4LX9A

Archaeal amino-terminal acetyltransferase (nat) bound to acetyl coenzyme a
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
157
structure length
157
Chain Sequence
DFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAIVDNSVVGYIMPRIEWGFSNIKQLPSLVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYYADGEDAYLMARPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARCHAEAL AMINO-TERMINAL ACETYLTRANSFERASE
publication title Implications for the evolution of eukaryotic amino-terminal acetyltransferase (NAT) enzymes from the structure of an archaeal ortholog.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 48
structure length 157
sequence length 157
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2013-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4lx9A00
2PSWA 2A4NA 2FS5A 3QB8A 2CNSA 2JDDA 5IV0A 1YVOA 4KZTA 4AG9A 4JXRA 3D3SA 2PR8A 1MK4A 4KOSA 1NSLA 4E2AA 2REEA 3FNCA 1CJWA 1OZPA 4QUSA 4KOUA 2VBQA 3DR8A 4KVXA 4UWJA 2QIRA 3E0KA 5E96A 1FY7A 2IL4A 1Z4RA 5EBVA 2ZW4A 1Y7RA 1KZFA 1QSTA 1NE9A 3R96A 1GHEA 3DNSA 2PRBA 1U6MA 2O28A 3MGDA 3V8IA 2P6GA 1I21A 5KTAA 4MBUA 3LD2A 1IICA 2R1IA 1MJAA 5F46A 3PGPA 2R8VA 1S5KA 1I1DA 2ZPAA 3R9GA 2G3AA 1P0HA 4R3KA 4QC6A 2R7HA 2F5IA 3GY9A 3EFAA 4CS0B 3DR6A 4KORA 2B5GB 1N71A 3EO4A 1Q2DA 4KUBA 4UWIA 2FIWA 4FD6A 2X7BA 1ON0A 4AVAA 4ONUA 4DNCA 1XE4A 3VWEA 3G3SA 2OZHA 1QSMA 4KOXA 1RXTA 3LODA 4OLLA 4B5PB 5EC4A 4KOTA 2Q4VA 3KKWA 2GANA 1SQHA 2Q7BA 1J4JA 1YR0A 2J8NA 3SHPA 1TIQA 3I9SA 3JUWA 1M44A 4YGOA 1IB1E 1YX0A 3IGRA 5F48A 4LX9A 3CXQA 5J8FA 1YREA 4NEXA 3W6SA 4KOWA 4AVCA 2GIVA 3FYNA 3EC4A 1BO4A 4UBRA 2BL1A 5H84A 2G0BA 2OZGA 3F5BA 4AB7A 4XPDC 5J8CA 3T9YA 3TTHA 3FRMA 4JJXA 2C27A 5F49A 2D4PA 2Q4YA 2D4OA 1KUYA 2FIAA 1KUVA 4YFJA 2CNTA 2Z0ZA 3R95A 2P6EA 5FVJA 1MJ9A 2FSRA 3T90A 4YRHA 3TO6A 4GS4A 4NXYA 4HNYB 3TOAA 4K30A 3GKRA 1RO5A 2HV2A 4IUSA 2Q0YA 2HQYA 2ZW5A 4F0YA 3C26A 2FT0A 3S6KA 2Q44A 3BJ7A 1PU9A 3R9FA 4QVTA 4XPKA 1KUXA 2ATRA 2I00A 3N7ZA 1XMTA 4U9YA 2VQYA 3D2MA 2J8RA 4Y49B 3ZZIA 3PZJA 5I0CA 2CY2A 3QAHA 2B58A 2VEZA 4CAVA 2JDCA 3PP9A 1Z4EA 3BJ8A 1S60A 4L8AA 4IF5A 3JVNA 3S6HA 3S6GA 5IX3A 1R57A 5IB0A 4JXQA 2OZUA 4OAEA 2VZZA 3CXPA 2NMTA 2EUIA 1YK3A 3P2HA 4KVOE 5HMNA 5JQ4A 5JPHA 1V0CA 1S7KA 4OADA 1S3ZA 4KOVA 4KLVA 4MY0A 4I49A 5H86A 2WPXA 4II9A 1XF8A 4MI4A 4XNHC 3W91A 2AE6A 1BOBA 4KOYA 2B3VA 2P0WA 1Z9UA 3SXOA 4CRYB 4PK2A 1CM0A 1XIXA 4JD6A 2ZW6A 4F6AA 4HKFA 1QSOA 2QECA 5C82A 1IIDA 4L89A 4U5YA 4E0AA 1M4GA 2B4DA 3CXSA 1XEBA 2DXQA 3D8PA 2J8MA 4R3LA 1S7NA 3F8KA 1MJBA 2GE3A 2H5MA 1WWZA 2Q04A 1QSRA 3FBUA 3D2PA 4UA3A 3VWDA 4ZBGA 1Q2YA 1PUAA 2Y0MA 3G8WA 4E8OA 1M4IA 3DDDA 1UFHA 2Z10A 3OWCA 2REFA 2PDOA 4FD4A 1M4DA 4NSQA 4MJ8A 2FXFA 1L0CA 1I12A 3TFYA 1K4JA 4AVBA 2FCKA 2P6FA 4Y49C 4JWPA 1VKCA 2B5GA 4M85A 3F0AA 2PC1A 1B87A 2FL4A 2B4BA 2Z11A 4MY3A 3R1KA 3EY5A 2JEVA 2CNMA 1IYKA 1S7FA 4XPDB 2AJ6A 1IYLA 4AG7A 2B4DB 3K9UA 5HH1A 4U9ZA 3TCVA 4B5PA 3NE7A 4NCZA 4BMHA 2ARHA 4CAXA 3ZJ0A 4ORFA 4B5OA 3H4QA 4H89A 2JLMA 4R87A 4XPLA 4PSXA 2EVNA 2I79A 3SXNA 1YGHA 2OB0A 4HNWB 2BUEA 2PR1A 3BLNA 1Y9WA 5CNPA 4PSWA 4KVME 4QBJA 2KCWA 1QSNA 4KLWA 2WPWA 2ZW7A 4MHDA 2RC4A 2OU2A 3W6XA 4H6UA 3S6FA 2BEIA 1M1DA 3GYAA 5DWNA 2B3UA 4CAWA 5C88A 3EXNA 5GCNA 4X5KA 5ISVA 3FXTA 3TE4A 1Y9KA 3TT2A 4M3SA 1VHSA 4FD5A 4R9MA 5KTDA 5DWMA 4NF1A 3TOBA 2K5TA 3TO9A 4LUAA 1LRZA 2R98A 2QMLA 3FIXA 3I3GA 2VXKA 1WK4A 3DSBA 4QB9A 1Q2CA 4JLYA 2OH1A 3FB3A 4J3GA 2G3TA 3B8GA 3P2FA 4XNHB 4KUAA 4CRZB 4EVYA 3WR7A 4H6ZA 2HUZA 2VI7A 5F47A 1YLEA 3IWGA 3UY5A 1B6BA 2BSWA 2VZYA 4PV6A 1P4NA 2PQ8A 4RS2A 5KTCA 4R57A 3R9EA 2ZXVA 4FD7A 4PK3A 1NMTA 3TO7A 4RI1A 1S7LA 4HNXB 3RYOA 1YVKA 2FE7A
chains in the Genus database with same CATH superfamily
2PSWA 2A4NA 2FS5A 3QB8A 5LYIA 3B3WA 2ZOGA 2CNSA 5LRGA 1PYTB 4A2ZA 4EFDA 2JDDA 4CGNA 5IV0A 4R76A 3PB8X 4UCPA 1YVOA 2O4HA 3KQZA 1OBRA 4HPSA 2AFMA 4KZTA 3H5ZA 4UF4A 4CYOA 4AG9A 5A28A 4JXRA 1NSAA 3D3SA 2DF5A 2PR8A 1MK4A 4KOSA 4UIBA 4KSIA 1NSLA 2REEA 3FNCA 1CJWA 1JWQA 1OZPA 4UEFA 1R43A 2J9AA 4QUSA 4KOUA 1A2ZA 4MFQA 2VBQA 2QVPA 2GLJA 2ODFA 5DS0A 3B3VA 4B6ZA 4OC1A 3DR8A 2Z3KA 4KVXA 4UWJA 4OC2A 2QIRA 3E0KA 4C7IA 2AFZA 3FEDA 1FY7A 5E96A 3K9TA 2IL4A 4DYOA 1Z4RA 3BXMA 3FMCA 4JZ0A 3NH8A 5EBVA 2ZW4A 5G20A 1AMPA 3I1UA 1Y7RA 1KZFA 1QSTA 1NE9A 3R96A 1GHEA 3DNSA 2PRBA 3RAMA 1U6MA 2ZEFA 2O28A 4MFPA 3MGDA 4UEEA 3V8IA 1F2PA 3MN8A 2P6GA 1I21A 3H8EA 5KTAA 4MBUA 1HDQA 3LD2A 1IICA 4UFXA 3JRUA 5J1QA 2PJ9A 1ARMA 3FF3A 5D8NA 2Q7SA 3L2NA 1LAPA 1XFOA 4IHMA 2R1IA 4P44A 1ZLHA 3B3TA 1MJAA 2JEWA 5F46A 1LFWA 3CPXA 2GREA 1X12A 1S5KA 2R8VA 3PGPA 1I1DA 2ZPAA 4M6HA 1VIXA 2G3AA 4TNUA 3R9GA 3QAYA 4IAVA 1P0HA 4R3KA 4QC6A 2R7HA 2F5IA 1DE4C 3GY9A 3BI1A 5AGEA 3EFAA 4H2KA 4CS0B 2POKA 4R6TA 3DR6A 2DPSA 3D66A 2PJ3A 2B5GB 1N71A 4KORA 3EO4A 3B7IA 1Q2DA 4KUBA 4UWIA 5G21A 4RUHA 2FIWA 1ZO0A 5LYFA 4B14A 3KZWA 4FD6A 2C1CA 4P4FA 1CP7A 2X7BA 1ON0A 4A31A 2GFQA 4CYPA 4AVAA 4O23A 2HB6A 4ONUA 3KR5A 4DNCA 1XE4A 7CPAA 3VWEA 3G3SA 1ZLIA 2OZHA 1QSMA 1YW6A 4KOXA 1RXTA 3LODA 4OLLA 3KASA 4LQ6A 1IY7A 1Z8LA 4B5PB 5EC4A 5K8NA 1RTQA 4KOTA 2AFXA 2Q4VA 2YGWA 2EK9A 3KKWA 1QQ9A 2GANA 1PCAA 1SQHA 2Q7BA 1TF9A 1J4JA 4OKOA 1ZG7A 1YR0A 2PJ8A 2ZEEA 3IWWA 2J8NA 3KHZA 1TIQA 3SHPA 4BD9A 3BHXA 3I9SA 3JUWA 1F2OA 1M44A 4YGOA 2NSMA 2PE3A 2Q51A 2ZEPA 1IB1E 4NJRA 1YX0A 3IGRA 3RO0A 4B10A 2BO9A 5F48A 5HVFA 3WC6A 3KI9A 4ZI6A 1TF8A 1Z8WA 3CXQA 3LACA 4LX9A 5J8FA 4A30A 1YREA 3D4UA 4GXHA 4MXUA 3PRTA 5LYDA 4NEXA 3W6SA 4KOWA 4AVCA 2RFHA 4Q7AA 2OR4A 1FNOA 1H8LA 4PXBA 5G1ZA 3FVLA 4PXDA 3D7FA 2GIVA 2EO8A 1JQGA 2IQ6A 4CGLA 3FYNA 1M4LA 3EC4A 3PB6X 1BO4A 2F7VA 3SI0A 4UBRA 2BL1A 3D7DA 3IU2A 5H84A 2G0BA 2OZGA 1ELLP 2V8HA 3MRUA 3F5BA 4AB7A 2PJ7A 1CP6A 4XPDC 2CF4A 3N5FA 3SJFA 3TC8A 5J8CA 3KL9A 4NGPA 3T9YA 3TTHA 1CPSA 2PJ0A 3SJGA 4BINA 3FRMA 4JJXA 2C27A 4NFRA 1IOFA 5F49A 2D4PA 2Q4YA 2D4OA 1KUYA 2FIAA 2ZELA 1KUVA 2ZENA 4MRIA 4YFJA 2CNTA 1YLOA 4MHYA 2Z0ZA 3IO1A 3R95A 2P6EA 1ARLA 3FX6A 4MHPA 2BCOA 4UFWA 5FVJA 5BWAB 1MJ9A 2FSRA 4MFZA 1HEEA 2C6GA 3T90A 4YRHA 3SI2A 3IU1A 5JH9A 3IFEA 3TO6A 2Z3PA 4GS4A 4MCPA 4NXYA 3VATA 4HNYB 1YW4A 5CBMA 4B13A 2PJ4A 4CAEA 3TOAA 2YNDA 3TX8A 3HUVA 4W9YA 4K30A 3GKRA 3FEEA 1RO5A 8CPAA 2HV2A 4IUSA 4C68A 2Q0YA 2ZEOA 2CTBA 4MFJA 4F9VA 2HQYA 3V7ZA 2ZW5A 4F0YA 3C26A 4NGNA 2V8GA 2FT0A 1VGYA 4MCQA 3S6KA 2Q44A 3PFEA 3BJ7A 1PU9A 3R9FA 4QVTA 4XPKA 5HXDA 1KUXA 2ATRA 2I00A 3N7ZA 1XMTA 4U9YA 2VQYA 2ZEHA 3D2MA 4MMOA 5AG5A 4P4JA 4DUKA 3WC5A 2J8RA 4Y49B 2RB7A 3ZZIA 3FH4A 3FJUA 4NGQA 5LRJA 3PZJA 4M6GA 4EWTA 4Z65A 5I0CA 4ONWA 2CY2A 4ZY0A 3IIBA 3IWEA 3QAHA 2B58A 2O53A 3B35A 2VEZA 4CAVA 2JDCA 3PP9A 3DLJA 1Z4EA 3GIUA 3GB0A 4OC5A 3BJ8A 3PB4X 3CDXA 1S60A 1Z8XA 5THWA 4IK2A 5AG4A 4L8AA 4IF5A 3S9NA 3JVNA 2IMOA 4X8IA 3WABA 3NH4A 4P4EA 3S6HA 3S6GA 3NFZA 5IX3A 1R57A 1YSJA 2F8HA 2PJ6A 3A9LA 3ISZA 4JXQA 5IB0A 3S9LA 2OOTA 4Q36A 2OZUA 4OAEA 4A33A 2VZZA 3CXPA 2V8DA 2AFOA 1Z2LA 2NMTA 2PJCA 2EUIA 1YK3A 3P2HA 2XEJA 4F0XA 3KHXA 4FUUA 3S9MA 1TKJA 2Q43A 4KVOE 5HMNA 4UEZA 1IGBA 2QYVA 5JQ4A 3WC7A 5JPHA 1V0CA 1S7KA 1XBUA 4OADA 4ZX8A 1S3ZA 5K8MA 4KOVA 2GU2A 4KLVA 4MY0A 4I49A 2PVVA 5H86A 2WPXA 4II9A 2ZOFA 1GYTA 1XF8A 3HLPA 4MI4A 5ELYA 4XNHC 3LWUA 3W91A 2AE6A 2FVGA 2QJ8A 3NE8A 1BOBA 1AUGA 2ZEGA 1UWYA 4KOYA 2B3VA 2P0WA 1Z5RA 1Z9UA 5AG7A 3SXOA 3H8GA 1XJOA 4MCRA 1CM0A 1FT7A 4PK2A 2PJ2A 4CRYB 5I4MA 4Q38A 3RBUA 1XIXA 4JD6A 1VHOA 2EWBA 2ZW6A 2Z3LA 4C2XA 1XOVA 2EK8A 4F6AA 4HKFA 1QSOA 4P10A 2QECA 5C82A 1IIDA 1ELMP 3VARA 5LYLA 4L89A 4U5YA 4OP4A 4E0AA 4YU9A 1BPNA 4A39A 4CGOA 1M4GA 4X2TA 2B4DA 2V77A 3CXSA 4NGSA 4A37A 2DXQA 1XEBA 1DTDA 2J8MA 3D8PA 4R3LA 4UFVA 1CBXA 1Q7LA 1S7NA 2XEGA 4MHNA 3CZXA 3F8KA 1MJBA 3GLJA 4ZY2A 3B3SA 4B12A 4FAIA 2GE3A 2H5MA 1WWZA 4R8FA 2Q04A 1QSRA 3FBUA 3FECA 3D2PA 4C2YA 3B2YA 4UA3A 3VWDA 4ZBGA 4F9UA 1Q2YA 1CPXA 1LOKA 1PUAA 4OC0A 4TWEA 4A95A 4P4IA 2Y0MA 3PFOA 2NYQA 3G8WA 4K3NA 1M4IA 4MFKA 4CYQA 4E8OA 3DDDA 3IEHA 3SJEA 1UFHA 2Z10A 3OWCA 4UCNA 2REFA 2CTCA 3T8WA 4C2ZA 2PDOA 4FD4A 1M4DA 1Y0RA 4CPAA 2I3CA 4NSQA 4BBHA 2ABZA 4MJ8A 4P45A 6CPAA 2CIJA 2FXFA 5EMIA 1L0CA 4OC4A 4KSAA 1I12A 1YQEA 3TFYA 2PJBA 1K4JA 3IC1A 3KR4A 1TXRA 2PRQA 2XEFA 2FCKA 2HC9A 2DPTA 2P6FA 3NA6A 4Y49C 4AVBA 4GM5A 4C7HA 4ZGYB 4ZYQA 3WT4A 4WWVA 3SI1A 3V38A 4P6YA 2WYRA 5HVGA 2Q4ZA 4PXCA 4JWPA 1VKCA 2B5GA 1VHEA 4M85A 1ZG9A 2EBJA 2PC1A 1B87A 3F0AA 5K8PA 2FL4A 2B4BA 2Z11A 5F09A 4MY3A 5K8OA 3R1KA 3EY5A 2GLFA 3CT9A 4PXEA 2JEVA 3D68A 5G22A 5LRKA 1XMBA 2CNMA 1IYKA 1S7FA 4F8ZA 4XPDB 2PJ5A 2AJ6A 4MCSA 1IYLA 2C6PA 4AG7A 4KSFA 2G9DA 4OMEA 5AG6A 4AXVA 5A27A 2YNCA 2B4DB 4PPZA 3K9UA 4PQAA 1YMEA 3CPAA 5HH1A 4E2AA 3DGVA 4U9ZA 3TCVA 4B5PA 4M6IA 3NE7A 4NCZA 4BMHA 2ARHA 4CAXA 4B11A 3ZJ0A 2Z3MA 4P4DA 4JYWA 2YNEA 4ORFA 4B5OA 3H4QA 1Z8TA 4H89A 4EMEA 3PB7X 2JLMA 2PIZA 4R87A 4XPLA 4PSXA 2PJ1A 2EVNA 2I79A 1R3NA 4X3RA 2YNCC 3SXNA 4NGMA 1YGHA 2OB0A 4HNWB 1LAMA 2BUEA 2PR1A 3BLNA 1HDUA 3H8FA 3NH5A 4P4BA 2WSAA 1Y9WA 5CNPA 4PSWA 4KVME 4QBJA 2KCWA 1QSNA 2PIYA 1TKFA 1LANA 4KLWA 2WPWA 3D7HA 2ZW7A 5IB9A 3VH9A 4MHDA 4MHZA 2WUUA 4R7MA 2RC4A 4WJBA 2OU2A 3W6XA 4H6UA 5JM6A 3PBEA 1EE3P 1IOIA 1BAVA 3RZAA 3PEIA 2Z3OA 3S6FA 2AFWA 1F57A 4NGRA 2BEIA 1M1DA 2PVWA 1Y7EA 2CXAA 4CYNA 3GYAA 3SJXA 4OIDA 2PCUA 3D67A 4ZY1A 2BOAA 4DJLA 5DWNA 4A38A 2B3UA 4RN7A 4G1PA 4CAWA 5C88A 4FWUA 3EXNA 5GCNA 3BI0A 4X5KA 4KS9A 4OC3A 5ISVA 3FXTA 3TE4A 1ZG8A 1Y9KA 3TT2A 1Y0YA 4M3SA 1VHSA 4FD5A 4R9MA 5KTDA 5DWMA 3ISXA 4A32A 4NF1A 4UIAA 1X10A 5CPAA 4OIWA 4UCMA 3TOBA 2WZNA 2K5TA 2AFUA 3PBBA 3TO9A 4A94A 4LUAA 1LRZA 2R98A 5JGFA 2QMLA 3FIXA 4NJQA 3I3GA 2AFSA 2VXKA 5D29A 3IJ3A 1WK4A 3DSBA 4QB9A 2V8VA 1CX8A 3B3CA 2PJAA 2C6CA 1Q2CA 2IJZA 4YWYA 4JLYA 2ANPA 1IU8A 2OH1A 3LMSA 4ZX9A 3JTKA 1XRYA 1KWMA 2XEIA 2JBJA 4NGTA 3FB3A 4J3GA 3KGQA 2JBKA 2G3TA 3B8GA 3D7GA 1BPMA 3P2FA 3K2KA 1QMUA 2VL1A 3GUXA 3KQXA 4KUAA 2ZEDA 4XNHB 3WR7A 4CRZB 4EVYA 4H6ZA 4CGPA 1BLLE 2HUZA 2VI7A 5F47A 1YLEA 3IWGA 3QNVA 1B6BA 2BSWA 3UY5A 1AYEA 2VZYA 4PV6A 1P4NA 4MFLA 2PQ8A 4RS2A 5KTCA 2DEAA 4R57A 3R9EA 4FBEA 2Z3NA 5HVHA 2ZXVA 1CG2A 4FD7A 3PB9X 4PK3A 1TKHA 1LCPA 1NMTA 3TO7A 4RI1A 4CGMA 1S7LA 4HNXB 3RYOA 2ZEMA 4LQGA 4CAFA 1YVKA 2FE7A 3RNZA
chains in the Genus database with same CATH topology
2PSWA 2A4NA 2FS5A 3QB8A 2CNSA 4A2ZA 2JDDA 4CGNA 5IV0A 4UCPA 1YVOA 4KZTA 4CYOA 3H5ZA 4AG9A 5A28A 4JXRA 3D3SA 2PR8A 1MK4A 4KOSA 1NSLA 4E2AA 2REEA 3FNCA 1CJWA 1OZPA 4QUSA 4KOUA 4MFQA 2VBQA 3DR8A 2Z3KA 4KVXA 4UWJA 4C7IA 2QIRA 3E0KA 5E96A 1FY7A 2IL4A 1Z4RA 5EBVA 5G20A 2ZW4A 1Y7RA 1KZFA 1QSTA 1NE9A 3R96A 1GHEA 3DNSA 2PRBA 1U6MA 2O28A 4MFPA 3MGDA 3V8IA 2P6GA 1I21A 5KTAA 4MBUA 3LD2A 1IICA 4UFXA 2R1IA 1MJAA 5F46A 3PGPA 2R8VA 1S5KA 1I1DA 2ZPAA 3R9GA 2G3AA 1P0HA 4R3KA 4QC6A 2R7HA 2F5IA 3GY9A 5AGEA 3EFAA 4CS0B 3DR6A 2DPSA 2B5GB 1N71A 4KORA 3EO4A 1Q2DA 4KUBA 4UWIA 5G21A 2FIWA 1ZO0A 4B14A 4FD6A 2X7BA 1ON0A 4A31A 4CYPA 4AVAA 4ONUA 4DNCA 1XE4A 3VWEA 3G3SA 2OZHA 1QSMA 4KOXA 1RXTA 3LODA 4OLLA 4B5PB 5EC4A 4KOTA 2Q4VA 2YGWA 3KKWA 2GANA 1SQHA 2Q7BA 1J4JA 1YR0A 2J8NA 3SHPA 1TIQA 3I9SA 3JUWA 1M44A 4YGOA 1IB1E 1YX0A 3IGRA 4B10A 5F48A 4LX9A 3CXQA 5J8FA 4A30A 1YREA 4NEXA 3W6SA 4KOWA 4AVCA 5G1ZA 2GIVA 4CGLA 3FYNA 3EC4A 1BO4A 4UBRA 2BL1A 3IU2A 5H84A 2G0BA 2OZGA 3F5BA 4AB7A 4XPDC 5J8CA 3T9YA 3TTHA 3FRMA 4JJXA 2C27A 5F49A 2D4PA 2Q4YA 2D4OA 1KUYA 2FIAA 1KUVA 4YFJA 2CNTA 2Z0ZA 3R95A 2P6EA 4UFWA 5FVJA 5BWAB 1MJ9A 2FSRA 4MFZA 3T90A 4YRHA 3IU1A 3TO6A 2Z3PA 4GS4A 4NXYA 4HNYB 4B13A 4CAEA 3TOAA 2YNDA 4K30A 3GKRA 1RO5A 2HV2A 4IUSA 4C68A 2Q0YA 4MFJA 2HQYA 2ZW5A 4F0YA 3C26A 2FT0A 3S6KA 2Q44A 3BJ7A 1PU9A 3R9FA 4QVTA 4XPKA 1KUXA 2ATRA 2I00A 3N7ZA 1XMTA 4U9YA 2VQYA 3D2MA 5AG5A 2J8RA 4Y49B 3ZZIA 3PZJA 5I0CA 2CY2A 3IWEA 3QAHA 2B58A 2VEZA 4CAVA 2JDCA 3PP9A 1Z4EA 3BJ8A 1S60A 5AG4A 4L8AA 4IF5A 3JVNA 3S6HA 3S6GA 5IX3A 1R57A 3A9LA 5IB0A 4JXQA 4Q36A 2OZUA 4OAEA 4A33A 2VZZA 3CXPA 2NMTA 2EUIA 1YK3A 3P2HA 4F0XA 4KVOE 5HMNA 5JQ4A 5JPHA 1V0CA 1S7KA 4OADA 1S3ZA 4KOVA 4KLVA 4MY0A 4I49A 5H86A 2WPXA 4II9A 1XF8A 4MI4A 4XNHC 3W91A 2AE6A 1BOBA 4KOYA 2B3VA 2P0WA 1Z9UA 5AG7A 3SXOA 4CRYB 4PK2A 1CM0A 4Q38A 1XIXA 4JD6A 2ZW6A 2Z3LA 4C2XA 4F6AA 4HKFA 1QSOA 2QECA 5C82A 1IIDA 4L89A 4U5YA 4E0AA 4CGOA 1M4GA 2B4DA 3CXSA 1XEBA 2DXQA 3D8PA 2J8MA 4R3LA 4UFVA 1S7NA 3F8KA 1MJBA 4B12A 2GE3A 2H5MA 1WWZA 2Q04A 1QSRA 3FBUA 3D2PA 4C2YA 4UA3A 3VWDA 4ZBGA 1Q2YA 1PUAA 4A95A 2Y0MA 4MFKA 3G8WA 4E8OA 1M4IA 4CYQA 3DDDA 1UFHA 2Z10A 3OWCA 4UCNA 2REFA 4C2ZA 2PDOA 4FD4A 1M4DA 4NSQA 4BBHA 4MJ8A 2FXFA 1L0CA 4KSAA 1I12A 3TFYA 1K4JA 4AVBA 2FCKA 4ZGYB 2DPTA 2P6FA 4Y49C 4C7HA 4JWPA 1VKCA 2B5GA 4M85A 3F0AA 2PC1A 1B87A 2FL4A 2B4BA 2Z11A 4MY3A 3R1KA 3EY5A 2JEVA 5G22A 2CNMA 1IYKA 1S7FA 4XPDB 2AJ6A 1IYLA 4AG7A 4KSFA 5AG6A 5A27A 2YNCA 2B4DB 3K9UA 5HH1A 4U9ZA 3TCVA 4B5PA 3NE7A 4NCZA 4BMHA 2ARHA 4CAXA 4B11A 3ZJ0A 2Z3MA 2YNEA 4ORFA 4B5OA 3H4QA 4H89A 2JLMA 4R87A 4XPLA 4PSXA 2EVNA 2I79A 2YNCC 3SXNA 1YGHA 2OB0A 4HNWB 2BUEA 2PR1A 3BLNA 2WSAA 1Y9WA 5CNPA 4PSWA 4KVME 4QBJA 2KCWA 1QSNA 4KLWA 2WPWA 2ZW7A 4MHDA 2WUUA 2RC4A 2OU2A 3W6XA 4H6UA 2Z3OA 3S6FA 2BEIA 1M1DA 2CXAA 4CYNA 3GYAA 5DWNA 2B3UA 4CAWA 5C88A 3EXNA 5GCNA 4X5KA 4KS9A 5ISVA 3FXTA 3TE4A 1Y9KA 3TT2A 4M3SA 1VHSA 4FD5A 4R9MA 5KTDA 5DWMA 4A32A 4NF1A 4UCMA 3TOBA 2K5TA 3TO9A 4LUAA 1LRZA 2R98A 2QMLA 3FIXA 3I3GA 2VXKA 1WK4A 3DSBA 4QB9A 1Q2CA 4JLYA 2OH1A 3JTKA 3FB3A 4J3GA 2G3TA 3B8GA 3P2FA 4XNHB 4KUAA 4CRZB 4EVYA 3WR7A 4H6ZA 4CGPA 2HUZA 2VI7A 5F47A 1YLEA 3IWGA 3UY5A 1B6BA 2BSWA 2VZYA 4PV6A 1P4NA 4MFLA 2PQ8A 4RS2A 5KTCA 4R57A 3R9EA 2Z3NA 2ZXVA 4FD7A 4PK3A 1NMTA 3TO7A 4RI1A 4CGMA 1S7LA 4HNXB 3RYOA 4CAFA 1YVKA 2FE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PSW A;  2A4N A;  2FS5 A;  3QB8 A;  2CNS A;  2JDD A;  5IV0 A;  1YVO A;  4KZT A;  4AG9 A;  4JXR A;  3D3S A;  2PR8 A;  1MK4 A;  4KOS A;  1NSL A;  4E2A A;  2REE A;  3FNC A;  1CJW A;  1OZP A;  4QUS A;  4KOU A;  2VBQ A;  3DR8 A;  4KVX A;  4UWJ A;  2QIR A;  3E0K A;  5E96 A;  1FY7 A;  2IL4 A;  1Z4R A;  5EBV A;  2ZW4 A;  1Y7R A;  1KZF A;  1QST A;  1NE9 A;  3R96 A;  1GHE A;  3DNS A;  2PRB A;  1U6M A;  2O28 A;  3MGD A;  3V8I A;  2P6G A;  1I21 A;  5KTA A;  4MBU A;  3LD2 A;  1IIC A;  2R1I A;  1MJA A;  5F46 A;  3PGP A;  2R8V A;  1S5K A;  1I1D A;  2ZPA A;  3R9G A;  2G3A A;  1P0H A;  4R3K A;  4QC6 A;  2R7H A;  2F5I A;  3GY9 A;  3EFA A;  4CS0 B;  3DR6 A;  4KOR A;  2B5G B;  1N71 A;  3EO4 A;  1Q2D A;  4KUB A;  4UWI A;  2FIW A;  4FD6 A;  2X7B A;  1ON0 A;  4AVA A;  4ONU A;  4DNC A;  1XE4 A;  3VWE A;  3G3S A;  2OZH A;  1QSM A;  4KOX A;  1RXT A;  3LOD A;  4OLL A;  4B5P B;  5EC4 A;  4KOT A;  2Q4V A;  3KKW A;  2GAN A;  1SQH A;  2Q7B A;  1J4J A;  1YR0 A;  2J8N A;  3SHP A;  1TIQ A;  3I9S A;  3JUW A;  1M44 A;  4YGO A;  1IB1 E;  1YX0 A;  3IGR A;  5F48 A;  4LX9 A;  3CXQ A;  5J8F A;  1YRE A;  4NEX A;  3W6S A;  4KOW A;  4AVC A;  2GIV A;  3FYN A;  3EC4 A;  1BO4 A;  4UBR A;  2BL1 A;  5H84 A;  2G0B A;  2OZG A;  3F5B A;  4AB7 A;  4XPD C;  5J8C A;  3T9Y A;  3TTH A;  3FRM A;  4JJX A;  2C27 A;  5F49 A;  2D4P A;  2Q4Y A;  2D4O A;  1KUY A;  2FIA A;  1KUV A;  4YFJ A;  2CNT A;  2Z0Z A;  3R95 A;  2P6E A;  5FVJ A;  1MJ9 A;  2FSR A;  3T90 A;  4YRH A;  3TO6 A;  4GS4 A;  4NXY A;  4HNY B;  3TOA A;  4K30 A;  3GKR A;  1RO5 A;  2HV2 A;  4IUS A;  2Q0Y A;  2HQY A;  2ZW5 A;  4F0Y A;  3C26 A;  2FT0 A;  3S6K A;  2Q44 A;  3BJ7 A;  1PU9 A;  3R9F A;  4QVT A;  4XPK A;  1KUX A;  2ATR A;  2I00 A;  3N7Z A;  1XMT A;  4U9Y A;  2VQY A;  3D2M A;  2J8R A;  4Y49 B;  3ZZI A;  3PZJ A;  5I0C A;  2CY2 A;  3QAH A;  2B58 A;  2VEZ A;  4CAV A;  2JDC A;  3PP9 A;  1Z4E A;  3BJ8 A;  1S60 A;  4L8A A;  4IF5 A;  3JVN A;  3S6H A;  3S6G A;  5IX3 A;  1R57 A;  5IB0 A;  4JXQ A;  2OZU A;  4OAE A;  2VZZ A;  3CXP A;  2NMT A;  2EUI A;  1YK3 A;  3P2H A;  4KVO E;  5HMN A;  5JQ4 A;  5JPH A;  1V0C A;  1S7K A;  4OAD A;  1S3Z A;  4KOV A;  4KLV A;  4MY0 A;  4I49 A;  5H86 A;  2WPX A;  4II9 A;  1XF8 A;  4MI4 A;  4XNH C;  3W91 A;  2AE6 A;  1BOB A;  4KOY A;  2B3V A;  2P0W A;  1Z9U A;  3SXO A;  4CRY B;  4PK2 A;  1CM0 A;  1XIX A;  4JD6 A;  2ZW6 A;  4F6A A;  4HKF A;  1QSO A;  2QEC A;  5C82 A;  1IID A;  4L89 A;  4U5Y A;  4E0A A;  1M4G A;  2B4D A;  3CXS A;  1XEB A;  2DXQ A;  3D8P A;  2J8M A;  4R3L A;  1S7N A;  3F8K A;  1MJB A;  2GE3 A;  2H5M A;  1WWZ A;  2Q04 A;  1QSR A;  3FBU A;  3D2P A;  4UA3 A;  3VWD A;  4ZBG A;  1Q2Y A;  1PUA A;  2Y0M A;  3G8W A;  4E8O A;  1M4I A;  3DDD A;  1UFH A;  2Z10 A;  3OWC A;  2REF A;  2PDO A;  4FD4 A;  1M4D A;  4NSQ A;  4MJ8 A;  2FXF A;  1L0C A;  1I12 A;  3TFY A;  1K4J A;  4AVB A;  2FCK A;  2P6F A;  4Y49 C;  4JWP A;  1VKC A;  2B5G A;  4M85 A;  3F0A A;  2PC1 A;  1B87 A;  2FL4 A;  2B4B A;  2Z11 A;  4MY3 A;  3R1K A;  3EY5 A;  2JEV A;  2CNM A;  1IYK A;  1S7F A;  4XPD B;  2AJ6 A;  1IYL A;  4AG7 A;  2B4D B;  3K9U A;  5HH1 A;  4U9Z A;  3TCV A;  4B5P A;  3NE7 A;  4NCZ A;  4BMH A;  2ARH A;  4CAX A;  3ZJ0 A;  4ORF A;  4B5O A;  3H4Q A;  4H89 A;  2JLM A;  4R87 A;  4XPL A;  4PSX A;  2EVN A;  2I79 A;  3SXN A;  1YGH A;  2OB0 A;  4HNW B;  2BUE A;  2PR1 A;  3BLN A;  1Y9W A;  5CNP A;  4PSW A;  4KVM E;  4QBJ A;  2KCW A;  1QSN A;  4KLW A;  2WPW A;  2ZW7 A;  4MHD A;  2RC4 A;  2OU2 A;  3W6X A;  4H6U A;  3S6F A;  2BEI A;  1M1D A;  3GYA A;  5DWN A;  2B3U A;  4CAW A;  5C88 A;  3EXN A;  5GCN A;  4X5K A;  5ISV A;  3FXT A;  3TE4 A;  1Y9K A;  3TT2 A;  4M3S A;  1VHS A;  4FD5 A;  4R9M A;  5KTD A;  5DWM A;  4NF1 A;  3TOB A;  2K5T A;  3TO9 A;  4LUA A;  1LRZ A;  2R98 A;  2QML A;  3FIX A;  3I3G A;  2VXK A;  1WK4 A;  3DSB A;  4QB9 A;  1Q2C A;  4JLY A;  2OH1 A;  3FB3 A;  4J3G A;  2G3T A;  3B8G A;  3P2F A;  4XNH B;  4KUA A;  4CRZ B;  4EVY A;  3WR7 A;  4H6Z A;  2HUZ A;  2VI7 A;  5F47 A;  1YLE A;  3IWG A;  3UY5 A;  1B6B A;  2BSW A;  2VZY A;  4PV6 A;  1P4N A;  2PQ8 A;  4RS2 A;  5KTC A;  4R57 A;  3R9E A;  2ZXV A;  4FD7 A;  4PK3 A;  1NMT A;  3TO7 A;  4RI1 A;  1S7L A;  4HNX B;  3RYO A;  1YVK A;  2FE7 A; 
#chains in the Genus database with same CATH topology
 2PSW A;  2A4N A;  2FS5 A;  3QB8 A;  5LYI A;  3B3W A;  2ZOG A;  2CNS A;  5LRG A;  1PYT B;  4A2Z A;  4EFD A;  2JDD A;  4CGN A;  5IV0 A;  4R76 A;  3PB8 X;  4UCP A;  1YVO A;  2O4H A;  3KQZ A;  1OBR A;  4HPS A;  2AFM A;  4KZT A;  3H5Z A;  4UF4 A;  4CYO A;  4AG9 A;  5A28 A;  4JXR A;  1NSA A;  3D3S A;  2DF5 A;  2PR8 A;  1MK4 A;  4KOS A;  4UIB A;  4KSI A;  1NSL A;  2REE A;  3FNC A;  1CJW A;  1JWQ A;  1OZP A;  4UEF A;  1R43 A;  2J9A A;  4QUS A;  4KOU A;  1A2Z A;  4MFQ A;  2VBQ A;  2QVP A;  2GLJ A;  2ODF A;  5DS0 A;  3B3V A;  4B6Z A;  4OC1 A;  3DR8 A;  2Z3K A;  4KVX A;  4UWJ A;  4OC2 A;  2QIR A;  3E0K A;  4C7I A;  2AFZ A;  3FED A;  1FY7 A;  5E96 A;  3K9T A;  2IL4 A;  4DYO A;  1Z4R A;  3BXM A;  3FMC A;  4JZ0 A;  3NH8 A;  5EBV A;  2ZW4 A;  5G20 A;  1AMP A;  3I1U A;  1Y7R A;  1KZF A;  1QST A;  1NE9 A;  3R96 A;  1GHE A;  3DNS A;  2PRB A;  3RAM A;  1U6M A;  2ZEF A;  2O28 A;  4MFP A;  3MGD A;  4UEE A;  3V8I A;  1F2P A;  3MN8 A;  2P6G A;  1I21 A;  3H8E A;  5KTA A;  4MBU A;  1HDQ A;  3LD2 A;  1IIC A;  4UFX A;  3JRU A;  5J1Q A;  2PJ9 A;  1ARM A;  3FF3 A;  5D8N A;  2Q7S A;  3L2N A;  1LAP A;  1XFO A;  4IHM A;  2R1I A;  4P44 A;  1ZLH A;  3B3T A;  1MJA A;  2JEW A;  5F46 A;  1LFW A;  3CPX A;  2GRE A;  1X12 A;  1S5K A;  2R8V A;  3PGP A;  1I1D A;  2ZPA A;  4M6H A;  1VIX A;  2G3A A;  4TNU A;  3R9G A;  3QAY A;  4IAV A;  1P0H A;  4R3K A;  4QC6 A;  2R7H A;  2F5I A;  1DE4 C;  3GY9 A;  3BI1 A;  5AGE A;  3EFA A;  4H2K A;  4CS0 B;  2POK A;  4R6T A;  3DR6 A;  2DPS A;  3D66 A;  2PJ3 A;  2B5G B;  1N71 A;  4KOR A;  3EO4 A;  3B7I A;  1Q2D A;  4KUB A;  4UWI A;  5G21 A;  4RUH A;  2FIW A;  1ZO0 A;  5LYF A;  4B14 A;  3KZW A;  4FD6 A;  2C1C A;  4P4F A;  1CP7 A;  2X7B A;  1ON0 A;  4A31 A;  2GFQ A;  4CYP A;  4AVA A;  4O23 A;  2HB6 A;  4ONU A;  3KR5 A;  4DNC A;  1XE4 A;  7CPA A;  3VWE A;  3G3S A;  1ZLI A;  2OZH A;  1QSM A;  1YW6 A;  4KOX A;  1RXT A;  3LOD A;  4OLL A;  3KAS A;  4LQ6 A;  1IY7 A;  1Z8L A;  4B5P B;  5EC4 A;  5K8N A;  1RTQ A;  4KOT A;  2AFX A;  2Q4V A;  2YGW A;  2EK9 A;  3KKW A;  1QQ9 A;  2GAN A;  1PCA A;  1SQH A;  2Q7B A;  1TF9 A;  1J4J A;  4OKO A;  1ZG7 A;  1YR0 A;  2PJ8 A;  2ZEE A;  3IWW A;  2J8N A;  3KHZ A;  1TIQ A;  3SHP A;  4BD9 A;  3BHX A;  3I9S A;  3JUW A;  1F2O A;  1M44 A;  4YGO A;  2NSM A;  2PE3 A;  2Q51 A;  2ZEP A;  1IB1 E;  4NJR A;  1YX0 A;  3IGR A;  3RO0 A;  4B10 A;  2BO9 A;  5F48 A;  5HVF A;  3WC6 A;  3KI9 A;  4ZI6 A;  1TF8 A;  1Z8W A;  3CXQ A;  3LAC A;  4LX9 A;  5J8F A;  4A30 A;  1YRE A;  3D4U A;  4GXH A;  4MXU A;  3PRT A;  5LYD A;  4NEX A;  3W6S A;  4KOW A;  4AVC A;  2RFH A;  4Q7A A;  2OR4 A;  1FNO A;  1H8L A;  4PXB A;  5G1Z A;  3FVL A;  4PXD A;  3D7F A;  2GIV A;  2EO8 A;  1JQG A;  2IQ6 A;  4CGL A;  3FYN A;  1M4L A;  3EC4 A;  3PB6 X;  1BO4 A;  2F7V A;  3SI0 A;  4UBR A;  2BL1 A;  3D7D A;  3IU2 A;  5H84 A;  2G0B A;  2OZG A;  1ELL P;  2V8H A;  3MRU A;  3F5B A;  4AB7 A;  2PJ7 A;  1CP6 A;  4XPD C;  2CF4 A;  3N5F A;  3SJF A;  3TC8 A;  5J8C A;  3KL9 A;  4NGP A;  3T9Y A;  3TTH A;  1CPS A;  2PJ0 A;  3SJG A;  4BIN A;  3FRM A;  4JJX A;  2C27 A;  4NFR A;  1IOF A;  5F49 A;  2D4P A;  2Q4Y A;  2D4O A;  1KUY A;  2FIA A;  2ZEL A;  1KUV A;  2ZEN A;  4MRI A;  4YFJ A;  2CNT A;  1YLO A;  4MHY A;  2Z0Z A;  3IO1 A;  3R95 A;  2P6E A;  1ARL A;  3FX6 A;  4MHP A;  2BCO A;  4UFW A;  5FVJ A;  5BWA B;  1MJ9 A;  2FSR A;  4MFZ A;  1HEE A;  2C6G A;  3T90 A;  4YRH A;  3SI2 A;  3IU1 A;  5JH9 A;  3IFE A;  3TO6 A;  2Z3P A;  4GS4 A;  4MCP A;  4NXY A;  3VAT A;  4HNY B;  1YW4 A;  5CBM A;  4B13 A;  2PJ4 A;  4CAE A;  3TOA A;  2YND A;  3TX8 A;  3HUV A;  4W9Y A;  4K30 A;  3GKR A;  3FEE A;  1RO5 A;  8CPA A;  2HV2 A;  4IUS A;  4C68 A;  2Q0Y A;  2ZEO A;  2CTB A;  4MFJ A;  4F9V A;  2HQY A;  3V7Z A;  2ZW5 A;  4F0Y A;  3C26 A;  4NGN A;  2V8G A;  2FT0 A;  1VGY A;  4MCQ A;  3S6K A;  2Q44 A;  3PFE A;  3BJ7 A;  1PU9 A;  3R9F A;  4QVT A;  4XPK A;  5HXD A;  1KUX A;  2ATR A;  2I00 A;  3N7Z A;  1XMT A;  4U9Y A;  2VQY A;  2ZEH A;  3D2M A;  4MMO A;  5AG5 A;  4P4J A;  4DUK A;  3WC5 A;  2J8R A;  4Y49 B;  2RB7 A;  3ZZI A;  3FH4 A;  3FJU A;  4NGQ A;  5LRJ A;  3PZJ A;  4M6G A;  4EWT A;  4Z65 A;  5I0C A;  4ONW A;  2CY2 A;  4ZY0 A;  3IIB A;  3IWE A;  3QAH A;  2B58 A;  2O53 A;  3B35 A;  2VEZ A;  4CAV A;  2JDC A;  3PP9 A;  3DLJ A;  1Z4E A;  3GIU A;  3GB0 A;  4OC5 A;  3BJ8 A;  3PB4 X;  3CDX A;  1S60 A;  1Z8X A;  5THW A;  4IK2 A;  5AG4 A;  4L8A A;  4IF5 A;  3S9N A;  3JVN A;  2IMO A;  4X8I A;  3WAB A;  3NH4 A;  4P4E A;  3S6H A;  3S6G A;  3NFZ A;  5IX3 A;  1R57 A;  1YSJ A;  2F8H A;  2PJ6 A;  3A9L A;  3ISZ A;  4JXQ A;  5IB0 A;  3S9L A;  2OOT A;  4Q36 A;  2OZU A;  4OAE A;  4A33 A;  2VZZ A;  3CXP A;  2V8D A;  2AFO A;  1Z2L A;  2NMT A;  2PJC A;  2EUI A;  1YK3 A;  3P2H A;  2XEJ A;  4F0X A;  3KHX A;  4FUU A;  3S9M A;  1TKJ A;  2Q43 A;  4KVO E;  5HMN A;  4UEZ A;  1IGB A;  2QYV A;  5JQ4 A;  3WC7 A;  5JPH A;  1V0C A;  1S7K A;  1XBU A;  4OAD A;  4ZX8 A;  1S3Z A;  5K8M A;  4KOV A;  2GU2 A;  4KLV A;  4MY0 A;  4I49 A;  2PVV A;  5H86 A;  2WPX A;  4II9 A;  2ZOF A;  1GYT A;  1XF8 A;  3HLP A;  4MI4 A;  5ELY A;  4XNH C;  3LWU A;  3W91 A;  2AE6 A;  2FVG A;  2QJ8 A;  3NE8 A;  1BOB A;  1AUG A;  2ZEG A;  1UWY A;  4KOY A;  2B3V A;  2P0W A;  1Z5R A;  1Z9U A;  5AG7 A;  3SXO A;  3H8G A;  1XJO A;  4MCR A;  1CM0 A;  1FT7 A;  4PK2 A;  2PJ2 A;  4CRY B;  5I4M A;  4Q38 A;  3RBU A;  1XIX A;  4JD6 A;  1VHO A;  2EWB A;  2ZW6 A;  2Z3L A;  4C2X A;  1XOV A;  2EK8 A;  4F6A A;  4HKF A;  1QSO A;  4P10 A;  2QEC A;  5C82 A;  1IID A;  1ELM P;  3VAR A;  5LYL A;  4L89 A;  4U5Y A;  4OP4 A;  4E0A A;  4YU9 A;  1BPN A;  4A39 A;  4CGO A;  1M4G A;  4X2T A;  2B4D A;  2V77 A;  3CXS A;  4NGS A;  4A37 A;  2DXQ A;  1XEB A;  1DTD A;  2J8M A;  3D8P A;  4R3L A;  4UFV A;  1CBX A;  1Q7L A;  1S7N A;  2XEG A;  4MHN A;  3CZX A;  3F8K A;  1MJB A;  3GLJ A;  4ZY2 A;  3B3S A;  4B12 A;  4FAI A;  2GE3 A;  2H5M A;  1WWZ A;  4R8F A;  2Q04 A;  1QSR A;  3FBU A;  3FEC A;  3D2P A;  4C2Y A;  3B2Y A;  4UA3 A;  3VWD A;  4ZBG A;  4F9U A;  1Q2Y A;  1CPX A;  1LOK A;  1PUA A;  4OC0 A;  4TWE A;  4A95 A;  4P4I A;  2Y0M A;  3PFO A;  2NYQ A;  3G8W A;  4K3N A;  1M4I A;  4MFK A;  4CYQ A;  4E8O A;  3DDD A;  3IEH A;  3SJE A;  1UFH A;  2Z10 A;  3OWC A;  4UCN A;  2REF A;  2CTC A;  3T8W A;  4C2Z A;  2PDO A;  4FD4 A;  1M4D A;  1Y0R A;  4CPA A;  2I3C A;  4NSQ A;  4BBH A;  2ABZ A;  4MJ8 A;  4P45 A;  6CPA A;  2CIJ A;  2FXF A;  5EMI A;  1L0C A;  4OC4 A;  4KSA A;  1I12 A;  1YQE A;  3TFY A;  2PJB A;  1K4J A;  3IC1 A;  3KR4 A;  1TXR A;  2PRQ A;  2XEF A;  2FCK A;  2HC9 A;  2DPT A;  2P6F A;  3NA6 A;  4Y49 C;  4AVB A;  4GM5 A;  4C7H A;  4ZGY B;  4ZYQ A;  3WT4 A;  4WWV A;  3SI1 A;  3V38 A;  4P6Y A;  2WYR A;  5HVG A;  2Q4Z A;  4PXC A;  4JWP A;  1VKC A;  2B5G A;  1VHE A;  4M85 A;  1ZG9 A;  2EBJ A;  2PC1 A;  1B87 A;  3F0A A;  5K8P A;  2FL4 A;  2B4B A;  2Z11 A;  5F09 A;  4MY3 A;  5K8O A;  3R1K A;  3EY5 A;  2GLF A;  3CT9 A;  4PXE A;  2JEV A;  3D68 A;  5G22 A;  5LRK A;  1XMB A;  2CNM A;  1IYK A;  1S7F A;  4F8Z A;  4XPD B;  2PJ5 A;  2AJ6 A;  4MCS A;  1IYL A;  2C6P A;  4AG7 A;  4KSF A;  2G9D A;  4OME A;  5AG6 A;  4AXV A;  5A27 A;  2YNC A;  2B4D B;  4PPZ A;  3K9U A;  4PQA A;  1YME A;  3CPA A;  5HH1 A;  4E2A A;  3DGV A;  4U9Z A;  3TCV A;  4B5P A;  4M6I A;  3NE7 A;  4NCZ A;  4BMH A;  2ARH A;  4CAX A;  4B11 A;  3ZJ0 A;  2Z3M A;  4P4D A;  4JYW A;  2YNE A;  4ORF A;  4B5O A;  3H4Q A;  1Z8T A;  4H89 A;  4EME A;  3PB7 X;  2JLM A;  2PIZ A;  4R87 A;  4XPL A;  4PSX A;  2PJ1 A;  2EVN A;  2I79 A;  1R3N A;  4X3R A;  2YNC C;  3SXN A;  4NGM A;  1YGH A;  2OB0 A;  4HNW B;  1LAM A;  2BUE A;  2PR1 A;  3BLN A;  1HDU A;  3H8F A;  3NH5 A;  4P4B A;  2WSA A;  1Y9W A;  5CNP A;  4PSW A;  4KVM E;  4QBJ A;  2KCW A;  1QSN A;  2PIY A;  1TKF A;  1LAN A;  4KLW A;  2WPW A;  3D7H A;  2ZW7 A;  5IB9 A;  3VH9 A;  4MHD A;  4MHZ A;  2WUU A;  4R7M A;  2RC4 A;  4WJB A;  2OU2 A;  3W6X A;  4H6U A;  5JM6 A;  3PBE A;  1EE3 P;  1IOI A;  1BAV A;  3RZA A;  3PEI A;  2Z3O A;  3S6F A;  2AFW A;  1F57 A;  4NGR A;  2BEI A;  1M1D A;  2PVW A;  1Y7E A;  2CXA A;  4CYN A;  3GYA A;  3SJX A;  4OID A;  2PCU A;  3D67 A;  4ZY1 A;  2BOA A;  4DJL A;  5DWN A;  4A38 A;  2B3U A;  4RN7 A;  4G1P A;  4CAW A;  5C88 A;  4FWU A;  3EXN A;  5GCN A;  3BI0 A;  4X5K A;  4KS9 A;  4OC3 A;  5ISV A;  3FXT A;  3TE4 A;  1ZG8 A;  1Y9K A;  3TT2 A;  1Y0Y A;  4M3S A;  1VHS A;  4FD5 A;  4R9M A;  5KTD A;  5DWM A;  3ISX A;  4A32 A;  4NF1 A;  4UIA A;  1X10 A;  5CPA A;  4OIW A;  4UCM A;  3TOB A;  2WZN A;  2K5T A;  2AFU A;  3PBB A;  3TO9 A;  4A94 A;  4LUA A;  1LRZ A;  2R98 A;  5JGF A;  2QML A;  3FIX A;  4NJQ A;  3I3G A;  2AFS A;  2VXK A;  5D29 A;  3IJ3 A;  1WK4 A;  3DSB A;  4QB9 A;  2V8V A;  1CX8 A;  3B3C A;  2PJA A;  2C6C A;  1Q2C A;  2IJZ A;  4YWY A;  4JLY A;  2ANP A;  1IU8 A;  2OH1 A;  3LMS A;  4ZX9 A;  3JTK A;  1XRY A;  1KWM A;  2XEI A;  2JBJ A;  4NGT A;  3FB3 A;  4J3G A;  3KGQ A;  2JBK A;  2G3T A;  3B8G A;  3D7G A;  1BPM A;  3P2F A;  3K2K A;  1QMU A;  2VL1 A;  3GUX A;  3KQX A;  4KUA A;  2ZED A;  4XNH B;  3WR7 A;  4CRZ B;  4EVY A;  4H6Z A;  4CGP A;  1BLL E;  2HUZ A;  2VI7 A;  5F47 A;  1YLE A;  3IWG A;  3QNV A;  1B6B A;  2BSW A;  3UY5 A;  1AYE A;  2VZY A;  4PV6 A;  1P4N A;  4MFL A;  2PQ8 A;  4RS2 A;  5KTC A;  2DEA A;  4R57 A;  3R9E A;  4FBE A;  2Z3N A;  5HVH A;  2ZXV A;  1CG2 A;  4FD7 A;  3PB9 X;  4PK3 A;  1TKH A;  1LCP A;  1NMT A;  3TO7 A;  4RI1 A;  4CGM A;  1S7L A;  4HNX B;  3RYO A;  2ZEM A;  4LQG A;  4CAF A;  1YVK A;  2FE7 A;  3RNZ A; 
#chains in the Genus database with same CATH homology
 2PSW A;  2A4N A;  2FS5 A;  3QB8 A;  2CNS A;  4A2Z A;  2JDD A;  4CGN A;  5IV0 A;  4UCP A;  1YVO A;  4KZT A;  4CYO A;  3H5Z A;  4AG9 A;  5A28 A;  4JXR A;  3D3S A;  2PR8 A;  1MK4 A;  4KOS A;  1NSL A;  4E2A A;  2REE A;  3FNC A;  1CJW A;  1OZP A;  4QUS A;  4KOU A;  4MFQ A;  2VBQ A;  3DR8 A;  2Z3K A;  4KVX A;  4UWJ A;  4C7I A;  2QIR A;  3E0K A;  5E96 A;  1FY7 A;  2IL4 A;  1Z4R A;  5EBV A;  5G20 A;  2ZW4 A;  1Y7R A;  1KZF A;  1QST A;  1NE9 A;  3R96 A;  1GHE A;  3DNS A;  2PRB A;  1U6M A;  2O28 A;  4MFP A;  3MGD A;  3V8I A;  2P6G A;  1I21 A;  5KTA A;  4MBU A;  3LD2 A;  1IIC A;  4UFX A;  2R1I A;  1MJA A;  5F46 A;  3PGP A;  2R8V A;  1S5K A;  1I1D A;  2ZPA A;  3R9G A;  2G3A A;  1P0H A;  4R3K A;  4QC6 A;  2R7H A;  2F5I A;  3GY9 A;  5AGE A;  3EFA A;  4CS0 B;  3DR6 A;  2DPS A;  2B5G B;  1N71 A;  4KOR A;  3EO4 A;  1Q2D A;  4KUB A;  4UWI A;  5G21 A;  2FIW A;  1ZO0 A;  4B14 A;  4FD6 A;  2X7B A;  1ON0 A;  4A31 A;  4CYP A;  4AVA A;  4ONU A;  4DNC A;  1XE4 A;  3VWE A;  3G3S A;  2OZH A;  1QSM A;  4KOX A;  1RXT A;  3LOD A;  4OLL A;  4B5P B;  5EC4 A;  4KOT A;  2Q4V A;  2YGW A;  3KKW A;  2GAN A;  1SQH A;  2Q7B A;  1J4J A;  1YR0 A;  2J8N A;  3SHP A;  1TIQ A;  3I9S A;  3JUW A;  1M44 A;  4YGO A;  1IB1 E;  1YX0 A;  3IGR A;  4B10 A;  5F48 A;  4LX9 A;  3CXQ A;  5J8F A;  4A30 A;  1YRE A;  4NEX A;  3W6S A;  4KOW A;  4AVC A;  5G1Z A;  2GIV A;  4CGL A;  3FYN A;  3EC4 A;  1BO4 A;  4UBR A;  2BL1 A;  3IU2 A;  5H84 A;  2G0B A;  2OZG A;  3F5B A;  4AB7 A;  4XPD C;  5J8C A;  3T9Y A;  3TTH A;  3FRM A;  4JJX A;  2C27 A;  5F49 A;  2D4P A;  2Q4Y A;  2D4O A;  1KUY A;  2FIA A;  1KUV A;  4YFJ A;  2CNT A;  2Z0Z A;  3R95 A;  2P6E A;  4UFW A;  5FVJ A;  5BWA B;  1MJ9 A;  2FSR A;  4MFZ A;  3T90 A;  4YRH A;  3IU1 A;  3TO6 A;  2Z3P A;  4GS4 A;  4NXY A;  4HNY B;  4B13 A;  4CAE A;  3TOA A;  2YND A;  4K30 A;  3GKR A;  1RO5 A;  2HV2 A;  4IUS A;  4C68 A;  2Q0Y A;  4MFJ A;  2HQY A;  2ZW5 A;  4F0Y A;  3C26 A;  2FT0 A;  3S6K A;  2Q44 A;  3BJ7 A;  1PU9 A;  3R9F A;  4QVT A;  4XPK A;  1KUX A;  2ATR A;  2I00 A;  3N7Z A;  1XMT A;  4U9Y A;  2VQY A;  3D2M A;  5AG5 A;  2J8R A;  4Y49 B;  3ZZI A;  3PZJ A;  5I0C A;  2CY2 A;  3IWE A;  3QAH A;  2B58 A;  2VEZ A;  4CAV A;  2JDC A;  3PP9 A;  1Z4E A;  3BJ8 A;  1S60 A;  5AG4 A;  4L8A A;  4IF5 A;  3JVN A;  3S6H A;  3S6G A;  5IX3 A;  1R57 A;  3A9L A;  5IB0 A;  4JXQ A;  4Q36 A;  2OZU A;  4OAE A;  4A33 A;  2VZZ A;  3CXP A;  2NMT A;  2EUI A;  1YK3 A;  3P2H A;  4F0X A;  4KVO E;  5HMN A;  5JQ4 A;  5JPH A;  1V0C A;  1S7K A;  4OAD A;  1S3Z A;  4KOV A;  4KLV A;  4MY0 A;  4I49 A;  5H86 A;  2WPX A;  4II9 A;  1XF8 A;  4MI4 A;  4XNH C;  3W91 A;  2AE6 A;  1BOB A;  4KOY A;  2B3V A;  2P0W A;  1Z9U A;  5AG7 A;  3SXO A;  4CRY B;  4PK2 A;  1CM0 A;  4Q38 A;  1XIX A;  4JD6 A;  2ZW6 A;  2Z3L A;  4C2X A;  4F6A A;  4HKF A;  1QSO A;  2QEC A;  5C82 A;  1IID A;  4L89 A;  4U5Y A;  4E0A A;  4CGO A;  1M4G A;  2B4D A;  3CXS A;  1XEB A;  2DXQ A;  3D8P A;  2J8M A;  4R3L A;  4UFV A;  1S7N A;  3F8K A;  1MJB A;  4B12 A;  2GE3 A;  2H5M A;  1WWZ A;  2Q04 A;  1QSR A;  3FBU A;  3D2P A;  4C2Y A;  4UA3 A;  3VWD A;  4ZBG A;  1Q2Y A;  1PUA A;  4A95 A;  2Y0M A;  4MFK A;  3G8W A;  4E8O A;  1M4I A;  4CYQ A;  3DDD A;  1UFH A;  2Z10 A;  3OWC A;  4UCN A;  2REF A;  4C2Z A;  2PDO A;  4FD4 A;  1M4D A;  4NSQ A;  4BBH A;  4MJ8 A;  2FXF A;  1L0C A;  4KSA A;  1I12 A;  3TFY A;  1K4J A;  4AVB A;  2FCK A;  4ZGY B;  2DPT A;  2P6F A;  4Y49 C;  4C7H A;  4JWP A;  1VKC A;  2B5G A;  4M85 A;  3F0A A;  2PC1 A;  1B87 A;  2FL4 A;  2B4B A;  2Z11 A;  4MY3 A;  3R1K A;  3EY5 A;  2JEV A;  5G22 A;  2CNM A;  1IYK A;  1S7F A;  4XPD B;  2AJ6 A;  1IYL A;  4AG7 A;  4KSF A;  5AG6 A;  5A27 A;  2YNC A;  2B4D B;  3K9U A;  5HH1 A;  4U9Z A;  3TCV A;  4B5P A;  3NE7 A;  4NCZ A;  4BMH A;  2ARH A;  4CAX A;  4B11 A;  3ZJ0 A;  2Z3M A;  2YNE A;  4ORF A;  4B5O A;  3H4Q A;  4H89 A;  2JLM A;  4R87 A;  4XPL A;  4PSX A;  2EVN A;  2I79 A;  2YNC C;  3SXN A;  1YGH A;  2OB0 A;  4HNW B;  2BUE A;  2PR1 A;  3BLN A;  2WSA A;  1Y9W A;  5CNP A;  4PSW A;  4KVM E;  4QBJ A;  2KCW A;  1QSN A;  4KLW A;  2WPW A;  2ZW7 A;  4MHD A;  2WUU A;  2RC4 A;  2OU2 A;  3W6X A;  4H6U A;  2Z3O A;  3S6F A;  2BEI A;  1M1D A;  2CXA A;  4CYN A;  3GYA A;  5DWN A;  2B3U A;  4CAW A;  5C88 A;  3EXN A;  5GCN A;  4X5K A;  4KS9 A;  5ISV A;  3FXT A;  3TE4 A;  1Y9K A;  3TT2 A;  4M3S A;  1VHS A;  4FD5 A;  4R9M A;  5KTD A;  5DWM A;  4A32 A;  4NF1 A;  4UCM A;  3TOB A;  2K5T A;  3TO9 A;  4LUA A;  1LRZ A;  2R98 A;  2QML A;  3FIX A;  3I3G A;  2VXK A;  1WK4 A;  3DSB A;  4QB9 A;  1Q2C A;  4JLY A;  2OH1 A;  3JTK A;  3FB3 A;  4J3G A;  2G3T A;  3B8G A;  3P2F A;  4XNH B;  4KUA A;  4CRZ B;  4EVY A;  3WR7 A;  4H6Z A;  4CGP A;  2HUZ A;  2VI7 A;  5F47 A;  1YLE A;  3IWG A;  3UY5 A;  1B6B A;  2BSW A;  2VZY A;  4PV6 A;  1P4N A;  4MFL A;  2PQ8 A;  4RS2 A;  5KTC A;  4R57 A;  3R9E A;  2Z3N A;  2ZXV A;  4FD7 A;  4PK3 A;  1NMT A;  3TO7 A;  4RI1 A;  4CGM A;  1S7L A;  4HNX B;  3RYO A;  4CAF A;  1YVK A;  2FE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...