4JLYA

Dodecameric structure of spermidine n-acetyltransferase from vibrio cholerae
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
172
structure length
172
Chain Sequence
NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine n1-acetyltransferase
publication title Substrate-Induced Allosteric Change in the Quaternary Structure of the Spermidine N-Acetyltransferase SpeG.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Transferase
total genus 49
structure length 172
sequence length 172
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2013-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4jlyA00
3EO4A 2FT0A 1B87A 3FNCA 3PZJA 4AVBA 4QUSA 4PSWA 3DDDA 4AVAA 3S6KA 2PSWA 3EY5A 4JD6A 2PR1A 3G3SA 2RC4A 2B58A 2NMTA 3TFYA 2HQYA 1N71A 4FD7A 4KUAA 4R57A 2A4NA 2BL1A 1BO4A 1VHSA 2VBQA 4KOUA 3D2MA 2G0BA 1Z4RA 2EVNA 3BJ7A 4KORA 1Z9UA 1M44A 4KUBA 4FD4A 2CNMA 4ONUA 1K4JA 1S7KA 2R8VA 2Q0YA 1MK4A 2Z11A 4KLVA 1SQHA 2B3VA 1MJAA 3DR8A 1I12A 4Y49C 3P2HA 2CY2A 4XPKA 1XIXA 4KOVA 1YVKA 1IICA 3EXNA 3QAHA 3T9YA 3H4QA 4E0AA 2OH1A 2D4PA 4DNCA 2FCKA 2PR8A 1IIDA 1ON0A 3JUWA 4MJ8A 1Q2YA 5IX3A 4PK2A 2OU2A 5CNPA 3IGRA 3MGDA 3W91A 3DSBA 2J8MA 3W6SA 3CXQA 3TOAA 2OZHA 1TIQA 2AE6A 1S5KA 1MJ9A 3R9EA 5E96A 4XNHC 2DXQA 2OB0A 2G3AA 1CJWA 4QC6A 3N7ZA 2QECA 5KTAA 1Y9KA 1VKCA 2ZPAA 1YGHA 4F6AA 4JXQA 4M85A 4E2AA 1KZFA 4H6UA 2WPXA 4M3SA 3FBUA 3R96A 5I0CA 1IYKA 3NE7A 4QB9A 3GKRA 2O28A 5F49A 4QVTA 4CAWA 4J3GA 3VWEA 4B5OA 5HMNA 1PUAA 2Q4YA 4MY3A 1GHEA 4R3KA 1RO5A 2BUEA 2QMLA 2GANA 5IV0A 1XEBA 4KVOE 2Q04A 2JEVA 4LUAA 4XNHB 1L0CA 4MI4A 2Q7BA 5F47A 4UWJA 2B4BA 3RYOA 4HNXB 1XMTA 2HUZA 3FXTA 2BSWA 4MY0A 4JWPA 4R87A 5DWNA 5ISVA 4U5YA 2FS5A 4L89A 1LRZA 3TO9A 4EVYA 3P2FA 4ORFA 3TE4A 2ZW6A 4AB7A 3R9FA 3B8GA 2Q4VA 3FRMA 3ZZIA 3SXOA 4KVXA 2B5GB 4NCZA 4U9ZA 4KOSA 2JDCA 1Z4EA 5JPHA 4OLLA 3GY9A 2Z0ZA 2PQ8A 2Z10A 4YFJA 2FIWA 4CRZB 4H89A 1PU9A 4KOXA 4KZTA 4E8OA 5JQ4A 4YGOA 5EBVA 3UY5A 1XF8A 1FY7A 1YR0A 4AG9A 3TO7A 3FB3A 1NMTA 2ATRA 3PP9A 5F46A 5H84A 3F8KA 2FL4A 2VI7A 4JXRA 1KUXA 4U9YA 2OZUA 3TTHA 2I00A 4PSXA 3F0AA 2PRBA 3K9UA 1YLEA 5EC4A 1NE9A 2FE7A 1Q2DA 3EC4A 4NXYA 2ZXVA 3GYAA 2ZW4A 2REFA 4LX9A 4I49A 1S7LA 4Y49B 5FVJA 4AG7A 2X7BA 3DNSA 1WWZA 2P6EA 1UFHA 3D2PA 3G8WA 2PC1A 4GS4A 5GCNA 1BOBA 2GE3A 4II9A 5J8FA 3R9GA 4H6ZA 3PGPA 3C26A 2P6FA 1M4IA 1Q2CA 1XE4A 4X5KA 1RXTA 2Y0MA 2VZYA 2HV2A 2R98A 5C82A 1QSRA 2ZW5A 1QSTA 2Q44A 1YK3A 1YVOA 2K5TA 4CRYB 1S7FA 3SHPA 1KUVA 4B5PB 1M1DA 4ZBGA 3W6XA 4MBUA 1R57A 2P6GA 3QB8A 4AVCA 5KTCA 2B5GA 2GIVA 1Y7RA 4NSQA 2FSRA 4RI1A 5KTDA 5IB0A 3S6HA 3ZJ0A 2B3UA 2R1IA 3D3SA 4XPLA 2JDDA 3F5BA 1IYLA 1QSOA 3TOBA 1V0CA 2IL4A 2B4DB 3S6GA 4JLYA 2REEA 4HKFA 4HNWB 1P0HA 4KVME 2JLMA 4UWIA 2KCWA 5C88A 1S3ZA 2G3TA 2ZW7A 2J8NA 3D8PA 3R1KA 2F5IA 1IB1E 4CS0B 3EFAA 3IWGA 3T90A 4KOTA 3TCVA 4XPDC 5F48A 3OWCA 3WR7A 2VXKA 1I1DA 2EUIA 4BMHA 3I9SA 3KKWA 4KOWA 3R95A 3CXSA 3FIXA 5HH1A 2VEZA 2FXFA 4HNYB 4PK3A 4FD6A 3VWDA 2CNTA 4OAEA 1S7NA 3V8IA 4FD5A 1WK4A 1QSMA 4R3LA 4IUSA 1M4GA 1J4JA 4L8AA 1YREA 3E0KA 3LD2A 2AJ6A 3SXNA 3LODA 2ARHA 4CAXA 2VQYA 1QSNA 2QIRA 3JVNA 4RS2A 4KOYA 5DWMA 4CAVA 4UA3A 2FIAA 2J8RA 4UBRA 1U6MA 4OADA 1Y9WA 1MJBA 4XPDB 4B5PA 2OZGA 1CM0A 4MHDA 1KUYA 1NSLA 4YRHA 2I79A 4NF1A 1I21A 1S60A 3BJ8A 1B6BA 3CXPA 2VZZA 4JJXA 1YX0A 2PDOA 2WPWA 4R9MA 5H86A 2P0WA 4F0YA 2CNSA 5J8CA 3TT2A 1P4NA 2B4DA 3BLNA 2R7HA 4KLWA 3FYNA 4PV6A 3DR6A 3S6FA 4QBJA 1M4DA 2C27A 2BEIA 4IF5A 4K30A 2H5MA 1OZPA 4NEXA 3TO6A 3I3GA 2D4OA
chains in the Genus database with same CATH superfamily
4ZYQA 3EO4A 3PBEA 4MHPA 2FT0A 1B87A 3FNCA 4B12A 3PZJA 3D7DA 4AVBA 3GUXA 4PSWA 3DDDA 4QUSA 1XFOA 2POKA 5EMIA 3S6KA 4AVAA 2PSWA 3EY5A 3PFOA 1HEEA 4JD6A 3LWUA 4C2YA 2PR1A 4BD9A 3G3SA 2RC4A 4B11A 2YNDA 2B58A 4NJRA 2NMTA 2Q43A 6CPAA 1LOKA 7CPAA 2HQYA 2ZEOA 1N71A 4MFQA 3TFYA 4FD7A 3SJEA 4KUAA 4UCNA 4R57A 4RN7A 3SJFA 2ZOGA 2AFWA 4FWUA 2A4NA 1NSAA 2BL1A 1BO4A 3K2KA 1VHSA 2HB6A 2VBQA 4JZ0A 2AFZA 3LACA 4OC5A 5A28A 4KOUA 2YNCC 3D2MA 2G0BA 2J9AA 1Z4RA 2EVNA 3BJ7A 1JWQA 1ZG8A 1Z9UA 3HLPA 4KORA 1XMBA 4B13A 1M44A 4KUBA 3FEDA 4FD4A 2CNMA 5K8PA 4ONUA 3JRUA 3SJGA 3SI1A 1K4JA 1S7KA 2R8VA 2Q0YA 1BPNA 3B3VA 3GLJA 4R8FA 1MK4A 2Z3KA 2Z11A 2ZEDA 2V8GA 4MXUA 2DEAA 4KLVA 3CDXA 3IC1A 4CGLA 1SQHA 4R76A 1IGBA 1IOIA 2XEJA 2B3VA 1MJAA 3B3TA 3DR8A 1CBXA 3PB9X 5D29A 1XBUA 2EWBA 1I12A 1BPMA 4Y49C 4NGRA 2ANPA 3P2HA 3D7GA 2CY2A 1TKFA 1XIXA 3LMSA 4XPKA 4KOVA 1YVKA 3KQZA 3WC7A 1YW4A 1IICA 3EXNA 3QAHA 3T9YA 3H4QA 4E0AA 1XRYA 2D4PA 2OH1A 4DNCA 3H8EA 4DJLA 4HPSA 1TXRA 1Q7LA 2AFXA 2FCKA 2PJCA 1IIDA 2PR8A 4B14A 4O23A 1ON0A 4MFJA 4P10A 2IMOA 2RFHA 2O53A 4NJQA 3JUWA 2RB7A 2V8HA 1Q2YA 4MJ8A 4PK2A 5IX3A 2OU2A 2VL1A 5LRGA 1ZLIA 8CPAA 5CNPA 4BINA 3IGRA 4B10A 1PCAA 3MGDA 3W91A 1LCPA 3DSBA 4GXHA 3WC6A 3SI0A 2J8MA 3B3CA 3W6SA 3S9NA 3CXQA 4ZGYB 2BO9A 3KI9A 4CAEA 4EWTA 2CXAA 2OZHA 1TIQA 3TOAA 3KHXA 2WYRA 2AE6A 4A30A 1S5KA 2PJBA 1MJ9A 1VGYA 3R9EA 5E96A 4XNHC 1XJOA 2DXQA 4OKOA 2OB0A 2G3AA 1CJWA 4P44A 3N5FA 2O4HA 2DPSA 2PJ9A 2YGWA 1Y7EA 4MHZA 4UCPA 3BI1A 3SJXA 4QC6A 3KHZA 3PB6X 2PCUA 4M6GA 4DUKA 4NGMA 2QECA 3N7ZA 5KTAA 1Y9KA 2GU2A 2GLJA 1VKCA 2ZPAA 3FH4A 1BLLE 2FVGA 1YGHA 5K8NA 4KSFA 4CGMA 4F6AA 1R3NA 4JXQA 4M85A 1KZFA 4E2AA 4H6UA 2WPXA 4M3SA 3KR5A 3QAYA 3B3WA 4MHNA 1Z2LA 3FBUA 3FX6A 3R96A 4M6IA 4IK2A 4CYPA 5I0CA 1IYKA 1A2ZA 3NE7A 3NH4A 3GKRA 4QB9A 3ISXA 2C1CA 4LQ6A 4LQGA 2WUUA 2HC9A 2O28A 5F49A 5DS0A 4QVTA 4CAWA 4WWVA 4J3GA 3VWEA 3BXMA 1BAVA 4MCRA 4B5OA 1PUAA 2Q4YA 4MFLA 4YWYA 3VARA 4F9VA 4MY3A 5HMNA 4UEFA 4C7IA 3PBBA 3K9TA 3L2NA 1GHEA 3GIUA 4A31A 5F09A 4R3KA 1TKHA 1YSJA 2PJ3A 1AYEA 1YLOA 4IHMA 1RO5A 1YQEA 2BUEA 2QMLA 2GANA 4IAVA 5IV0A 3CT9A 1ELMP 4G1PA 3CPXA 5CPAA 2NSMA 4NGQA 1XEBA 1RTQA 2Q04A 4KVOE 2JEVA 2AFOA 4MCSA 4LUAA 4Q38A 4UFVA 4UEEA 4XNHB 1L0CA 4MI4A 2Q7BA 4CGOA 5F47A 4UWJA 2B4BA 3RYOA 4C2XA 4HNXB 1XMTA 3RZAA 2HUZA 3FXTA 3D4UA 3D7HA 2BSWA 4PXBA 4X8IA 4MY0A 4EFDA 5LYLA 4FAIA 4JWPA 4R87A 1CP7A 5JM6A 1ARMA 1Z8WA 2CIJA 2JBKA 5DWNA 1LAMA 1KWMA 4F8ZA 4MRIA 3FMCA 4U5YA 5ISVA 4MFPA 4R7MA 3KQXA 2ZOFA 1R43A 2FS5A 4L89A 1LRZA 4C68A 3TO9A 2PVWA 4EVYA 4A39A 2C6GA 3P2FA 4RUHA 2F8HA 4KSAA 1IOFA 4ORFA 3TE4A 2ZW6A 5G1ZA 3NH8A 4AB7A 3ISZA 4NGTA 3R9FA 2GFQA 2Q4VA 3B8GA 3FRMA 3SXOA 3ZZIA 4KVXA 2PVVA 4C2ZA 5HVFA 4MFZA 3WT4A 2B5GB 4NCZA 1EE3P 3WC5A 4P4IA 4U9ZA 4ZY2A 5K8OA 4A95A 2YNCA 4OIWA 4KOSA 4F0XA 2JDCA 1Z4EA 4ZX9A 4AXVA 5JPHA 1Z8TA 4OLLA 4MMOA 3GY9A 3BI0A 2Z0ZA 3HUVA 2PQ8A 2Z10A 4CAFA 4YFJA 2FIWA 4PXDA 4CRZB 4H89A 1PU9A 3KL9A 4KOXA 4WJBA 4KZTA 4E8OA 5JQ4A 1TF8A 4KS9A 4YGOA 5EBVA 4NGPA 1XF8A 3UY5A 1FY7A 1YR0A 3PEIA 4AG9A 4P4EA 3RBUA 3V38A 4MCPA 3TO7A 1LANA 2ZELA 4UFXA 3FB3A 1NMTA 2ATRA 2Z3PA 3PP9A 3D68A 2PRQA 5F46A 5H84A 3F8KA 2FL4A 2QYVA 4NGNA 3NA6A 2VI7A 4JXRA 1KUXA 3IFEA 4A37A 2GREA 3VH9A 2PJ8A 2PIYA 4U9YA 1HDQA 3D7FA 2AFUA 2OZUA 4P4FA 4UIAA 4CYOA 3B3SA 4FUUA 3TTHA 2I00A 2PJ0A 4PSXA 3F0AA 3IU2A 3IIBA 1LFWA 1QQ9A 2PRBA 3K9UA 4OMEA 4UEZA 5K8MA 1YLEA 5EC4A 1NE9A 3MRUA 2FE7A 1Q2DA 1CP6A 3EC4A 4C7HA 2DF5A 5LYFA 3DGVA 4NXYA 2ZXVA 3GYAA 2Z3OA 3TC8A 3H8GA 4OC4A 2ZW4A 2REFA 2Z3LA 1QMUA 2Q51A 2WSAA 5BWAB 4LX9A 4I49A 4FBEA 1ZLHA 5LRKA 1S7LA 4Y49B 1ZG7A 5FVJA 2CF4A 4AG7A 2BCOA 4F9UA 4OC1A 2X7BA 3PB4X 1TKJA 3DNSA 4PPZA 1WWZA 2XEGA 4CPAA 2P6EA 1VHOA 3NE8A 5I4MA 1UFHA 5G21A 3D2PA 4X2TA 3S9MA 1F57A 2QJ8A 3PRTA 3G8WA 4P4JA 2PC1A 2PJ7A 3PFEA 4PXEA 4GS4A 4PXCA 5GCNA 5JGFA 2C6PA 1BOBA 2GE3A 4II9A 3FJUA 2ZEMA 2OR4A 1H8LA 5J8FA 5JH9A 2PJ6A 3R9GA 4H6ZA 3B7IA 3PGPA 1GYTA 3TOBA 1CX8A 2ZEPA 3C26A 2P6FA 3D67A 1M4IA 1Q2CA 1XE4A 1X10A 4X5KA 4TNUA 3IWEA 1RXTA 5AG5A 4DYOA 3I1UA 1TF9A 3RNZA 4CYNA 2Y0MA 2VZYA 2HV2A 3TX8A 5IB9A 2R98A 5J1QA 3IU1A 5C82A 4OC2A 1QSRA 2ZW5A 1QSTA 2Q44A 1HDUA 1YK3A 4A33A 1YVOA 3BHXA 5AG7A 2K5TA 1LAPA 4CRYB 1S7FA 3SHPA 1KUVA 4B5PB 1M1DA 2ABZA 4ZBGA 1ZO0A 4UF4A 3W6XA 4MBUA 1R57A 2P6GA 3QB8A 4AVCA 5KTCA 4EMEA 3CZXA 2B5GA 1AUGA 2GIVA 1FNOA 2XEIA 1Y7RA 3KZWA 4NSQA 4CYQA 2FSRA 3PB8X 4RI1A 5KTDA 4ZY0A 3NH5A 4P6YA 5IB0A 3S6HA 2Q4ZA 5THWA 3SI2A 3ZJ0A 2B3UA 2R1IA 3D3SA 4XPLA 1FT7A 4UIBA 4P4BA 5G20A 2JDDA 4MCQA 5LYIA 4W9YA 3F5BA 1IYLA 2V8VA 3FF3A 4M6HA 2V8DA 1QSOA 3FVLA 1V0CA 2F7VA 2B4DB 2IL4A 2JBJA 2QVPA 3S6GA 4JLYA 2REEA 4HKFA 4HNWB 3IO1A 1P0HA 4KVME 4OC3A 2JLMA 4PQAA 5G22A 3T8WA 2I3CA 3V7ZA 4UWIA 2G9DA 2KCWA 2EO8A 5C88A 2AFMA 1S3ZA 5CBMA 4X3RA 2EK9A 3GB0A 2G3TA 4Z65A 2ZW7A 2J8NA 3D8PA 4JYWA 4ZY1A 3R1KA 4A2ZA 1ZG9A 1DTDA 2F5IA 3FECA 4KSIA 1IB1E 3RO0A 4CS0B 3EFAA 3IWGA 3B35A 4NGSA 5AG6A 2IQ6A 3T90A 1JQGA 4A38A 4NFRA 4KOTA 3TCVA 4XPDC 5F48A 3OWCA 3H8FA 2IJZA 2ZEEA 2EK8A 2VXKA 4MFKA 3WR7A 4Q36A 1I1DA 4P45A 1Y0YA 1F2PA 2EUIA 4BMHA 3I9SA 3KKWA 1X12A 4KOWA 3R95A 3CXSA 3FIXA 2JEWA 4TWEA 5HH1A 4OIDA 2CTCA 2GLFA 2VEZA 3D66A 2FXFA 3IJ3A 4HNYB 2ODFA 4PK3A 4FD6A 3VWDA 1PYTB 1Z8XA 2ZEFA 2ZEGA 5AGEA 2OOTA 2CNTA 2V77A 4OAEA 4UFWA 1Y0RA 2PIZA 4CGNA 1DE4C 1S7NA 3V8IA 1WK4A 1CG2A 4FD5A 3VATA 5A27A 1QSMA 1IU8A 4R3LA 1M4LA 3WABA 4IUSA 2PJ2A 4OC0A 1M4GA 1IY7A 1J4JA 4L8AA 1YMEA 2DPTA 3JTKA 1YREA 5LYDA 2PJ4A 3E0KA 3LD2A 3S9LA 3NFZA 2AJ6A 3SXNA 3B2YA 1ARLA 2ARHA 2BOAA 3LODA 5LRJA 4ZX8A 3QNVA 2CTBA 4CAXA 2VQYA 2ZENA 1QSNA 2QIRA 3JVNA 4RS2A 4OP4A 4KOYA 5DWMA 4ZI6A 4CAVA 3RAMA 4UA3A 4BBHA 4UCMA 2FIAA 2J8RA 4H2KA 4UBRA 2WZNA 1U6MA 4OADA 1Y9WA 5HVHA 1YW6A 1MJBA 3KR4A 1ELLP 3CPAA 1OBRA 1CPSA 4XPDB 4B5PA 1CPXA 2OZGA 1VHEA 1CM0A 4MHDA 3PB7X 1KUYA 4R6TA 1NSLA 4YRHA 2XEFA 4CGPA 2I79A 4NF1A 3IEHA 5HXDA 2PJ5A 2Q7SA 3DLJA 3KASA 3IWWA 4Q7AA 1I21A 1VIXA 2Z3MA 3KGQA 3MN8A 1S60A 2AFSA 3BJ8A 1Z8LA 2EBJA 2PJ1A 1B6BA 1UWYA 4P4DA 3CXPA 4K3NA 2VZZA 4JJXA 1YX0A 2PDOA 2WPWA 4R9MA 4ONWA 4GM5A 5H86A 2NYQA 4A94A 2ZEHA 3H5ZA 2P0WA 2YNEA 4F0YA 5HVGA 5AG4A 1AMPA 1XOVA 1F2OA 1Z5RA 2CNSA 4YU9A 5ELYA 3TT2A 4B6ZA 5J8CA 1P4NA 2PJAA 2B4DA 3BLNA 2R7HA 4KLWA 3FYNA 4PV6A 3DR6A 2C6CA 3S6FA 4QBJA 3A9LA 1M4DA 2C27A 4MHYA 5D8NA 2BEIA 2PE3A 3FEEA 4IF5A 2Z3NA 4K30A 2H5MA 1OZPA 4NEXA 3TO6A 3I3GA 4A32A 2D4OA
chains in the Genus database with same CATH topology
3EO4A 2FT0A 1B87A 3FNCA 4B12A 3PZJA 4AVBA 4QUSA 4PSWA 3DDDA 4AVAA 3S6KA 2PSWA 3EY5A 4JD6A 4C2YA 2PR1A 3G3SA 2RC4A 4B11A 2YNDA 2B58A 2NMTA 3TFYA 2HQYA 4MFQA 1N71A 4FD7A 4KUAA 4UCNA 4R57A 2A4NA 2BL1A 1BO4A 1VHSA 2VBQA 5A28A 4KOUA 2YNCC 3D2MA 2G0BA 1Z4RA 2EVNA 3BJ7A 4KORA 4B13A 1Z9UA 1M44A 4KUBA 4FD4A 2CNMA 4ONUA 1K4JA 1S7KA 2R8VA 2Q0YA 1MK4A 2Z3KA 2Z11A 4KLVA 4CGLA 1SQHA 2B3VA 1MJAA 3DR8A 1I12A 4Y49C 3P2HA 2CY2A 4XPKA 1XIXA 4KOVA 1YVKA 1IICA 3EXNA 3QAHA 3T9YA 3H4QA 4E0AA 2OH1A 2D4PA 4DNCA 2FCKA 2PR8A 4B14A 1IIDA 1ON0A 4MFJA 3JUWA 4MJ8A 1Q2YA 5IX3A 4PK2A 2OU2A 5CNPA 3IGRA 4B10A 3MGDA 3W91A 3DSBA 2J8MA 3W6SA 3CXQA 4ZGYB 4CAEA 2CXAA 2OZHA 1TIQA 3TOAA 2AE6A 4A30A 1S5KA 1MJ9A 3R9EA 5E96A 4XNHC 2DXQA 2OB0A 2G3AA 1CJWA 2DPSA 2YGWA 4UCPA 4QC6A 3N7ZA 2QECA 5KTAA 1Y9KA 1VKCA 2ZPAA 1YGHA 4KSFA 4CGMA 4F6AA 4JXQA 4M85A 4E2AA 1KZFA 4H6UA 2WPXA 4M3SA 3FBUA 3R96A 4CYPA 5I0CA 1IYKA 3NE7A 4QB9A 3GKRA 2WUUA 2O28A 5F49A 4QVTA 4CAWA 4J3GA 3VWEA 4B5OA 5HMNA 1PUAA 2Q4YA 4MFLA 4MY3A 4C7IA 1GHEA 4A31A 4R3KA 1RO5A 2BUEA 2QMLA 2GANA 5IV0A 1XEBA 4KVOE 2Q04A 4Q38A 2JEVA 4LUAA 4UFVA 4XNHB 1L0CA 4MI4A 2Q7BA 4CGOA 5F47A 4UWJA 2B4BA 3RYOA 4C2XA 4HNXB 1XMTA 2HUZA 3FXTA 2BSWA 4MY0A 4JWPA 4R87A 5DWNA 5ISVA 4U5YA 4MFPA 2FS5A 4L89A 1LRZA 4C68A 3TO9A 4EVYA 3P2FA 4KSAA 4ORFA 3TE4A 2ZW6A 5G1ZA 4AB7A 3R9FA 3B8GA 2Q4VA 3FRMA 3ZZIA 3SXOA 4KVXA 4C2ZA 4MFZA 2B5GB 4NCZA 4U9ZA 4A95A 2YNCA 4F0XA 4KOSA 2JDCA 1Z4EA 5JPHA 4OLLA 3GY9A 2Z0ZA 2PQ8A 2Z10A 4CAFA 4YFJA 2FIWA 4CRZB 4H89A 1PU9A 4KOXA 4KZTA 4E8OA 5JQ4A 4KS9A 4YGOA 5EBVA 3UY5A 1XF8A 1FY7A 1YR0A 4AG9A 3TO7A 4UFXA 3FB3A 1NMTA 2ATRA 2Z3PA 3PP9A 5F46A 5H84A 3F8KA 2FL4A 2VI7A 4JXRA 1KUXA 4U9YA 4CYOA 2OZUA 3TTHA 2I00A 4PSXA 3F0AA 3IU2A 2PRBA 3K9UA 1YLEA 5EC4A 1NE9A 2FE7A 1Q2DA 3EC4A 4C7HA 4NXYA 2ZXVA 3GYAA 2Z3OA 2ZW4A 2REFA 2Z3LA 2WSAA 5BWAB 4LX9A 4I49A 1S7LA 4Y49B 5FVJA 4AG7A 2X7BA 3DNSA 1WWZA 2P6EA 1UFHA 5G21A 3D2PA 3G8WA 2PC1A 4GS4A 5GCNA 1BOBA 2GE3A 4II9A 5J8FA 3R9GA 4H6ZA 3PGPA 3C26A 2P6FA 1M4IA 1Q2CA 1XE4A 4X5KA 3IWEA 1RXTA 5AG5A 4CYNA 2Y0MA 2VZYA 2HV2A 2R98A 3IU1A 5C82A 1QSRA 2ZW5A 1QSTA 2Q44A 1YK3A 4A33A 1YVOA 5AG7A 2K5TA 4CRYB 1S7FA 3SHPA 1KUVA 4B5PB 1M1DA 4ZBGA 1ZO0A 3W6XA 4MBUA 1R57A 2P6GA 3QB8A 4AVCA 5KTCA 2B5GA 2GIVA 1Y7RA 4NSQA 4CYQA 2FSRA 4RI1A 5KTDA 5IB0A 3S6HA 3ZJ0A 2B3UA 2R1IA 3D3SA 4XPLA 5G20A 2JDDA 3F5BA 1IYLA 1QSOA 3TOBA 1V0CA 2IL4A 2B4DB 3S6GA 4JLYA 2REEA 4HKFA 4HNWB 1P0HA 4KVME 2JLMA 5G22A 4UWIA 2KCWA 5C88A 1S3ZA 2G3TA 2ZW7A 2J8NA 3D8PA 3R1KA 4A2ZA 2F5IA 1IB1E 4CS0B 3EFAA 3IWGA 5AG6A 3T90A 4KOTA 3TCVA 4XPDC 5F48A 3OWCA 3WR7A 2VXKA 4MFKA 4Q36A 1I1DA 2EUIA 4BMHA 3I9SA 3KKWA 4KOWA 3R95A 3CXSA 3FIXA 5HH1A 2VEZA 2FXFA 4HNYB 4PK3A 4FD6A 3VWDA 5AGEA 2CNTA 4OAEA 4UFWA 4CGNA 1S7NA 3V8IA 4FD5A 1WK4A 5A27A 1QSMA 4R3LA 4IUSA 1M4GA 1J4JA 4L8AA 2DPTA 3JTKA 1YREA 3E0KA 3LD2A 2AJ6A 3SXNA 3LODA 2ARHA 4CAXA 2VQYA 1QSNA 2QIRA 3JVNA 4RS2A 4KOYA 5DWMA 4CAVA 4UA3A 4BBHA 4UCMA 2FIAA 2J8RA 4UBRA 1U6MA 4OADA 1Y9WA 1MJBA 4XPDB 4B5PA 2OZGA 1CM0A 4MHDA 1KUYA 1NSLA 4YRHA 4CGPA 2I79A 4NF1A 1I21A 2Z3MA 1S60A 3BJ8A 1B6BA 3CXPA 2VZZA 4JJXA 1YX0A 2PDOA 2WPWA 4R9MA 5H86A 3H5ZA 2P0WA 2YNEA 4F0YA 5AG4A 2CNSA 5J8CA 3TT2A 1P4NA 2B4DA 3BLNA 2R7HA 4KLWA 3FYNA 4PV6A 3DR6A 3S6FA 4QBJA 3A9LA 1M4DA 2C27A 2BEIA 4IF5A 2Z3NA 4K30A 2H5MA 1OZPA 4NEXA 3TO6A 3I3GA 4A32A 2D4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EO4 A;  2FT0 A;  1B87 A;  3FNC A;  3PZJ A;  4AVB A;  4QUS A;  4PSW A;  3DDD A;  4AVA A;  3S6K A;  2PSW A;  3EY5 A;  4JD6 A;  2PR1 A;  3G3S A;  2RC4 A;  2B58 A;  2NMT A;  3TFY A;  2HQY A;  1N71 A;  4FD7 A;  4KUA A;  4R57 A;  2A4N A;  2BL1 A;  1BO4 A;  1VHS A;  2VBQ A;  4KOU A;  3D2M A;  2G0B A;  1Z4R A;  2EVN A;  3BJ7 A;  4KOR A;  1Z9U A;  1M44 A;  4KUB A;  4FD4 A;  2CNM A;  4ONU A;  1K4J A;  1S7K A;  2R8V A;  2Q0Y A;  1MK4 A;  2Z11 A;  4KLV A;  1SQH A;  2B3V A;  1MJA A;  3DR8 A;  1I12 A;  4Y49 C;  3P2H A;  2CY2 A;  4XPK A;  1XIX A;  4KOV A;  1YVK A;  1IIC A;  3EXN A;  3QAH A;  3T9Y A;  3H4Q A;  4E0A A;  2OH1 A;  2D4P A;  4DNC A;  2FCK A;  2PR8 A;  1IID A;  1ON0 A;  3JUW A;  4MJ8 A;  1Q2Y A;  5IX3 A;  4PK2 A;  2OU2 A;  5CNP A;  3IGR A;  3MGD A;  3W91 A;  3DSB A;  2J8M A;  3W6S A;  3CXQ A;  3TOA A;  2OZH A;  1TIQ A;  2AE6 A;  1S5K A;  1MJ9 A;  3R9E A;  5E96 A;  4XNH C;  2DXQ A;  2OB0 A;  2G3A A;  1CJW A;  4QC6 A;  3N7Z A;  2QEC A;  5KTA A;  1Y9K A;  1VKC A;  2ZPA A;  1YGH A;  4F6A A;  4JXQ A;  4M85 A;  4E2A A;  1KZF A;  4H6U A;  2WPX A;  4M3S A;  3FBU A;  3R96 A;  5I0C A;  1IYK A;  3NE7 A;  4QB9 A;  3GKR A;  2O28 A;  5F49 A;  4QVT A;  4CAW A;  4J3G A;  3VWE A;  4B5O A;  5HMN A;  1PUA A;  2Q4Y A;  4MY3 A;  1GHE A;  4R3K A;  1RO5 A;  2BUE A;  2QML A;  2GAN A;  5IV0 A;  1XEB A;  4KVO E;  2Q04 A;  2JEV A;  4LUA A;  4XNH B;  1L0C A;  4MI4 A;  2Q7B A;  5F47 A;  4UWJ A;  2B4B A;  3RYO A;  4HNX B;  1XMT A;  2HUZ A;  3FXT A;  2BSW A;  4MY0 A;  4JWP A;  4R87 A;  5DWN A;  5ISV A;  4U5Y A;  2FS5 A;  4L89 A;  1LRZ A;  3TO9 A;  4EVY A;  3P2F A;  4ORF A;  3TE4 A;  2ZW6 A;  4AB7 A;  3R9F A;  3B8G A;  2Q4V A;  3FRM A;  3ZZI A;  3SXO A;  4KVX A;  2B5G B;  4NCZ A;  4U9Z A;  4KOS A;  2JDC A;  1Z4E A;  5JPH A;  4OLL A;  3GY9 A;  2Z0Z A;  2PQ8 A;  2Z10 A;  4YFJ A;  2FIW A;  4CRZ B;  4H89 A;  1PU9 A;  4KOX A;  4KZT A;  4E8O A;  5JQ4 A;  4YGO A;  5EBV A;  3UY5 A;  1XF8 A;  1FY7 A;  1YR0 A;  4AG9 A;  3TO7 A;  3FB3 A;  1NMT A;  2ATR A;  3PP9 A;  5F46 A;  5H84 A;  3F8K A;  2FL4 A;  2VI7 A;  4JXR A;  1KUX A;  4U9Y A;  2OZU A;  3TTH A;  2I00 A;  4PSX A;  3F0A A;  2PRB A;  3K9U A;  1YLE A;  5EC4 A;  1NE9 A;  2FE7 A;  1Q2D A;  3EC4 A;  4NXY A;  2ZXV A;  3GYA A;  2ZW4 A;  2REF A;  4LX9 A;  4I49 A;  1S7L A;  4Y49 B;  5FVJ A;  4AG7 A;  2X7B A;  3DNS A;  1WWZ A;  2P6E A;  1UFH A;  3D2P A;  3G8W A;  2PC1 A;  4GS4 A;  5GCN A;  1BOB A;  2GE3 A;  4II9 A;  5J8F A;  3R9G A;  4H6Z A;  3PGP A;  3C26 A;  2P6F A;  1M4I A;  1Q2C A;  1XE4 A;  4X5K A;  1RXT A;  2Y0M A;  2VZY A;  2HV2 A;  2R98 A;  5C82 A;  1QSR A;  2ZW5 A;  1QST A;  2Q44 A;  1YK3 A;  1YVO A;  2K5T A;  4CRY B;  1S7F A;  3SHP A;  1KUV A;  4B5P B;  1M1D A;  4ZBG A;  3W6X A;  4MBU A;  1R57 A;  2P6G A;  3QB8 A;  4AVC A;  5KTC A;  2B5G A;  2GIV A;  1Y7R A;  4NSQ A;  2FSR A;  4RI1 A;  5KTD A;  5IB0 A;  3S6H A;  3ZJ0 A;  2B3U A;  2R1I A;  3D3S A;  4XPL A;  2JDD A;  3F5B A;  1IYL A;  1QSO A;  3TOB A;  1V0C A;  2IL4 A;  2B4D B;  3S6G A;  4JLY A;  2REE A;  4HKF A;  4HNW B;  1P0H A;  4KVM E;  2JLM A;  4UWI A;  2KCW A;  5C88 A;  1S3Z A;  2G3T A;  2ZW7 A;  2J8N A;  3D8P A;  3R1K A;  2F5I A;  1IB1 E;  4CS0 B;  3EFA A;  3IWG A;  3T90 A;  4KOT A;  3TCV A;  4XPD C;  5F48 A;  3OWC A;  3WR7 A;  2VXK A;  1I1D A;  2EUI A;  4BMH A;  3I9S A;  3KKW A;  4KOW A;  3R95 A;  3CXS A;  3FIX A;  5HH1 A;  2VEZ A;  2FXF A;  4HNY B;  4PK3 A;  4FD6 A;  3VWD A;  2CNT A;  4OAE A;  1S7N A;  3V8I A;  4FD5 A;  1WK4 A;  1QSM A;  4R3L A;  4IUS A;  1M4G A;  1J4J A;  4L8A A;  1YRE A;  3E0K A;  3LD2 A;  2AJ6 A;  3SXN A;  3LOD A;  2ARH A;  4CAX A;  2VQY A;  1QSN A;  2QIR A;  3JVN A;  4RS2 A;  4KOY A;  5DWM A;  4CAV A;  4UA3 A;  2FIA A;  2J8R A;  4UBR A;  1U6M A;  4OAD A;  1Y9W A;  1MJB A;  4XPD B;  4B5P A;  2OZG A;  1CM0 A;  4MHD A;  1KUY A;  1NSL A;  4YRH A;  2I79 A;  4NF1 A;  1I21 A;  1S60 A;  3BJ8 A;  1B6B A;  3CXP A;  2VZZ A;  4JJX A;  1YX0 A;  2PDO A;  2WPW A;  4R9M A;  5H86 A;  2P0W A;  4F0Y A;  2CNS A;  5J8C A;  3TT2 A;  1P4N A;  2B4D A;  3BLN A;  2R7H A;  4KLW A;  3FYN A;  4PV6 A;  3DR6 A;  3S6F A;  4QBJ A;  1M4D A;  2C27 A;  2BEI A;  4IF5 A;  4K30 A;  2H5M A;  1OZP A;  4NEX A;  3TO6 A;  3I3G A;  2D4O A; 
#chains in the Genus database with same CATH topology
 4ZYQ A;  3EO4 A;  3PBE A;  4MHP A;  2FT0 A;  1B87 A;  3FNC A;  4B12 A;  3PZJ A;  3D7D A;  4AVB A;  3GUX A;  4PSW A;  3DDD A;  4QUS A;  1XFO A;  2POK A;  5EMI A;  3S6K A;  4AVA A;  2PSW A;  3EY5 A;  3PFO A;  1HEE A;  4JD6 A;  3LWU A;  4C2Y A;  2PR1 A;  4BD9 A;  3G3S A;  2RC4 A;  4B11 A;  2YND A;  2B58 A;  4NJR A;  2NMT A;  2Q43 A;  6CPA A;  1LOK A;  7CPA A;  2HQY A;  2ZEO A;  1N71 A;  4MFQ A;  3TFY A;  4FD7 A;  3SJE A;  4KUA A;  4UCN A;  4R57 A;  4RN7 A;  3SJF A;  2ZOG A;  2AFW A;  4FWU A;  2A4N A;  1NSA A;  2BL1 A;  1BO4 A;  3K2K A;  1VHS A;  2HB6 A;  2VBQ A;  4JZ0 A;  2AFZ A;  3LAC A;  4OC5 A;  5A28 A;  4KOU A;  2YNC C;  3D2M A;  2G0B A;  2J9A A;  1Z4R A;  2EVN A;  3BJ7 A;  1JWQ A;  1ZG8 A;  1Z9U A;  3HLP A;  4KOR A;  1XMB A;  4B13 A;  1M44 A;  4KUB A;  3FED A;  4FD4 A;  2CNM A;  5K8P A;  4ONU A;  3JRU A;  3SJG A;  3SI1 A;  1K4J A;  1S7K A;  2R8V A;  2Q0Y A;  1BPN A;  3B3V A;  3GLJ A;  4R8F A;  1MK4 A;  2Z3K A;  2Z11 A;  2ZED A;  2V8G A;  4MXU A;  2DEA A;  4KLV A;  3CDX A;  3IC1 A;  4CGL A;  1SQH A;  4R76 A;  1IGB A;  1IOI A;  2XEJ A;  2B3V A;  1MJA A;  3B3T A;  3DR8 A;  1CBX A;  3PB9 X;  5D29 A;  1XBU A;  2EWB A;  1I12 A;  1BPM A;  4Y49 C;  4NGR A;  2ANP A;  3P2H A;  3D7G A;  2CY2 A;  1TKF A;  1XIX A;  3LMS A;  4XPK A;  4KOV A;  1YVK A;  3KQZ A;  3WC7 A;  1YW4 A;  1IIC A;  3EXN A;  3QAH A;  3T9Y A;  3H4Q A;  4E0A A;  1XRY A;  2D4P A;  2OH1 A;  4DNC A;  3H8E A;  4DJL A;  4HPS A;  1TXR A;  1Q7L A;  2AFX A;  2FCK A;  2PJC A;  1IID A;  2PR8 A;  4B14 A;  4O23 A;  1ON0 A;  4MFJ A;  4P10 A;  2IMO A;  2RFH A;  2O53 A;  4NJQ A;  3JUW A;  2RB7 A;  2V8H A;  1Q2Y A;  4MJ8 A;  4PK2 A;  5IX3 A;  2OU2 A;  2VL1 A;  5LRG A;  1ZLI A;  8CPA A;  5CNP A;  4BIN A;  3IGR A;  4B10 A;  1PCA A;  3MGD A;  3W91 A;  1LCP A;  3DSB A;  4GXH A;  3WC6 A;  3SI0 A;  2J8M A;  3B3C A;  3W6S A;  3S9N A;  3CXQ A;  4ZGY B;  2BO9 A;  3KI9 A;  4CAE A;  4EWT A;  2CXA A;  2OZH A;  1TIQ A;  3TOA A;  3KHX A;  2WYR A;  2AE6 A;  4A30 A;  1S5K A;  2PJB A;  1MJ9 A;  1VGY A;  3R9E A;  5E96 A;  4XNH C;  1XJO A;  2DXQ A;  4OKO A;  2OB0 A;  2G3A A;  1CJW A;  4P44 A;  3N5F A;  2O4H A;  2DPS A;  2PJ9 A;  2YGW A;  1Y7E A;  4MHZ A;  4UCP A;  3BI1 A;  3SJX A;  4QC6 A;  3KHZ A;  3PB6 X;  2PCU A;  4M6G A;  4DUK A;  4NGM A;  2QEC A;  3N7Z A;  5KTA A;  1Y9K A;  2GU2 A;  2GLJ A;  1VKC A;  2ZPA A;  3FH4 A;  1BLL E;  2FVG A;  1YGH A;  5K8N A;  4KSF A;  4CGM A;  4F6A A;  1R3N A;  4JXQ A;  4M85 A;  1KZF A;  4E2A A;  4H6U A;  2WPX A;  4M3S A;  3KR5 A;  3QAY A;  3B3W A;  4MHN A;  1Z2L A;  3FBU A;  3FX6 A;  3R96 A;  4M6I A;  4IK2 A;  4CYP A;  5I0C A;  1IYK A;  1A2Z A;  3NE7 A;  3NH4 A;  3GKR A;  4QB9 A;  3ISX A;  2C1C A;  4LQ6 A;  4LQG A;  2WUU A;  2HC9 A;  2O28 A;  5F49 A;  5DS0 A;  4QVT A;  4CAW A;  4WWV A;  4J3G A;  3VWE A;  3BXM A;  1BAV A;  4MCR A;  4B5O A;  1PUA A;  2Q4Y A;  4MFL A;  4YWY A;  3VAR A;  4F9V A;  4MY3 A;  5HMN A;  4UEF A;  4C7I A;  3PBB A;  3K9T A;  3L2N A;  1GHE A;  3GIU A;  4A31 A;  5F09 A;  4R3K A;  1TKH A;  1YSJ A;  2PJ3 A;  1AYE A;  1YLO A;  4IHM A;  1RO5 A;  1YQE A;  2BUE A;  2QML A;  2GAN A;  4IAV A;  5IV0 A;  3CT9 A;  1ELM P;  4G1P A;  3CPX A;  5CPA A;  2NSM A;  4NGQ A;  1XEB A;  1RTQ A;  2Q04 A;  4KVO E;  2JEV A;  2AFO A;  4MCS A;  4LUA A;  4Q38 A;  4UFV A;  4UEE A;  4XNH B;  1L0C A;  4MI4 A;  2Q7B A;  4CGO A;  5F47 A;  4UWJ A;  2B4B A;  3RYO A;  4C2X A;  4HNX B;  1XMT A;  3RZA A;  2HUZ A;  3FXT A;  3D4U A;  3D7H A;  2BSW A;  4PXB A;  4X8I A;  4MY0 A;  4EFD A;  5LYL A;  4FAI A;  4JWP A;  4R87 A;  1CP7 A;  5JM6 A;  1ARM A;  1Z8W A;  2CIJ A;  2JBK A;  5DWN A;  1LAM A;  1KWM A;  4F8Z A;  4MRI A;  3FMC A;  4U5Y A;  5ISV A;  4MFP A;  4R7M A;  3KQX A;  2ZOF A;  1R43 A;  2FS5 A;  4L89 A;  1LRZ A;  4C68 A;  3TO9 A;  2PVW A;  4EVY A;  4A39 A;  2C6G A;  3P2F A;  4RUH A;  2F8H A;  4KSA A;  1IOF A;  4ORF A;  3TE4 A;  2ZW6 A;  5G1Z A;  3NH8 A;  4AB7 A;  3ISZ A;  4NGT A;  3R9F A;  2GFQ A;  2Q4V A;  3B8G A;  3FRM A;  3SXO A;  3ZZI A;  4KVX A;  2PVV A;  4C2Z A;  5HVF A;  4MFZ A;  3WT4 A;  2B5G B;  4NCZ A;  1EE3 P;  3WC5 A;  4P4I A;  4U9Z A;  4ZY2 A;  5K8O A;  4A95 A;  2YNC A;  4OIW A;  4KOS A;  4F0X A;  2JDC A;  1Z4E A;  4ZX9 A;  4AXV A;  5JPH A;  1Z8T A;  4OLL A;  4MMO A;  3GY9 A;  3BI0 A;  2Z0Z A;  3HUV A;  2PQ8 A;  2Z10 A;  4CAF A;  4YFJ A;  2FIW A;  4PXD A;  4CRZ B;  4H89 A;  1PU9 A;  3KL9 A;  4KOX A;  4WJB A;  4KZT A;  4E8O A;  5JQ4 A;  1TF8 A;  4KS9 A;  4YGO A;  5EBV A;  4NGP A;  1XF8 A;  3UY5 A;  1FY7 A;  1YR0 A;  3PEI A;  4AG9 A;  4P4E A;  3RBU A;  3V38 A;  4MCP A;  3TO7 A;  1LAN A;  2ZEL A;  4UFX A;  3FB3 A;  1NMT A;  2ATR A;  2Z3P A;  3PP9 A;  3D68 A;  2PRQ A;  5F46 A;  5H84 A;  3F8K A;  2FL4 A;  2QYV A;  4NGN A;  3NA6 A;  2VI7 A;  4JXR A;  1KUX A;  3IFE A;  4A37 A;  2GRE A;  3VH9 A;  2PJ8 A;  2PIY A;  4U9Y A;  1HDQ A;  3D7F A;  2AFU A;  2OZU A;  4P4F A;  4UIA A;  4CYO A;  3B3S A;  4FUU A;  3TTH A;  2I00 A;  2PJ0 A;  4PSX A;  3F0A A;  3IU2 A;  3IIB A;  1LFW A;  1QQ9 A;  2PRB A;  3K9U A;  4OME A;  4UEZ A;  5K8M A;  1YLE A;  5EC4 A;  1NE9 A;  3MRU A;  2FE7 A;  1Q2D A;  1CP6 A;  3EC4 A;  4C7H A;  2DF5 A;  5LYF A;  3DGV A;  4NXY A;  2ZXV A;  3GYA A;  2Z3O A;  3TC8 A;  3H8G A;  4OC4 A;  2ZW4 A;  2REF A;  2Z3L A;  1QMU A;  2Q51 A;  2WSA A;  5BWA B;  4LX9 A;  4I49 A;  4FBE A;  1ZLH A;  5LRK A;  1S7L A;  4Y49 B;  1ZG7 A;  5FVJ A;  2CF4 A;  4AG7 A;  2BCO A;  4F9U A;  4OC1 A;  2X7B A;  3PB4 X;  1TKJ A;  3DNS A;  4PPZ A;  1WWZ A;  2XEG A;  4CPA A;  2P6E A;  1VHO A;  3NE8 A;  5I4M A;  1UFH A;  5G21 A;  3D2P A;  4X2T A;  3S9M A;  1F57 A;  2QJ8 A;  3PRT A;  3G8W A;  4P4J A;  2PC1 A;  2PJ7 A;  3PFE A;  4PXE A;  4GS4 A;  4PXC A;  5GCN A;  5JGF A;  2C6P A;  1BOB A;  2GE3 A;  4II9 A;  3FJU A;  2ZEM A;  2OR4 A;  1H8L A;  5J8F A;  5JH9 A;  2PJ6 A;  3R9G A;  4H6Z A;  3B7I A;  3PGP A;  1GYT A;  3TOB A;  1CX8 A;  2ZEP A;  3C26 A;  2P6F A;  3D67 A;  1M4I A;  1Q2C A;  1XE4 A;  1X10 A;  4X5K A;  4TNU A;  3IWE A;  1RXT A;  5AG5 A;  4DYO A;  3I1U A;  1TF9 A;  3RNZ A;  4CYN A;  2Y0M A;  2VZY A;  2HV2 A;  3TX8 A;  5IB9 A;  2R98 A;  5J1Q A;  3IU1 A;  5C82 A;  4OC2 A;  1QSR A;  2ZW5 A;  1QST A;  2Q44 A;  1HDU A;  1YK3 A;  4A33 A;  1YVO A;  3BHX A;  5AG7 A;  2K5T A;  1LAP A;  4CRY B;  1S7F A;  3SHP A;  1KUV A;  4B5P B;  1M1D A;  2ABZ A;  4ZBG A;  1ZO0 A;  4UF4 A;  3W6X A;  4MBU A;  1R57 A;  2P6G A;  3QB8 A;  4AVC A;  5KTC A;  4EME A;  3CZX A;  2B5G A;  1AUG A;  2GIV A;  1FNO A;  2XEI A;  1Y7R A;  3KZW A;  4NSQ A;  4CYQ A;  2FSR A;  3PB8 X;  4RI1 A;  5KTD A;  4ZY0 A;  3NH5 A;  4P6Y A;  5IB0 A;  3S6H A;  2Q4Z A;  5THW A;  3SI2 A;  3ZJ0 A;  2B3U A;  2R1I A;  3D3S A;  4XPL A;  1FT7 A;  4UIB A;  4P4B A;  5G20 A;  2JDD A;  4MCQ A;  5LYI A;  4W9Y A;  3F5B A;  1IYL A;  2V8V A;  3FF3 A;  4M6H A;  2V8D A;  1QSO A;  3FVL A;  1V0C A;  2F7V A;  2B4D B;  2IL4 A;  2JBJ A;  2QVP A;  3S6G A;  4JLY A;  2REE A;  4HKF A;  4HNW B;  3IO1 A;  1P0H A;  4KVM E;  4OC3 A;  2JLM A;  4PQA A;  5G22 A;  3T8W A;  2I3C A;  3V7Z A;  4UWI A;  2G9D A;  2KCW A;  2EO8 A;  5C88 A;  2AFM A;  1S3Z A;  5CBM A;  4X3R A;  2EK9 A;  3GB0 A;  2G3T A;  4Z65 A;  2ZW7 A;  2J8N A;  3D8P A;  4JYW A;  4ZY1 A;  3R1K A;  4A2Z A;  1ZG9 A;  1DTD A;  2F5I A;  3FEC A;  4KSI A;  1IB1 E;  3RO0 A;  4CS0 B;  3EFA A;  3IWG A;  3B35 A;  4NGS A;  5AG6 A;  2IQ6 A;  3T90 A;  1JQG A;  4A38 A;  4NFR A;  4KOT A;  3TCV A;  4XPD C;  5F48 A;  3OWC A;  3H8F A;  2IJZ A;  2ZEE A;  2EK8 A;  2VXK A;  4MFK A;  3WR7 A;  4Q36 A;  1I1D A;  4P45 A;  1Y0Y A;  1F2P A;  2EUI A;  4BMH A;  3I9S A;  3KKW A;  1X12 A;  4KOW A;  3R95 A;  3CXS A;  3FIX A;  2JEW A;  4TWE A;  5HH1 A;  4OID A;  2CTC A;  2GLF A;  2VEZ A;  3D66 A;  2FXF A;  3IJ3 A;  4HNY B;  2ODF A;  4PK3 A;  4FD6 A;  3VWD A;  1PYT B;  1Z8X A;  2ZEF A;  2ZEG A;  5AGE A;  2OOT A;  2CNT A;  2V77 A;  4OAE A;  4UFW A;  1Y0R A;  2PIZ A;  4CGN A;  1DE4 C;  1S7N A;  3V8I A;  1WK4 A;  1CG2 A;  4FD5 A;  3VAT A;  5A27 A;  1QSM A;  1IU8 A;  4R3L A;  1M4L A;  3WAB A;  4IUS A;  2PJ2 A;  4OC0 A;  1M4G A;  1IY7 A;  1J4J A;  4L8A A;  1YME A;  2DPT A;  3JTK A;  1YRE A;  5LYD A;  2PJ4 A;  3E0K A;  3LD2 A;  3S9L A;  3NFZ A;  2AJ6 A;  3SXN A;  3B2Y A;  1ARL A;  2ARH A;  2BOA A;  3LOD A;  5LRJ A;  4ZX8 A;  3QNV A;  2CTB A;  4CAX A;  2VQY A;  2ZEN A;  1QSN A;  2QIR A;  3JVN A;  4RS2 A;  4OP4 A;  4KOY A;  5DWM A;  4ZI6 A;  4CAV A;  3RAM A;  4UA3 A;  4BBH A;  4UCM A;  2FIA A;  2J8R A;  4H2K A;  4UBR A;  2WZN A;  1U6M A;  4OAD A;  1Y9W A;  5HVH A;  1YW6 A;  1MJB A;  3KR4 A;  1ELL P;  3CPA A;  1OBR A;  1CPS A;  4XPD B;  4B5P A;  1CPX A;  2OZG A;  1VHE A;  1CM0 A;  4MHD A;  3PB7 X;  1KUY A;  4R6T A;  1NSL A;  4YRH A;  2XEF A;  4CGP A;  2I79 A;  4NF1 A;  3IEH A;  5HXD A;  2PJ5 A;  2Q7S A;  3DLJ A;  3KAS A;  3IWW A;  4Q7A A;  1I21 A;  1VIX A;  2Z3M A;  3KGQ A;  3MN8 A;  1S60 A;  2AFS A;  3BJ8 A;  1Z8L A;  2EBJ A;  2PJ1 A;  1B6B A;  1UWY A;  4P4D A;  3CXP A;  4K3N A;  2VZZ A;  4JJX A;  1YX0 A;  2PDO A;  2WPW A;  4R9M A;  4ONW A;  4GM5 A;  5H86 A;  2NYQ A;  4A94 A;  2ZEH A;  3H5Z A;  2P0W A;  2YNE A;  4F0Y A;  5HVG A;  5AG4 A;  1AMP A;  1XOV A;  1F2O A;  1Z5R A;  2CNS A;  4YU9 A;  5ELY A;  3TT2 A;  4B6Z A;  5J8C A;  1P4N A;  2PJA A;  2B4D A;  3BLN A;  2R7H A;  4KLW A;  3FYN A;  4PV6 A;  3DR6 A;  2C6C A;  3S6F A;  4QBJ A;  3A9L A;  1M4D A;  2C27 A;  4MHY A;  5D8N A;  2BEI A;  2PE3 A;  3FEE A;  4IF5 A;  2Z3N A;  4K30 A;  2H5M A;  1OZP A;  4NEX A;  3TO6 A;  3I3G A;  4A32 A;  2D4O A; 
#chains in the Genus database with same CATH homology
 3EO4 A;  2FT0 A;  1B87 A;  3FNC A;  4B12 A;  3PZJ A;  4AVB A;  4QUS A;  4PSW A;  3DDD A;  4AVA A;  3S6K A;  2PSW A;  3EY5 A;  4JD6 A;  4C2Y A;  2PR1 A;  3G3S A;  2RC4 A;  4B11 A;  2YND A;  2B58 A;  2NMT A;  3TFY A;  2HQY A;  4MFQ A;  1N71 A;  4FD7 A;  4KUA A;  4UCN A;  4R57 A;  2A4N A;  2BL1 A;  1BO4 A;  1VHS A;  2VBQ A;  5A28 A;  4KOU A;  2YNC C;  3D2M A;  2G0B A;  1Z4R A;  2EVN A;  3BJ7 A;  4KOR A;  4B13 A;  1Z9U A;  1M44 A;  4KUB A;  4FD4 A;  2CNM A;  4ONU A;  1K4J A;  1S7K A;  2R8V A;  2Q0Y A;  1MK4 A;  2Z3K A;  2Z11 A;  4KLV A;  4CGL A;  1SQH A;  2B3V A;  1MJA A;  3DR8 A;  1I12 A;  4Y49 C;  3P2H A;  2CY2 A;  4XPK A;  1XIX A;  4KOV A;  1YVK A;  1IIC A;  3EXN A;  3QAH A;  3T9Y A;  3H4Q A;  4E0A A;  2OH1 A;  2D4P A;  4DNC A;  2FCK A;  2PR8 A;  4B14 A;  1IID A;  1ON0 A;  4MFJ A;  3JUW A;  4MJ8 A;  1Q2Y A;  5IX3 A;  4PK2 A;  2OU2 A;  5CNP A;  3IGR A;  4B10 A;  3MGD A;  3W91 A;  3DSB A;  2J8M A;  3W6S A;  3CXQ A;  4ZGY B;  4CAE A;  2CXA A;  2OZH A;  1TIQ A;  3TOA A;  2AE6 A;  4A30 A;  1S5K A;  1MJ9 A;  3R9E A;  5E96 A;  4XNH C;  2DXQ A;  2OB0 A;  2G3A A;  1CJW A;  2DPS A;  2YGW A;  4UCP A;  4QC6 A;  3N7Z A;  2QEC A;  5KTA A;  1Y9K A;  1VKC A;  2ZPA A;  1YGH A;  4KSF A;  4CGM A;  4F6A A;  4JXQ A;  4M85 A;  4E2A A;  1KZF A;  4H6U A;  2WPX A;  4M3S A;  3FBU A;  3R96 A;  4CYP A;  5I0C A;  1IYK A;  3NE7 A;  4QB9 A;  3GKR A;  2WUU A;  2O28 A;  5F49 A;  4QVT A;  4CAW A;  4J3G A;  3VWE A;  4B5O A;  5HMN A;  1PUA A;  2Q4Y A;  4MFL A;  4MY3 A;  4C7I A;  1GHE A;  4A31 A;  4R3K A;  1RO5 A;  2BUE A;  2QML A;  2GAN A;  5IV0 A;  1XEB A;  4KVO E;  2Q04 A;  4Q38 A;  2JEV A;  4LUA A;  4UFV A;  4XNH B;  1L0C A;  4MI4 A;  2Q7B A;  4CGO A;  5F47 A;  4UWJ A;  2B4B A;  3RYO A;  4C2X A;  4HNX B;  1XMT A;  2HUZ A;  3FXT A;  2BSW A;  4MY0 A;  4JWP A;  4R87 A;  5DWN A;  5ISV A;  4U5Y A;  4MFP A;  2FS5 A;  4L89 A;  1LRZ A;  4C68 A;  3TO9 A;  4EVY A;  3P2F A;  4KSA A;  4ORF A;  3TE4 A;  2ZW6 A;  5G1Z A;  4AB7 A;  3R9F A;  3B8G A;  2Q4V A;  3FRM A;  3ZZI A;  3SXO A;  4KVX A;  4C2Z A;  4MFZ A;  2B5G B;  4NCZ A;  4U9Z A;  4A95 A;  2YNC A;  4F0X A;  4KOS A;  2JDC A;  1Z4E A;  5JPH A;  4OLL A;  3GY9 A;  2Z0Z A;  2PQ8 A;  2Z10 A;  4CAF A;  4YFJ A;  2FIW A;  4CRZ B;  4H89 A;  1PU9 A;  4KOX A;  4KZT A;  4E8O A;  5JQ4 A;  4KS9 A;  4YGO A;  5EBV A;  3UY5 A;  1XF8 A;  1FY7 A;  1YR0 A;  4AG9 A;  3TO7 A;  4UFX A;  3FB3 A;  1NMT A;  2ATR A;  2Z3P A;  3PP9 A;  5F46 A;  5H84 A;  3F8K A;  2FL4 A;  2VI7 A;  4JXR A;  1KUX A;  4U9Y A;  4CYO A;  2OZU A;  3TTH A;  2I00 A;  4PSX A;  3F0A A;  3IU2 A;  2PRB A;  3K9U A;  1YLE A;  5EC4 A;  1NE9 A;  2FE7 A;  1Q2D A;  3EC4 A;  4C7H A;  4NXY A;  2ZXV A;  3GYA A;  2Z3O A;  2ZW4 A;  2REF A;  2Z3L A;  2WSA A;  5BWA B;  4LX9 A;  4I49 A;  1S7L A;  4Y49 B;  5FVJ A;  4AG7 A;  2X7B A;  3DNS A;  1WWZ A;  2P6E A;  1UFH A;  5G21 A;  3D2P A;  3G8W A;  2PC1 A;  4GS4 A;  5GCN A;  1BOB A;  2GE3 A;  4II9 A;  5J8F A;  3R9G A;  4H6Z A;  3PGP A;  3C26 A;  2P6F A;  1M4I A;  1Q2C A;  1XE4 A;  4X5K A;  3IWE A;  1RXT A;  5AG5 A;  4CYN A;  2Y0M A;  2VZY A;  2HV2 A;  2R98 A;  3IU1 A;  5C82 A;  1QSR A;  2ZW5 A;  1QST A;  2Q44 A;  1YK3 A;  4A33 A;  1YVO A;  5AG7 A;  2K5T A;  4CRY B;  1S7F A;  3SHP A;  1KUV A;  4B5P B;  1M1D A;  4ZBG A;  1ZO0 A;  3W6X A;  4MBU A;  1R57 A;  2P6G A;  3QB8 A;  4AVC A;  5KTC A;  2B5G A;  2GIV A;  1Y7R A;  4NSQ A;  4CYQ A;  2FSR A;  4RI1 A;  5KTD A;  5IB0 A;  3S6H A;  3ZJ0 A;  2B3U A;  2R1I A;  3D3S A;  4XPL A;  5G20 A;  2JDD A;  3F5B A;  1IYL A;  1QSO A;  3TOB A;  1V0C A;  2IL4 A;  2B4D B;  3S6G A;  4JLY A;  2REE A;  4HKF A;  4HNW B;  1P0H A;  4KVM E;  2JLM A;  5G22 A;  4UWI A;  2KCW A;  5C88 A;  1S3Z A;  2G3T A;  2ZW7 A;  2J8N A;  3D8P A;  3R1K A;  4A2Z A;  2F5I A;  1IB1 E;  4CS0 B;  3EFA A;  3IWG A;  5AG6 A;  3T90 A;  4KOT A;  3TCV A;  4XPD C;  5F48 A;  3OWC A;  3WR7 A;  2VXK A;  4MFK A;  4Q36 A;  1I1D A;  2EUI A;  4BMH A;  3I9S A;  3KKW A;  4KOW A;  3R95 A;  3CXS A;  3FIX A;  5HH1 A;  2VEZ A;  2FXF A;  4HNY B;  4PK3 A;  4FD6 A;  3VWD A;  5AGE A;  2CNT A;  4OAE A;  4UFW A;  4CGN A;  1S7N A;  3V8I A;  4FD5 A;  1WK4 A;  5A27 A;  1QSM A;  4R3L A;  4IUS A;  1M4G A;  1J4J A;  4L8A A;  2DPT A;  3JTK A;  1YRE A;  3E0K A;  3LD2 A;  2AJ6 A;  3SXN A;  3LOD A;  2ARH A;  4CAX A;  2VQY A;  1QSN A;  2QIR A;  3JVN A;  4RS2 A;  4KOY A;  5DWM A;  4CAV A;  4UA3 A;  4BBH A;  4UCM A;  2FIA A;  2J8R A;  4UBR A;  1U6M A;  4OAD A;  1Y9W A;  1MJB A;  4XPD B;  4B5P A;  2OZG A;  1CM0 A;  4MHD A;  1KUY A;  1NSL A;  4YRH A;  4CGP A;  2I79 A;  4NF1 A;  1I21 A;  2Z3M A;  1S60 A;  3BJ8 A;  1B6B A;  3CXP A;  2VZZ A;  4JJX A;  1YX0 A;  2PDO A;  2WPW A;  4R9M A;  5H86 A;  3H5Z A;  2P0W A;  2YNE A;  4F0Y A;  5AG4 A;  2CNS A;  5J8C A;  3TT2 A;  1P4N A;  2B4D A;  3BLN A;  2R7H A;  4KLW A;  3FYN A;  4PV6 A;  3DR6 A;  3S6F A;  4QBJ A;  3A9L A;  1M4D A;  2C27 A;  2BEI A;  4IF5 A;  2Z3N A;  4K30 A;  2H5M A;  1OZP A;  4NEX A;  3TO6 A;  3I3G A;  4A32 A;  2D4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...