3B35A

Crystal structure of the m180a mutant of the aminopeptidase from vibrio proteolyticus
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDATNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Zinc coordination geometry and ligand binding affinity: the structural and kinetic analysis of the second-shell serine 228 residue and the methionine 180 residue of the aminopeptidase from Vibrio proteolyticus.
pubmed doi rcsb
source organism Vibrio proteolyticus
molecule tags Hydrolase
molecule keywords Bacterial leucyl aminopeptidase
total genus 119
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2007-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3b35A00
3L2NA 4DJLA 4ONWA 4R8FA 4ZI6A 4G1PA 3WABA 5LRJA 4R7MA 3PB9X 4ZY1A 3BI0A 1Z5RA 2DEAA 1YLOA 3PFOA 3MRUA 2ZELA 2C6PA 4NFRA 1CBXA 2PVWA 2EK8A 3VH9A 1BPNA 3FVLA 4PXCA 2ZOGA 2WYRA 2AFWA 2BCOA 5HVGA 2V8DA 1PYTB 5K8NA 3GB0A 5K8OA 4OIWA 5IB9A 3I1UA 3IWWA 3CPAA 3JRUA 4UEZA 1QQ9A 4WWVA 4A39A 3B7IA 3SI0A 5D8NA 4TNUA 3TX8A 2PJAA 2PIZA 4OMEA 2JEWA 1LAMA 3RZAA 4IHMA 2ZEGA 4MCSA 1PCAA 3HUVA 5D29A 2AFZA 4DYOA 3WC5A 1EE3P 3S9NA 1LAPA 1YW6A 1TF8A 1VGYA 4OC4A 3NH5A 4X2TA 4EWTA 1XBUA 1IGBA 2F8HA 3PFEA 2PJ0A 2XEGA 2ZEFA 3FF3A 3KQZA 4NGPA 3KQXA 3NA6A 4ZYQA 4P4DA 4DUKA 3D4UA 4IAVA 1Y7EA 3WC6A 4AXVA 3IEHA 2XEFA 1HDQA 3D7DA 3PBEA 4NGTA 3RBUA 2PVVA 1XJOA 2ZEDA 4FBEA 1AYEA 3D68A 4UF4A 4YWYA 4BD9A 2PJ6A 2IQ6A 4UEFA 4KSIA 2CIJA 2CTCA 3PEIA 1XMBA 1XFOA 4A94A 1DE4C 1TXRA 3D66A 3H8GA 4F9UA 3KZWA 5HXDA 2OR4A 4TWEA 1VHEA 4OIDA 3D7HA 4ZY0A 1TF9A 4FUUA 2NYQA 1M4LA 1RTQA 1BAVA 2V8VA 4P44A 4P6YA 3IIBA 3SI1A 2QYVA 4MXUA 1H8LA 4MCPA 4P45A 4PXEA 5THWA 1TKHA 4NGMA 2I3CA 6CPAA 2XEIA 3K2KA 4MHYA 3BHXA 3H8FA 3D7GA 5JH9A 1Z2LA 3QNVA 4EMEA 3TC8A 4P4IA 5K8PA 1TKJA 2WZNA 3CPXA 1ZG9A 3IC1A 3ISXA 3RAMA 3DLJA 5HVFA 4MCQA 4PXDA 5ELYA 3KGQA 3FJUA 4R76A 1VHOA 2RFHA 3KI9A 1HEEA 3GUXA 3SJFA 2ZEOA 5LRKA 2AFMA 4UIAA 1OBRA 2Q43A 1BLLE 4EFDA 3NH8A 4X8IA 2PJBA 5HVHA 3BI1A 3FX6A 3KR4A 2O53A 3D7FA 5K8MA 2GU2A 5CPAA 3LMSA 3WC7A 3N5FA 2CF4A 3B2YA 1ARMA 2V77A 4B6ZA 4H2KA 4P4BA 2PJ7A 2XEJA 4NGSA 3KASA 1GYTA 1CPXA 1Y0YA 1LOKA 2GLJA 1LFWA 5LYIA 2EWBA 4ZY2A 2ZOFA 1VIXA 3CDXA 4Q7AA 3B3CA 3SJXA 2ZEMA 2RB7A 4WJBA 3HLPA 4MHPA 3SJEA 1ZLHA 1ZG8A 1LANA 2AFOA 4A38A 2CTBA 3ISZA 3T8WA 3K9TA 1CX8A 4OC3A 7CPAA 4MCRA 3H8EA 4P4EA 2BOAA 4PPZA 1XRYA 4ZX8A 4P4JA 1YMEA 3FECA 3V38A 1HDUA 2AFXA 1R3NA 4NGNA 3SI2A 3WT4A 5LYFA 4JZ0A 2VL1A 4LQGA 5CBMA 4OP4A 2ZENA 4K3NA 4NJRA 1NSAA 4CPAA 2O4HA 2AFUA 3KR5A 4NJQA 5DS0A 1YW4A 5LYLA 3B3WA 2HB6A 4W9YA 3S9MA 3KL9A 4FWUA 4P4FA 2PIYA 3V7ZA 3LWUA 1ZG7A 3B35A 2PJ8A 4A37A 4F8ZA 4ZX9A 3IJ3A 1CP7A 2ZEHA 5LRGA 2POKA 1R43A 5F09A 3IFEA 1ARLA 2PJ4A 4PQAA 5JGFA 3B3TA 1QMUA 1CPSA 3DGVA 2PJ3A 3FEDA 3VATA 2PRQA 1UWYA 2ZEPA 4IK2A 2NSMA 3IO1A 4PXBA 1FNOA 4MHNA 4NGRA 4OKOA 2AFSA 1Q7LA 3KHXA 2J9AA 1YSJA 1Z8LA 4O23A 1AMPA 2C6CA 3CT9A 1ELMP 2QVPA 2JBKA 3PBBA 4F9VA 2ZEEA 1TKFA 2FVGA 3B3VA 3FMCA 3PB4X 1DTDA 5LYDA 5JM6A 2QJ8A 4OC0A 3SJGA 2PJ5A 3PB8X 2PJ2A 4GM5A 1F2OA 1BPMA 4JYWA 4MRIA 1JQGA 4NGQA 3B3SA 2ANPA 3NH4A 5J1QA 2Q4ZA 2V8GA 3GLJA 2PJCA 3FH4A 2G9DA 2BO9A 3S9LA 2PJ1A 2V8HA 2PJ9A 2C1CA 2F7VA 8CPAA 4OC2A 2C6GA 1FT7A 4FAIA 2EK9A 4MMOA 2Q51A 1CG2A 1CP6A 3MN8A 4OC5A 5I4MA 4Z65A 3VARA 1Y0RA 4X3RA 4OC1A 1IY7A 2HC9A 1LCPA 4UIBA 3PRTA 2JBJA 3KHZA 3NFZA 4RUHA 2IJZA 4UEEA 2GLFA 3PB6X 1F2PA 1ZLIA 3PB7X 1F57A 2ABZA 4MHZA 2OOTA 3D67A 2GREA 1ELLP 2IMOA 2PE3A 1KWMA 3BXMA 4P10A 4YU9A 4R6TA 3FEEA 2PCUA
chains in the Genus database with same CATH superfamily
1P0HA 3L2NA 4KOYA 3MGDA 1U6MA 4DJLA 1TIQA 1Q2YA 2HQYA 2PRBA 4C2YA 4ONWA 2FT0A 4E2AA 1MK4A 1Z4RA 4U5YA 3VWDA 4R8FA 4ZI6A 2VBQA 4G1PA 3WABA 5LRJA 2BEIA 4R7MA 1M4IA 3PB9X 4CRZB 3LACA 4ZY1A 3BI0A 1Z5RA 1Z4EA 2DEAA 2HUZA 3S6HA 1YLOA 2ODFA 3PFOA 3MRUA 2ZELA 3BLNA 4UFVA 2C6PA 4ORFA 1CJWA 4IF5A 1CBXA 4NFRA 4II9A 2PVWA 4LQ6A 5DWNA 4YRHA 2EK8A 3UY5A 4XNHB 3VH9A 1BPNA 3FVLA 3JVNA 4PXCA 2ZOGA 2WYRA 2WPXA 3P2FA 1Z8XA 2AFWA 2BCOA 5HVGA 2V8DA 1IOIA 5KTDA 1PYTB 2EO8A 2GE3A 2YNCC 5K8NA 3GB0A 4NEXA 4UCPA 5K8OA 4OIWA 4C7IA 2VZYA 2ARHA 1YGHA 5IB0A 4UWIA 2VI7A 5IB9A 5JPHA 4XPLA 3I1UA 3IWWA 3CPAA 3JRUA 4UEZA 4AVCA 1L0CA 1QQ9A 4UBRA 3B7IA 1MJ9A 4WWVA 4A39A 5KTCA 3FXTA 1MJAA 4FD7A 3A9LA 1XOVA 2Q7SA 2D4OA 4TNUA 2QIRA 4GS4A 4XPDC 1YK3A 5H84A 1IIDA 4OADA 3TX8A 4BBHA 3W6SA 2PJAA 4A30A 2PIZA 4OMEA 2JEWA 1LAMA 3QAHA 4KS9A 3RZAA 3RNZA 3ZJ0A 5AG4A 4IHMA 2ZEGA 4MCSA 2GFQA 4B14A 1PCAA 3HUVA 5D29A 4M6IA 2AFZA 4L89A 4DYOA 1B87A 1EE3P 3WC5A 2G3TA 1BOBA 3S9NA 1LAPA 1XF8A 1YW6A 1TF8A 1VGYA 2G3AA 3NH5A 4OC4A 2B5GB 4X2TA 4EWTA 1S7LA 1XBUA 1IGBA 4KOSA 3F8KA 2F8HA 4B10A 3PFEA 2PJ0A 4R57A 4H89A 2XEGA 2J8RA 2ZEFA 3FF3A 3KKWA 3KQZA 4NGPA 3KQXA 3NA6A 4ZYQA 4JXQA 2HV2A 3W91A 4C68A 4P4DA 3CXSA 4DUKA 3GKRA 4X5KA 3D4UA 1GHEA 4IAVA 1Y7EA 3WC6A 2VXKA 4EVYA 2JDCA 4AXVA 3FB3A 2Q4VA 5C88A 3IEHA 2XEFA 1QSMA 5A28A 1HDQA 3D7DA 3H4QA 2Q4YA 3PBEA 4KUAA 4NGTA 3RBUA 2PVVA 1XJOA 2ZEDA 4FBEA 1AYEA 1Z8WA 3D68A 4UF4A 4YWYA 4BD9A 2PJ6A 2IQ6A 4UEFA 4KSIA 2CIJA 2FE7A 2CTCA 3PEIA 1XEBA 1XMBA 1XFOA 4UWJA 4A94A 1DE4C 5CNPA 4QUSA 3NE8A 4HNYB 4JJXA 1P4NA 4MHDA 2P6FA 5F46A 1TXRA 3C26A 3D66A 3H8GA 4F9UA 3KZWA 4FD4A 5HXDA 2OR4A 2QECA 4HKFA 4TWEA 2B4BA 4NF1A 1VHEA 3E0KA 4J3GA 4OIDA 1ZO0A 2GANA 4PSXA 2FIWA 3DNSA 4MFLA 3D7HA 4NCZA 3T90A 3TO9A 4YGOA 4KUBA 3TTHA 4ZY0A 1TF9A 4FUUA 3JUWA 2NYQA 2J8NA 5J8FA 1M4LA 1RTQA 3D2MA 4B11A 1BAVA 1S7KA 1IB1E 2FS5A 2V8VA 4M6HA 4P6YA 4P44A 5AGEA 3SXOA 4GXHA 3IIBA 3SI1A 4CYPA 3TE4A 2DPTA 2CNMA 2QYVA 2Z0ZA 4MXUA 1H8LA 1KUXA 2AE6A 4Y49C 3R9EA 4MCPA 3SI0A 4P45A 5JQ4A 3R9GA 4PXEA 3TCVA 5THWA 1YREA 1TKHA 4NGMA 2R8VA 4XPDB 1A2ZA 1Z8TA 2I3CA 6CPAA 2WPWA 3V8IA 4HNXB 2XEIA 1VKCA 3IWGA 3K2KA 4KZTA 3BHXA 3H8FA 3D7GA 4MHYA 5EBVA 1Z2LA 5JH9A 3N7ZA 2YNDA 4KOTA 3QNVA 3IWEA 4EMEA 3TC8A 4AG9A 4CAEA 4P4IA 5K8PA 1TKJA 2WZNA 2Q44A 2JLMA 2PR1A 3CPXA 1ZG9A 4OLLA 1VHSA 4KVXA 3IC1A 2B4DB 3ISXA 3RAMA 3DLJA 5HVFA 4MCQA 4PXDA 2CXAA 5ELYA 4CGMA 1YVKA 3KGQA 4CAWA 2ZW5A 2K5TA 3FJUA 4MFZA 4KOUA 1MJBA 1NMTA 3TFYA 4R76A 4M85A 5AG6A 2QMLA 4NSQA 4A33A 4MFKA 1VHOA 2DPSA 3D2PA 2RFHA 4U9YA 3KI9A 1HEEA 4C2XA 3GUXA 3BJ7A 3SJFA 3S6KA 3T9YA 2ZEOA 5LRKA 2ZW6A 2AFMA 4UIAA 4A95A 4CGPA 1OBRA 2Q43A 4M3SA 2WUUA 1BLLE 4Q38A 1NSLA 2KCWA 4EFDA 1QSNA 3NH8A 4X8IA 2PJBA 1CM0A 5H86A 3IGRA 4H6ZA 1QSRA 1RXTA 4R9MA 2YNEA 3BI1A 3FX6A 5HVHA 4MBUA 3KR4A 2ZW7A 4FD5A 5G21A 5G20A 2VQYA 5I0CA 3D8PA 2O53A 3D7FA 3TOAA 5K8MA 2A4NA 2GU2A 1S5KA 5CPAA 3LMSA 3WC7A 3N5FA 1K4JA 1J4JA 5IV0A 3DR8A 2CF4A 2I79A 1ARMA 3B2YA 4QC6A 2V77A 1M44A 4B6ZA 4H2KA 4P4BA 2FCKA 2PJ7A 2Y0MA 4A32A 5E96A 2XEJA 2B5GA 1N71A 4OAEA 3S6GA 4BMHA 4NXYA 3S6FA 1S7FA 3WR7A 4NGSA 2D4PA 4UCNA 3KASA 4F0XA 3R9FA 1GYTA 1CPXA 2Z11A 4CS0B 1Y9WA 2B3UA 1Y0YA 1LOKA 4HPSA 3TT2A 2GLJA 1LFWA 3RO0A 5LYIA 2EWBA 4ZY2A 1WK4A 3TOBA 3QB8A 2PQ8A 2ZOFA 5IX3A 2NMTA 4U9ZA 1VIXA 4UFXA 5GCNA 4B5PB 3CDXA 4Q7AA 3PGPA 3B3CA 4KORA 3SJXA 2BUEA 2ZEMA 2RB7A 5G1ZA 4WJBA 1S60A 2YNCA 3CXQA 3HLPA 4MI4A 1ZLHA 1ZG8A 1LANA 4MHPA 4XNHC 5AG7A 3SJEA 2AFOA 4CYNA 2FSRA 2Z10A 4A38A 2CTBA 4ZBGA 3ISZA 3CXPA 3K9TA 3T8WA 4CYOA 1Q2CA 1CX8A 4OC3A 2Q7BA 4KOWA 7CPAA 4MCRA 3H8EA 4P4EA 2BOAA 4PPZA 3K9UA 3EC4A 4MJ8A 4YFJA 1XRYA 2CNTA 4ZX8A 4P4JA 3FIXA 1YMEA 3SHPA 3FECA 3V38A 4IUSA 1HDUA 2AFXA 1R3NA 5J8CA 1BO4A 4NGNA 3SI2A 3WT4A 5LYFA 3NE7A 1M4DA 4M6GA 2PSWA 2OB0A 2OZHA 4JZ0A 4KSFA 2VL1A 1AUGA 3GIUA 4LQGA 5C82A 5CBMA 4KLWA 1ON0A 2J8MA 4OP4A 4Y49B 2FL4A 4MFPA 1LRZA 1IICA 2ZENA 1S7NA 4PSWA 4DNCA 4K3NA 4NJRA 2BSWA 1Q2DA 3EO4A 4JXRA 1I21A 1NSAA 1YLEA 4CPAA 2O4HA 2AFUA 4R3LA 3KR5A 3H5ZA 4AG7A 2YGWA 4NJQA 5DS0A 2JDDA 1YW4A 1I12A 1V0CA 4E8OA 5G22A 3QAYA 5LYLA 3B3WA 3SXNA 5HMNA 2HB6A 4W9YA 3S9MA 4LX9A 2Z3LA 3KL9A 4FWUA 3TO7A 3CZXA 2CNSA 2IL4A 1JWQA 2PIYA 4P4FA 4E0AA 5F48A 3V7ZA 2PR8A 3LWUA 4QBJA 3EXNA 4CYQA 2C27A 2X7BA 1ZG7A 2Z3KA 3B35A 3I3GA 2PJ8A 4A37A 4F8ZA 2ATRA 4CRYB 1S3ZA 4C2ZA 4ZX9A 4LUAA 3IJ3A 3GY9A 3GYAA 1CP7A 2ZEHA 3F5BA 5LRGA 4CGNA 2POKA 4I49A 4XPKA 1SQHA 1R43A 2P0WA 2I00A 4K30A 2Z3OA 4QB9A 5F09A 4MY0A 4FD6A 3IFEA 5BWAB 3EY5A 1ARLA 3I9SA 4R3KA 2R7HA 2R98A 2EBJA 5KTAA 1XE4A 2PJ4A 3JTKA 4AB7A 4PQAA 5JGFA 3B3TA 1QMUA 3OWCA 1FY7A 1CPSA 3DGVA 2PJ3A 1X12A 3FEDA 5D8NA 3VATA 3FYNA 1KZFA 2FIAA 4CAVA 2P6GA 4MFQA 2EVNA 2PRQA 4MFJA 1UWYA 2R1IA 2O28A 2ZEPA 4IK2A 2NSMA 3IO1A 4B13A 4CGLA 3G8WA 1FNOA 4PXBA 4MHNA 1XIXA 4NGRA 1YR0A 2DF5A 4OKOA 5AG5A 1Y7RA 3DSBA 2AFSA 1Q7LA 3LODA 3KHXA 2PC1A 2J9AA 4CAFA 1YSJA 4MY3A 1B6BA 1KUVA 4A2ZA 4C7HA 1Z8LA 4RI1A 4F6AA 4O23A 2B58A 4AVAA 4PK3A 1KUYA 1AMPA 2C6CA 2G0BA 1ELMP 2P6EA 2OZGA 2QVPA 3CT9A 4CAXA 4HNWB 4ONUA 3G3SA 2JBKA 3PBBA 4F9VA 1QSTA 2ZEEA 2VEZA 4L8AA 2Z3PA 1TKFA 3W6XA 2FVGA 3B3VA 3FMCA 3PB4X 1DTDA 5LYDA 5JM6A 2QJ8A 5EC4A 3PZJA 4ZGYB 1IYLA 4KSAA 4OC0A 3SJGA 2PJ5A 2REEA 2GIVA 3PB8X 1NE9A 2PJ2A 4GM5A 3TO6A 2ZPAA 1F2OA 1IU8A 1BPMA 4JYWA 4MRIA 1JQGA 4NGQA 1QSOA 2BL1A 3B3SA 2ANPA 2OZUA 3NH4A 1XMTA 4AVBA 5J1QA 3P2HA 2Q04A 2Q4ZA 5ISVA 2V8GA 3GLJA 2PJCA 4UA3A 3FRMA 2ZXVA 2G9DA 3FH4A 2BO9A 2OH1A 2WSAA 2CY2A 1PUAA 3B8GA 2PJ1A 2V8HA 3S9LA 4UFWA 2PJ9A 1X10A 2C1CA 2VZZA 3RYOA 1IOFA 4JD6A 5A27A 4B12A 2Z3MA 2F7VA 8CPAA 3LD2A 2RC4A 4OC2A 2C6GA 2JEVA 4KOVA 1FT7A 4RN7A 3PP9A 4KLVA 4FAIA 4B5PA 2PDOA 1R57A 2EK9A 1UFHA 3FBUA 2Q51A 1CG2A 1CP6A 2H5MA 1YX0A 3MN8A 4MMOA 4OC5A 4PK2A 5I4MA 4Z65A 1RO5A 3FNCA 4R87A 4Q36A 4JWPA 3R95A 1I1DA 1PU9A 3VARA 4RS2A 5F47A 1Y0RA 3F0AA 4OC1A 4UCMA 4X3RA 5HH1A 4F0YA 1IY7A 2HC9A 4B5OA 1LCPA 4UIBA 3PRTA 1YVOA 2DXQA 2JBJA 4KOXA 4RUHA 3IU2A 3KHZA 2B4DA 2Q0YA 3NFZA 3R1KA 2IJZA 3DDDA 3EFAA 2REFA 2GLFA 3PB6X 4UEEA 2Z3NA 5FVJA 1F2PA 2OU2A 1OZPA 4QVTA 2EUIA 5F49A 1ZLIA 3PB7X 4KVME 1WWZA 2B3VA 2ZW4A 1Y9KA 1F57A 2ABZA 3R96A 1YQEA 4MHZA 2FXFA 4KVOE 4CGOA 5DWMA 2OOTA 3VWEA 3D67A 1IYKA 4PV6A 4H6UA 3ZZIA 2GREA 4BINA 3D3SA 1ELLP 4JLYA 4A31A 2IMOA 2PE3A 3DR6A 1M1DA 3IU1A 1KWMA 3BXMA 4P10A 1M4GA 4YU9A 5EMIA 3BJ8A 1Z9UA 4R6TA 2F5IA 2AJ6A 3FEEA 2PCUA
chains in the Genus database with same CATH topology
3L2NA 4DJLA 4ONWA 4R8FA 4ZI6A 4G1PA 3WABA 5LRJA 4R7MA 3PB9X 4ZY1A 3BI0A 1Z5RA 2DEAA 1YLOA 3PFOA 3MRUA 2ZELA 2C6PA 4NFRA 1CBXA 2PVWA 2EK8A 3VH9A 1BPNA 3FVLA 4PXCA 2ZOGA 2WYRA 2AFWA 2BCOA 5HVGA 2V8DA 1PYTB 5K8NA 3GB0A 5K8OA 4OIWA 5IB9A 3I1UA 3IWWA 3CPAA 3JRUA 4UEZA 1QQ9A 4WWVA 4A39A 3B7IA 3SI0A 5D8NA 4TNUA 3TX8A 2PJAA 2PIZA 4OMEA 2JEWA 1LAMA 3RZAA 4IHMA 2ZEGA 4MCSA 1PCAA 3HUVA 5D29A 2AFZA 4DYOA 3WC5A 1EE3P 3S9NA 1LAPA 1YW6A 1TF8A 1VGYA 4OC4A 3NH5A 4X2TA 4EWTA 1XBUA 1IGBA 2F8HA 3PFEA 2PJ0A 2XEGA 2ZEFA 3FF3A 3KQZA 4NGPA 3KQXA 3NA6A 4ZYQA 4P4DA 4DUKA 3D4UA 4IAVA 1Y7EA 3WC6A 4AXVA 3IEHA 2XEFA 1HDQA 3D7DA 3PBEA 4NGTA 3RBUA 2PVVA 1XJOA 2ZEDA 4FBEA 1AYEA 3D68A 4UF4A 4YWYA 4BD9A 2PJ6A 2IQ6A 4UEFA 4KSIA 2CIJA 2CTCA 3PEIA 1XMBA 1XFOA 4A94A 1DE4C 1TXRA 3D66A 3H8GA 4F9UA 3KZWA 5HXDA 2OR4A 4TWEA 1VHEA 4OIDA 3D7HA 4ZY0A 1TF9A 4FUUA 2NYQA 1M4LA 1RTQA 1BAVA 2V8VA 4P44A 4P6YA 3IIBA 3SI1A 2QYVA 4MXUA 1H8LA 4MCPA 4P45A 4PXEA 5THWA 1TKHA 4NGMA 2I3CA 6CPAA 2XEIA 3K2KA 4MHYA 3BHXA 3H8FA 3D7GA 5JH9A 1Z2LA 3QNVA 4EMEA 3TC8A 4P4IA 5K8PA 1TKJA 2WZNA 3CPXA 1ZG9A 3IC1A 3ISXA 3RAMA 3DLJA 5HVFA 4MCQA 4PXDA 5ELYA 3KGQA 3FJUA 4R76A 1VHOA 2RFHA 3KI9A 1HEEA 3GUXA 3SJFA 2ZEOA 5LRKA 2AFMA 4UIAA 1OBRA 2Q43A 1BLLE 4EFDA 3NH8A 4X8IA 2PJBA 5HVHA 3BI1A 3FX6A 3KR4A 2O53A 3D7FA 5K8MA 2GU2A 5CPAA 3LMSA 3WC7A 3N5FA 2CF4A 3B2YA 1ARMA 2V77A 4B6ZA 4H2KA 4P4BA 2PJ7A 2XEJA 4NGSA 3KASA 1GYTA 1CPXA 1Y0YA 1LOKA 2GLJA 1LFWA 5LYIA 2EWBA 4ZY2A 2ZOFA 1VIXA 3CDXA 4Q7AA 3B3CA 3SJXA 2ZEMA 2RB7A 4WJBA 3HLPA 4MHPA 3SJEA 1ZLHA 1ZG8A 1LANA 2AFOA 4A38A 2CTBA 3ISZA 3T8WA 3K9TA 1CX8A 4OC3A 7CPAA 4MCRA 3H8EA 4P4EA 2BOAA 4PPZA 1XRYA 4ZX8A 4P4JA 1YMEA 3FECA 3V38A 1HDUA 2AFXA 1R3NA 4NGNA 3SI2A 3WT4A 5LYFA 4JZ0A 2VL1A 4LQGA 5CBMA 4OP4A 2ZENA 4K3NA 4NJRA 1NSAA 4CPAA 2O4HA 2AFUA 3KR5A 4NJQA 5DS0A 1YW4A 5LYLA 3B3WA 2HB6A 4W9YA 3S9MA 3KL9A 4FWUA 4P4FA 2PIYA 3V7ZA 3LWUA 1ZG7A 3B35A 2PJ8A 4A37A 4F8ZA 4ZX9A 3IJ3A 1CP7A 2ZEHA 5LRGA 2POKA 1R43A 5F09A 3IFEA 1ARLA 2PJ4A 4PQAA 5JGFA 3B3TA 1QMUA 1CPSA 3DGVA 2PJ3A 3FEDA 3VATA 2PRQA 1UWYA 2ZEPA 4IK2A 2NSMA 3IO1A 4PXBA 1FNOA 4MHNA 4NGRA 4OKOA 2AFSA 1Q7LA 3KHXA 2J9AA 1YSJA 1Z8LA 4O23A 1AMPA 2C6CA 3CT9A 1ELMP 2QVPA 2JBKA 3PBBA 4F9VA 2ZEEA 1TKFA 2FVGA 3B3VA 3FMCA 3PB4X 1DTDA 5LYDA 5JM6A 2QJ8A 4OC0A 3SJGA 2PJ5A 3PB8X 2PJ2A 4GM5A 1F2OA 1BPMA 4JYWA 4MRIA 1JQGA 4NGQA 3B3SA 2ANPA 3NH4A 5J1QA 2Q4ZA 2V8GA 3GLJA 2PJCA 3FH4A 2G9DA 2BO9A 3S9LA 2PJ1A 2V8HA 2PJ9A 2C1CA 2F7VA 8CPAA 4OC2A 2C6GA 1FT7A 4FAIA 2EK9A 4MMOA 2Q51A 1CG2A 1CP6A 3MN8A 4OC5A 5I4MA 4Z65A 3VARA 1Y0RA 4X3RA 4OC1A 1IY7A 2HC9A 1LCPA 4UIBA 3PRTA 2JBJA 3KHZA 3NFZA 4RUHA 2IJZA 4UEEA 2GLFA 3PB6X 1F2PA 1ZLIA 3PB7X 1F57A 2ABZA 4MHZA 2OOTA 3D67A 2GREA 1ELLP 2IMOA 2PE3A 1KWMA 3BXMA 4P10A 4YU9A 4R6TA 3FEEA 2PCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2N A;  4DJL A;  4ONW A;  4R8F A;  4ZI6 A;  4G1P A;  3WAB A;  5LRJ A;  4R7M A;  3PB9 X;  4ZY1 A;  3BI0 A;  1Z5R A;  2DEA A;  1YLO A;  3PFO A;  3MRU A;  2ZEL A;  2C6P A;  4NFR A;  1CBX A;  2PVW A;  2EK8 A;  3VH9 A;  1BPN A;  3FVL A;  4PXC A;  2ZOG A;  2WYR A;  2AFW A;  2BCO A;  5HVG A;  2V8D A;  1PYT B;  5K8N A;  3GB0 A;  5K8O A;  4OIW A;  5IB9 A;  3I1U A;  3IWW A;  3CPA A;  3JRU A;  4UEZ A;  1QQ9 A;  4WWV A;  4A39 A;  3B7I A;  3SI0 A;  5D8N A;  4TNU A;  3TX8 A;  2PJA A;  2PIZ A;  4OME A;  2JEW A;  1LAM A;  3RZA A;  4IHM A;  2ZEG A;  4MCS A;  1PCA A;  3HUV A;  5D29 A;  2AFZ A;  4DYO A;  3WC5 A;  1EE3 P;  3S9N A;  1LAP A;  1YW6 A;  1TF8 A;  1VGY A;  4OC4 A;  3NH5 A;  4X2T A;  4EWT A;  1XBU A;  1IGB A;  2F8H A;  3PFE A;  2PJ0 A;  2XEG A;  2ZEF A;  3FF3 A;  3KQZ A;  4NGP A;  3KQX A;  3NA6 A;  4ZYQ A;  4P4D A;  4DUK A;  3D4U A;  4IAV A;  1Y7E A;  3WC6 A;  4AXV A;  3IEH A;  2XEF A;  1HDQ A;  3D7D A;  3PBE A;  4NGT A;  3RBU A;  2PVV A;  1XJO A;  2ZED A;  4FBE A;  1AYE A;  3D68 A;  4UF4 A;  4YWY A;  4BD9 A;  2PJ6 A;  2IQ6 A;  4UEF A;  4KSI A;  2CIJ A;  2CTC A;  3PEI A;  1XMB A;  1XFO A;  4A94 A;  1DE4 C;  1TXR A;  3D66 A;  3H8G A;  4F9U A;  3KZW A;  5HXD A;  2OR4 A;  4TWE A;  1VHE A;  4OID A;  3D7H A;  4ZY0 A;  1TF9 A;  4FUU A;  2NYQ A;  1M4L A;  1RTQ A;  1BAV A;  2V8V A;  4P44 A;  4P6Y A;  3IIB A;  3SI1 A;  2QYV A;  4MXU A;  1H8L A;  4MCP A;  4P45 A;  4PXE A;  5THW A;  1TKH A;  4NGM A;  2I3C A;  6CPA A;  2XEI A;  3K2K A;  4MHY A;  3BHX A;  3H8F A;  3D7G A;  5JH9 A;  1Z2L A;  3QNV A;  4EME A;  3TC8 A;  4P4I A;  5K8P A;  1TKJ A;  2WZN A;  3CPX A;  1ZG9 A;  3IC1 A;  3ISX A;  3RAM A;  3DLJ A;  5HVF A;  4MCQ A;  4PXD A;  5ELY A;  3KGQ A;  3FJU A;  4R76 A;  1VHO A;  2RFH A;  3KI9 A;  1HEE A;  3GUX A;  3SJF A;  2ZEO A;  5LRK A;  2AFM A;  4UIA A;  1OBR A;  2Q43 A;  1BLL E;  4EFD A;  3NH8 A;  4X8I A;  2PJB A;  5HVH A;  3BI1 A;  3FX6 A;  3KR4 A;  2O53 A;  3D7F A;  5K8M A;  2GU2 A;  5CPA A;  3LMS A;  3WC7 A;  3N5F A;  2CF4 A;  3B2Y A;  1ARM A;  2V77 A;  4B6Z A;  4H2K A;  4P4B A;  2PJ7 A;  2XEJ A;  4NGS A;  3KAS A;  1GYT A;  1CPX A;  1Y0Y A;  1LOK A;  2GLJ A;  1LFW A;  5LYI A;  2EWB A;  4ZY2 A;  2ZOF A;  1VIX A;  3CDX A;  4Q7A A;  3B3C A;  3SJX A;  2ZEM A;  2RB7 A;  4WJB A;  3HLP A;  4MHP A;  3SJE A;  1ZLH A;  1ZG8 A;  1LAN A;  2AFO A;  4A38 A;  2CTB A;  3ISZ A;  3T8W A;  3K9T A;  1CX8 A;  4OC3 A;  7CPA A;  4MCR A;  3H8E A;  4P4E A;  2BOA A;  4PPZ A;  1XRY A;  4ZX8 A;  4P4J A;  1YME A;  3FEC A;  3V38 A;  1HDU A;  2AFX A;  1R3N A;  4NGN A;  3SI2 A;  3WT4 A;  5LYF A;  4JZ0 A;  2VL1 A;  4LQG A;  5CBM A;  4OP4 A;  2ZEN A;  4K3N A;  4NJR A;  1NSA A;  4CPA A;  2O4H A;  2AFU A;  3KR5 A;  4NJQ A;  5DS0 A;  1YW4 A;  5LYL A;  3B3W A;  2HB6 A;  4W9Y A;  3S9M A;  3KL9 A;  4FWU A;  4P4F A;  2PIY A;  3V7Z A;  3LWU A;  1ZG7 A;  3B35 A;  2PJ8 A;  4A37 A;  4F8Z A;  4ZX9 A;  3IJ3 A;  1CP7 A;  2ZEH A;  5LRG A;  2POK A;  1R43 A;  5F09 A;  3IFE A;  1ARL A;  2PJ4 A;  4PQA A;  5JGF A;  3B3T A;  1QMU A;  1CPS A;  3DGV A;  2PJ3 A;  3FED A;  3VAT A;  2PRQ A;  1UWY A;  2ZEP A;  4IK2 A;  2NSM A;  3IO1 A;  4PXB A;  1FNO A;  4MHN A;  4NGR A;  4OKO A;  2AFS A;  1Q7L A;  3KHX A;  2J9A A;  1YSJ A;  1Z8L A;  4O23 A;  1AMP A;  2C6C A;  3CT9 A;  1ELM P;  2QVP A;  2JBK A;  3PBB A;  4F9V A;  2ZEE A;  1TKF A;  2FVG A;  3B3V A;  3FMC A;  3PB4 X;  1DTD A;  5LYD A;  5JM6 A;  2QJ8 A;  4OC0 A;  3SJG A;  2PJ5 A;  3PB8 X;  2PJ2 A;  4GM5 A;  1F2O A;  1BPM A;  4JYW A;  4MRI A;  1JQG A;  4NGQ A;  3B3S A;  2ANP A;  3NH4 A;  5J1Q A;  2Q4Z A;  2V8G A;  3GLJ A;  2PJC A;  3FH4 A;  2G9D A;  2BO9 A;  3S9L A;  2PJ1 A;  2V8H A;  2PJ9 A;  2C1C A;  2F7V A;  8CPA A;  4OC2 A;  2C6G A;  1FT7 A;  4FAI A;  2EK9 A;  4MMO A;  2Q51 A;  1CG2 A;  1CP6 A;  3MN8 A;  4OC5 A;  5I4M A;  4Z65 A;  3VAR A;  1Y0R A;  4X3R A;  4OC1 A;  1IY7 A;  2HC9 A;  1LCP A;  4UIB A;  3PRT A;  2JBJ A;  3KHZ A;  3NFZ A;  4RUH A;  2IJZ A;  4UEE A;  2GLF A;  3PB6 X;  1F2P A;  1ZLI A;  3PB7 X;  1F57 A;  2ABZ A;  4MHZ A;  2OOT A;  3D67 A;  2GRE A;  1ELL P;  2IMO A;  2PE3 A;  1KWM A;  3BXM A;  4P10 A;  4YU9 A;  4R6T A;  3FEE A;  2PCU A; 
#chains in the Genus database with same CATH topology
 1P0H A;  3L2N A;  4KOY A;  3MGD A;  1U6M A;  4DJL A;  1TIQ A;  1Q2Y A;  2HQY A;  2PRB A;  4C2Y A;  4ONW A;  2FT0 A;  4E2A A;  1MK4 A;  1Z4R A;  4U5Y A;  3VWD A;  4R8F A;  4ZI6 A;  2VBQ A;  4G1P A;  3WAB A;  5LRJ A;  2BEI A;  4R7M A;  1M4I A;  3PB9 X;  4CRZ B;  3LAC A;  4ZY1 A;  3BI0 A;  1Z5R A;  1Z4E A;  2DEA A;  2HUZ A;  3S6H A;  1YLO A;  2ODF A;  3PFO A;  3MRU A;  2ZEL A;  3BLN A;  4UFV A;  2C6P A;  4ORF A;  1CJW A;  4IF5 A;  1CBX A;  4NFR A;  4II9 A;  2PVW A;  4LQ6 A;  5DWN A;  4YRH A;  2EK8 A;  3UY5 A;  4XNH B;  3VH9 A;  1BPN A;  3FVL A;  3JVN A;  4PXC A;  2ZOG A;  2WYR A;  2WPX A;  3P2F A;  1Z8X A;  2AFW A;  2BCO A;  5HVG A;  2V8D A;  1IOI A;  5KTD A;  1PYT B;  2EO8 A;  2GE3 A;  2YNC C;  5K8N A;  3GB0 A;  4NEX A;  4UCP A;  5K8O A;  4OIW A;  4C7I A;  2VZY A;  2ARH A;  1YGH A;  5IB0 A;  4UWI A;  2VI7 A;  5IB9 A;  5JPH A;  4XPL A;  3I1U A;  3IWW A;  3CPA A;  3JRU A;  4UEZ A;  4AVC A;  1L0C A;  1QQ9 A;  4UBR A;  3B7I A;  1MJ9 A;  4WWV A;  4A39 A;  5KTC A;  3FXT A;  1MJA A;  4FD7 A;  3A9L A;  1XOV A;  2Q7S A;  2D4O A;  4TNU A;  2QIR A;  4GS4 A;  4XPD C;  1YK3 A;  5H84 A;  1IID A;  4OAD A;  3TX8 A;  4BBH A;  3W6S A;  2PJA A;  4A30 A;  2PIZ A;  4OME A;  2JEW A;  1LAM A;  3QAH A;  4KS9 A;  3RZA A;  3RNZ A;  3ZJ0 A;  5AG4 A;  4IHM A;  2ZEG A;  4MCS A;  2GFQ A;  4B14 A;  1PCA A;  3HUV A;  5D29 A;  4M6I A;  2AFZ A;  4L89 A;  4DYO A;  1B87 A;  1EE3 P;  3WC5 A;  2G3T A;  1BOB A;  3S9N A;  1LAP A;  1XF8 A;  1YW6 A;  1TF8 A;  1VGY A;  2G3A A;  3NH5 A;  4OC4 A;  2B5G B;  4X2T A;  4EWT A;  1S7L A;  1XBU A;  1IGB A;  4KOS A;  3F8K A;  2F8H A;  4B10 A;  3PFE A;  2PJ0 A;  4R57 A;  4H89 A;  2XEG A;  2J8R A;  2ZEF A;  3FF3 A;  3KKW A;  3KQZ A;  4NGP A;  3KQX A;  3NA6 A;  4ZYQ A;  4JXQ A;  2HV2 A;  3W91 A;  4C68 A;  4P4D A;  3CXS A;  4DUK A;  3GKR A;  4X5K A;  3D4U A;  1GHE A;  4IAV A;  1Y7E A;  3WC6 A;  2VXK A;  4EVY A;  2JDC A;  4AXV A;  3FB3 A;  2Q4V A;  5C88 A;  3IEH A;  2XEF A;  1QSM A;  5A28 A;  1HDQ A;  3D7D A;  3H4Q A;  2Q4Y A;  3PBE A;  4KUA A;  4NGT A;  3RBU A;  2PVV A;  1XJO A;  2ZED A;  4FBE A;  1AYE A;  1Z8W A;  3D68 A;  4UF4 A;  4YWY A;  4BD9 A;  2PJ6 A;  2IQ6 A;  4UEF A;  4KSI A;  2CIJ A;  2FE7 A;  2CTC A;  3PEI A;  1XEB A;  1XMB A;  1XFO A;  4UWJ A;  4A94 A;  1DE4 C;  5CNP A;  4QUS A;  3NE8 A;  4HNY B;  4JJX A;  1P4N A;  4MHD A;  2P6F A;  5F46 A;  1TXR A;  3C26 A;  3D66 A;  3H8G A;  4F9U A;  3KZW A;  4FD4 A;  5HXD A;  2OR4 A;  2QEC A;  4HKF A;  4TWE A;  2B4B A;  4NF1 A;  1VHE A;  3E0K A;  4J3G A;  4OID A;  1ZO0 A;  2GAN A;  4PSX A;  2FIW A;  3DNS A;  4MFL A;  3D7H A;  4NCZ A;  3T90 A;  3TO9 A;  4YGO A;  4KUB A;  3TTH A;  4ZY0 A;  1TF9 A;  4FUU A;  3JUW A;  2NYQ A;  2J8N A;  5J8F A;  1M4L A;  1RTQ A;  3D2M A;  4B11 A;  1BAV A;  1S7K A;  1IB1 E;  2FS5 A;  2V8V A;  4M6H A;  4P6Y A;  4P44 A;  5AGE A;  3SXO A;  4GXH A;  3IIB A;  3SI1 A;  4CYP A;  3TE4 A;  2DPT A;  2CNM A;  2QYV A;  2Z0Z A;  4MXU A;  1H8L A;  1KUX A;  2AE6 A;  4Y49 C;  3R9E A;  4MCP A;  3SI0 A;  4P45 A;  5JQ4 A;  3R9G A;  4PXE A;  3TCV A;  5THW A;  1YRE A;  1TKH A;  4NGM A;  2R8V A;  4XPD B;  1A2Z A;  1Z8T A;  2I3C A;  6CPA A;  2WPW A;  3V8I A;  4HNX B;  2XEI A;  1VKC A;  3IWG A;  3K2K A;  4KZT A;  3BHX A;  3H8F A;  3D7G A;  4MHY A;  5EBV A;  1Z2L A;  5JH9 A;  3N7Z A;  2YND A;  4KOT A;  3QNV A;  3IWE A;  4EME A;  3TC8 A;  4AG9 A;  4CAE A;  4P4I A;  5K8P A;  1TKJ A;  2WZN A;  2Q44 A;  2JLM A;  2PR1 A;  3CPX A;  1ZG9 A;  4OLL A;  1VHS A;  4KVX A;  3IC1 A;  2B4D B;  3ISX A;  3RAM A;  3DLJ A;  5HVF A;  4MCQ A;  4PXD A;  2CXA A;  5ELY A;  4CGM A;  1YVK A;  3KGQ A;  4CAW A;  2ZW5 A;  2K5T A;  3FJU A;  4MFZ A;  4KOU A;  1MJB A;  1NMT A;  3TFY A;  4R76 A;  4M85 A;  5AG6 A;  2QML A;  4NSQ A;  4A33 A;  4MFK A;  1VHO A;  2DPS A;  3D2P A;  2RFH A;  4U9Y A;  3KI9 A;  1HEE A;  4C2X A;  3GUX A;  3BJ7 A;  3SJF A;  3S6K A;  3T9Y A;  2ZEO A;  5LRK A;  2ZW6 A;  2AFM A;  4UIA A;  4A95 A;  4CGP A;  1OBR A;  2Q43 A;  4M3S A;  2WUU A;  1BLL E;  4Q38 A;  1NSL A;  2KCW A;  4EFD A;  1QSN A;  3NH8 A;  4X8I A;  2PJB A;  1CM0 A;  5H86 A;  3IGR A;  4H6Z A;  1QSR A;  1RXT A;  4R9M A;  2YNE A;  3BI1 A;  3FX6 A;  5HVH A;  4MBU A;  3KR4 A;  2ZW7 A;  4FD5 A;  5G21 A;  5G20 A;  2VQY A;  5I0C A;  3D8P A;  2O53 A;  3D7F A;  3TOA A;  5K8M A;  2A4N A;  2GU2 A;  1S5K A;  5CPA A;  3LMS A;  3WC7 A;  3N5F A;  1K4J A;  1J4J A;  5IV0 A;  3DR8 A;  2CF4 A;  2I79 A;  1ARM A;  3B2Y A;  4QC6 A;  2V77 A;  1M44 A;  4B6Z A;  4H2K A;  4P4B A;  2FCK A;  2PJ7 A;  2Y0M A;  4A32 A;  5E96 A;  2XEJ A;  2B5G A;  1N71 A;  4OAE A;  3S6G A;  4BMH A;  4NXY A;  3S6F A;  1S7F A;  3WR7 A;  4NGS A;  2D4P A;  4UCN A;  3KAS A;  4F0X A;  3R9F A;  1GYT A;  1CPX A;  2Z11 A;  4CS0 B;  1Y9W A;  2B3U A;  1Y0Y A;  1LOK A;  4HPS A;  3TT2 A;  2GLJ A;  1LFW A;  3RO0 A;  5LYI A;  2EWB A;  4ZY2 A;  1WK4 A;  3TOB A;  3QB8 A;  2PQ8 A;  2ZOF A;  5IX3 A;  2NMT A;  4U9Z A;  1VIX A;  4UFX A;  5GCN A;  4B5P B;  3CDX A;  4Q7A A;  3PGP A;  3B3C A;  4KOR A;  3SJX A;  2BUE A;  2ZEM A;  2RB7 A;  5G1Z A;  4WJB A;  1S60 A;  2YNC A;  3CXQ A;  3HLP A;  4MI4 A;  1ZLH A;  1ZG8 A;  1LAN A;  4MHP A;  4XNH C;  5AG7 A;  3SJE A;  2AFO A;  4CYN A;  2FSR A;  2Z10 A;  4A38 A;  2CTB A;  4ZBG A;  3ISZ A;  3CXP A;  3K9T A;  3T8W A;  4CYO A;  1Q2C A;  1CX8 A;  4OC3 A;  2Q7B A;  4KOW A;  7CPA A;  4MCR A;  3H8E A;  4P4E A;  2BOA A;  4PPZ A;  3K9U A;  3EC4 A;  4MJ8 A;  4YFJ A;  1XRY A;  2CNT A;  4ZX8 A;  4P4J A;  3FIX A;  1YME A;  3SHP A;  3FEC A;  3V38 A;  4IUS A;  1HDU A;  2AFX A;  1R3N A;  5J8C A;  1BO4 A;  4NGN A;  3SI2 A;  3WT4 A;  5LYF A;  3NE7 A;  1M4D A;  4M6G A;  2PSW A;  2OB0 A;  2OZH A;  4JZ0 A;  4KSF A;  2VL1 A;  1AUG A;  3GIU A;  4LQG A;  5C82 A;  5CBM A;  4KLW A;  1ON0 A;  2J8M A;  4OP4 A;  4Y49 B;  2FL4 A;  4MFP A;  1LRZ A;  1IIC A;  2ZEN A;  1S7N A;  4PSW A;  4DNC A;  4K3N A;  4NJR A;  2BSW A;  1Q2D A;  3EO4 A;  4JXR A;  1I21 A;  1NSA A;  1YLE A;  4CPA A;  2O4H A;  2AFU A;  4R3L A;  3KR5 A;  3H5Z A;  4AG7 A;  2YGW A;  4NJQ A;  5DS0 A;  2JDD A;  1YW4 A;  1I12 A;  1V0C A;  4E8O A;  5G22 A;  3QAY A;  5LYL A;  3B3W A;  3SXN A;  5HMN A;  2HB6 A;  4W9Y A;  3S9M A;  4LX9 A;  2Z3L A;  3KL9 A;  4FWU A;  3TO7 A;  3CZX A;  2CNS A;  2IL4 A;  1JWQ A;  2PIY A;  4P4F A;  4E0A A;  5F48 A;  3V7Z A;  2PR8 A;  3LWU A;  4QBJ A;  3EXN A;  4CYQ A;  2C27 A;  2X7B A;  1ZG7 A;  2Z3K A;  3B35 A;  3I3G A;  2PJ8 A;  4A37 A;  4F8Z A;  2ATR A;  4CRY B;  1S3Z A;  4C2Z A;  4ZX9 A;  4LUA A;  3IJ3 A;  3GY9 A;  3GYA A;  1CP7 A;  2ZEH A;  3F5B A;  5LRG A;  4CGN A;  2POK A;  4I49 A;  4XPK A;  1SQH A;  1R43 A;  2P0W A;  2I00 A;  4K30 A;  2Z3O A;  4QB9 A;  5F09 A;  4MY0 A;  4FD6 A;  3IFE A;  5BWA B;  3EY5 A;  1ARL A;  3I9S A;  4R3K A;  2R7H A;  2R98 A;  2EBJ A;  5KTA A;  1XE4 A;  2PJ4 A;  3JTK A;  4AB7 A;  4PQA A;  5JGF A;  3B3T A;  1QMU A;  3OWC A;  1FY7 A;  1CPS A;  3DGV A;  2PJ3 A;  1X12 A;  3FED A;  5D8N A;  3VAT A;  3FYN A;  1KZF A;  2FIA A;  4CAV A;  2P6G A;  4MFQ A;  2EVN A;  2PRQ A;  4MFJ A;  1UWY A;  2R1I A;  2O28 A;  2ZEP A;  4IK2 A;  2NSM A;  3IO1 A;  4B13 A;  4CGL A;  3G8W A;  1FNO A;  4PXB A;  4MHN A;  1XIX A;  4NGR A;  1YR0 A;  2DF5 A;  4OKO A;  5AG5 A;  1Y7R A;  3DSB A;  2AFS A;  1Q7L A;  3LOD A;  3KHX A;  2PC1 A;  2J9A A;  4CAF A;  1YSJ A;  4MY3 A;  1B6B A;  1KUV A;  4A2Z A;  4C7H A;  1Z8L A;  4RI1 A;  4F6A A;  4O23 A;  2B58 A;  4AVA A;  4PK3 A;  1KUY A;  1AMP A;  2C6C A;  2G0B A;  1ELM P;  2P6E A;  2OZG A;  2QVP A;  3CT9 A;  4CAX A;  4HNW B;  4ONU A;  3G3S A;  2JBK A;  3PBB A;  4F9V A;  1QST A;  2ZEE A;  2VEZ A;  4L8A A;  2Z3P A;  1TKF A;  3W6X A;  2FVG A;  3B3V A;  3FMC A;  3PB4 X;  1DTD A;  5LYD A;  5JM6 A;  2QJ8 A;  5EC4 A;  3PZJ A;  4ZGY B;  1IYL A;  4KSA A;  4OC0 A;  3SJG A;  2PJ5 A;  2REE A;  2GIV A;  3PB8 X;  1NE9 A;  2PJ2 A;  4GM5 A;  3TO6 A;  2ZPA A;  1F2O A;  1IU8 A;  1BPM A;  4JYW A;  4MRI A;  1JQG A;  4NGQ A;  1QSO A;  2BL1 A;  3B3S A;  2ANP A;  2OZU A;  3NH4 A;  1XMT A;  4AVB A;  5J1Q A;  3P2H A;  2Q04 A;  2Q4Z A;  5ISV A;  2V8G A;  3GLJ A;  2PJC A;  4UA3 A;  3FRM A;  2ZXV A;  2G9D A;  3FH4 A;  2BO9 A;  2OH1 A;  2WSA A;  2CY2 A;  1PUA A;  3B8G A;  2PJ1 A;  2V8H A;  3S9L A;  4UFW A;  2PJ9 A;  1X10 A;  2C1C A;  2VZZ A;  3RYO A;  1IOF A;  4JD6 A;  5A27 A;  4B12 A;  2Z3M A;  2F7V A;  8CPA A;  3LD2 A;  2RC4 A;  4OC2 A;  2C6G A;  2JEV A;  4KOV A;  1FT7 A;  4RN7 A;  3PP9 A;  4KLV A;  4FAI A;  4B5P A;  2PDO A;  1R57 A;  2EK9 A;  1UFH A;  3FBU A;  2Q51 A;  1CG2 A;  1CP6 A;  2H5M A;  1YX0 A;  3MN8 A;  4MMO A;  4OC5 A;  4PK2 A;  5I4M A;  4Z65 A;  1RO5 A;  3FNC A;  4R87 A;  4Q36 A;  4JWP A;  3R95 A;  1I1D A;  1PU9 A;  3VAR A;  4RS2 A;  5F47 A;  1Y0R A;  3F0A A;  4OC1 A;  4UCM A;  4X3R A;  5HH1 A;  4F0Y A;  1IY7 A;  2HC9 A;  4B5O A;  1LCP A;  4UIB A;  3PRT A;  1YVO A;  2DXQ A;  2JBJ A;  4KOX A;  4RUH A;  3IU2 A;  3KHZ A;  2B4D A;  2Q0Y A;  3NFZ A;  3R1K A;  2IJZ A;  3DDD A;  3EFA A;  2REF A;  2GLF A;  3PB6 X;  4UEE A;  2Z3N A;  5FVJ A;  1F2P A;  2OU2 A;  1OZP A;  4QVT A;  2EUI A;  5F49 A;  1ZLI A;  3PB7 X;  4KVM E;  1WWZ A;  2B3V A;  2ZW4 A;  1Y9K A;  1F57 A;  2ABZ A;  3R96 A;  1YQE A;  4MHZ A;  2FXF A;  4KVO E;  4CGO A;  5DWM A;  2OOT A;  3VWE A;  3D67 A;  1IYK A;  4PV6 A;  4H6U A;  3ZZI A;  2GRE A;  4BIN A;  3D3S A;  1ELL P;  4JLY A;  4A31 A;  2IMO A;  2PE3 A;  3DR6 A;  1M1D A;  3IU1 A;  1KWM A;  3BXM A;  4P10 A;  1M4G A;  4YU9 A;  5EMI A;  3BJ8 A;  1Z9U A;  4R6T A;  2F5I A;  2AJ6 A;  3FEE A;  2PCU A; 
#chains in the Genus database with same CATH homology
 3L2N A;  4DJL A;  4ONW A;  4R8F A;  4ZI6 A;  4G1P A;  3WAB A;  5LRJ A;  4R7M A;  3PB9 X;  4ZY1 A;  3BI0 A;  1Z5R A;  2DEA A;  1YLO A;  3PFO A;  3MRU A;  2ZEL A;  2C6P A;  4NFR A;  1CBX A;  2PVW A;  2EK8 A;  3VH9 A;  1BPN A;  3FVL A;  4PXC A;  2ZOG A;  2WYR A;  2AFW A;  2BCO A;  5HVG A;  2V8D A;  1PYT B;  5K8N A;  3GB0 A;  5K8O A;  4OIW A;  5IB9 A;  3I1U A;  3IWW A;  3CPA A;  3JRU A;  4UEZ A;  1QQ9 A;  4WWV A;  4A39 A;  3B7I A;  3SI0 A;  5D8N A;  4TNU A;  3TX8 A;  2PJA A;  2PIZ A;  4OME A;  2JEW A;  1LAM A;  3RZA A;  4IHM A;  2ZEG A;  4MCS A;  1PCA A;  3HUV A;  5D29 A;  2AFZ A;  4DYO A;  3WC5 A;  1EE3 P;  3S9N A;  1LAP A;  1YW6 A;  1TF8 A;  1VGY A;  4OC4 A;  3NH5 A;  4X2T A;  4EWT A;  1XBU A;  1IGB A;  2F8H A;  3PFE A;  2PJ0 A;  2XEG A;  2ZEF A;  3FF3 A;  3KQZ A;  4NGP A;  3KQX A;  3NA6 A;  4ZYQ A;  4P4D A;  4DUK A;  3D4U A;  4IAV A;  1Y7E A;  3WC6 A;  4AXV A;  3IEH A;  2XEF A;  1HDQ A;  3D7D A;  3PBE A;  4NGT A;  3RBU A;  2PVV A;  1XJO A;  2ZED A;  4FBE A;  1AYE A;  3D68 A;  4UF4 A;  4YWY A;  4BD9 A;  2PJ6 A;  2IQ6 A;  4UEF A;  4KSI A;  2CIJ A;  2CTC A;  3PEI A;  1XMB A;  1XFO A;  4A94 A;  1DE4 C;  1TXR A;  3D66 A;  3H8G A;  4F9U A;  3KZW A;  5HXD A;  2OR4 A;  4TWE A;  1VHE A;  4OID A;  3D7H A;  4ZY0 A;  1TF9 A;  4FUU A;  2NYQ A;  1M4L A;  1RTQ A;  1BAV A;  2V8V A;  4P44 A;  4P6Y A;  3IIB A;  3SI1 A;  2QYV A;  4MXU A;  1H8L A;  4MCP A;  4P45 A;  4PXE A;  5THW A;  1TKH A;  4NGM A;  2I3C A;  6CPA A;  2XEI A;  3K2K A;  4MHY A;  3BHX A;  3H8F A;  3D7G A;  5JH9 A;  1Z2L A;  3QNV A;  4EME A;  3TC8 A;  4P4I A;  5K8P A;  1TKJ A;  2WZN A;  3CPX A;  1ZG9 A;  3IC1 A;  3ISX A;  3RAM A;  3DLJ A;  5HVF A;  4MCQ A;  4PXD A;  5ELY A;  3KGQ A;  3FJU A;  4R76 A;  1VHO A;  2RFH A;  3KI9 A;  1HEE A;  3GUX A;  3SJF A;  2ZEO A;  5LRK A;  2AFM A;  4UIA A;  1OBR A;  2Q43 A;  1BLL E;  4EFD A;  3NH8 A;  4X8I A;  2PJB A;  5HVH A;  3BI1 A;  3FX6 A;  3KR4 A;  2O53 A;  3D7F A;  5K8M A;  2GU2 A;  5CPA A;  3LMS A;  3WC7 A;  3N5F A;  2CF4 A;  3B2Y A;  1ARM A;  2V77 A;  4B6Z A;  4H2K A;  4P4B A;  2PJ7 A;  2XEJ A;  4NGS A;  3KAS A;  1GYT A;  1CPX A;  1Y0Y A;  1LOK A;  2GLJ A;  1LFW A;  5LYI A;  2EWB A;  4ZY2 A;  2ZOF A;  1VIX A;  3CDX A;  4Q7A A;  3B3C A;  3SJX A;  2ZEM A;  2RB7 A;  4WJB A;  3HLP A;  4MHP A;  3SJE A;  1ZLH A;  1ZG8 A;  1LAN A;  2AFO A;  4A38 A;  2CTB A;  3ISZ A;  3T8W A;  3K9T A;  1CX8 A;  4OC3 A;  7CPA A;  4MCR A;  3H8E A;  4P4E A;  2BOA A;  4PPZ A;  1XRY A;  4ZX8 A;  4P4J A;  1YME A;  3FEC A;  3V38 A;  1HDU A;  2AFX A;  1R3N A;  4NGN A;  3SI2 A;  3WT4 A;  5LYF A;  4JZ0 A;  2VL1 A;  4LQG A;  5CBM A;  4OP4 A;  2ZEN A;  4K3N A;  4NJR A;  1NSA A;  4CPA A;  2O4H A;  2AFU A;  3KR5 A;  4NJQ A;  5DS0 A;  1YW4 A;  5LYL A;  3B3W A;  2HB6 A;  4W9Y A;  3S9M A;  3KL9 A;  4FWU A;  4P4F A;  2PIY A;  3V7Z A;  3LWU A;  1ZG7 A;  3B35 A;  2PJ8 A;  4A37 A;  4F8Z A;  4ZX9 A;  3IJ3 A;  1CP7 A;  2ZEH A;  5LRG A;  2POK A;  1R43 A;  5F09 A;  3IFE A;  1ARL A;  2PJ4 A;  4PQA A;  5JGF A;  3B3T A;  1QMU A;  1CPS A;  3DGV A;  2PJ3 A;  3FED A;  3VAT A;  2PRQ A;  1UWY A;  2ZEP A;  4IK2 A;  2NSM A;  3IO1 A;  4PXB A;  1FNO A;  4MHN A;  4NGR A;  4OKO A;  2AFS A;  1Q7L A;  3KHX A;  2J9A A;  1YSJ A;  1Z8L A;  4O23 A;  1AMP A;  2C6C A;  3CT9 A;  1ELM P;  2QVP A;  2JBK A;  3PBB A;  4F9V A;  2ZEE A;  1TKF A;  2FVG A;  3B3V A;  3FMC A;  3PB4 X;  1DTD A;  5LYD A;  5JM6 A;  2QJ8 A;  4OC0 A;  3SJG A;  2PJ5 A;  3PB8 X;  2PJ2 A;  4GM5 A;  1F2O A;  1BPM A;  4JYW A;  4MRI A;  1JQG A;  4NGQ A;  3B3S A;  2ANP A;  3NH4 A;  5J1Q A;  2Q4Z A;  2V8G A;  3GLJ A;  2PJC A;  3FH4 A;  2G9D A;  2BO9 A;  3S9L A;  2PJ1 A;  2V8H A;  2PJ9 A;  2C1C A;  2F7V A;  8CPA A;  4OC2 A;  2C6G A;  1FT7 A;  4FAI A;  2EK9 A;  4MMO A;  2Q51 A;  1CG2 A;  1CP6 A;  3MN8 A;  4OC5 A;  5I4M A;  4Z65 A;  3VAR A;  1Y0R A;  4X3R A;  4OC1 A;  1IY7 A;  2HC9 A;  1LCP A;  4UIB A;  3PRT A;  2JBJ A;  3KHZ A;  3NFZ A;  4RUH A;  2IJZ A;  4UEE A;  2GLF A;  3PB6 X;  1F2P A;  1ZLI A;  3PB7 X;  1F57 A;  2ABZ A;  4MHZ A;  2OOT A;  3D67 A;  2GRE A;  1ELL P;  2IMO A;  2PE3 A;  1KWM A;  3BXM A;  4P10 A;  4YU9 A;  4R6T A;  3FEE A;  2PCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...