4LX9A

Archaeal amino-terminal acetyltransferase (nat) bound to acetyl coenzyme a
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
157
structure length
157
Chain Sequence
DFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAIVDNSVVGYIMPRIEWGFSNIKQLPSLVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYYADGEDAYLMARPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ARCHAEAL AMINO-TERMINAL ACETYLTRANSFERASE
publication title Implications for the evolution of eukaryotic amino-terminal acetyltransferase (NAT) enzymes from the structure of an archaeal ortholog.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 48
structure length 157
sequence length 157
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2013-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4lx9A00
4IUSA 5ISVA 4AVBA 1B87A 3BJ7A 3SHPA 2J8MA 3ZZIA 1B6BA 1QSOA 4NCZA 1TIQA 2JEVA 2P6GA 3BLNA 4KORA 3FIXA 2R8VA 4R87A 4NSQA 1Q2CA 4CAWA 4H6UA 4R9MA 4XPKA 1S3ZA 4PSWA 1KZFA 2JDCA 4JWPA 4NEXA 4MI4A 2KCWA 1WK4A 4FD5A 5JQ4A 4NF1A 3VWDA 3C26A 5C88A 2NMTA 2O28A 2Q4VA 2X7BA 3ZJ0A 2QECA 2BUEA 2Q4YA 2R98A 4KOUA 2H5MA 2ATRA 4HNYB 3P2HA 1N71A 1IYKA 1Z4RA 3E0KA 2VQYA 2FCKA 3QB8A 2Q44A 3R9GA 3BJ8A 4ORFA 3F8KA 4F6AA 1QSNA 1S60A 1RXTA 2B58A 4J3GA 1Y9WA 1XF8A 2Z11A 3PGPA 3R9EA 5KTDA 3FXTA 4KOVA 2CNSA 3GKRA 3W6SA 1BO4A 1VHSA 2B3UA 2OB0A 3K9UA 2J8NA 1WWZA 3GY9A 2C27A 1YK3A 5EC4A 3FRMA 3S6KA 2VXKA 3R96A 2A4NA 3G8WA 5F48A 2QIRA 4U9ZA 4L89A 1Y9KA 3D2PA 2ZW5A 4H6ZA 3GYAA 3MGDA 4CAXA 3R9FA 1S7LA 2P0WA 2PSWA 4KLVA 2CY2A 2R1IA 3S6FA 1MK4A 5JPHA 3TO7A 2DXQA 5KTCA 3VWEA 1ON0A 1S7FA 3T90A 4BMHA 2ZPAA 4IF5A 2JLMA 4OADA 3S6GA 4PV6A 2QMLA 2VZYA 4E8OA 5HMNA 2Z10A 4JXQA 4QC6A 1MJBA 1IYLA 3B8GA 5IX3A 1YX0A 4JXRA 1RO5A 1P4NA 1OZPA 1PUAA 4QBJA 1QSTA 2ZW7A 3P2FA 4XPDB 2B5GA 1Y7RA 1YLEA 2ZW6A 4MHDA 2OH1A 2B5GB 2FS5A 4H89A 4XPLA 1KUYA 4L8AA 4ZBGA 2JDDA 4MY3A 5E96A 2GANA 4KOTA 4FD4A 2FE7A 1YVOA 3DSBA 2FL4A 4FD7A 4OLLA 4X5KA 1QSMA 3PP9A 2EUIA 1Z9UA 3TTHA 4PK3A 3CXQA 2BSWA 1S5KA 4U9YA 3SXOA 4XNHC 2RC4A 4DNCA 4YFJA 3TOAA 2HV2A 1Z4EA 5EBVA 2Q7BA 2CNTA 2Q04A 2R7HA 4MJ8A 4OAEA 1IB1E 1NSLA 4PK2A 1XE4A 3I9SA 4EVYA 4LX9A 4QVTA 5F46A 3TO6A 3R95A 5F47A 3FB3A 3PZJA 2PR8A 4UWJA 2D4OA 2J8RA 4KZTA 1IIDA 1L0CA 4FD6A 3F5BA 4R3LA 1R57A 1YGHA 4KUAA 4Y49B 1YR0A 2REFA 2AE6A 1YREA 3IGRA 5H86A 5IV0A 4ONUA 3RYOA 3KKWA 4UA3A 5FVJA 4M85A 2EVNA 2PR1A 3CXPA 3FYNA 2PQ8A 5CNPA 4QB9A 3D2MA 4KVXA 2PDOA 3TO9A 2B4BA 5C82A 4LUAA 3N7ZA 3TFYA 4PSXA 3S6HA 2AJ6A 2OZGA 1SQHA 3EC4A 5HH1A 3DDDA 1BOBA 4HKFA 5GCNA 4KVOE 4CAVA 4QUSA 4KOSA 1U6MA 3LODA 3TE4A 2G3AA 1MJ9A 4F0YA 4UWIA 4KOXA 1KUVA 1M1DA 2HUZA 4KLWA 2BEIA 2F5IA 3I3GA 1S7NA 2FT0A 3H4QA 1UFHA 5H84A 3TT2A 1M4GA 1MJAA 2K5TA 1XIXA 1I12A 2ZW4A 4CS0B 1CM0A 1P0HA 1GHEA 3LD2A 5KTAA 4YGOA 3CXSA 2FXFA 5J8FA 4R3KA 1PU9A 3D3SA 5DWNA 3F0AA 2ZXVA 3OWCA 4GS4A 3R1KA 2OZUA 2WPWA 2VZZA 3JUWA 2FIWA 5IB0A 2PC1A 2B4DA 4K30A 1M4IA 4JD6A 3TOBA 4RI1A 4R57A 4M3SA 2P6FA 2G3TA 3DNSA 1V0CA 2B4DB 5I0CA 3EY5A 3FBUA 1NE9A 4CRZB 4YRHA 4U5YA 1NMTA 4HNWB 4E2AA 1LRZA 4KOWA 2Q0YA 1XEBA 1QSRA 4MBUA 1Q2DA 2FIAA 1IICA 2Z0ZA 4XPDC 4KOYA 4JLYA 3WR7A 2Y0MA 4RS2A 4II9A 4JJXA 3G3SA 3TCVA 2VEZA 2B3VA 1KUXA 3DR8A 4MY0A 3DR6A 3EXNA 1K4JA 4KVME 1J4JA 4AVCA 2I79A 1I21A 2OU2A 5DWMA 4E0AA 1Q2YA 2G0BA 3V8IA 4UBRA 3SXNA 2GE3A 3FNCA 2REEA 2PRBA 2VBQA 1M4DA 4KUBA 4AVAA 3IWGA 1CJWA 2HQYA 2VI7A 3W91A 1S7KA 3NE7A 4HNXB 2FSRA 2BL1A 3T9YA 2I00A 3EO4A 4AB7A 1YVKA 4I49A 3JVNA 1VKCA 2OZHA 3D8PA 2WPXA 5F49A 2CNMA 1I1DA 4AG7A 4XNHB 1M44A 2ARHA 3EFAA 3W6XA 4CRYB 4AG9A 5J8CA 2P6EA 2D4PA 1XMTA 4B5OA 4B5PA 3QAHA 2IL4A 4Y49C 3UY5A 1FY7A 2GIVA 4B5PB 4NXYA
chains in the Genus database with same CATH superfamily
4IUSA 4P4IA 4R8FA 3CPAA 1YLOA 4FUUA 4JYWA 3SJEA 4A95A 4AVBA 4ZY0A 2ZEGA 3B3VA 1BLLE 1B87A 3BJ7A 4WWVA 2J8MA 3SHPA 3ZZIA 5JH9A 1B6BA 1QSOA 2Q51A 1TIQA 1VHEA 2JEVA 2P6GA 4NCZA 4Q38A 3BLNA 4KORA 3FIXA 2R8VA 4R87A 4MFLA 2WYRA 2QVPA 1IOFA 4NSQA 4W9YA 1Q2CA 4PXEA 2Z3OA 5DS0A 3FF3A 3B35A 4CAWA 3SI0A 2IJZA 4FBEA 4H6UA 2C1CA 3IJ3A 4IAVA 4OC4A 3PFEA 4R9MA 1S3ZA 4XPKA 5J1QA 1IY7A 2IQ6A 4PSWA 3PB7X 5CPAA 4CYOA 1KZFA 2JDCA 4JWPA 4NEXA 2RB7A 3NE8A 4MI4A 2KCWA 1WK4A 4FWUA 2ZOFA 4G1PA 4UFWA 4X2TA 4A30A 2PJ1A 4FD5A 5G20A 5JQ4A 4NF1A 3VWDA 3D7HA 4DYOA 3SI1A 3C26A 1FNOA 3B2YA 3B3CA 5C88A 1Y0RA 2NMTA 2WSAA 2O28A 4F8ZA 2PJAA 2Q4VA 2EK8A 2X7BA 4P6YA 3ZJ0A 3LWUA 2QECA 2BUEA 2Q4YA 2R98A 4KOUA 2H5MA 2ATRA 2HC9A 3H8EA 3V38A 4HNYB 3P2HA 1N71A 1IYKA 1Z4RA 2PJ7A 1HEEA 3E0KA 3PB6X 2VQYA 4ZX8A 4MHPA 2FCKA 3QB8A 2Q44A 2F7VA 2V8GA 2CIJA 3R9GA 2Q43A 3BJ8A 3FH4A 1EE3P 5HVGA 4ORFA 4CYPA 3F8KA 4MXUA 1Z2LA 3T8WA 4KSIA 4F6AA 1QSNA 4IK2A 5A27A 5K8MA 1S60A 3IWEA 1RXTA 2B58A 4J3GA 1Y9WA 1XF8A 5HXDA 2Z11A 3PGPA 3R9EA 5KTDA 5A28A 4TWEA 3FXTA 4KOVA 1JQGA 2PE3A 2CNSA 3GKRA 2EO8A 1HDUA 3D4UA 3W6SA 1BO4A 1PYTB 4P4BA 2ZELA 4NJQA 1VHSA 2B3UA 2OB0A 5IB9A 3K9UA 5LYDA 2J8NA 1WWZA 4OP4A 5HVHA 1OBRA 1Y0YA 3GY9A 2C27A 1YK3A 5EC4A 2CXAA 3S9NA 1Q7LA 1CPXA 5JM6A 1XMBA 3D68A 3FRMA 3ISXA 4UEZA 3S6KA 4A2ZA 4ZY1A 3IIBA 2YNCC 2VXKA 3R96A 4EMEA 1KWMA 2A4NA 3G8WA 3FEDA 1PCAA 5F48A 2QIRA 3I1UA 3B7IA 1ZLIA 4U9ZA 4L89A 1Y9KA 3D2PA 2ZW5A 4DUKA 2QYVA 2EK9A 4B5PB 4H6ZA 3GYAA 3B3TA 3MGDA 4CAXA 4OC3A 3R9FA 1S7LA 2P0WA 2PSWA 4IHMA 4KSFA 4KLVA 2CY2A 4UCMA 4CAEA 2R1IA 3H5ZA 3S6FA 1MK4A 1FT7A 1H8LA 4EWTA 3A9LA 4MFQA 2EWBA 4UIBA 5JPHA 1CPSA 3TO7A 1X12A 1NSAA 5THWA 2DXQA 3RBUA 5KTCA 2DF5A 3VWEA 1ON0A 1ARMA 2PJ3A 2ZEOA 4MFKA 1S7FA 4F9UA 4GXHA 5K8OA 3T90A 4ONWA 2ZPAA 4BMHA 4IF5A 2JLMA 1IOIA 4KS9A 4OADA 3S6GA 5LYIA 2DPTA 2ZEEA 4NGRA 5AG7A 4CAFA 4PV6A 4YU9A 3WC6A 5LYFA 2PJ8A 2QMLA 2VZYA 1JWQA 1AMPA 4NGNA 4E8OA 5HMNA 1HDQA 4PXDA 5JGFA 2Z10A 4JXQA 4QC6A 4Q7AA 1MJBA 1LAPA 1IYLA 2XEJA 3B8GA 4P10A 4C68A 2BOAA 2J9AA 4UEFA 4OIDA 5IX3A 3IWWA 1YX0A 2ZENA 3CT9A 4JXRA 2IMOA 4MCSA 1RO5A 4R7MA 4NGQA 1P4NA 1QQ9A 1OZPA 1PUAA 2PJBA 3PB8X 4OIWA 2YNEA 4M6IA 4QBJA 1ELLP 4PXBA 1QSTA 2ZW7A 2CF4A 5HVFA 3P2FA 4XPDB 3WT4A 2B5GA 2Z3MA 1Y7RA 3PB9X 4MHNA 4B11A 1YLEA 2ZW6A 3KI9A 4MHDA 4UFVA 2ZEHA 3PBBA 7CPAA 1BPMA 1F2OA 4JZ0A 2O4HA 2OH1A 2B5GB 2FS5A 4H89A 4MCQA 4XPLA 1VGYA 4WJBA 3NH5A 1KUYA 1X10A 3D67A 2HB6A 4L8AA 4M6HA 2JDDA 4MY3A 4ZBGA 5E96A 2C6PA 2GANA 4F9VA 2PJ0A 4KOTA 4FD4A 4RUHA 2FE7A 3N5FA 4AXVA 1YVOA 4ZYQA 1QMUA 1VIXA 4B14A 3FVLA 3DSBA 1Z8WA 2FL4A 3D7FA 4FD7A 4OLLA 2ZEDA 3SJGA 1A2ZA 4X5KA 1QSMA 5K8NA 2AFMA 2YNCA 3PP9A 4OKOA 5AGEA 2EUIA 1Z9UA 3TTHA 4PK3A 4UF4A 3CXQA 2BSWA 3VH9A 4MHYA 5K8PA 1S5KA 4U9YA 1CBXA 1XFOA 4PPZA 3SXOA 4XNHC 1Z8LA 2RC4A 4NJRA 3S9MA 2AFXA 3PB4X 2PVWA 4K3NA 3BXMA 4P45A 4DNCA 2JBJA 4YFJA 3TOAA 2HV2A 1Z4EA 5EBVA 2Q7BA 2CNTA 4C2ZA 1ARLA 1LCPA 2JBKA 1Z5RA 4MFPA 2Q04A 5ELYA 4B10A 2R7HA 3GIUA 4A94A 4CGLA 2V77A 4MJ8A 4OC5A 4OAEA 4ZY2A 2BO9A 1IB1E 1Z8XA 1NSLA 3WABA 2ANPA 2DPSA 1BAVA 4PK2A 4F0XA 4PXCA 1XE4A 3I9SA 4EVYA 1TF9A 1IGBA 3KR4A 1CP6A 4LX9A 4QVTA 3RZAA 5F46A 3WC7A 3B3WA 3CDXA 3TO6A 3R95A 2PIYA 3H8FA 3PRTA 5F47A 3FB3A 3PZJA 2PR8A 4UWJA 2D4OA 2PRQA 2J8RA 4KZTA 1IIDA 1L0CA 4FD6A 3F5BA 4R3LA 2NSMA 1R57A 1ZLHA 1YGHA 3IEHA 4KUAA 3IFEA 4TNUA 3PBEA 4O23A 1TKHA 1YR0A 2REFA 4Y49B 2AE6A 4UCPA 4C7IA 1YREA 3CZXA 3IGRA 4NFRA 5H86A 5IV0A 2PJ6A 4CPAA 3RO0A 4CYQA 2Q7SA 4ONUA 1LANA 3RYOA 2Z3KA 2CTCA 3DLJA 4MHZA 5G22A 3KKWA 2Z3PA 1F57A 4UA3A 4DJLA 1DTDA 2AFOA 2PCUA 2OR4A 4MCPA 5FVJA 4M85A 4H2KA 4CGNA 2EVNA 2C6CA 2PR1A 3CXPA 4LQ6A 5EMIA 1AYEA 4A38A 4A37A 3FYNA 3QAYA 2PQ8A 5CNPA 2PIZA 4QB9A 4RN7A 4ZI6A 3D2MA 6CPAA 4M6GA 4C2YA 2AFWA 4C7HA 4KVXA 2PDOA 2YNDA 3TO9A 4ZX9A 1R43A 3NH4A 2B4BA 2AFZA 5C82A 4LUAA 3N7ZA 3TFYA 1XRYA 4PSXA 5CBMA 3PFOA 1ZG7A 3S6HA 2AJ6A 2OZGA 1SQHA 3EC4A 1ELMP 5HH1A 3FJUA 3DDDA 1BOBA 2ZEPA 2YGWA 4HKFA 1CP7A 5GCNA 4KVOE 4CAVA 3NH8A 4OC2A 3KQZA 4QUSA 3ISZA 4KOSA 1U6MA 2WUUA 3LODA 1Y7EA 4YWYA 4EFDA 2G3AA 4X8IA 3TE4A 1MJ9A 1TKFA 2PJ4A 4R76A 4UWIA 4F0YA 4KOXA 1KUVA 4BINA 1M1DA 5F09A 1YW6A 2HUZA 3D7DA 3FECA 2GLFA 1AUGA 3KHXA 4KLWA 2BEIA 2F5IA 3I3GA 3JTKA 1S7NA 2ABZA 4X3RA 2GLJA 2ZEFA 2GU2A 2FT0A 2GFQA 4C2XA 3H4QA 1UFHA 5H84A 3KL9A 5D8NA 3TX8A 1XOVA 4HPSA 3TT2A 4Z65A 1Z8TA 1M4GA 1MJAA 2ZEMA 2K5TA 2BCOA 1XIXA 2FVGA 2ODFA 1I12A 2ZW4A 1YW4A 4UFXA 4CS0B 3S9LA 3MN8A 4KSAA 4CYNA 4CGOA 3HLPA 1CM0A 3KQXA 4R6TA 1TF8A 2Z3NA 3IO1A 4OC0A 1P0HA 3NFZA 1GHEA 3LD2A 3CPXA 5KTAA 3JRUA 2PJ2A 2OOTA 1GYTA 4YGOA 3CXSA 5I4MA 2FXFA 5J8FA 1CG2A 3K9TA 4P4DA 4R3KA 4B13A 1PU9A 3BHXA 1UWYA 3D3SA 5D29A 4MRIA 4MCRA 5DWNA 4GM5A 4B12A 2G9DA 3F0AA 2ZXVA 3OWCA 3FX6A 4GS4A 3R1KA 2OZUA 2WPWA 4NGMA 4A33A 2VZZA 1LOKA 2FIWA 2PJCA 2Q4ZA 3JUWA 3SJFA 1R3NA 5IB0A 2POKA 4P4JA 3V7ZA 2PC1A 2B4DA 2Z3LA 2EBJA 4K30A 1M4IA 1ZG8A 4JD6A 5LRGA 4RI1A 3TOBA 3IC1A 2XEFA 4LQGA 4R57A 4M3SA 2P6FA 4MMOA 1BPNA 2G3TA 3DNSA 1V0CA 2B4DB 5I0CA 3EY5A 3FBUA 1NE9A 4CRZB 4YRHA 4U5YA 1NMTA 4HNWB 2I3CA 4E2AA 1LRZA 2QJ8A 4KOWA 2Q0YA 2WZNA 2XEIA 4OMEA 1XEBA 1QSRA 1M4LA 3LMSA 4MBUA 4NGPA 1Q2DA 3IU2A 2FIAA 3MRUA 1IICA 2Z0ZA 1TKJA 4XPDC 4KOYA 4JLYA 3WR7A 2Y0MA 4RS2A 4II9A 2CTBA 4JJXA 3GLJA 3G3SA 5LRJA 3TCVA 1LAMA 2VEZA 3KHZA 3PEIA 2B3VA 4A39A 1KUXA 3H8GA 3DR8A 1F2PA 4MY0A 4UCNA 3RNZA 3DR6A 3EXNA 2GREA 1K4JA 1IU8A 4KVME 1J4JA 4AVCA 2I79A 2JEWA 2V8DA 1I21A 2AFSA 2OU2A 3D7GA 3KASA 5DWMA 1Q2YA 3NA6A 4E0AA 3TC8A 8CPAA 3B3SA 2G0BA 4P4FA 3V8IA 2PJ9A 4UBRA 3KR5A 3K2KA 3SXNA 2F8HA 2GE3A 3FNCA 2REEA 5AG6A 4P44A 2V8HA 2PRBA 5ISVA 2VBQA 3FMCA 4MFJA 1M4DA 3LACA 4KUBA 4AVAA 3IWGA 1CJWA 2HQYA 2VI7A 3W91A 4A31A 1YQEA 1TXRA 1S7KA 2VL1A 3NE7A 4BD9A 1XJOA 4HNXB 4UIAA 2FSRA 2PJ5A 1ZG9A 2BL1A 4UEEA 2XEGA 4CGMA 1YSJA 3QNVA 3T9YA 4OC1A 5AG4A 2I00A 3L2NA 3EO4A 4AB7A 1YMEA 1YVKA 4I49A 3RAMA 3WC5A 3IU1A 3BI0A 2O53A 3GB0A 3SJXA 4P4EA 2ZOGA 1CX8A 3HUVA 3JVNA 1RTQA 3KZWA 3FEEA 4PQAA 1VKCA 2NYQA 2OZHA 3D8PA 2AFUA 4NGTA 4CGPA 5G21A 5G1ZA 2RFHA 5LRKA 2WPXA 3GUXA 5F49A 4NGSA 2CNMA 3VATA 1I1DA 1LFWA 4XNHB 4AG7A 4B6ZA 1M44A 2ARHA 3EFAA 3W6XA 4CRYB 4AG9A 5J8CA 2P6EA 2D4PA 4Q36A 5LYLA 3VARA 2C6GA 4BBHA 1XMTA 4B5OA 4B5PA 3QAHA 4MFZA 2IL4A 2V8VA 5BWAB 4A32A 4Y49C 1VHOA 3SI2A 4FAIA 1XBUA 1DE4C 3UY5A 2DEAA 2PVVA 1FY7A 2GIVA 3BI1A 3DGVA 1ZO0A 4ZGYB 5AG5A 3D66A 3KGQA 4NXYA
chains in the Genus database with same CATH topology
4IUSA 5ISVA 4A95A 4AVBA 1B87A 3BJ7A 3SHPA 2J8MA 3ZZIA 1B6BA 1QSOA 4NCZA 1TIQA 2JEVA 2P6GA 4Q38A 3BLNA 4KORA 3FIXA 2R8VA 4R87A 4MFLA 4NSQA 1Q2CA 2Z3OA 4CAWA 4H6UA 4R9MA 4XPKA 1S3ZA 4PSWA 4CYOA 1KZFA 2JDCA 4JWPA 4NEXA 4MI4A 2KCWA 1WK4A 4A30A 4UFWA 4FD5A 5G20A 5JQ4A 4NF1A 3VWDA 3C26A 5C88A 2NMTA 2WSAA 2O28A 2Q4VA 2X7BA 3ZJ0A 2QECA 2BUEA 2Q4YA 2R98A 4KOUA 2H5MA 2ATRA 4HNYB 3P2HA 1N71A 1IYKA 1Z4RA 3E0KA 2VQYA 2FCKA 3QB8A 2Q44A 3R9GA 3BJ8A 4ORFA 4CYPA 3F8KA 4F6AA 1QSNA 5A27A 1S60A 3IWEA 1RXTA 2B58A 4J3GA 1Y9WA 1XF8A 2Z11A 3PGPA 3R9EA 5KTDA 5A28A 3FXTA 4KOVA 2CNSA 3GKRA 3W6SA 1BO4A 1VHSA 2B3UA 2OB0A 3K9UA 2J8NA 1WWZA 3GY9A 2C27A 1YK3A 5EC4A 2CXAA 3FRMA 3S6KA 4A2ZA 2YNCC 2VXKA 3R96A 2A4NA 3G8WA 5F48A 2QIRA 4U9ZA 4L89A 1Y9KA 3D2PA 2ZW5A 4B5PB 4H6ZA 3GYAA 3MGDA 4CAXA 3R9FA 1S7LA 2P0WA 2PSWA 4KSFA 4KLVA 2CY2A 4UCMA 4CAEA 2R1IA 3H5ZA 3S6FA 1MK4A 3A9LA 4MFQA 5JPHA 3TO7A 2DXQA 5KTCA 3VWEA 1ON0A 4MFKA 1S7FA 3T90A 4BMHA 2ZPAA 4IF5A 2JLMA 4KS9A 4OADA 3S6GA 2DPTA 5AG7A 4CAFA 4PV6A 2QMLA 2VZYA 4E8OA 5HMNA 2Z10A 4JXQA 4QC6A 1MJBA 4C68A 1IYLA 3B8GA 5IX3A 1YX0A 4JXRA 1RO5A 1P4NA 1OZPA 1PUAA 2YNEA 4QBJA 1QSTA 2ZW7A 3P2FA 4XPDB 2B5GA 2Z3MA 1Y7RA 4B11A 1YLEA 2ZW6A 4MHDA 4UFVA 2OH1A 2B5GB 2FS5A 4H89A 4XPLA 1KUYA 4L8AA 4ZBGA 2JDDA 4MY3A 5E96A 2GANA 4KOTA 4FD4A 2FE7A 1YVOA 4B14A 3DSBA 2FL4A 4FD7A 4OLLA 4X5KA 1QSMA 5AGEA 2YNCA 3PP9A 2EUIA 1Z9UA 3TTHA 4PK3A 3CXQA 2BSWA 1S5KA 4U9YA 3SXOA 4XNHC 2RC4A 4DNCA 4YFJA 3TOAA 2HV2A 1Z4EA 5EBVA 2Q7BA 2CNTA 4C2ZA 4MFPA 2Q04A 4B10A 4CGLA 2R7HA 4MJ8A 4OAEA 1IB1E 1NSLA 2DPSA 4PK2A 4F0XA 1XE4A 3I9SA 4EVYA 4LX9A 4QVTA 5F46A 3TO6A 3R95A 5F47A 3FB3A 3PZJA 2PR8A 4UWJA 2D4OA 2J8RA 4KZTA 1IIDA 1L0CA 4FD6A 3F5BA 4R3LA 1R57A 1YGHA 4KUAA 4Y49B 1YR0A 2REFA 2AE6A 4UCPA 4C7IA 1YREA 3IGRA 5H86A 5IV0A 4CYQA 4ONUA 3RYOA 2Z3KA 5G22A 3KKWA 2Z3PA 4UA3A 5FVJA 4M85A 4CGNA 2EVNA 2PR1A 3CXPA 3FYNA 2PQ8A 5CNPA 4QB9A 3D2MA 4C2YA 4C7HA 4KVXA 2PDOA 2YNDA 3TO9A 2B4BA 5C82A 4LUAA 3N7ZA 3TFYA 4PSXA 3S6HA 2AJ6A 2OZGA 1SQHA 3EC4A 5HH1A 3DDDA 1BOBA 4HKFA 2YGWA 5GCNA 4KVOE 4CAVA 4QUSA 4KOSA 1U6MA 2WUUA 3LODA 3TE4A 2G3AA 1MJ9A 4F0YA 4UWIA 4KOXA 1KUVA 1M1DA 2HUZA 4KLWA 2BEIA 2F5IA 3I3GA 3JTKA 1S7NA 2FT0A 4C2XA 3H4QA 1UFHA 5H84A 3TT2A 1M4GA 1MJAA 2K5TA 1XIXA 1I12A 2ZW4A 4UFXA 4CS0B 4KSAA 4CYNA 4CGOA 1CM0A 2Z3NA 1P0HA 1GHEA 3LD2A 5KTAA 4YGOA 3CXSA 2FXFA 5J8FA 4R3KA 4B13A 1PU9A 3D3SA 4B12A 5DWNA 3F0AA 2ZXVA 3OWCA 4GS4A 3R1KA 2OZUA 2WPWA 4A33A 2VZZA 3JUWA 2FIWA 5IB0A 2PC1A 2B4DA 2Z3LA 4K30A 1M4IA 4JD6A 3TOBA 4RI1A 4R57A 4M3SA 2P6FA 2G3TA 3DNSA 1V0CA 2B4DB 5I0CA 3EY5A 3FBUA 1NE9A 4CRZB 4YRHA 4U5YA 1NMTA 4HNWB 4E2AA 1LRZA 4KOWA 2Q0YA 1XEBA 1QSRA 4MBUA 1Q2DA 3IU2A 2FIAA 1IICA 2Z0ZA 4XPDC 4KOYA 4JLYA 3WR7A 2Y0MA 4RS2A 4II9A 4JJXA 3G3SA 3TCVA 2VEZA 2B3VA 1KUXA 3DR8A 4MY0A 4UCNA 3DR6A 3EXNA 1K4JA 4KVME 1J4JA 4AVCA 2I79A 1I21A 2OU2A 5DWMA 4E0AA 1Q2YA 2G0BA 3V8IA 4UBRA 3SXNA 2GE3A 3FNCA 2REEA 5AG6A 2PRBA 2VBQA 4MFJA 1M4DA 4KUBA 4AVAA 3IWGA 1CJWA 2HQYA 2VI7A 3W91A 4A31A 1S7KA 3NE7A 4HNXB 2FSRA 2BL1A 4CGMA 3T9YA 5AG4A 2I00A 3EO4A 4AB7A 1YVKA 4I49A 3IU1A 3JVNA 1VKCA 2OZHA 3D8PA 4CGPA 5G21A 5G1ZA 2WPXA 5F49A 2CNMA 1I1DA 4AG7A 4XNHB 1M44A 2ARHA 3EFAA 3W6XA 4CRYB 4AG9A 5J8CA 2P6EA 2D4PA 4Q36A 4BBHA 1XMTA 4B5OA 4B5PA 3QAHA 4MFZA 2IL4A 5BWAB 4A32A 4Y49C 3UY5A 1FY7A 2GIVA 4ZGYB 1ZO0A 5AG5A 4NXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUS A;  5ISV A;  4AVB A;  1B87 A;  3BJ7 A;  3SHP A;  2J8M A;  3ZZI A;  1B6B A;  1QSO A;  4NCZ A;  1TIQ A;  2JEV A;  2P6G A;  3BLN A;  4KOR A;  3FIX A;  2R8V A;  4R87 A;  4NSQ A;  1Q2C A;  4CAW A;  4H6U A;  4R9M A;  4XPK A;  1S3Z A;  4PSW A;  1KZF A;  2JDC A;  4JWP A;  4NEX A;  4MI4 A;  2KCW A;  1WK4 A;  4FD5 A;  5JQ4 A;  4NF1 A;  3VWD A;  3C26 A;  5C88 A;  2NMT A;  2O28 A;  2Q4V A;  2X7B A;  3ZJ0 A;  2QEC A;  2BUE A;  2Q4Y A;  2R98 A;  4KOU A;  2H5M A;  2ATR A;  4HNY B;  3P2H A;  1N71 A;  1IYK A;  1Z4R A;  3E0K A;  2VQY A;  2FCK A;  3QB8 A;  2Q44 A;  3R9G A;  3BJ8 A;  4ORF A;  3F8K A;  4F6A A;  1QSN A;  1S60 A;  1RXT A;  2B58 A;  4J3G A;  1Y9W A;  1XF8 A;  2Z11 A;  3PGP A;  3R9E A;  5KTD A;  3FXT A;  4KOV A;  2CNS A;  3GKR A;  3W6S A;  1BO4 A;  1VHS A;  2B3U A;  2OB0 A;  3K9U A;  2J8N A;  1WWZ A;  3GY9 A;  2C27 A;  1YK3 A;  5EC4 A;  3FRM A;  3S6K A;  2VXK A;  3R96 A;  2A4N A;  3G8W A;  5F48 A;  2QIR A;  4U9Z A;  4L89 A;  1Y9K A;  3D2P A;  2ZW5 A;  4H6Z A;  3GYA A;  3MGD A;  4CAX A;  3R9F A;  1S7L A;  2P0W A;  2PSW A;  4KLV A;  2CY2 A;  2R1I A;  3S6F A;  1MK4 A;  5JPH A;  3TO7 A;  2DXQ A;  5KTC A;  3VWE A;  1ON0 A;  1S7F A;  3T90 A;  4BMH A;  2ZPA A;  4IF5 A;  2JLM A;  4OAD A;  3S6G A;  4PV6 A;  2QML A;  2VZY A;  4E8O A;  5HMN A;  2Z10 A;  4JXQ A;  4QC6 A;  1MJB A;  1IYL A;  3B8G A;  5IX3 A;  1YX0 A;  4JXR A;  1RO5 A;  1P4N A;  1OZP A;  1PUA A;  4QBJ A;  1QST A;  2ZW7 A;  3P2F A;  4XPD B;  2B5G A;  1Y7R A;  1YLE A;  2ZW6 A;  4MHD A;  2OH1 A;  2B5G B;  2FS5 A;  4H89 A;  4XPL A;  1KUY A;  4L8A A;  4ZBG A;  2JDD A;  4MY3 A;  5E96 A;  2GAN A;  4KOT A;  4FD4 A;  2FE7 A;  1YVO A;  3DSB A;  2FL4 A;  4FD7 A;  4OLL A;  4X5K A;  1QSM A;  3PP9 A;  2EUI A;  1Z9U A;  3TTH A;  4PK3 A;  3CXQ A;  2BSW A;  1S5K A;  4U9Y A;  3SXO A;  4XNH C;  2RC4 A;  4DNC A;  4YFJ A;  3TOA A;  2HV2 A;  1Z4E A;  5EBV A;  2Q7B A;  2CNT A;  2Q04 A;  2R7H A;  4MJ8 A;  4OAE A;  1IB1 E;  1NSL A;  4PK2 A;  1XE4 A;  3I9S A;  4EVY A;  4LX9 A;  4QVT A;  5F46 A;  3TO6 A;  3R95 A;  5F47 A;  3FB3 A;  3PZJ A;  2PR8 A;  4UWJ A;  2D4O A;  2J8R A;  4KZT A;  1IID A;  1L0C A;  4FD6 A;  3F5B A;  4R3L A;  1R57 A;  1YGH A;  4KUA A;  4Y49 B;  1YR0 A;  2REF A;  2AE6 A;  1YRE A;  3IGR A;  5H86 A;  5IV0 A;  4ONU A;  3RYO A;  3KKW A;  4UA3 A;  5FVJ A;  4M85 A;  2EVN A;  2PR1 A;  3CXP A;  3FYN A;  2PQ8 A;  5CNP A;  4QB9 A;  3D2M A;  4KVX A;  2PDO A;  3TO9 A;  2B4B A;  5C82 A;  4LUA A;  3N7Z A;  3TFY A;  4PSX A;  3S6H A;  2AJ6 A;  2OZG A;  1SQH A;  3EC4 A;  5HH1 A;  3DDD A;  1BOB A;  4HKF A;  5GCN A;  4KVO E;  4CAV A;  4QUS A;  4KOS A;  1U6M A;  3LOD A;  3TE4 A;  2G3A A;  1MJ9 A;  4F0Y A;  4UWI A;  4KOX A;  1KUV A;  1M1D A;  2HUZ A;  4KLW A;  2BEI A;  2F5I A;  3I3G A;  1S7N A;  2FT0 A;  3H4Q A;  1UFH A;  5H84 A;  3TT2 A;  1M4G A;  1MJA A;  2K5T A;  1XIX A;  1I12 A;  2ZW4 A;  4CS0 B;  1CM0 A;  1P0H A;  1GHE A;  3LD2 A;  5KTA A;  4YGO A;  3CXS A;  2FXF A;  5J8F A;  4R3K A;  1PU9 A;  3D3S A;  5DWN A;  3F0A A;  2ZXV A;  3OWC A;  4GS4 A;  3R1K A;  2OZU A;  2WPW A;  2VZZ A;  3JUW A;  2FIW A;  5IB0 A;  2PC1 A;  2B4D A;  4K30 A;  1M4I A;  4JD6 A;  3TOB A;  4RI1 A;  4R57 A;  4M3S A;  2P6F A;  2G3T A;  3DNS A;  1V0C A;  2B4D B;  5I0C A;  3EY5 A;  3FBU A;  1NE9 A;  4CRZ B;  4YRH A;  4U5Y A;  1NMT A;  4HNW B;  4E2A A;  1LRZ A;  4KOW A;  2Q0Y A;  1XEB A;  1QSR A;  4MBU A;  1Q2D A;  2FIA A;  1IIC A;  2Z0Z A;  4XPD C;  4KOY A;  4JLY A;  3WR7 A;  2Y0M A;  4RS2 A;  4II9 A;  4JJX A;  3G3S A;  3TCV A;  2VEZ A;  2B3V A;  1KUX A;  3DR8 A;  4MY0 A;  3DR6 A;  3EXN A;  1K4J A;  4KVM E;  1J4J A;  4AVC A;  2I79 A;  1I21 A;  2OU2 A;  5DWM A;  4E0A A;  1Q2Y A;  2G0B A;  3V8I A;  4UBR A;  3SXN A;  2GE3 A;  3FNC A;  2REE A;  2PRB A;  2VBQ A;  1M4D A;  4KUB A;  4AVA A;  3IWG A;  1CJW A;  2HQY A;  2VI7 A;  3W91 A;  1S7K A;  3NE7 A;  4HNX B;  2FSR A;  2BL1 A;  3T9Y A;  2I00 A;  3EO4 A;  4AB7 A;  1YVK A;  4I49 A;  3JVN A;  1VKC A;  2OZH A;  3D8P A;  2WPX A;  5F49 A;  2CNM A;  1I1D A;  4AG7 A;  4XNH B;  1M44 A;  2ARH A;  3EFA A;  3W6X A;  4CRY B;  4AG9 A;  5J8C A;  2P6E A;  2D4P A;  1XMT A;  4B5O A;  4B5P A;  3QAH A;  2IL4 A;  4Y49 C;  3UY5 A;  1FY7 A;  2GIV A;  4B5P B;  4NXY A; 
#chains in the Genus database with same CATH topology
 4IUS A;  4P4I A;  4R8F A;  3CPA A;  1YLO A;  4FUU A;  4JYW A;  3SJE A;  4A95 A;  4AVB A;  4ZY0 A;  2ZEG A;  3B3V A;  1BLL E;  1B87 A;  3BJ7 A;  4WWV A;  2J8M A;  3SHP A;  3ZZI A;  5JH9 A;  1B6B A;  1QSO A;  2Q51 A;  1TIQ A;  1VHE A;  2JEV A;  2P6G A;  4NCZ A;  4Q38 A;  3BLN A;  4KOR A;  3FIX A;  2R8V A;  4R87 A;  4MFL A;  2WYR A;  2QVP A;  1IOF A;  4NSQ A;  4W9Y A;  1Q2C A;  4PXE A;  2Z3O A;  5DS0 A;  3FF3 A;  3B35 A;  4CAW A;  3SI0 A;  2IJZ A;  4FBE A;  4H6U A;  2C1C A;  3IJ3 A;  4IAV A;  4OC4 A;  3PFE A;  4R9M A;  1S3Z A;  4XPK A;  5J1Q A;  1IY7 A;  2IQ6 A;  4PSW A;  3PB7 X;  5CPA A;  4CYO A;  1KZF A;  2JDC A;  4JWP A;  4NEX A;  2RB7 A;  3NE8 A;  4MI4 A;  2KCW A;  1WK4 A;  4FWU A;  2ZOF A;  4G1P A;  4UFW A;  4X2T A;  4A30 A;  2PJ1 A;  4FD5 A;  5G20 A;  5JQ4 A;  4NF1 A;  3VWD A;  3D7H A;  4DYO A;  3SI1 A;  3C26 A;  1FNO A;  3B2Y A;  3B3C A;  5C88 A;  1Y0R A;  2NMT A;  2WSA A;  2O28 A;  4F8Z A;  2PJA A;  2Q4V A;  2EK8 A;  2X7B A;  4P6Y A;  3ZJ0 A;  3LWU A;  2QEC A;  2BUE A;  2Q4Y A;  2R98 A;  4KOU A;  2H5M A;  2ATR A;  2HC9 A;  3H8E A;  3V38 A;  4HNY B;  3P2H A;  1N71 A;  1IYK A;  1Z4R A;  2PJ7 A;  1HEE A;  3E0K A;  3PB6 X;  2VQY A;  4ZX8 A;  4MHP A;  2FCK A;  3QB8 A;  2Q44 A;  2F7V A;  2V8G A;  2CIJ A;  3R9G A;  2Q43 A;  3BJ8 A;  3FH4 A;  1EE3 P;  5HVG A;  4ORF A;  4CYP A;  3F8K A;  4MXU A;  1Z2L A;  3T8W A;  4KSI A;  4F6A A;  1QSN A;  4IK2 A;  5A27 A;  5K8M A;  1S60 A;  3IWE A;  1RXT A;  2B58 A;  4J3G A;  1Y9W A;  1XF8 A;  5HXD A;  2Z11 A;  3PGP A;  3R9E A;  5KTD A;  5A28 A;  4TWE A;  3FXT A;  4KOV A;  1JQG A;  2PE3 A;  2CNS A;  3GKR A;  2EO8 A;  1HDU A;  3D4U A;  3W6S A;  1BO4 A;  1PYT B;  4P4B A;  2ZEL A;  4NJQ A;  1VHS A;  2B3U A;  2OB0 A;  5IB9 A;  3K9U A;  5LYD A;  2J8N A;  1WWZ A;  4OP4 A;  5HVH A;  1OBR A;  1Y0Y A;  3GY9 A;  2C27 A;  1YK3 A;  5EC4 A;  2CXA A;  3S9N A;  1Q7L A;  1CPX A;  5JM6 A;  1XMB A;  3D68 A;  3FRM A;  3ISX A;  4UEZ A;  3S6K A;  4A2Z A;  4ZY1 A;  3IIB A;  2YNC C;  2VXK A;  3R96 A;  4EME A;  1KWM A;  2A4N A;  3G8W A;  3FED A;  1PCA A;  5F48 A;  2QIR A;  3I1U A;  3B7I A;  1ZLI A;  4U9Z A;  4L89 A;  1Y9K A;  3D2P A;  2ZW5 A;  4DUK A;  2QYV A;  2EK9 A;  4B5P B;  4H6Z A;  3GYA A;  3B3T A;  3MGD A;  4CAX A;  4OC3 A;  3R9F A;  1S7L A;  2P0W A;  2PSW A;  4IHM A;  4KSF A;  4KLV A;  2CY2 A;  4UCM A;  4CAE A;  2R1I A;  3H5Z A;  3S6F A;  1MK4 A;  1FT7 A;  1H8L A;  4EWT A;  3A9L A;  4MFQ A;  2EWB A;  4UIB A;  5JPH A;  1CPS A;  3TO7 A;  1X12 A;  1NSA A;  5THW A;  2DXQ A;  3RBU A;  5KTC A;  2DF5 A;  3VWE A;  1ON0 A;  1ARM A;  2PJ3 A;  2ZEO A;  4MFK A;  1S7F A;  4F9U A;  4GXH A;  5K8O A;  3T90 A;  4ONW A;  2ZPA A;  4BMH A;  4IF5 A;  2JLM A;  1IOI A;  4KS9 A;  4OAD A;  3S6G A;  5LYI A;  2DPT A;  2ZEE A;  4NGR A;  5AG7 A;  4CAF A;  4PV6 A;  4YU9 A;  3WC6 A;  5LYF A;  2PJ8 A;  2QML A;  2VZY A;  1JWQ A;  1AMP A;  4NGN A;  4E8O A;  5HMN A;  1HDQ A;  4PXD A;  5JGF A;  2Z10 A;  4JXQ A;  4QC6 A;  4Q7A A;  1MJB A;  1LAP A;  1IYL A;  2XEJ A;  3B8G A;  4P10 A;  4C68 A;  2BOA A;  2J9A A;  4UEF A;  4OID A;  5IX3 A;  3IWW A;  1YX0 A;  2ZEN A;  3CT9 A;  4JXR A;  2IMO A;  4MCS A;  1RO5 A;  4R7M A;  4NGQ A;  1P4N A;  1QQ9 A;  1OZP A;  1PUA A;  2PJB A;  3PB8 X;  4OIW A;  2YNE A;  4M6I A;  4QBJ A;  1ELL P;  4PXB A;  1QST A;  2ZW7 A;  2CF4 A;  5HVF A;  3P2F A;  4XPD B;  3WT4 A;  2B5G A;  2Z3M A;  1Y7R A;  3PB9 X;  4MHN A;  4B11 A;  1YLE A;  2ZW6 A;  3KI9 A;  4MHD A;  4UFV A;  2ZEH A;  3PBB A;  7CPA A;  1BPM A;  1F2O A;  4JZ0 A;  2O4H A;  2OH1 A;  2B5G B;  2FS5 A;  4H89 A;  4MCQ A;  4XPL A;  1VGY A;  4WJB A;  3NH5 A;  1KUY A;  1X10 A;  3D67 A;  2HB6 A;  4L8A A;  4M6H A;  2JDD A;  4MY3 A;  4ZBG A;  5E96 A;  2C6P A;  2GAN A;  4F9V A;  2PJ0 A;  4KOT A;  4FD4 A;  4RUH A;  2FE7 A;  3N5F A;  4AXV A;  1YVO A;  4ZYQ A;  1QMU A;  1VIX A;  4B14 A;  3FVL A;  3DSB A;  1Z8W A;  2FL4 A;  3D7F A;  4FD7 A;  4OLL A;  2ZED A;  3SJG A;  1A2Z A;  4X5K A;  1QSM A;  5K8N A;  2AFM A;  2YNC A;  3PP9 A;  4OKO A;  5AGE A;  2EUI A;  1Z9U A;  3TTH A;  4PK3 A;  4UF4 A;  3CXQ A;  2BSW A;  3VH9 A;  4MHY A;  5K8P A;  1S5K A;  4U9Y A;  1CBX A;  1XFO A;  4PPZ A;  3SXO A;  4XNH C;  1Z8L A;  2RC4 A;  4NJR A;  3S9M A;  2AFX A;  3PB4 X;  2PVW A;  4K3N A;  3BXM A;  4P45 A;  4DNC A;  2JBJ A;  4YFJ A;  3TOA A;  2HV2 A;  1Z4E A;  5EBV A;  2Q7B A;  2CNT A;  4C2Z A;  1ARL A;  1LCP A;  2JBK A;  1Z5R A;  4MFP A;  2Q04 A;  5ELY A;  4B10 A;  2R7H A;  3GIU A;  4A94 A;  4CGL A;  2V77 A;  4MJ8 A;  4OC5 A;  4OAE A;  4ZY2 A;  2BO9 A;  1IB1 E;  1Z8X A;  1NSL A;  3WAB A;  2ANP A;  2DPS A;  1BAV A;  4PK2 A;  4F0X A;  4PXC A;  1XE4 A;  3I9S A;  4EVY A;  1TF9 A;  1IGB A;  3KR4 A;  1CP6 A;  4LX9 A;  4QVT A;  3RZA A;  5F46 A;  3WC7 A;  3B3W A;  3CDX A;  3TO6 A;  3R95 A;  2PIY A;  3H8F A;  3PRT A;  5F47 A;  3FB3 A;  3PZJ A;  2PR8 A;  4UWJ A;  2D4O A;  2PRQ A;  2J8R A;  4KZT A;  1IID A;  1L0C A;  4FD6 A;  3F5B A;  4R3L A;  2NSM A;  1R57 A;  1ZLH A;  1YGH A;  3IEH A;  4KUA A;  3IFE A;  4TNU A;  3PBE A;  4O23 A;  1TKH A;  1YR0 A;  2REF A;  4Y49 B;  2AE6 A;  4UCP A;  4C7I A;  1YRE A;  3CZX A;  3IGR A;  4NFR A;  5H86 A;  5IV0 A;  2PJ6 A;  4CPA A;  3RO0 A;  4CYQ A;  2Q7S A;  4ONU A;  1LAN A;  3RYO A;  2Z3K A;  2CTC A;  3DLJ A;  4MHZ A;  5G22 A;  3KKW A;  2Z3P A;  1F57 A;  4UA3 A;  4DJL A;  1DTD A;  2AFO A;  2PCU A;  2OR4 A;  4MCP A;  5FVJ A;  4M85 A;  4H2K A;  4CGN A;  2EVN A;  2C6C A;  2PR1 A;  3CXP A;  4LQ6 A;  5EMI A;  1AYE A;  4A38 A;  4A37 A;  3FYN A;  3QAY A;  2PQ8 A;  5CNP A;  2PIZ A;  4QB9 A;  4RN7 A;  4ZI6 A;  3D2M A;  6CPA A;  4M6G A;  4C2Y A;  2AFW A;  4C7H A;  4KVX A;  2PDO A;  2YND A;  3TO9 A;  4ZX9 A;  1R43 A;  3NH4 A;  2B4B A;  2AFZ A;  5C82 A;  4LUA A;  3N7Z A;  3TFY A;  1XRY A;  4PSX A;  5CBM A;  3PFO A;  1ZG7 A;  3S6H A;  2AJ6 A;  2OZG A;  1SQH A;  3EC4 A;  1ELM P;  5HH1 A;  3FJU A;  3DDD A;  1BOB A;  2ZEP A;  2YGW A;  4HKF A;  1CP7 A;  5GCN A;  4KVO E;  4CAV A;  3NH8 A;  4OC2 A;  3KQZ A;  4QUS A;  3ISZ A;  4KOS A;  1U6M A;  2WUU A;  3LOD A;  1Y7E A;  4YWY A;  4EFD A;  2G3A A;  4X8I A;  3TE4 A;  1MJ9 A;  1TKF A;  2PJ4 A;  4R76 A;  4UWI A;  4F0Y A;  4KOX A;  1KUV A;  4BIN A;  1M1D A;  5F09 A;  1YW6 A;  2HUZ A;  3D7D A;  3FEC A;  2GLF A;  1AUG A;  3KHX A;  4KLW A;  2BEI A;  2F5I A;  3I3G A;  3JTK A;  1S7N A;  2ABZ A;  4X3R A;  2GLJ A;  2ZEF A;  2GU2 A;  2FT0 A;  2GFQ A;  4C2X A;  3H4Q A;  1UFH A;  5H84 A;  3KL9 A;  5D8N A;  3TX8 A;  1XOV A;  4HPS A;  3TT2 A;  4Z65 A;  1Z8T A;  1M4G A;  1MJA A;  2ZEM A;  2K5T A;  2BCO A;  1XIX A;  2FVG A;  2ODF A;  1I12 A;  2ZW4 A;  1YW4 A;  4UFX A;  4CS0 B;  3S9L A;  3MN8 A;  4KSA A;  4CYN A;  4CGO A;  3HLP A;  1CM0 A;  3KQX A;  4R6T A;  1TF8 A;  2Z3N A;  3IO1 A;  4OC0 A;  1P0H A;  3NFZ A;  1GHE A;  3LD2 A;  3CPX A;  5KTA A;  3JRU A;  2PJ2 A;  2OOT A;  1GYT A;  4YGO A;  3CXS A;  5I4M A;  2FXF A;  5J8F A;  1CG2 A;  3K9T A;  4P4D A;  4R3K A;  4B13 A;  1PU9 A;  3BHX A;  1UWY A;  3D3S A;  5D29 A;  4MRI A;  4MCR A;  5DWN A;  4GM5 A;  4B12 A;  2G9D A;  3F0A A;  2ZXV A;  3OWC A;  3FX6 A;  4GS4 A;  3R1K A;  2OZU A;  2WPW A;  4NGM A;  4A33 A;  2VZZ A;  1LOK A;  2FIW A;  2PJC A;  2Q4Z A;  3JUW A;  3SJF A;  1R3N A;  5IB0 A;  2POK A;  4P4J A;  3V7Z A;  2PC1 A;  2B4D A;  2Z3L A;  2EBJ A;  4K30 A;  1M4I A;  1ZG8 A;  4JD6 A;  5LRG A;  4RI1 A;  3TOB A;  3IC1 A;  2XEF A;  4LQG A;  4R57 A;  4M3S A;  2P6F A;  4MMO A;  1BPN A;  2G3T A;  3DNS A;  1V0C A;  2B4D B;  5I0C A;  3EY5 A;  3FBU A;  1NE9 A;  4CRZ B;  4YRH A;  4U5Y A;  1NMT A;  4HNW B;  2I3C A;  4E2A A;  1LRZ A;  2QJ8 A;  4KOW A;  2Q0Y A;  2WZN A;  2XEI A;  4OME A;  1XEB A;  1QSR A;  1M4L A;  3LMS A;  4MBU A;  4NGP A;  1Q2D A;  3IU2 A;  2FIA A;  3MRU A;  1IIC A;  2Z0Z A;  1TKJ A;  4XPD C;  4KOY A;  4JLY A;  3WR7 A;  2Y0M A;  4RS2 A;  4II9 A;  2CTB A;  4JJX A;  3GLJ A;  3G3S A;  5LRJ A;  3TCV A;  1LAM A;  2VEZ A;  3KHZ A;  3PEI A;  2B3V A;  4A39 A;  1KUX A;  3H8G A;  3DR8 A;  1F2P A;  4MY0 A;  4UCN A;  3RNZ A;  3DR6 A;  3EXN A;  2GRE A;  1K4J A;  1IU8 A;  4KVM E;  1J4J A;  4AVC A;  2I79 A;  2JEW A;  2V8D A;  1I21 A;  2AFS A;  2OU2 A;  3D7G A;  3KAS A;  5DWM A;  1Q2Y A;  3NA6 A;  4E0A A;  3TC8 A;  8CPA A;  3B3S A;  2G0B A;  4P4F A;  3V8I A;  2PJ9 A;  4UBR A;  3KR5 A;  3K2K A;  3SXN A;  2F8H A;  2GE3 A;  3FNC A;  2REE A;  5AG6 A;  4P44 A;  2V8H A;  2PRB A;  5ISV A;  2VBQ A;  3FMC A;  4MFJ A;  1M4D A;  3LAC A;  4KUB A;  4AVA A;  3IWG A;  1CJW A;  2HQY A;  2VI7 A;  3W91 A;  4A31 A;  1YQE A;  1TXR A;  1S7K A;  2VL1 A;  3NE7 A;  4BD9 A;  1XJO A;  4HNX B;  4UIA A;  2FSR A;  2PJ5 A;  1ZG9 A;  2BL1 A;  4UEE A;  2XEG A;  4CGM A;  1YSJ A;  3QNV A;  3T9Y A;  4OC1 A;  5AG4 A;  2I00 A;  3L2N A;  3EO4 A;  4AB7 A;  1YME A;  1YVK A;  4I49 A;  3RAM A;  3WC5 A;  3IU1 A;  3BI0 A;  2O53 A;  3GB0 A;  3SJX A;  4P4E A;  2ZOG A;  1CX8 A;  3HUV A;  3JVN A;  1RTQ A;  3KZW A;  3FEE A;  4PQA A;  1VKC A;  2NYQ A;  2OZH A;  3D8P A;  2AFU A;  4NGT A;  4CGP A;  5G21 A;  5G1Z A;  2RFH A;  5LRK A;  2WPX A;  3GUX A;  5F49 A;  4NGS A;  2CNM A;  3VAT A;  1I1D A;  1LFW A;  4XNH B;  4AG7 A;  4B6Z A;  1M44 A;  2ARH A;  3EFA A;  3W6X A;  4CRY B;  4AG9 A;  5J8C A;  2P6E A;  2D4P A;  4Q36 A;  5LYL A;  3VAR A;  2C6G A;  4BBH A;  1XMT A;  4B5O A;  4B5P A;  3QAH A;  4MFZ A;  2IL4 A;  2V8V A;  5BWA B;  4A32 A;  4Y49 C;  1VHO A;  3SI2 A;  4FAI A;  1XBU A;  1DE4 C;  3UY5 A;  2DEA A;  2PVV A;  1FY7 A;  2GIV A;  3BI1 A;  3DGV A;  1ZO0 A;  4ZGY B;  5AG5 A;  3D66 A;  3KGQ A;  4NXY A; 
#chains in the Genus database with same CATH homology
 4IUS A;  5ISV A;  4A95 A;  4AVB A;  1B87 A;  3BJ7 A;  3SHP A;  2J8M A;  3ZZI A;  1B6B A;  1QSO A;  4NCZ A;  1TIQ A;  2JEV A;  2P6G A;  4Q38 A;  3BLN A;  4KOR A;  3FIX A;  2R8V A;  4R87 A;  4MFL A;  4NSQ A;  1Q2C A;  2Z3O A;  4CAW A;  4H6U A;  4R9M A;  4XPK A;  1S3Z A;  4PSW A;  4CYO A;  1KZF A;  2JDC A;  4JWP A;  4NEX A;  4MI4 A;  2KCW A;  1WK4 A;  4A30 A;  4UFW A;  4FD5 A;  5G20 A;  5JQ4 A;  4NF1 A;  3VWD A;  3C26 A;  5C88 A;  2NMT A;  2WSA A;  2O28 A;  2Q4V A;  2X7B A;  3ZJ0 A;  2QEC A;  2BUE A;  2Q4Y A;  2R98 A;  4KOU A;  2H5M A;  2ATR A;  4HNY B;  3P2H A;  1N71 A;  1IYK A;  1Z4R A;  3E0K A;  2VQY A;  2FCK A;  3QB8 A;  2Q44 A;  3R9G A;  3BJ8 A;  4ORF A;  4CYP A;  3F8K A;  4F6A A;  1QSN A;  5A27 A;  1S60 A;  3IWE A;  1RXT A;  2B58 A;  4J3G A;  1Y9W A;  1XF8 A;  2Z11 A;  3PGP A;  3R9E A;  5KTD A;  5A28 A;  3FXT A;  4KOV A;  2CNS A;  3GKR A;  3W6S A;  1BO4 A;  1VHS A;  2B3U A;  2OB0 A;  3K9U A;  2J8N A;  1WWZ A;  3GY9 A;  2C27 A;  1YK3 A;  5EC4 A;  2CXA A;  3FRM A;  3S6K A;  4A2Z A;  2YNC C;  2VXK A;  3R96 A;  2A4N A;  3G8W A;  5F48 A;  2QIR A;  4U9Z A;  4L89 A;  1Y9K A;  3D2P A;  2ZW5 A;  4B5P B;  4H6Z A;  3GYA A;  3MGD A;  4CAX A;  3R9F A;  1S7L A;  2P0W A;  2PSW A;  4KSF A;  4KLV A;  2CY2 A;  4UCM A;  4CAE A;  2R1I A;  3H5Z A;  3S6F A;  1MK4 A;  3A9L A;  4MFQ A;  5JPH A;  3TO7 A;  2DXQ A;  5KTC A;  3VWE A;  1ON0 A;  4MFK A;  1S7F A;  3T90 A;  4BMH A;  2ZPA A;  4IF5 A;  2JLM A;  4KS9 A;  4OAD A;  3S6G A;  2DPT A;  5AG7 A;  4CAF A;  4PV6 A;  2QML A;  2VZY A;  4E8O A;  5HMN A;  2Z10 A;  4JXQ A;  4QC6 A;  1MJB A;  4C68 A;  1IYL A;  3B8G A;  5IX3 A;  1YX0 A;  4JXR A;  1RO5 A;  1P4N A;  1OZP A;  1PUA A;  2YNE A;  4QBJ A;  1QST A;  2ZW7 A;  3P2F A;  4XPD B;  2B5G A;  2Z3M A;  1Y7R A;  4B11 A;  1YLE A;  2ZW6 A;  4MHD A;  4UFV A;  2OH1 A;  2B5G B;  2FS5 A;  4H89 A;  4XPL A;  1KUY A;  4L8A A;  4ZBG A;  2JDD A;  4MY3 A;  5E96 A;  2GAN A;  4KOT A;  4FD4 A;  2FE7 A;  1YVO A;  4B14 A;  3DSB A;  2FL4 A;  4FD7 A;  4OLL A;  4X5K A;  1QSM A;  5AGE A;  2YNC A;  3PP9 A;  2EUI A;  1Z9U A;  3TTH A;  4PK3 A;  3CXQ A;  2BSW A;  1S5K A;  4U9Y A;  3SXO A;  4XNH C;  2RC4 A;  4DNC A;  4YFJ A;  3TOA A;  2HV2 A;  1Z4E A;  5EBV A;  2Q7B A;  2CNT A;  4C2Z A;  4MFP A;  2Q04 A;  4B10 A;  4CGL A;  2R7H A;  4MJ8 A;  4OAE A;  1IB1 E;  1NSL A;  2DPS A;  4PK2 A;  4F0X A;  1XE4 A;  3I9S A;  4EVY A;  4LX9 A;  4QVT A;  5F46 A;  3TO6 A;  3R95 A;  5F47 A;  3FB3 A;  3PZJ A;  2PR8 A;  4UWJ A;  2D4O A;  2J8R A;  4KZT A;  1IID A;  1L0C A;  4FD6 A;  3F5B A;  4R3L A;  1R57 A;  1YGH A;  4KUA A;  4Y49 B;  1YR0 A;  2REF A;  2AE6 A;  4UCP A;  4C7I A;  1YRE A;  3IGR A;  5H86 A;  5IV0 A;  4CYQ A;  4ONU A;  3RYO A;  2Z3K A;  5G22 A;  3KKW A;  2Z3P A;  4UA3 A;  5FVJ A;  4M85 A;  4CGN A;  2EVN A;  2PR1 A;  3CXP A;  3FYN A;  2PQ8 A;  5CNP A;  4QB9 A;  3D2M A;  4C2Y A;  4C7H A;  4KVX A;  2PDO A;  2YND A;  3TO9 A;  2B4B A;  5C82 A;  4LUA A;  3N7Z A;  3TFY A;  4PSX A;  3S6H A;  2AJ6 A;  2OZG A;  1SQH A;  3EC4 A;  5HH1 A;  3DDD A;  1BOB A;  4HKF A;  2YGW A;  5GCN A;  4KVO E;  4CAV A;  4QUS A;  4KOS A;  1U6M A;  2WUU A;  3LOD A;  3TE4 A;  2G3A A;  1MJ9 A;  4F0Y A;  4UWI A;  4KOX A;  1KUV A;  1M1D A;  2HUZ A;  4KLW A;  2BEI A;  2F5I A;  3I3G A;  3JTK A;  1S7N A;  2FT0 A;  4C2X A;  3H4Q A;  1UFH A;  5H84 A;  3TT2 A;  1M4G A;  1MJA A;  2K5T A;  1XIX A;  1I12 A;  2ZW4 A;  4UFX A;  4CS0 B;  4KSA A;  4CYN A;  4CGO A;  1CM0 A;  2Z3N A;  1P0H A;  1GHE A;  3LD2 A;  5KTA A;  4YGO A;  3CXS A;  2FXF A;  5J8F A;  4R3K A;  4B13 A;  1PU9 A;  3D3S A;  4B12 A;  5DWN A;  3F0A A;  2ZXV A;  3OWC A;  4GS4 A;  3R1K A;  2OZU A;  2WPW A;  4A33 A;  2VZZ A;  3JUW A;  2FIW A;  5IB0 A;  2PC1 A;  2B4D A;  2Z3L A;  4K30 A;  1M4I A;  4JD6 A;  3TOB A;  4RI1 A;  4R57 A;  4M3S A;  2P6F A;  2G3T A;  3DNS A;  1V0C A;  2B4D B;  5I0C A;  3EY5 A;  3FBU A;  1NE9 A;  4CRZ B;  4YRH A;  4U5Y A;  1NMT A;  4HNW B;  4E2A A;  1LRZ A;  4KOW A;  2Q0Y A;  1XEB A;  1QSR A;  4MBU A;  1Q2D A;  3IU2 A;  2FIA A;  1IIC A;  2Z0Z A;  4XPD C;  4KOY A;  4JLY A;  3WR7 A;  2Y0M A;  4RS2 A;  4II9 A;  4JJX A;  3G3S A;  3TCV A;  2VEZ A;  2B3V A;  1KUX A;  3DR8 A;  4MY0 A;  4UCN A;  3DR6 A;  3EXN A;  1K4J A;  4KVM E;  1J4J A;  4AVC A;  2I79 A;  1I21 A;  2OU2 A;  5DWM A;  4E0A A;  1Q2Y A;  2G0B A;  3V8I A;  4UBR A;  3SXN A;  2GE3 A;  3FNC A;  2REE A;  5AG6 A;  2PRB A;  2VBQ A;  4MFJ A;  1M4D A;  4KUB A;  4AVA A;  3IWG A;  1CJW A;  2HQY A;  2VI7 A;  3W91 A;  4A31 A;  1S7K A;  3NE7 A;  4HNX B;  2FSR A;  2BL1 A;  4CGM A;  3T9Y A;  5AG4 A;  2I00 A;  3EO4 A;  4AB7 A;  1YVK A;  4I49 A;  3IU1 A;  3JVN A;  1VKC A;  2OZH A;  3D8P A;  4CGP A;  5G21 A;  5G1Z A;  2WPX A;  5F49 A;  2CNM A;  1I1D A;  4AG7 A;  4XNH B;  1M44 A;  2ARH A;  3EFA A;  3W6X A;  4CRY B;  4AG9 A;  5J8C A;  2P6E A;  2D4P A;  4Q36 A;  4BBH A;  1XMT A;  4B5O A;  4B5P A;  3QAH A;  4MFZ A;  2IL4 A;  5BWA B;  4A32 A;  4Y49 C;  3UY5 A;  1FY7 A;  2GIV A;  4ZGY B;  1ZO0 A;  5AG5 A;  4NXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...