHA 4ZY2A 3RYOA 1QQ9A 1NSAA 2ZELA 1ZG7A 1S5KA 2PCUA 2B5GA 3NE7A 3PBBA 1QSNA 1R43A 1VHSA 3D7HA 1NE9A 3K9UA 4LQGA 2Z3NA 3IU2A 1S3ZA 2IJZA 2A4NA 2Q44A 4JJXA 4KLWA 1QSOA 1Z8WA 2POKA 3CPXA 1HDQA 3CXQA 1XIXA 4CAXA 4UA3A 1KUXA 1IGBA 4OP4A 1IOFA 1Y7EA 2O4HA 3IGRA 2ZEPA 3RO0A 1GYTA 4ZYQA 3T9YA 2P6FA 4EVYA 4XNHC 1YLEA 4NGQA 3F0AA 5IV0A 4B13A 2PJ5A 3WC6A 4UEFA 3GIUA 1ARLA 4PSXA 4YWYA 1ARMA 3QB8A 1LAPA 1XRYA 2PJ9A 5DWNA 4NJRA 1I1DA 3KZWA 2XEIA 1YW4A 4MBUA 1LCPA 4ONWA 2GREA 3FH4A 3BXMA 2FIAA 4R76A 4A39A 2FVGA 2HUZA 1CG2A 2EWBA 3H8FA 2BCOA 1F2PA 4P6YA 2OOTA 3W6SA 4A37A 5F46A 2PJ8A 2FXFA 2GFQA 5KTAA 5AGEA 3WC5A 3EO4A 4K30A 4KOUA 3G8WA 1VGYA 2AFMA 3B8GA 2F8HA 4XNHB 4MFLA 1TXRA 2QIRA 2Q4ZA 4JWPA 2ABZA 2J8NA 4CPAA 3S9NA 4AVCA 2ZW6A 2CF4A 4NFRA 4ONUA 2B3UA 3S6FA 3B35A 2VEZA 4NEXA 2B5GB 5J8CA 4CGLA 4KOWA 4RS2A 3IIBA 4AB7A 2O53A 3PB8X 1XF8A 1PUAA 4C7IA 2B3VA 4OMEA 4NJQA 3KQZA 3FIXA 3LD2A 4Q36A 2D4OA 4IF5A 2PR8A 5H84A 1CM0A 3D66A 4P10A 3SXNA 4UFVA 4B6ZA 3RNZA 3W6XA 1UFHA 3L2NA 2YNDA 2QVPA 1R3NA 4I49A 4C68A 3SI2A 4C2ZA 2JLMA 2Z3OA 5A27A 5CBMA 2PR1A 2FSRA 5FVJA 4KOTA 1XMTA 4RUHA 3JVNA 2Z3KA 2PIZA 4PV6A 2PQ8A 5LYDA 3QAYA 4UF4A 1ZLIA 2OZUA 3B7IA 2BEIA 5A28A 1BPNA 2QJ8A 4R6TA 4QBJA 1OZPA 2PJ1A 4H6UA 2ZENA 1XE4A 4MRIA 3TO9A 3D4UA 4B10A 2YNEA 4FD7A 1A2ZA 5E96A 2HC9A 4M6IA 1YVOA 2R1IA 3S9LA 2J9AA 3PZJA 4OADA 2I79A 3K2KA 2B4BA 2FT0A 2X7BA 2FL4A 2AFUA 4KUAA 4R7MA 2ARHA 5AG7A 4ZBGA 4NF1A 2Q7BA 1TIQA 4GS4A 4KLVA 4UWJA 4ZX9A 4OAEA 2AFZA 1R57A 2FS5A 1IYKA 4KORA 3PFOA 1TKJA 2R8VA 2Z10A 2ZW7A 4PXBA 1B6BA 5F47A 3SI1A 2CNSA 1Y9WA 4PQAA 3PB9X 4P45A 2AFWA 4R9MA 3IU1A 2J8MA 3VH9A 4KSIA 2G3AA 3KHXA 3WR7A 2C6PA 2I3CA 3EY5A 4UCMA 2PJAA 5JPHA 2PJ3A 1LRZA 2EBJA 4JXQA 1L0CA 4P4EA 2REFA 2IMOA 4MHYA 4JLYA 3TFYA 3PFEA 3PGPA 5AG5A 3WABA 1S7KA 3LACA 3EXNA 1IU8A 2I00A 1LAMA 6CPAA 2EO8A 3VWDA 4CS0B 1S7FA 4LX9A 5I0CA 3NFZA 2QYVA 3FEDA 4MCQA 3BJ7A 4OC3A 2ZEEA 1XJOA 3FRMA 2D4PA 5KTDA 3EFAA 4U9ZA 5F48A 3R95A 3TTHA 2BO9A 3NH4A 4UIAA 4CAEA 1YLOA 4CRZB 3C26A 3E0KA 1K4JA 1PCAA 3S6KA 3V8IA 1U6MA 1IB1E 1M4IA 3FBUA 4XPLA 4OC4A 3DSBA 1XEBA 2Z3PA 5KTCA 3TOAA 2XEGA 2WZNA 1MJ9A 1AMPA 5JGFA 2P6GA 3JRUA 4PXDA 3GUXA 4MCSA 2Q51A 2F5IA 4MXUA 1JWQA 1CBXA 4IAVA 4KSAA 4LUAA 1Z2LA 4A94A 4B14A 3KI9A 3CZXA 1NMTA 4U5YA 4A95A 8CPAA 3BI0A 4F6AA 3CXSA 4QB9A 4CYQA 5JQ4A 4P4FA 2GANA 1BPMA 3DLJA 1EE3P 3NH8A 4ZX8A 3ZJ0A 2C6GA 5IX3A 2Q04A 4NGNA 2YGWA 1IICA 2FIWA 1M4DA 1YGHA 2AFXA 2FCKA 3EC4A 2GIVA 4JXRA 2G0BA 2Q0YA 2JDCA 3T8WA 4L89A 2IQ6A 1TKFA 1RO5A 1QMUA 2V8DA 4NSQA 5AG6A 1YW6A 3KKWA 4NXYA 3D7GA 3R9EA 3NH5A 1ZO0A 2Z3LA 5D29A 2ANPA 2WPXA 3IWGA 3TX8A 1QSMA 4MHZA 1VIXA 1X10A 2IL4A 2QMLA 3DNSA 2OH1A 2Q4VA 4HNYB 2VZZA 3D67A 3KASA 3H4QA 4KVOE 4NGSA 4NGPA 3WT4A 4PSWA 5LRGA 4E0AA 4Q38A 3BI1A 2Q43A 4YU9A 3D7DA 3PB4X 4MJ8A 4HPSA 3VWEA 2PVVA 5ISVA 5HVHA 4CGNA 2WPWA 2NYQA 3FB3A 1PYTB 3A9LA 3CXPA 4F9UA 5LYLA 4II9A 1JQGA 4GM5A 2RB7A 5CNPA 4OC5A 3NA6A 4E2AA 2H5MA 3IWWA 2XEJA 4PPZA 1KUYA 3TE4A 5F49A 1KUVA 4HKFA 1F57A 3R96A 1VHEA 2G9DA 3P2FA 4EFDA 1V0CA 2EK8A 4AVAA 3G3SA 3MGDA 4KVXA 2PJ4A 2VBQA 5HXDA 4B5OA 3FECA 4OC0A 4MCRA 3IFEA 3DR6A 2ZEMA 4J3GA 2CNMA 2PDOA 3B2YA 4FD4A 4DUKA 2VI7A 3FMCA 3GY9A 2GE3A 2PJ7A 2G3TA 4IHMA 1QSTA 2ZW5A 5G20A 4MCPA 4UFWA 5LRJA 1XFOA 3BJ8A 3KHZA 1YVKA 2ZEHA 5JH9A 3TC8A 4KOSA 1S60A 2WUUA 2OZHA 4CAWA 2RFHA 2ZEFA 4UCNA 5J1QA 1CPXA 2PRQA 2JBKA 1I21A 4C7HA 2B4DB 1F2OA 4CGMA 2AFOA 4OC1A 3N7ZA 5GCNA 4CGPA 4UFXA 1M1DA 3F5BA 1KWMA 3S6HA 4G1PA 1QSRA 1RTQA 1RXTA 3P2HA 3SJFA 4B5PB 4BMHA 2R7HA 1XOVA 2CTBA 5H86A 5G1ZA 4AVBA 1HDUA 2BSWA 4FAIA 3FF3A 2KCWA 4OKOA 2CY2A 4HNWB 2Q4YA 4P4JA 2HB6A 2V8HA 3IO1A 1IY7A 4QVTA 3W91A 4AXVA 4MFKA 5HH1A 1Y9KA 1BOBA 1IOIA 4P4DA 2P6EA 4KSFA 1S7LA 3RAMA 4NGTA 1AYEA 2PJCA 3F8KA 2CIJA 3FVLA 3TOBA 5HMNA 4RN7A 3I1UA 2AE6A 5CPAA 1Q2YA 3VARA 3LODA 2DPSA 1Z8TA 2VXKA 1Z9UA 3GLJA 4QUSA 2ODFA 2PVWA 4MFZA 4X3RA 4CGOA 1VKCA 4OC2A 4A30A 2C1CA 2NSMA 4Y49C 1DE4C 3UY5A 4P4BA 4R3LA 4UIBA 4EWTA 4A32A 4R57A 5DS0A 7CPAA 3MRUA 3DDDA 4JD6A 1B87A 1WK4A 1YQEA 2PIYA 2ZW4A 4W9YA 4KOYA 1H8LA 4MHDA 4U9YA 4EMEA 1BAVA 3KGQA 3PRTA 2QECA 2C6CA 3GYAA 2F7VA 3ISXA 3KR5A 4Z65A 1Z8LA 2HQYA 2BL1A 3FJUA 1LANA 3FYNA 3D7FA 3KR4A 4WWVA 5ELYA 3SJXA 1CPSA 1GHEA 3PBEA 1Z8XA 1ON0A 5LYIA 4H89A 4MI4A 3PB7X 4PXEA 1UWYA 1ELLP 4OLLA 3H5ZA 3R9FA 5C82A 4XPKA 2JEWA 4DNCA 1CX8A 1HEEA 3K9TA 4M85A 4Y49B 5G21A 4DYOA 4HNXB 2PRBA 5D8NA 1M4GA 1YR0A 4P4IA 2PJ2A 4R87A 3VATA 3D68A 4NCZA 3GB0A 4UEEA 2VL1A 4MFQA 2REEA 4X5KA 3B3SA 3PB6X 3FEEA 4M3SA 4A2ZA 4C2XA 3DR8A 3D8PA 4UCPA 2CTCA 1BO4A 1J4JA 2V8VA 5IB0A 1CP7A 4KVME 3RBUA 5THWA 1ELMP 4L8AA 4PK2A 2ZPAA 1KZFA 1P4NA 2ZOGA 4UWIA 2NMTA 1FY7A 4NGRA 2Z11A 4RI1A 5HVFA 5AG4A 2Z3MA 4KOXA 3H8EA 4TNUA 4FBEA 1VHOA 2B4DA 1N71A 3V38A 4FUUA 1DTDA 3V7ZA 3FNCA 3H8GA 3B3CA 4MFJA 2AJ6A 4MHPA 3PEIA 4MY3A 2Q7SA 1YSJA 4NGMA 3SJGA 4B5PA 5K8PA 4CRYB 1LFWA 3TT2A 1OBRA 4BD9A 4KOVA 1I12A 2VQYA 2Y0MA 1Q2DA 4GXHA 3RZAA 4DJLA 2R98A 5LRKA 2ZEOA 1XBUA 4P44A 4YRHA 3DGVA 1Q7LA 1XMBA 4KS9A 1Z4RA 4MMOA 1TF8A 2OB0A 4M6HA 4PXCA 4H2KA 3S9MA 2ZEDA 3SXOA 2RC4A 2BOAA 4ZI6A 2AFSA 2PC1A 3IC1A 5K8NA 5K8OA 4F0XA 4FD6A 4A31A 4CAFA 2Z0ZA 5I4MA 1Q2CA 4F8ZA 2DXQA 3SJEA 4ZY1A 2GLFA 5EMIA 4UBRA 3GKRA 2PJ0A 3KQXA 1ZG9A 2CNTA 2WSAA 4CAVA 2DF5A 2OZGA 3S6GA 1YX0A 4QC6A 3ISZA 1IIDA 4LQ6A 2GLJA 5C88A 3I9SA 4WJBA 4XPDC 2CXAA 3SI0A 4UEZA 3T90A 3ZZIA 2BUEA 5F09A 2JEVA 1FNOA 3N5FA 2PJBA 3WC7A 4CYPA 4YFJA 4MFPA 3HLPA 4X2TA 2PE3A 2JDDA 4FD5A 2PSWA 5J8FA 4KUBA 3MN8A 2ZEGA 5DWMA 2HV2A 2O28A 2JBJA 5IB9A 1YK3A 3QAHA 5EBVA 2PJ6A 1SQHA 1Z5RA 4R3KA 4X8IA 3FX6A 4A33A 3D2PA 1M4LA 3B3WA 1Y0YA 3LMSA 4JYWA 2V77A 4OIDA 2B58A 4TWEA 3IJ3A 4XPDB 5JM6A 3QNVA 1X12A 2V8GA 1IYLA 1Z4EA 1MK4A 4Q7AA 3I3GA 1ZG8A 3LWUA 3TO6A 2OU2A 5LYFA 2P0WA 3JUWA 1ZLHA 1FT7A 4YGOA 2J8RA 4MHNA 4C2YA 4AG7A 4OIWA 1BLLE 2YNCA 3PP9A 1AUGA 3FXTA 4E8OA 3BLNA 1PU9A 1WWZA 4CYNA 3CPAA 2XEFA 4F9VA 3SHPA 4CYOA 4A38A 2ATRA 4F0YA 1NSLA 4B12A 2DPTA 3JTKA 3D2MA 5EC4A 1TKHA 4M6GA 3CT9A 1LOKA 3D3SA 1CJWA 4ORFA 2VZYA 4PK3A 2ZOFA 4O23A 1CP6A 4IK2A 2EUIA 3R9GA 2DEAA 3IWEA 2WYRA 1S7NA 1M44A 4KZTA 3R1KA 2GU2A 3TO7A 5BWAB 1P0HA 3NE8A 2YNCC 1Y7RA 3CDXA 4JZ0A 2C27A 1YMEA 2EVNA 3B3TA 5G22A 2OR4A 2ZXVA 1MJBA 4K3NA 4B11A 2K5TA 4FWUA 3HUVA 3IEHA 1MJAA 4BINA 4H6ZA 4IUSA 5HVGA 3B3VA 3KL9A 1YREA
chains in the Genus database with same CATH topology
4ZGYB 3OWCA 4AG9A 2FE7A 4MY0A 3TCVA 4BBHA 3RYOA 1S5KA 2B5GA 3NE7A 1QSNA 1VHSA 1NE9A 3K9UA 2Z3NA 3IU2A 1S3ZA 4KLWA 2A4NA 2Q44A 4JJXA 1QSOA 3CXQA 1XIXA 4CAXA 4UA3A 1KUXA 3IGRA 3T9YA 2P6FA 4EVYA 4XNHC 1YLEA 3F0AA 5IV0A 4B13A 4PSXA 3QB8A 5DWNA 1I1DA 4MBUA 2FIAA 2HUZA 3W6SA 5F46A 2FXFA 5KTAA 5AGEA 3EO4A 4K30A 4KOUA 3G8WA 3B8GA 4XNHB 4MFLA 2QIRA 4JWPA 2J8NA 4AVCA 2ZW6A 4ONUA 2B3UA 3S6FA 2VEZA 4NEXA 2B5GB 5J8CA 4CGLA 4KOWA 4RS2A 4AB7A 4C7IA 1XF8A 1PUAA 2B3VA 3FIXA 3LD2A 4Q36A 2D4OA 4IF5A 2PR8A 5H84A 1CM0A 3SXNA 4UFVA 3W6XA 1UFHA 2YNDA 4I49A 4C68A 4C2ZA 2JLMA 2Z3OA 5A27A 2PR1A 2FSRA 5FVJA 4KOTA 1XMTA 3JVNA 2Z3KA 4PV6A 2PQ8A 2OZUA 2BEIA 5A28A 4QBJA 1OZPA 4H6UA 1XE4A 3TO9A 4B10A 2YNEA 4FD7A 5E96A 1YVOA 2R1IA 3PZJA 4OADA 2I79A 2B4BA 2FT0A 2X7BA 2FL4A 4KUAA 4ZBGA 2ARHA 5AG7A 2Q7BA 4NF1A 1TIQA 4GS4A 4KLVA 4UWJA 4OAEA 1R57A 2FS5A 1IYKA 4KORA 2R8VA 2Z10A 2ZW7A 1B6BA 5F47A 2CNSA 1Y9WA 4R9MA 3IU1A 2J8MA 2G3AA 3WR7A 3EY5A 5JPHA 1LRZA 4JXQA 1L0CA 2REFA 4JLYA 3TFYA 3PGPA 5AG5A 1S7KA 3EXNA 2I00A 3VWDA 4CS0B 1S7FA 4LX9A 5I0CA 3BJ7A 3FRMA 2D4PA 5KTDA 3EFAA 4U9ZA 5F48A 3R95A 3TTHA 4CAEA 4CRZB 3C26A 3E0KA 1K4JA 3S6KA 3V8IA 1U6MA 1IB1E 1M4IA 3FBUA 3DSBA 1XEBA 2Z3PA 5KTCA 3TOAA 1MJ9A 2P6GA 2F5IA 4KSAA 4LUAA 4B14A 1NMTA 4U5YA 4A95A 4F6AA 3CXSA 4QB9A 4CYQA 5JQ4A 3ZJ0A 2GANA 5IX3A 2Q04A 2YGWA 1IICA 2FIWA 1M4DA 1YGHA 2FCKA 3EC4A 2GIVA 4JXRA 2G0BA 2Q0YA 2JDCA 4L89A 1RO5A 4NSQA 5AG6A 3KKWA 4NXYA 3R9EA 1ZO0A 2Z3LA 2WPXA 3IWGA 1QSMA 4HNYB 2IL4A 2QMLA 3DNSA 2OH1A 2Q4VA 4KVOE 2VZZA 4UCMA 4XPLA 3H4QA 4PSWA 4E0AA 4Q38A 4MJ8A 3VWEA 5ISVA 4CGNA 2WPWA 3FB3A 3A9LA 3CXPA 4II9A 5CNPA 4E2AA 2H5MA 1KUYA 3TE4A 5F49A 1KUVA 4HKFA 3R96A 3P2FA 1V0CA 4AVAA 3G3SA 3MGDA 4KVXA 2VBQA 4B5OA 3DR6A 4J3GA 2CNMA 2PDOA 4FD4A 2VI7A 3GY9A 2GE3A 2G3TA 1QSTA 2ZW5A 5G20A 4UFWA 3BJ8A 1YVKA 4KOSA 1S60A 2WUUA 2OZHA 4CAWA 4UCNA 1I21A 4C7HA 2B4DB 4CGMA 3N7ZA 5GCNA 4CGPA 4UFXA 1M1DA 3F5BA 3S6HA 1QSRA 1RXTA 4B5PB 3P2HA 4BMHA 2R7HA 5H86A 4AVBA 5G1ZA 2BSWA 2KCWA 2CY2A 4HNWB 2Q4YA 4QVTA 3W91A 4MFKA 5HH1A 1Y9KA 1BOBA 2P6EA 4KSFA 1S7LA 3F8KA 3TOBA 5HMNA 2AE6A 1Q2YA 3LODA 2DPSA 2VXKA 1Z9UA 4QUSA 4CGOA 4MFZA 1VKCA 4A30A 4Y49C 3UY5A 4R3LA 4A32A 4R57A 3DDDA 4JD6A 1B87A 1WK4A 2ZW4A 4KOYA 4MHDA 4U9YA 2QECA 3GYAA 2HQYA 2BL1A 3FYNA 1GHEA 1ON0A 4H89A 4MI4A 4OLLA 3H5ZA 3R9FA 5C82A 4XPKA 4DNCA 4M85A 4Y49B 5G21A 4HNXB 2PRBA 1M4GA 1YR0A 4R87A 4NCZA 4MFQA 2REEA 4X5KA 4M3SA 4A2ZA 4C2XA 3DR8A 3D8PA 4UCPA 1BO4A 1J4JA 5IB0A 4KVME 4L8AA 4PK2A 2ZPAA 1KZFA 1P4NA 4UWIA 2NMTA 1FY7A 2Z11A 4RI1A 5AG4A 2Z3MA 4KOXA 2B4DA 1N71A 3FNCA 4MFJA 2AJ6A 4MY3A 4B5PA 4CRYB 3TT2A 4KOVA 1I12A 2VQYA 2Y0MA 1Q2DA 2R98A 4YRHA 4KS9A 1Z4RA 2OB0A 3SXOA 2RC4A 2PC1A 4F0XA 4FD6A 4A31A 4CAFA 2Z0ZA 1Q2CA 2DXQA 4UBRA 3GKRA 2CNTA 2WSAA 4CAVA 2OZGA 3S6GA 1YX0A 4QC6A 1IIDA 5C88A 3I9SA 4XPDC 2CXAA 3T90A 3ZZIA 2BUEA 2JEVA 4CYPA 4YFJA 4MFPA 2JDDA 4FD5A 2PSWA 5J8FA 4KUBA 5DWMA 2HV2A 2O28A 1YK3A 3QAHA 5EBVA 1SQHA 4R3KA 4A33A 3D2PA 2B58A 4XPDB 1IYLA 1Z4EA 1MK4A 3I3GA 3TO6A 2OU2A 2P0WA 3JUWA 4YGOA 2J8RA 4C2YA 4AG7A 3PP9A 2YNCA 3FXTA 4E8OA 3BLNA 1PU9A 1WWZA 4CYNA 3SHPA 4CYOA 4F0YA 2ATRA 1NSLA 4B12A 2DPTA 3JTKA 3D2MA 5EC4A 3D3SA 1CJWA 4ORFA 2VZYA 4PK3A 2EUIA 3R9GA 3IWEA 1S7NA 1M44A 4KZTA 3R1KA 3TO7A 5BWAB 1P0HA 2YNCC 1Y7RA 2C27A 2EVNA 5G22A 2ZXVA 4B11A 1MJBA 2K5TA 1MJAA 4H6ZA 4IUSA 1YREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWC A;  4AG9 A;  2FE7 A;  4MY0 A;  3TCV A;  3RYO A;  1S5K A;  2B5G A;  3NE7 A;  1QSN A;  1VHS A;  1NE9 A;  3K9U A;  4KLW A;  1S3Z A;  2A4N A;  2Q44 A;  4JJX A;  1QSO A;  3CXQ A;  1XIX A;  4CAX A;  4UA3 A;  1KUX A;  3IGR A;  3T9Y A;  2P6F A;  4EVY A;  4XNH C;  1YLE A;  3F0A A;  5IV0 A;  4PSX A;  3QB8 A;  5DWN A;  1I1D A;  4MBU A;  2FIA A;  2HUZ A;  3W6S A;  5F46 A;  2FXF A;  5KTA A;  3EO4 A;  4K30 A;  4KOU A;  3G8W A;  3B8G A;  4XNH B;  2QIR A;  4JWP A;  2J8N A;  4AVC A;  2ZW6 A;  4ONU A;  2B3U A;  3S6F A;  2VEZ A;  4NEX A;  2B5G B;  5J8C A;  4KOW A;  4RS2 A;  4AB7 A;  1XF8 A;  1PUA A;  2B3V A;  3FIX A;  3LD2 A;  2D4O A;  4IF5 A;  2PR8 A;  5H84 A;  1CM0 A;  3SXN A;  3W6X A;  1UFH A;  4I49 A;  2JLM A;  2PR1 A;  2FSR A;  5FVJ A;  4KOT A;  1XMT A;  3JVN A;  4PV6 A;  2PQ8 A;  2OZU A;  2BEI A;  4QBJ A;  1OZP A;  4H6U A;  1XE4 A;  3TO9 A;  5E96 A;  4FD7 A;  1YVO A;  2R1I A;  3PZJ A;  4OAD A;  2I79 A;  2B4B A;  2FT0 A;  2X7B A;  2FL4 A;  4KUA A;  4ZBG A;  2ARH A;  2Q7B A;  4NF1 A;  1TIQ A;  4GS4 A;  4KLV A;  4UWJ A;  4OAE A;  1R57 A;  2FS5 A;  1IYK A;  4KOR A;  2R8V A;  2Z10 A;  2ZW7 A;  1B6B A;  5F47 A;  2CNS A;  1Y9W A;  4R9M A;  2J8M A;  2G3A A;  3WR7 A;  3EY5 A;  5JPH A;  1LRZ A;  4JXQ A;  1L0C A;  2REF A;  4JLY A;  3TFY A;  3PGP A;  1S7K A;  3EXN A;  2I00 A;  3VWD A;  4CS0 B;  1S7F A;  4LX9 A;  5I0C A;  3BJ7 A;  3FRM A;  2D4P A;  5KTD A;  3EFA A;  4U9Z A;  5F48 A;  3R95 A;  3TTH A;  4CRZ B;  3C26 A;  3E0K A;  1K4J A;  3S6K A;  3V8I A;  1U6M A;  1IB1 E;  1M4I A;  3FBU A;  3DSB A;  1XEB A;  5KTC A;  3TOA A;  1MJ9 A;  2P6G A;  2F5I A;  4LUA A;  1NMT A;  4U5Y A;  4F6A A;  3CXS A;  4QB9 A;  5JQ4 A;  3ZJ0 A;  2GAN A;  5IX3 A;  2Q04 A;  1IIC A;  2FIW A;  1M4D A;  1YGH A;  2FCK A;  3EC4 A;  2GIV A;  4JXR A;  2G0B A;  2Q0Y A;  2JDC A;  4L89 A;  1RO5 A;  4NSQ A;  3KKW A;  4NXY A;  3R9E A;  2WPX A;  3IWG A;  1QSM A;  4HNY B;  2IL4 A;  2QML A;  3DNS A;  2OH1 A;  4KVO E;  2Q4V A;  2VZZ A;  4XPL A;  3H4Q A;  4PSW A;  4E0A A;  4MJ8 A;  3VWE A;  5ISV A;  2WPW A;  3FB3 A;  3CXP A;  4II9 A;  5CNP A;  4E2A A;  2H5M A;  1KUY A;  3TE4 A;  5F49 A;  1KUV A;  4HKF A;  3R96 A;  3P2F A;  1V0C A;  4AVA A;  3G3S A;  3MGD A;  4KVX A;  2VBQ A;  4B5O A;  3DR6 A;  4J3G A;  2CNM A;  2PDO A;  4FD4 A;  2VI7 A;  3GY9 A;  2GE3 A;  2G3T A;  1QST A;  2ZW5 A;  3BJ8 A;  1YVK A;  4KOS A;  1S60 A;  2OZH A;  4CAW A;  1I21 A;  2B4D B;  3N7Z A;  5GCN A;  1M1D A;  3F5B A;  3S6H A;  1QSR A;  1RXT A;  4B5P B;  3P2H A;  4BMH A;  2R7H A;  5H86 A;  4AVB A;  2BSW A;  2KCW A;  2CY2 A;  4HNW B;  2Q4Y A;  4QVT A;  3W91 A;  5HH1 A;  1Y9K A;  1BOB A;  2P6E A;  1S7L A;  3F8K A;  3TOB A;  5HMN A;  2AE6 A;  1Q2Y A;  3LOD A;  2VXK A;  1Z9U A;  4QUS A;  1VKC A;  4Y49 C;  3UY5 A;  4R3L A;  4R57 A;  3DDD A;  4JD6 A;  1B87 A;  1WK4 A;  2ZW4 A;  4KOY A;  4MHD A;  4U9Y A;  2QEC A;  3GYA A;  2HQY A;  2BL1 A;  3FYN A;  1GHE A;  1ON0 A;  4H89 A;  4MI4 A;  4OLL A;  3R9F A;  5C82 A;  4XPK A;  4DNC A;  4M85 A;  4Y49 B;  4HNX B;  2PRB A;  1M4G A;  1YR0 A;  4R87 A;  4NCZ A;  2REE A;  4X5K A;  4M3S A;  3DR8 A;  3D8P A;  1BO4 A;  1J4J A;  5IB0 A;  4KVM E;  4L8A A;  4PK2 A;  2ZPA A;  1KZF A;  1P4N A;  4UWI A;  2NMT A;  1FY7 A;  2Z11 A;  4RI1 A;  4KOX A;  2B4D A;  1N71 A;  3FNC A;  2AJ6 A;  4MY3 A;  4B5P A;  4CRY B;  3TT2 A;  4KOV A;  1I12 A;  2VQY A;  2Y0M A;  1Q2D A;  2R98 A;  4YRH A;  1Z4R A;  2OB0 A;  3SXO A;  2RC4 A;  2PC1 A;  4FD6 A;  2Z0Z A;  1Q2C A;  2DXQ A;  4UBR A;  3GKR A;  2CNT A;  4CAV A;  2OZG A;  3S6G A;  1YX0 A;  4QC6 A;  1IID A;  5C88 A;  3I9S A;  4XPD C;  3T90 A;  3ZZI A;  2BUE A;  2JEV A;  4YFJ A;  2JDD A;  4FD5 A;  2PSW A;  5J8F A;  4KUB A;  5DWM A;  2HV2 A;  2O28 A;  1YK3 A;  3QAH A;  5EBV A;  1SQH A;  4R3K A;  3D2P A;  2B58 A;  4XPD B;  1IYL A;  1Z4E A;  1MK4 A;  3I3G A;  3TO6 A;  2OU2 A;  2P0W A;  3JUW A;  4YGO A;  2J8R A;  4AG7 A;  3PP9 A;  3FXT A;  4E8O A;  3BLN A;  1PU9 A;  1WWZ A;  3SHP A;  4F0Y A;  2ATR A;  1NSL A;  3D2M A;  5EC4 A;  3D3S A;  1CJW A;  4ORF A;  2VZY A;  4PK3 A;  2EUI A;  3R9G A;  1S7N A;  1M44 A;  4KZT A;  3R1K A;  3TO7 A;  1P0H A;  1Y7R A;  2C27 A;  2EVN A;  2ZXV A;  1MJB A;  2K5T A;  1MJA A;  4H6Z A;  4IUS A;  1YRE A; 
#chains in the Genus database with same CATH topology
 4ZGY B;  1Y0R A;  3OWC A;  2EK9 A;  4AG9 A;  4ZY0 A;  5K8M A;  3BHX A;  2FE7 A;  4MY0 A;  4R8F A;  1TF9 A;  3TCV A;  4BBH A;  4ZY2 A;  3RYO A;  1QQ9 A;  1NSA A;  2ZEL A;  1ZG7 A;  1S5K A;  2PCU A;  2B5G A;  3NE7 A;  3PBB A;  1QSN A;  1R43 A;  1VHS A;  3D7H A;  1NE9 A;  3K9U A;  4LQG A;  2Z3N A;  3IU2 A;  1S3Z A;  2IJZ A;  2A4N A;  2Q44 A;  4JJX A;  4KLW A;  1QSO A;  1Z8W A;  2POK A;  3CPX A;  1HDQ A;  3CXQ A;  1XIX A;  4CAX A;  4UA3 A;  1KUX A;  1IGB A;  4OP4 A;  1IOF A;  1Y7E A;  2O4H A;  3IGR A;  2ZEP A;  3RO0 A;  1GYT A;  4ZYQ A;  3T9Y A;  2P6F A;  4EVY A;  4XNH C;  1YLE A;  4NGQ A;  3F0A A;  5IV0 A;  4B13 A;  2PJ5 A;  3WC6 A;  4UEF A;  3GIU A;  1ARL A;  4PSX A;  4YWY A;  1ARM A;  3QB8 A;  1LAP A;  1XRY A;  2PJ9 A;  5DWN A;  4NJR A;  1I1D A;  3KZW A;  2XEI A;  1YW4 A;  4MBU A;  1LCP A;  4ONW A;  2GRE A;  3FH4 A;  3BXM A;  2FIA A;  4R76 A;  4A39 A;  2FVG A;  2HUZ A;  1CG2 A;  2EWB A;  3H8F A;  2BCO A;  1F2P A;  4P6Y A;  2OOT A;  3W6S A;  4A37 A;  5F46 A;  2PJ8 A;  2FXF A;  2GFQ A;  5KTA A;  5AGE A;  3WC5 A;  3EO4 A;  4K30 A;  4KOU A;  3G8W A;  1VGY A;  2AFM A;  3B8G A;  2F8H A;  4XNH B;  4MFL A;  1TXR A;  2QIR A;  2Q4Z A;  4JWP A;  2ABZ A;  2J8N A;  4CPA A;  3S9N A;  4AVC A;  2ZW6 A;  2CF4 A;  4NFR A;  4ONU A;  2B3U A;  3S6F A;  3B35 A;  2VEZ A;  4NEX A;  2B5G B;  5J8C A;  4CGL A;  4KOW A;  4RS2 A;  3IIB A;  4AB7 A;  2O53 A;  3PB8 X;  1XF8 A;  1PUA A;  4C7I A;  2B3V A;  4OME A;  4NJQ A;  3KQZ A;  3FIX A;  3LD2 A;  4Q36 A;  2D4O A;  4IF5 A;  2PR8 A;  5H84 A;  1CM0 A;  3D66 A;  4P10 A;  3SXN A;  4UFV A;  4B6Z A;  3RNZ A;  3W6X A;  1UFH A;  3L2N A;  2YND A;  2QVP A;  1R3N A;  4I49 A;  4C68 A;  3SI2 A;  4C2Z A;  2JLM A;  2Z3O A;  5A27 A;  5CBM A;  2PR1 A;  2FSR A;  5FVJ A;  4KOT A;  1XMT A;  4RUH A;  3JVN A;  2Z3K A;  2PIZ A;  4PV6 A;  2PQ8 A;  5LYD A;  3QAY A;  4UF4 A;  1ZLI A;  2OZU A;  3B7I A;  2BEI A;  5A28 A;  1BPN A;  2QJ8 A;  4R6T A;  4QBJ A;  1OZP A;  2PJ1 A;  4H6U A;  2ZEN A;  1XE4 A;  4MRI A;  3TO9 A;  3D4U A;  4B10 A;  2YNE A;  4FD7 A;  1A2Z A;  5E96 A;  2HC9 A;  4M6I A;  1YVO A;  2R1I A;  3S9L A;  2J9A A;  3PZJ A;  4OAD A;  2I79 A;  3K2K A;  2B4B A;  2FT0 A;  2X7B A;  2FL4 A;  2AFU A;  4KUA A;  4R7M A;  2ARH A;  5AG7 A;  4ZBG A;  4NF1 A;  2Q7B A;  1TIQ A;  4GS4 A;  4KLV A;  4UWJ A;  4ZX9 A;  4OAE A;  2AFZ A;  1R57 A;  2FS5 A;  1IYK A;  4KOR A;  3PFO A;  1TKJ A;  2R8V A;  2Z10 A;  2ZW7 A;  4PXB A;  1B6B A;  5F47 A;  3SI1 A;  2CNS A;  1Y9W A;  4PQA A;  3PB9 X;  4P45 A;  2AFW A;  4R9M A;  3IU1 A;  2J8M A;  3VH9 A;  4KSI A;  2G3A A;  3KHX A;  3WR7 A;  2C6P A;  2I3C A;  3EY5 A;  4UCM A;  2PJA A;  5JPH A;  2PJ3 A;  1LRZ A;  2EBJ A;  4JXQ A;  1L0C A;  4P4E A;  2REF A;  2IMO A;  4MHY A;  4JLY A;  3TFY A;  3PFE A;  3PGP A;  5AG5 A;  3WAB A;  1S7K A;  3LAC A;  3EXN A;  1IU8 A;  2I00 A;  1LAM A;  6CPA A;  2EO8 A;  3VWD A;  4CS0 B;  1S7F A;  4LX9 A;  5I0C A;  3NFZ A;  2QYV A;  3FED A;  4MCQ A;  3BJ7 A;  4OC3 A;  2ZEE A;  1XJO A;  3FRM A;  2D4P A;  5KTD A;  3EFA A;  4U9Z A;  5F48 A;  3R95 A;  3TTH A;  2BO9 A;  3NH4 A;  4UIA A;  4CAE A;  1YLO A;  4CRZ B;  3C26 A;  3E0K A;  1K4J A;  1PCA A;  3S6K A;  3V8I A;  1U6M A;  1IB1 E;  1M4I A;  3FBU A;  4XPL A;  4OC4 A;  3DSB A;  1XEB A;  2Z3P A;  5KTC A;  3TOA A;  2XEG A;  2WZN A;  1MJ9 A;  1AMP A;  5JGF A;  2P6G A;  3JRU A;  4PXD A;  3GUX A;  4MCS A;  2Q51 A;  2F5I A;  4MXU A;  1JWQ A;  1CBX A;  4IAV A;  4KSA A;  4LUA A;  1Z2L A;  4A94 A;  4B14 A;  3KI9 A;  3CZX A;  1NMT A;  4U5Y A;  4A95 A;  8CPA A;  3BI0 A;  4F6A A;  3CXS A;  4QB9 A;  4CYQ A;  5JQ4 A;  4P4F A;  2GAN A;  1BPM A;  3DLJ A;  1EE3 P;  3NH8 A;  4ZX8 A;  3ZJ0 A;  2C6G A;  5IX3 A;  2Q04 A;  4NGN A;  2YGW A;  1IIC A;  2FIW A;  1M4D A;  1YGH A;  2AFX A;  2FCK A;  3EC4 A;  2GIV A;  4JXR A;  2G0B A;  2Q0Y A;  2JDC A;  3T8W A;  4L89 A;  2IQ6 A;  1TKF A;  1RO5 A;  1QMU A;  2V8D A;  4NSQ A;  5AG6 A;  1YW6 A;  3KKW A;  4NXY A;  3D7G A;  3R9E A;  3NH5 A;  1ZO0 A;  2Z3L A;  5D29 A;  2ANP A;  2WPX A;  3IWG A;  3TX8 A;  1QSM A;  4MHZ A;  1VIX A;  1X10 A;  2IL4 A;  2QML A;  3DNS A;  2OH1 A;  2Q4V A;  4HNY B;  2VZZ A;  3D67 A;  3KAS A;  3H4Q A;  4KVO E;  4NGS A;  4NGP A;  3WT4 A;  4PSW A;  5LRG A;  4E0A A;  4Q38 A;  3BI1 A;  2Q43 A;  4YU9 A;  3D7D A;  3PB4 X;  4MJ8 A;  4HPS A;  3VWE A;  2PVV A;  5ISV A;  5HVH A;  4CGN A;  2WPW A;  2NYQ A;  3FB3 A;  1PYT B;  3A9L A;  3CXP A;  4F9U A;  5LYL A;  4II9 A;  1JQG A;  4GM5 A;  2RB7 A;  5CNP A;  4OC5 A;  3NA6 A;  4E2A A;  2H5M A;  3IWW A;  2XEJ A;  4PPZ A;  1KUY A;  3TE4 A;  5F49 A;  1KUV A;  4HKF A;  1F57 A;  3R96 A;  1VHE A;  2G9D A;  3P2F A;  4EFD A;  1V0C A;  2EK8 A;  4AVA A;  3G3S A;  3MGD A;  4KVX A;  2PJ4 A;  2VBQ A;  5HXD A;  4B5O A;  3FEC A;  4OC0 A;  4MCR A;  3IFE A;  3DR6 A;  2ZEM A;  4J3G A;  2CNM A;  2PDO A;  3B2Y A;  4FD4 A;  4DUK A;  2VI7 A;  3FMC A;  3GY9 A;  2GE3 A;  2PJ7 A;  2G3T A;  4IHM A;  1QST A;  2ZW5 A;  5G20 A;  4MCP A;  4UFW A;  5LRJ A;  1XFO A;  3BJ8 A;  3KHZ A;  1YVK A;  2ZEH A;  5JH9 A;  3TC8 A;  4KOS A;  1S60 A;  2WUU A;  2OZH A;  4CAW A;  2RFH A;  2ZEF A;  4UCN A;  5J1Q A;  1CPX A;  2PRQ A;  2JBK A;  1I21 A;  4C7H A;  2B4D B;  1F2O A;  4CGM A;  2AFO A;  4OC1 A;  3N7Z A;  5GCN A;  4CGP A;  4UFX A;  1M1D A;  3F5B A;  1KWM A;  3S6H A;  4G1P A;  1QSR A;  1RTQ A;  1RXT A;  3P2H A;  3SJF A;  4B5P B;  4BMH A;  2R7H A;  1XOV A;  2CTB A;  5H86 A;  5G1Z A;  4AVB A;  1HDU A;  2BSW A;  4FAI A;  3FF3 A;  2KCW A;  4OKO A;  2CY2 A;  4HNW B;  2Q4Y A;  4P4J A;  2HB6 A;  2V8H A;  3IO1 A;  1IY7 A;  4QVT A;  3W91 A;  4AXV A;  4MFK A;  5HH1 A;  1Y9K A;  1BOB A;  1IOI A;  4P4D A;  2P6E A;  4KSF A;  1S7L A;  3RAM A;  4NGT A;  1AYE A;  2PJC A;  3F8K A;  2CIJ A;  3FVL A;  3TOB A;  5HMN A;  4RN7 A;  3I1U A;  2AE6 A;  5CPA A;  1Q2Y A;  3VAR A;  3LOD A;  2DPS A;  1Z8T A;  2VXK A;  1Z9U A;  3GLJ A;  4QUS A;  2ODF A;  2PVW A;  4MFZ A;  4X3R A;  4CGO A;  1VKC A;  4OC2 A;  4A30 A;  2C1C A;  2NSM A;  4Y49 C;  1DE4 C;  3UY5 A;  4P4B A;  4R3L A;  4UIB A;  4EWT A;  4A32 A;  4R57 A;  5DS0 A;  7CPA A;  3MRU A;  3DDD A;  4JD6 A;  1B87 A;  1WK4 A;  1YQE A;  2PIY A;  2ZW4 A;  4W9Y A;  4KOY A;  1H8L A;  4MHD A;  4U9Y A;  4EME A;  1BAV A;  3KGQ A;  3PRT A;  2QEC A;  2C6C A;  3GYA A;  2F7V A;  3ISX A;  3KR5 A;  4Z65 A;  1Z8L A;  2HQY A;  2BL1 A;  3FJU A;  1LAN A;  3FYN A;  3D7F A;  3KR4 A;  4WWV A;  5ELY A;  3SJX A;  1CPS A;  1GHE A;  3PBE A;  1Z8X A;  1ON0 A;  5LYI A;  4H89 A;  4MI4 A;  3PB7 X;  4PXE A;  1UWY A;  1ELL P;  4OLL A;  3H5Z A;  3R9F A;  5C82 A;  4XPK A;  2JEW A;  4DNC A;  1CX8 A;  1HEE A;  3K9T A;  4M85 A;  4Y49 B;  5G21 A;  4DYO A;  4HNX B;  2PRB A;  5D8N A;  1M4G A;  1YR0 A;  4P4I A;  2PJ2 A;  4R87 A;  3VAT A;  3D68 A;  4NCZ A;  3GB0 A;  4UEE A;  2VL1 A;  4MFQ A;  2REE A;  4X5K A;  3B3S A;  3PB6 X;  3FEE A;  4M3S A;  4A2Z A;  4C2X A;  3DR8 A;  3D8P A;  4UCP A;  2CTC A;  1BO4 A;  1J4J A;  2V8V A;  5IB0 A;  1CP7 A;  4KVM E;  3RBU A;  5THW A;  1ELM P;  4L8A A;  4PK2 A;  2ZPA A;  1KZF A;  1P4N A;  2ZOG A;  4UWI A;  2NMT A;  1FY7 A;  4NGR A;  2Z11 A;  4RI1 A;  5HVF A;  5AG4 A;  2Z3M A;  4KOX A;  3H8E A;  4TNU A;  4FBE A;  1VHO A;  2B4D A;  1N71 A;  3V38 A;  4FUU A;  1DTD A;  3V7Z A;  3FNC A;  3H8G A;  3B3C A;  4MFJ A;  2AJ6 A;  4MHP A;  3PEI A;  4MY3 A;  2Q7S A;  1YSJ A;  4NGM A;  3SJG A;  4B5P A;  5K8P A;  4CRY B;  1LFW A;  3TT2 A;  1OBR A;  4BD9 A;  4KOV A;  1I12 A;  2VQY A;  2Y0M A;  1Q2D A;  4GXH A;  3RZA A;  4DJL A;  2R98 A;  5LRK A;  2ZEO A;  1XBU A;  4P44 A;  4YRH A;  3DGV A;  1Q7L A;  1XMB A;  4KS9 A;  1Z4R A;  4MMO A;  1TF8 A;  2OB0 A;  4M6H A;  4PXC A;  4H2K A;  3S9M A;  2ZED A;  3SXO A;  2RC4 A;  2BOA A;  4ZI6 A;  2AFS A;  2PC1 A;  3IC1 A;  5K8N A;  5K8O A;  4F0X A;  4FD6 A;  4A31 A;  4CAF A;  2Z0Z A;  5I4M A;  1Q2C A;  4F8Z A;  2DXQ A;  3SJE A;  4ZY1 A;  2GLF A;  5EMI A;  4UBR A;  3GKR A;  2PJ0 A;  3KQX A;  1ZG9 A;  2CNT A;  2WSA A;  4CAV A;  2DF5 A;  2OZG A;  3S6G A;  1YX0 A;  4QC6 A;  3ISZ A;  1IID A;  4LQ6 A;  2GLJ A;  5C88 A;  3I9S A;  4WJB A;  4XPD C;  2CXA A;  3SI0 A;  4UEZ A;  3T90 A;  3ZZI A;  2BUE A;  5F09 A;  2JEV A;  1FNO A;  3N5F A;  2PJB A;  3WC7 A;  4CYP A;  4YFJ A;  4MFP A;  3HLP A;  4X2T A;  2PE3 A;  2JDD A;  4FD5 A;  2PSW A;  5J8F A;  4KUB A;  3MN8 A;  2ZEG A;  5DWM A;  2HV2 A;  2O28 A;  2JBJ A;  5IB9 A;  1YK3 A;  3QAH A;  5EBV A;  2PJ6 A;  1SQH A;  1Z5R A;  4R3K A;  4X8I A;  3FX6 A;  4A33 A;  3D2P A;  1M4L A;  3B3W A;  1Y0Y A;  3LMS A;  4JYW A;  2V77 A;  4OID A;  2B58 A;  4TWE A;  3IJ3 A;  4XPD B;  5JM6 A;  3QNV A;  1X12 A;  2V8G A;  1IYL A;  1Z4E A;  1MK4 A;  4Q7A A;  3I3G A;  1ZG8 A;  3LWU A;  3TO6 A;  2OU2 A;  5LYF A;  2P0W A;  3JUW A;  1ZLH A;  1FT7 A;  4YGO A;  2J8R A;  4MHN A;  4C2Y A;  4AG7 A;  4OIW A;  1BLL E;  2YNC A;  3PP9 A;  1AUG A;  3FXT A;  4E8O A;  3BLN A;  1PU9 A;  1WWZ A;  4CYN A;  3CPA A;  2XEF A;  4F9V A;  3SHP A;  4CYO A;  4A38 A;  2ATR A;  4F0Y A;  1NSL A;  4B12 A;  2DPT A;  3JTK A;  3D2M A;  5EC4 A;  1TKH A;  4M6G A;  3CT9 A;  1LOK A;  3D3S A;  1CJW A;  4ORF A;  2VZY A;  4PK3 A;  2ZOF A;  4O23 A;  1CP6 A;  4IK2 A;  2EUI A;  3R9G A;  2DEA A;  3IWE A;  2WYR A;  1S7N A;  1M44 A;  4KZT A;  3R1K A;  2GU2 A;  3TO7 A;  5BWA B;  1P0H A;  3NE8 A;  2YNC C;  1Y7R A;  3CDX A;  4JZ0 A;  2C27 A;  1YME A;  2EVN A;  3B3T A;  5G22 A;  2OR4 A;  2ZXV A;  1MJB A;  4K3N A;  4B11 A;  2K5T A;  4FWU A;  3HUV A;  3IEH A;  1MJA A;  4BIN A;  4H6Z A;  4IUS A;  5HVG A;  3B3V A;  3KL9 A;  1YRE A; 
#chains in the Genus database with same CATH homology
 4ZGY B;  3OWC A;  4AG9 A;  2FE7 A;  4MY0 A;  3TCV A;  4BBH A;  3RYO A;  1S5K A;  2B5G A;  3NE7 A;  1QSN A;  1VHS A;  1NE9 A;  3K9U A;  2Z3N A;  3IU2 A;  1S3Z A;  4KLW A;  2A4N A;  2Q44 A;  4JJX A;  1QSO A;  3CXQ A;  1XIX A;  4CAX A;  4UA3 A;  1KUX A;  3IGR A;  3T9Y A;  2P6F A;  4EVY A;  4XNH C;  1YLE A;  3F0A A;  5IV0 A;  4B13 A;  4PSX A;  3QB8 A;  5DWN A;  1I1D A;  4MBU A;  2FIA A;  2HUZ A;  3W6S A;  5F46 A;  2FXF A;  5KTA A;  5AGE A;  3EO4 A;  4K30 A;  4KOU A;  3G8W A;  3B8G A;  4XNH B;  4MFL A;  2QIR A;  4JWP A;  2J8N A;  4AVC A;  2ZW6 A;  4ONU A;  2B3U A;  3S6F A;  2VEZ A;  4NEX A;  2B5G B;  5J8C A;  4CGL A;  4KOW A;  4RS2 A;  4AB7 A;  4C7I A;  1XF8 A;  1PUA A;  2B3V A;  3FIX A;  3LD2 A;  4Q36 A;  2D4O A;  4IF5 A;  2PR8 A;  5H84 A;  1CM0 A;  3SXN A;  4UFV A;  3W6X A;  1UFH A;  2YND A;  4I49 A;  4C68 A;  4C2Z A;  2JLM A;  2Z3O A;  5A27 A;  2PR1 A;  2FSR A;  5FVJ A;  4KOT A;  1XMT A;  3JVN A;  2Z3K A;  4PV6 A;  2PQ8 A;  2OZU A;  2BEI A;  5A28 A;  4QBJ A;  1OZP A;  4H6U A;  1XE4 A;  3TO9 A;  4B10 A;  2YNE A;  4FD7 A;  5E96 A;  1YVO A;  2R1I A;  3PZJ A;  4OAD A;  2I79 A;  2B4B A;  2FT0 A;  2X7B A;  2FL4 A;  4KUA A;  4ZBG A;  2ARH A;  5AG7 A;  2Q7B A;  4NF1 A;  1TIQ A;  4GS4 A;  4KLV A;  4UWJ A;  4OAE A;  1R57 A;  2FS5 A;  1IYK A;  4KOR A;  2R8V A;  2Z10 A;  2ZW7 A;  1B6B A;  5F47 A;  2CNS A;  1Y9W A;  4R9M A;  3IU1 A;  2J8M A;  2G3A A;  3WR7 A;  3EY5 A;  5JPH A;  1LRZ A;  4JXQ A;  1L0C A;  2REF A;  4JLY A;  3TFY A;  3PGP A;  5AG5 A;  1S7K A;  3EXN A;  2I00 A;  3VWD A;  4CS0 B;  1S7F A;  4LX9 A;  5I0C A;  3BJ7 A;  3FRM A;  2D4P A;  5KTD A;  3EFA A;  4U9Z A;  5F48 A;  3R95 A;  3TTH A;  4CAE A;  4CRZ B;  3C26 A;  3E0K A;  1K4J A;  3S6K A;  3V8I A;  1U6M A;  1IB1 E;  1M4I A;  3FBU A;  3DSB A;  1XEB A;  2Z3P A;  5KTC A;  3TOA A;  1MJ9 A;  2P6G A;  2F5I A;  4KSA A;  4LUA A;  4B14 A;  1NMT A;  4U5Y A;  4A95 A;  4F6A A;  3CXS A;  4QB9 A;  4CYQ A;  5JQ4 A;  3ZJ0 A;  2GAN A;  5IX3 A;  2Q04 A;  2YGW A;  1IIC A;  2FIW A;  1M4D A;  1YGH A;  2FCK A;  3EC4 A;  2GIV A;  4JXR A;  2G0B A;  2Q0Y A;  2JDC A;  4L89 A;  1RO5 A;  4NSQ A;  5AG6 A;  3KKW A;  4NXY A;  3R9E A;  1ZO0 A;  2Z3L A;  2WPX A;  3IWG A;  1QSM A;  4HNY B;  2IL4 A;  2QML A;  3DNS A;  2OH1 A;  2Q4V A;  4KVO E;  2VZZ A;  4UCM A;  4XPL A;  3H4Q A;  4PSW A;  4E0A A;  4Q38 A;  4MJ8 A;  3VWE A;  5ISV A;  4CGN A;  2WPW A;  3FB3 A;  3A9L A;  3CXP A;  4II9 A;  5CNP A;  4E2A A;  2H5M A;  1KUY A;  3TE4 A;  5F49 A;  1KUV A;  4HKF A;  3R96 A;  3P2F A;  1V0C A;  4AVA A;  3G3S A;  3MGD A;  4KVX A;  2VBQ A;  4B5O A;  3DR6 A;  4J3G A;  2CNM A;  2PDO A;  4FD4 A;  2VI7 A;  3GY9 A;  2GE3 A;  2G3T A;  1QST A;  2ZW5 A;  5G20 A;  4UFW A;  3BJ8 A;  1YVK A;  4KOS A;  1S60 A;  2WUU A;  2OZH A;  4CAW A;  4UCN A;  1I21 A;  4C7H A;  2B4D B;  4CGM A;  3N7Z A;  5GCN A;  4CGP A;  4UFX A;  1M1D A;  3F5B A;  3S6H A;  1QSR A;  1RXT A;  4B5P B;  3P2H A;  4BMH A;  2R7H A;  5H86 A;  4AVB A;  5G1Z A;  2BSW A;  2KCW A;  2CY2 A;  4HNW B;  2Q4Y A;  4QVT A;  3W91 A;  4MFK A;  5HH1 A;  1Y9K A;  1BOB A;  2P6E A;  4KSF A;  1S7L A;  3F8K A;  3TOB A;  5HMN A;  2AE6 A;  1Q2Y A;  3LOD A;  2DPS A;  2VXK A;  1Z9U A;  4QUS A;  4CGO A;  4MFZ A;  1VKC A;  4A30 A;  4Y49 C;  3UY5 A;  4R3L A;  4A32 A;  4R57 A;  3DDD A;  4JD6 A;  1B87 A;  1WK4 A;  2ZW4 A;  4KOY A;  4MHD A;  4U9Y A;  2QEC A;  3GYA A;  2HQY A;  2BL1 A;  3FYN A;  1GHE A;  1ON0 A;  4H89 A;  4MI4 A;  4OLL A;  3H5Z A;  3R9F A;  5C82 A;  4XPK A;  4DNC A;  4M85 A;  4Y49 B;  5G21 A;  4HNX B;  2PRB A;  1M4G A;  1YR0 A;  4R87 A;  4NCZ A;  4MFQ A;  2REE A;  4X5K A;  4M3S A;  4A2Z A;  4C2X A;  3DR8 A;  3D8P A;  4UCP A;  1BO4 A;  1J4J A;  5IB0 A;  4KVM E;  4L8A A;  4PK2 A;  2ZPA A;  1KZF A;  1P4N A;  4UWI A;  2NMT A;  1FY7 A;  2Z11 A;  4RI1 A;  5AG4 A;  2Z3M A;  4KOX A;  2B4D A;  1N71 A;  3FNC A;  4MFJ A;  2AJ6 A;  4MY3 A;  4B5P A;  4CRY B;  3TT2 A;  4KOV A;  1I12 A;  2VQY A;  2Y0M A;  1Q2D A;  2R98 A;  4YRH A;  4KS9 A;  1Z4R A;  2OB0 A;  3SXO A;  2RC4 A;  2PC1 A;  4F0X A;  4FD6 A;  4A31 A;  4CAF A;  2Z0Z A;  1Q2C A;  2DXQ A;  4UBR A;  3GKR A;  2CNT A;  2WSA A;  4CAV A;  2OZG A;  3S6G A;  1YX0 A;  4QC6 A;  1IID A;  5C88 A;  3I9S A;  4XPD C;  2CXA A;  3T90 A;  3ZZI A;  2BUE A;  2JEV A;  4CYP A;  4YFJ A;  4MFP A;  2JDD A;  4FD5 A;  2PSW A;  5J8F A;  4KUB A;  5DWM A;  2HV2 A;  2O28 A;  1YK3 A;  3QAH A;  5EBV A;  1SQH A;  4R3K A;  4A33 A;  3D2P A;  2B58 A;  4XPD B;  1IYL A;  1Z4E A;  1MK4 A;  3I3G A;  3TO6 A;  2OU2 A;  2P0W A;  3JUW A;  4YGO A;  2J8R A;  4C2Y A;  4AG7 A;  3PP9 A;  2YNC A;  3FXT A;  4E8O A;  3BLN A;  1PU9 A;  1WWZ A;  4CYN A;  3SHP A;  4CYO A;  4F0Y A;  2ATR A;  1NSL A;  4B12 A;  2DPT A;  3JTK A;  3D2M A;  5EC4 A;  3D3S A;  1CJW A;  4ORF A;  2VZY A;  4PK3 A;  2EUI A;  3R9G A;  3IWE A;  1S7N A;  1M44 A;  4KZT A;  3R1K A;  3TO7 A;  5BWA B;  1P0H A;  2YNC C;  1Y7R A;  2C27 A;  2EVN A;  5G22 A;  2ZXV A;  4B11 A;  1MJB A;  2K5T A;  1MJA A;  4H6Z A;  4IUS A;  1YRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...