4JLYA

Dodecameric structure of spermidine n-acetyltransferase from vibrio cholerae
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
172
structure length
172
Chain Sequence
b'NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine n1-acetyltransferase
publication title Substrate-Induced Allosteric Change in the Quaternary Structure of the Spermidine N-Acetyltransferase SpeG.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Transferase
total genus 49
structure length 172
sequence length 172
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2013-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4jlyA00
1KZFA 2CNSA 1VHSA 3EFAA 4K30A 4XPLA 1P0HA 4JJXA 1OZPA 1Q2YA 4QVTA 3R9FA 1M44A 4CRYB 4BMHA 1QSNA 2QECA 4MJ8A 2NMTA 3FB3A 1BOBA 4HNXB 4E0AA 3IWGA 3T90A 3JUWA 2PRBA 3EY5A 4KVOE 3VWDA 1MJBA 2B58A 4MY0A 3WR7A 2HUZA 1K4JA 4QC6A 2GIVA 1KUYA 2PSWA 2OU2A 2KCWA 2IL4A 1MK4A 1WWZA 2G3AA 5FVJA 3FXTA 4NXYA 3IGRA 4NF1A 3DDDA 4AVBA 3BJ7A 4E8OA 1UFHA 3ZZIA 3P2HA 3JVNA 1RXTA 1YREA 3TTHA 4MBUA 4II9A 1LRZA 3TO7A 1Z4EA 2BL1A 1Z9UA 2JLMA 4X5KA 2ZW7A 2EVNA 4U9ZA 4QB9A 5DWMA 4F0YA 1XF8A 5F46A 1NE9A 2G3TA 3QAHA 2VBQA 4RS2A 4UA3A 3TT2A 3MGDA 1YR0A 1N71A 5EC4A 1CM0A 2Q0YA 4PSWA 5DWNA 1I21A 3V8IA 3GKRA 3EC4A 1YVKA 1PU9A 1Y9WA 1QSRA 2PQ8A 2R8VA 3SXNA 1QSMA 2OZGA 4FD7A 2VXKA 2FIWA 2Q4YA 4L89A 1CJWA 3D3SA 4OAEA 4B5PA 3R9EA 2P6GA 5ISVA 1RO5A 1QSOA 1XMTA 1TIQA 1YK3A 4E2AA 2D4OA 5E96A 5J8CA 4IUSA 1S5KA 5JQ4A 3F8KA 4KUAA 3N7ZA 4NSQA 3SXOA 3UY5A 1S60A 4OLLA 2Z11A 2FXFA 2R98A 4M3SA 2J8RA 1M4GA 2FIAA 4KLVA 2B4BA 3EO4A 2OH1A 3NE7A 2P6EA 1Y7RA 3S6FA 4YGOA 5JPHA 3FIXA 1FY7A 4PV6A 2HQYA 5IV0A 3VWEA 2Q7BA 2B4DB 3S6GA 4H6UA 4L8AA 3SHPA 2JDCA 3D8PA 2FS5A 3TOBA 4KOVA 4JLYA 4KLWA 2PR1A 2ZXVA 4CAWA 2ZW4A 2CNMA 1IYLA 3GYAA 5IX3A 2EUIA 2B3VA 2CY2A 4KOSA 4R3KA 1Y9KA 5CNPA 1IICA 5IB0A 3W6SA 3TE4A 2JDDA 4RI1A 3TOAA 4OADA 2C27A 3F5BA 1IYKA 2OZUA 5GCNA 2OB0A 3R95A 3FRMA 4CRZB 1S7FA 4UBRA 5H86A 2FSRA 3R9GA 2J8MA 3QB8A 4IF5A 3FBUA 1NMTA 4LUAA 4QBJA 4R87A 4U5YA 2ATRA 1S7LA 1KUVA 3EXNA 1I12A 2AJ6A 2B3UA 4LX9A 5KTAA 3DSBA 3I3GA 4AG7A 2BSWA 2VEZA 1WK4A 4JXQA 3CXQA 1NSLA 1P4NA 1YLEA 2H5MA 1XIXA 4ONUA 3I9SA 2FCKA 4KOUA 2CNTA 1S7KA 4H6ZA 4FD5A 2OZHA 4R57A 4M85A 1YX0A 2QIRA 4CAVA 2B5GA 1QSTA 3S6HA 5H84A 2Q4VA 1Q2CA 1Z4RA 3TFYA 3LODA 2PDOA 3D2MA 4KOWA 4JWPA 3TCVA 1B87A 2P6FA 4ORFA 1VKCA 4AVAA 2ZW5A 4CAXA 4UWIA 4GS4A 4MHDA 1M4IA 1PUAA 2F5IA 2HV2A 2VQYA 4AVCA 4JD6A 3KKWA 3C26A 3BLNA 1L0CA 3CXSA 3BJ8A 1Q2DA 4R3LA 4FD4A 4KZTA 4NEXA 2GE3A 4YFJA 3G3SA 2ZW6A 4FD6A 5J8FA 4XNHB 4H89A 4NCZA 1ON0A 3S6KA 2Q44A 1BO4A 4B5PB 2I00A 2P0WA 4F6AA 3R1KA 3G8WA 3RYOA 5KTDA 2D4PA 3FNCA 2QMLA 4CS0B 2RC4A 5EBVA 4DNCA 2G0BA 4XPDB 2ZPAA 3PZJA 3TO6A 3K9UA 4PSXA 3W6XA 2Y0MA 1YGHA 3TO9A 3DNSA 2ARHA 4UWJA 2VI7A 2GANA 4AB7A 4ZBGA 5HMNA 2PR8A 4PK3A 5F47A 3DR6A 3E0KA 4KUBA 3T9YA 1MJAA 1V0CA 5HH1A 4HNWB 4B5OA 2R7HA 2J8NA 4HNYB 4KOTA 2FL4A 4Y49C 4KOYA 2R1IA 4EVYA 4YRHA 3W91A 4KVXA 2VZZA 4XNHC 3P2FA 1J4JA 3H4QA 1GHEA 2DXQA 3F0AA 3PGPA 3ZJ0A 3GY9A 2BEIA 2Q04A 4PK2A 4XPDC 2JEVA 2BUEA 2AE6A 2X7BA 4I49A 1XEBA 1S7NA 3OWCA 5KTCA 2VZYA 1XE4A 4HKFA 4QUSA 2REFA 3CXPA 5C88A 2I79A 4U9YA 2PC1A 3B8GA 2WPWA 2REEA 3D2PA 1B6BA 5C82A 4MY3A 2FT0A 1S3ZA 3DR8A 1R57A 2Z0ZA 4R9MA 5F49A 4KVME 1I1DA 1IB1E 1M4DA 4XPKA 1U6MA 1KUXA 4MI4A 4KORA 2O28A 3R96A 1SQHA 2K5TA 1IIDA 4JXRA 4J3GA 1M1DA 2B5GB 4Y49B 1YVOA 4AG9A 3PP9A 3LD2A 2FE7A 2B4DA 2Z10A 5I0CA 3FYNA 2WPXA 2A4NA 4KOXA 5F48A 1MJ9A
chains in the Genus database with same CATH superfamily
1KZFA 2IQ6A 2CNSA 1VHSA 3EFAA 5D8NA 1X10A 3D7GA 4K30A 5G22A 1TKFA 4M6GA 4MMOA 4XPLA 3ISZA 5J1QA 1P0HA 4JJXA 1OZPA 3KQZA 2C6GA 4B6ZA 2OR4A 3BXMA 1Q2YA 4QVTA 3R9FA 1M44A 2Z3MA 3BI0A 4CRYB 4BMHA 1QSNA 5HVHA 4MFKA 4CYQA 2QECA 2HC9A 1A2ZA 4MJ8A 3LWUA 2NMTA 4EMEA 2AFUA 3GLJA 3GB0A 4MFZA 2PJ0A 3FB3A 5JH9A 1BOBA 4HNXB 4E0AA 3IWGA 3T90A 2DEAA 3JUWA 3KGQA 4MCSA 2PRBA 3EY5A 4KVOE 4UCNA 3VWDA 1MJBA 4A33A 4CGOA 3S9LA 2YNCC 4CGNA 2B58A 4MY0A 5AG6A 3WR7A 2HUZA 1K4JA 4MFJA 4QC6A 4X8IA 2GIVA 2ABZA 4B10A 1KUYA 1F2OA 2IMOA 2OU2A 2KCWA 2PSWA 3TX8A 4ONWA 2IL4A 3FEDA 1MK4A 4MHZA 1WWZA 2XEFA 2G3AA 5FVJA 3WC7A 3FXTA 3PRTA 3FMCA 1BAVA 4NXYA 5THWA 2J9AA 4NFRA 2Q4ZA 1XRYA 3DGVA 4P45A 3IGRA 4NF1A 3SJXA 3PB6X 3DDDA 3IU1A 1CPXA 4WJBA 1Z5RA 3B7IA 3NH8A 3KR4A 4AVBA 2PVWA 1IU8A 3BJ7A 3D7HA 3FF3A 2F7VA 4E8OA 1UFHA 1VGYA 3KASA 4JZ0A 3ZZIA 1KWMA 3JVNA 3P2HA 4NGQA 4Q36A 1RXTA 1YREA 3TTHA 2EK8A 4MBUA 3RAMA 3KHZA 4II9A 1LRZA 3JTKA 3TO7A 4MFQA 1Z4EA 5AG5A 1CX8A 2BL1A 1Z9UA 2JLMA 4W9YA 4X5KA 1TF8A 2ZW7A 2OOTA 2EVNA 1BPNA 5LRGA 4U9ZA 4QB9A 2GFQA 5DWMA 4AXVA 4F0YA 4MCRA 1XF8A 3TC8A 1JWQA 4A95A 5F46A 1NE9A 1R3NA 1IOIA 2YNEA 2G3TA 3QAHA 3FJUA 2VBQA 2PJ3A 4RS2A 4C7IA 4UA3A 2Q51A 3FX6A 3TT2A 4ZY0A 3MGDA 1YQEA 1N71A 1YR0A 4ZI6A 5EC4A 1CM0A 2Q0YA 4PSWA 2EWBA 4ZY2A 3QAYA 5DWNA 4ZGYB 1TKHA 4A32A 2YGWA 4OP4A 1I21A 1Y0YA 3V8IA 3GKRA 2ZEMA 3EC4A 1YVKA 3WC5A 1LAMA 1PU9A 1Y9WA 1QSRA 1YW6A 4G1PA 4TNUA 2PQ8A 4A31A 1Z8XA 2R8VA 3CZXA 3NA6A 3SXNA 1QSMA 2OZGA 4FD7A 2ZEHA 3B3TA 4KSIA 2VXKA 5K8PA 2V8DA 3H8GA 2FIWA 2PJBA 2Q4YA 4L89A 1CBXA 1CJWA 5G1ZA 5A27A 4EFDA 2PCUA 4LQ6A 2EO8A 4H2KA 5F09A 2F8HA 3D3SA 4OAEA 4B5PA 2AFSA 4A38A 3SI0A 2PJ8A 3R9EA 4TWEA 2P6GA 2QYVA 3SJEA 5ISVA 1RO5A 3LMSA 4P4EA 2PJ5A 3D68A 1Z8WA 3D67A 1QSOA 1LAPA 1XMTA 3B3CA 3I1UA 1TIQA 3D4UA 4MHYA 3K2KA 1YK3A 3K9TA 5LYIA 1ZG7A 4NGTA 4E2AA 2ODFA 1UWYA 2D4OA 5E96A 4CGLA 4NGSA 5J8CA 4IUSA 3IC1A 1PYTB 1S5KA 3KI9A 1VIXA 1FNOA 5JQ4A 2ZEOA 2I3CA 3F8KA 4UCPA 4KUAA 3N7ZA 1XOVA 4NSQA 2HB6A 3SXOA 4IHMA 4P4IA 3WC6A 3UY5A 1S60A 4OLLA 4WWVA 3KHXA 4NGRA 5LYFA 2Z11A 2AFOA 4YWYA 3WABA 2FXFA 2ZEEA 2Z3LA 2R98A 4Z65A 2FVGA 4M3SA 3IU2A 2J8RA 3JRUA 1M4GA 3PEIA 4PQAA 4PXCA 2FIAA 4KLVA 4MXUA 2B4BA 3EO4A 2OH1A 3NE7A 2P6EA 1Y7RA 4O23A 1FT7A 3S6FA 3CT9A 4A37A 3PFEA 4YGOA 5JPHA 3FH4A 2V8GA 3FIXA 1FY7A 4PXBA 3RBUA 2CTBA 4PV6A 2HQYA 5HVGA 3VWEA 5IV0A 2Q7BA 1XMBA 2B4DB 3PB9X 3S6GA 4UFXA 2ZEFA 3GIUA 5A28A 1AMPA 4H6UA 4L8AA 4OKOA 3SHPA 4ZY1A 2JDCA 3D8PA 3S9MA 2FS5A 4EWTA 4F0XA 4ZX9A 4P10A 4P4BA 2O4HA 3TOBA 4GXHA 4KOVA 4JLYA 4KLWA 3SJFA 2PR1A 2ZXVA 3B3WA 4F8ZA 4CAWA 2ZW4A 4CGPA 2CNMA 4BD9A 1IYLA 4UFWA 3GYAA 5IX3A 3T8WA 3H8EA 3QNVA 1ARMA 4LQGA 4MCQA 2EUIA 4MRIA 3PB4X 3B3SA 2B3VA 5K8MA 1LOKA 4GM5A 2CY2A 4KOSA 1ARLA 4NJQA 4R3KA 3A9LA 1Y9KA 5CNPA 1IICA 4MCPA 4C7HA 2Z3NA 5IB0A 4K3NA 3W6SA 4CGMA 3TE4A 2JDDA 4RI1A 3TOAA 2ZENA 4OADA 4R7MA 2C27A 3F5BA 4OIDA 4MHPA 1F2PA 1CG2A 3IWWA 1IYKA 3KZWA 2OZUA 1M4LA 5GCNA 4DJLA 4M6IA 2OB0A 2V8VA 3R95A 4F9VA 1BLLE 3FRMA 4CRZB 3NH5A 1S7FA 1OBRA 2GREA 2WZNA 4UBRA 3RZAA 5H86A 4OC2A 3CPAA 4CYPA 4ZYQA 2FSRA 2C1CA 3R9GA 2AFMA 4NJRA 2Z3PA 2J8MA 2Z3KA 3QB8A 2V8HA 3IFEA 4KSFA 4NGMA 4IF5A 4OIWA 7CPAA 4CAEA 3FBUA 5HXDA 1NMTA 4LUAA 3DLJA 3KL9A 3NE8A 4QBJA 4R76A 4R87A 4R8FA 2ATRA 4U5YA 1S7LA 1KUVA 2ANPA 1XBUA 3EXNA 2NSMA 3SJGA 1I12A 4PPZA 2AJ6A 2B3UA 3FECA 2DPSA 4LX9A 5KTAA 3PBBA 3DSBA 4HPSA 3NH4A 2CIJA 3I3GA 5CBMA 3PBEA 3IO1A 4IAVA 4AG7A 4B14A 2BSWA 2VEZA 1WK4A 3L2NA 5D29A 4JXQA 3CXQA 5LRKA 1NSLA 4KS9A 1P4NA 1YLEA 2H5MA 3CPXA 1XIXA 4ONUA 5JM6A 3I9SA 2FCKA 4KOUA 2CNTA 1S7KA 4P6YA 4C2ZA 4KOXA 4H6ZA 4X3RA 4R6TA 2YNCA 1AYEA 4Q7AA 4FD5A 1Y7EA 4A2ZA 2OZHA 2C6CA 3KQXA 3SI1A 1YW4A 4R57A 4M85A 4A30A 1YX0A 2QIRA 4P44A 4OC4A 4CAVA 5CPAA 4X2TA 3N5FA 3B35A 2B5GA 4UEFA 1QSTA 3S6HA 1JQGA 2O53A 4UCMA 5BWAB 2ZEGA 1VHEA 5H84A 3BHXA 2Q4VA 1Q2CA 1Z4RA 2EBJA 3TFYA 4P4JA 1QQ9A 3LODA 1CP6A 4YU9A 5LYDA 5I4MA 2V77A 5G21A 2PDOA 3D2MA 4KOWA 1BPMA 2VL1A 2CF4A 4JWPA 3TCVA 4P4FA 1B87A 5DS0A 2P6FA 4A94A 2GLFA 4ORFA 4NGNA 1LANA 1VKCA 5ELYA 4RN7A 4AVAA 4CAFA 2AFZA 2ZW5A 4CAXA 4UWIA 1YLOA 4GS4A 4MHDA 1M4IA 1PUAA 2WYRA 2F5IA 2BOAA 2HV2A 3RO0A 4BINA 2VQYA 4AVCA 1Q7LA 4JD6A 1VHOA 3KKWA 3WT4A 3C26A 3PFOA 3BLNA 1L0CA 3CXSA 2G9DA 3BJ8A 4DUKA 1Q2DA 5K8NA 4R3LA 4FD4A 2JEWA 2YNDA 4KZTA 5G20A 4JYWA 4NEXA 3IJ3A 4KSAA 3LACA 3RNZA 4B12A 2GE3A 4YFJA 1IY7A 1Z8TA 4Q38A 3G3SA 4NGPA 2XEIA 3H8FA 2ZW6A 3MRUA 4FD6A 5J8FA 4XNHB 2RB7A 4H89A 5K8OA 1X12A 4NCZA 1ON0A 3S6KA 2Q44A 3D7DA 1BO4A 4B5PB 4CYNA 1HDUA 2I00A 2PJAA 2IJZA 2P0WA 5IB9A 4F6AA 3D7FA 3G8WA 3R1KA 2ZOGA 3VARA 3RYOA 3HLPA 5KTDA 2D4PA 1R43A 3FNCA 2QMLA 4CS0B 1RTQA 2PIZA 2RC4A 2ZEDA 6CPAA 4OC3A 5EBVA 2XEGA 3VH9A 4DNCA 1ZLIA 2G0BA 4CYOA 4XPDB 4FUUA 1EE3P 4UFVA 2ZPAA 1IGBA 1GYTA 3PZJA 3TO6A 3CDXA 3K9UA 4PSXA 1ELMP 2PJ6A 3VATA 3W6XA 2Y0MA 3KR5A 1YGHA 3TO9A 3BI1A 2ARHA 1LFWA 2DF5A 2PE3A 2PJ4A 3DNSA 3IWEA 3S9NA 2ZOFA 4UWJA 5LRJA 4UEEA 1ZO0A 2VI7A 2GANA 4AB7A 3HUVA 4ZBGA 5HMNA 1HDQA 2PR8A 4PK3A 5F47A 3DR6A 3E0KA 3FVLA 4KUBA 3T9YA 2AFWA 1MJAA 1V0CA 5EMIA 5HH1A 1HEEA 4HNWB 2R7HA 3PB8X 4B5OA 2PJ2A 1F57A 1ELLP 2BO9A 2J8NA 3IIBA 2FL4A 4HNYB 4KOTA 4Y49C 2ZEPA 4P4DA 4FAIA 2Z3OA 4KOYA 8CPAA 1TF9A 2R1IA 4EVYA 3H5ZA 4OC5A 4YRHA 3W91A 4BBHA 3GUXA 4KVXA 2VZZA 4XNHC 1Z2LA 3P2FA 4UEZA 1XJOA 1J4JA 2GU2A 3H4QA 2XEJA 4B11A 1GHEA 4FWUA 1XFOA 3FEEA 2PRQA 4PXDA 2WSAA 2DXQA 4B13A 1H8LA 3F0AA 4OC1A 3PGPA 3ZJ0A 1YSJA 3GY9A 1NSAA 5LYLA 2BEIA 4UIAA 2Q04A 4PK2A 3B2YA 1CP7A 4XPDC 5AGEA 2JEVA 2BUEA 2AE6A 2CXAA 1Z8LA 2X7BA 4I49A 4PXEA 1XEBA 2PJCA 1S7NA 4MFLA 4C68A 3OWCA 5KTCA 2VZYA 4ZX8A 1XE4A 4C2YA 4HKFA 1AUGA 4QUSA 4OMEA 2REFA 5JGFA 3CXPA 5C88A 1YMEA 2I79A 3PB7X 4U9YA 2PC1A 3B8GA 2WPWA 2REEA 3D2PA 1B6BA 2C6PA 2NYQA 1IOFA 2QJ8A 3D66A 5C82A 3SI2A 4MY3A 4UIBA 1CPSA 2ZELA 4CPAA 2FT0A 1S3ZA 2AFXA 2GLJA 2PJ9A 3DR8A 2PJ1A 1R57A 2JBKA 4MFPA 2PIYA 2Z0ZA 5AG7A 1TKJA 1TXRA 1ZG9A 2RFHA 1DE4C 4R9MA 2Q43A 4F9UA 5F49A 2WUUA 4KVME 4RUHA 1I1DA 1IB1E 1M4DA 4XPKA 1ZLHA 1U6MA 4DYOA 1KUXA 2PVVA 2QVPA 3NFZA 4M6HA 4A39A 5AG4A 4MI4A 2BCOA 4KORA 4MHNA 4OC0A 2O28A 3R96A 1SQHA 2K5TA 4C2XA 2DPTA 1PCAA 1IIDA 5HVFA 2PJ7A 4JXRA 4UF4A 1Y0RA 2CTCA 1QMUA 4J3GA 1LCPA 3IEHA 4FBEA 1M1DA 3ISXA 2B5GB 2EK9A 4Y49B 1DTDA 1YVOA 2JBJA 3PP9A 3V38A 3LD2A 4AG9A 3V7ZA 2FE7A 2B4DA 2POKA 2Z10A 5I0CA 3FYNA 2Q7SA 2WPXA 2A4NA 3MN8A 1ZG8A 4IK2A 3B3VA 5F48A 1MJ9A
chains in the Genus database with same CATH topology
1KZFA 2CNSA 1VHSA 3EFAA 4K30A 5G22A 4XPLA 1P0HA 4JJXA 1OZPA 1Q2YA 4QVTA 3R9FA 1M44A 2Z3MA 4CRYB 4BMHA 1QSNA 4MFKA 4CYQA 2QECA 4MJ8A 2NMTA 4MFZA 3FB3A 1BOBA 4HNXB 4E0AA 3IWGA 3T90A 3JUWA 2PRBA 3EY5A 4KVOE 4UCNA 3VWDA 1MJBA 4A33A 4CGOA 2YNCC 4CGNA 2B58A 4MY0A 5AG6A 3WR7A 2HUZA 1K4JA 4MFJA 4QC6A 2GIVA 4B10A 1KUYA 2PSWA 2OU2A 2KCWA 2IL4A 1MK4A 1WWZA 2G3AA 5FVJA 3FXTA 4NXYA 3IGRA 4NF1A 3DDDA 3IU1A 4AVBA 3BJ7A 4E8OA 1UFHA 3ZZIA 3P2HA 3JVNA 4Q36A 1RXTA 1YREA 3TTHA 4MBUA 4II9A 1LRZA 3JTKA 3TO7A 4MFQA 1Z4EA 5AG5A 2BL1A 1Z9UA 2JLMA 4X5KA 2ZW7A 2EVNA 4U9ZA 4QB9A 5DWMA 4F0YA 1XF8A 4A95A 5F46A 1NE9A 2YNEA 2G3TA 3QAHA 2VBQA 4RS2A 4C7IA 4UA3A 3TT2A 3MGDA 1YR0A 1N71A 5EC4A 1CM0A 2Q0YA 4PSWA 5DWNA 4ZGYB 4A32A 2YGWA 1I21A 3V8IA 3GKRA 3EC4A 1YVKA 1PU9A 1Y9WA 1QSRA 2PQ8A 4A31A 2R8VA 3SXNA 1QSMA 2OZGA 4FD7A 2VXKA 2FIWA 2Q4YA 4L89A 5A27A 5G1ZA 1CJWA 3D3SA 4OAEA 4B5PA 3R9EA 2P6GA 5ISVA 1RO5A 1QSOA 1XMTA 1TIQA 1YK3A 4E2AA 2D4OA 5E96A 4CGLA 5J8CA 4IUSA 1S5KA 5JQ4A 3F8KA 4UCPA 4KUAA 3N7ZA 4NSQA 3SXOA 3UY5A 1S60A 4OLLA 2Z11A 2FXFA 2Z3LA 2R98A 4M3SA 3IU2A 2J8RA 1M4GA 2FIAA 4KLVA 2B4BA 3EO4A 2OH1A 3NE7A 2P6EA 1Y7RA 3S6FA 4YGOA 5JPHA 3FIXA 1FY7A 4PV6A 2HQYA 5IV0A 3VWEA 2Q7BA 2B4DB 3S6GA 4UFXA 5A28A 4H6UA 4L8AA 3SHPA 2JDCA 3D8PA 2FS5A 4F0XA 3TOBA 4KOVA 4JLYA 4KLWA 2PR1A 2ZXVA 4CAWA 2ZW4A 4CGPA 2CNMA 1IYLA 4UFWA 3GYAA 5IX3A 2EUIA 2B3VA 2CY2A 4KOSA 4R3KA 3A9LA 1Y9KA 5CNPA 1IICA 4C7HA 2Z3NA 5IB0A 3W6SA 4CGMA 3TE4A 2JDDA 4RI1A 3TOAA 4OADA 2C27A 3F5BA 1IYKA 2OZUA 5GCNA 2OB0A 3R95A 3FRMA 4CRZB 1S7FA 4UBRA 5H86A 4CYPA 2FSRA 3R9GA 2Z3PA 2J8MA 2Z3KA 3QB8A 4KSFA 4IF5A 4CAEA 3FBUA 1NMTA 4LUAA 4QBJA 4R87A 4U5YA 2ATRA 1S7LA 1KUVA 3EXNA 1I12A 2AJ6A 2B3UA 2DPSA 4LX9A 5KTAA 3DSBA 3I3GA 4AG7A 4B14A 2BSWA 2VEZA 1WK4A 4JXQA 3CXQA 1NSLA 4KS9A 1P4NA 1YLEA 2H5MA 1XIXA 4ONUA 3I9SA 2FCKA 4KOUA 2CNTA 1S7KA 4C2ZA 4H6ZA 2YNCA 4FD5A 4A2ZA 2OZHA 4R57A 4M85A 4A30A 1YX0A 2QIRA 4CAVA 2B5GA 1QSTA 3S6HA 4UCMA 5BWAB 5H84A 2Q4VA 1Q2CA 1Z4RA 3TFYA 3LODA 5G21A 2PDOA 3D2MA 4KOWA 4JWPA 3TCVA 1B87A 2P6FA 4ORFA 1VKCA 4AVAA 4CAFA 2ZW5A 4CAXA 4UWIA 4GS4A 4MHDA 1M4IA 1PUAA 2F5IA 2HV2A 2VQYA 4AVCA 4JD6A 3KKWA 3C26A 3BLNA 1L0CA 3CXSA 3BJ8A 1Q2DA 4R3LA 4FD4A 2YNDA 4KZTA 5G20A 4NEXA 4KSAA 4B12A 2GE3A 4YFJA 4Q38A 3G3SA 2ZW6A 4FD6A 5J8FA 4XNHB 4H89A 4NCZA 1ON0A 3S6KA 2Q44A 1BO4A 4B5PB 4CYNA 2I00A 2P0WA 4F6AA 3R1KA 3G8WA 3RYOA 5KTDA 2D4PA 3FNCA 2QMLA 4CS0B 2RC4A 5EBVA 4DNCA 4CYOA 2G0BA 4XPDB 4UFVA 2ZPAA 3PZJA 3TO6A 3K9UA 4PSXA 3W6XA 2Y0MA 1YGHA 3TO9A 3DNSA 2ARHA 3IWEA 4UWJA 1ZO0A 2VI7A 2GANA 4AB7A 4ZBGA 5HMNA 2PR8A 4PK3A 5F47A 3DR6A 3E0KA 4KUBA 3T9YA 1MJAA 1V0CA 5HH1A 4HNWB 4B5OA 2R7HA 2J8NA 4HNYB 4KOTA 2FL4A 4Y49C 2Z3OA 4KOYA 2R1IA 4EVYA 3H5ZA 4YRHA 3W91A 4BBHA 4KVXA 2VZZA 4XNHC 3P2FA 1J4JA 3H4QA 4B11A 1GHEA 2WSAA 2DXQA 4B13A 3F0AA 3PGPA 3ZJ0A 3GY9A 2BEIA 2Q04A 4PK2A 4XPDC 5AGEA 2JEVA 2BUEA 2AE6A 2CXAA 2X7BA 4I49A 1XEBA 4MFLA 1S7NA 4C68A 3OWCA 5KTCA 2VZYA 1XE4A 4C2YA 4HKFA 4QUSA 2REFA 3CXPA 5C88A 2I79A 4U9YA 2PC1A 3B8GA 2WPWA 2REEA 3D2PA 1B6BA 5C82A 4MY3A 2FT0A 1S3ZA 3DR8A 4MFPA 5AG7A 1R57A 2Z0ZA 4R9MA 5F49A 2WUUA 4KVME 1I1DA 1IB1E 1M4DA 4XPKA 1U6MA 1KUXA 5AG4A 4MI4A 4KORA 2O28A 3R96A 1SQHA 2K5TA 4C2XA 2DPTA 1IIDA 4JXRA 4J3GA 1M1DA 2B5GB 4Y49B 1YVOA 4AG9A 3PP9A 3LD2A 2FE7A 2B4DA 2Z10A 5I0CA 3FYNA 2WPXA 2A4NA 4KOXA 5F48A 1MJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KZF A;  2CNS A;  1VHS A;  3EFA A;  4K30 A;  4XPL A;  1P0H A;  4JJX A;  1OZP A;  1Q2Y A;  4QVT A;  3R9F A;  1M44 A;  4CRY B;  4BMH A;  1QSN A;  2QEC A;  4MJ8 A;  2NMT A;  3FB3 A;  1BOB A;  4HNX B;  4E0A A;  3IWG A;  3T90 A;  3JUW A;  2PRB A;  3EY5 A;  4KVO E;  3VWD A;  1MJB A;  2B58 A;  4MY0 A;  3WR7 A;  2HUZ A;  1K4J A;  4QC6 A;  2GIV A;  1KUY A;  2PSW A;  2OU2 A;  2KCW A;  2IL4 A;  1MK4 A;  1WWZ A;  2G3A A;  5FVJ A;  3FXT A;  4NXY A;  3IGR A;  4NF1 A;  3DDD A;  4AVB A;  3BJ7 A;  4E8O A;  1UFH A;  3ZZI A;  3P2H A;  3JVN A;  1RXT A;  1YRE A;  3TTH A;  4MBU A;  4II9 A;  1LRZ A;  3TO7 A;  1Z4E A;  2BL1 A;  1Z9U A;  2JLM A;  4X5K A;  2ZW7 A;  2EVN A;  4U9Z A;  4QB9 A;  5DWM A;  4F0Y A;  1XF8 A;  5F46 A;  1NE9 A;  2G3T A;  3QAH A;  2VBQ A;  4RS2 A;  4UA3 A;  3TT2 A;  3MGD A;  1YR0 A;  1N71 A;  5EC4 A;  1CM0 A;  2Q0Y A;  4PSW A;  5DWN A;  1I21 A;  3V8I A;  3GKR A;  3EC4 A;  1YVK A;  1PU9 A;  1Y9W A;  1QSR A;  2PQ8 A;  2R8V A;  3SXN A;  1QSM A;  2OZG A;  4FD7 A;  2VXK A;  2FIW A;  2Q4Y A;  4L89 A;  1CJW A;  3D3S A;  4OAE A;  4B5P A;  3R9E A;  2P6G A;  5ISV A;  1RO5 A;  1QSO A;  1XMT A;  1TIQ A;  1YK3 A;  4E2A A;  2D4O A;  5E96 A;  5J8C A;  4IUS A;  1S5K A;  5JQ4 A;  3F8K A;  4KUA A;  3N7Z A;  4NSQ A;  3SXO A;  3UY5 A;  1S60 A;  4OLL A;  2Z11 A;  2FXF A;  2R98 A;  4M3S A;  2J8R A;  1M4G A;  2FIA A;  4KLV A;  2B4B A;  3EO4 A;  2OH1 A;  3NE7 A;  2P6E A;  1Y7R A;  3S6F A;  4YGO A;  5JPH A;  3FIX A;  1FY7 A;  4PV6 A;  2HQY A;  5IV0 A;  3VWE A;  2Q7B A;  2B4D B;  3S6G A;  4H6U A;  4L8A A;  3SHP A;  2JDC A;  3D8P A;  2FS5 A;  3TOB A;  4KOV A;  4JLY A;  4KLW A;  2PR1 A;  2ZXV A;  4CAW A;  2ZW4 A;  2CNM A;  1IYL A;  3GYA A;  5IX3 A;  2EUI A;  2B3V A;  2CY2 A;  4KOS A;  4R3K A;  1Y9K A;  5CNP A;  1IIC A;  5IB0 A;  3W6S A;  3TE4 A;  2JDD A;  4RI1 A;  3TOA A;  4OAD A;  2C27 A;  3F5B A;  1IYK A;  2OZU A;  5GCN A;  2OB0 A;  3R95 A;  3FRM A;  4CRZ B;  1S7F A;  4UBR A;  5H86 A;  2FSR A;  3R9G A;  2J8M A;  3QB8 A;  4IF5 A;  3FBU A;  1NMT A;  4LUA A;  4QBJ A;  4R87 A;  4U5Y A;  2ATR A;  1S7L A;  1KUV A;  3EXN A;  1I12 A;  2AJ6 A;  2B3U A;  4LX9 A;  5KTA A;  3DSB A;  3I3G A;  4AG7 A;  2BSW A;  2VEZ A;  1WK4 A;  4JXQ A;  3CXQ A;  1NSL A;  1P4N A;  1YLE A;  2H5M A;  1XIX A;  4ONU A;  3I9S A;  2FCK A;  4KOU A;  2CNT A;  1S7K A;  4H6Z A;  4FD5 A;  2OZH A;  4R57 A;  4M85 A;  1YX0 A;  2QIR A;  4CAV A;  2B5G A;  1QST A;  3S6H A;  5H84 A;  2Q4V A;  1Q2C A;  1Z4R A;  3TFY A;  3LOD A;  2PDO A;  3D2M A;  4KOW A;  4JWP A;  3TCV A;  1B87 A;  2P6F A;  4ORF A;  1VKC A;  4AVA A;  2ZW5 A;  4CAX A;  4UWI A;  4GS4 A;  4MHD A;  1M4I A;  1PUA A;  2F5I A;  2HV2 A;  2VQY A;  4AVC A;  4JD6 A;  3KKW A;  3C26 A;  3BLN A;  1L0C A;  3CXS A;  3BJ8 A;  1Q2D A;  4R3L A;  4FD4 A;  4KZT A;  4NEX A;  2GE3 A;  4YFJ A;  3G3S A;  2ZW6 A;  4FD6 A;  5J8F A;  4XNH B;  4H89 A;  4NCZ A;  1ON0 A;  3S6K A;  2Q44 A;  1BO4 A;  4B5P B;  2I00 A;  2P0W A;  4F6A A;  3R1K A;  3G8W A;  3RYO A;  5KTD A;  2D4P A;  3FNC A;  2QML A;  4CS0 B;  2RC4 A;  5EBV A;  4DNC A;  2G0B A;  4XPD B;  2ZPA A;  3PZJ A;  3TO6 A;  3K9U A;  4PSX A;  3W6X A;  2Y0M A;  1YGH A;  3TO9 A;  3DNS A;  2ARH A;  4UWJ A;  2VI7 A;  2GAN A;  4AB7 A;  4ZBG A;  5HMN A;  2PR8 A;  4PK3 A;  5F47 A;  3DR6 A;  3E0K A;  4KUB A;  3T9Y A;  1MJA A;  1V0C A;  5HH1 A;  4HNW B;  4B5O A;  2R7H A;  2J8N A;  4HNY B;  4KOT A;  2FL4 A;  4Y49 C;  4KOY A;  2R1I A;  4EVY A;  4YRH A;  3W91 A;  4KVX A;  2VZZ A;  4XNH C;  3P2F A;  1J4J A;  3H4Q A;  1GHE A;  2DXQ A;  3F0A A;  3PGP A;  3ZJ0 A;  3GY9 A;  2BEI A;  2Q04 A;  4PK2 A;  4XPD C;  2JEV A;  2BUE A;  2AE6 A;  2X7B A;  4I49 A;  1XEB A;  1S7N A;  3OWC A;  5KTC A;  2VZY A;  1XE4 A;  4HKF A;  4QUS A;  2REF A;  3CXP A;  5C88 A;  2I79 A;  4U9Y A;  2PC1 A;  3B8G A;  2WPW A;  2REE A;  3D2P A;  1B6B A;  5C82 A;  4MY3 A;  2FT0 A;  1S3Z A;  3DR8 A;  1R57 A;  2Z0Z A;  4R9M A;  5F49 A;  4KVM E;  1I1D A;  1IB1 E;  1M4D A;  4XPK A;  1U6M A;  1KUX A;  4MI4 A;  4KOR A;  2O28 A;  3R96 A;  1SQH A;  2K5T A;  1IID A;  4JXR A;  4J3G A;  1M1D A;  2B5G B;  4Y49 B;  1YVO A;  4AG9 A;  3PP9 A;  3LD2 A;  2FE7 A;  2B4D A;  2Z10 A;  5I0C A;  3FYN A;  2WPX A;  2A4N A;  4KOX A;  5F48 A;  1MJ9 A; 
#chains in the Genus database with same CATH topology
 1KZF A;  2IQ6 A;  2CNS A;  1VHS A;  3EFA A;  5D8N A;  1X10 A;  3D7G A;  4K30 A;  5G22 A;  1TKF A;  4M6G A;  4MMO A;  4XPL A;  3ISZ A;  5J1Q A;  1P0H A;  4JJX A;  1OZP A;  3KQZ A;  2C6G A;  4B6Z A;  2OR4 A;  3BXM A;  1Q2Y A;  4QVT A;  3R9F A;  1M44 A;  2Z3M A;  3BI0 A;  4CRY B;  4BMH A;  1QSN A;  5HVH A;  4MFK A;  4CYQ A;  2QEC A;  2HC9 A;  1A2Z A;  4MJ8 A;  3LWU A;  2NMT A;  4EME A;  2AFU A;  3GLJ A;  3GB0 A;  4MFZ A;  2PJ0 A;  3FB3 A;  5JH9 A;  1BOB A;  4HNX B;  4E0A A;  3IWG A;  3T90 A;  2DEA A;  3JUW A;  3KGQ A;  4MCS A;  2PRB A;  3EY5 A;  4KVO E;  4UCN A;  3VWD A;  1MJB A;  4A33 A;  4CGO A;  3S9L A;  2YNC C;  4CGN A;  2B58 A;  4MY0 A;  5AG6 A;  3WR7 A;  2HUZ A;  1K4J A;  4MFJ A;  4QC6 A;  4X8I A;  2GIV A;  2ABZ A;  4B10 A;  1KUY A;  1F2O A;  2IMO A;  2OU2 A;  2KCW A;  2PSW A;  3TX8 A;  4ONW A;  2IL4 A;  3FED A;  1MK4 A;  4MHZ A;  1WWZ A;  2XEF A;  2G3A A;  5FVJ A;  3WC7 A;  3FXT A;  3PRT A;  3FMC A;  1BAV A;  4NXY A;  5THW A;  2J9A A;  4NFR A;  2Q4Z A;  1XRY A;  3DGV A;  4P45 A;  3IGR A;  4NF1 A;  3SJX A;  3PB6 X;  3DDD A;  3IU1 A;  1CPX A;  4WJB A;  1Z5R A;  3B7I A;  3NH8 A;  3KR4 A;  4AVB A;  2PVW A;  1IU8 A;  3BJ7 A;  3D7H A;  3FF3 A;  2F7V A;  4E8O A;  1UFH A;  1VGY A;  3KAS A;  4JZ0 A;  3ZZI A;  1KWM A;  3JVN A;  3P2H A;  4NGQ A;  4Q36 A;  1RXT A;  1YRE A;  3TTH A;  2EK8 A;  4MBU A;  3RAM A;  3KHZ A;  4II9 A;  1LRZ A;  3JTK A;  3TO7 A;  4MFQ A;  1Z4E A;  5AG5 A;  1CX8 A;  2BL1 A;  1Z9U A;  2JLM A;  4W9Y A;  4X5K A;  1TF8 A;  2ZW7 A;  2OOT A;  2EVN A;  1BPN A;  5LRG A;  4U9Z A;  4QB9 A;  2GFQ A;  5DWM A;  4AXV A;  4F0Y A;  4MCR A;  1XF8 A;  3TC8 A;  1JWQ A;  4A95 A;  5F46 A;  1NE9 A;  1R3N A;  1IOI A;  2YNE A;  2G3T A;  3QAH A;  3FJU A;  2VBQ A;  2PJ3 A;  4RS2 A;  4C7I A;  4UA3 A;  2Q51 A;  3FX6 A;  3TT2 A;  4ZY0 A;  3MGD A;  1YQE A;  1N71 A;  1YR0 A;  4ZI6 A;  5EC4 A;  1CM0 A;  2Q0Y A;  4PSW A;  2EWB A;  4ZY2 A;  3QAY A;  5DWN A;  4ZGY B;  1TKH A;  4A32 A;  2YGW A;  4OP4 A;  1I21 A;  1Y0Y A;  3V8I A;  3GKR A;  2ZEM A;  3EC4 A;  1YVK A;  3WC5 A;  1LAM A;  1PU9 A;  1Y9W A;  1QSR A;  1YW6 A;  4G1P A;  4TNU A;  2PQ8 A;  4A31 A;  1Z8X A;  2R8V A;  3CZX A;  3NA6 A;  3SXN A;  1QSM A;  2OZG A;  4FD7 A;  2ZEH A;  3B3T A;  4KSI A;  2VXK A;  5K8P A;  2V8D A;  3H8G A;  2FIW A;  2PJB A;  2Q4Y A;  4L89 A;  1CBX A;  1CJW A;  5G1Z A;  5A27 A;  4EFD A;  2PCU A;  4LQ6 A;  2EO8 A;  4H2K A;  5F09 A;  2F8H A;  3D3S A;  4OAE A;  4B5P A;  2AFS A;  4A38 A;  3SI0 A;  2PJ8 A;  3R9E A;  4TWE A;  2P6G A;  2QYV A;  3SJE A;  5ISV A;  1RO5 A;  3LMS A;  4P4E A;  2PJ5 A;  3D68 A;  1Z8W A;  3D67 A;  1QSO A;  1LAP A;  1XMT A;  3B3C A;  3I1U A;  1TIQ A;  3D4U A;  4MHY A;  3K2K A;  1YK3 A;  3K9T A;  5LYI A;  1ZG7 A;  4NGT A;  4E2A A;  2ODF A;  1UWY A;  2D4O A;  5E96 A;  4CGL A;  4NGS A;  5J8C A;  4IUS A;  3IC1 A;  1PYT B;  1S5K A;  3KI9 A;  1VIX A;  1FNO A;  5JQ4 A;  2ZEO A;  2I3C A;  3F8K A;  4UCP A;  4KUA A;  3N7Z A;  1XOV A;  4NSQ A;  2HB6 A;  3SXO A;  4IHM A;  4P4I A;  3WC6 A;  3UY5 A;  1S60 A;  4OLL A;  4WWV A;  3KHX A;  4NGR A;  5LYF A;  2Z11 A;  2AFO A;  4YWY A;  3WAB A;  2FXF A;  2ZEE A;  2Z3L A;  2R98 A;  4Z65 A;  2FVG A;  4M3S A;  3IU2 A;  2J8R A;  3JRU A;  1M4G A;  3PEI A;  4PQA A;  4PXC A;  2FIA A;  4KLV A;  4MXU A;  2B4B A;  3EO4 A;  2OH1 A;  3NE7 A;  2P6E A;  1Y7R A;  4O23 A;  1FT7 A;  3S6F A;  3CT9 A;  4A37 A;  3PFE A;  4YGO A;  5JPH A;  3FH4 A;  2V8G A;  3FIX A;  1FY7 A;  4PXB A;  3RBU A;  2CTB A;  4PV6 A;  2HQY A;  5HVG A;  3VWE A;  5IV0 A;  2Q7B A;  1XMB A;  2B4D B;  3PB9 X;  3S6G A;  4UFX A;  2ZEF A;  3GIU A;  5A28 A;  1AMP A;  4H6U A;  4L8A A;  4OKO A;  3SHP A;  4ZY1 A;  2JDC A;  3D8P A;  3S9M A;  2FS5 A;  4EWT A;  4F0X A;  4ZX9 A;  4P10 A;  4P4B A;  2O4H A;  3TOB A;  4GXH A;  4KOV A;  4JLY A;  4KLW A;  3SJF A;  2PR1 A;  2ZXV A;  3B3W A;  4F8Z A;  4CAW A;  2ZW4 A;  4CGP A;  2CNM A;  4BD9 A;  1IYL A;  4UFW A;  3GYA A;  5IX3 A;  3T8W A;  3H8E A;  3QNV A;  1ARM A;  4LQG A;  4MCQ A;  2EUI A;  4MRI A;  3PB4 X;  3B3S A;  2B3V A;  5K8M A;  1LOK A;  4GM5 A;  2CY2 A;  4KOS A;  1ARL A;  4NJQ A;  4R3K A;  3A9L A;  1Y9K A;  5CNP A;  1IIC A;  4MCP A;  4C7H A;  2Z3N A;  5IB0 A;  4K3N A;  3W6S A;  4CGM A;  3TE4 A;  2JDD A;  4RI1 A;  3TOA A;  2ZEN A;  4OAD A;  4R7M A;  2C27 A;  3F5B A;  4OID A;  4MHP A;  1F2P A;  1CG2 A;  3IWW A;  1IYK A;  3KZW A;  2OZU A;  1M4L A;  5GCN A;  4DJL A;  4M6I A;  2OB0 A;  2V8V A;  3R95 A;  4F9V A;  1BLL E;  3FRM A;  4CRZ B;  3NH5 A;  1S7F A;  1OBR A;  2GRE A;  2WZN A;  4UBR A;  3RZA A;  5H86 A;  4OC2 A;  3CPA A;  4CYP A;  4ZYQ A;  2FSR A;  2C1C A;  3R9G A;  2AFM A;  4NJR A;  2Z3P A;  2J8M A;  2Z3K A;  3QB8 A;  2V8H A;  3IFE A;  4KSF A;  4NGM A;  4IF5 A;  4OIW A;  7CPA A;  4CAE A;  3FBU A;  5HXD A;  1NMT A;  4LUA A;  3DLJ A;  3KL9 A;  3NE8 A;  4QBJ A;  4R76 A;  4R87 A;  4R8F A;  2ATR A;  4U5Y A;  1S7L A;  1KUV A;  2ANP A;  1XBU A;  3EXN A;  2NSM A;  3SJG A;  1I12 A;  4PPZ A;  2AJ6 A;  2B3U A;  3FEC A;  2DPS A;  4LX9 A;  5KTA A;  3PBB A;  3DSB A;  4HPS A;  3NH4 A;  2CIJ A;  3I3G A;  5CBM A;  3PBE A;  3IO1 A;  4IAV A;  4AG7 A;  4B14 A;  2BSW A;  2VEZ A;  1WK4 A;  3L2N A;  5D29 A;  4JXQ A;  3CXQ A;  5LRK A;  1NSL A;  4KS9 A;  1P4N A;  1YLE A;  2H5M A;  3CPX A;  1XIX A;  4ONU A;  5JM6 A;  3I9S A;  2FCK A;  4KOU A;  2CNT A;  1S7K A;  4P6Y A;  4C2Z A;  4KOX A;  4H6Z A;  4X3R A;  4R6T A;  2YNC A;  1AYE A;  4Q7A A;  4FD5 A;  1Y7E A;  4A2Z A;  2OZH A;  2C6C A;  3KQX A;  3SI1 A;  1YW4 A;  4R57 A;  4M85 A;  4A30 A;  1YX0 A;  2QIR A;  4P44 A;  4OC4 A;  4CAV A;  5CPA A;  4X2T A;  3N5F A;  3B35 A;  2B5G A;  4UEF A;  1QST A;  3S6H A;  1JQG A;  2O53 A;  4UCM A;  5BWA B;  2ZEG A;  1VHE A;  5H84 A;  3BHX A;  2Q4V A;  1Q2C A;  1Z4R A;  2EBJ A;  3TFY A;  4P4J A;  1QQ9 A;  3LOD A;  1CP6 A;  4YU9 A;  5LYD A;  5I4M A;  2V77 A;  5G21 A;  2PDO A;  3D2M A;  4KOW A;  1BPM A;  2VL1 A;  2CF4 A;  4JWP A;  3TCV A;  4P4F A;  1B87 A;  5DS0 A;  2P6F A;  4A94 A;  2GLF A;  4ORF A;  4NGN A;  1LAN A;  1VKC A;  5ELY A;  4RN7 A;  4AVA A;  4CAF A;  2AFZ A;  2ZW5 A;  4CAX A;  4UWI A;  1YLO A;  4GS4 A;  4MHD A;  1M4I A;  1PUA A;  2WYR A;  2F5I A;  2BOA A;  2HV2 A;  3RO0 A;  4BIN A;  2VQY A;  4AVC A;  1Q7L A;  4JD6 A;  1VHO A;  3KKW A;  3WT4 A;  3C26 A;  3PFO A;  3BLN A;  1L0C A;  3CXS A;  2G9D A;  3BJ8 A;  4DUK A;  1Q2D A;  5K8N A;  4R3L A;  4FD4 A;  2JEW A;  2YND A;  4KZT A;  5G20 A;  4JYW A;  4NEX A;  3IJ3 A;  4KSA A;  3LAC A;  3RNZ A;  4B12 A;  2GE3 A;  4YFJ A;  1IY7 A;  1Z8T A;  4Q38 A;  3G3S A;  4NGP A;  2XEI A;  3H8F A;  2ZW6 A;  3MRU A;  4FD6 A;  5J8F A;  4XNH B;  2RB7 A;  4H89 A;  5K8O A;  1X12 A;  4NCZ A;  1ON0 A;  3S6K A;  2Q44 A;  3D7D A;  1BO4 A;  4B5P B;  4CYN A;  1HDU A;  2I00 A;  2PJA A;  2IJZ A;  2P0W A;  5IB9 A;  4F6A A;  3D7F A;  3G8W A;  3R1K A;  2ZOG A;  3VAR A;  3RYO A;  3HLP A;  5KTD A;  2D4P A;  1R43 A;  3FNC A;  2QML A;  4CS0 B;  1RTQ A;  2PIZ A;  2RC4 A;  2ZED A;  6CPA A;  4OC3 A;  5EBV A;  2XEG A;  3VH9 A;  4DNC A;  1ZLI A;  2G0B A;  4CYO A;  4XPD B;  4FUU A;  1EE3 P;  4UFV A;  2ZPA A;  1IGB A;  1GYT A;  3PZJ A;  3TO6 A;  3CDX A;  3K9U A;  4PSX A;  1ELM P;  2PJ6 A;  3VAT A;  3W6X A;  2Y0M A;  3KR5 A;  1YGH A;  3TO9 A;  3BI1 A;  2ARH A;  1LFW A;  2DF5 A;  2PE3 A;  2PJ4 A;  3DNS A;  3IWE A;  3S9N A;  2ZOF A;  4UWJ A;  5LRJ A;  4UEE A;  1ZO0 A;  2VI7 A;  2GAN A;  4AB7 A;  3HUV A;  4ZBG A;  5HMN A;  1HDQ A;  2PR8 A;  4PK3 A;  5F47 A;  3DR6 A;  3E0K A;  3FVL A;  4KUB A;  3T9Y A;  2AFW A;  1MJA A;  1V0C A;  5EMI A;  5HH1 A;  1HEE A;  4HNW B;  2R7H A;  3PB8 X;  4B5O A;  2PJ2 A;  1F57 A;  1ELL P;  2BO9 A;  2J8N A;  3IIB A;  2FL4 A;  4HNY B;  4KOT A;  4Y49 C;  2ZEP A;  4P4D A;  4FAI A;  2Z3O A;  4KOY A;  8CPA A;  1TF9 A;  2R1I A;  4EVY A;  3H5Z A;  4OC5 A;  4YRH A;  3W91 A;  4BBH A;  3GUX A;  4KVX A;  2VZZ A;  4XNH C;  1Z2L A;  3P2F A;  4UEZ A;  1XJO A;  1J4J A;  2GU2 A;  3H4Q A;  2XEJ A;  4B11 A;  1GHE A;  4FWU A;  1XFO A;  3FEE A;  2PRQ A;  4PXD A;  2WSA A;  2DXQ A;  4B13 A;  1H8L A;  3F0A A;  4OC1 A;  3PGP A;  3ZJ0 A;  1YSJ A;  3GY9 A;  1NSA A;  5LYL A;  2BEI A;  4UIA A;  2Q04 A;  4PK2 A;  3B2Y A;  1CP7 A;  4XPD C;  5AGE A;  2JEV A;  2BUE A;  2AE6 A;  2CXA A;  1Z8L A;  2X7B A;  4I49 A;  4PXE A;  1XEB A;  2PJC A;  1S7N A;  4MFL A;  4C68 A;  3OWC A;  5KTC A;  2VZY A;  4ZX8 A;  1XE4 A;  4C2Y A;  4HKF A;  1AUG A;  4QUS A;  4OME A;  2REF A;  5JGF A;  3CXP A;  5C88 A;  1YME A;  2I79 A;  3PB7 X;  4U9Y A;  2PC1 A;  3B8G A;  2WPW A;  2REE A;  3D2P A;  1B6B A;  2C6P A;  2NYQ A;  1IOF A;  2QJ8 A;  3D66 A;  5C82 A;  3SI2 A;  4MY3 A;  4UIB A;  1CPS A;  2ZEL A;  4CPA A;  2FT0 A;  1S3Z A;  2AFX A;  2GLJ A;  2PJ9 A;  3DR8 A;  2PJ1 A;  1R57 A;  2JBK A;  4MFP A;  2PIY A;  2Z0Z A;  5AG7 A;  1TKJ A;  1TXR A;  1ZG9 A;  2RFH A;  1DE4 C;  4R9M A;  2Q43 A;  4F9U A;  5F49 A;  2WUU A;  4KVM E;  4RUH A;  1I1D A;  1IB1 E;  1M4D A;  4XPK A;  1ZLH A;  1U6M A;  4DYO A;  1KUX A;  2PVV A;  2QVP A;  3NFZ A;  4M6H A;  4A39 A;  5AG4 A;  4MI4 A;  2BCO A;  4KOR A;  4MHN A;  4OC0 A;  2O28 A;  3R96 A;  1SQH A;  2K5T A;  4C2X A;  2DPT A;  1PCA A;  1IID A;  5HVF A;  2PJ7 A;  4JXR A;  4UF4 A;  1Y0R A;  2CTC A;  1QMU A;  4J3G A;  1LCP A;  3IEH A;  4FBE A;  1M1D A;  3ISX A;  2B5G B;  2EK9 A;  4Y49 B;  1DTD A;  1YVO A;  2JBJ A;  3PP9 A;  3V38 A;  3LD2 A;  4AG9 A;  3V7Z A;  2FE7 A;  2B4D A;  2POK A;  2Z10 A;  5I0C A;  3FYN A;  2Q7S A;  2WPX A;  2A4N A;  3MN8 A;  1ZG8 A;  4IK2 A;  3B3V A;  5F48 A;  1MJ9 A; 
#chains in the Genus database with same CATH homology
 1KZF A;  2CNS A;  1VHS A;  3EFA A;  4K30 A;  5G22 A;  4XPL A;  1P0H A;  4JJX A;  1OZP A;  1Q2Y A;  4QVT A;  3R9F A;  1M44 A;  2Z3M A;  4CRY B;  4BMH A;  1QSN A;  4MFK A;  4CYQ A;  2QEC A;  4MJ8 A;  2NMT A;  4MFZ A;  3FB3 A;  1BOB A;  4HNX B;  4E0A A;  3IWG A;  3T90 A;  3JUW A;  2PRB A;  3EY5 A;  4KVO E;  4UCN A;  3VWD A;  1MJB A;  4A33 A;  4CGO A;  2YNC C;  4CGN A;  2B58 A;  4MY0 A;  5AG6 A;  3WR7 A;  2HUZ A;  1K4J A;  4MFJ A;  4QC6 A;  2GIV A;  4B10 A;  1KUY A;  2PSW A;  2OU2 A;  2KCW A;  2IL4 A;  1MK4 A;  1WWZ A;  2G3A A;  5FVJ A;  3FXT A;  4NXY A;  3IGR A;  4NF1 A;  3DDD A;  3IU1 A;  4AVB A;  3BJ7 A;  4E8O A;  1UFH A;  3ZZI A;  3P2H A;  3JVN A;  4Q36 A;  1RXT A;  1YRE A;  3TTH A;  4MBU A;  4II9 A;  1LRZ A;  3JTK A;  3TO7 A;  4MFQ A;  1Z4E A;  5AG5 A;  2BL1 A;  1Z9U A;  2JLM A;  4X5K A;  2ZW7 A;  2EVN A;  4U9Z A;  4QB9 A;  5DWM A;  4F0Y A;  1XF8 A;  4A95 A;  5F46 A;  1NE9 A;  2YNE A;  2G3T A;  3QAH A;  2VBQ A;  4RS2 A;  4C7I A;  4UA3 A;  3TT2 A;  3MGD A;  1YR0 A;  1N71 A;  5EC4 A;  1CM0 A;  2Q0Y A;  4PSW A;  5DWN A;  4ZGY B;  4A32 A;  2YGW A;  1I21 A;  3V8I A;  3GKR A;  3EC4 A;  1YVK A;  1PU9 A;  1Y9W A;  1QSR A;  2PQ8 A;  4A31 A;  2R8V A;  3SXN A;  1QSM A;  2OZG A;  4FD7 A;  2VXK A;  2FIW A;  2Q4Y A;  4L89 A;  5A27 A;  5G1Z A;  1CJW A;  3D3S A;  4OAE A;  4B5P A;  3R9E A;  2P6G A;  5ISV A;  1RO5 A;  1QSO A;  1XMT A;  1TIQ A;  1YK3 A;  4E2A A;  2D4O A;  5E96 A;  4CGL A;  5J8C A;  4IUS A;  1S5K A;  5JQ4 A;  3F8K A;  4UCP A;  4KUA A;  3N7Z A;  4NSQ A;  3SXO A;  3UY5 A;  1S60 A;  4OLL A;  2Z11 A;  2FXF A;  2Z3L A;  2R98 A;  4M3S A;  3IU2 A;  2J8R A;  1M4G A;  2FIA A;  4KLV A;  2B4B A;  3EO4 A;  2OH1 A;  3NE7 A;  2P6E A;  1Y7R A;  3S6F A;  4YGO A;  5JPH A;  3FIX A;  1FY7 A;  4PV6 A;  2HQY A;  5IV0 A;  3VWE A;  2Q7B A;  2B4D B;  3S6G A;  4UFX A;  5A28 A;  4H6U A;  4L8A A;  3SHP A;  2JDC A;  3D8P A;  2FS5 A;  4F0X A;  3TOB A;  4KOV A;  4JLY A;  4KLW A;  2PR1 A;  2ZXV A;  4CAW A;  2ZW4 A;  4CGP A;  2CNM A;  1IYL A;  4UFW A;  3GYA A;  5IX3 A;  2EUI A;  2B3V A;  2CY2 A;  4KOS A;  4R3K A;  3A9L A;  1Y9K A;  5CNP A;  1IIC A;  4C7H A;  2Z3N A;  5IB0 A;  3W6S A;  4CGM A;  3TE4 A;  2JDD A;  4RI1 A;  3TOA A;  4OAD A;  2C27 A;  3F5B A;  1IYK A;  2OZU A;  5GCN A;  2OB0 A;  3R95 A;  3FRM A;  4CRZ B;  1S7F A;  4UBR A;  5H86 A;  4CYP A;  2FSR A;  3R9G A;  2Z3P A;  2J8M A;  2Z3K A;  3QB8 A;  4KSF A;  4IF5 A;  4CAE A;  3FBU A;  1NMT A;  4LUA A;  4QBJ A;  4R87 A;  4U5Y A;  2ATR A;  1S7L A;  1KUV A;  3EXN A;  1I12 A;  2AJ6 A;  2B3U A;  2DPS A;  4LX9 A;  5KTA A;  3DSB A;  3I3G A;  4AG7 A;  4B14 A;  2BSW A;  2VEZ A;  1WK4 A;  4JXQ A;  3CXQ A;  1NSL A;  4KS9 A;  1P4N A;  1YLE A;  2H5M A;  1XIX A;  4ONU A;  3I9S A;  2FCK A;  4KOU A;  2CNT A;  1S7K A;  4C2Z A;  4H6Z A;  2YNC A;  4FD5 A;  4A2Z A;  2OZH A;  4R57 A;  4M85 A;  4A30 A;  1YX0 A;  2QIR A;  4CAV A;  2B5G A;  1QST A;  3S6H A;  4UCM A;  5BWA B;  5H84 A;  2Q4V A;  1Q2C A;  1Z4R A;  3TFY A;  3LOD A;  5G21 A;  2PDO A;  3D2M A;  4KOW A;  4JWP A;  3TCV A;  1B87 A;  2P6F A;  4ORF A;  1VKC A;  4AVA A;  4CAF A;  2ZW5 A;  4CAX A;  4UWI A;  4GS4 A;  4MHD A;  1M4I A;  1PUA A;  2F5I A;  2HV2 A;  2VQY A;  4AVC A;  4JD6 A;  3KKW A;  3C26 A;  3BLN A;  1L0C A;  3CXS A;  3BJ8 A;  1Q2D A;  4R3L A;  4FD4 A;  2YND A;  4KZT A;  5G20 A;  4NEX A;  4KSA A;  4B12 A;  2GE3 A;  4YFJ A;  4Q38 A;  3G3S A;  2ZW6 A;  4FD6 A;  5J8F A;  4XNH B;  4H89 A;  4NCZ A;  1ON0 A;  3S6K A;  2Q44 A;  1BO4 A;  4B5P B;  4CYN A;  2I00 A;  2P0W A;  4F6A A;  3R1K A;  3G8W A;  3RYO A;  5KTD A;  2D4P A;  3FNC A;  2QML A;  4CS0 B;  2RC4 A;  5EBV A;  4DNC A;  4CYO A;  2G0B A;  4XPD B;  4UFV A;  2ZPA A;  3PZJ A;  3TO6 A;  3K9U A;  4PSX A;  3W6X A;  2Y0M A;  1YGH A;  3TO9 A;  3DNS A;  2ARH A;  3IWE A;  4UWJ A;  1ZO0 A;  2VI7 A;  2GAN A;  4AB7 A;  4ZBG A;  5HMN A;  2PR8 A;  4PK3 A;  5F47 A;  3DR6 A;  3E0K A;  4KUB A;  3T9Y A;  1MJA A;  1V0C A;  5HH1 A;  4HNW B;  4B5O A;  2R7H A;  2J8N A;  4HNY B;  4KOT A;  2FL4 A;  4Y49 C;  2Z3O A;  4KOY A;  2R1I A;  4EVY A;  3H5Z A;  4YRH A;  3W91 A;  4BBH A;  4KVX A;  2VZZ A;  4XNH C;  3P2F A;  1J4J A;  3H4Q A;  4B11 A;  1GHE A;  2WSA A;  2DXQ A;  4B13 A;  3F0A A;  3PGP A;  3ZJ0 A;  3GY9 A;  2BEI A;  2Q04 A;  4PK2 A;  4XPD C;  5AGE A;  2JEV A;  2BUE A;  2AE6 A;  2CXA A;  2X7B A;  4I49 A;  1XEB A;  4MFL A;  1S7N A;  4C68 A;  3OWC A;  5KTC A;  2VZY A;  1XE4 A;  4C2Y A;  4HKF A;  4QUS A;  2REF A;  3CXP A;  5C88 A;  2I79 A;  4U9Y A;  2PC1 A;  3B8G A;  2WPW A;  2REE A;  3D2P A;  1B6B A;  5C82 A;  4MY3 A;  2FT0 A;  1S3Z A;  3DR8 A;  4MFP A;  5AG7 A;  1R57 A;  2Z0Z A;  4R9M A;  5F49 A;  2WUU A;  4KVM E;  1I1D A;  1IB1 E;  1M4D A;  4XPK A;  1U6M A;  1KUX A;  5AG4 A;  4MI4 A;  4KOR A;  2O28 A;  3R96 A;  1SQH A;  2K5T A;  4C2X A;  2DPT A;  1IID A;  4JXR A;  4J3G A;  1M1D A;  2B5G B;  4Y49 B;  1YVO A;  4AG9 A;  3PP9 A;  3LD2 A;  2FE7 A;  2B4D A;  2Z10 A;  5I0C A;  3FYN A;  2WPX A;  2A4N A;  4KOX A;  5F48 A;  1MJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...