3B35A

Crystal structure of the m180a mutant of the aminopeptidase from vibrio proteolyticus
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
291
structure length
291
Chain Sequence
b'MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDATNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
publication title Zinc coordination geometry and ligand binding affinity: the structural and kinetic analysis of the second-shell serine 228 residue and the methionine 180 residue of the aminopeptidase from Vibrio proteolyticus.
pubmed doi rcsb
source organism Vibrio proteolyticus
molecule tags Hydrolase
total genus 119
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2007-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3b35A00
3FVLA 4A39A 4Q7AA 1ZG7A 3PBEA 4NGNA 3WT4A 1VGYA 4MHYA 4MCSA 4ZX9A 4EMEA 3KQZA 3GUXA 2ZOFA 4LQGA 4FWUA 4FBEA 4TNUA 1YW6A 4FAIA 2PVWA 4PXDA 3GLJA 1R3NA 2FVGA 2CF4A 2C1CA 3SJXA 4MHPA 3D7FA 3DGVA 4A38A 2QJ8A 3B35A 2GLJA 3D4UA 3KQXA 4PQAA 1DE4C 2PIYA 4FUUA 4IHMA 3SJEA 4OIDA 2JBJA 3B3TA 6CPAA 1ARMA 5I4MA 2GLFA 2BCOA 1TXRA 4IAVA 1Y0RA 2QVPA 8CPAA 1Y7EA 5CBMA 4OMEA 3KHXA 2ZEGA 5LYIA 2DEAA 3NH4A 1DTDA 4P6YA 4PPZA 4NGRA 4X2TA 1QMUA 3NH8A 2AFSA 3S9LA 1Z2LA 2JEWA 3VH9A 5HVGA 2EK9A 4P4DA 1LAMA 1PCAA 2PJ6A 3B3VA 4UEEA 5HXDA 2Q43A 3NFZA 3CPXA 4A37A 2ZEOA 3MN8A 4DJLA 1H8LA 4OC4A 3FEEA 1XFOA 2PRQA 4GM5A 2IMOA 4JYWA 3H8FA 4P10A 2ZEFA 5CPAA 3D7DA 3IFEA 4NGQA 3PEIA 1AMPA 1VIXA 3KL9A 4MHZA 3WC7A 5JGFA 1F2PA 2PJAA 7CPAA 1UWYA 4OC5A 1XRYA 2ZELA 4MCRA 3CT9A 2G9DA 3D68A 4PXCA 2JBKA 3PB4X 2Q51A 3WC5A 4ZI6A 1Z8LA 2V8GA 3KR4A 3WABA 2RB7A 2AFWA 3FF3A 2C6CA 3BXMA 1ZG9A 2OR4A 3TC8A 1FNOA 1F2OA 2NYQA 5LRKA 3NH5A 4P4BA 1XJOA 1JQGA 4MXUA 5J1QA 4F8ZA 3FJUA 3L2NA 4PXBA 3B3CA 4UEZA 3D7GA 2ZEDA 4BD9A 4R6TA 4ONWA 2C6PA 2AFOA 3V7ZA 5JM6A 3B7IA 3CDXA 1TF8A 1EE3P 4OIWA 4PXEA 2GREA 4OC2A 3PB9X 2C6GA 1OBRA 2PJ9A 4NJQA 1CX8A 1F57A 3RZAA 2ZEEA 2V8DA 4K3NA 5JH9A 1XMBA 4F9UA 4Z65A 1ELMP 5F09A 1LFWA 4X8IA 2CTBA 2PJ3A 3RAMA 3SI2A 4P44A 2AFUA 4ZYQA 5HVHA 4UEFA 1YSJA 4O23A 4TWEA 3PB8X 4W9YA 2VL1A 4P45A 2PJ7A 5HVFA 3FH4A 4B6ZA 3WC6A 1BPMA 5LRGA 1BLLE 3IJ3A 1ZLHA 4WJBA 4H2KA 4OP4A 2PVVA 4NGMA 3K2KA 2WZNA 2OOTA 1XBUA 1ARLA 3D7HA 3PB7X 4NGPA 3IIBA 5D8NA 5K8MA 5DS0A 1QQ9A 1BPNA 4ZY2A 4KSIA 2XEIA 3KZWA 3PBBA 1CPXA 4P4EA 1YW4A 3PFOA 3ISZA 5LRJA 1FT7A 3VATA 1KWMA 2ZOGA 2ZENA 1HDQA 4NFRA 3B3WA 5ELYA 2O4HA 2QYVA 1TF9A 3KI9A 4R76A 4OC3A 1TKHA 4MCPA 2GU2A 4ZY0A 2BOAA 1CP7A 2V77A 1Y0YA 3NA6A 1CBXA 3IO1A 4DYOA 2F8HA 3PRTA 3PFEA 4EFDA 3BI0A 4MMOA 4UIAA 2WYRA 1RTQA 2RFHA 4NGSA 2HC9A 3SI0A 5LYDA 3T8WA 2XEGA 2PJ5A 4F9VA 4OC1A 3I1UA 2ANPA 1TKJA 2O53A 4YWYA 1YMEA 4NGTA 2BO9A 2NSMA 3D66A 1BAVA 3SI1A 4AXVA 4ZX8A 2V8VA 2PCUA 3RBUA 1VHOA 3SJGA 1LOKA 1AYEA 1ELLP 2IJZA 3IEHA 2ZEPA 2J9AA 2PJBA 4G1PA 4MHNA 1IGBA 1PYTB 4CPAA 4WWVA 1ZLIA 2V8HA 1HEEA 5K8PA 4R8FA 3D67A 3FECA 5THWA 2PE3A 3H8EA 3TX8A 3JRUA 3HUVA 1HDUA 3V38A 1M4LA 4R7MA 2PJ8A 3KGQA 2PJ4A 2ZEHA 1R43A 1Q7LA 2ABZA 3KASA 3ISXA 4X3RA 1IY7A 3B3SA 4UIBA 3FX6A 3FEDA 4YU9A 1YLOA 2EK8A 2ZEMA 2AFXA 3IWWA 2AFMA 3N5FA 2PJ1A 3VARA 4OKOA 1CPSA 2CTCA 2POKA 2XEFA 3S9MA 3KHZA 2PJ0A 2HB6A 5LYLA 2PJCA 2Q4ZA 2I3CA 3KR5A 2EWBA 5D29A 3DLJA 3FMCA 2XEJA 4P4IA 2IQ6A 4OC0A 1ZG8A 2CIJA 3K9TA 4P4FA 4P4JA 3LMSA 5IB9A 3GB0A 1TKFA 4IK2A 4MRIA 2PIZA 5K8OA 4UF4A 3BI1A 4JZ0A 3LWUA 3H8GA 3IC1A 3BHXA 1GYTA 3S9NA 1LCPA 3PB6X 3QNVA 3SJFA 4RUHA 2PJ2A 2AFZA 3B2YA 1CP6A 4NJRA 4ZY1A 4DUKA 1NSAA 1VHEA 1CG2A 5K8NA 1LANA 3MRUA 5LYFA 3CPAA 4EWTA 1LAPA 2F7VA 4A94A 4MCQA 3HLPA 1Z5RA
chains in the Genus database with same CATH superfamily
1Q2DA 3FVLA 3TOAA 1S7LA 4A32A 4A39A 4Q7AA 4B12A 3DDDA 1ZG7A 3PBEA 4NGNA 4Q36A 2WSAA 3PGPA 3WT4A 1KUXA 1VGYA 2R8VA 4MHYA 4MCSA 2BEIA 4ZX9A 3KQZA 4EMEA 4M6IA 3GUXA 4ZBGA 2ZOFA 2ZXVA 4LQGA 5KTAA 2VXKA 5HH1A 4FWUA 4FBEA 4TNUA 1YW6A 2PDOA 4FAIA 1XE4A 4Q38A 2PVWA 3FB3A 4PXDA 1GHEA 5C82A 3GLJA 4HKFA 1R3NA 3RO0A 2FVGA 2CF4A 2JLMA 2AJ6A 4H89A 2C1CA 3SJXA 1IICA 4KUBA 4MHPA 3D2MA 3D7FA 5AG5A 3DGVA 2YNCA 1Q2CA 3ZJ0A 4CGOA 1XF8A 4A38A 2QJ8A 3B35A 3D3SA 4B5OA 4CGLA 2GLJA 3D4UA 4C2YA 3TFYA 5AGEA 3KQXA 4QC6A 1KUYA 3JTKA 4PQAA 2WPXA 1DE4C 2PIYA 4FUUA 4IHMA 3E0KA 3SJEA 4OIDA 2JBJA 4F0XA 3B3TA 6CPAA 1ARMA 5I4MA 2ARHA 4XPKA 4A30A 5IX3A 2GLFA 2BCOA 1TXRA 4IAVA 1Y0RA 1Z9UA 2DPSA 3PZJA 4A33A 2QVPA 8CPAA 3TT2A 2P6GA 1IU8A 1Y7EA 5CBMA 5G20A 2ZW7A 4OMEA 3KHXA 2ZEGA 2Z3MA 1QSNA 3RYOA 2FXFA 3BJ8A 5LYIA 2DEAA 4NEXA 3VWDA 4FD7A 1S7FA 3NH4A 4KOWA 3T90A 5F46A 1S60A 2ATRA 1DTDA 1YREA 4LUAA 4P6YA 3W91A 2G3TA 2Y0MA 4PPZA 4NGRA 2FIWA 4UCPA 1QSTA 4X2TA 1QMUA 3NH8A 4LQ6A 4UFXA 2Q0YA 2QECA 1JWQA 2AFSA 3S9LA 2H5MA 5H84A 3DR8A 1Z2LA 2JEWA 2Q4YA 3VH9A 4NF1A 5G1ZA 5HVGA 2EK9A 2EO8A 4P4DA 1LAMA 1PCAA 2PJ6A 3B3VA 2I00A 3CXSA 3DR6A 4UEEA 2GE3A 4HPSA 4ORFA 3S6KA 2Z3OA 2FSRA 1CJWA 3N7ZA 2Q43A 3NFZA 3QAHA 3CPXA 5HXDA 3OWCA 4A37A 1IOFA 4MFZA 2REEA 4UA3A 3R9GA 2ZEOA 4B5PA 3MN8A 4KUAA 5F48A 3R9FA 4DJLA 3GYAA 3R95A 1H8LA 4OC4A 3FEEA 2G3AA 1XFOA 2PRQA 1NMTA 4GM5A 2IMOA 1XIXA 3I9SA 4CGPA 4JYWA 3H8FA 4MBUA 3GIUA 4P10A 2ZEFA 3F0AA 4XPDC 5CPAA 3D7DA 3IGRA 3TO6A 3IFEA 3FYNA 4NGQA 3PEIA 2F5IA 4C2XA 4OADA 1AMPA 1VIXA 3KL9A 2GFQA 4MHZA 2VI7A 1S5KA 4B13A 4YFJA 4KSAA 3WC7A 4H6UA 5JGFA 2AE6A 1F2PA 2PJAA 2QIRA 4AVBA 4CRYB 2B4DB 5CNPA 1SQHA 1UWYA 7CPAA 4OC5A 1XRYA 2ZELA 4MCRA 3R1KA 2Q7BA 3CT9A 3H4QA 1YLEA 2G9DA 4XPDB 3D68A 4PXCA 2JBKA 3PB4X 4IF5A 4QB9A 2BSWA 2PR8A 2Q51A 4MFPA 3WC5A 4ZI6A 4RI1A 1QSMA 1Z8LA 3D2PA 3H5ZA 5IV0A 1S3ZA 4JD6A 2V8GA 3KR4A 1Z8XA 4H6ZA 3WABA 4YGOA 1UFHA 3JVNA 2RB7A 2Z11A 2OH1A 5HMNA 2AFWA 3FF3A 1IYLA 2C6CA 3BXMA 1ZG9A 5ISVA 2GIVA 4L8AA 4R87A 4F0YA 3NE7A 2OR4A 3FRMA 3TC8A 2ODFA 1PUAA 1FNOA 5GCNA 4CYPA 1F2OA 2NYQA 4MFQA 5LRKA 3NH5A 4P4BA 1XJOA 1JQGA 1L0CA 4JXRA 4MXUA 3TO7A 5J1QA 2B5GB 5AG6A 2ZW4A 2OZUA 2JEVA 3FJUA 3L2NA 4U9ZA 4F8ZA 4CYOA 5J8FA 2J8NA 2B58A 4Y49C 4PXBA 3B3CA 4UEZA 3D7GA 2PRBA 1Y9WA 2Z3PA 2Z0ZA 2B3VA 4JXQA 3TCVA 4CS0B 3UY5A 4AVAA 3RNZA 2ZEDA 4M85A 2DXQA 3R9EA 4BD9A 1LRZA 4R6TA 4ONUA 1P4NA 4ONWA 3SHPA 3KKWA 2C6PA 2VZYA 2WUUA 2AFOA 3V7ZA 3FIXA 2D4PA 3VWEA 5JM6A 3B7IA 3CDXA 1TF8A 4MY3A 1EE3P 4OIWA 4PXEA 2GREA 2CNMA 4KVOE 3PB9X 2C6GA 1OBRA 2HQYA 2PJ9A 4OC2A 4NJQA 1CX8A 2ZW5A 5F49A 1WWZA 2CXAA 3LACA 1F57A 4Y49B 3RZAA 2ZEEA 2V8DA 4PV6A 4K3NA 4E0AA 4NXYA 2YNCC 4A95A 1XMBA 4F9UA 5JH9A 4Z65A 4TWEA 4CAFA 1ELMP 1YR0A 5F09A 1LFWA 4X8IA 3S6HA 2EBJA 2CTBA 2PJ3A 3RAMA 1IYKA 1B6BA 2Z3NA 2AFUA 4P44A 3SI2A 4ZYQA 3S6FA 5HVHA 3B8GA 1IB1E 3F8KA 4FD5A 3IWEA 4KZTA 2JDCA 4UEFA 3C26A 1YSJA 2B4BA 1IIDA 3PB8X 1Y9KA 1XMTA 4FD6A 2VL1A 2J8MA 4K30A 4O23A 2PJ7A 2YNDA 3D8PA 3FH4A 4P45A 5HVFA 4B6ZA 2QMLA 3CXQA 1RO5A 1P0HA 3WC6A 4BMHA 1YVOA 2JDDA 2VEZA 4AVCA 1BPMA 3GY9A 1BLLE 5LRGA 1MJAA 4UWJA 5JPHA 2FIAA 3IJ3A 1YGHA 1ZLHA 2VQYA 1I1DA 4WJBA 4H2KA 2B3UA 4UBRA 4OP4A 2PVVA 3QB8A 4AB7A 2X7BA 5J8CA 4NGMA 4U9YA 4CRZB 1BO4A 2HV2A 3K2KA 2WZNA 2OOTA 1XBUA 1ARLA 2P6FA 3FBUA 3D7HA 3PB7X 1ZO0A 4NGPA 3IIBA 2REFA 5D8NA 2GANA 5K8MA 1CM0A 5DS0A 1QQ9A 1BPNA 2EVNA 4MHDA 5AG7A 1I12A 2OB0A 2R98A 2B4DA 4ZY2A 4KSIA 4KOSA 2XEIA 5KTCA 5AG4A 4KOUA 3KZWA 4CGNA 3PBBA 1CPXA 2PSWA 3P2HA 2Q4VA 1YW4A 4P4EA 3PFOA 3ISZA 5LRJA 3T9YA 3MGDA 1Z8TA 3F5BA 2CNSA 1FT7A 1QSRA 3VATA 4QBJA 4MJ8A 3JUWA 4KOYA 1KWMA 2ZOGA 5C88A 2ZENA 4MY0A 4KOVA 2P6EA 4FD4A 1HDQA 4NFRA 3B3WA 3PP9A 4KLWA 5ELYA 3S6GA 2VZZA 2O4HA 2QYVA 1TF9A 4AG9A 5IB0A 3KI9A 4AG7A 4DNCA 4R76A 4OC3A 1TKHA 4MCPA 2O28A 1S7NA 2GU2A 5I0CA 4ZY0A 4KOTA 2BOAA 1M1DA 1CP7A 2V77A 1Y0YA 3NA6A 1CBXA 4PK2A 3A9LA 1YX0A 3IO1A 4PK3A 2HUZA 4CYNA 3LD2A 4RN7A 2R7HA 4DYOA 2F8HA 4PSWA 4B5PB 2NMTA 2OZHA 3PRTA 4YRHA 2IL4A 5FVJA 1BOBA 3G3SA 3PFEA 4EFDA 2FT0A 3DSBA 3TTHA 4BBHA 1AUGA 3BI0A 4MMOA 4UIAA 1I21A 3IU1A 4KVXA 2ZW6A 2RC4A 1YQEA 2WYRA 1RTQA 4J3GA 2RFHA 4NGSA 4E8OA 4CAVA 1MJBA 1RXTA 4CYQA 2CNTA 1NE9A 2HC9A 4UWIA 3SI0A 5LYDA 4C68A 3EXNA 3T8WA 2XEGA 4LX9A 2PJ5A 4F9VA 3R96A 4OC1A 4UCMA 3I1UA 4II9A 4X5KA 1Z8WA 3EO4A 4IUSA 1KZFA 1X12A 2ANPA 4GS4A 1TKJA 4CAWA 2O53A 4YWYA 2Z3KA 3QAYA 1YMEA 4NGTA 2BO9A 4KORA 2NSMA 3D66A 1M4DA 4CAXA 2P0WA 1BAVA 3BJ7A 4KLVA 3SI1A 3TOBA 4AXVA 5JQ4A 4ZX8A 2V8VA 2C27A 5E96A 2PCUA 3FNCA 3RBUA 1VHOA 3SJGA 1LOKA 4GXHA 5DWNA 4R3LA 2PR1A 4OLLA 3V8IA 1AYEA 4L89A 4XNHC 1VHSA 1ELLP 2IJZA 2OU2A 5DWMA 4CGMA 3IEHA 4HNYB 2ZEPA 2J9AA 2PJBA 4G1PA 4MHNA 4B10A 2FE7A 1IGBA 1PYTB 5G22A 1TIQA 1WK4A 4CPAA 4WWVA 1ZLIA 2R1IA 2V8HA 1HEEA 5F47A 3TO9A 4HNWB 2Q7SA 4QVTA 3CXPA 2ZPAA 5EC4A 4C2ZA 5K8PA 2BL1A 4R8FA 3LODA 4JLYA 2PC1A 2VBQA 4QUSA 4NSQA 1Z4EA 3D67A 5A28A 4C7HA 3FECA 3W6XA 5THWA 2PE3A 3H8EA 2YNEA 4XPLA 3TX8A 3ZZIA 3G8WA 4KOXA 3CZXA 3JRUA 4MFLA 3BLNA 3HUVA 4M3SA 4XNHB 4B14A 2K5TA 1HDUA 3V38A 1M4LA 1R57A 1M4GA 4R7MA 4B11A 2PJ8A 1V0CA 3KGQA 4NCZA 4A2ZA 1NSLA 2PJ4A 2Q04A 2ZEHA 3IWGA 1R43A 4I49A 1Q7LA 2ABZA 3KASA 3ISXA 4X3RA 1IY7A 3B3SA 2Z3LA 1N71A 4MFKA 1Q2YA 3FX6A 4RS2A 3EFAA 1M4IA 4UIBA 5G21A 3FEDA 4YU9A 1YLOA 2EK8A 2ZEMA 2AFXA 2A4NA 2FL4A 4UFVA 2WPWA 2FCKA 4BINA 3IWWA 2AFMA 3N5FA 4R57A 2PJ1A 4W9YA 3VARA 4OKOA 4U5YA 1CPSA 3IU2A 5A27A 3EC4A 2CTCA 4KVME 2POKA 3K9UA 2XEFA 4KSFA 3S9MA 4EVYA 3WR7A 3SXOA 3KHZA 3GKRA 2J8RA 4CAEA 2PJ0A 5EMIA 2HB6A 3SXNA 5LYLA 2PJCA 4M6GA 2Q4ZA 2I3CA 3KR5A 1ON0A 2EWBA 5D29A 3DLJA 3FMCA 1MJ9A 4PSXA 2XEJA 4P4IA 2IQ6A 4OC0A 1ZG8A 4R3KA 1OZPA 1Z4RA 2CIJA 3K9TA 4MFJA 4P4FA 4P4JA 3LMSA 2BUEA 2D4OA 2OZGA 5H86A 1KUVA 5IB9A 3GB0A 1S7KA 1TKFA 4JJXA 4C7IA 4IK2A 1MK4A 5BWAB 4MRIA 2PIZA 5K8OA 3TE4A 3EY5A 4UFWA 4UF4A 4R9MA 3BI1A 2DPTA 4JZ0A 2PQ8A 1B87A 3LWUA 1M44A 4KS9A 3H8GA 3IC1A 1XEBA 3BHXA 1YVKA 1GYTA 3S9NA 1K4JA 2B5GA 2DF5A 3DNSA 1LCPA 1YK3A 3PB6X 3QNVA 4UCNA 1FY7A 3SJFA 4MI4A 2G0BA 5KTDA 4RUHA 2PJ2A 1IOIA 2AFZA 3B2YA 1CP6A 4NJRA 3I3GA 2YGWA 4A31A 4ZY1A 1A2ZA 4OAEA 3FXTA 4DUKA 2Q44A 1NSAA 1VHEA 1CG2A 3NE8A 5K8NA 2FS5A 1XOVA 4HNXB 4M6HA 1LANA 1VKCA 3MRUA 1PU9A 1U6MA 2EUIA 5LYFA 4ZGYB 3CPAA 4EWTA 1LAPA 4F6AA 2I79A 2Z10A 1Y7RA 2CY2A 2F7VA 2KCWA 4JWPA 4MCQA 4A94A 3HLPA 1Z5RA 5EBVA 3W6SA 1QSOA 4E2AA 3P2FA 1X10A 1J4JA
chains in the Genus database with same CATH topology
3FVLA 4A39A 4Q7AA 1ZG7A 3PBEA 4NGNA 3WT4A 1VGYA 4MHYA 4MCSA 4ZX9A 4EMEA 3KQZA 3GUXA 2ZOFA 4LQGA 4FWUA 4FBEA 4TNUA 1YW6A 4FAIA 2PVWA 4PXDA 3GLJA 1R3NA 2FVGA 2CF4A 2C1CA 3SJXA 4MHPA 3D7FA 3DGVA 4A38A 2QJ8A 3B35A 2GLJA 3D4UA 3KQXA 4PQAA 1DE4C 2PIYA 4FUUA 4IHMA 3SJEA 4OIDA 2JBJA 3B3TA 6CPAA 1ARMA 5I4MA 2GLFA 2BCOA 1TXRA 4IAVA 1Y0RA 2QVPA 8CPAA 1Y7EA 5CBMA 4OMEA 3KHXA 2ZEGA 5LYIA 2DEAA 3NH4A 1DTDA 4P6YA 4PPZA 4NGRA 4X2TA 1QMUA 3NH8A 2AFSA 3S9LA 1Z2LA 2JEWA 3VH9A 5HVGA 2EK9A 4P4DA 1LAMA 1PCAA 2PJ6A 3B3VA 4UEEA 5HXDA 2Q43A 3NFZA 3CPXA 4A37A 2ZEOA 3MN8A 4DJLA 1H8LA 4OC4A 3FEEA 1XFOA 2PRQA 4GM5A 2IMOA 4JYWA 3H8FA 4P10A 2ZEFA 5CPAA 3D7DA 3IFEA 4NGQA 3PEIA 1AMPA 1VIXA 3KL9A 4MHZA 3WC7A 5JGFA 1F2PA 2PJAA 7CPAA 1UWYA 4OC5A 1XRYA 2ZELA 4MCRA 3CT9A 2G9DA 3D68A 4PXCA 2JBKA 3PB4X 2Q51A 3WC5A 4ZI6A 1Z8LA 2V8GA 3KR4A 3WABA 2RB7A 2AFWA 3FF3A 2C6CA 3BXMA 1ZG9A 2OR4A 3TC8A 1FNOA 1F2OA 2NYQA 5LRKA 3NH5A 4P4BA 1XJOA 1JQGA 4MXUA 5J1QA 4F8ZA 3FJUA 3L2NA 4PXBA 3B3CA 4UEZA 3D7GA 2ZEDA 4BD9A 4R6TA 4ONWA 2C6PA 2AFOA 3V7ZA 5JM6A 3B7IA 3CDXA 1TF8A 1EE3P 4OIWA 4PXEA 2GREA 4OC2A 3PB9X 2C6GA 1OBRA 2PJ9A 4NJQA 1CX8A 1F57A 3RZAA 2ZEEA 2V8DA 4K3NA 5JH9A 1XMBA 4F9UA 4Z65A 1ELMP 5F09A 1LFWA 4X8IA 2CTBA 2PJ3A 3RAMA 3SI2A 4P44A 2AFUA 4ZYQA 5HVHA 4UEFA 1YSJA 4O23A 4TWEA 3PB8X 4W9YA 2VL1A 4P45A 2PJ7A 5HVFA 3FH4A 4B6ZA 3WC6A 1BPMA 5LRGA 1BLLE 3IJ3A 1ZLHA 4WJBA 4H2KA 4OP4A 2PVVA 4NGMA 3K2KA 2WZNA 2OOTA 1XBUA 1ARLA 3D7HA 3PB7X 4NGPA 3IIBA 5D8NA 5K8MA 5DS0A 1QQ9A 1BPNA 4ZY2A 4KSIA 2XEIA 3KZWA 3PBBA 1CPXA 4P4EA 1YW4A 3PFOA 3ISZA 5LRJA 1FT7A 3VATA 1KWMA 2ZOGA 2ZENA 1HDQA 4NFRA 3B3WA 5ELYA 2O4HA 2QYVA 1TF9A 3KI9A 4R76A 4OC3A 1TKHA 4MCPA 2GU2A 4ZY0A 2BOAA 1CP7A 2V77A 1Y0YA 3NA6A 1CBXA 3IO1A 4DYOA 2F8HA 3PRTA 3PFEA 4EFDA 3BI0A 4MMOA 4UIAA 2WYRA 1RTQA 2RFHA 4NGSA 2HC9A 3SI0A 5LYDA 3T8WA 2XEGA 2PJ5A 4F9VA 4OC1A 3I1UA 2ANPA 1TKJA 2O53A 4YWYA 1YMEA 4NGTA 2BO9A 2NSMA 3D66A 1BAVA 3SI1A 4AXVA 4ZX8A 2V8VA 2PCUA 3RBUA 1VHOA 3SJGA 1LOKA 1AYEA 1ELLP 2IJZA 3IEHA 2ZEPA 2J9AA 2PJBA 4G1PA 4MHNA 1IGBA 1PYTB 4CPAA 4WWVA 1ZLIA 2V8HA 1HEEA 5K8PA 4R8FA 3D67A 3FECA 5THWA 2PE3A 3H8EA 3TX8A 3JRUA 3HUVA 1HDUA 3V38A 1M4LA 4R7MA 2PJ8A 3KGQA 2PJ4A 2ZEHA 1R43A 1Q7LA 2ABZA 3KASA 3ISXA 4X3RA 1IY7A 3B3SA 4UIBA 3FX6A 3FEDA 4YU9A 1YLOA 2EK8A 2ZEMA 2AFXA 3IWWA 2AFMA 3N5FA 2PJ1A 3VARA 4OKOA 1CPSA 2CTCA 2POKA 2XEFA 3S9MA 3KHZA 2PJ0A 2HB6A 5LYLA 2PJCA 2Q4ZA 2I3CA 3KR5A 2EWBA 5D29A 3DLJA 3FMCA 2XEJA 4P4IA 2IQ6A 4OC0A 1ZG8A 2CIJA 3K9TA 4P4FA 4P4JA 3LMSA 5IB9A 3GB0A 1TKFA 4IK2A 4MRIA 2PIZA 5K8OA 4UF4A 3BI1A 4JZ0A 3LWUA 3H8GA 3IC1A 3BHXA 1GYTA 3S9NA 1LCPA 3PB6X 3QNVA 3SJFA 4RUHA 2PJ2A 2AFZA 3B2YA 1CP6A 4NJRA 4ZY1A 4DUKA 1NSAA 1VHEA 1CG2A 5K8NA 1LANA 3MRUA 5LYFA 3CPAA 4EWTA 1LAPA 2F7VA 4A94A 4MCQA 3HLPA 1Z5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FVL A;  4A39 A;  4Q7A A;  1ZG7 A;  3PBE A;  4NGN A;  3WT4 A;  1VGY A;  4MHY A;  4MCS A;  4ZX9 A;  4EME A;  3KQZ A;  3GUX A;  2ZOF A;  4LQG A;  4FWU A;  4FBE A;  4TNU A;  1YW6 A;  4FAI A;  2PVW A;  4PXD A;  3GLJ A;  1R3N A;  2FVG A;  2CF4 A;  2C1C A;  3SJX A;  4MHP A;  3D7F A;  3DGV A;  4A38 A;  2QJ8 A;  3B35 A;  2GLJ A;  3D4U A;  3KQX A;  4PQA A;  1DE4 C;  2PIY A;  4FUU A;  4IHM A;  3SJE A;  4OID A;  2JBJ A;  3B3T A;  6CPA A;  1ARM A;  5I4M A;  2GLF A;  2BCO A;  1TXR A;  4IAV A;  1Y0R A;  2QVP A;  8CPA A;  1Y7E A;  5CBM A;  4OME A;  3KHX A;  2ZEG A;  5LYI A;  2DEA A;  3NH4 A;  1DTD A;  4P6Y A;  4PPZ A;  4NGR A;  4X2T A;  1QMU A;  3NH8 A;  2AFS A;  3S9L A;  1Z2L A;  2JEW A;  3VH9 A;  5HVG A;  2EK9 A;  4P4D A;  1LAM A;  1PCA A;  2PJ6 A;  3B3V A;  4UEE A;  5HXD A;  2Q43 A;  3NFZ A;  3CPX A;  4A37 A;  2ZEO A;  3MN8 A;  4DJL A;  1H8L A;  4OC4 A;  3FEE A;  1XFO A;  2PRQ A;  4GM5 A;  2IMO A;  4JYW A;  3H8F A;  4P10 A;  2ZEF A;  5CPA A;  3D7D A;  3IFE A;  4NGQ A;  3PEI A;  1AMP A;  1VIX A;  3KL9 A;  4MHZ A;  3WC7 A;  5JGF A;  1F2P A;  2PJA A;  7CPA A;  1UWY A;  4OC5 A;  1XRY A;  2ZEL A;  4MCR A;  3CT9 A;  2G9D A;  3D68 A;  4PXC A;  2JBK A;  3PB4 X;  2Q51 A;  3WC5 A;  4ZI6 A;  1Z8L A;  2V8G A;  3KR4 A;  3WAB A;  2RB7 A;  2AFW A;  3FF3 A;  2C6C A;  3BXM A;  1ZG9 A;  2OR4 A;  3TC8 A;  1FNO A;  1F2O A;  2NYQ A;  5LRK A;  3NH5 A;  4P4B A;  1XJO A;  1JQG A;  4MXU A;  5J1Q A;  4F8Z A;  3FJU A;  3L2N A;  4PXB A;  3B3C A;  4UEZ A;  3D7G A;  2ZED A;  4BD9 A;  4R6T A;  4ONW A;  2C6P A;  2AFO A;  3V7Z A;  5JM6 A;  3B7I A;  3CDX A;  1TF8 A;  1EE3 P;  4OIW A;  4PXE A;  2GRE A;  4OC2 A;  3PB9 X;  2C6G A;  1OBR A;  2PJ9 A;  4NJQ A;  1CX8 A;  1F57 A;  3RZA A;  2ZEE A;  2V8D A;  4K3N A;  5JH9 A;  1XMB A;  4F9U A;  4Z65 A;  1ELM P;  5F09 A;  1LFW A;  4X8I A;  2CTB A;  2PJ3 A;  3RAM A;  3SI2 A;  4P44 A;  2AFU A;  4ZYQ A;  5HVH A;  4UEF A;  1YSJ A;  4O23 A;  4TWE A;  3PB8 X;  4W9Y A;  2VL1 A;  4P45 A;  2PJ7 A;  5HVF A;  3FH4 A;  4B6Z A;  3WC6 A;  1BPM A;  5LRG A;  1BLL E;  3IJ3 A;  1ZLH A;  4WJB A;  4H2K A;  4OP4 A;  2PVV A;  4NGM A;  3K2K A;  2WZN A;  2OOT A;  1XBU A;  1ARL A;  3D7H A;  3PB7 X;  4NGP A;  3IIB A;  5D8N A;  5K8M A;  5DS0 A;  1QQ9 A;  1BPN A;  4ZY2 A;  4KSI A;  2XEI A;  3KZW A;  3PBB A;  1CPX A;  4P4E A;  1YW4 A;  3PFO A;  3ISZ A;  5LRJ A;  1FT7 A;  3VAT A;  1KWM A;  2ZOG A;  2ZEN A;  1HDQ A;  4NFR A;  3B3W A;  5ELY A;  2O4H A;  2QYV A;  1TF9 A;  3KI9 A;  4R76 A;  4OC3 A;  1TKH A;  4MCP A;  2GU2 A;  4ZY0 A;  2BOA A;  1CP7 A;  2V77 A;  1Y0Y A;  3NA6 A;  1CBX A;  3IO1 A;  4DYO A;  2F8H A;  3PRT A;  3PFE A;  4EFD A;  3BI0 A;  4MMO A;  4UIA A;  2WYR A;  1RTQ A;  2RFH A;  4NGS A;  2HC9 A;  3SI0 A;  5LYD A;  3T8W A;  2XEG A;  2PJ5 A;  4F9V A;  4OC1 A;  3I1U A;  2ANP A;  1TKJ A;  2O53 A;  4YWY A;  1YME A;  4NGT A;  2BO9 A;  2NSM A;  3D66 A;  1BAV A;  3SI1 A;  4AXV A;  4ZX8 A;  2V8V A;  2PCU A;  3RBU A;  1VHO A;  3SJG A;  1LOK A;  1AYE A;  1ELL P;  2IJZ A;  3IEH A;  2ZEP A;  2J9A A;  2PJB A;  4G1P A;  4MHN A;  1IGB A;  1PYT B;  4CPA A;  4WWV A;  1ZLI A;  2V8H A;  1HEE A;  5K8P A;  4R8F A;  3D67 A;  3FEC A;  5THW A;  2PE3 A;  3H8E A;  3TX8 A;  3JRU A;  3HUV A;  1HDU A;  3V38 A;  1M4L A;  4R7M A;  2PJ8 A;  3KGQ A;  2PJ4 A;  2ZEH A;  1R43 A;  1Q7L A;  2ABZ A;  3KAS A;  3ISX A;  4X3R A;  1IY7 A;  3B3S A;  4UIB A;  3FX6 A;  3FED A;  4YU9 A;  1YLO A;  2EK8 A;  2ZEM A;  2AFX A;  3IWW A;  2AFM A;  3N5F A;  2PJ1 A;  3VAR A;  4OKO A;  1CPS A;  2CTC A;  2POK A;  2XEF A;  3S9M A;  3KHZ A;  2PJ0 A;  2HB6 A;  5LYL A;  2PJC A;  2Q4Z A;  2I3C A;  3KR5 A;  2EWB A;  5D29 A;  3DLJ A;  3FMC A;  2XEJ A;  4P4I A;  2IQ6 A;  4OC0 A;  1ZG8 A;  2CIJ A;  3K9T A;  4P4F A;  4P4J A;  3LMS A;  5IB9 A;  3GB0 A;  1TKF A;  4IK2 A;  4MRI A;  2PIZ A;  5K8O A;  4UF4 A;  3BI1 A;  4JZ0 A;  3LWU A;  3H8G A;  3IC1 A;  3BHX A;  1GYT A;  3S9N A;  1LCP A;  3PB6 X;  3QNV A;  3SJF A;  4RUH A;  2PJ2 A;  2AFZ A;  3B2Y A;  1CP6 A;  4NJR A;  4ZY1 A;  4DUK A;  1NSA A;  1VHE A;  1CG2 A;  5K8N A;  1LAN A;  3MRU A;  5LYF A;  3CPA A;  4EWT A;  1LAP A;  2F7V A;  4A94 A;  4MCQ A;  3HLP A;  1Z5R A; 
#chains in the Genus database with same CATH topology
 1Q2D A;  3FVL A;  3TOA A;  1S7L A;  4A32 A;  4A39 A;  4Q7A A;  4B12 A;  3DDD A;  1ZG7 A;  3PBE A;  4NGN A;  4Q36 A;  2WSA A;  3PGP A;  3WT4 A;  1KUX A;  1VGY A;  2R8V A;  4MHY A;  4MCS A;  2BEI A;  4ZX9 A;  3KQZ A;  4EME A;  4M6I A;  3GUX A;  4ZBG A;  2ZOF A;  2ZXV A;  4LQG A;  5KTA A;  2VXK A;  5HH1 A;  4FWU A;  4FBE A;  4TNU A;  1YW6 A;  2PDO A;  4FAI A;  1XE4 A;  4Q38 A;  2PVW A;  3FB3 A;  4PXD A;  1GHE A;  5C82 A;  3GLJ A;  4HKF A;  1R3N A;  3RO0 A;  2FVG A;  2CF4 A;  2JLM A;  2AJ6 A;  4H89 A;  2C1C A;  3SJX A;  1IIC A;  4KUB A;  4MHP A;  3D2M A;  3D7F A;  5AG5 A;  3DGV A;  2YNC A;  1Q2C A;  3ZJ0 A;  4CGO A;  1XF8 A;  4A38 A;  2QJ8 A;  3B35 A;  3D3S A;  4B5O A;  4CGL A;  2GLJ A;  3D4U A;  4C2Y A;  3TFY A;  5AGE A;  3KQX A;  4QC6 A;  1KUY A;  3JTK A;  4PQA A;  2WPX A;  1DE4 C;  2PIY A;  4FUU A;  4IHM A;  3E0K A;  3SJE A;  4OID A;  2JBJ A;  4F0X A;  3B3T A;  6CPA A;  1ARM A;  5I4M A;  2ARH A;  4XPK A;  4A30 A;  5IX3 A;  2GLF A;  2BCO A;  1TXR A;  4IAV A;  1Y0R A;  1Z9U A;  2DPS A;  3PZJ A;  4A33 A;  2QVP A;  8CPA A;  3TT2 A;  2P6G A;  1IU8 A;  1Y7E A;  5CBM A;  5G20 A;  2ZW7 A;  4OME A;  3KHX A;  2ZEG A;  2Z3M A;  1QSN A;  3RYO A;  2FXF A;  3BJ8 A;  5LYI A;  2DEA A;  4NEX A;  3VWD A;  4FD7 A;  1S7F A;  3NH4 A;  4KOW A;  3T90 A;  5F46 A;  1S60 A;  2ATR A;  1DTD A;  1YRE A;  4LUA A;  4P6Y A;  3W91 A;  2G3T A;  2Y0M A;  4PPZ A;  4NGR A;  2FIW A;  4UCP A;  1QST A;  4X2T A;  1QMU A;  3NH8 A;  4LQ6 A;  4UFX A;  2Q0Y A;  2QEC A;  1JWQ A;  2AFS A;  3S9L A;  2H5M A;  5H84 A;  3DR8 A;  1Z2L A;  2JEW A;  2Q4Y A;  3VH9 A;  4NF1 A;  5G1Z A;  5HVG A;  2EK9 A;  2EO8 A;  4P4D A;  1LAM A;  1PCA A;  2PJ6 A;  3B3V A;  2I00 A;  3CXS A;  3DR6 A;  4UEE A;  2GE3 A;  4HPS A;  4ORF A;  3S6K A;  2Z3O A;  2FSR A;  1CJW A;  3N7Z A;  2Q43 A;  3NFZ A;  3QAH A;  3CPX A;  5HXD A;  3OWC A;  4A37 A;  1IOF A;  4MFZ A;  2REE A;  4UA3 A;  3R9G A;  2ZEO A;  4B5P A;  3MN8 A;  4KUA A;  5F48 A;  3R9F A;  4DJL A;  3GYA A;  3R95 A;  1H8L A;  4OC4 A;  3FEE A;  2G3A A;  1XFO A;  2PRQ A;  1NMT A;  4GM5 A;  2IMO A;  1XIX A;  3I9S A;  4CGP A;  4JYW A;  3H8F A;  4MBU A;  3GIU A;  4P10 A;  2ZEF A;  3F0A A;  4XPD C;  5CPA A;  3D7D A;  3IGR A;  3TO6 A;  3IFE A;  3FYN A;  4NGQ A;  3PEI A;  2F5I A;  4C2X A;  4OAD A;  1AMP A;  1VIX A;  3KL9 A;  2GFQ A;  4MHZ A;  2VI7 A;  1S5K A;  4B13 A;  4YFJ A;  4KSA A;  3WC7 A;  4H6U A;  5JGF A;  2AE6 A;  1F2P A;  2PJA A;  2QIR A;  4AVB A;  4CRY B;  2B4D B;  5CNP A;  1SQH A;  1UWY A;  7CPA A;  4OC5 A;  1XRY A;  2ZEL A;  4MCR A;  3R1K A;  2Q7B A;  3CT9 A;  3H4Q A;  1YLE A;  2G9D A;  4XPD B;  3D68 A;  4PXC A;  2JBK A;  3PB4 X;  4IF5 A;  4QB9 A;  2BSW A;  2PR8 A;  2Q51 A;  4MFP A;  3WC5 A;  4ZI6 A;  4RI1 A;  1QSM A;  1Z8L A;  3D2P A;  3H5Z A;  5IV0 A;  1S3Z A;  4JD6 A;  2V8G A;  3KR4 A;  1Z8X A;  4H6Z A;  3WAB A;  4YGO A;  1UFH A;  3JVN A;  2RB7 A;  2Z11 A;  2OH1 A;  5HMN A;  2AFW A;  3FF3 A;  1IYL A;  2C6C A;  3BXM A;  1ZG9 A;  5ISV A;  2GIV A;  4L8A A;  4R87 A;  4F0Y A;  3NE7 A;  2OR4 A;  3FRM A;  3TC8 A;  2ODF A;  1PUA A;  1FNO A;  5GCN A;  4CYP A;  1F2O A;  2NYQ A;  4MFQ A;  5LRK A;  3NH5 A;  4P4B A;  1XJO A;  1JQG A;  1L0C A;  4JXR A;  4MXU A;  3TO7 A;  5J1Q A;  2B5G B;  5AG6 A;  2ZW4 A;  2OZU A;  2JEV A;  3FJU A;  3L2N A;  4U9Z A;  4F8Z A;  4CYO A;  5J8F A;  2J8N A;  2B58 A;  4Y49 C;  4PXB A;  3B3C A;  4UEZ A;  3D7G A;  2PRB A;  1Y9W A;  2Z3P A;  2Z0Z A;  2B3V A;  4JXQ A;  3TCV A;  4CS0 B;  3UY5 A;  4AVA A;  3RNZ A;  2ZED A;  4M85 A;  2DXQ A;  3R9E A;  4BD9 A;  1LRZ A;  4R6T A;  4ONU A;  1P4N A;  4ONW A;  3SHP A;  3KKW A;  2C6P A;  2VZY A;  2WUU A;  2AFO A;  3V7Z A;  3FIX A;  2D4P A;  3VWE A;  5JM6 A;  3B7I A;  3CDX A;  1TF8 A;  4MY3 A;  1EE3 P;  4OIW A;  4PXE A;  2GRE A;  2CNM A;  4KVO E;  3PB9 X;  2C6G A;  1OBR A;  2HQY A;  2PJ9 A;  4OC2 A;  4NJQ A;  1CX8 A;  2ZW5 A;  5F49 A;  1WWZ A;  2CXA A;  3LAC A;  1F57 A;  4Y49 B;  3RZA A;  2ZEE A;  2V8D A;  4PV6 A;  4K3N A;  4E0A A;  4NXY A;  2YNC C;  4A95 A;  1XMB A;  4F9U A;  5JH9 A;  4Z65 A;  4TWE A;  4CAF A;  1ELM P;  1YR0 A;  5F09 A;  1LFW A;  4X8I A;  3S6H A;  2EBJ A;  2CTB A;  2PJ3 A;  3RAM A;  1IYK A;  1B6B A;  2Z3N A;  2AFU A;  4P44 A;  3SI2 A;  4ZYQ A;  3S6F A;  5HVH A;  3B8G A;  1IB1 E;  3F8K A;  4FD5 A;  3IWE A;  4KZT A;  2JDC A;  4UEF A;  3C26 A;  1YSJ A;  2B4B A;  1IID A;  3PB8 X;  1Y9K A;  1XMT A;  4FD6 A;  2VL1 A;  2J8M A;  4K30 A;  4O23 A;  2PJ7 A;  2YND A;  3D8P A;  3FH4 A;  4P45 A;  5HVF A;  4B6Z A;  2QML A;  3CXQ A;  1RO5 A;  1P0H A;  3WC6 A;  4BMH A;  1YVO A;  2JDD A;  2VEZ A;  4AVC A;  1BPM A;  3GY9 A;  1BLL E;  5LRG A;  1MJA A;  4UWJ A;  5JPH A;  2FIA A;  3IJ3 A;  1YGH A;  1ZLH A;  2VQY A;  1I1D A;  4WJB A;  4H2K A;  2B3U A;  4UBR A;  4OP4 A;  2PVV A;  3QB8 A;  4AB7 A;  2X7B A;  5J8C A;  4NGM A;  4U9Y A;  4CRZ B;  1BO4 A;  2HV2 A;  3K2K A;  2WZN A;  2OOT A;  1XBU A;  1ARL A;  2P6F A;  3FBU A;  3D7H A;  3PB7 X;  1ZO0 A;  4NGP A;  3IIB A;  2REF A;  5D8N A;  2GAN A;  5K8M A;  1CM0 A;  5DS0 A;  1QQ9 A;  1BPN A;  2EVN A;  4MHD A;  5AG7 A;  1I12 A;  2OB0 A;  2R98 A;  2B4D A;  4ZY2 A;  4KSI A;  4KOS A;  2XEI A;  5KTC A;  5AG4 A;  4KOU A;  3KZW A;  4CGN A;  3PBB A;  1CPX A;  2PSW A;  3P2H A;  2Q4V A;  1YW4 A;  4P4E A;  3PFO A;  3ISZ A;  5LRJ A;  3T9Y A;  3MGD A;  1Z8T A;  3F5B A;  2CNS A;  1FT7 A;  1QSR A;  3VAT A;  4QBJ A;  4MJ8 A;  3JUW A;  4KOY A;  1KWM A;  2ZOG A;  5C88 A;  2ZEN A;  4MY0 A;  4KOV A;  2P6E A;  4FD4 A;  1HDQ A;  4NFR A;  3B3W A;  3PP9 A;  4KLW A;  5ELY A;  3S6G A;  2VZZ A;  2O4H A;  2QYV A;  1TF9 A;  4AG9 A;  5IB0 A;  3KI9 A;  4AG7 A;  4DNC A;  4R76 A;  4OC3 A;  1TKH A;  4MCP A;  2O28 A;  1S7N A;  2GU2 A;  5I0C A;  4ZY0 A;  4KOT A;  2BOA A;  1M1D A;  1CP7 A;  2V77 A;  1Y0Y A;  3NA6 A;  1CBX A;  4PK2 A;  3A9L A;  1YX0 A;  3IO1 A;  4PK3 A;  2HUZ A;  4CYN A;  3LD2 A;  4RN7 A;  2R7H A;  4DYO A;  2F8H A;  4PSW A;  4B5P B;  2NMT A;  2OZH A;  3PRT A;  4YRH A;  2IL4 A;  5FVJ A;  1BOB A;  3G3S A;  3PFE A;  4EFD A;  2FT0 A;  3DSB A;  3TTH A;  4BBH A;  1AUG A;  3BI0 A;  4MMO A;  4UIA A;  1I21 A;  3IU1 A;  4KVX A;  2ZW6 A;  2RC4 A;  1YQE A;  2WYR A;  1RTQ A;  4J3G A;  2RFH A;  4NGS A;  4E8O A;  4CAV A;  1MJB A;  1RXT A;  4CYQ A;  2CNT A;  1NE9 A;  2HC9 A;  4UWI A;  3SI0 A;  5LYD A;  4C68 A;  3EXN A;  3T8W A;  2XEG A;  4LX9 A;  2PJ5 A;  4F9V A;  3R96 A;  4OC1 A;  4UCM A;  3I1U A;  4II9 A;  4X5K A;  1Z8W A;  3EO4 A;  4IUS A;  1KZF A;  1X12 A;  2ANP A;  4GS4 A;  1TKJ A;  4CAW A;  2O53 A;  4YWY A;  2Z3K A;  3QAY A;  1YME A;  4NGT A;  2BO9 A;  4KOR A;  2NSM A;  3D66 A;  1M4D A;  4CAX A;  2P0W A;  1BAV A;  3BJ7 A;  4KLV A;  3SI1 A;  3TOB A;  4AXV A;  5JQ4 A;  4ZX8 A;  2V8V A;  2C27 A;  5E96 A;  2PCU A;  3FNC A;  3RBU A;  1VHO A;  3SJG A;  1LOK A;  4GXH A;  5DWN A;  4R3L A;  2PR1 A;  4OLL A;  3V8I A;  1AYE A;  4L89 A;  4XNH C;  1VHS A;  1ELL P;  2IJZ A;  2OU2 A;  5DWM A;  4CGM A;  3IEH A;  4HNY B;  2ZEP A;  2J9A A;  2PJB A;  4G1P A;  4MHN A;  4B10 A;  2FE7 A;  1IGB A;  1PYT B;  5G22 A;  1TIQ A;  1WK4 A;  4CPA A;  4WWV A;  1ZLI A;  2R1I A;  2V8H A;  1HEE A;  5F47 A;  3TO9 A;  4HNW B;  2Q7S A;  4QVT A;  3CXP A;  2ZPA A;  5EC4 A;  4C2Z A;  5K8P A;  2BL1 A;  4R8F A;  3LOD A;  4JLY A;  2PC1 A;  2VBQ A;  4QUS A;  4NSQ A;  1Z4E A;  3D67 A;  5A28 A;  4C7H A;  3FEC A;  3W6X A;  5THW A;  2PE3 A;  3H8E A;  2YNE A;  4XPL A;  3TX8 A;  3ZZI A;  3G8W A;  4KOX A;  3CZX A;  3JRU A;  4MFL A;  3BLN A;  3HUV A;  4M3S A;  4XNH B;  4B14 A;  2K5T A;  1HDU A;  3V38 A;  1M4L A;  1R57 A;  1M4G A;  4R7M A;  4B11 A;  2PJ8 A;  1V0C A;  3KGQ A;  4NCZ A;  4A2Z A;  1NSL A;  2PJ4 A;  2Q04 A;  2ZEH A;  3IWG A;  1R43 A;  4I49 A;  1Q7L A;  2ABZ A;  3KAS A;  3ISX A;  4X3R A;  1IY7 A;  3B3S A;  2Z3L A;  1N71 A;  4MFK A;  1Q2Y A;  3FX6 A;  4RS2 A;  3EFA A;  1M4I A;  4UIB A;  5G21 A;  3FED A;  4YU9 A;  1YLO A;  2EK8 A;  2ZEM A;  2AFX A;  2A4N A;  2FL4 A;  4UFV A;  2WPW A;  2FCK A;  4BIN A;  3IWW A;  2AFM A;  3N5F A;  4R57 A;  2PJ1 A;  4W9Y A;  3VAR A;  4OKO A;  4U5Y A;  1CPS A;  3IU2 A;  5A27 A;  3EC4 A;  2CTC A;  4KVM E;  2POK A;  3K9U A;  2XEF A;  4KSF A;  3S9M A;  4EVY A;  3WR7 A;  3SXO A;  3KHZ A;  3GKR A;  2J8R A;  4CAE A;  2PJ0 A;  5EMI A;  2HB6 A;  3SXN A;  5LYL A;  2PJC A;  4M6G A;  2Q4Z A;  2I3C A;  3KR5 A;  1ON0 A;  2EWB A;  5D29 A;  3DLJ A;  3FMC A;  1MJ9 A;  4PSX A;  2XEJ A;  4P4I A;  2IQ6 A;  4OC0 A;  1ZG8 A;  4R3K A;  1OZP A;  1Z4R A;  2CIJ A;  3K9T A;  4MFJ A;  4P4F A;  4P4J A;  3LMS A;  2BUE A;  2D4O A;  2OZG A;  5H86 A;  1KUV A;  5IB9 A;  3GB0 A;  1S7K A;  1TKF A;  4JJX A;  4C7I A;  4IK2 A;  1MK4 A;  5BWA B;  4MRI A;  2PIZ A;  5K8O A;  3TE4 A;  3EY5 A;  4UFW A;  4UF4 A;  4R9M A;  3BI1 A;  2DPT A;  4JZ0 A;  2PQ8 A;  1B87 A;  3LWU A;  1M44 A;  4KS9 A;  3H8G A;  3IC1 A;  1XEB A;  3BHX A;  1YVK A;  1GYT A;  3S9N A;  1K4J A;  2B5G A;  2DF5 A;  3DNS A;  1LCP A;  1YK3 A;  3PB6 X;  3QNV A;  4UCN A;  1FY7 A;  3SJF A;  4MI4 A;  2G0B A;  5KTD A;  4RUH A;  2PJ2 A;  1IOI A;  2AFZ A;  3B2Y A;  1CP6 A;  4NJR A;  3I3G A;  2YGW A;  4A31 A;  4ZY1 A;  1A2Z A;  4OAE A;  3FXT A;  4DUK A;  2Q44 A;  1NSA A;  1VHE A;  1CG2 A;  3NE8 A;  5K8N A;  2FS5 A;  1XOV A;  4HNX B;  4M6H A;  1LAN A;  1VKC A;  3MRU A;  1PU9 A;  1U6M A;  2EUI A;  5LYF A;  4ZGY B;  3CPA A;  4EWT A;  1LAP A;  4F6A A;  2I79 A;  2Z10 A;  1Y7R A;  2CY2 A;  2F7V A;  2KCW A;  4JWP A;  4MCQ A;  4A94 A;  3HLP A;  1Z5R A;  5EBV A;  3W6S A;  1QSO A;  4E2A A;  3P2F A;  1X10 A;  1J4J A; 
#chains in the Genus database with same CATH homology
 3FVL A;  4A39 A;  4Q7A A;  1ZG7 A;  3PBE A;  4NGN A;  3WT4 A;  1VGY A;  4MHY A;  4MCS A;  4ZX9 A;  4EME A;  3KQZ A;  3GUX A;  2ZOF A;  4LQG A;  4FWU A;  4FBE A;  4TNU A;  1YW6 A;  4FAI A;  2PVW A;  4PXD A;  3GLJ A;  1R3N A;  2FVG A;  2CF4 A;  2C1C A;  3SJX A;  4MHP A;  3D7F A;  3DGV A;  4A38 A;  2QJ8 A;  3B35 A;  2GLJ A;  3D4U A;  3KQX A;  4PQA A;  1DE4 C;  2PIY A;  4FUU A;  4IHM A;  3SJE A;  4OID A;  2JBJ A;  3B3T A;  6CPA A;  1ARM A;  5I4M A;  2GLF A;  2BCO A;  1TXR A;  4IAV A;  1Y0R A;  2QVP A;  8CPA A;  1Y7E A;  5CBM A;  4OME A;  3KHX A;  2ZEG A;  5LYI A;  2DEA A;  3NH4 A;  1DTD A;  4P6Y A;  4PPZ A;  4NGR A;  4X2T A;  1QMU A;  3NH8 A;  2AFS A;  3S9L A;  1Z2L A;  2JEW A;  3VH9 A;  5HVG A;  2EK9 A;  4P4D A;  1LAM A;  1PCA A;  2PJ6 A;  3B3V A;  4UEE A;  5HXD A;  2Q43 A;  3NFZ A;  3CPX A;  4A37 A;  2ZEO A;  3MN8 A;  4DJL A;  1H8L A;  4OC4 A;  3FEE A;  1XFO A;  2PRQ A;  4GM5 A;  2IMO A;  4JYW A;  3H8F A;  4P10 A;  2ZEF A;  5CPA A;  3D7D A;  3IFE A;  4NGQ A;  3PEI A;  1AMP A;  1VIX A;  3KL9 A;  4MHZ A;  3WC7 A;  5JGF A;  1F2P A;  2PJA A;  7CPA A;  1UWY A;  4OC5 A;  1XRY A;  2ZEL A;  4MCR A;  3CT9 A;  2G9D A;  3D68 A;  4PXC A;  2JBK A;  3PB4 X;  2Q51 A;  3WC5 A;  4ZI6 A;  1Z8L A;  2V8G A;  3KR4 A;  3WAB A;  2RB7 A;  2AFW A;  3FF3 A;  2C6C A;  3BXM A;  1ZG9 A;  2OR4 A;  3TC8 A;  1FNO A;  1F2O A;  2NYQ A;  5LRK A;  3NH5 A;  4P4B A;  1XJO A;  1JQG A;  4MXU A;  5J1Q A;  4F8Z A;  3FJU A;  3L2N A;  4PXB A;  3B3C A;  4UEZ A;  3D7G A;  2ZED A;  4BD9 A;  4R6T A;  4ONW A;  2C6P A;  2AFO A;  3V7Z A;  5JM6 A;  3B7I A;  3CDX A;  1TF8 A;  1EE3 P;  4OIW A;  4PXE A;  2GRE A;  4OC2 A;  3PB9 X;  2C6G A;  1OBR A;  2PJ9 A;  4NJQ A;  1CX8 A;  1F57 A;  3RZA A;  2ZEE A;  2V8D A;  4K3N A;  5JH9 A;  1XMB A;  4F9U A;  4Z65 A;  1ELM P;  5F09 A;  1LFW A;  4X8I A;  2CTB A;  2PJ3 A;  3RAM A;  3SI2 A;  4P44 A;  2AFU A;  4ZYQ A;  5HVH A;  4UEF A;  1YSJ A;  4O23 A;  4TWE A;  3PB8 X;  4W9Y A;  2VL1 A;  4P45 A;  2PJ7 A;  5HVF A;  3FH4 A;  4B6Z A;  3WC6 A;  1BPM A;  5LRG A;  1BLL E;  3IJ3 A;  1ZLH A;  4WJB A;  4H2K A;  4OP4 A;  2PVV A;  4NGM A;  3K2K A;  2WZN A;  2OOT A;  1XBU A;  1ARL A;  3D7H A;  3PB7 X;  4NGP A;  3IIB A;  5D8N A;  5K8M A;  5DS0 A;  1QQ9 A;  1BPN A;  4ZY2 A;  4KSI A;  2XEI A;  3KZW A;  3PBB A;  1CPX A;  4P4E A;  1YW4 A;  3PFO A;  3ISZ A;  5LRJ A;  1FT7 A;  3VAT A;  1KWM A;  2ZOG A;  2ZEN A;  1HDQ A;  4NFR A;  3B3W A;  5ELY A;  2O4H A;  2QYV A;  1TF9 A;  3KI9 A;  4R76 A;  4OC3 A;  1TKH A;  4MCP A;  2GU2 A;  4ZY0 A;  2BOA A;  1CP7 A;  2V77 A;  1Y0Y A;  3NA6 A;  1CBX A;  3IO1 A;  4DYO A;  2F8H A;  3PRT A;  3PFE A;  4EFD A;  3BI0 A;  4MMO A;  4UIA A;  2WYR A;  1RTQ A;  2RFH A;  4NGS A;  2HC9 A;  3SI0 A;  5LYD A;  3T8W A;  2XEG A;  2PJ5 A;  4F9V A;  4OC1 A;  3I1U A;  2ANP A;  1TKJ A;  2O53 A;  4YWY A;  1YME A;  4NGT A;  2BO9 A;  2NSM A;  3D66 A;  1BAV A;  3SI1 A;  4AXV A;  4ZX8 A;  2V8V A;  2PCU A;  3RBU A;  1VHO A;  3SJG A;  1LOK A;  1AYE A;  1ELL P;  2IJZ A;  3IEH A;  2ZEP A;  2J9A A;  2PJB A;  4G1P A;  4MHN A;  1IGB A;  1PYT B;  4CPA A;  4WWV A;  1ZLI A;  2V8H A;  1HEE A;  5K8P A;  4R8F A;  3D67 A;  3FEC A;  5THW A;  2PE3 A;  3H8E A;  3TX8 A;  3JRU A;  3HUV A;  1HDU A;  3V38 A;  1M4L A;  4R7M A;  2PJ8 A;  3KGQ A;  2PJ4 A;  2ZEH A;  1R43 A;  1Q7L A;  2ABZ A;  3KAS A;  3ISX A;  4X3R A;  1IY7 A;  3B3S A;  4UIB A;  3FX6 A;  3FED A;  4YU9 A;  1YLO A;  2EK8 A;  2ZEM A;  2AFX A;  3IWW A;  2AFM A;  3N5F A;  2PJ1 A;  3VAR A;  4OKO A;  1CPS A;  2CTC A;  2POK A;  2XEF A;  3S9M A;  3KHZ A;  2PJ0 A;  2HB6 A;  5LYL A;  2PJC A;  2Q4Z A;  2I3C A;  3KR5 A;  2EWB A;  5D29 A;  3DLJ A;  3FMC A;  2XEJ A;  4P4I A;  2IQ6 A;  4OC0 A;  1ZG8 A;  2CIJ A;  3K9T A;  4P4F A;  4P4J A;  3LMS A;  5IB9 A;  3GB0 A;  1TKF A;  4IK2 A;  4MRI A;  2PIZ A;  5K8O A;  4UF4 A;  3BI1 A;  4JZ0 A;  3LWU A;  3H8G A;  3IC1 A;  3BHX A;  1GYT A;  3S9N A;  1LCP A;  3PB6 X;  3QNV A;  3SJF A;  4RUH A;  2PJ2 A;  2AFZ A;  3B2Y A;  1CP6 A;  4NJR A;  4ZY1 A;  4DUK A;  1NSA A;  1VHE A;  1CG2 A;  5K8N A;  1LAN A;  3MRU A;  5LYF A;  3CPA A;  4EWT A;  1LAP A;  2F7V A;  4A94 A;  4MCQ A;  3HLP A;  1Z5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...