3B35A

Crystal structure of the m180a mutant of the aminopeptidase from vibrio proteolyticus
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDATNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
publication title Zinc coordination geometry and ligand binding affinity: the structural and kinetic analysis of the second-shell serine 228 residue and the methionine 180 residue of the aminopeptidase from Vibrio proteolyticus.
pubmed doi rcsb
source organism Vibrio proteolyticus
molecule tags Hydrolase
total genus 119
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2007-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3b35A00
3SI0A 2NSMA 4CPAA 1UWYA 5J1QA 4A38A 1XJOA 2F7VA 1XFOA 4NGRA 4UF4A 4OC1A 1HDUA 1BPMA 4ZY0A 1LANA 1CPXA 3B3CA 3T8WA 4PQAA 2PJ3A 2ZEFA 4FAIA 3WABA 3SJXA 1ARLA 2NYQA 3V7ZA 5K8PA 2XEGA 4A94A 4OC4A 1XBUA 3RAMA 4FBEA 3FEDA 1QQ9A 3IIBA 4UEEA 1BLLE 1AMPA 1PCAA 1Y0YA 1ZG9A 2AFSA 4F9VA 2PVVA 3H8FA 2RB7A 2XEJA 4NGQA 3WC7A 1KWMA 2ABZA 2O4HA 3GLJA 4EWTA 4LQGA 4KSIA 4OIDA 3FMCA 2CF4A 2PJ0A 3WC5A 5ELYA 2CTCA 3B7IA 4MHYA 2WZNA 4X3RA 2V77A 4JYWA 5LRGA 2GU2A 3CPAA 1CP7A 2QYVA 3NH4A 2OOTA 1VGYA 2AFOA 4NJRA 4G1PA 2IJZA 3KR4A 2V8GA 4P6YA 1CG2A 2ZEMA 3S9NA 5HVFA 5LRKA 2ZENA 3SI2A 5JM6A 2AFXA 3B3SA 2AFUA 3KR5A 5HVGA 4OC0A 4PXDA 3D68A 2ZEOA 4UIBA 3KQZA 3ISZA 4K3NA 4OKOA 2ZEPA 5K8NA 3BI0A 3SI1A 2ZEHA 1R43A 4P4DA 2GLFA 5HXDA 1Y0RA 1PYTB 2ZEEA 1TXRA 3H8EA 2Q4ZA 3DGVA 2BO9A 3B2YA 3QNVA 3RBUA 3FH4A 4NJQA 4OC2A 1XRYA 3KL9A 3WT4A 3D7GA 5D29A 2JEWA 5F09A 1HDQA 2Q43A 5D8NA 3VH9A 2PJ8A 2OR4A 3KHZA 3SJGA 2ZOFA 3IJ3A 3JRUA 5K8OA 4A37A 2EWBA 2C1CA 2ZEDA 3GUXA 3CPXA 1F2OA 5LYIA 2PJBA 4ZX8A 1IY7A 1OBRA 1ZLHA 4JZ0A 4OMEA 3K2KA 3D66A 3FX6A 3NH5A 8CPAA 4DJLA 5LYLA 3VATA 2PJ7A 1F2PA 4P4JA 1GYTA 4R6TA 1YW4A 1FNOA 4O23A 1DE4C 3MN8A 1Q7LA 3PB7X 2PJ6A 2PJ1A 1AYEA 5JGFA 2VL1A 3GB0A 3FECA 4MHNA 4IHMA 1ZLIA 3NA6A 2V8HA 3D7DA 4OC5A 1CBXA 2XEIA 2FVGA 2CTBA 4BD9A 2PJCA 2BOAA 2I3CA 4H2KA 4PPZA 1CPSA 2EK8A 4ONWA 4UEZA 3BXMA 4IK2A 4IAVA 2IMOA 3KZWA 5JH9A 4MCRA 1LAPA 2QVPA 1ZG8A 2DEAA 2ZEGA 3ISXA 2JBKA 3D7HA 2QJ8A 2PCUA 1DTDA 3WC6A 1TF9A 4B6ZA 2ZELA 3S9LA 4NGTA 5LYFA 2PJAA 1LFWA 3KASA 7CPAA 4X2TA 4R76A 1M4LA 1VHOA 2PJ9A 1Z5RA 2JBJA 3N5FA 3NFZA 4GM5A 1YLOA 2AFWA 4MHZA 6CPAA 1BPNA 1CX8A 2PE3A 3PEIA 3IC1A 1ARMA 1Y7EA 2C6GA 1JQGA 3LWUA 3TC8A 3CDXA 4P4BA 4NGMA 3D4UA 3IWWA 1LAMA 2PVWA 3PFOA 4P4EA 2Q51A 2WYRA 4ZY2A 3D67A 3H8GA 4TWEA 2XEFA 2EK9A 1R3NA 4DYOA 2RFHA 2PJ2A 3PB8X 3KGQA 3PB4X 3SJFA 4MHPA 2HB6A 4P45A 3IFEA 4Q7AA 4MXUA 3PBEA 4TNUA 3IEHA 3RZAA 2ZOGA 3MRUA 5THWA 2POKA 4FUUA 1IGBA 1EE3P 1TF8A 1CP6A 1VIXA 1TKFA 2F8HA 5I4MA 2CIJA 2PRQA 4NGPA 2G9DA 4OC3A 4NFRA 4ZI6A 4W9YA 4UIAA 1H8LA 3K9TA 4MCQA 3CT9A 1Z2LA 1QMUA 4ZY1A 2ANPA 5LRJA 3FEEA 3FJUA 4OP4A 4R8FA 4OIWA 1TKHA 4R7MA 3FF3A 4WJBA 2PIYA 3PB9X 4FWUA 2PIZA 3TX8A 3V38A 5HVHA 2PJ4A 3KHXA 2IQ6A 4WWVA 3HLPA 3NH8A 2GREA 2AFZA 2AFMA 4AXVA 3B3TA 3I1UA 1HEEA 1YSJA 1LCPA 3B35A 5DS0A 4A39A 2GLJA 1FT7A 3PBBA 3KQXA 4F9UA 1TKJA 3B3WA 2C6PA 3PRTA 4EFDA 4F8ZA 4YWYA 4MCPA 1YMEA 4P4FA 2BCOA 2V8DA 4ZYQA 1RTQA 4NGSA 4ZX9A 4P4IA 4PXBA 3B3VA 3BHXA 3D7FA 4P10A 3SJEA 3KI9A 4X8IA 1ELLP 5LYDA 1Z8LA 4MRIA 4MCSA 4P44A 1VHEA 1ZG7A 4UEFA 1YW6A 5CPAA 4EMEA 4PXCA 3DLJA 4RUHA 3PB6X 2J9AA 3BI1A 1BAVA 1ELMP 3PFEA 2O53A 3S9MA 4Z65A 1XMBA 2C6CA 3VARA 1LOKA 3IO1A 4NGNA 2PJ5A 3LMSA 5K8MA 3HUVA 4MMOA 2HC9A 1NSAA 2V8VA 5IB9A 4PXEA 4DUKA 4YU9A 1F57A 5CBMA 3FVLA 3L2NA
chains in the Genus database with same CATH superfamily
3SI0A 2NSMA 4CPAA 1UWYA 1XE4A 4A38A 5J1QA 1XJOA 2F7VA 3D8PA 1XFOA 4NGRA 1I21A 4UF4A 4B10A 4OC1A 1HDUA 1M4IA 1BPMA 4ZY0A 1LANA 3TE4A 1KZFA 5AG7A 1CPXA 4UCMA 2QMLA 3B3CA 2VQYA 4KORA 3T8WA 4PQAA 2PDOA 2HUZA 2PJ3A 5F49A 2P6FA 1XEBA 4KOSA 1M44A 2ZEFA 4ORFA 1QSNA 4FAIA 2ATRA 3JVNA 3P2HA 5AG5A 3WABA 4AG9A 3SXOA 2EVNA 1S7FA 3SJXA 4F0YA 1ARLA 3PP9A 2NYQA 4JLYA 3V7ZA 5K8PA 1M4DA 2XEGA 4A94A 4OC4A 1XBUA 2OB0A 3P2FA 3RAMA 2QECA 4FBEA 3FEDA 1QQ9A 1QSMA 4KZTA 4UBRA 3R9FA 5IB0A 4XNHB 3IIBA 1AUGA 1Z8XA 2B4DA 1Z8TA 4UEEA 2YNCC 4A95A 2FSRA 1BLLE 4KSAA 1AMPA 5G22A 3QAHA 4CYOA 3EFAA 4JJXA 3T90A 1PCAA 1Y0YA 1ZG9A 2AFSA 2VBQA 3TO6A 4F9VA 4KOXA 4M85A 2PVVA 3H8FA 2RB7A 2XEJA 3TO7A 4BMHA 4NGQA 3FNCA 1BOBA 3VWDA 1P0HA 3WC7A 3KKWA 4KLVA 1KWMA 2ABZA 2Z10A 4B5PB 1Z8WA 2O4HA 4C68A 3GLJA 1S60A 1JWQA 4EWTA 4LQGA 3F8KA 4KSIA 4OIDA 3FMCA 1YQEA 2CF4A 2Q0YA 5EMIA 2PJ0A 4OLLA 3WC5A 3D2MA 5F48A 2DPTA 5HMNA 3FBUA 5ELYA 1Z4RA 4MFKA 1Q2CA 2CTCA 2FE7A 3B7IA 1CJWA 4MHYA 1K4JA 2FCKA 2WZNA 4CGPA 4X3RA 2V77A 4JYWA 2OZHA 5LRGA 2GU2A 3RNZA 2ZPAA 3CPAA 1CP7A 1RO5A 2B5GA 2QYVA 3PGPA 3NH4A 2RC4A 2OOTA 1VGYA 2AFOA 4NJRA 3IWEA 2P6EA 3K9UA 4YRHA 2BEIA 4G1PA 2IJZA 2REEA 3KR4A 2V8GA 4KLWA 4P6YA 4Q36A 2WPWA 1CG2A 1UFHA 2ZEMA 4CS0B 3S9NA 5HVFA 5LRKA 4C7IA 4PV6A 1CM0A 2ARHA 2ZENA 2ZW5A 2P6GA 3SI2A 3JTKA 3W6XA 1J4JA 4NEXA 3PZJA 4M3SA 4PSXA 5JM6A 4AB7A 4ZGYB 1YK3A 4XNHC 3IU2A 2AFXA 4CAXA 3B3SA 4A33A 4CAFA 1OZPA 2AFUA 2F5IA 1PU9A 3KR5A 3R96A 5HVGA 2GFQA 2DPSA 3S6HA 4B13A 4FD6A 4OC0A 4PXDA 3QAYA 3D68A 3TOAA 2Z3MA 2ZEOA 4UIBA 2DF5A 3KQZA 3ISZA 1MJ9A 2JDCA 4OADA 2ZW6A 4K3NA 4OKOA 2ZEPA 3CXSA 5K8NA 4Y49B 3GIUA 3BI0A 3TCVA 1KUXA 4CRYB 3SI1A 1Q2DA 1QSRA 2ZEHA 2WUUA 2FT0A 3FIXA 2BSWA 4KOUA 1R43A 4P4DA 4MI4A 2GLFA 2Q04A 4AG7A 5HXDA 4JWPA 1Y0RA 1X10A 1PYTB 4KOYA 1M1DA 1KUVA 1KUYA 2ZEEA 1TXRA 3H8EA 4NSQA 1IYLA 2Q4ZA 4R57A 3DGVA 2PR1A 4B11A 3SHPA 1Y9WA 4UA3A 1XIXA 2BO9A 3B2YA 3QNVA 3RBUA 2B3VA 3BJ8A 4Q38A 3FH4A 4NJQA 1WK4A 4OC2A 1XRYA 1NE9A 4IF5A 3KL9A 3R9GA 4HPSA 3D7GA 5D29A 5F47A 4H6ZA 3SXNA 2JEWA 3WT4A 1N71A 3TTHA 1HDQA 2Q43A 3CZXA 5D8NA 5F09A 3IU1A 3EY5A 3VH9A 4CRZB 2REFA 4GS4A 4RI1A 2PJ8A 2CNSA 3R9EA 3DR8A 2OR4A 2Z3OA 3F5BA 1P4NA 2Z0ZA 3KHZA 3SJGA 2Q7SA 2ZOFA 5H86A 3IJ3A 1X12A 3JRUA 5K8OA 4A37A 1IIDA 1Y9KA 2EWBA 5F46A 2C1CA 2Y0MA 2ZEDA 4OAEA 2WPXA 4BBHA 3DSBA 2D4PA 5E96A 3GUXA 1V0CA 3CPXA 1F2OA 1B87A 5LYIA 1IB1E 2PSWA 1A2ZA 4FD5A 4PK2A 1MJBA 2PJBA 4ZX8A 1IY7A 1OBRA 2EBJA 1ZLHA 4JZ0A 4OMEA 4KVXA 2X7BA 3K2KA 3D66A 1Q2YA 3FX6A 5GCNA 4M6HA 4II9A 1NMTA 3NH5A 4U9ZA 4KOTA 8CPAA 4DJLA 4AVBA 5LYLA 1IOIA 4A31A 2VXKA 3VATA 5AGEA 2Z3NA 4KOWA 2PJ7A 1F2PA 4UWIA 4B5PA 4P4JA 1GYTA 4R6TA 1YW4A 4E2AA 1FNOA 4A2ZA 4O23A 1IYKA 1DE4C 3MN8A 1Z9UA 2CNMA 1Q7LA 3FB3A 3PB7X 2PJ6A 4F0XA 2FS5A 2PJ1A 1AYEA 1SQHA 5JGFA 1YREA 1VHSA 3VWEA 2VL1A 2JEVA 3D3SA 3GB0A 3I3GA 3FECA 4MHNA 3DDDA 3FRMA 2R98A 3TT2A 5C88A 4IHMA 1ZLIA 3NA6A 4E8OA 2VEZA 1ZO0A 4ZBGA 2V8HA 3D7DA 4CYNA 2J8RA 5IX3A 4OC5A 1CBXA 2XEIA 2FVGA 4XPDB 2CTBA 1S7KA 2BL1A 5KTCA 2J8NA 4BD9A 2PJCA 4X5KA 2BOAA 2I3CA 4H2KA 4A32A 4UWJA 4PPZA 2CNTA 4UFVA 1PUAA 5J8CA 4R87A 4MFPA 2PRBA 1CPSA 4DNCA 2OZGA 2EK8A 4ONUA 4ONWA 4UEZA 3V8IA 1S5KA 4UCNA 3BXMA 4IK2A 3UY5A 1MK4A 4IAVA 1RXTA 4J3GA 3WR7A 4CGMA 2K5TA 4KS9A 4FD7A 2IMOA 1XMTA 1YLEA 3KZWA 5JH9A 2GE3A 4MCRA 1LAPA 2ZXVA 2QVPA 2PR8A 1ZG8A 2DEAA 2OZUA 2ZEGA 3ISXA 4IUSA 3ZJ0A 4CAEA 2JBKA 3D7HA 2KCWA 4YGOA 3W6SA 3CXPA 2QJ8A 3S6GA 4QC6A 2PCUA 4JXQA 1DTDA 4LX9A 1TF9A 3I9SA 3WC6A 4B6ZA 1XF8A 2A4NA 2Q4VA 2ZELA 3H5ZA 3H4QA 4RN7A 3S9LA 3EC4A 2OH1A 2BUEA 4NGTA 2FL4A 5LYFA 2PJAA 1LFWA 3KASA 4R3KA 2HV2A 3G8WA 3N7ZA 7CPAA 4X2TA 4R76A 1ON0A 1M4LA 1M4GA 3EO4A 1VHOA 3W91A 2PJ9A 4NCZA 1Z5RA 2JBJA 3N5FA 4KVME 2YNEA 3NFZA 4JD6A 4GM5A 4HNXB 1YLOA 4PSWA 1I12A 2AFWA 4MHZA 6CPAA 1BPNA 1CX8A 2PE3A 1YX0A 3PEIA 3IC1A 5IV0A 1ARMA 5EBVA 1Y7EA 4H6UA 1NSLA 2I79A 1VKCA 1JQGA 2C6GA 3LWUA 5H84A 3TC8A 5C82A 3CDXA 4P4BA 1BO4A 3DR6A 1GHEA 3T9YA 4NGMA 3D4UA 2R8VA 3IWWA 1LAMA 2D4OA 2PVWA 3PFOA 3CXQA 2Z3PA 2O28A 1YR0A 2AE6A 4P4EA 4XPDC 2Q51A 5BWAB 2WYRA 4ZY2A 2Q7BA 2B4BA 4MFLA 2P0WA 2CY2A 3D67A 3H8GA 2FIWA 2XEFA 4TWEA 2EK9A 2ZW4A 1R3NA 4KOVA 4L8AA 4DYOA 2RFHA 2PJ2A 3PB8X 3KGQA 3PB4X 3SJFA 1IU8A 1L0CA 3DNSA 4KUAA 4MHPA 3S6FA 4MBUA 5FVJA 3F0AA 4B5OA 1Z4EA 2HB6A 2GANA 3NE8A 4P45A 3IFEA 4Q7AA 4MXUA 3PBEA 4TNUA 4CGOA 3IEHA 5G21A 2IL4A 2Z3LA 3RZAA 2ZOGA 3MRUA 4A30A 3B8GA 4YFJA 5THWA 2POKA 4FUUA 3G3SA 4UCPA 1IGBA 4C7HA 1EE3P 1TF8A 1CP6A 2VI7A 1VIXA 1TKFA 4M6GA 4KSFA 2Z3KA 2PQ8A 4QUSA 1S7NA 4JXRA 2F8HA 3IWGA 2CIJA 2PRQA 2YGWA 4NGPA 5I4MA 2I00A 5I0CA 2G9DA 3C26A 4OC3A 1I1DA 4MJ8A 4NFRA 4ZI6A 1B6BA 4UIAA 4W9YA 4HNYB 1H8LA 5KTDA 3K9TA 5EC4A 4MCQA 1IICA 1LRZA 1Z2LA 1QSTA 3CT9A 3R1KA 4MHDA 3ZZIA 4B14A 4Y49C 4EVYA 1QMUA 2VZZA 4ZY1A 2ANPA 5LRJA 3FEEA 2OU2A 3FJUA 4MY3A 3GKRA 1XOVA 4MFZA 4OP4A 4R8FA 4OIWA 4CGNA 4CYQA 3TFYA 3RO0A 1TKHA 4R7MA 3S6KA 4C2XA 3FF3A 2B4DB 4WJBA 2PIYA 2B58A 4QB9A 3PB9X 2JDDA 2Q4YA 3A9LA 1QSOA 4FWUA 1U6MA 3EXNA 2PIZA 3TX8A 3LACA 3V38A 4NF1A 5HH1A 5HVHA 2PJ4A 3KHXA 2IQ6A 4WWVA 3QB8A 3HLPA 3NH8A 2GREA 2C27A 4R9MA 2AFZA 2AFMA 5G20A 4AXVA 3B3TA 1TIQA 2G0BA 5JQ4A 3I1UA 3E0KA 3GYAA 1HEEA 1YSJA 1LCPA 3GY9A 5J8FA 3B35A 3LODA 5DS0A 2YNDA 4A39A 2GLJA 1FT7A 4MFJA 4H89A 4MFQA 5A27A 5DWNA 3PBBA 2FXFA 4PK3A 3KQXA 4CYPA 2ZW7A 4QBJA 1FY7A 4F9UA 1TKJA 3B3WA 2VZYA 2R7HA 2C6PA 4MY0A 4C2ZA 2H5MA 3PRTA 5AG6A 4EFDA 2CXAA 4HNWB 4F8ZA 4AVAA 1YVOA 2R1IA 3BLNA 4YWYA 4MCPA 1YMEA 4P4FA 2DXQA 4F6AA 1YGHA 2BCOA 2V8DA 4ZYQA 1RTQA 2EUIA 2Q44A 2JLMA 3OWCA 4CAVA 4NGSA 1MJAA 4KUBA 4ZX9A 2B5GB 3NE7A 4AVCA 2ODFA 2G3AA 4U9YA 3RYOA 4P4IA 3MGDA 2NMTA 4PXBA 2FIAA 3B3VA 3BHXA 3LD2A 3D7FA 4P10A 5AG4A 3SJEA 3KI9A 3FYNA 4X8IA 4FD4A 2EO8A 1ELLP 2PC1A 2QIRA 1WWZA 4CGLA 3D2PA 1R57A 5LYDA 4E0AA 5A28A 1Z8LA 4MRIA 1S7LA 3IGRA 4MCSA 3BJ7A 4GXHA 2GIVA 1VHEA 4P44A 1ZG7A 4UFWA 4UEFA 1YW6A 4B12A 3FXTA 5ISVA 4KVOE 2YNCA 4LQ6A 5CPAA 4EMEA 4M6IA 4PXCA 3DLJA 4RUHA 4BINA 3PB6X 2J8MA 4U5YA 4XPKA 4UFXA 2J9AA 5G1ZA 3BI1A 1BAVA 1ELMP 2HQYA 2O53A 3PFEA 4HKFA 4RS2A 3S9MA 4NXYA 4CAWA 4Z65A 1XMBA 2C6CA 2AJ6A 3VARA 4QVTA 1YVKA 1LOKA 5JPHA 3TOBA 2G3TA 3IO1A 4NGNA 5CNPA 5DWMA 2PJ5A 2B3UA 2WSAA 3LMSA 3R95A 3HUVA 4MMOA 5K8MA 4C2YA 2HC9A 1NSAA 1Y7RA 2V8VA 5IB9A 4PXEA 2Z11A 4LUAA 4DUKA 4YU9A 1F57A 5CBMA 4XPLA 1IOFA 3JUWA 4I49A 4K30A 4R3LA 5KTAA 3FVLA 3L2NA 1S3ZA 4L89A 3TO9A
chains in the Genus database with same CATH topology
3SI0A 2NSMA 4CPAA 1UWYA 5J1QA 4A38A 1XJOA 2F7VA 1XFOA 4NGRA 4UF4A 4OC1A 1HDUA 1BPMA 4ZY0A 1LANA 1CPXA 3B3CA 3T8WA 4PQAA 2PJ3A 2ZEFA 4FAIA 3WABA 3SJXA 1ARLA 2NYQA 3V7ZA 5K8PA 2XEGA 4A94A 4OC4A 1XBUA 3RAMA 4FBEA 3FEDA 1QQ9A 3IIBA 4UEEA 1BLLE 1AMPA 1PCAA 1Y0YA 1ZG9A 2AFSA 4F9VA 2PVVA 3H8FA 2RB7A 2XEJA 4NGQA 3WC7A 1KWMA 2ABZA 2O4HA 3GLJA 4EWTA 4LQGA 4KSIA 4OIDA 3FMCA 2CF4A 2PJ0A 3WC5A 5ELYA 2CTCA 3B7IA 4MHYA 2WZNA 4X3RA 2V77A 4JYWA 5LRGA 2GU2A 3CPAA 1CP7A 2QYVA 3NH4A 2OOTA 1VGYA 2AFOA 4NJRA 4G1PA 2IJZA 3KR4A 2V8GA 4P6YA 1CG2A 2ZEMA 3S9NA 5HVFA 5LRKA 2ZENA 3SI2A 5JM6A 2AFXA 3B3SA 2AFUA 3KR5A 5HVGA 4OC0A 4PXDA 3D68A 2ZEOA 4UIBA 3KQZA 3ISZA 4K3NA 4OKOA 2ZEPA 5K8NA 3BI0A 3SI1A 2ZEHA 1R43A 4P4DA 2GLFA 5HXDA 1Y0RA 1PYTB 2ZEEA 1TXRA 3H8EA 2Q4ZA 3DGVA 2BO9A 3B2YA 3QNVA 3RBUA 3FH4A 4NJQA 4OC2A 1XRYA 3KL9A 3WT4A 3D7GA 5D29A 2JEWA 5F09A 1HDQA 2Q43A 5D8NA 3VH9A 2PJ8A 2OR4A 3KHZA 3SJGA 2ZOFA 3IJ3A 3JRUA 5K8OA 4A37A 2EWBA 2C1CA 2ZEDA 3GUXA 3CPXA 1F2OA 5LYIA 2PJBA 4ZX8A 1IY7A 1OBRA 1ZLHA 4JZ0A 4OMEA 3K2KA 3D66A 3FX6A 3NH5A 8CPAA 4DJLA 5LYLA 3VATA 2PJ7A 1F2PA 4P4JA 1GYTA 4R6TA 1YW4A 1FNOA 4O23A 1DE4C 3MN8A 1Q7LA 3PB7X 2PJ6A 2PJ1A 1AYEA 5JGFA 2VL1A 3GB0A 3FECA 4MHNA 4IHMA 1ZLIA 3NA6A 2V8HA 3D7DA 4OC5A 1CBXA 2XEIA 2FVGA 2CTBA 4BD9A 2PJCA 2BOAA 2I3CA 4H2KA 4PPZA 1CPSA 2EK8A 4ONWA 4UEZA 3BXMA 4IK2A 4IAVA 2IMOA 3KZWA 5JH9A 4MCRA 1LAPA 2QVPA 1ZG8A 2DEAA 2ZEGA 3ISXA 2JBKA 3D7HA 2QJ8A 2PCUA 1DTDA 3WC6A 1TF9A 4B6ZA 2ZELA 3S9LA 4NGTA 5LYFA 2PJAA 1LFWA 3KASA 7CPAA 4X2TA 4R76A 1M4LA 1VHOA 2PJ9A 1Z5RA 2JBJA 3N5FA 3NFZA 4GM5A 1YLOA 2AFWA 4MHZA 6CPAA 1BPNA 1CX8A 2PE3A 3PEIA 3IC1A 1ARMA 1Y7EA 2C6GA 1JQGA 3LWUA 3TC8A 3CDXA 4P4BA 4NGMA 3D4UA 3IWWA 1LAMA 2PVWA 3PFOA 4P4EA 2Q51A 2WYRA 4ZY2A 3D67A 3H8GA 4TWEA 2XEFA 2EK9A 1R3NA 4DYOA 2RFHA 2PJ2A 3PB8X 3KGQA 3PB4X 3SJFA 4MHPA 2HB6A 4P45A 3IFEA 4Q7AA 4MXUA 3PBEA 4TNUA 3IEHA 3RZAA 2ZOGA 3MRUA 5THWA 2POKA 4FUUA 1IGBA 1EE3P 1TF8A 1CP6A 1VIXA 1TKFA 2F8HA 5I4MA 2CIJA 2PRQA 4NGPA 2G9DA 4OC3A 4NFRA 4ZI6A 4W9YA 4UIAA 1H8LA 3K9TA 4MCQA 3CT9A 1Z2LA 1QMUA 4ZY1A 2ANPA 5LRJA 3FEEA 3FJUA 4OP4A 4R8FA 4OIWA 1TKHA 4R7MA 3FF3A 4WJBA 2PIYA 3PB9X 4FWUA 2PIZA 3TX8A 3V38A 5HVHA 2PJ4A 3KHXA 2IQ6A 4WWVA 3HLPA 3NH8A 2GREA 2AFZA 2AFMA 4AXVA 3B3TA 3I1UA 1HEEA 1YSJA 1LCPA 3B35A 5DS0A 4A39A 2GLJA 1FT7A 3PBBA 3KQXA 4F9UA 1TKJA 3B3WA 2C6PA 3PRTA 4EFDA 4F8ZA 4YWYA 4MCPA 1YMEA 4P4FA 2BCOA 2V8DA 4ZYQA 1RTQA 4NGSA 4ZX9A 4P4IA 4PXBA 3B3VA 3BHXA 3D7FA 4P10A 3SJEA 3KI9A 4X8IA 1ELLP 5LYDA 1Z8LA 4MRIA 4MCSA 4P44A 1VHEA 1ZG7A 4UEFA 1YW6A 5CPAA 4EMEA 4PXCA 3DLJA 4RUHA 3PB6X 2J9AA 3BI1A 1BAVA 1ELMP 3PFEA 2O53A 3S9MA 4Z65A 1XMBA 2C6CA 3VARA 1LOKA 3IO1A 4NGNA 2PJ5A 3LMSA 5K8MA 3HUVA 4MMOA 2HC9A 1NSAA 2V8VA 5IB9A 4PXEA 4DUKA 4YU9A 1F57A 5CBMA 3FVLA 3L2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SI0 A;  2NSM A;  4CPA A;  1UWY A;  5J1Q A;  4A38 A;  1XJO A;  2F7V A;  1XFO A;  4NGR A;  4UF4 A;  4OC1 A;  1HDU A;  1BPM A;  4ZY0 A;  1LAN A;  1CPX A;  3B3C A;  3T8W A;  4PQA A;  2PJ3 A;  2ZEF A;  4FAI A;  3WAB A;  3SJX A;  1ARL A;  2NYQ A;  3V7Z A;  5K8P A;  2XEG A;  4A94 A;  4OC4 A;  1XBU A;  3RAM A;  4FBE A;  3FED A;  1QQ9 A;  3IIB A;  4UEE A;  1BLL E;  1AMP A;  1PCA A;  1Y0Y A;  1ZG9 A;  2AFS A;  4F9V A;  2PVV A;  3H8F A;  2RB7 A;  2XEJ A;  4NGQ A;  3WC7 A;  1KWM A;  2ABZ A;  2O4H A;  3GLJ A;  4EWT A;  4LQG A;  4KSI A;  4OID A;  3FMC A;  2CF4 A;  2PJ0 A;  3WC5 A;  5ELY A;  2CTC A;  3B7I A;  4MHY A;  2WZN A;  4X3R A;  2V77 A;  4JYW A;  5LRG A;  2GU2 A;  3CPA A;  1CP7 A;  2QYV A;  3NH4 A;  2OOT A;  1VGY A;  2AFO A;  4NJR A;  4G1P A;  2IJZ A;  3KR4 A;  2V8G A;  4P6Y A;  1CG2 A;  2ZEM A;  3S9N A;  5HVF A;  5LRK A;  2ZEN A;  3SI2 A;  5JM6 A;  2AFX A;  3B3S A;  2AFU A;  3KR5 A;  5HVG A;  4OC0 A;  4PXD A;  3D68 A;  2ZEO A;  4UIB A;  3KQZ A;  3ISZ A;  4K3N A;  4OKO A;  2ZEP A;  5K8N A;  3BI0 A;  3SI1 A;  2ZEH A;  1R43 A;  4P4D A;  2GLF A;  5HXD A;  1Y0R A;  1PYT B;  2ZEE A;  1TXR A;  3H8E A;  2Q4Z A;  3DGV A;  2BO9 A;  3B2Y A;  3QNV A;  3RBU A;  3FH4 A;  4NJQ A;  4OC2 A;  1XRY A;  3KL9 A;  3WT4 A;  3D7G A;  5D29 A;  2JEW A;  5F09 A;  1HDQ A;  2Q43 A;  5D8N A;  3VH9 A;  2PJ8 A;  2OR4 A;  3KHZ A;  3SJG A;  2ZOF A;  3IJ3 A;  3JRU A;  5K8O A;  4A37 A;  2EWB A;  2C1C A;  2ZED A;  3GUX A;  3CPX A;  1F2O A;  5LYI A;  2PJB A;  4ZX8 A;  1IY7 A;  1OBR A;  1ZLH A;  4JZ0 A;  4OME A;  3K2K A;  3D66 A;  3FX6 A;  3NH5 A;  8CPA A;  4DJL A;  5LYL A;  3VAT A;  2PJ7 A;  1F2P A;  4P4J A;  1GYT A;  4R6T A;  1YW4 A;  1FNO A;  4O23 A;  1DE4 C;  3MN8 A;  1Q7L A;  3PB7 X;  2PJ6 A;  2PJ1 A;  1AYE A;  5JGF A;  2VL1 A;  3GB0 A;  3FEC A;  4MHN A;  4IHM A;  1ZLI A;  3NA6 A;  2V8H A;  3D7D A;  4OC5 A;  1CBX A;  2XEI A;  2FVG A;  2CTB A;  4BD9 A;  2PJC A;  2BOA A;  2I3C A;  4H2K A;  4PPZ A;  1CPS A;  2EK8 A;  4ONW A;  4UEZ A;  3BXM A;  4IK2 A;  4IAV A;  2IMO A;  3KZW A;  5JH9 A;  4MCR A;  1LAP A;  2QVP A;  1ZG8 A;  2DEA A;  2ZEG A;  3ISX A;  2JBK A;  3D7H A;  2QJ8 A;  2PCU A;  1DTD A;  3WC6 A;  1TF9 A;  4B6Z A;  2ZEL A;  3S9L A;  4NGT A;  5LYF A;  2PJA A;  1LFW A;  3KAS A;  7CPA A;  4X2T A;  4R76 A;  1M4L A;  1VHO A;  2PJ9 A;  1Z5R A;  2JBJ A;  3N5F A;  3NFZ A;  4GM5 A;  1YLO A;  2AFW A;  4MHZ A;  6CPA A;  1BPN A;  1CX8 A;  2PE3 A;  3PEI A;  3IC1 A;  1ARM A;  1Y7E A;  2C6G A;  1JQG A;  3LWU A;  3TC8 A;  3CDX A;  4P4B A;  4NGM A;  3D4U A;  3IWW A;  1LAM A;  2PVW A;  3PFO A;  4P4E A;  2Q51 A;  2WYR A;  4ZY2 A;  3D67 A;  3H8G A;  4TWE A;  2XEF A;  2EK9 A;  1R3N A;  4DYO A;  2RFH A;  2PJ2 A;  3PB8 X;  3KGQ A;  3PB4 X;  3SJF A;  4MHP A;  2HB6 A;  4P45 A;  3IFE A;  4Q7A A;  4MXU A;  3PBE A;  4TNU A;  3IEH A;  3RZA A;  2ZOG A;  3MRU A;  5THW A;  2POK A;  4FUU A;  1IGB A;  1EE3 P;  1TF8 A;  1CP6 A;  1VIX A;  1TKF A;  2F8H A;  5I4M A;  2CIJ A;  2PRQ A;  4NGP A;  2G9D A;  4OC3 A;  4NFR A;  4ZI6 A;  4W9Y A;  4UIA A;  1H8L A;  3K9T A;  4MCQ A;  3CT9 A;  1Z2L A;  1QMU A;  4ZY1 A;  2ANP A;  5LRJ A;  3FEE A;  3FJU A;  4OP4 A;  4R8F A;  4OIW A;  1TKH A;  4R7M A;  3FF3 A;  4WJB A;  2PIY A;  3PB9 X;  4FWU A;  2PIZ A;  3TX8 A;  3V38 A;  5HVH A;  2PJ4 A;  3KHX A;  2IQ6 A;  4WWV A;  3HLP A;  3NH8 A;  2GRE A;  2AFZ A;  2AFM A;  4AXV A;  3B3T A;  3I1U A;  1HEE A;  1YSJ A;  1LCP A;  3B35 A;  5DS0 A;  4A39 A;  2GLJ A;  1FT7 A;  3PBB A;  3KQX A;  4F9U A;  1TKJ A;  3B3W A;  2C6P A;  3PRT A;  4EFD A;  4F8Z A;  4YWY A;  4MCP A;  1YME A;  4P4F A;  2BCO A;  2V8D A;  4ZYQ A;  1RTQ A;  4NGS A;  4ZX9 A;  4P4I A;  4PXB A;  3B3V A;  3BHX A;  3D7F A;  4P10 A;  3SJE A;  3KI9 A;  4X8I A;  1ELL P;  5LYD A;  1Z8L A;  4MRI A;  4MCS A;  4P44 A;  1VHE A;  1ZG7 A;  4UEF A;  1YW6 A;  5CPA A;  4EME A;  4PXC A;  3DLJ A;  4RUH A;  3PB6 X;  2J9A A;  3BI1 A;  1BAV A;  1ELM P;  3PFE A;  2O53 A;  3S9M A;  4Z65 A;  1XMB A;  2C6C A;  3VAR A;  1LOK A;  3IO1 A;  4NGN A;  2PJ5 A;  3LMS A;  5K8M A;  3HUV A;  4MMO A;  2HC9 A;  1NSA A;  2V8V A;  5IB9 A;  4PXE A;  4DUK A;  4YU9 A;  1F57 A;  5CBM A;  3FVL A;  3L2N A; 
#chains in the Genus database with same CATH topology
 3SI0 A;  2NSM A;  4CPA A;  1UWY A;  1XE4 A;  4A38 A;  5J1Q A;  1XJO A;  2F7V A;  3D8P A;  1XFO A;  4NGR A;  1I21 A;  4UF4 A;  4B10 A;  4OC1 A;  1HDU A;  1M4I A;  1BPM A;  4ZY0 A;  1LAN A;  3TE4 A;  1KZF A;  5AG7 A;  1CPX A;  4UCM A;  2QML A;  3B3C A;  2VQY A;  4KOR A;  3T8W A;  4PQA A;  2PDO A;  2HUZ A;  2PJ3 A;  5F49 A;  2P6F A;  1XEB A;  4KOS A;  1M44 A;  2ZEF A;  4ORF A;  1QSN A;  4FAI A;  2ATR A;  3JVN A;  3P2H A;  5AG5 A;  3WAB A;  4AG9 A;  3SXO A;  2EVN A;  1S7F A;  3SJX A;  4F0Y A;  1ARL A;  3PP9 A;  2NYQ A;  4JLY A;  3V7Z A;  5K8P A;  1M4D A;  2XEG A;  4A94 A;  4OC4 A;  1XBU A;  2OB0 A;  3P2F A;  3RAM A;  2QEC A;  4FBE A;  3FED A;  1QQ9 A;  1QSM A;  4KZT A;  4UBR A;  3R9F A;  5IB0 A;  4XNH B;  3IIB A;  1AUG A;  1Z8X A;  2B4D A;  1Z8T A;  4UEE A;  2YNC C;  4A95 A;  2FSR A;  1BLL E;  4KSA A;  1AMP A;  5G22 A;  3QAH A;  4CYO A;  3EFA A;  4JJX A;  3T90 A;  1PCA A;  1Y0Y A;  1ZG9 A;  2AFS A;  2VBQ A;  3TO6 A;  4F9V A;  4KOX A;  4M85 A;  2PVV A;  3H8F A;  2RB7 A;  2XEJ A;  3TO7 A;  4BMH A;  4NGQ A;  3FNC A;  1BOB A;  3VWD A;  1P0H A;  3WC7 A;  3KKW A;  4KLV A;  1KWM A;  2ABZ A;  2Z10 A;  4B5P B;  1Z8W A;  2O4H A;  4C68 A;  3GLJ A;  1S60 A;  1JWQ A;  4EWT A;  4LQG A;  3F8K A;  4KSI A;  4OID A;  3FMC A;  1YQE A;  2CF4 A;  2Q0Y A;  5EMI A;  2PJ0 A;  4OLL A;  3WC5 A;  3D2M A;  5F48 A;  2DPT A;  5HMN A;  3FBU A;  5ELY A;  1Z4R A;  4MFK A;  1Q2C A;  2CTC A;  2FE7 A;  3B7I A;  1CJW A;  4MHY A;  1K4J A;  2FCK A;  2WZN A;  4CGP A;  4X3R A;  2V77 A;  4JYW A;  2OZH A;  5LRG A;  2GU2 A;  3RNZ A;  2ZPA A;  3CPA A;  1CP7 A;  1RO5 A;  2B5G A;  2QYV A;  3PGP A;  3NH4 A;  2RC4 A;  2OOT A;  1VGY A;  2AFO A;  4NJR A;  3IWE A;  2P6E A;  3K9U A;  4YRH A;  2BEI A;  4G1P A;  2IJZ A;  2REE A;  3KR4 A;  2V8G A;  4KLW A;  4P6Y A;  4Q36 A;  2WPW A;  1CG2 A;  1UFH A;  2ZEM A;  4CS0 B;  3S9N A;  5HVF A;  5LRK A;  4C7I A;  4PV6 A;  1CM0 A;  2ARH A;  2ZEN A;  2ZW5 A;  2P6G A;  3SI2 A;  3JTK A;  3W6X A;  1J4J A;  4NEX A;  3PZJ A;  4M3S A;  4PSX A;  5JM6 A;  4AB7 A;  4ZGY B;  1YK3 A;  4XNH C;  3IU2 A;  2AFX A;  4CAX A;  3B3S A;  4A33 A;  4CAF A;  1OZP A;  2AFU A;  2F5I A;  1PU9 A;  3KR5 A;  3R96 A;  5HVG A;  2GFQ A;  2DPS A;  3S6H A;  4B13 A;  4FD6 A;  4OC0 A;  4PXD A;  3QAY A;  3D68 A;  3TOA A;  2Z3M A;  2ZEO A;  4UIB A;  2DF5 A;  3KQZ A;  3ISZ A;  1MJ9 A;  2JDC A;  4OAD A;  2ZW6 A;  4K3N A;  4OKO A;  2ZEP A;  3CXS A;  5K8N A;  4Y49 B;  3GIU A;  3BI0 A;  3TCV A;  1KUX A;  4CRY B;  3SI1 A;  1Q2D A;  1QSR A;  2ZEH A;  2WUU A;  2FT0 A;  3FIX A;  2BSW A;  4KOU A;  1R43 A;  4P4D A;  4MI4 A;  2GLF A;  2Q04 A;  4AG7 A;  5HXD A;  4JWP A;  1Y0R A;  1X10 A;  1PYT B;  4KOY A;  1M1D A;  1KUV A;  1KUY A;  2ZEE A;  1TXR A;  3H8E A;  4NSQ A;  1IYL A;  2Q4Z A;  4R57 A;  3DGV A;  2PR1 A;  4B11 A;  3SHP A;  1Y9W A;  4UA3 A;  1XIX A;  2BO9 A;  3B2Y A;  3QNV A;  3RBU A;  2B3V A;  3BJ8 A;  4Q38 A;  3FH4 A;  4NJQ A;  1WK4 A;  4OC2 A;  1XRY A;  1NE9 A;  4IF5 A;  3KL9 A;  3R9G A;  4HPS A;  3D7G A;  5D29 A;  5F47 A;  4H6Z A;  3SXN A;  2JEW A;  3WT4 A;  1N71 A;  3TTH A;  1HDQ A;  2Q43 A;  3CZX A;  5D8N A;  5F09 A;  3IU1 A;  3EY5 A;  3VH9 A;  4CRZ B;  2REF A;  4GS4 A;  4RI1 A;  2PJ8 A;  2CNS A;  3R9E A;  3DR8 A;  2OR4 A;  2Z3O A;  3F5B A;  1P4N A;  2Z0Z A;  3KHZ A;  3SJG A;  2Q7S A;  2ZOF A;  5H86 A;  3IJ3 A;  1X12 A;  3JRU A;  5K8O A;  4A37 A;  1IID A;  1Y9K A;  2EWB A;  5F46 A;  2C1C A;  2Y0M A;  2ZED A;  4OAE A;  2WPX A;  4BBH A;  3DSB A;  2D4P A;  5E96 A;  3GUX A;  1V0C A;  3CPX A;  1F2O A;  1B87 A;  5LYI A;  1IB1 E;  2PSW A;  1A2Z A;  4FD5 A;  4PK2 A;  1MJB A;  2PJB A;  4ZX8 A;  1IY7 A;  1OBR A;  2EBJ A;  1ZLH A;  4JZ0 A;  4OME A;  4KVX A;  2X7B A;  3K2K A;  3D66 A;  1Q2Y A;  3FX6 A;  5GCN A;  4M6H A;  4II9 A;  1NMT A;  3NH5 A;  4U9Z A;  4KOT A;  8CPA A;  4DJL A;  4AVB A;  5LYL A;  1IOI A;  4A31 A;  2VXK A;  3VAT A;  5AGE A;  2Z3N A;  4KOW A;  2PJ7 A;  1F2P A;  4UWI A;  4B5P A;  4P4J A;  1GYT A;  4R6T A;  1YW4 A;  4E2A A;  1FNO A;  4A2Z A;  4O23 A;  1IYK A;  1DE4 C;  3MN8 A;  1Z9U A;  2CNM A;  1Q7L A;  3FB3 A;  3PB7 X;  2PJ6 A;  4F0X A;  2FS5 A;  2PJ1 A;  1AYE A;  1SQH A;  5JGF A;  1YRE A;  1VHS A;  3VWE A;  2VL1 A;  2JEV A;  3D3S A;  3GB0 A;  3I3G A;  3FEC A;  4MHN A;  3DDD A;  3FRM A;  2R98 A;  3TT2 A;  5C88 A;  4IHM A;  1ZLI A;  3NA6 A;  4E8O A;  2VEZ A;  1ZO0 A;  4ZBG A;  2V8H A;  3D7D A;  4CYN A;  2J8R A;  5IX3 A;  4OC5 A;  1CBX A;  2XEI A;  2FVG A;  4XPD B;  2CTB A;  1S7K A;  2BL1 A;  5KTC A;  2J8N A;  4BD9 A;  2PJC A;  4X5K A;  2BOA A;  2I3C A;  4H2K A;  4A32 A;  4UWJ A;  4PPZ A;  2CNT A;  4UFV A;  1PUA A;  5J8C A;  4R87 A;  4MFP A;  2PRB A;  1CPS A;  4DNC A;  2OZG A;  2EK8 A;  4ONU A;  4ONW A;  4UEZ A;  3V8I A;  1S5K A;  4UCN A;  3BXM A;  4IK2 A;  3UY5 A;  1MK4 A;  4IAV A;  1RXT A;  4J3G A;  3WR7 A;  4CGM A;  2K5T A;  4KS9 A;  4FD7 A;  2IMO A;  1XMT A;  1YLE A;  3KZW A;  5JH9 A;  2GE3 A;  4MCR A;  1LAP A;  2ZXV A;  2QVP A;  2PR8 A;  1ZG8 A;  2DEA A;  2OZU A;  2ZEG A;  3ISX A;  4IUS A;  3ZJ0 A;  4CAE A;  2JBK A;  3D7H A;  2KCW A;  4YGO A;  3W6S A;  3CXP A;  2QJ8 A;  3S6G A;  4QC6 A;  2PCU A;  4JXQ A;  1DTD A;  4LX9 A;  1TF9 A;  3I9S A;  3WC6 A;  4B6Z A;  1XF8 A;  2A4N A;  2Q4V A;  2ZEL A;  3H5Z A;  3H4Q A;  4RN7 A;  3S9L A;  3EC4 A;  2OH1 A;  2BUE A;  4NGT A;  2FL4 A;  5LYF A;  2PJA A;  1LFW A;  3KAS A;  4R3K A;  2HV2 A;  3G8W A;  3N7Z A;  7CPA A;  4X2T A;  4R76 A;  1ON0 A;  1M4L A;  1M4G A;  3EO4 A;  1VHO A;  3W91 A;  2PJ9 A;  4NCZ A;  1Z5R A;  2JBJ A;  3N5F A;  4KVM E;  2YNE A;  3NFZ A;  4JD6 A;  4GM5 A;  4HNX B;  1YLO A;  4PSW A;  1I12 A;  2AFW A;  4MHZ A;  6CPA A;  1BPN A;  1CX8 A;  2PE3 A;  1YX0 A;  3PEI A;  3IC1 A;  5IV0 A;  1ARM A;  5EBV A;  1Y7E A;  4H6U A;  1NSL A;  2I79 A;  1VKC A;  1JQG A;  2C6G A;  3LWU A;  5H84 A;  3TC8 A;  5C82 A;  3CDX A;  4P4B A;  1BO4 A;  3DR6 A;  1GHE A;  3T9Y A;  4NGM A;  3D4U A;  2R8V A;  3IWW A;  1LAM A;  2D4O A;  2PVW A;  3PFO A;  3CXQ A;  2Z3P A;  2O28 A;  1YR0 A;  2AE6 A;  4P4E A;  4XPD C;  2Q51 A;  5BWA B;  2WYR A;  4ZY2 A;  2Q7B A;  2B4B A;  4MFL A;  2P0W A;  2CY2 A;  3D67 A;  3H8G A;  2FIW A;  2XEF A;  4TWE A;  2EK9 A;  2ZW4 A;  1R3N A;  4KOV A;  4L8A A;  4DYO A;  2RFH A;  2PJ2 A;  3PB8 X;  3KGQ A;  3PB4 X;  3SJF A;  1IU8 A;  1L0C A;  3DNS A;  4KUA A;  4MHP A;  3S6F A;  4MBU A;  5FVJ A;  3F0A A;  4B5O A;  1Z4E A;  2HB6 A;  2GAN A;  3NE8 A;  4P45 A;  3IFE A;  4Q7A A;  4MXU A;  3PBE A;  4TNU A;  4CGO A;  3IEH A;  5G21 A;  2IL4 A;  2Z3L A;  3RZA A;  2ZOG A;  3MRU A;  4A30 A;  3B8G A;  4YFJ A;  5THW A;  2POK A;  4FUU A;  3G3S A;  4UCP A;  1IGB A;  4C7H A;  1EE3 P;  1TF8 A;  1CP6 A;  2VI7 A;  1VIX A;  1TKF A;  4M6G A;  4KSF A;  2Z3K A;  2PQ8 A;  4QUS A;  1S7N A;  4JXR A;  2F8H A;  3IWG A;  2CIJ A;  2PRQ A;  2YGW A;  4NGP A;  5I4M A;  2I00 A;  5I0C A;  2G9D A;  3C26 A;  4OC3 A;  1I1D A;  4MJ8 A;  4NFR A;  4ZI6 A;  1B6B A;  4UIA A;  4W9Y A;  4HNY B;  1H8L A;  5KTD A;  3K9T A;  5EC4 A;  4MCQ A;  1IIC A;  1LRZ A;  1Z2L A;  1QST A;  3CT9 A;  3R1K A;  4MHD A;  3ZZI A;  4B14 A;  4Y49 C;  4EVY A;  1QMU A;  2VZZ A;  4ZY1 A;  2ANP A;  5LRJ A;  3FEE A;  2OU2 A;  3FJU A;  4MY3 A;  3GKR A;  1XOV A;  4MFZ A;  4OP4 A;  4R8F A;  4OIW A;  4CGN A;  4CYQ A;  3TFY A;  3RO0 A;  1TKH A;  4R7M A;  3S6K A;  4C2X A;  3FF3 A;  2B4D B;  4WJB A;  2PIY A;  2B58 A;  4QB9 A;  3PB9 X;  2JDD A;  2Q4Y A;  3A9L A;  1QSO A;  4FWU A;  1U6M A;  3EXN A;  2PIZ A;  3TX8 A;  3LAC A;  3V38 A;  4NF1 A;  5HH1 A;  5HVH A;  2PJ4 A;  3KHX A;  2IQ6 A;  4WWV A;  3QB8 A;  3HLP A;  3NH8 A;  2GRE A;  2C27 A;  4R9M A;  2AFZ A;  2AFM A;  5G20 A;  4AXV A;  3B3T A;  1TIQ A;  2G0B A;  5JQ4 A;  3I1U A;  3E0K A;  3GYA A;  1HEE A;  1YSJ A;  1LCP A;  3GY9 A;  5J8F A;  3B35 A;  3LOD A;  5DS0 A;  2YND A;  4A39 A;  2GLJ A;  1FT7 A;  4MFJ A;  4H89 A;  4MFQ A;  5A27 A;  5DWN A;  3PBB A;  2FXF A;  4PK3 A;  3KQX A;  4CYP A;  2ZW7 A;  4QBJ A;  1FY7 A;  4F9U A;  1TKJ A;  3B3W A;  2VZY A;  2R7H A;  2C6P A;  4MY0 A;  4C2Z A;  2H5M A;  3PRT A;  5AG6 A;  4EFD A;  2CXA A;  4HNW B;  4F8Z A;  4AVA A;  1YVO A;  2R1I A;  3BLN A;  4YWY A;  4MCP A;  1YME A;  4P4F A;  2DXQ A;  4F6A A;  1YGH A;  2BCO A;  2V8D A;  4ZYQ A;  1RTQ A;  2EUI A;  2Q44 A;  2JLM A;  3OWC A;  4CAV A;  4NGS A;  1MJA A;  4KUB A;  4ZX9 A;  2B5G B;  3NE7 A;  4AVC A;  2ODF A;  2G3A A;  4U9Y A;  3RYO A;  4P4I A;  3MGD A;  2NMT A;  4PXB A;  2FIA A;  3B3V A;  3BHX A;  3LD2 A;  3D7F A;  4P10 A;  5AG4 A;  3SJE A;  3KI9 A;  3FYN A;  4X8I A;  4FD4 A;  2EO8 A;  1ELL P;  2PC1 A;  2QIR A;  1WWZ A;  4CGL A;  3D2P A;  1R57 A;  5LYD A;  4E0A A;  5A28 A;  1Z8L A;  4MRI A;  1S7L A;  3IGR A;  4MCS A;  3BJ7 A;  4GXH A;  2GIV A;  1VHE A;  4P44 A;  1ZG7 A;  4UFW A;  4UEF A;  1YW6 A;  4B12 A;  3FXT A;  5ISV A;  4KVO E;  2YNC A;  4LQ6 A;  5CPA A;  4EME A;  4M6I A;  4PXC A;  3DLJ A;  4RUH A;  4BIN A;  3PB6 X;  2J8M A;  4U5Y A;  4XPK A;  4UFX A;  2J9A A;  5G1Z A;  3BI1 A;  1BAV A;  1ELM P;  2HQY A;  2O53 A;  3PFE A;  4HKF A;  4RS2 A;  3S9M A;  4NXY A;  4CAW A;  4Z65 A;  1XMB A;  2C6C A;  2AJ6 A;  3VAR A;  4QVT A;  1YVK A;  1LOK A;  5JPH A;  3TOB A;  2G3T A;  3IO1 A;  4NGN A;  5CNP A;  5DWM A;  2PJ5 A;  2B3U A;  2WSA A;  3LMS A;  3R95 A;  3HUV A;  4MMO A;  5K8M A;  4C2Y A;  2HC9 A;  1NSA A;  1Y7R A;  2V8V A;  5IB9 A;  4PXE A;  2Z11 A;  4LUA A;  4DUK A;  4YU9 A;  1F57 A;  5CBM A;  4XPL A;  1IOF A;  3JUW A;  4I49 A;  4K30 A;  4R3L A;  5KTA A;  3FVL A;  3L2N A;  1S3Z A;  4L89 A;  3TO9 A; 
#chains in the Genus database with same CATH homology
 3SI0 A;  2NSM A;  4CPA A;  1UWY A;  5J1Q A;  4A38 A;  1XJO A;  2F7V A;  1XFO A;  4NGR A;  4UF4 A;  4OC1 A;  1HDU A;  1BPM A;  4ZY0 A;  1LAN A;  1CPX A;  3B3C A;  3T8W A;  4PQA A;  2PJ3 A;  2ZEF A;  4FAI A;  3WAB A;  3SJX A;  1ARL A;  2NYQ A;  3V7Z A;  5K8P A;  2XEG A;  4A94 A;  4OC4 A;  1XBU A;  3RAM A;  4FBE A;  3FED A;  1QQ9 A;  3IIB A;  4UEE A;  1BLL E;  1AMP A;  1PCA A;  1Y0Y A;  1ZG9 A;  2AFS A;  4F9V A;  2PVV A;  3H8F A;  2RB7 A;  2XEJ A;  4NGQ A;  3WC7 A;  1KWM A;  2ABZ A;  2O4H A;  3GLJ A;  4EWT A;  4LQG A;  4KSI A;  4OID A;  3FMC A;  2CF4 A;  2PJ0 A;  3WC5 A;  5ELY A;  2CTC A;  3B7I A;  4MHY A;  2WZN A;  4X3R A;  2V77 A;  4JYW A;  5LRG A;  2GU2 A;  3CPA A;  1CP7 A;  2QYV A;  3NH4 A;  2OOT A;  1VGY A;  2AFO A;  4NJR A;  4G1P A;  2IJZ A;  3KR4 A;  2V8G A;  4P6Y A;  1CG2 A;  2ZEM A;  3S9N A;  5HVF A;  5LRK A;  2ZEN A;  3SI2 A;  5JM6 A;  2AFX A;  3B3S A;  2AFU A;  3KR5 A;  5HVG A;  4OC0 A;  4PXD A;  3D68 A;  2ZEO A;  4UIB A;  3KQZ A;  3ISZ A;  4K3N A;  4OKO A;  2ZEP A;  5K8N A;  3BI0 A;  3SI1 A;  2ZEH A;  1R43 A;  4P4D A;  2GLF A;  5HXD A;  1Y0R A;  1PYT B;  2ZEE A;  1TXR A;  3H8E A;  2Q4Z A;  3DGV A;  2BO9 A;  3B2Y A;  3QNV A;  3RBU A;  3FH4 A;  4NJQ A;  4OC2 A;  1XRY A;  3KL9 A;  3WT4 A;  3D7G A;  5D29 A;  2JEW A;  5F09 A;  1HDQ A;  2Q43 A;  5D8N A;  3VH9 A;  2PJ8 A;  2OR4 A;  3KHZ A;  3SJG A;  2ZOF A;  3IJ3 A;  3JRU A;  5K8O A;  4A37 A;  2EWB A;  2C1C A;  2ZED A;  3GUX A;  3CPX A;  1F2O A;  5LYI A;  2PJB A;  4ZX8 A;  1IY7 A;  1OBR A;  1ZLH A;  4JZ0 A;  4OME A;  3K2K A;  3D66 A;  3FX6 A;  3NH5 A;  8CPA A;  4DJL A;  5LYL A;  3VAT A;  2PJ7 A;  1F2P A;  4P4J A;  1GYT A;  4R6T A;  1YW4 A;  1FNO A;  4O23 A;  1DE4 C;  3MN8 A;  1Q7L A;  3PB7 X;  2PJ6 A;  2PJ1 A;  1AYE A;  5JGF A;  2VL1 A;  3GB0 A;  3FEC A;  4MHN A;  4IHM A;  1ZLI A;  3NA6 A;  2V8H A;  3D7D A;  4OC5 A;  1CBX A;  2XEI A;  2FVG A;  2CTB A;  4BD9 A;  2PJC A;  2BOA A;  2I3C A;  4H2K A;  4PPZ A;  1CPS A;  2EK8 A;  4ONW A;  4UEZ A;  3BXM A;  4IK2 A;  4IAV A;  2IMO A;  3KZW A;  5JH9 A;  4MCR A;  1LAP A;  2QVP A;  1ZG8 A;  2DEA A;  2ZEG A;  3ISX A;  2JBK A;  3D7H A;  2QJ8 A;  2PCU A;  1DTD A;  3WC6 A;  1TF9 A;  4B6Z A;  2ZEL A;  3S9L A;  4NGT A;  5LYF A;  2PJA A;  1LFW A;  3KAS A;  7CPA A;  4X2T A;  4R76 A;  1M4L A;  1VHO A;  2PJ9 A;  1Z5R A;  2JBJ A;  3N5F A;  3NFZ A;  4GM5 A;  1YLO A;  2AFW A;  4MHZ A;  6CPA A;  1BPN A;  1CX8 A;  2PE3 A;  3PEI A;  3IC1 A;  1ARM A;  1Y7E A;  2C6G A;  1JQG A;  3LWU A;  3TC8 A;  3CDX A;  4P4B A;  4NGM A;  3D4U A;  3IWW A;  1LAM A;  2PVW A;  3PFO A;  4P4E A;  2Q51 A;  2WYR A;  4ZY2 A;  3D67 A;  3H8G A;  4TWE A;  2XEF A;  2EK9 A;  1R3N A;  4DYO A;  2RFH A;  2PJ2 A;  3PB8 X;  3KGQ A;  3PB4 X;  3SJF A;  4MHP A;  2HB6 A;  4P45 A;  3IFE A;  4Q7A A;  4MXU A;  3PBE A;  4TNU A;  3IEH A;  3RZA A;  2ZOG A;  3MRU A;  5THW A;  2POK A;  4FUU A;  1IGB A;  1EE3 P;  1TF8 A;  1CP6 A;  1VIX A;  1TKF A;  2F8H A;  5I4M A;  2CIJ A;  2PRQ A;  4NGP A;  2G9D A;  4OC3 A;  4NFR A;  4ZI6 A;  4W9Y A;  4UIA A;  1H8L A;  3K9T A;  4MCQ A;  3CT9 A;  1Z2L A;  1QMU A;  4ZY1 A;  2ANP A;  5LRJ A;  3FEE A;  3FJU A;  4OP4 A;  4R8F A;  4OIW A;  1TKH A;  4R7M A;  3FF3 A;  4WJB A;  2PIY A;  3PB9 X;  4FWU A;  2PIZ A;  3TX8 A;  3V38 A;  5HVH A;  2PJ4 A;  3KHX A;  2IQ6 A;  4WWV A;  3HLP A;  3NH8 A;  2GRE A;  2AFZ A;  2AFM A;  4AXV A;  3B3T A;  3I1U A;  1HEE A;  1YSJ A;  1LCP A;  3B35 A;  5DS0 A;  4A39 A;  2GLJ A;  1FT7 A;  3PBB A;  3KQX A;  4F9U A;  1TKJ A;  3B3W A;  2C6P A;  3PRT A;  4EFD A;  4F8Z A;  4YWY A;  4MCP A;  1YME A;  4P4F A;  2BCO A;  2V8D A;  4ZYQ A;  1RTQ A;  4NGS A;  4ZX9 A;  4P4I A;  4PXB A;  3B3V A;  3BHX A;  3D7F A;  4P10 A;  3SJE A;  3KI9 A;  4X8I A;  1ELL P;  5LYD A;  1Z8L A;  4MRI A;  4MCS A;  4P44 A;  1VHE A;  1ZG7 A;  4UEF A;  1YW6 A;  5CPA A;  4EME A;  4PXC A;  3DLJ A;  4RUH A;  3PB6 X;  2J9A A;  3BI1 A;  1BAV A;  1ELM P;  3PFE A;  2O53 A;  3S9M A;  4Z65 A;  1XMB A;  2C6C A;  3VAR A;  1LOK A;  3IO1 A;  4NGN A;  2PJ5 A;  3LMS A;  5K8M A;  3HUV A;  4MMO A;  2HC9 A;  1NSA A;  2V8V A;  5IB9 A;  4PXE A;  4DUK A;  4YU9 A;  1F57 A;  5CBM A;  3FVL A;  3L2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...