3B35A

Crystal structure of the m180a mutant of the aminopeptidase from vibrio proteolyticus
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDATNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Bacterial leucyl aminopeptidase
publication title Zinc coordination geometry and ligand binding affinity: the structural and kinetic analysis of the second-shell serine 228 residue and the methionine 180 residue of the aminopeptidase from Vibrio proteolyticus.
pubmed doi rcsb
source organism Vibrio proteolyticus
total genus 119
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2007-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3b35A00
1Y0RA 1ZLHA 3SJGA 2PIYA 2JEWA 4YU9A 4EMEA 2NYQA 2ZEEA 3CPXA 3DGVA 1BPMA 3SJFA 2ZEDA 1LOKA 3FVLA 2QVPA 3GLJA 2F8HA 4MCRA 3KQZA 3D7DA 2DEAA 3B3VA 2PJBA 3D68A 4TNUA 4NJRA 3N5FA 4DJLA 5D8NA 4ZI6A 4BD9A 5JGFA 2AFOA 4LQGA 1RTQA 2O4HA 2C6CA 4NGQA 5K8MA 4ZX9A 2C6PA 4EFDA 1FT7A 4OC1A 3NH5A 1HEEA 5THWA 4B6ZA 1CP6A 3V7ZA 4PXBA 1Z8LA 4KSIA 1KWMA 2JBKA 3TX8A 4NGSA 2PRQA 1BPNA 4PXDA 1AMPA 3FX6A 3VATA 5LYLA 4R6TA 3RZAA 4MCSA 2GLJA 3SI0A 1YMEA 2POKA 3IJ3A 3MRUA 3H8FA 4OP4A 3B35A 4X3RA 1ZG8A 4NFRA 1CPSA 4OC2A 1CPXA 2XEIA 4P4JA 1XMBA 1QQ9A 2BOAA 1CG2A 4X2TA 4DYOA 3FF3A 2ZELA 4MHNA 5LYDA 2AFXA 4P4IA 1LFWA 2PIZA 3VARA 3PB8X 3T8WA 1IGBA 4JYWA 3PRTA 4MHZA 3D7FA 1ARLA 1GYTA 2PJAA 4Q7AA 2PJ5A 2PJ6A 3K2KA 3FEEA 2HB6A 4UF4A 4R8FA 5K8OA 3NH4A 3PFEA 5J1QA 2QYVA 4PXEA 5D29A 3IIBA 3NFZA 3I1UA 3KASA 3IEHA 4A38A 3S9NA 4MMOA 5HVFA 2EK9A 3SJXA 1ELLP 3KL9A 4JZ0A 4NJQA 3KR5A 4FAIA 4OC5A 5HXDA 1JQGA 4R7MA 1LANA 3FJUA 4UIBA 2AFSA 3D4UA 4P4DA 4CPAA 6CPAA 5CPAA 3S9MA 2PJ9A 4ZYQA 1LCPA 2ZOFA 5HVGA 3V38A 2EK8A 1Y0YA 2AFUA 4TWEA 4P10A 3SI2A 2PJ4A 1Z5RA 1TF9A 2I3CA 1OBRA 1BAVA 5JM6A 4ONWA 2Q43A 1EE3P 2IMOA 1PYTB 5HVHA 3ISXA 5LRGA 1CP7A 2BO9A 1LAPA 4P44A 4F9UA 4IHMA 4P6YA 3IFEA 3GB0A 4O23A 3FEDA 1YSJA 1Q7LA 3B7IA 3H8GA 2IQ6A 4PPZA 1XBUA 3QNVA 2ZEHA 4P4BA 4RUHA 4OIWA 3KZWA 1FNOA 3RBUA 1ELMP 3CDXA 2J9AA 1BLLE 3PFOA 2ABZA 2ZEPA 5K8PA 5K8NA 3PEIA 4X8IA 1YLOA 3IWWA 2PJ8A 2RB7A 2XEJA 2ZEMA 3HUVA 2AFMA 3SI1A 2JBJA 4H2KA 4ZY1A 1IY7A 2PJ1A 2HC9A 1TKFA 2ANPA 5F09A 4OC4A 2PJ3A 3BI1A 1TF8A 1H8LA 1CX8A 3PB6X 3SJEA 4ZY0A 4FUUA 2PVVA 4PQAA 1R43A 3MN8A 4F8ZA 2CF4A 3TC8A 3S9LA 1Z2LA 4NGNA 2PJ0A 4MHPA 4EWTA 2O53A 3CT9A 4MXUA 4P4FA 3KHXA 4A94A 2ZOGA 1VGYA 4NGPA 1ZG9A 2EWBA 1UWYA 1CBXA 2PVWA 2CTCA 3KQXA 3D7GA 3B3SA 3KR4A 5LYFA 2V8VA 2G9DA 3HLPA 2PCUA 3PBEA 2ZEFA 2Q51A 4F9VA 3NA6A 1AYEA 2WYRA 1HDQA 4MCQA 3WC7A 4R76A 1R3NA 3ISZA 3LWUA 2C1CA 5LRJA 4OMEA 1QMUA 4ZY2A 4A37A 4MHYA 2ZENA 4AXVA 2PJ2A 1ARMA 2RFHA 3FH4A 1F2PA 2XEFA 3PB9X 3NH8A 2VL1A 5I4MA 3KGQA 2ZEOA 1XFOA 1ZLIA 3D67A 4NGMA 1DE4C 2WZNA 3WC6A 1XJOA 4ZX8A 4UIAA 5LYIA 4DUKA 4UEEA 4UEFA 3B3TA 1Y7EA 4OKOA 4MRIA 4A39A 1M4LA 3L2NA 1F57A 1VIXA 4OC0A 2CIJA 3LMSA 4W9YA 3WC5A 2GU2A 4NGTA 3WABA 3DLJA 4FBEA 2FVGA 3D66A 2GLFA 1VHEA 2CTBA 4GM5A 4G1PA 5CBMA 1YW6A 2NSMA 4K3NA 2OR4A 5LRKA 3VH9A 1ZG7A 1TKHA 1HDUA 3B3WA 3K9TA 5IB9A 3PB4X 2V77A 1PCAA 2AFZA 3FMCA 2F7VA 5JH9A 4FWUA 2V8HA 1DTDA 4OIDA 2V8DA 3IO1A 4PXCA 1XRYA 3KI9A 1VHOA 2PJ7A 4NGRA 3PB7X 2QJ8A 2IJZA 7CPAA 4WJBA 3FECA 2AFWA 5DS0A 3B3CA 2GREA 3PBBA 4P4EA 1TKJA 2XEGA 3CPAA 3IC1A 3GUXA 4IK2A 3B2YA 4P45A 2OOTA 3BXMA 1LAMA 4YWYA 2PE3A 1NSAA 3JRUA 4Z65A 3H8EA 3KHZA 4IAVA 3RAMA 2ZEGA 2V8GA 2BCOA 5ELYA 2PJCA 1TXRA 1F2OA 3WT4A 3BI0A 1YW4A 8CPAA 3BHXA 4MCPA 4UEZA 4WWVA 2Q4ZA 2C6GA 4OC3A 3D7HA
chains in the Genus database with same CATH superfamily
4IF5A 2D4PA 1Y0RA 4Q36A 3VWEA 2GFQA 2FS5A 1ZLHA 3G8WA 1YLEA 3SJGA 2PIYA 1NE9A 2JEWA 4YU9A 4AG9A 2NYQA 2ZEEA 4B5OA 4EMEA 3CPXA 3RO0A 3DGVA 2REFA 4KSFA 1OZPA 1TIQA 1WWZA 1BPMA 3SJFA 3R9EA 2ZEDA 5IB0A 1LOKA 3FVLA 4QBJA 2PR8A 3TOAA 2QVPA 3GLJA 2Q7SA 4R3LA 4UWIA 2F8HA 3EXNA 4JXQA 4MCRA 3KQZA 4RN7A 4B13A 3D7DA 1X10A 2DEAA 2PJBA 3B3VA 3JVNA 1S3ZA 3D68A 4TNUA 3R1KA 4NJRA 4CRYB 4GS4A 4UFWA 3N5FA 4KSAA 4DJLA 2OB0A 5D8NA 4ZI6A 4BD9A 3EC4A 5DWMA 1I1DA 4MY3A 5JGFA 2B4DB 2AFOA 3LODA 3QAYA 4OADA 5EC4A 4LQGA 2CXAA 1RTQA 2O4HA 2C6CA 4CAFA 4NGQA 5K8MA 4MFZA 4ZX9A 4RS2A 2C6PA 4KVME 4UBRA 1PU9A 4EFDA 1FT7A 2H5MA 4MFQA 4OC1A 3NH5A 4CRZB 4B14A 2G3TA 1HEEA 4L8AA 4AVBA 3F5BA 2QECA 1S60A 3GY9A 2BEIA 1AUGA 3NE7A 5THWA 1VHSA 4YFJA 4B6ZA 3IU1A 1CP6A 1XOVA 1Q2YA 3KKWA 5BWAB 5AG5A 3V7ZA 2R1IA 4PXBA 1Z8LA 1FY7A 2B5GA 2P6GA 1YVOA 4KSIA 1PUAA 1KWMA 1ON0A 4UWJA 2JBKA 3TX8A 4A30A 1XMTA 4NGSA 2EUIA 2PRQA 3FIXA 1BPNA 4PXDA 2Q4YA 1AMPA 3FX6A 2Z3PA 4KOYA 3VATA 5J8CA 5LYLA 4R6TA 1XEBA 5GCNA 4MCSA 4R57A 2DXQA 3RZAA 2GLJA 5G22A 3SI0A 3C26A 1YMEA 4NF1A 1RO5A 2O28A 2POKA 3IJ3A 3MRUA 1IIDA 1B6BA 3H8FA 4OP4A 4Y49C 4A31A 1IU8A 3B35A 4X3RA 1ZG8A 4NFRA 1CPSA 2DF5A 1Z4EA 3R9FA 4YRHA 4OC2A 1CPXA 3S6KA 2XEIA 3IWGA 4X5KA 4P4JA 1XMBA 3FBUA 5JPHA 1X12A 1P0HA 2J8MA 2Q7BA 1QQ9A 2PR1A 2Z3MA 2G0BA 2BOAA 4H6ZA 3QB8A 2F5IA 4KOSA 1CG2A 4X2TA 2Y0MA 4DYOA 3FF3A 1Z8TA 2ZELA 4KORA 4MHNA 5LYDA 2VBQA 2Q4VA 4MY0A 3FYNA 1YREA 1M4DA 2AFXA 4P4IA 1LFWA 2PIZA 2P0WA 2B5GB 3VARA 1V0CA 4CGMA 3LD2A 3PB8X 3T8WA 1IGBA 4JYWA 2OZGA 4C68A 3PRTA 2J8RA 4MHZA 4MHDA 3D7FA 4ORFA 1M4GA 1ARLA 1JWQA 4CAVA 1GYTA 4J3GA 2PJAA 4Q7AA 2PJ5A 2PJ6A 3K2KA 5KTCA 3FEEA 1XIXA 2HB6A 4UF4A 1S7KA 1SQHA 4YGOA 4R8FA 5K8OA 3NH4A 3PFEA 5J8FA 5J1QA 3FB3A 2QYVA 3D2MA 3D8PA 4KS9A 4PXEA 4MFKA 3IIBA 2YNCA 2CY2A 5D29A 2FXFA 3I1UA 3NFZA 3KASA 3IEHA 3R95A 2ZW5A 4A38A 3PGPA 3S9NA 4MMOA 4M6GA 2REEA 5CNPA 5HVFA 2EK9A 3IGRA 3SJXA 1ELLP 3KL9A 4FD4A 4JZ0A 2VZZA 3R96A 2Q44A 4KOUA 4M6IA 4NJQA 3KR5A 4CGPA 4OC5A 4FAIA 4UCPA 2Z3NA 2EBJA 5HXDA 2JLMA 3DSBA 4KLVA 5F48A 1UFHA 2GANA 1XE4A 1JQGA 1S7NA 2Z0ZA 4R7MA 1LANA 2A4NA 1IOIA 1QSNA 4KVXA 3FJUA 4UIBA 2Z10A 4L89A 2AFSA 2OZHA 3D4UA 4P4DA 5HH1A 4CPAA 6CPAA 1WK4A 3RYOA 1Y9WA 2VEZA 5IV0A 5CPAA 1GHEA 3S9MA 1MJ9A 4JLYA 5G20A 2PJ9A 4ZYQA 1LCPA 2YGWA 2ZOFA 5HVGA 4IUSA 3V38A 2EK8A 1Y0YA 2AFUA 4KOVA 4TWEA 4P10A 3RNZA 3GYAA 5E96A 3SI2A 2PJ4A 2I00A 1TF9A 1Z4RA 1Z5RA 2I3CA 1YR0A 1OBRA 5AG4A 1BAVA 2ZXVA 2FE7A 1Q2CA 1K4JA 4ONWA 5JM6A 4I49A 2Q43A 5ISVA 1EE3P 2IMOA 1PYTB 5HVHA 3EFAA 3ISXA 2FCKA 5LRGA 4NXYA 1CP7A 3FXTA 4LX9A 2BO9A 1RXTA 4C2YA 1LAPA 4P44A 5KTAA 1M4IA 4F9UA 4IHMA 4P6YA 3IFEA 3T90A 3GB0A 4O23A 2C27A 1QSRA 4CAEA 2VQYA 3N7ZA 3FEDA 1YSJA 3BJ7A 5JQ4A 1Q7LA 3B7IA 1M44A 1KUVA 2IQ6A 1NMTA 2ODFA 3H8GA 4GXHA 4MFPA 4PPZA 3TO9A 2G3AA 3I9SA 4H89A 1XBUA 4LUAA 3QNVA 2ZEHA 4K30A 4P4BA 3CXPA 4H6UA 2BSWA 2JDDA 4MJ8A 5H86A 3TO6A 3NE8A 3P2FA 1BOBA 1N71A 2YNDA 4RUHA 4OIWA 3KZWA 3B8GA 3P2HA 2BL1A 1Y9KA 1I21A 4NSQA 2HQYA 1FNOA 4HNXB 2RC4A 2VXKA 3RBUA 1KUXA 4XPDC 1ELMP 3CDXA 4E0AA 2J9AA 1BLLE 4CGNA 4C7IA 3PFOA 2ABZA 5C88A 2ZEPA 1IB1E 5K8PA 4E8OA 3BLNA 3BJ8A 2CNTA 5K8NA 3PEIA 4X8IA 3EO4A 2CNMA 4UFVA 1YLOA 3IWWA 2PJ8A 2FIAA 2RB7A 2Z3KA 2XEJA 2ZEMA 3JTKA 4EVYA 3HUVA 4KUAA 4Q38A 2AFMA 5FVJA 3SI1A 5A28A 2X7BA 3W6XA 2OH1A 2JBJA 4H2KA 3H5ZA 4ZY1A 2EVNA 1IY7A 2PJ1A 2HC9A 1TKFA 1S7LA 2ANPA 1A2ZA 5AG7A 4OC4A 5F09A 1S7FA 4DNCA 4AVAA 3IWEA 2PJ3A 1U6MA 3BI1A 4R9MA 4XNHC 2QMLA 4BMHA 5IX3A 3QAHA 4A32A 1QSMA 1BO4A 4B5PA 1TF8A 1H8LA 4PSWA 3W91A 1CX8A 3DNSA 2P6FA 3PB6X 3SJEA 4KOTA 3TTHA 4ZY0A 4FUUA 2PVVA 4PQAA 4F0YA 1R43A 4CAXA 3IU2A 1MJAA 4R3KA 1IICA 5C82A 4KUBA 4KLWA 1M1DA 2R98A 4M3SA 4BINA 5F46A 1LRZA 4U5YA 3FRMA 3MN8A 5A27A 4F8ZA 4QC6A 4E2AA 3CXSA 2CF4A 3K9UA 3TC8A 4BBHA 3S9LA 4JJXA 1Z2LA 4NGNA 2ZPAA 2BUEA 2PJ0A 3G3SA 1QSOA 4MHPA 2O53A 3TO7A 4EWTA 4QVTA 2PRBA 3GKRA 4KOWA 3CT9A 4KOXA 4MXUA 4P4FA 1MJBA 4PV6A 3KHXA 4KVOE 2J8NA 3TOBA 2QIRA 4A94A 1ZO0A 2ZOGA 2Z3LA 1J4JA 3H4QA 3I3GA 4JXRA 4NCZA 4B11A 5EBVA 2B4BA 2ZW7A 1VGYA 4OLLA 1QSTA 2Q0YA 5F49A 4MI4A 3V8IA 4A2ZA 2FL4A 1IOFA 4NGPA 1VKCA 1ZG9A 4XPKA 3SXOA 3MGDA 4OAEA 2EWBA 1UWYA 1CBXA 4CS0B 2PVWA 4C7HA 2CTCA 3KQXA 1YX0A 1B87A 2WSAA 3B3SA 3D7GA 3KR4A 3S6GA 4AVCA 5LYFA 2V8VA 4AB7A 4B5PB 1KUYA 3DR8A 2G9DA 3HLPA 2PCUA 3PBEA 1XF8A 2HV2A 4MBUA 3SHPA 2ZEFA 5AGEA 3D3SA 1Z9UA 2Q51A 4B12A 2OU2A 4F9VA 2B58A 3NA6A 1AYEA 1Q2DA 2WYRA 1HDQA 4MCQA 2B3VA 3WC7A 3R9GA 4R76A 1R3NA 3ISZA 3LWUA 2C1CA 5DWNA 5G1ZA 3F8KA 2I79A 2PDOA 3CZXA 5LRJA 2GE3A 1QMUA 4OMEA 4ZY2A 4A37A 4MHYA 4CYOA 1MK4A 2ZENA 4QB9A 4AXVA 2PJ2A 1ARMA 2RFHA 3CXQA 3FH4A 4PK3A 3S6FA 3UY5A 1F2PA 4U9YA 2PC1A 2XEFA 5H84A 1Y7RA 3PB9X 4HPSA 3NH8A 2VL1A 5I4MA 2ARHA 4ZBGA 1CJWA 3GIUA 3KGQA 2ZEOA 1XFOA 1ZLIA 2FSRA 3D67A 4HKFA 3TCVA 4NGMA 3TT2A 1DE4C 2WZNA 3WC6A 1YGHA 4RI1A 1XJOA 4ZX8A 4UIAA 2ATRA 5LYIA 4DUKA 2DPSA 3PP9A 4UEEA 1R57A 2WPXA 1Y7EA 3B3TA 4UEFA 4OKOA 3OWCA 4MRIA 1Z8WA 4MFJA 4A39A 1M4LA 3L2NA 1F57A 1VIXA 2R8VA 4HNYB 2KCWA 4A33A 4OC0A 4MFLA 1S5KA 2CIJA 4XPLA 3LMSA 1P4NA 4W9YA 3WC5A 3TE4A 2GU2A 2CNSA 4R87A 4NGTA 5F47A 4II9A 4M6HA 3DLJA 3WABA 2GIVA 4FBEA 2FVGA 3D66A 2GLFA 1VHEA 2FIWA 2CTBA 4LQ6A 4GM5A 4G1PA 5CBMA 2HUZA 1YW6A 2NMTA 2NSMA 4K3NA 2OR4A 2FT0A 5LRKA 3VH9A 1ZG7A 1TKHA 1NSLA 1HDUA 4CGOA 3B3WA 3T9YA 3K9TA 4A95A 5IB9A 3PB4X 3S6HA 4F0XA 2V77A 1IYLA 4CYPA 1PCAA 2K5TA 4B10A 3F0AA 2AFZA 4UCMA 3FMCA 2F7VA 4NEXA 3TFYA 2OZUA 4ONUA 3WR7A 4CYNA 5JH9A 2DPTA 4FWUA 2V8HA 1DTDA 4OIDA 4PK2A 4C2XA 2V8DA 3D2PA 3VWDA 1Z8XA 2Z11A 1IYKA 3IO1A 4PXCA 1XRYA 3KI9A 1VHOA 4FD5A 2PJ7A 4NGRA 2VZYA 1YQEA 3PB7X 4JD6A 3PZJA 2QJ8A 2P6EA 2R7HA 1I12A 2IJZA 3ZJ0A 2JEVA 5KTDA 7CPAA 2Q04A 3FNCA 4WJBA 3FECA 1YK3A 1L0CA 4UA3A 2VI7A 2AFWA 2IL4A 5DS0A 3B3CA 4JWPA 3EY5A 4ZGYB 2GREA 2Z3OA 4CYQA 3PBBA 4P4EA 1TKJA 4XPDB 5I0CA 3E0KA 4HNWB 4U9ZA 2XEGA 3CPAA 4F6AA 3IC1A 3LACA 3GUXA 5EMIA 1KZFA 1YVKA 4CGLA 4Y49B 2PQ8A 3JUWA 4IK2A 3B2YA 4FD6A 2AE6A 3DR6A 4P45A 2OOTA 3BXMA 1LAMA 4YWYA 2PE3A 1NSAA 2WPWA 3JRUA 4KZTA 4Z65A 4M85A 3SXNA 3A9LA 4C2ZA 4CAWA 2YNEA 2AJ6A 2D4OA 1CM0A 2ZW6A 3H8EA 3KHZA 4IAVA 3RAMA 4AG7A 2WUUA 2ZEGA 2PSWA 2V8GA 4QUSA 2BCOA 2B3UA 2YNCC 5ELYA 2B4DA 5AG6A 3ZZIA 4XNHB 2PJCA 1TXRA 1F2OA 5HMNA 2ZW4A 2JDCA 4FD7A 4PSXA 3WT4A 3BI0A 1YW4A 2EO8A 8CPAA 3BHXA 4MCPA 4UEZA 3DDDA 4UCNA 4WWVA 5G21A 3W6SA 2Q4ZA 2C6GA 4UFXA 4OC3A 3D7HA
chains in the Genus database with same CATH topology
1Y0RA 1ZLHA 3SJGA 2PIYA 2JEWA 4YU9A 4EMEA 2NYQA 2ZEEA 3CPXA 3DGVA 1BPMA 3SJFA 2ZEDA 1LOKA 3FVLA 2QVPA 3GLJA 2F8HA 4MCRA 3KQZA 3D7DA 2DEAA 3B3VA 2PJBA 3D68A 4TNUA 4NJRA 3N5FA 4DJLA 5D8NA 4ZI6A 4BD9A 5JGFA 2AFOA 4LQGA 1RTQA 2O4HA 2C6CA 4NGQA 5K8MA 4ZX9A 2C6PA 4EFDA 1FT7A 4OC1A 3NH5A 1HEEA 5THWA 4B6ZA 1CP6A 3V7ZA 4PXBA 1Z8LA 4KSIA 1KWMA 2JBKA 3TX8A 4NGSA 2PRQA 1BPNA 4PXDA 1AMPA 3FX6A 3VATA 5LYLA 4R6TA 3RZAA 4MCSA 2GLJA 3SI0A 1YMEA 2POKA 3IJ3A 3MRUA 3H8FA 4OP4A 3B35A 4X3RA 1ZG8A 4NFRA 1CPSA 4OC2A 1CPXA 2XEIA 4P4JA 1XMBA 1QQ9A 2BOAA 1CG2A 4X2TA 4DYOA 3FF3A 2ZELA 4MHNA 5LYDA 2AFXA 4P4IA 1LFWA 2PIZA 3VARA 3PB8X 3T8WA 1IGBA 4JYWA 3PRTA 4MHZA 3D7FA 1ARLA 1GYTA 2PJAA 4Q7AA 2PJ5A 2PJ6A 3K2KA 3FEEA 2HB6A 4UF4A 4R8FA 5K8OA 3NH4A 3PFEA 5J1QA 2QYVA 4PXEA 5D29A 3IIBA 3NFZA 3I1UA 3KASA 3IEHA 4A38A 3S9NA 4MMOA 5HVFA 2EK9A 3SJXA 1ELLP 3KL9A 4JZ0A 4NJQA 3KR5A 4FAIA 4OC5A 5HXDA 1JQGA 4R7MA 1LANA 3FJUA 4UIBA 2AFSA 3D4UA 4P4DA 4CPAA 6CPAA 5CPAA 3S9MA 2PJ9A 4ZYQA 1LCPA 2ZOFA 5HVGA 3V38A 2EK8A 1Y0YA 2AFUA 4TWEA 4P10A 3SI2A 2PJ4A 1Z5RA 1TF9A 2I3CA 1OBRA 1BAVA 5JM6A 4ONWA 2Q43A 1EE3P 2IMOA 1PYTB 5HVHA 3ISXA 5LRGA 1CP7A 2BO9A 1LAPA 4P44A 4F9UA 4IHMA 4P6YA 3IFEA 3GB0A 4O23A 3FEDA 1YSJA 1Q7LA 3B7IA 3H8GA 2IQ6A 4PPZA 1XBUA 3QNVA 2ZEHA 4P4BA 4RUHA 4OIWA 3KZWA 1FNOA 3RBUA 1ELMP 3CDXA 2J9AA 1BLLE 3PFOA 2ABZA 2ZEPA 5K8PA 5K8NA 3PEIA 4X8IA 1YLOA 3IWWA 2PJ8A 2RB7A 2XEJA 2ZEMA 3HUVA 2AFMA 3SI1A 2JBJA 4H2KA 4ZY1A 1IY7A 2PJ1A 2HC9A 1TKFA 2ANPA 5F09A 4OC4A 2PJ3A 3BI1A 1TF8A 1H8LA 1CX8A 3PB6X 3SJEA 4ZY0A 4FUUA 2PVVA 4PQAA 1R43A 3MN8A 4F8ZA 2CF4A 3TC8A 3S9LA 1Z2LA 4NGNA 2PJ0A 4MHPA 4EWTA 2O53A 3CT9A 4MXUA 4P4FA 3KHXA 4A94A 2ZOGA 1VGYA 4NGPA 1ZG9A 2EWBA 1UWYA 1CBXA 2PVWA 2CTCA 3KQXA 3D7GA 3B3SA 3KR4A 5LYFA 2V8VA 2G9DA 3HLPA 2PCUA 3PBEA 2ZEFA 2Q51A 4F9VA 3NA6A 1AYEA 2WYRA 1HDQA 4MCQA 3WC7A 4R76A 1R3NA 3ISZA 3LWUA 2C1CA 5LRJA 4OMEA 1QMUA 4ZY2A 4A37A 4MHYA 2ZENA 4AXVA 2PJ2A 1ARMA 2RFHA 3FH4A 1F2PA 2XEFA 3PB9X 3NH8A 2VL1A 5I4MA 3KGQA 2ZEOA 1XFOA 1ZLIA 3D67A 4NGMA 1DE4C 2WZNA 3WC6A 1XJOA 4ZX8A 4UIAA 5LYIA 4DUKA 4UEEA 4UEFA 3B3TA 1Y7EA 4OKOA 4MRIA 4A39A 1M4LA 3L2NA 1F57A 1VIXA 4OC0A 2CIJA 3LMSA 4W9YA 3WC5A 2GU2A 4NGTA 3WABA 3DLJA 4FBEA 2FVGA 3D66A 2GLFA 1VHEA 2CTBA 4GM5A 4G1PA 5CBMA 1YW6A 2NSMA 4K3NA 2OR4A 5LRKA 3VH9A 1ZG7A 1TKHA 1HDUA 3B3WA 3K9TA 5IB9A 3PB4X 2V77A 1PCAA 2AFZA 3FMCA 2F7VA 5JH9A 4FWUA 2V8HA 1DTDA 4OIDA 2V8DA 3IO1A 4PXCA 1XRYA 3KI9A 1VHOA 2PJ7A 4NGRA 3PB7X 2QJ8A 2IJZA 7CPAA 4WJBA 3FECA 2AFWA 5DS0A 3B3CA 2GREA 3PBBA 4P4EA 1TKJA 2XEGA 3CPAA 3IC1A 3GUXA 4IK2A 3B2YA 4P45A 2OOTA 3BXMA 1LAMA 4YWYA 2PE3A 1NSAA 3JRUA 4Z65A 3H8EA 3KHZA 4IAVA 3RAMA 2ZEGA 2V8GA 2BCOA 5ELYA 2PJCA 1TXRA 1F2OA 3WT4A 3BI0A 1YW4A 8CPAA 3BHXA 4MCPA 4UEZA 4WWVA 2Q4ZA 2C6GA 4OC3A 3D7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0R A;  1ZLH A;  3SJG A;  2PIY A;  2JEW A;  4YU9 A;  4EME A;  2NYQ A;  2ZEE A;  3CPX A;  3DGV A;  1BPM A;  3SJF A;  2ZED A;  1LOK A;  3FVL A;  2QVP A;  3GLJ A;  2F8H A;  4MCR A;  3KQZ A;  3D7D A;  2DEA A;  3B3V A;  2PJB A;  3D68 A;  4TNU A;  4NJR A;  3N5F A;  4DJL A;  5D8N A;  4ZI6 A;  4BD9 A;  5JGF A;  2AFO A;  4LQG A;  1RTQ A;  2O4H A;  2C6C A;  4NGQ A;  5K8M A;  4ZX9 A;  2C6P A;  4EFD A;  1FT7 A;  4OC1 A;  3NH5 A;  1HEE A;  5THW A;  4B6Z A;  1CP6 A;  3V7Z A;  4PXB A;  1Z8L A;  4KSI A;  1KWM A;  2JBK A;  3TX8 A;  4NGS A;  2PRQ A;  1BPN A;  4PXD A;  1AMP A;  3FX6 A;  3VAT A;  5LYL A;  4R6T A;  3RZA A;  4MCS A;  2GLJ A;  3SI0 A;  1YME A;  2POK A;  3IJ3 A;  3MRU A;  3H8F A;  4OP4 A;  3B35 A;  4X3R A;  1ZG8 A;  4NFR A;  1CPS A;  4OC2 A;  1CPX A;  2XEI A;  4P4J A;  1XMB A;  1QQ9 A;  2BOA A;  1CG2 A;  4X2T A;  4DYO A;  3FF3 A;  2ZEL A;  4MHN A;  5LYD A;  2AFX A;  4P4I A;  1LFW A;  2PIZ A;  3VAR A;  3PB8 X;  3T8W A;  1IGB A;  4JYW A;  3PRT A;  4MHZ A;  3D7F A;  1ARL A;  1GYT A;  2PJA A;  4Q7A A;  2PJ5 A;  2PJ6 A;  3K2K A;  3FEE A;  2HB6 A;  4UF4 A;  4R8F A;  5K8O A;  3NH4 A;  3PFE A;  5J1Q A;  2QYV A;  4PXE A;  5D29 A;  3IIB A;  3NFZ A;  3I1U A;  3KAS A;  3IEH A;  4A38 A;  3S9N A;  4MMO A;  5HVF A;  2EK9 A;  3SJX A;  1ELL P;  3KL9 A;  4JZ0 A;  4NJQ A;  3KR5 A;  4FAI A;  4OC5 A;  5HXD A;  1JQG A;  4R7M A;  1LAN A;  3FJU A;  4UIB A;  2AFS A;  3D4U A;  4P4D A;  4CPA A;  6CPA A;  5CPA A;  3S9M A;  2PJ9 A;  4ZYQ A;  1LCP A;  2ZOF A;  5HVG A;  3V38 A;  2EK8 A;  1Y0Y A;  2AFU A;  4TWE A;  4P10 A;  3SI2 A;  2PJ4 A;  1Z5R A;  1TF9 A;  2I3C A;  1OBR A;  1BAV A;  5JM6 A;  4ONW A;  2Q43 A;  1EE3 P;  2IMO A;  1PYT B;  5HVH A;  3ISX A;  5LRG A;  1CP7 A;  2BO9 A;  1LAP A;  4P44 A;  4F9U A;  4IHM A;  4P6Y A;  3IFE A;  3GB0 A;  4O23 A;  3FED A;  1YSJ A;  1Q7L A;  3B7I A;  3H8G A;  2IQ6 A;  4PPZ A;  1XBU A;  3QNV A;  2ZEH A;  4P4B A;  4RUH A;  4OIW A;  3KZW A;  1FNO A;  3RBU A;  1ELM P;  3CDX A;  2J9A A;  1BLL E;  3PFO A;  2ABZ A;  2ZEP A;  5K8P A;  5K8N A;  3PEI A;  4X8I A;  1YLO A;  3IWW A;  2PJ8 A;  2RB7 A;  2XEJ A;  2ZEM A;  3HUV A;  2AFM A;  3SI1 A;  2JBJ A;  4H2K A;  4ZY1 A;  1IY7 A;  2PJ1 A;  2HC9 A;  1TKF A;  2ANP A;  5F09 A;  4OC4 A;  2PJ3 A;  3BI1 A;  1TF8 A;  1H8L A;  1CX8 A;  3PB6 X;  3SJE A;  4ZY0 A;  4FUU A;  2PVV A;  4PQA A;  1R43 A;  3MN8 A;  4F8Z A;  2CF4 A;  3TC8 A;  3S9L A;  1Z2L A;  4NGN A;  2PJ0 A;  4MHP A;  4EWT A;  2O53 A;  3CT9 A;  4MXU A;  4P4F A;  3KHX A;  4A94 A;  2ZOG A;  1VGY A;  4NGP A;  1ZG9 A;  2EWB A;  1UWY A;  1CBX A;  2PVW A;  2CTC A;  3KQX A;  3D7G A;  3B3S A;  3KR4 A;  5LYF A;  2V8V A;  2G9D A;  3HLP A;  2PCU A;  3PBE A;  2ZEF A;  2Q51 A;  4F9V A;  3NA6 A;  1AYE A;  2WYR A;  1HDQ A;  4MCQ A;  3WC7 A;  4R76 A;  1R3N A;  3ISZ A;  3LWU A;  2C1C A;  5LRJ A;  4OME A;  1QMU A;  4ZY2 A;  4A37 A;  4MHY A;  2ZEN A;  4AXV A;  2PJ2 A;  1ARM A;  2RFH A;  3FH4 A;  1F2P A;  2XEF A;  3PB9 X;  3NH8 A;  2VL1 A;  5I4M A;  3KGQ A;  2ZEO A;  1XFO A;  1ZLI A;  3D67 A;  4NGM A;  1DE4 C;  2WZN A;  3WC6 A;  1XJO A;  4ZX8 A;  4UIA A;  5LYI A;  4DUK A;  4UEE A;  4UEF A;  3B3T A;  1Y7E A;  4OKO A;  4MRI A;  4A39 A;  1M4L A;  3L2N A;  1F57 A;  1VIX A;  4OC0 A;  2CIJ A;  3LMS A;  4W9Y A;  3WC5 A;  2GU2 A;  4NGT A;  3WAB A;  3DLJ A;  4FBE A;  2FVG A;  3D66 A;  2GLF A;  1VHE A;  2CTB A;  4GM5 A;  4G1P A;  5CBM A;  1YW6 A;  2NSM A;  4K3N A;  2OR4 A;  5LRK A;  3VH9 A;  1ZG7 A;  1TKH A;  1HDU A;  3B3W A;  3K9T A;  5IB9 A;  3PB4 X;  2V77 A;  1PCA A;  2AFZ A;  3FMC A;  2F7V A;  5JH9 A;  4FWU A;  2V8H A;  1DTD A;  4OID A;  2V8D A;  3IO1 A;  4PXC A;  1XRY A;  3KI9 A;  1VHO A;  2PJ7 A;  4NGR A;  3PB7 X;  2QJ8 A;  2IJZ A;  7CPA A;  4WJB A;  3FEC A;  2AFW A;  5DS0 A;  3B3C A;  2GRE A;  3PBB A;  4P4E A;  1TKJ A;  2XEG A;  3CPA A;  3IC1 A;  3GUX A;  4IK2 A;  3B2Y A;  4P45 A;  2OOT A;  3BXM A;  1LAM A;  4YWY A;  2PE3 A;  1NSA A;  3JRU A;  4Z65 A;  3H8E A;  3KHZ A;  4IAV A;  3RAM A;  2ZEG A;  2V8G A;  2BCO A;  5ELY A;  2PJC A;  1TXR A;  1F2O A;  3WT4 A;  3BI0 A;  1YW4 A;  8CPA A;  3BHX A;  4MCP A;  4UEZ A;  4WWV A;  2Q4Z A;  2C6G A;  4OC3 A;  3D7H A; 
#chains in the Genus database with same CATH topology
 4IF5 A;  2D4P A;  1Y0R A;  4Q36 A;  3VWE A;  2GFQ A;  2FS5 A;  1ZLH A;  3G8W A;  1YLE A;  3SJG A;  2PIY A;  1NE9 A;  2JEW A;  4YU9 A;  4AG9 A;  2NYQ A;  2ZEE A;  4B5O A;  4EME A;  3CPX A;  3RO0 A;  3DGV A;  2REF A;  4KSF A;  1OZP A;  1TIQ A;  1WWZ A;  1BPM A;  3SJF A;  3R9E A;  2ZED A;  5IB0 A;  1LOK A;  3FVL A;  4QBJ A;  2PR8 A;  3TOA A;  2QVP A;  3GLJ A;  2Q7S A;  4R3L A;  4UWI A;  2F8H A;  3EXN A;  4JXQ A;  4MCR A;  3KQZ A;  4RN7 A;  4B13 A;  3D7D A;  1X10 A;  2DEA A;  2PJB A;  3B3V A;  3JVN A;  1S3Z A;  3D68 A;  4TNU A;  3R1K A;  4NJR A;  4CRY B;  4GS4 A;  4UFW A;  3N5F A;  4KSA A;  4DJL A;  2OB0 A;  5D8N A;  4ZI6 A;  4BD9 A;  3EC4 A;  5DWM A;  1I1D A;  4MY3 A;  5JGF A;  2B4D B;  2AFO A;  3LOD A;  3QAY A;  4OAD A;  5EC4 A;  4LQG A;  2CXA A;  1RTQ A;  2O4H A;  2C6C A;  4CAF A;  4NGQ A;  5K8M A;  4MFZ A;  4ZX9 A;  4RS2 A;  2C6P A;  4KVM E;  4UBR A;  1PU9 A;  4EFD A;  1FT7 A;  2H5M A;  4MFQ A;  4OC1 A;  3NH5 A;  4CRZ B;  4B14 A;  2G3T A;  1HEE A;  4L8A A;  4AVB A;  3F5B A;  2QEC A;  1S60 A;  3GY9 A;  2BEI A;  1AUG A;  3NE7 A;  5THW A;  1VHS A;  4YFJ A;  4B6Z A;  3IU1 A;  1CP6 A;  1XOV A;  1Q2Y A;  3KKW A;  5BWA B;  5AG5 A;  3V7Z A;  2R1I A;  4PXB A;  1Z8L A;  1FY7 A;  2B5G A;  2P6G A;  1YVO A;  4KSI A;  1PUA A;  1KWM A;  1ON0 A;  4UWJ A;  2JBK A;  3TX8 A;  4A30 A;  1XMT A;  4NGS A;  2EUI A;  2PRQ A;  3FIX A;  1BPN A;  4PXD A;  2Q4Y A;  1AMP A;  3FX6 A;  2Z3P A;  4KOY A;  3VAT A;  5J8C A;  5LYL A;  4R6T A;  1XEB A;  5GCN A;  4MCS A;  4R57 A;  2DXQ A;  3RZA A;  2GLJ A;  5G22 A;  3SI0 A;  3C26 A;  1YME A;  4NF1 A;  1RO5 A;  2O28 A;  2POK A;  3IJ3 A;  3MRU A;  1IID A;  1B6B A;  3H8F A;  4OP4 A;  4Y49 C;  4A31 A;  1IU8 A;  3B35 A;  4X3R A;  1ZG8 A;  4NFR A;  1CPS A;  2DF5 A;  1Z4E A;  3R9F A;  4YRH A;  4OC2 A;  1CPX A;  3S6K A;  2XEI A;  3IWG A;  4X5K A;  4P4J A;  1XMB A;  3FBU A;  5JPH A;  1X12 A;  1P0H A;  2J8M A;  2Q7B A;  1QQ9 A;  2PR1 A;  2Z3M A;  2G0B A;  2BOA A;  4H6Z A;  3QB8 A;  2F5I A;  4KOS A;  1CG2 A;  4X2T A;  2Y0M A;  4DYO A;  3FF3 A;  1Z8T A;  2ZEL A;  4KOR A;  4MHN A;  5LYD A;  2VBQ A;  2Q4V A;  4MY0 A;  3FYN A;  1YRE A;  1M4D A;  2AFX A;  4P4I A;  1LFW A;  2PIZ A;  2P0W A;  2B5G B;  3VAR A;  1V0C A;  4CGM A;  3LD2 A;  3PB8 X;  3T8W A;  1IGB A;  4JYW A;  2OZG A;  4C68 A;  3PRT A;  2J8R A;  4MHZ A;  4MHD A;  3D7F A;  4ORF A;  1M4G A;  1ARL A;  1JWQ A;  4CAV A;  1GYT A;  4J3G A;  2PJA A;  4Q7A A;  2PJ5 A;  2PJ6 A;  3K2K A;  5KTC A;  3FEE A;  1XIX A;  2HB6 A;  4UF4 A;  1S7K A;  1SQH A;  4YGO A;  4R8F A;  5K8O A;  3NH4 A;  3PFE A;  5J8F A;  5J1Q A;  3FB3 A;  2QYV A;  3D2M A;  3D8P A;  4KS9 A;  4PXE A;  4MFK A;  3IIB A;  2YNC A;  2CY2 A;  5D29 A;  2FXF A;  3I1U A;  3NFZ A;  3KAS A;  3IEH A;  3R95 A;  2ZW5 A;  4A38 A;  3PGP A;  3S9N A;  4MMO A;  4M6G A;  2REE A;  5CNP A;  5HVF A;  2EK9 A;  3IGR A;  3SJX A;  1ELL P;  3KL9 A;  4FD4 A;  4JZ0 A;  2VZZ A;  3R96 A;  2Q44 A;  4KOU A;  4M6I A;  4NJQ A;  3KR5 A;  4CGP A;  4OC5 A;  4FAI A;  4UCP A;  2Z3N A;  2EBJ A;  5HXD A;  2JLM A;  3DSB A;  4KLV A;  5F48 A;  1UFH A;  2GAN A;  1XE4 A;  1JQG A;  1S7N A;  2Z0Z A;  4R7M A;  1LAN A;  2A4N A;  1IOI A;  1QSN A;  4KVX A;  3FJU A;  4UIB A;  2Z10 A;  4L89 A;  2AFS A;  2OZH A;  3D4U A;  4P4D A;  5HH1 A;  4CPA A;  6CPA A;  1WK4 A;  3RYO A;  1Y9W A;  2VEZ A;  5IV0 A;  5CPA A;  1GHE A;  3S9M A;  1MJ9 A;  4JLY A;  5G20 A;  2PJ9 A;  4ZYQ A;  1LCP A;  2YGW A;  2ZOF A;  5HVG A;  4IUS A;  3V38 A;  2EK8 A;  1Y0Y A;  2AFU A;  4KOV A;  4TWE A;  4P10 A;  3RNZ A;  3GYA A;  5E96 A;  3SI2 A;  2PJ4 A;  2I00 A;  1TF9 A;  1Z4R A;  1Z5R A;  2I3C A;  1YR0 A;  1OBR A;  5AG4 A;  1BAV A;  2ZXV A;  2FE7 A;  1Q2C A;  1K4J A;  4ONW A;  5JM6 A;  4I49 A;  2Q43 A;  5ISV A;  1EE3 P;  2IMO A;  1PYT B;  5HVH A;  3EFA A;  3ISX A;  2FCK A;  5LRG A;  4NXY A;  1CP7 A;  3FXT A;  4LX9 A;  2BO9 A;  1RXT A;  4C2Y A;  1LAP A;  4P44 A;  5KTA A;  1M4I A;  4F9U A;  4IHM A;  4P6Y A;  3IFE A;  3T90 A;  3GB0 A;  4O23 A;  2C27 A;  1QSR A;  4CAE A;  2VQY A;  3N7Z A;  3FED A;  1YSJ A;  3BJ7 A;  5JQ4 A;  1Q7L A;  3B7I A;  1M44 A;  1KUV A;  2IQ6 A;  1NMT A;  2ODF A;  3H8G A;  4GXH A;  4MFP A;  4PPZ A;  3TO9 A;  2G3A A;  3I9S A;  4H89 A;  1XBU A;  4LUA A;  3QNV A;  2ZEH A;  4K30 A;  4P4B A;  3CXP A;  4H6U A;  2BSW A;  2JDD A;  4MJ8 A;  5H86 A;  3TO6 A;  3NE8 A;  3P2F A;  1BOB A;  1N71 A;  2YND A;  4RUH A;  4OIW A;  3KZW A;  3B8G A;  3P2H A;  2BL1 A;  1Y9K A;  1I21 A;  4NSQ A;  2HQY A;  1FNO A;  4HNX B;  2RC4 A;  2VXK A;  3RBU A;  1KUX A;  4XPD C;  1ELM P;  3CDX A;  4E0A A;  2J9A A;  1BLL E;  4CGN A;  4C7I A;  3PFO A;  2ABZ A;  5C88 A;  2ZEP A;  1IB1 E;  5K8P A;  4E8O A;  3BLN A;  3BJ8 A;  2CNT A;  5K8N A;  3PEI A;  4X8I A;  3EO4 A;  2CNM A;  4UFV A;  1YLO A;  3IWW A;  2PJ8 A;  2FIA A;  2RB7 A;  2Z3K A;  2XEJ A;  2ZEM A;  3JTK A;  4EVY A;  3HUV A;  4KUA A;  4Q38 A;  2AFM A;  5FVJ A;  3SI1 A;  5A28 A;  2X7B A;  3W6X A;  2OH1 A;  2JBJ A;  4H2K A;  3H5Z A;  4ZY1 A;  2EVN A;  1IY7 A;  2PJ1 A;  2HC9 A;  1TKF A;  1S7L A;  2ANP A;  1A2Z A;  5AG7 A;  4OC4 A;  5F09 A;  1S7F A;  4DNC A;  4AVA A;  3IWE A;  2PJ3 A;  1U6M A;  3BI1 A;  4R9M A;  4XNH C;  2QML A;  4BMH A;  5IX3 A;  3QAH A;  4A32 A;  1QSM A;  1BO4 A;  4B5P A;  1TF8 A;  1H8L A;  4PSW A;  3W91 A;  1CX8 A;  3DNS A;  2P6F A;  3PB6 X;  3SJE A;  4KOT A;  3TTH A;  4ZY0 A;  4FUU A;  2PVV A;  4PQA A;  4F0Y A;  1R43 A;  4CAX A;  3IU2 A;  1MJA A;  4R3K A;  1IIC A;  5C82 A;  4KUB A;  4KLW A;  1M1D A;  2R98 A;  4M3S A;  4BIN A;  5F46 A;  1LRZ A;  4U5Y A;  3FRM A;  3MN8 A;  5A27 A;  4F8Z A;  4QC6 A;  4E2A A;  3CXS A;  2CF4 A;  3K9U A;  3TC8 A;  4BBH A;  3S9L A;  4JJX A;  1Z2L A;  4NGN A;  2ZPA A;  2BUE A;  2PJ0 A;  3G3S A;  1QSO A;  4MHP A;  2O53 A;  3TO7 A;  4EWT A;  4QVT A;  2PRB A;  3GKR A;  4KOW A;  3CT9 A;  4KOX A;  4MXU A;  4P4F A;  1MJB A;  4PV6 A;  3KHX A;  4KVO E;  2J8N A;  3TOB A;  2QIR A;  4A94 A;  1ZO0 A;  2ZOG A;  2Z3L A;  1J4J A;  3H4Q A;  3I3G A;  4JXR A;  4NCZ A;  4B11 A;  5EBV A;  2B4B A;  2ZW7 A;  1VGY A;  4OLL A;  1QST A;  2Q0Y A;  5F49 A;  4MI4 A;  3V8I A;  4A2Z A;  2FL4 A;  1IOF A;  4NGP A;  1VKC A;  1ZG9 A;  4XPK A;  3SXO A;  3MGD A;  4OAE A;  2EWB A;  1UWY A;  1CBX A;  4CS0 B;  2PVW A;  4C7H A;  2CTC A;  3KQX A;  1YX0 A;  1B87 A;  2WSA A;  3B3S A;  3D7G A;  3KR4 A;  3S6G A;  4AVC A;  5LYF A;  2V8V A;  4AB7 A;  4B5P B;  1KUY A;  3DR8 A;  2G9D A;  3HLP A;  2PCU A;  3PBE A;  1XF8 A;  2HV2 A;  4MBU A;  3SHP A;  2ZEF A;  5AGE A;  3D3S A;  1Z9U A;  2Q51 A;  4B12 A;  2OU2 A;  4F9V A;  2B58 A;  3NA6 A;  1AYE A;  1Q2D A;  2WYR A;  1HDQ A;  4MCQ A;  2B3V A;  3WC7 A;  3R9G A;  4R76 A;  1R3N A;  3ISZ A;  3LWU A;  2C1C A;  5DWN A;  5G1Z A;  3F8K A;  2I79 A;  2PDO A;  3CZX A;  5LRJ A;  2GE3 A;  1QMU A;  4OME A;  4ZY2 A;  4A37 A;  4MHY A;  4CYO A;  1MK4 A;  2ZEN A;  4QB9 A;  4AXV A;  2PJ2 A;  1ARM A;  2RFH A;  3CXQ A;  3FH4 A;  4PK3 A;  3S6F A;  3UY5 A;  1F2P A;  4U9Y A;  2PC1 A;  2XEF A;  5H84 A;  1Y7R A;  3PB9 X;  4HPS A;  3NH8 A;  2VL1 A;  5I4M A;  2ARH A;  4ZBG A;  1CJW A;  3GIU A;  3KGQ A;  2ZEO A;  1XFO A;  1ZLI A;  2FSR A;  3D67 A;  4HKF A;  3TCV A;  4NGM A;  3TT2 A;  1DE4 C;  2WZN A;  3WC6 A;  1YGH A;  4RI1 A;  1XJO A;  4ZX8 A;  4UIA A;  2ATR A;  5LYI A;  4DUK A;  2DPS A;  3PP9 A;  4UEE A;  1R57 A;  2WPX A;  1Y7E A;  3B3T A;  4UEF A;  4OKO A;  3OWC A;  4MRI A;  1Z8W A;  4MFJ A;  4A39 A;  1M4L A;  3L2N A;  1F57 A;  1VIX A;  2R8V A;  4HNY B;  2KCW A;  4A33 A;  4OC0 A;  4MFL A;  1S5K A;  2CIJ A;  4XPL A;  3LMS A;  1P4N A;  4W9Y A;  3WC5 A;  3TE4 A;  2GU2 A;  2CNS A;  4R87 A;  4NGT A;  5F47 A;  4II9 A;  4M6H A;  3DLJ A;  3WAB A;  2GIV A;  4FBE A;  2FVG A;  3D66 A;  2GLF A;  1VHE A;  2FIW A;  2CTB A;  4LQ6 A;  4GM5 A;  4G1P A;  5CBM A;  2HUZ A;  1YW6 A;  2NMT A;  2NSM A;  4K3N A;  2OR4 A;  2FT0 A;  5LRK A;  3VH9 A;  1ZG7 A;  1TKH A;  1NSL A;  1HDU A;  4CGO A;  3B3W A;  3T9Y A;  3K9T A;  4A95 A;  5IB9 A;  3PB4 X;  3S6H A;  4F0X A;  2V77 A;  1IYL A;  4CYP A;  1PCA A;  2K5T A;  4B10 A;  3F0A A;  2AFZ A;  4UCM A;  3FMC A;  2F7V A;  4NEX A;  3TFY A;  2OZU A;  4ONU A;  3WR7 A;  4CYN A;  5JH9 A;  2DPT A;  4FWU A;  2V8H A;  1DTD A;  4OID A;  4PK2 A;  4C2X A;  2V8D A;  3D2P A;  3VWD A;  1Z8X A;  2Z11 A;  1IYK A;  3IO1 A;  4PXC A;  1XRY A;  3KI9 A;  1VHO A;  4FD5 A;  2PJ7 A;  4NGR A;  2VZY A;  1YQE A;  3PB7 X;  4JD6 A;  3PZJ A;  2QJ8 A;  2P6E A;  2R7H A;  1I12 A;  2IJZ A;  3ZJ0 A;  2JEV A;  5KTD A;  7CPA A;  2Q04 A;  3FNC A;  4WJB A;  3FEC A;  1YK3 A;  1L0C A;  4UA3 A;  2VI7 A;  2AFW A;  2IL4 A;  5DS0 A;  3B3C A;  4JWP A;  3EY5 A;  4ZGY B;  2GRE A;  2Z3O A;  4CYQ A;  3PBB A;  4P4E A;  1TKJ A;  4XPD B;  5I0C A;  3E0K A;  4HNW B;  4U9Z A;  2XEG A;  3CPA A;  4F6A A;  3IC1 A;  3LAC A;  3GUX A;  5EMI A;  1KZF A;  1YVK A;  4CGL A;  4Y49 B;  2PQ8 A;  3JUW A;  4IK2 A;  3B2Y A;  4FD6 A;  2AE6 A;  3DR6 A;  4P45 A;  2OOT A;  3BXM A;  1LAM A;  4YWY A;  2PE3 A;  1NSA A;  2WPW A;  3JRU A;  4KZT A;  4Z65 A;  4M85 A;  3SXN A;  3A9L A;  4C2Z A;  4CAW A;  2YNE A;  2AJ6 A;  2D4O A;  1CM0 A;  2ZW6 A;  3H8E A;  3KHZ A;  4IAV A;  3RAM A;  4AG7 A;  2WUU A;  2ZEG A;  2PSW A;  2V8G A;  4QUS A;  2BCO A;  2B3U A;  2YNC C;  5ELY A;  2B4D A;  5AG6 A;  3ZZI A;  4XNH B;  2PJC A;  1TXR A;  1F2O A;  5HMN A;  2ZW4 A;  2JDC A;  4FD7 A;  4PSX A;  3WT4 A;  3BI0 A;  1YW4 A;  2EO8 A;  8CPA A;  3BHX A;  4MCP A;  4UEZ A;  3DDD A;  4UCN A;  4WWV A;  5G21 A;  3W6S A;  2Q4Z A;  2C6G A;  4UFX A;  4OC3 A;  3D7H A; 
#chains in the Genus database with same CATH homology
 1Y0R A;  1ZLH A;  3SJG A;  2PIY A;  2JEW A;  4YU9 A;  4EME A;  2NYQ A;  2ZEE A;  3CPX A;  3DGV A;  1BPM A;  3SJF A;  2ZED A;  1LOK A;  3FVL A;  2QVP A;  3GLJ A;  2F8H A;  4MCR A;  3KQZ A;  3D7D A;  2DEA A;  3B3V A;  2PJB A;  3D68 A;  4TNU A;  4NJR A;  3N5F A;  4DJL A;  5D8N A;  4ZI6 A;  4BD9 A;  5JGF A;  2AFO A;  4LQG A;  1RTQ A;  2O4H A;  2C6C A;  4NGQ A;  5K8M A;  4ZX9 A;  2C6P A;  4EFD A;  1FT7 A;  4OC1 A;  3NH5 A;  1HEE A;  5THW A;  4B6Z A;  1CP6 A;  3V7Z A;  4PXB A;  1Z8L A;  4KSI A;  1KWM A;  2JBK A;  3TX8 A;  4NGS A;  2PRQ A;  1BPN A;  4PXD A;  1AMP A;  3FX6 A;  3VAT A;  5LYL A;  4R6T A;  3RZA A;  4MCS A;  2GLJ A;  3SI0 A;  1YME A;  2POK A;  3IJ3 A;  3MRU A;  3H8F A;  4OP4 A;  3B35 A;  4X3R A;  1ZG8 A;  4NFR A;  1CPS A;  4OC2 A;  1CPX A;  2XEI A;  4P4J A;  1XMB A;  1QQ9 A;  2BOA A;  1CG2 A;  4X2T A;  4DYO A;  3FF3 A;  2ZEL A;  4MHN A;  5LYD A;  2AFX A;  4P4I A;  1LFW A;  2PIZ A;  3VAR A;  3PB8 X;  3T8W A;  1IGB A;  4JYW A;  3PRT A;  4MHZ A;  3D7F A;  1ARL A;  1GYT A;  2PJA A;  4Q7A A;  2PJ5 A;  2PJ6 A;  3K2K A;  3FEE A;  2HB6 A;  4UF4 A;  4R8F A;  5K8O A;  3NH4 A;  3PFE A;  5J1Q A;  2QYV A;  4PXE A;  5D29 A;  3IIB A;  3NFZ A;  3I1U A;  3KAS A;  3IEH A;  4A38 A;  3S9N A;  4MMO A;  5HVF A;  2EK9 A;  3SJX A;  1ELL P;  3KL9 A;  4JZ0 A;  4NJQ A;  3KR5 A;  4FAI A;  4OC5 A;  5HXD A;  1JQG A;  4R7M A;  1LAN A;  3FJU A;  4UIB A;  2AFS A;  3D4U A;  4P4D A;  4CPA A;  6CPA A;  5CPA A;  3S9M A;  2PJ9 A;  4ZYQ A;  1LCP A;  2ZOF A;  5HVG A;  3V38 A;  2EK8 A;  1Y0Y A;  2AFU A;  4TWE A;  4P10 A;  3SI2 A;  2PJ4 A;  1Z5R A;  1TF9 A;  2I3C A;  1OBR A;  1BAV A;  5JM6 A;  4ONW A;  2Q43 A;  1EE3 P;  2IMO A;  1PYT B;  5HVH A;  3ISX A;  5LRG A;  1CP7 A;  2BO9 A;  1LAP A;  4P44 A;  4F9U A;  4IHM A;  4P6Y A;  3IFE A;  3GB0 A;  4O23 A;  3FED A;  1YSJ A;  1Q7L A;  3B7I A;  3H8G A;  2IQ6 A;  4PPZ A;  1XBU A;  3QNV A;  2ZEH A;  4P4B A;  4RUH A;  4OIW A;  3KZW A;  1FNO A;  3RBU A;  1ELM P;  3CDX A;  2J9A A;  1BLL E;  3PFO A;  2ABZ A;  2ZEP A;  5K8P A;  5K8N A;  3PEI A;  4X8I A;  1YLO A;  3IWW A;  2PJ8 A;  2RB7 A;  2XEJ A;  2ZEM A;  3HUV A;  2AFM A;  3SI1 A;  2JBJ A;  4H2K A;  4ZY1 A;  1IY7 A;  2PJ1 A;  2HC9 A;  1TKF A;  2ANP A;  5F09 A;  4OC4 A;  2PJ3 A;  3BI1 A;  1TF8 A;  1H8L A;  1CX8 A;  3PB6 X;  3SJE A;  4ZY0 A;  4FUU A;  2PVV A;  4PQA A;  1R43 A;  3MN8 A;  4F8Z A;  2CF4 A;  3TC8 A;  3S9L A;  1Z2L A;  4NGN A;  2PJ0 A;  4MHP A;  4EWT A;  2O53 A;  3CT9 A;  4MXU A;  4P4F A;  3KHX A;  4A94 A;  2ZOG A;  1VGY A;  4NGP A;  1ZG9 A;  2EWB A;  1UWY A;  1CBX A;  2PVW A;  2CTC A;  3KQX A;  3D7G A;  3B3S A;  3KR4 A;  5LYF A;  2V8V A;  2G9D A;  3HLP A;  2PCU A;  3PBE A;  2ZEF A;  2Q51 A;  4F9V A;  3NA6 A;  1AYE A;  2WYR A;  1HDQ A;  4MCQ A;  3WC7 A;  4R76 A;  1R3N A;  3ISZ A;  3LWU A;  2C1C A;  5LRJ A;  4OME A;  1QMU A;  4ZY2 A;  4A37 A;  4MHY A;  2ZEN A;  4AXV A;  2PJ2 A;  1ARM A;  2RFH A;  3FH4 A;  1F2P A;  2XEF A;  3PB9 X;  3NH8 A;  2VL1 A;  5I4M A;  3KGQ A;  2ZEO A;  1XFO A;  1ZLI A;  3D67 A;  4NGM A;  1DE4 C;  2WZN A;  3WC6 A;  1XJO A;  4ZX8 A;  4UIA A;  5LYI A;  4DUK A;  4UEE A;  4UEF A;  3B3T A;  1Y7E A;  4OKO A;  4MRI A;  4A39 A;  1M4L A;  3L2N A;  1F57 A;  1VIX A;  4OC0 A;  2CIJ A;  3LMS A;  4W9Y A;  3WC5 A;  2GU2 A;  4NGT A;  3WAB A;  3DLJ A;  4FBE A;  2FVG A;  3D66 A;  2GLF A;  1VHE A;  2CTB A;  4GM5 A;  4G1P A;  5CBM A;  1YW6 A;  2NSM A;  4K3N A;  2OR4 A;  5LRK A;  3VH9 A;  1ZG7 A;  1TKH A;  1HDU A;  3B3W A;  3K9T A;  5IB9 A;  3PB4 X;  2V77 A;  1PCA A;  2AFZ A;  3FMC A;  2F7V A;  5JH9 A;  4FWU A;  2V8H A;  1DTD A;  4OID A;  2V8D A;  3IO1 A;  4PXC A;  1XRY A;  3KI9 A;  1VHO A;  2PJ7 A;  4NGR A;  3PB7 X;  2QJ8 A;  2IJZ A;  7CPA A;  4WJB A;  3FEC A;  2AFW A;  5DS0 A;  3B3C A;  2GRE A;  3PBB A;  4P4E A;  1TKJ A;  2XEG A;  3CPA A;  3IC1 A;  3GUX A;  4IK2 A;  3B2Y A;  4P45 A;  2OOT A;  3BXM A;  1LAM A;  4YWY A;  2PE3 A;  1NSA A;  3JRU A;  4Z65 A;  3H8E A;  3KHZ A;  4IAV A;  3RAM A;  2ZEG A;  2V8G A;  2BCO A;  5ELY A;  2PJC A;  1TXR A;  1F2O A;  3WT4 A;  3BI0 A;  1YW4 A;  8CPA A;  3BHX A;  4MCP A;  4UEZ A;  4WWV A;  2Q4Z A;  2C6G A;  4OC3 A;  3D7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...