4LX9A

Archaeal amino-terminal acetyltransferase (nat) bound to acetyl coenzyme a
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
157
structure length
157
Chain Sequence
DFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAIVDNSVVGYIMPRIEWGFSNIKQLPSLVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYYADGEDAYLMARPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARCHAEAL AMINO-TERMINAL ACETYLTRANSFERASE
publication title Implications for the evolution of eukaryotic amino-terminal acetyltransferase (NAT) enzymes from the structure of an archaeal ortholog.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 48
structure length 157
sequence length 157
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2013-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4lx9A00
3S6HA 1CJWA 2FT0A 4M85A 4XPKA 5EC4A 2C27A 2HQYA 3RYOA 4KOUA 4JXQA 4HNXB 4PK3A 4ONUA 4JLYA 1M4DA 4E0AA 2QIRA 2B4BA 5H86A 1QSNA 4OAEA 1QSTA 2QECA 2B58A 2K5TA 3CXSA 4X5KA 1RO5A 3S6FA 4CS0B 2FS5A 4UWIA 2PDOA 4KZTA 4NEXA 4XPDB 5J8FA 1Y7RA 2Y0MA 4AG9A 4XPDC 2OB0A 2R98A 2GE3A 2BEIA 4FD7A 2VBQA 4H6UA 1Q2CA 3BJ7A 3I3GA 4AVAA 3F5BA 4PV6A 3NE7A 2WPWA 1GHEA 2VQYA 3LD2A 3T90A 2Q44A 2G3TA 3F8KA 2Q4YA 5KTCA 3BJ8A 2PR1A 2Z11A 2KCWA 4AG7A 4CAVA 2P6GA 2Q4VA 3R1KA 4B5PA 2CNSA 2F5IA 3PZJA 4KOYA 4R57A 4KOSA 3TE4A 1P0HA 3D3SA 5KTAA 2JEVA 4NSQA 4YRHA 2R7HA 4MHDA 3BLNA 3EC4A 4J3GA 1XF8A 1OZPA 3V8IA 1M1DA 3W6SA 4KLVA 4JWPA 4KUBA 3IWGA 1NMTA 3TCVA 3D8PA 2AJ6A 3PP9A 2J8NA 1TIQA 4KOWA 2H5MA 3IGRA 5C82A 4AVBA 4FD4A 4CRZB 1NSLA 3SHPA 2B3VA 2D4PA 2G0BA 2OU2A 4II9A 4UA3A 3TT2A 5JPHA 2B5GA 2VEZA 4MY3A 3GKRA 4HNYB 4OLLA 4RI1A 2R8VA 4R9MA 2VI7A 4U5YA 2IL4A 3P2FA 1S7KA 3W6XA 1PUAA 4I49A 1LRZA 2HV2A 1Q2YA 1YX0A 5I0CA 2GIVA 2FIAA 3FYNA 2O28A 5IX3A 2OZHA 4QUSA 5C88A 1SQHA 4F6AA 1N71A 1I1DA 1YLEA 3F0AA 1YK3A 2D4OA 4MBUA 1VKCA 5DWNA 4U9YA 1MK4A 4MJ8A 2A4NA 4KVXA 4R3KA 5GCNA 1I21A 1S7FA 2PQ8A 4L8AA 4OADA 5ISVA 2CNMA 3T9YA 4YGOA 1Z9UA 2FSRA 2I79A 4IUSA 2ZW5A 4Y49B 4Y49C 4ORFA 1M44A 3SXNA 1YVKA 2NMTA 3CXPA 3ZJ0A 1P4NA 2Q0YA 5HMNA 1YREA 3TTHA 5F48A 3R9FA 2J8RA 3GYAA 3R96A 3TO6A 2X7BA 4NXYA 4HNWB 3K9UA 5CNPA 2G3AA 4AB7A 2AE6A 4PK2A 2CY2A 4R3LA 2ARHA 3PGPA 5DWMA 2P6FA 1MJ9A 2ZW4A 2ZW6A 4KORA 3D2MA 2Z0ZA 3CXQA 2PR8A 1MJAA 2BL1A 5FVJA 3R9EA 2REEA 4UBRA 2FIWA 1KUVA 3S6KA 2FXFA 4NF1A 1R57A 1S60A 2FE7A 2ZPAA 4KVME 1Y9WA 3H4QA 1K4JA 4EVYA 2PC1A 1CM0A 2ZW7A 2Z10A 4B5PB 4M3SA 3D2PA 1WWZA 4E8OA 3P2HA 2B4DB 1WK4A 3DR8A 1MJBA 4FD6A 3I9SA 4IF5A 2J8MA 4FD5A 4KOVA 3EXNA 3FB3A 4UWJA 1VHSA 2CNTA 4H89A 3C26A 4DNCA 2JDDA 1YR0A 2EVNA 2JDCA 2OH1A 2DXQA 1XEBA 2PRBA 3TOBA 4QVTA 2Q7BA 3MGDA 3LODA 2OZGA 2P6EA 1YVOA 1M4IA 4BMHA 3KKWA 2GANA 1IICA 1V0CA 2B3UA 2OZUA 1ON0A 2REFA 5J8CA 3VWEA 3FXTA 4JD6A 4ZBGA 2B5GB 4MI4A 1IYLA 1BO4A 4KUAA 5IB0A 4XPLA 4QC6A 4CRYB 1IYKA 4R87A 3VWDA 2ZXVA 1Z4EA 2ATRA 3QAHA 4KOXA 4E2AA 3JUWA 2I00A 4K30A 4PSXA 3W91A 1QSRA 3TOAA 2Q04A 2BUEA 5IV0A 1S7LA 3DDDA 3FNCA 1Q2DA 4GS4A 4JJXA 1IIDA 2VZYA 3DNSA 2BSWA 4XNHB 5E96A 4XNHC 1S5KA 2QMLA 5JQ4A 4PSWA 1FY7A 2VXKA 3DSBA 5F49A 4KVOE 4RS2A 4CAXA 5EBVA 2VZZA 5H84A 1Y9KA 4B5OA 5HH1A 1IB1E 3B8GA 4LUAA 5KTDA 3ZZIA 1XE4A 1YGHA 3N7ZA 3TO7A 2P0WA 1QSOA 3DR6A 1KZFA 3JVNA 3G3SA 4CAWA 1I12A 2FCKA 3G8WA 5F47A 2PSWA 1B87A 1U6MA 2B4DA 3R9GA 1M4GA 3OWCA 1QSMA 3EO4A 4H6ZA 1PU9A 4L89A 3TFYA 3SXOA 1XMTA 4YFJA 5F46A 4KLWA 1S7NA 3R95A 4QB9A 4HKFA 2WPXA 2EUIA 3EY5A 3FRMA 1J4JA 3FBUA 1UFHA 4MY0A 1KUYA 4U9ZA 4F0YA 3WR7A 4LX9A 2FL4A 4KOTA 1L0CA 3TO9A 3GY9A 3S6GA 4AVCA 1XIXA 4QBJA 2R1IA 3QB8A 3FIXA 1NE9A 1KUXA 4NCZA 1S3ZA 1RXTA 1Z4RA 3EFAA 1B6BA 2RC4A 2JLMA 3E0KA 4JXRA 3UY5A 2HUZA 1BOBA
chains in the Genus database with same CATH superfamily
2DEAA 2YNCA 3S6HA 1CJWA 2FT0A 2CIJA 4M85A 4PXDA 4XPKA 4P45A 5EC4A 2C27A 2HQYA 3RYOA 4KOUA 4JXQA 3D67A 4HNXB 4PK3A 4ONUA 3WC7A 5G21A 4BINA 4JLYA 1M4DA 4E0AA 2EO8A 2B4BA 2QIRA 5H86A 2C6CA 1QSNA 4OAEA 1QMUA 1QSTA 2QECA 3FVLA 3WC6A 3SJFA 1Z8XA 1QQ9A 2B58A 2K5TA 1FT7A 2PVWA 2PIZA 3CXSA 4X5KA 1RO5A 3S6FA 2V8VA 4UFWA 4CS0B 2FS5A 4UWIA 2PDOA 2Z3PA 4TWEA 4ZY0A 5D8NA 4KZTA 4DJLA 2AFMA 2AFZA 4GXHA 3D68A 4NEXA 4OKOA 4XPDB 5J8FA 1Y7RA 2Y0MA 4AG9A 4XPDC 3IEHA 4DYOA 2OB0A 2R98A 3KHXA 2GE3A 2V8DA 4ZX8A 3VH9A 4NGQA 2BEIA 3RNZA 2YGWA 2IQ6A 1Y0YA 4FD7A 2Q7SA 3PFOA 4M6HA 1ZG9A 2PJ8A 4FUUA 4C7HA 4CGPA 4F8ZA 2F7VA 2VBQA 4H6UA 1Q2CA 3D4UA 4HPSA 3BJ7A 3IIBA 4OIDA 3I3GA 3S9MA 4AVAA 3F5BA 4PV6A 3NE7A 4MFZA 4AXVA 2C6GA 4MRIA 4EWTA 2WZNA 4KSIA 4UF4A 5AG5A 4A30A 4A33A 2PCUA 2WPWA 1GHEA 3CPAA 2VQYA 3LD2A 3T90A 2Q44A 3B3VA 4H2KA 2G3TA 1ZO0A 3F8KA 4PPZA 3PB9X 2Q4YA 3S9NA 5K8NA 4UEFA 3B3WA 5KTCA 3BJ8A 2PJ1A 2PR1A 2Z11A 2KCWA 4AG7A 4C2XA 4CAVA 2P6GA 3BI1A 2Q4VA 3R1KA 4B5PA 2CNSA 2F5IA 3PZJA 4NGNA 4P4IA 4KOYA 4R57A 4BD9A 3WABA 4UIAA 5HVFA 4W9YA 4KOSA 4ZYQA 3TE4A 1P0HA 2V8GA 3D3SA 4KSAA 4ZY2A 5KTAA 4NGSA 1BPNA 2JEVA 2CTBA 4NSQA 4YRHA 2R7HA 4MHDA 3RZAA 3BLNA 3EC4A 4NJQA 5HXDA 2O53A 4J3GA 4UCNA 4CGLA 2ZOGA 4UFXA 4R6TA 2CTCA 4B14A 1XF8A 3BHXA 1OZPA 2I3CA 5LYDA 4Q38A 4WWVA 5G20A 3V8IA 1M1DA 4OP4A 3PBEA 3W6SA 1LOKA 4KLVA 4JWPA 4KUBA 3IWGA 3PB4X 3H8GA 4KS9A 1IOIA 1NMTA 3TCVA 2IMOA 1LCPA 3D8PA 1PYTB 4B11A 2AJ6A 3PP9A 1BPMA 2J8NA 1TIQA 4KOWA 2H5MA 3IGRA 2GLFA 4AVBA 5C82A 2V8HA 3FEEA 4FD4A 4NGTA 2Z3OA 4PXCA 4CRZB 1IGBA 5G22A 4MMOA 1NSLA 4RN7A 3SHPA 2B3VA 3N5FA 2D4PA 2G0BA 4PXBA 2OU2A 2POKA 1TKHA 3KHZA 3MN8A 4II9A 2O4HA 2PJ2A 4CGNA 3V38A 4YU9A 4UA3A 3TT2A 5JPHA 2B5GA 2VEZA 4MY3A 3GKRA 4HNYB 5AG6A 3TC8A 3PB8X 4OLLA 4RI1A 4RUHA 4ZI6A 2R8VA 4R9MA 1LAMA 2VI7A 2IL4A 4ONWA 4U5YA 5BWAB 3P2FA 4MCQA 4CPAA 4B10A 1S7KA 3KQZA 4G1PA 4CGOA 3D7GA 2PJ9A 1Y7EA 3W6XA 1PUAA 1XFOA 3B7IA 4I49A 7CPAA 4B13A 4Q36A 1LRZA 2HV2A 1Q2YA 1YX0A 2FVGA 4NGRA 1XOVA 5ELYA 3D7FA 5I0CA 2GIVA 2FIAA 3FYNA 5A27A 5G1ZA 2O28A 5IX3A 2OZHA 4MHYA 2DF5A 4QUSA 2AFSA 5C88A 1SQHA 4F6AA 1N71A 1I1DA 1TF9A 1YLEA 1YW6A 3F0AA 3NA6A 4A95A 4OC4A 1YK3A 4KSFA 4C7IA 2D4OA 1CPXA 3CZXA 4MBUA 1ARLA 4F9UA 1VKCA 5DWNA 4U9YA 1OBRA 2J9AA 2GREA 2YNEA 1ZG8A 4P4JA 1MK4A 4UCMA 4MJ8A 2A4NA 3B3SA 1VIXA 4KVXA 4R3KA 5GCNA 1ELMP 2Q43A 4UFVA 1I21A 3BI0A 5THWA 1S7FA 2PQ8A 1HEEA 4L8AA 2PJBA 4OADA 5ISVA 4OC0A 3LWUA 2CNMA 2ABZA 4YGOA 1Z9UA 3T9YA 4MFLA 2FSRA 2ZEDA 3CPXA 3GLJA 1CBXA 1YSJA 2I79A 3D66A 2ZW5A 3ISZA 4IUSA 4Y49B 5D29A 4Y49C 2NSMA 4ORFA 1M44A 2PRQA 3SXNA 1YVKA 2NMTA 2YNCC 2EBJA 5AG7A 1RTQA 3FMCA 3CXPA 3HUVA 3ZJ0A 3KI9A 4CYOA 5JGFA 1P4NA 2Q0YA 5HMNA 1YREA 3IJ3A 3TTHA 1NSAA 5F48A 2VL1A 2NYQA 3R9FA 4CYNA 2J8RA 3GYAA 4A37A 1F57A 2CXAA 3R96A 6CPAA 3TO6A 5JH9A 2X7BA 4NXYA 1LFWA 4A94A 4NFRA 4PQAA 3KGQA 3IC1A 5I4MA 3B3CA 4P4DA 3SJEA 2PE3A 2XEFA 4HNWB 3K9UA 3IO1A 4X2TA 1IOFA 5CNPA 2G3AA 4WJBA 4AB7A 2AE6A 2PJ0A 1IY7A 3PB7X 4PK2A 3HLPA 3TX8A 3FH4A 4ZX9A 3PB6X 1Z8TA 2Z3LA 4F0XA 3LMSA 2CY2A 2ZEHA 3IWWA 4R3LA 2ARHA 3PGPA 4B12A 1TXRA 2RB7A 2AFUA 5DWMA 2P6FA 1MJ9A 3S9LA 3FJUA 1DE4C 1GYTA 2ZW4A 4P10A 1HDUA 4X8IA 2ZW6A 4ZY1A 4KORA 3D2MA 2DPSA 2Z0ZA 2OOTA 3CXQA 2QJ8A 4R76A 1JQGA 2PR8A 1MJAA 2BL1A 5FVJA 3R9EA 4F9VA 3VARA 4CGMA 2F8HA 2REEA 2JBKA 3H5ZA 4GM5A 4UBRA 2FIWA 4MFQA 2PJ7A 1KUVA 3S6KA 2FXFA 3IFEA 4MFJA 4NF1A 1R57A 1ZLIA 1S60A 4X3RA 3T8WA 3B2YA 5HVHA 3IU2A 1YW4A 4NGMA 2FE7A 2GFQA 1Z2LA 2ZPAA 4KVME 5IB9A 1Y9WA 3H4QA 4FWUA 4NGPA 3B35A 3MRUA 1K4JA 3RBUA 3D7HA 2WSAA 4EVYA 4TNUA 1X12A 2PC1A 1TKJA 1CM0A 2ZW7A 3NE8A 4PXEA 5LRGA 2AFXA 4IK2A 4MCPA 1XRYA 1A2ZA 2EK8A 2Z10A 3ISXA 4B5PB 4A38A 3PEIA 3D2PA 4M3SA 2AFOA 1KWMA 1WWZA 2Z3KA 4E8OA 3P2HA 2B4DB 3KL9A 1WK4A 2DPTA 4P4BA 2PIYA 2AFWA 1AYEA 3DR8A 1MJBA 1Z8LA 4FD6A 3KASA 4M6IA 3I9SA 4MFPA 4IF5A 3SJGA 2J8MA 4FD5A 3NH4A 3FECA 4KOVA 3EXNA 3FB3A 4UWJA 1VHSA 2OR4A 3GIUA 2CNTA 4H89A 3C26A 2IJZA 4DNCA 3I1UA 2JDDA 1YR0A 2EVNA 4OC3A 2JDCA 2OH1A 5LYFA 2DXQA 1XEBA 3A9LA 1CG2A 5LRJA 2PRBA 3TOBA 4P6YA 3KR5A 3FX6A 4QVTA 2Q7BA 4FAIA 3MGDA 3KR4A 5EMIA 2PJAA 3LODA 1Y0RA 3PFEA 4MHPA 4P4FA 2OZGA 4K3NA 1YMEA 1Q7LA 2P6EA 3QNVA 3L2NA 4MCRA 3QAYA 1YVOA 2Z3MA 2C6PA 1M4IA 1XBUA 4CAFA 2PJ3A 1BAVA 1VHEA 4BMHA 4EMEA 2BO9A 2GANA 3KKWA 3RAMA 1IICA 1V0CA 3SJXA 2B3UA 3IWEA 2OZUA 1ON0A 2ANPA 1VHOA 2REFA 3JRUA 5J8CA 1R43A 4P4EA 3FXTA 3VWEA 4JD6A 4ZBGA 2BOAA 2B5GB 4MI4A 1IYLA 1BO4A 2YNDA 1H8LA 4KUAA 3H8FA 5IB0A 4XPLA 4QC6A 4CRYB 4OC1A 1IYKA 2PVVA 3K9TA 4R87A 3SI0A 3VWDA 4CYQA 1XJOA 4YWYA 2ZXVA 1Z4EA 2ATRA 2CF4A 3FEDA 3QAHA 4MXUA 1Z8WA 4KOXA 1CX8A 4C2ZA 3NH5A 4E2AA 4JYWA 1VGYA 2PJCA 4LQGA 1F2PA 4C2YA 3JUWA 4MHZA 5LYLA 4B6ZA 2XEIA 3B3TA 2QYVA 1XMBA 2I00A 4K30A 5AGEA 1UWYA 1YLOA 3GUXA 4PSXA 3W91A 1QSRA 3TOAA 2Q04A 2BUEA 4O23A 5IV0A 4P44A 4IAVA 1S7LA 4NJRA 2Q51A 3DDDA 3FNCA 1LAPA 1BLLE 1Q2DA 3SI2A 4GS4A 4JJXA 3CDXA 1IIDA 2VZYA 3DNSA 1FNOA 2BSWA 4XNHB 5E96A 1X10A 2G9DA 2WUUA 2PJ5A 4XNHC 1ARMA 4Q7AA 2XEJA 1S5KA 1YQEA 2QMLA 3IU1A 4OIWA 1F2OA 1PCAA 4MCSA 5JQ4A 4PSWA 1ZG7A 1FY7A 2VXKA 5AG4A 3DSBA 4UEZA 5F49A 4KVOE 1HDQA 5K8PA 4RS2A 8CPAA 5HVGA 4CAXA 4CYPA 5EBVA 2VZZA 3PRTA 1DTDA 5CBMA 5LRKA 5CPAA 2PJ6A 5H84A 1Y9KA 3RO0A 4B5OA 5HH1A 2QVPA 1IB1E 3B8GA 4LUAA 4OMEA 5KTDA 1CP7A 4R8FA 3ZZIA 1XE4A 1YGHA 2XEGA 3H8EA 3N7ZA 3TO7A 2P0WA 3WT4A 5K8MA 1QSOA 4JZ0A 3DLJA 3DR6A 4OC2A 1KZFA 1TF8A 2RFHA 4IHMA 3KQXA 3JVNA 3VATA 3G3SA 4CAWA 1CPSA 1I12A 2FCKA 3G8WA 2PSWA 1ZLHA 5F47A 1B87A 1U6MA 1Z5RA 2B4DA 2GU2A 2ZOFA 3R9GA 3V7ZA 1M4GA 4LQ6A 3OWCA 1QSMA 1TKFA 3EO4A 4H6ZA 5JM6A 3GB0A 5K8OA 1AUGA 1PU9A 2ODFA 4L89A 3TFYA 3KZWA 2Q4ZA 2ZEMA 3SXOA 3NFZA 3DGVA 1XMTA 4YFJA 5F46A 3BXMA 1JWQA 4KLWA 1S7NA 3R95A 5J1QA 4QB9A 2ZELA 4HKFA 4EFDA 4Z65A 2WPXA 2EUIA 5A28A 2EWBA 2HC9A 3SI1A 3WC5A 3EY5A 3D7DA 3FRMA 1J4JA 2HB6A 3FBUA 1UFHA 4MY0A 2ZEPA 1AMPA 2PJ4A 2EK9A 1KUYA 2JBJA 4U9ZA 3CT9A 4UIBA 4DUKA 4F0YA 4UEEA 2ZENA 2ZEOA 4MFKA 4A32A 3WR7A 4LX9A 4UCPA 2FL4A 4KOTA 1L0CA 3TO9A 4C68A 5DS0A 3GY9A 3S6GA 3NH8A 4AVCA 1XIXA 3PBBA 4QBJA 3K2KA 5F09A 2R1IA 3QB8A 3FIXA 4MHNA 1NE9A 4OC5A 2JEWA 1KUXA 2ZEFA 4NCZA 2GLJA 1S3ZA 4ZGYB 4A31A 4A2ZA 3FF3A 4R7MA 4BBHA 1ELLP 1IU8A 2ZEGA 1RXTA 2ZEEA 1Z4RA 3EFAA 4FBEA 5LYIA 2WYRA 1LANA 2V77A 1B6BA 4M6GA 2BCOA 3JTKA 2RC4A 2JLMA 3E0KA 4JXRA 3UY5A 2HUZA 4CAEA 3LACA 2Z3NA 1CP6A 4A39A 1BOBA 1EE3P 1R3NA 1M4LA 2C1CA
chains in the Genus database with same CATH topology
2YNCA 3S6HA 1CJWA 2FT0A 4M85A 4XPKA 5EC4A 2C27A 2HQYA 3RYOA 4KOUA 4JXQA 4HNXB 4PK3A 4ONUA 5G21A 4JLYA 1M4DA 4E0AA 2QIRA 2B4BA 5H86A 1QSNA 4OAEA 1QSTA 2QECA 2B58A 2K5TA 3CXSA 4X5KA 1RO5A 3S6FA 4UFWA 4CS0B 2FS5A 4UWIA 2PDOA 2Z3PA 4KZTA 4NEXA 4XPDB 5J8FA 1Y7RA 2Y0MA 4AG9A 4XPDC 2OB0A 2R98A 2GE3A 2BEIA 2YGWA 4FD7A 4C7HA 4CGPA 2VBQA 4H6UA 1Q2CA 3BJ7A 3I3GA 4AVAA 3F5BA 4PV6A 3NE7A 4MFZA 5AG5A 4A30A 4A33A 2WPWA 1GHEA 2VQYA 3LD2A 3T90A 2Q44A 2G3TA 1ZO0A 3F8KA 2Q4YA 5KTCA 3BJ8A 2PR1A 2Z11A 2KCWA 4AG7A 4C2XA 4CAVA 2P6GA 2Q4VA 3R1KA 4B5PA 2CNSA 2F5IA 3PZJA 4KOYA 4R57A 4KOSA 3TE4A 1P0HA 4KSAA 3D3SA 5KTAA 2JEVA 4NSQA 4YRHA 2R7HA 4MHDA 3BLNA 3EC4A 4J3GA 4UCNA 4CGLA 4UFXA 4B14A 1XF8A 1OZPA 4Q38A 5G20A 3V8IA 1M1DA 3W6SA 4KLVA 4JWPA 4KUBA 3IWGA 4KS9A 1NMTA 3TCVA 3D8PA 4B11A 2AJ6A 3PP9A 2J8NA 1TIQA 4KOWA 2H5MA 3IGRA 5C82A 4AVBA 4FD4A 2Z3OA 4CRZB 5G22A 1NSLA 3SHPA 2B3VA 2D4PA 2G0BA 2OU2A 4II9A 4CGNA 4UA3A 3TT2A 5JPHA 2B5GA 2VEZA 4MY3A 3GKRA 4HNYB 5AG6A 4OLLA 4RI1A 2R8VA 4R9MA 2VI7A 4U5YA 2IL4A 5BWAB 3P2FA 4B10A 1S7KA 4CGOA 3W6XA 1PUAA 4I49A 4B13A 4Q36A 1LRZA 2HV2A 1Q2YA 1YX0A 5I0CA 2GIVA 2FIAA 3FYNA 5A27A 5G1ZA 2O28A 5IX3A 2OZHA 4QUSA 5C88A 1SQHA 4F6AA 1N71A 1I1DA 1YLEA 4A95A 3F0AA 1YK3A 4KSFA 4C7IA 2D4OA 4MBUA 1VKCA 5DWNA 4U9YA 2YNEA 1MK4A 4UCMA 4MJ8A 2A4NA 4KVXA 4R3KA 5GCNA 4UFVA 1I21A 1S7FA 2PQ8A 4L8AA 4OADA 5ISVA 2CNMA 3T9YA 4YGOA 1Z9UA 4MFLA 2FSRA 2I79A 4IUSA 2ZW5A 4Y49B 4Y49C 4ORFA 1M44A 3SXNA 1YVKA 2NMTA 2YNCC 5AG7A 3CXPA 3ZJ0A 4CYOA 1P4NA 2Q0YA 5HMNA 1YREA 3TTHA 5F48A 4CYNA 3R9FA 2J8RA 3GYAA 2CXAA 3R96A 3TO6A 2X7BA 4NXYA 4HNWB 3K9UA 5CNPA 2G3AA 4AB7A 2AE6A 4PK2A 2Z3LA 4F0XA 2CY2A 4R3LA 2ARHA 3PGPA 4B12A 5DWMA 2P6FA 1MJ9A 2ZW4A 2ZW6A 4KORA 3D2MA 2DPSA 2Z0ZA 3CXQA 2PR8A 1MJAA 2BL1A 5FVJA 3R9EA 4CGMA 2REEA 3H5ZA 4UBRA 2FIWA 4MFQA 1KUVA 3S6KA 2FXFA 4MFJA 4NF1A 1R57A 1S60A 3IU2A 2FE7A 2ZPAA 4KVME 1Y9WA 3H4QA 1K4JA 2WSAA 4EVYA 2PC1A 1CM0A 2ZW7A 2Z10A 4B5PB 4M3SA 3D2PA 1WWZA 2Z3KA 4E8OA 3P2HA 2B4DB 1WK4A 2DPTA 3DR8A 1MJBA 4FD6A 3I9SA 4MFPA 4IF5A 2J8MA 4FD5A 4KOVA 3EXNA 3FB3A 4UWJA 1VHSA 2CNTA 4H89A 3C26A 4DNCA 2JDDA 1YR0A 2EVNA 2JDCA 2OH1A 2DXQA 1XEBA 3A9LA 2PRBA 3TOBA 4QVTA 2Q7BA 3MGDA 3LODA 2OZGA 2P6EA 1YVOA 2Z3MA 1M4IA 4CAFA 4BMHA 3KKWA 2GANA 1IICA 1V0CA 2B3UA 3IWEA 2OZUA 1ON0A 2REFA 5J8CA 3VWEA 3FXTA 4JD6A 4ZBGA 2B5GB 4MI4A 1IYLA 1BO4A 2YNDA 4KUAA 5IB0A 4XPLA 4QC6A 4CRYB 1IYKA 4R87A 4CYQA 3VWDA 2ZXVA 1Z4EA 2ATRA 3QAHA 4KOXA 4C2ZA 4E2AA 4C2YA 3JUWA 2I00A 4K30A 5AGEA 4PSXA 3W91A 1QSRA 3TOAA 2Q04A 2BUEA 5IV0A 1S7LA 3DDDA 3FNCA 1Q2DA 4GS4A 4JJXA 1IIDA 2VZYA 3DNSA 2BSWA 4XNHB 5E96A 2WUUA 4XNHC 1S5KA 2QMLA 3IU1A 5JQ4A 4PSWA 1FY7A 2VXKA 5AG4A 3DSBA 5F49A 4KVOE 4RS2A 4CAXA 4CYPA 5EBVA 2VZZA 5H84A 1Y9KA 4B5OA 5HH1A 1IB1E 3B8GA 4LUAA 5KTDA 3ZZIA 1XE4A 1YGHA 3N7ZA 3TO7A 2P0WA 1QSOA 3DR6A 1KZFA 3JVNA 3G3SA 4CAWA 1I12A 2FCKA 3G8WA 5F47A 2PSWA 1B87A 1U6MA 2B4DA 3R9GA 1M4GA 3OWCA 1QSMA 3EO4A 4H6ZA 1PU9A 4L89A 3TFYA 3SXOA 1XMTA 4YFJA 5F46A 4KLWA 1S7NA 3R95A 4QB9A 4HKFA 2WPXA 2EUIA 5A28A 3EY5A 3FRMA 1J4JA 3FBUA 1UFHA 4MY0A 1KUYA 4U9ZA 4F0YA 4MFKA 4A32A 3WR7A 4LX9A 4UCPA 2FL4A 4KOTA 1L0CA 3TO9A 4C68A 3GY9A 3S6GA 4AVCA 1XIXA 4QBJA 2R1IA 3QB8A 3FIXA 1NE9A 1KUXA 4NCZA 1S3ZA 4ZGYB 4A31A 4A2ZA 4BBHA 1RXTA 1Z4RA 3EFAA 1B6BA 3JTKA 2RC4A 2JLMA 3E0KA 4JXRA 3UY5A 2HUZA 4CAEA 2Z3NA 1BOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6H A;  1CJW A;  2FT0 A;  4M85 A;  4XPK A;  5EC4 A;  2C27 A;  2HQY A;  3RYO A;  4KOU A;  4JXQ A;  4HNX B;  4PK3 A;  4ONU A;  4JLY A;  1M4D A;  4E0A A;  2QIR A;  2B4B A;  5H86 A;  1QSN A;  4OAE A;  1QST A;  2QEC A;  2B58 A;  2K5T A;  3CXS A;  4X5K A;  1RO5 A;  3S6F A;  4CS0 B;  2FS5 A;  4UWI A;  2PDO A;  4KZT A;  4NEX A;  4XPD B;  5J8F A;  1Y7R A;  2Y0M A;  4AG9 A;  4XPD C;  2OB0 A;  2R98 A;  2GE3 A;  2BEI A;  4FD7 A;  2VBQ A;  4H6U A;  1Q2C A;  3BJ7 A;  3I3G A;  4AVA A;  3F5B A;  4PV6 A;  3NE7 A;  2WPW A;  1GHE A;  2VQY A;  3LD2 A;  3T90 A;  2Q44 A;  2G3T A;  3F8K A;  2Q4Y A;  5KTC A;  3BJ8 A;  2PR1 A;  2Z11 A;  2KCW A;  4AG7 A;  4CAV A;  2P6G A;  2Q4V A;  3R1K A;  4B5P A;  2CNS A;  2F5I A;  3PZJ A;  4KOY A;  4R57 A;  4KOS A;  3TE4 A;  1P0H A;  3D3S A;  5KTA A;  2JEV A;  4NSQ A;  4YRH A;  2R7H A;  4MHD A;  3BLN A;  3EC4 A;  4J3G A;  1XF8 A;  1OZP A;  3V8I A;  1M1D A;  3W6S A;  4KLV A;  4JWP A;  4KUB A;  3IWG A;  1NMT A;  3TCV A;  3D8P A;  2AJ6 A;  3PP9 A;  2J8N A;  1TIQ A;  4KOW A;  2H5M A;  3IGR A;  5C82 A;  4AVB A;  4FD4 A;  4CRZ B;  1NSL A;  3SHP A;  2B3V A;  2D4P A;  2G0B A;  2OU2 A;  4II9 A;  4UA3 A;  3TT2 A;  5JPH A;  2B5G A;  2VEZ A;  4MY3 A;  3GKR A;  4HNY B;  4OLL A;  4RI1 A;  2R8V A;  4R9M A;  2VI7 A;  4U5Y A;  2IL4 A;  3P2F A;  1S7K A;  3W6X A;  1PUA A;  4I49 A;  1LRZ A;  2HV2 A;  1Q2Y A;  1YX0 A;  5I0C A;  2GIV A;  2FIA A;  3FYN A;  2O28 A;  5IX3 A;  2OZH A;  4QUS A;  5C88 A;  1SQH A;  4F6A A;  1N71 A;  1I1D A;  1YLE A;  3F0A A;  1YK3 A;  2D4O A;  4MBU A;  1VKC A;  5DWN A;  4U9Y A;  1MK4 A;  4MJ8 A;  2A4N A;  4KVX A;  4R3K A;  5GCN A;  1I21 A;  1S7F A;  2PQ8 A;  4L8A A;  4OAD A;  5ISV A;  2CNM A;  3T9Y A;  4YGO A;  1Z9U A;  2FSR A;  2I79 A;  4IUS A;  2ZW5 A;  4Y49 B;  4Y49 C;  4ORF A;  1M44 A;  3SXN A;  1YVK A;  2NMT A;  3CXP A;  3ZJ0 A;  1P4N A;  2Q0Y A;  5HMN A;  1YRE A;  3TTH A;  5F48 A;  3R9F A;  2J8R A;  3GYA A;  3R96 A;  3TO6 A;  2X7B A;  4NXY A;  4HNW B;  3K9U A;  5CNP A;  2G3A A;  4AB7 A;  2AE6 A;  4PK2 A;  2CY2 A;  4R3L A;  2ARH A;  3PGP A;  5DWM A;  2P6F A;  1MJ9 A;  2ZW4 A;  2ZW6 A;  4KOR A;  3D2M A;  2Z0Z A;  3CXQ A;  2PR8 A;  1MJA A;  2BL1 A;  5FVJ A;  3R9E A;  2REE A;  4UBR A;  2FIW A;  1KUV A;  3S6K A;  2FXF A;  4NF1 A;  1R57 A;  1S60 A;  2FE7 A;  2ZPA A;  4KVM E;  1Y9W A;  3H4Q A;  1K4J A;  4EVY A;  2PC1 A;  1CM0 A;  2ZW7 A;  2Z10 A;  4B5P B;  4M3S A;  3D2P A;  1WWZ A;  4E8O A;  3P2H A;  2B4D B;  1WK4 A;  3DR8 A;  1MJB A;  4FD6 A;  3I9S A;  4IF5 A;  2J8M A;  4FD5 A;  4KOV A;  3EXN A;  3FB3 A;  4UWJ A;  1VHS A;  2CNT A;  4H89 A;  3C26 A;  4DNC A;  2JDD A;  1YR0 A;  2EVN A;  2JDC A;  2OH1 A;  2DXQ A;  1XEB A;  2PRB A;  3TOB A;  4QVT A;  2Q7B A;  3MGD A;  3LOD A;  2OZG A;  2P6E A;  1YVO A;  1M4I A;  4BMH A;  3KKW A;  2GAN A;  1IIC A;  1V0C A;  2B3U A;  2OZU A;  1ON0 A;  2REF A;  5J8C A;  3VWE A;  3FXT A;  4JD6 A;  4ZBG A;  2B5G B;  4MI4 A;  1IYL A;  1BO4 A;  4KUA A;  5IB0 A;  4XPL A;  4QC6 A;  4CRY B;  1IYK A;  4R87 A;  3VWD A;  2ZXV A;  1Z4E A;  2ATR A;  3QAH A;  4KOX A;  4E2A A;  3JUW A;  2I00 A;  4K30 A;  4PSX A;  3W91 A;  1QSR A;  3TOA A;  2Q04 A;  2BUE A;  5IV0 A;  1S7L A;  3DDD A;  3FNC A;  1Q2D A;  4GS4 A;  4JJX A;  1IID A;  2VZY A;  3DNS A;  2BSW A;  4XNH B;  5E96 A;  4XNH C;  1S5K A;  2QML A;  5JQ4 A;  4PSW A;  1FY7 A;  2VXK A;  3DSB A;  5F49 A;  4KVO E;  4RS2 A;  4CAX A;  5EBV A;  2VZZ A;  5H84 A;  1Y9K A;  4B5O A;  5HH1 A;  1IB1 E;  3B8G A;  4LUA A;  5KTD A;  3ZZI A;  1XE4 A;  1YGH A;  3N7Z A;  3TO7 A;  2P0W A;  1QSO A;  3DR6 A;  1KZF A;  3JVN A;  3G3S A;  4CAW A;  1I12 A;  2FCK A;  3G8W A;  5F47 A;  2PSW A;  1B87 A;  1U6M A;  2B4D A;  3R9G A;  1M4G A;  3OWC A;  1QSM A;  3EO4 A;  4H6Z A;  1PU9 A;  4L89 A;  3TFY A;  3SXO A;  1XMT A;  4YFJ A;  5F46 A;  4KLW A;  1S7N A;  3R95 A;  4QB9 A;  4HKF A;  2WPX A;  2EUI A;  3EY5 A;  3FRM A;  1J4J A;  3FBU A;  1UFH A;  4MY0 A;  1KUY A;  4U9Z A;  4F0Y A;  3WR7 A;  4LX9 A;  2FL4 A;  4KOT A;  1L0C A;  3TO9 A;  3GY9 A;  3S6G A;  4AVC A;  1XIX A;  4QBJ A;  2R1I A;  3QB8 A;  3FIX A;  1NE9 A;  1KUX A;  4NCZ A;  1S3Z A;  1RXT A;  1Z4R A;  3EFA A;  1B6B A;  2RC4 A;  2JLM A;  3E0K A;  4JXR A;  3UY5 A;  2HUZ A;  1BOB A; 
#chains in the Genus database with same CATH topology
 2DEA A;  2YNC A;  3S6H A;  1CJW A;  2FT0 A;  2CIJ A;  4M85 A;  4PXD A;  4XPK A;  4P45 A;  5EC4 A;  2C27 A;  2HQY A;  3RYO A;  4KOU A;  4JXQ A;  3D67 A;  4HNX B;  4PK3 A;  4ONU A;  3WC7 A;  5G21 A;  4BIN A;  4JLY A;  1M4D A;  4E0A A;  2EO8 A;  2B4B A;  2QIR A;  5H86 A;  2C6C A;  1QSN A;  4OAE A;  1QMU A;  1QST A;  2QEC A;  3FVL A;  3WC6 A;  3SJF A;  1Z8X A;  1QQ9 A;  2B58 A;  2K5T A;  1FT7 A;  2PVW A;  2PIZ A;  3CXS A;  4X5K A;  1RO5 A;  3S6F A;  2V8V A;  4UFW A;  4CS0 B;  2FS5 A;  4UWI A;  2PDO A;  2Z3P A;  4TWE A;  4ZY0 A;  5D8N A;  4KZT A;  4DJL A;  2AFM A;  2AFZ A;  4GXH A;  3D68 A;  4NEX A;  4OKO A;  4XPD B;  5J8F A;  1Y7R A;  2Y0M A;  4AG9 A;  4XPD C;  3IEH A;  4DYO A;  2OB0 A;  2R98 A;  3KHX A;  2GE3 A;  2V8D A;  4ZX8 A;  3VH9 A;  4NGQ A;  2BEI A;  3RNZ A;  2YGW A;  2IQ6 A;  1Y0Y A;  4FD7 A;  2Q7S A;  3PFO A;  4M6H A;  1ZG9 A;  2PJ8 A;  4FUU A;  4C7H A;  4CGP A;  4F8Z A;  2F7V A;  2VBQ A;  4H6U A;  1Q2C A;  3D4U A;  4HPS A;  3BJ7 A;  3IIB A;  4OID A;  3I3G A;  3S9M A;  4AVA A;  3F5B A;  4PV6 A;  3NE7 A;  4MFZ A;  4AXV A;  2C6G A;  4MRI A;  4EWT A;  2WZN A;  4KSI A;  4UF4 A;  5AG5 A;  4A30 A;  4A33 A;  2PCU A;  2WPW A;  1GHE A;  3CPA A;  2VQY A;  3LD2 A;  3T90 A;  2Q44 A;  3B3V A;  4H2K A;  2G3T A;  1ZO0 A;  3F8K A;  4PPZ A;  3PB9 X;  2Q4Y A;  3S9N A;  5K8N A;  4UEF A;  3B3W A;  5KTC A;  3BJ8 A;  2PJ1 A;  2PR1 A;  2Z11 A;  2KCW A;  4AG7 A;  4C2X A;  4CAV A;  2P6G A;  3BI1 A;  2Q4V A;  3R1K A;  4B5P A;  2CNS A;  2F5I A;  3PZJ A;  4NGN A;  4P4I A;  4KOY A;  4R57 A;  4BD9 A;  3WAB A;  4UIA A;  5HVF A;  4W9Y A;  4KOS A;  4ZYQ A;  3TE4 A;  1P0H A;  2V8G A;  3D3S A;  4KSA A;  4ZY2 A;  5KTA A;  4NGS A;  1BPN A;  2JEV A;  2CTB A;  4NSQ A;  4YRH A;  2R7H A;  4MHD A;  3RZA A;  3BLN A;  3EC4 A;  4NJQ A;  5HXD A;  2O53 A;  4J3G A;  4UCN A;  4CGL A;  2ZOG A;  4UFX A;  4R6T A;  2CTC A;  4B14 A;  1XF8 A;  3BHX A;  1OZP A;  2I3C A;  5LYD A;  4Q38 A;  4WWV A;  5G20 A;  3V8I A;  1M1D A;  4OP4 A;  3PBE A;  3W6S A;  1LOK A;  4KLV A;  4JWP A;  4KUB A;  3IWG A;  3PB4 X;  3H8G A;  4KS9 A;  1IOI A;  1NMT A;  3TCV A;  2IMO A;  1LCP A;  3D8P A;  1PYT B;  4B11 A;  2AJ6 A;  3PP9 A;  1BPM A;  2J8N A;  1TIQ A;  4KOW A;  2H5M A;  3IGR A;  2GLF A;  4AVB A;  5C82 A;  2V8H A;  3FEE A;  4FD4 A;  4NGT A;  2Z3O A;  4PXC A;  4CRZ B;  1IGB A;  5G22 A;  4MMO A;  1NSL A;  4RN7 A;  3SHP A;  2B3V A;  3N5F A;  2D4P A;  2G0B A;  4PXB A;  2OU2 A;  2POK A;  1TKH A;  3KHZ A;  3MN8 A;  4II9 A;  2O4H A;  2PJ2 A;  4CGN A;  3V38 A;  4YU9 A;  4UA3 A;  3TT2 A;  5JPH A;  2B5G A;  2VEZ A;  4MY3 A;  3GKR A;  4HNY B;  5AG6 A;  3TC8 A;  3PB8 X;  4OLL A;  4RI1 A;  4RUH A;  4ZI6 A;  2R8V A;  4R9M A;  1LAM A;  2VI7 A;  2IL4 A;  4ONW A;  4U5Y A;  5BWA B;  3P2F A;  4MCQ A;  4CPA A;  4B10 A;  1S7K A;  3KQZ A;  4G1P A;  4CGO A;  3D7G A;  2PJ9 A;  1Y7E A;  3W6X A;  1PUA A;  1XFO A;  3B7I A;  4I49 A;  7CPA A;  4B13 A;  4Q36 A;  1LRZ A;  2HV2 A;  1Q2Y A;  1YX0 A;  2FVG A;  4NGR A;  1XOV A;  5ELY A;  3D7F A;  5I0C A;  2GIV A;  2FIA A;  3FYN A;  5A27 A;  5G1Z A;  2O28 A;  5IX3 A;  2OZH A;  4MHY A;  2DF5 A;  4QUS A;  2AFS A;  5C88 A;  1SQH A;  4F6A A;  1N71 A;  1I1D A;  1TF9 A;  1YLE A;  1YW6 A;  3F0A A;  3NA6 A;  4A95 A;  4OC4 A;  1YK3 A;  4KSF A;  4C7I A;  2D4O A;  1CPX A;  3CZX A;  4MBU A;  1ARL A;  4F9U A;  1VKC A;  5DWN A;  4U9Y A;  1OBR A;  2J9A A;  2GRE A;  2YNE A;  1ZG8 A;  4P4J A;  1MK4 A;  4UCM A;  4MJ8 A;  2A4N A;  3B3S A;  1VIX A;  4KVX A;  4R3K A;  5GCN A;  1ELM P;  2Q43 A;  4UFV A;  1I21 A;  3BI0 A;  5THW A;  1S7F A;  2PQ8 A;  1HEE A;  4L8A A;  2PJB A;  4OAD A;  5ISV A;  4OC0 A;  3LWU A;  2CNM A;  2ABZ A;  4YGO A;  1Z9U A;  3T9Y A;  4MFL A;  2FSR A;  2ZED A;  3CPX A;  3GLJ A;  1CBX A;  1YSJ A;  2I79 A;  3D66 A;  2ZW5 A;  3ISZ A;  4IUS A;  4Y49 B;  5D29 A;  4Y49 C;  2NSM A;  4ORF A;  1M44 A;  2PRQ A;  3SXN A;  1YVK A;  2NMT A;  2YNC C;  2EBJ A;  5AG7 A;  1RTQ A;  3FMC A;  3CXP A;  3HUV A;  3ZJ0 A;  3KI9 A;  4CYO A;  5JGF A;  1P4N A;  2Q0Y A;  5HMN A;  1YRE A;  3IJ3 A;  3TTH A;  1NSA A;  5F48 A;  2VL1 A;  2NYQ A;  3R9F A;  4CYN A;  2J8R A;  3GYA A;  4A37 A;  1F57 A;  2CXA A;  3R96 A;  6CPA A;  3TO6 A;  5JH9 A;  2X7B A;  4NXY A;  1LFW A;  4A94 A;  4NFR A;  4PQA A;  3KGQ A;  3IC1 A;  5I4M A;  3B3C A;  4P4D A;  3SJE A;  2PE3 A;  2XEF A;  4HNW B;  3K9U A;  3IO1 A;  4X2T A;  1IOF A;  5CNP A;  2G3A A;  4WJB A;  4AB7 A;  2AE6 A;  2PJ0 A;  1IY7 A;  3PB7 X;  4PK2 A;  3HLP A;  3TX8 A;  3FH4 A;  4ZX9 A;  3PB6 X;  1Z8T A;  2Z3L A;  4F0X A;  3LMS A;  2CY2 A;  2ZEH A;  3IWW A;  4R3L A;  2ARH A;  3PGP A;  4B12 A;  1TXR A;  2RB7 A;  2AFU A;  5DWM A;  2P6F A;  1MJ9 A;  3S9L A;  3FJU A;  1DE4 C;  1GYT A;  2ZW4 A;  4P10 A;  1HDU A;  4X8I A;  2ZW6 A;  4ZY1 A;  4KOR A;  3D2M A;  2DPS A;  2Z0Z A;  2OOT A;  3CXQ A;  2QJ8 A;  4R76 A;  1JQG A;  2PR8 A;  1MJA A;  2BL1 A;  5FVJ A;  3R9E A;  4F9V A;  3VAR A;  4CGM A;  2F8H A;  2REE A;  2JBK A;  3H5Z A;  4GM5 A;  4UBR A;  2FIW A;  4MFQ A;  2PJ7 A;  1KUV A;  3S6K A;  2FXF A;  3IFE A;  4MFJ A;  4NF1 A;  1R57 A;  1ZLI A;  1S60 A;  4X3R A;  3T8W A;  3B2Y A;  5HVH A;  3IU2 A;  1YW4 A;  4NGM A;  2FE7 A;  2GFQ A;  1Z2L A;  2ZPA A;  4KVM E;  5IB9 A;  1Y9W A;  3H4Q A;  4FWU A;  4NGP A;  3B35 A;  3MRU A;  1K4J A;  3RBU A;  3D7H A;  2WSA A;  4EVY A;  4TNU A;  1X12 A;  2PC1 A;  1TKJ A;  1CM0 A;  2ZW7 A;  3NE8 A;  4PXE A;  5LRG A;  2AFX A;  4IK2 A;  4MCP A;  1XRY A;  1A2Z A;  2EK8 A;  2Z10 A;  3ISX A;  4B5P B;  4A38 A;  3PEI A;  3D2P A;  4M3S A;  2AFO A;  1KWM A;  1WWZ A;  2Z3K A;  4E8O A;  3P2H A;  2B4D B;  3KL9 A;  1WK4 A;  2DPT A;  4P4B A;  2PIY A;  2AFW A;  1AYE A;  3DR8 A;  1MJB A;  1Z8L A;  4FD6 A;  3KAS A;  4M6I A;  3I9S A;  4MFP A;  4IF5 A;  3SJG A;  2J8M A;  4FD5 A;  3NH4 A;  3FEC A;  4KOV A;  3EXN A;  3FB3 A;  4UWJ A;  1VHS A;  2OR4 A;  3GIU A;  2CNT A;  4H89 A;  3C26 A;  2IJZ A;  4DNC A;  3I1U A;  2JDD A;  1YR0 A;  2EVN A;  4OC3 A;  2JDC A;  2OH1 A;  5LYF A;  2DXQ A;  1XEB A;  3A9L A;  1CG2 A;  5LRJ A;  2PRB A;  3TOB A;  4P6Y A;  3KR5 A;  3FX6 A;  4QVT A;  2Q7B A;  4FAI A;  3MGD A;  3KR4 A;  5EMI A;  2PJA A;  3LOD A;  1Y0R A;  3PFE A;  4MHP A;  4P4F A;  2OZG A;  4K3N A;  1YME A;  1Q7L A;  2P6E A;  3QNV A;  3L2N A;  4MCR A;  3QAY A;  1YVO A;  2Z3M A;  2C6P A;  1M4I A;  1XBU A;  4CAF A;  2PJ3 A;  1BAV A;  1VHE A;  4BMH A;  4EME A;  2BO9 A;  2GAN A;  3KKW A;  3RAM A;  1IIC A;  1V0C A;  3SJX A;  2B3U A;  3IWE A;  2OZU A;  1ON0 A;  2ANP A;  1VHO A;  2REF A;  3JRU A;  5J8C A;  1R43 A;  4P4E A;  3FXT A;  3VWE A;  4JD6 A;  4ZBG A;  2BOA A;  2B5G B;  4MI4 A;  1IYL A;  1BO4 A;  2YND A;  1H8L A;  4KUA A;  3H8F A;  5IB0 A;  4XPL A;  4QC6 A;  4CRY B;  4OC1 A;  1IYK A;  2PVV A;  3K9T A;  4R87 A;  3SI0 A;  3VWD A;  4CYQ A;  1XJO A;  4YWY A;  2ZXV A;  1Z4E A;  2ATR A;  2CF4 A;  3FED A;  3QAH A;  4MXU A;  1Z8W A;  4KOX A;  1CX8 A;  4C2Z A;  3NH5 A;  4E2A A;  4JYW A;  1VGY A;  2PJC A;  4LQG A;  1F2P A;  4C2Y A;  3JUW A;  4MHZ A;  5LYL A;  4B6Z A;  2XEI A;  3B3T A;  2QYV A;  1XMB A;  2I00 A;  4K30 A;  5AGE A;  1UWY A;  1YLO A;  3GUX A;  4PSX A;  3W91 A;  1QSR A;  3TOA A;  2Q04 A;  2BUE A;  4O23 A;  5IV0 A;  4P44 A;  4IAV A;  1S7L A;  4NJR A;  2Q51 A;  3DDD A;  3FNC A;  1LAP A;  1BLL E;  1Q2D A;  3SI2 A;  4GS4 A;  4JJX A;  3CDX A;  1IID A;  2VZY A;  3DNS A;  1FNO A;  2BSW A;  4XNH B;  5E96 A;  1X10 A;  2G9D A;  2WUU A;  2PJ5 A;  4XNH C;  1ARM A;  4Q7A A;  2XEJ A;  1S5K A;  1YQE A;  2QML A;  3IU1 A;  4OIW A;  1F2O A;  1PCA A;  4MCS A;  5JQ4 A;  4PSW A;  1ZG7 A;  1FY7 A;  2VXK A;  5AG4 A;  3DSB A;  4UEZ A;  5F49 A;  4KVO E;  1HDQ A;  5K8P A;  4RS2 A;  8CPA A;  5HVG A;  4CAX A;  4CYP A;  5EBV A;  2VZZ A;  3PRT A;  1DTD A;  5CBM A;  5LRK A;  5CPA A;  2PJ6 A;  5H84 A;  1Y9K A;  3RO0 A;  4B5O A;  5HH1 A;  2QVP A;  1IB1 E;  3B8G A;  4LUA A;  4OME A;  5KTD A;  1CP7 A;  4R8F A;  3ZZI A;  1XE4 A;  1YGH A;  2XEG A;  3H8E A;  3N7Z A;  3TO7 A;  2P0W A;  3WT4 A;  5K8M A;  1QSO A;  4JZ0 A;  3DLJ A;  3DR6 A;  4OC2 A;  1KZF A;  1TF8 A;  2RFH A;  4IHM A;  3KQX A;  3JVN A;  3VAT A;  3G3S A;  4CAW A;  1CPS A;  1I12 A;  2FCK A;  3G8W A;  2PSW A;  1ZLH A;  5F47 A;  1B87 A;  1U6M A;  1Z5R A;  2B4D A;  2GU2 A;  2ZOF A;  3R9G A;  3V7Z A;  1M4G A;  4LQ6 A;  3OWC A;  1QSM A;  1TKF A;  3EO4 A;  4H6Z A;  5JM6 A;  3GB0 A;  5K8O A;  1AUG A;  1PU9 A;  2ODF A;  4L89 A;  3TFY A;  3KZW A;  2Q4Z A;  2ZEM A;  3SXO A;  3NFZ A;  3DGV A;  1XMT A;  4YFJ A;  5F46 A;  3BXM A;  1JWQ A;  4KLW A;  1S7N A;  3R95 A;  5J1Q A;  4QB9 A;  2ZEL A;  4HKF A;  4EFD A;  4Z65 A;  2WPX A;  2EUI A;  5A28 A;  2EWB A;  2HC9 A;  3SI1 A;  3WC5 A;  3EY5 A;  3D7D A;  3FRM A;  1J4J A;  2HB6 A;  3FBU A;  1UFH A;  4MY0 A;  2ZEP A;  1AMP A;  2PJ4 A;  2EK9 A;  1KUY A;  2JBJ A;  4U9Z A;  3CT9 A;  4UIB A;  4DUK A;  4F0Y A;  4UEE A;  2ZEN A;  2ZEO A;  4MFK A;  4A32 A;  3WR7 A;  4LX9 A;  4UCP A;  2FL4 A;  4KOT A;  1L0C A;  3TO9 A;  4C68 A;  5DS0 A;  3GY9 A;  3S6G A;  3NH8 A;  4AVC A;  1XIX A;  3PBB A;  4QBJ A;  3K2K A;  5F09 A;  2R1I A;  3QB8 A;  3FIX A;  4MHN A;  1NE9 A;  4OC5 A;  2JEW A;  1KUX A;  2ZEF A;  4NCZ A;  2GLJ A;  1S3Z A;  4ZGY B;  4A31 A;  4A2Z A;  3FF3 A;  4R7M A;  4BBH A;  1ELL P;  1IU8 A;  2ZEG A;  1RXT A;  2ZEE A;  1Z4R A;  3EFA A;  4FBE A;  5LYI A;  2WYR A;  1LAN A;  2V77 A;  1B6B A;  4M6G A;  2BCO A;  3JTK A;  2RC4 A;  2JLM A;  3E0K A;  4JXR A;  3UY5 A;  2HUZ A;  4CAE A;  3LAC A;  2Z3N A;  1CP6 A;  4A39 A;  1BOB A;  1EE3 P;  1R3N A;  1M4L A;  2C1C A; 
#chains in the Genus database with same CATH homology
 2YNC A;  3S6H A;  1CJW A;  2FT0 A;  4M85 A;  4XPK A;  5EC4 A;  2C27 A;  2HQY A;  3RYO A;  4KOU A;  4JXQ A;  4HNX B;  4PK3 A;  4ONU A;  5G21 A;  4JLY A;  1M4D A;  4E0A A;  2QIR A;  2B4B A;  5H86 A;  1QSN A;  4OAE A;  1QST A;  2QEC A;  2B58 A;  2K5T A;  3CXS A;  4X5K A;  1RO5 A;  3S6F A;  4UFW A;  4CS0 B;  2FS5 A;  4UWI A;  2PDO A;  2Z3P A;  4KZT A;  4NEX A;  4XPD B;  5J8F A;  1Y7R A;  2Y0M A;  4AG9 A;  4XPD C;  2OB0 A;  2R98 A;  2GE3 A;  2BEI A;  2YGW A;  4FD7 A;  4C7H A;  4CGP A;  2VBQ A;  4H6U A;  1Q2C A;  3BJ7 A;  3I3G A;  4AVA A;  3F5B A;  4PV6 A;  3NE7 A;  4MFZ A;  5AG5 A;  4A30 A;  4A33 A;  2WPW A;  1GHE A;  2VQY A;  3LD2 A;  3T90 A;  2Q44 A;  2G3T A;  1ZO0 A;  3F8K A;  2Q4Y A;  5KTC A;  3BJ8 A;  2PR1 A;  2Z11 A;  2KCW A;  4AG7 A;  4C2X A;  4CAV A;  2P6G A;  2Q4V A;  3R1K A;  4B5P A;  2CNS A;  2F5I A;  3PZJ A;  4KOY A;  4R57 A;  4KOS A;  3TE4 A;  1P0H A;  4KSA A;  3D3S A;  5KTA A;  2JEV A;  4NSQ A;  4YRH A;  2R7H A;  4MHD A;  3BLN A;  3EC4 A;  4J3G A;  4UCN A;  4CGL A;  4UFX A;  4B14 A;  1XF8 A;  1OZP A;  4Q38 A;  5G20 A;  3V8I A;  1M1D A;  3W6S A;  4KLV A;  4JWP A;  4KUB A;  3IWG A;  4KS9 A;  1NMT A;  3TCV A;  3D8P A;  4B11 A;  2AJ6 A;  3PP9 A;  2J8N A;  1TIQ A;  4KOW A;  2H5M A;  3IGR A;  5C82 A;  4AVB A;  4FD4 A;  2Z3O A;  4CRZ B;  5G22 A;  1NSL A;  3SHP A;  2B3V A;  2D4P A;  2G0B A;  2OU2 A;  4II9 A;  4CGN A;  4UA3 A;  3TT2 A;  5JPH A;  2B5G A;  2VEZ A;  4MY3 A;  3GKR A;  4HNY B;  5AG6 A;  4OLL A;  4RI1 A;  2R8V A;  4R9M A;  2VI7 A;  4U5Y A;  2IL4 A;  5BWA B;  3P2F A;  4B10 A;  1S7K A;  4CGO A;  3W6X A;  1PUA A;  4I49 A;  4B13 A;  4Q36 A;  1LRZ A;  2HV2 A;  1Q2Y A;  1YX0 A;  5I0C A;  2GIV A;  2FIA A;  3FYN A;  5A27 A;  5G1Z A;  2O28 A;  5IX3 A;  2OZH A;  4QUS A;  5C88 A;  1SQH A;  4F6A A;  1N71 A;  1I1D A;  1YLE A;  4A95 A;  3F0A A;  1YK3 A;  4KSF A;  4C7I A;  2D4O A;  4MBU A;  1VKC A;  5DWN A;  4U9Y A;  2YNE A;  1MK4 A;  4UCM A;  4MJ8 A;  2A4N A;  4KVX A;  4R3K A;  5GCN A;  4UFV A;  1I21 A;  1S7F A;  2PQ8 A;  4L8A A;  4OAD A;  5ISV A;  2CNM A;  3T9Y A;  4YGO A;  1Z9U A;  4MFL A;  2FSR A;  2I79 A;  4IUS A;  2ZW5 A;  4Y49 B;  4Y49 C;  4ORF A;  1M44 A;  3SXN A;  1YVK A;  2NMT A;  2YNC C;  5AG7 A;  3CXP A;  3ZJ0 A;  4CYO A;  1P4N A;  2Q0Y A;  5HMN A;  1YRE A;  3TTH A;  5F48 A;  4CYN A;  3R9F A;  2J8R A;  3GYA A;  2CXA A;  3R96 A;  3TO6 A;  2X7B A;  4NXY A;  4HNW B;  3K9U A;  5CNP A;  2G3A A;  4AB7 A;  2AE6 A;  4PK2 A;  2Z3L A;  4F0X A;  2CY2 A;  4R3L A;  2ARH A;  3PGP A;  4B12 A;  5DWM A;  2P6F A;  1MJ9 A;  2ZW4 A;  2ZW6 A;  4KOR A;  3D2M A;  2DPS A;  2Z0Z A;  3CXQ A;  2PR8 A;  1MJA A;  2BL1 A;  5FVJ A;  3R9E A;  4CGM A;  2REE A;  3H5Z A;  4UBR A;  2FIW A;  4MFQ A;  1KUV A;  3S6K A;  2FXF A;  4MFJ A;  4NF1 A;  1R57 A;  1S60 A;  3IU2 A;  2FE7 A;  2ZPA A;  4KVM E;  1Y9W A;  3H4Q A;  1K4J A;  2WSA A;  4EVY A;  2PC1 A;  1CM0 A;  2ZW7 A;  2Z10 A;  4B5P B;  4M3S A;  3D2P A;  1WWZ A;  2Z3K A;  4E8O A;  3P2H A;  2B4D B;  1WK4 A;  2DPT A;  3DR8 A;  1MJB A;  4FD6 A;  3I9S A;  4MFP A;  4IF5 A;  2J8M A;  4FD5 A;  4KOV A;  3EXN A;  3FB3 A;  4UWJ A;  1VHS A;  2CNT A;  4H89 A;  3C26 A;  4DNC A;  2JDD A;  1YR0 A;  2EVN A;  2JDC A;  2OH1 A;  2DXQ A;  1XEB A;  3A9L A;  2PRB A;  3TOB A;  4QVT A;  2Q7B A;  3MGD A;  3LOD A;  2OZG A;  2P6E A;  1YVO A;  2Z3M A;  1M4I A;  4CAF A;  4BMH A;  3KKW A;  2GAN A;  1IIC A;  1V0C A;  2B3U A;  3IWE A;  2OZU A;  1ON0 A;  2REF A;  5J8C A;  3VWE A;  3FXT A;  4JD6 A;  4ZBG A;  2B5G B;  4MI4 A;  1IYL A;  1BO4 A;  2YND A;  4KUA A;  5IB0 A;  4XPL A;  4QC6 A;  4CRY B;  1IYK A;  4R87 A;  4CYQ A;  3VWD A;  2ZXV A;  1Z4E A;  2ATR A;  3QAH A;  4KOX A;  4C2Z A;  4E2A A;  4C2Y A;  3JUW A;  2I00 A;  4K30 A;  5AGE A;  4PSX A;  3W91 A;  1QSR A;  3TOA A;  2Q04 A;  2BUE A;  5IV0 A;  1S7L A;  3DDD A;  3FNC A;  1Q2D A;  4GS4 A;  4JJX A;  1IID A;  2VZY A;  3DNS A;  2BSW A;  4XNH B;  5E96 A;  2WUU A;  4XNH C;  1S5K A;  2QML A;  3IU1 A;  5JQ4 A;  4PSW A;  1FY7 A;  2VXK A;  5AG4 A;  3DSB A;  5F49 A;  4KVO E;  4RS2 A;  4CAX A;  4CYP A;  5EBV A;  2VZZ A;  5H84 A;  1Y9K A;  4B5O A;  5HH1 A;  1IB1 E;  3B8G A;  4LUA A;  5KTD A;  3ZZI A;  1XE4 A;  1YGH A;  3N7Z A;  3TO7 A;  2P0W A;  1QSO A;  3DR6 A;  1KZF A;  3JVN A;  3G3S A;  4CAW A;  1I12 A;  2FCK A;  3G8W A;  5F47 A;  2PSW A;  1B87 A;  1U6M A;  2B4D A;  3R9G A;  1M4G A;  3OWC A;  1QSM A;  3EO4 A;  4H6Z A;  1PU9 A;  4L89 A;  3TFY A;  3SXO A;  1XMT A;  4YFJ A;  5F46 A;  4KLW A;  1S7N A;  3R95 A;  4QB9 A;  4HKF A;  2WPX A;  2EUI A;  5A28 A;  3EY5 A;  3FRM A;  1J4J A;  3FBU A;  1UFH A;  4MY0 A;  1KUY A;  4U9Z A;  4F0Y A;  4MFK A;  4A32 A;  3WR7 A;  4LX9 A;  4UCP A;  2FL4 A;  4KOT A;  1L0C A;  3TO9 A;  4C68 A;  3GY9 A;  3S6G A;  4AVC A;  1XIX A;  4QBJ A;  2R1I A;  3QB8 A;  3FIX A;  1NE9 A;  1KUX A;  4NCZ A;  1S3Z A;  4ZGY B;  4A31 A;  4A2Z A;  4BBH A;  1RXT A;  1Z4R A;  3EFA A;  1B6B A;  3JTK A;  2RC4 A;  2JLM A;  3E0K A;  4JXR A;  3UY5 A;  2HUZ A;  4CAE A;  2Z3N A;  1BOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...