4JLYA

Dodecameric structure of spermidine n-acetyltransferase from vibrio cholerae
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
172
structure length
172
Chain Sequence
NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate-Induced Allosteric Change in the Quaternary Structure of the Spermidine N-Acetyltransferase SpeG.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Transferase
molecule keywords Spermidine n1-acetyltransferase
total genus 49
structure length 172
sequence length 172
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2013-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4jlyA00
3P2HA 4E0AA 4YFJA 2Q44A 3VWDA 2WPXA 4IUSA 4QVTA 3UY5A 1M44A 1NMTA 2VQYA 2J8MA 3TFYA 4KOVA 2D4OA 5DWNA 1Y7RA 1XEBA 2GE3A 1R57A 4LX9A 4UWIA 1Q2YA 2AJ6A 1XMTA 2RC4A 3R9EA 1P0HA 3JUWA 3C26A 4H6UA 3BJ8A 3P2FA 3BLNA 4PK3A 2Y0MA 1S7FA 3F5BA 3DDDA 4U9ZA 5DWMA 3JVNA 3ZZIA 4FD4A 4R3KA 1NSLA 2HV2A 4KLVA 4Y49B 4DNCA 3TTHA 3DNSA 4PV6A 2B4DA 3TO6A 2Q7BA 4EVYA 4AVAA 3SXNA 4QC6A 2REEA 3EXNA 4L8AA 2FE7A 3FRMA 2ATRA 3MGDA 4BMHA 5FVJA 5JQ4A 2GIVA 2P6EA 2ZPAA 1S7LA 5H86A 2J8NA 1Y9KA 4HNYB 4MY0A 3TE4A 1IICA 5HH1A 3GY9A 3TOAA 1MJAA 4FD5A 2VZZA 3F8KA 4K30A 4RI1A 1GHEA 1CM0A 4HNWB 3S6HA 2WPWA 4LUAA 1XE4A 2B4DB 3EO4A 3S6FA 2B58A 1LRZA 1S60A 3LD2A 1M4IA 4KVME 4Y49C 3R1KA 2Q04A 1B6BA 1KUVA 4NF1A 2PSWA 2HUZA 2REFA 1XF8A 3TCVA 5F47A 4B5OA 4XPLA 2BSWA 3EFAA 1YREA 3BJ7A 2CNMA 4CS0B 2Q4YA 2K5TA 2VXKA 3CXPA 4GS4A 3GYAA 4JXRA 5EBVA 4J3GA 2PRBA 2CY2A 4XPDC 1S7KA 1QSNA 2NMTA 1I12A 2KCWA 4E2AA 2FXFA 3DR8A 4OAEA 3NE7A 2FT0A 4M85A 4KZTA 4NSQA 2Q4VA 2QMLA 5IX3A 5J8FA 4KOWA 4KOTA 4KUAA 3EC4A 4AVCA 2ZXVA 2J8RA 4NCZA 2JEVA 4FD7A 1YR0A 3R96A 3E0KA 3DSBA 4CRYB 1Z4EA 5GCNA 4KUBA 1IYLA 2B5GA 1WK4A 2P0WA 2B3VA 3R9FA 2A4NA 4KOSA 3CXQA 5EC4A 2DXQA 2OB0A 1WWZA 2R7HA 1PU9A 1UFHA 4CAVA 4M3SA 3GKRA 1Q2CA 4R57A 2G3AA 2P6FA 1V0CA 3H4QA 3TT2A 5F46A 5ISVA 3D2PA 4JWPA 4FD6A 4AB7A 2VZYA 3B8GA 2FIWA 3FNCA 3KKWA 3W6SA 2PQ8A 1J4JA 1IB1E 4XNHC 1P4NA 3FXTA 2JDDA 4II9A 3D3SA 1YGHA 2FCKA 3WR7A 2B5GB 3OWCA 2ZW5A 3IWGA 2ZW4A 4B5PB 1VHSA 1YLEA 1S7NA 4X5KA 4YGOA 3LODA 4KORA 2BUEA 2JDCA 1M4DA 2O28A 2H5MA 4OADA 1I1DA 2BEIA 2JLMA 4PSWA 2FL4A 4E8OA 4HKFA 3V8IA 4AG7A 2IL4A 3R9GA 5I0CA 3QB8A 2R98A 5KTCA 1KZFA 5C82A 4JD6A 2B4BA 2ZW7A 2PR8A 1Q2DA 5E96A 4B5PA 4ONUA 1BO4A 2FIAA 4PK2A 2Z11A 3T90A 3FYNA 2FS5A 2OU2A 1QSMA 3I3GA 4IF5A 5IB0A 2P6GA 3TO7A 5C88A 5F49A 3G8WA 3I9SA 2CNSA 1QSRA 1S3ZA 2I00A 2Z0ZA 4L89A 3FB3A 4PSXA 3PP9A 1TIQA 4R87A 3PGPA 4KOUA 4MI4A 4U5YA 4CAWA 1PUAA 1YVKA 2OH1A 4KOYA 2ARHA 1MK4A 4KVOE 2ZW6A 3TOBA 2QIRA 2F5IA 1YK3A 3DR6A 3D8PA 2D4PA 4MY3A 2OZHA 1YX0A 2VEZA 3FIXA 1Z9UA 3K9UA 3TO9A 3EY5A 2QECA 4U9YA 1XIXA 2BL1A 3G3SA 1OZPA 1M1DA 1KUXA 4KVXA 1M4GA 2B3UA 1U6MA 4I49A 4ORFA 5IV0A 4F0YA 4CAXA 4CRZB 2HQYA 2PDOA 2G0BA 1MJBA 4JXQA 1NE9A 4KLWA 4JJXA 3T9YA 2CNTA 3VWEA 1L0CA 4NXYA 5F48A 5JPHA 2Q0YA 3SHPA 5KTAA 4NEXA 1MJ9A 4H6ZA 5J8CA 4AVBA 3W91A 4QB9A 4F6AA 1N71A 2VI7A 4QBJA 1BOBA 4XPKA 2G3TA 5KTDA 2X7BA 1QSTA 3PZJA 2PC1A 4MHDA 1I21A 4OLLA 1K4JA 4YRHA 3SXOA 4XPDB 3ZJ0A 2FSRA 3QAHA 2GANA 4MBUA 2OZUA 1KUYA 4R9MA 2PR1A 4UBRA 5CNPA 4UWJA 4AG9A 1CJWA 3IGRA 2C27A 1IIDA 1FY7A 1Z4RA 4JLYA 4KOXA 3W6XA 2R1IA 4MJ8A 4ZBGA 4H89A 1Y9WA 2Z10A 4HNXB 4R3LA 3R95A 2AE6A 2EUIA 2OZGA 3S6GA 1SQHA 3N7ZA 2EVNA 4QUSA 3F0AA 1IYKA 1B87A 4UA3A 1QSOA 2VBQA 1RO5A 4RS2A 3D2MA 3RYOA 3FBUA 5H84A 2I79A 5HMNA 1VKCA 1ON0A 1YVOA 2R8VA 3S6KA 3CXSA 1S5KA 1RXTA 4XNHB
chains in the Genus database with same CATH superfamily
3P2HA 4E0AA 4YFJA 2PJCA 2Q44A 1X12A 2WPXA 4IUSA 3VWDA 4QVTA 2Z3PA 1KWMA 3FX6A 8CPAA 1YLOA 2EK8A 3UY5A 1M44A 1NMTA 2VQYA 4KS9A 2J8MA 2NSMA 2ODFA 2ZENA 4WJBA 1IU8A 2DEAA 2ZOFA 4KOVA 2D4OA 3TFYA 1F2PA 5DWNA 1Y7RA 1XEBA 3WC6A 4OP4A 1Z8TA 2GE3A 2FVGA 4CGOA 1R57A 4LX9A 4UWIA 1Q2YA 2Z3NA 2C1CA 5G21A 2AJ6A 3B3SA 3V38A 1Z8XA 2QVPA 3PEIA 4H2KA 4JZ0A 1XMTA 2RC4A 1XRYA 3R9EA 1P0HA 3JUWA 3FH4A 1QMUA 3C26A 1ARMA 4H6UA 3BJ8A 3P2FA 4G1PA 3B3WA 3BLNA 2YNEA 4MCRA 5D29A 4PK3A 2Y0MA 1S7FA 2PJBA 3F5BA 3SJFA 3KI9A 3DDDA 3KQZA 4U9ZA 3VH9A 5DWMA 4M6IA 3JVNA 3ZZIA 5THWA 4FD4A 1CX8A 4R3KA 1NSLA 4GXHA 4F0XA 2HV2A 4KLVA 4BD9A 2Z3LA 3SI0A 2ZEMA 1CPSA 3FEEA 4Y49B 2Q51A 3RAMA 3A9LA 3DNSA 3TTHA 4DNCA 4PV6A 5DS0A 3D4UA 2B4DA 4NGRA 3TO6A 2Q7BA 4EVYA 3IO1A 4A39A 2JBJA 4AVAA 4NJRA 4F8ZA 3SXNA 3L2NA 2PJ7A 1LAMA 2HC9A 4QC6A 2REEA 3EXNA 3KZWA 2PVVA 4L8AA 2FE7A 2BO9A 4C68A 3FRMA 2ATRA 2CF4A 3MGDA 4BBHA 4BMHA 3D7DA 4FAIA 2V77A 5FVJA 5JQ4A 3CDXA 4IHMA 2GIVA 3N5FA 3PFEA 3KASA 2P6EA 3S9MA 3GUXA 2ZPAA 1LANA 3WC5A 1S7LA 3IU2A 2J8NA 4MCSA 1Y9KA 4HNYB 4IAVA 5H86A 4CYNA 4LQ6A 4MY0A 4A30A 1YSJA 4A31A 4NGTA 3TE4A 3ISZA 1IICA 5HH1A 3GY9A 3IWEA 3TOAA 1TKFA 3GLJA 3I1UA 4FUUA 4MHYA 1MJAA 4MMOA 4R6TA 4FD5A 2PJ4A 2VZZA 4UEZA 3F8KA 4K30A 4PXEA 4RI1A 3SI1A 3H8EA 4UEEA 1GHEA 4B11A 1CM0A 4HNWB 2V8HA 3S6HA 2PJ1A 2WPWA 5G20A 4LUAA 7CPAA 4MFPA 1XE4A 2B4DB 4A38A 4DUKA 2QYVA 2WUUA 1UWYA 2AFWA 3EO4A 4MXUA 2B58A 3S6FA 1LRZA 1S60A 2OOTA 2ZELA 3LD2A 4NGMA 1M4IA 3KL9A 2NYQA 4OIDA 4OC2A 3IC1A 2Q4ZA 4KVME 1DTDA 4Y49C 2Q7SA 1YW4A 3D66A 4OC3A 3D7HA 4AXVA 4MFLA 3R1KA 5I4MA 4R76A 2Q04A 1B6BA 1KUVA 2PJAA 4NF1A 4P4EA 2PSWA 2HUZA 5AG4A 4OC5A 2REFA 1XF8A 3TCVA 4MFZA 1HEEA 2PJ0A 5JH9A 3HUVA 1PYTB 5F47A 4B5OA 4ZX8A 4XPLA 1ELMP 5ELYA 2BSWA 2PVWA 3EFAA 4KSIA 3D7GA 3PBBA 1YREA 4RN7A 3BJ7A 4CGPA 4OC0A 2CNMA 2EO8A 4CS0B 2Q4YA 4A94A 2K5TA 1LAPA 4OMEA 4PQAA 2V8VA 2VXKA 3CXPA 2PIYA 4CYQA 4GS4A 3KHZA 2O53A 3GYAA 1CBXA 4JXRA 3VATA 1FNOA 2F8HA 3PB7X 4A32A 4MRIA 1Z8LA 5EBVA 3IFEA 4J3GA 2PRBA 2CY2A 2XEFA 4XPDC 1S7KA 1QSNA 1TF8A 2I3CA 2ZEDA 2ZEOA 2NMTA 5BWAB 1I12A 1IY7A 4LQGA 2KCWA 4E2AA 2FXFA 4RUHA 1AUGA 1H8LA 3DR8A 1ELLP 2EK9A 4OAEA 1ZLHA 3NE7A 2FT0A 4O23A 4M85A 4KZTA 4NSQA 2Q4VA 2QMLA 5IX3A 5J8FA 4KOWA 4KOTA 3BI0A 1FT7A 2ZEEA 3B3VA 1Z5RA 4KUAA 4NGSA 5AG7A 5LYLA 2ZOGA 1AMPA 3IJ3A 3EC4A 1VIXA 3WABA 3PBEA 2XEIA 2GREA 4AVCA 3B3CA 2ZXVA 2J8RA 2ZEGA 4NCZA 4Z65A 2JEVA 4FD7A 2AFZA 4NGQA 1YR0A 3JTKA 1CG2A 3NA6A 3R96A 3E0KA 3DSBA 4CRYB 1CP7A 1Z4EA 3MN8A 5GCNA 4KUBA 1IYLA 3TX8A 2B5GA 2JBKA 1WK4A 2P0WA 3S9LA 2B3VA 3R9FA 3KR4A 2AFOA 1ZG8A 1Z8WA 2A4NA 2AFSA 2C6CA 2PE3A 3CXQA 4KOSA 5AG6A 4B10A 4B6ZA 4CGNA 5EC4A 2DXQA 1TF9A 2OB0A 5CPAA 6CPAA 1WWZA 2R7HA 1PU9A 1X10A 4X2TA 4K3NA 1UFHA 4CAVA 4M3SA 5K8NA 3K9TA 3GKRA 1Q2CA 3CT9A 1XBUA 4R57A 5A27A 1IOIA 1IGBA 2G3AA 2ANPA 1VHEA 4KSFA 2P6FA 1V0CA 3H4QA 3PRTA 3TT2A 5F46A 5ISVA 3D2PA 4JWPA 4FD6A 4P4FA 2AFMA 4P45A 4JYWA 2C6GA 4AB7A 2VZYA 1IOFA 3B8GA 4C2ZA 3T8WA 1CPXA 1XFOA 3RO0A 3RZAA 2FIWA 3FNCA 4P4IA 3KKWA 3NE8A 1ZLIA 3SI2A 3W6SA 4TNUA 4CYOA 2PQ8A 1J4JA 3FMCA 1IB1E 2PJ5A 3IEHA 4XNHC 4UCPA 1P4NA 1VGYA 3FXTA 2JDDA 2WZNA 5G1ZA 4II9A 3D3SA 2Q43A 1YGHA 3B3TA 1Y7EA 2FCKA 3WR7A 3V7ZA 2B5GB 1ZG7A 3OWCA 1JWQA 2ZW5A 3FVLA 2PJ2A 3IWGA 2ZW4A 4B5PB 1VHSA 3GB0A 1YLEA 1OBRA 1S7NA 4X5KA 1HDUA 4YGOA 3LODA 4P10A 1EE3P 4KORA 1YW6A 2BUEA 2F7VA 3LWUA 2JDCA 1BLLE 1M4DA 1Z2LA 2O28A 2H5MA 4OADA 4NGNA 4X8IA 1JQGA 4IK2A 1I1DA 2CTCA 1BPNA 3K2KA 2BEIA 2XEJA 1M4LA 2DPTA 2JLMA 4PSWA 2FL4A 4E8OA 5CBMA 4CPAA 2PJ9A 4HKFA 3V8IA 2DF5A 3KHXA 2IL4A 4AG7A 3R9GA 5I0CA 3CZXA 3QB8A 2R98A 2GU2A 5KTCA 3IIBA 4NFRA 1KZFA 4MHNA 5C82A 4ZYQA 4JD6A 3D67A 2B4BA 4NJQA 2PIZA 2ZW7A 2PR8A 4Q36A 4MFKA 2ZEHA 1PCAA 1Q2DA 3B7IA 5AGEA 5E96A 2DPSA 4A37A 4B5PA 4ONUA 1BO4A 1CP6A 2FIAA 2Z11A 4PK2A 3FYNA 4P4BA 3T90A 4EMEA 4EWTA 2C6PA 2BOAA 2FS5A 2OU2A 2PRQA 1QSMA 3I3GA 3QAYA 4OKOA 4ZY1A 2HB6A 3PB8X 4IF5A 4B12A 3NH8A 4A95A 5IB0A 2P6GA 2EWBA 3FECA 4R7MA 3BXMA 2OR4A 5LRJA 2V8DA 3PB6X 3TO7A 4ZY2A 5C88A 5F49A 5LYIA 3G8WA 4CGMA 4EFDA 4FWUA 3PB9X 3I9SA 2CNSA 5D8NA 1QSRA 1S3ZA 2AFUA 2I00A 2PCUA 3PB4X 4OC4A 2Z0ZA 4BINA 4L89A 3RBUA 5AG5A 4UFXA 3FB3A 4Q7AA 4PSXA 4C2YA 1AYEA 3PP9A 5A28A 3LACA 1TIQA 1ZO0A 4R87A 4W9YA 4MCPA 2CIJA 3PGPA 4MCQA 4KOUA 4MI4A 3B2YA 4U5YA 2XEGA 1DE4C 1Y0YA 4YWYA 4CAWA 4ONWA 1PUAA 2PJ6A 1XJOA 1YVKA 2QJ8A 2OH1A 3IU1A 4HPSA 4KOYA 2ARHA 1MK4A 4KVOE 4PXCA 2ZW6A 4PXBA 2GLFA 3FJUA 4WWVA 3TOBA 4CYPA 2QIRA 4MHPA 3SJGA 2F5IA 4UIBA 4B13A 1YK3A 3WC7A 3DR6A 1F2OA 1QQ9A 3D8PA 3KR5A 3LMSA 2D4PA 4MY3A 4UFVA 4NGPA 3D68A 5IB9A 4FBEA 4P4DA 2ZEFA 2OZHA 4TWEA 1YX0A 3S9NA 2VEZA 4GM5A 4ZGYB 3FIXA 1Z9UA 3K9UA 4ZX9A 3TO9A 3EY5A 2QECA 4U9YA 4C2XA 1XIXA 2BL1A 2YGWA 3G3SA 1OZPA 1M1DA 1KUXA 4KVXA 3H8GA 1M4GA 2B3UA 2GLJA 3PFOA 1ARLA 2J9AA 1U6MA 3QNVA 4I49A 4ORFA 5IV0A 4F0YA 3D7FA 4CAXA 4CRZB 1BPMA 2HQYA 4KSAA 2PDOA 2G0BA 1YQEA 3BHXA 1HDQA 2IQ6A 3SJXA 1MJBA 4JXQA 1YMEA 4M6GA 5K8OA 1NE9A 2WSAA 4JJXA 4KLWA 3T9YA 2CNTA 3VWEA 4A33A 1L0CA 3MRUA 4NXYA 4UCMA 5F48A 3B35A 5JPHA 1XOVA 2Q0YA 2V8GA 2Z3MA 3SHPA 4NEXA 5HVFA 5KTAA 1MJ9A 4UIAA 4H6ZA 4CAEA 2ABZA 4AVBA 5J8CA 3W91A 4QB9A 4ZY0A 4F6AA 1N71A 2VI7A 3CPAA 3H5ZA 4OC1A 1BOBA 4XPKA 2G3TA 5LRGA 4QBJA 4ZI6A 5KTDA 2X7BA 3NH5A 1QSTA 3FEDA 4M6HA 3PZJA 1XMBA 2PC1A 2GFQA 2YNCC 3VARA 4MHDA 1RTQA 1I21A 4B14A 4OLLA 3GIUA 1K4JA 4YRHA 4P44A 3SXOA 3TC8A 4CGLA 4Q38A 4XPDB 3ZJ0A 2IMOA 2FSRA 1TKHA 3DGVA 2YNDA 3KGQA 3QAHA 3CPXA 4P6YA 4F9UA 5JGFA 2GANA 1A2ZA 4MBUA 2OZUA 1KUYA 4OIWA 4YU9A 4MFJA 2PR1A 3NH4A 4R9MA 4UBRA 5CNPA 5LYDA 3H8FA 2AFXA 1Q7LA 2IJZA 4UFWA 4UWJA 4AG9A 3RNZA 1LOKA 2Z3OA 4PXDA 1CJWA 3IGRA 4DYOA 3KQXA 4R8FA 2C27A 2G9DA 5LYFA 2WYRA 1IIDA 4PPZA 4P4JA 1Y0RA 2RB7A 3BI1A 3WT4A 4UCNA 1GYTA 3NFZA 5HVHA 5JM6A 1R3NA 1VHOA 3IWWA 1FY7A 3FF3A 1Z4RA 2Z3KA 4JLYA 4KOXA 3W6XA 2R1IA 4CAFA 4MJ8A 4ZBGA 2CXAA 4UF4A 4H89A 1Y9WA 2JEWA 4MHZA 2PJ8A 2Z10A 1LFWA 4X3RA 4HNXB 4R3LA 3R95A 2AE6A 2EUIA 2OZGA 3S6GA 5LRKA 1R43A 4UEFA 1SQHA 2RFHA 3N7ZA 2EVNA 4QUSA 5HVGA 1NSAA 3F0AA 1TXRA 5J1QA 1TKJA 1IYKA 1B87A 5K8MA 4UA3A 2ZEPA 4A2ZA 4C7IA 2EBJA 1QSOA 2VBQA 3SJEA 1RO5A 2POKA 1ZG9A 2CTBA 3HLPA 4RS2A 4C7HA 3D2MA 3RYOA 3FBUA 2VL1A 5H84A 2O4HA 4DJLA 2PJ3A 5G22A 5HXDA 3ISXA 3JRUA 2I79A 2YNCA 5EMIA 4XNHB 5K8PA 1LCPA 3DLJA 5HMNA 1VKCA 1ON0A 1YVOA 2R8VA 4MFQA 3S6KA 4F9VA 3CXSA 1S5KA 5F09A 2BCOA 1RXTA 1BAVA 1F57A
chains in the Genus database with same CATH topology
3P2HA 4E0AA 4YFJA 2Q44A 3VWDA 2WPXA 4IUSA 4QVTA 2Z3PA 3UY5A 1M44A 1NMTA 2VQYA 4KS9A 2J8MA 3TFYA 4KOVA 2D4OA 5DWNA 1Y7RA 1XEBA 2GE3A 4CGOA 1R57A 4LX9A 4UWIA 1Q2YA 2Z3NA 5G21A 2AJ6A 1XMTA 2RC4A 3R9EA 1P0HA 3JUWA 3C26A 4H6UA 3BJ8A 3P2FA 3BLNA 2YNEA 4PK3A 2Y0MA 1S7FA 3F5BA 3DDDA 4U9ZA 5DWMA 3JVNA 3ZZIA 4FD4A 4R3KA 4F0XA 1NSLA 2HV2A 4KLVA 2Z3LA 4Y49B 4DNCA 3TTHA 3A9LA 3DNSA 4PV6A 2B4DA 3TO6A 2Q7BA 4EVYA 4AVAA 3SXNA 4QC6A 2REEA 3EXNA 4L8AA 2FE7A 4C68A 3FRMA 2ATRA 3MGDA 4BBHA 4BMHA 5FVJA 5JQ4A 2GIVA 2P6EA 2ZPAA 1S7LA 3IU2A 2J8NA 5H86A 1Y9KA 4HNYB 4CYNA 4MY0A 4A30A 4A31A 3TE4A 1IICA 5HH1A 3GY9A 3IWEA 3TOAA 1MJAA 4FD5A 2VZZA 3F8KA 4K30A 4RI1A 1GHEA 4B11A 1CM0A 4HNWB 3S6HA 2WPWA 5G20A 4LUAA 4MFPA 1XE4A 2B4DB 2WUUA 3EO4A 3S6FA 2B58A 1LRZA 1S60A 3LD2A 1M4IA 4KVME 4Y49C 4MFLA 3R1KA 2Q04A 1B6BA 1KUVA 4NF1A 2PSWA 2HUZA 5AG4A 2REFA 1XF8A 3TCVA 4MFZA 5F47A 4B5OA 4XPLA 2BSWA 3EFAA 1YREA 3BJ7A 4CGPA 2CNMA 4CS0B 2Q4YA 2K5TA 2VXKA 3CXPA 4CYQA 4GS4A 3GYAA 4JXRA 4A32A 5EBVA 4J3GA 2PRBA 2CY2A 4XPDC 1S7KA 1QSNA 5BWAB 2NMTA 1I12A 2KCWA 4E2AA 2FXFA 3DR8A 4OAEA 3NE7A 2FT0A 4M85A 4KZTA 4NSQA 2Q4VA 2QMLA 5IX3A 5J8FA 4KOWA 4KOTA 5AG7A 4KUAA 3EC4A 4AVCA 2ZXVA 2J8RA 4NCZA 2JEVA 4FD7A 1YR0A 3JTKA 3R96A 3E0KA 3DSBA 4CRYB 1Z4EA 5GCNA 4KUBA 1IYLA 2B5GA 1WK4A 2P0WA 2B3VA 3R9FA 5AG6A 2A4NA 4B10A 4KOSA 3CXQA 4CGNA 5EC4A 2DXQA 2OB0A 1WWZA 2R7HA 1PU9A 1UFHA 4CAVA 4M3SA 3GKRA 1Q2CA 4R57A 5A27A 2G3AA 4KSFA 2P6FA 1V0CA 3H4QA 3TT2A 5F46A 5ISVA 3D2PA 4JWPA 4FD6A 4AB7A 2VZYA 4C2ZA 3B8GA 2FIWA 3FNCA 3KKWA 3W6SA 4CYOA 2PQ8A 1J4JA 1IB1E 4XNHC 4UCPA 1P4NA 3FXTA 2JDDA 5G1ZA 4II9A 3D3SA 1YGHA 2FCKA 3WR7A 2B5GB 3OWCA 2ZW5A 3IWGA 2ZW4A 4B5PB 1VHSA 1YLEA 1S7NA 4X5KA 4YGOA 3LODA 4KORA 2BUEA 2JDCA 1M4DA 2O28A 2H5MA 4OADA 1I1DA 2BEIA 2JLMA 2DPTA 4PSWA 2FL4A 4E8OA 4HKFA 3V8IA 4AG7A 2IL4A 3R9GA 5I0CA 3QB8A 2R98A 5KTCA 1KZFA 5C82A 4JD6A 2B4BA 2ZW7A 2PR8A 4Q36A 4MFKA 1Q2DA 5AGEA 5E96A 2DPSA 4B5PA 4ONUA 1BO4A 2FIAA 4PK2A 2Z11A 3T90A 3FYNA 2FS5A 2OU2A 1QSMA 3I3GA 4IF5A 4B12A 4A95A 5IB0A 2P6GA 3TO7A 5C88A 5F49A 3G8WA 4CGMA 3I9SA 2CNSA 1QSRA 1S3ZA 2I00A 2Z0ZA 4L89A 5AG5A 4UFXA 3FB3A 4PSXA 4C2YA 3PP9A 5A28A 1TIQA 1ZO0A 4R87A 3PGPA 4KOUA 4MI4A 4U5YA 4CAWA 1PUAA 1YVKA 2OH1A 3IU1A 4KOYA 2ARHA 1MK4A 4KVOE 2ZW6A 3TOBA 4CYPA 2QIRA 2F5IA 4B13A 1YK3A 3DR6A 3D8PA 4UFVA 2D4PA 4MY3A 2OZHA 1YX0A 2VEZA 4ZGYB 3FIXA 1Z9UA 3K9UA 3TO9A 3EY5A 2QECA 4U9YA 4C2XA 1XIXA 2BL1A 3G3SA 2YGWA 1OZPA 1M1DA 1KUXA 4KVXA 1M4GA 2B3UA 1U6MA 4I49A 4ORFA 5IV0A 4F0YA 4CAXA 4CRZB 2HQYA 4KSAA 2PDOA 2G0BA 1MJBA 4JXQA 1NE9A 2WSAA 4JJXA 4KLWA 3T9YA 2CNTA 3VWEA 4A33A 1L0CA 4NXYA 4UCMA 5F48A 5JPHA 2Q0YA 2Z3MA 3SHPA 4NEXA 5KTAA 1MJ9A 4H6ZA 4CAEA 5J8CA 4AVBA 3W91A 4QB9A 4F6AA 1N71A 2VI7A 4QBJA 3H5ZA 1BOBA 4XPKA 2G3TA 5KTDA 2X7BA 1QSTA 3PZJA 2PC1A 2YNCC 4MHDA 4B14A 1I21A 4OLLA 1K4JA 4YRHA 3SXOA 4CGLA 4Q38A 4XPDB 3ZJ0A 2FSRA 2YNDA 3QAHA 2GANA 4MBUA 2OZUA 1KUYA 4MFJA 2PR1A 4R9MA 4UBRA 5CNPA 4UFWA 4UWJA 4AG9A 2Z3OA 1CJWA 3IGRA 2C27A 1IIDA 4UCNA 1FY7A 1Z4RA 2Z3KA 4JLYA 4KOXA 3W6XA 2R1IA 4CAFA 4MJ8A 4ZBGA 2CXAA 4H89A 1Y9WA 2Z10A 4HNXB 4R3LA 3R95A 2AE6A 2EUIA 2OZGA 3S6GA 1SQHA 3N7ZA 2EVNA 4QUSA 3F0AA 1IYKA 1B87A 4UA3A 4A2ZA 4C7IA 1QSOA 2VBQA 1RO5A 4C7HA 4RS2A 3D2MA 3RYOA 3FBUA 5H84A 5G22A 2I79A 2YNCA 5HMNA 1VKCA 1ON0A 1YVOA 2R8VA 4MFQA 3S6KA 3CXSA 1S5KA 1RXTA 4XNHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P2H A;  4E0A A;  4YFJ A;  2Q44 A;  3VWD A;  2WPX A;  4IUS A;  4QVT A;  3UY5 A;  1M44 A;  1NMT A;  2VQY A;  2J8M A;  3TFY A;  4KOV A;  2D4O A;  5DWN A;  1Y7R A;  1XEB A;  2GE3 A;  1R57 A;  4LX9 A;  4UWI A;  1Q2Y A;  2AJ6 A;  1XMT A;  2RC4 A;  3R9E A;  1P0H A;  3JUW A;  3C26 A;  4H6U A;  3BJ8 A;  3P2F A;  3BLN A;  4PK3 A;  2Y0M A;  1S7F A;  3F5B A;  3DDD A;  4U9Z A;  5DWM A;  3JVN A;  3ZZI A;  4FD4 A;  4R3K A;  1NSL A;  2HV2 A;  4KLV A;  4Y49 B;  4DNC A;  3TTH A;  3DNS A;  4PV6 A;  2B4D A;  3TO6 A;  2Q7B A;  4EVY A;  4AVA A;  3SXN A;  4QC6 A;  2REE A;  3EXN A;  4L8A A;  2FE7 A;  3FRM A;  2ATR A;  3MGD A;  4BMH A;  5FVJ A;  5JQ4 A;  2GIV A;  2P6E A;  2ZPA A;  1S7L A;  5H86 A;  2J8N A;  1Y9K A;  4HNY B;  4MY0 A;  3TE4 A;  1IIC A;  5HH1 A;  3GY9 A;  3TOA A;  1MJA A;  4FD5 A;  2VZZ A;  3F8K A;  4K30 A;  4RI1 A;  1GHE A;  1CM0 A;  4HNW B;  3S6H A;  2WPW A;  4LUA A;  1XE4 A;  2B4D B;  3EO4 A;  3S6F A;  2B58 A;  1LRZ A;  1S60 A;  3LD2 A;  1M4I A;  4KVM E;  4Y49 C;  3R1K A;  2Q04 A;  1B6B A;  1KUV A;  4NF1 A;  2PSW A;  2HUZ A;  2REF A;  1XF8 A;  3TCV A;  5F47 A;  4B5O A;  4XPL A;  2BSW A;  3EFA A;  1YRE A;  3BJ7 A;  2CNM A;  4CS0 B;  2Q4Y A;  2K5T A;  2VXK A;  3CXP A;  4GS4 A;  3GYA A;  4JXR A;  5EBV A;  4J3G A;  2PRB A;  2CY2 A;  4XPD C;  1S7K A;  1QSN A;  2NMT A;  1I12 A;  2KCW A;  4E2A A;  2FXF A;  3DR8 A;  4OAE A;  3NE7 A;  2FT0 A;  4M85 A;  4KZT A;  4NSQ A;  2Q4V A;  2QML A;  5IX3 A;  5J8F A;  4KOW A;  4KOT A;  4KUA A;  3EC4 A;  4AVC A;  2ZXV A;  2J8R A;  4NCZ A;  2JEV A;  4FD7 A;  1YR0 A;  3R96 A;  3E0K A;  3DSB A;  4CRY B;  1Z4E A;  5GCN A;  4KUB A;  1IYL A;  2B5G A;  1WK4 A;  2P0W A;  2B3V A;  3R9F A;  2A4N A;  4KOS A;  3CXQ A;  5EC4 A;  2DXQ A;  2OB0 A;  1WWZ A;  2R7H A;  1PU9 A;  1UFH A;  4CAV A;  4M3S A;  3GKR A;  1Q2C A;  4R57 A;  2G3A A;  2P6F A;  1V0C A;  3H4Q A;  3TT2 A;  5F46 A;  5ISV A;  3D2P A;  4JWP A;  4FD6 A;  4AB7 A;  2VZY A;  3B8G A;  2FIW A;  3FNC A;  3KKW A;  3W6S A;  2PQ8 A;  1J4J A;  1IB1 E;  4XNH C;  1P4N A;  3FXT A;  2JDD A;  4II9 A;  3D3S A;  1YGH A;  2FCK A;  3WR7 A;  2B5G B;  3OWC A;  2ZW5 A;  3IWG A;  2ZW4 A;  4B5P B;  1VHS A;  1YLE A;  1S7N A;  4X5K A;  4YGO A;  3LOD A;  4KOR A;  2BUE A;  2JDC A;  1M4D A;  2O28 A;  2H5M A;  4OAD A;  1I1D A;  2BEI A;  2JLM A;  4PSW A;  2FL4 A;  4E8O A;  4HKF A;  3V8I A;  4AG7 A;  2IL4 A;  3R9G A;  5I0C A;  3QB8 A;  2R98 A;  5KTC A;  1KZF A;  5C82 A;  4JD6 A;  2B4B A;  2ZW7 A;  2PR8 A;  1Q2D A;  5E96 A;  4B5P A;  4ONU A;  1BO4 A;  2FIA A;  4PK2 A;  2Z11 A;  3T90 A;  3FYN A;  2FS5 A;  2OU2 A;  1QSM A;  3I3G A;  4IF5 A;  5IB0 A;  2P6G A;  3TO7 A;  5C88 A;  5F49 A;  3G8W A;  3I9S A;  2CNS A;  1QSR A;  1S3Z A;  2I00 A;  2Z0Z A;  4L89 A;  3FB3 A;  4PSX A;  3PP9 A;  1TIQ A;  4R87 A;  3PGP A;  4KOU A;  4MI4 A;  4U5Y A;  4CAW A;  1PUA A;  1YVK A;  2OH1 A;  4KOY A;  2ARH A;  1MK4 A;  4KVO E;  2ZW6 A;  3TOB A;  2QIR A;  2F5I A;  1YK3 A;  3DR6 A;  3D8P A;  2D4P A;  4MY3 A;  2OZH A;  1YX0 A;  2VEZ A;  3FIX A;  1Z9U A;  3K9U A;  3TO9 A;  3EY5 A;  2QEC A;  4U9Y A;  1XIX A;  2BL1 A;  3G3S A;  1OZP A;  1M1D A;  1KUX A;  4KVX A;  1M4G A;  2B3U A;  1U6M A;  4I49 A;  4ORF A;  5IV0 A;  4F0Y A;  4CAX A;  4CRZ B;  2HQY A;  2PDO A;  2G0B A;  1MJB A;  4JXQ A;  1NE9 A;  4KLW A;  4JJX A;  3T9Y A;  2CNT A;  3VWE A;  1L0C A;  4NXY A;  5F48 A;  5JPH A;  2Q0Y A;  3SHP A;  5KTA A;  4NEX A;  1MJ9 A;  4H6Z A;  5J8C A;  4AVB A;  3W91 A;  4QB9 A;  4F6A A;  1N71 A;  2VI7 A;  4QBJ A;  1BOB A;  4XPK A;  2G3T A;  5KTD A;  2X7B A;  1QST A;  3PZJ A;  2PC1 A;  4MHD A;  1I21 A;  4OLL A;  1K4J A;  4YRH A;  3SXO A;  4XPD B;  3ZJ0 A;  2FSR A;  3QAH A;  2GAN A;  4MBU A;  2OZU A;  1KUY A;  4R9M A;  2PR1 A;  4UBR A;  5CNP A;  4UWJ A;  4AG9 A;  1CJW A;  3IGR A;  2C27 A;  1IID A;  1FY7 A;  1Z4R A;  4JLY A;  4KOX A;  3W6X A;  2R1I A;  4MJ8 A;  4ZBG A;  4H89 A;  1Y9W A;  2Z10 A;  4HNX B;  4R3L A;  3R95 A;  2AE6 A;  2EUI A;  2OZG A;  3S6G A;  1SQH A;  3N7Z A;  2EVN A;  4QUS A;  3F0A A;  1IYK A;  1B87 A;  4UA3 A;  1QSO A;  2VBQ A;  1RO5 A;  4RS2 A;  3D2M A;  3RYO A;  3FBU A;  5H84 A;  2I79 A;  5HMN A;  1VKC A;  1ON0 A;  1YVO A;  2R8V A;  3S6K A;  3CXS A;  1S5K A;  1RXT A;  4XNH B; 
#chains in the Genus database with same CATH topology
 3P2H A;  4E0A A;  4YFJ A;  2PJC A;  2Q44 A;  1X12 A;  2WPX A;  4IUS A;  3VWD A;  4QVT A;  2Z3P A;  1KWM A;  3FX6 A;  8CPA A;  1YLO A;  2EK8 A;  3UY5 A;  1M44 A;  1NMT A;  2VQY A;  4KS9 A;  2J8M A;  2NSM A;  2ODF A;  2ZEN A;  4WJB A;  1IU8 A;  2DEA A;  2ZOF A;  4KOV A;  2D4O A;  3TFY A;  1F2P A;  5DWN A;  1Y7R A;  1XEB A;  3WC6 A;  4OP4 A;  1Z8T A;  2GE3 A;  2FVG A;  4CGO A;  1R57 A;  4LX9 A;  4UWI A;  1Q2Y A;  2Z3N A;  2C1C A;  5G21 A;  2AJ6 A;  3B3S A;  3V38 A;  1Z8X A;  2QVP A;  3PEI A;  4H2K A;  4JZ0 A;  1XMT A;  2RC4 A;  1XRY A;  3R9E A;  1P0H A;  3JUW A;  3FH4 A;  1QMU A;  3C26 A;  1ARM A;  4H6U A;  3BJ8 A;  3P2F A;  4G1P A;  3B3W A;  3BLN A;  2YNE A;  4MCR A;  5D29 A;  4PK3 A;  2Y0M A;  1S7F A;  2PJB A;  3F5B A;  3SJF A;  3KI9 A;  3DDD A;  3KQZ A;  4U9Z A;  3VH9 A;  5DWM A;  4M6I A;  3JVN A;  3ZZI A;  5THW A;  4FD4 A;  1CX8 A;  4R3K A;  1NSL A;  4GXH A;  4F0X A;  2HV2 A;  4KLV A;  4BD9 A;  2Z3L A;  3SI0 A;  2ZEM A;  1CPS A;  3FEE A;  4Y49 B;  2Q51 A;  3RAM A;  3A9L A;  3DNS A;  3TTH A;  4DNC A;  4PV6 A;  5DS0 A;  3D4U A;  2B4D A;  4NGR A;  3TO6 A;  2Q7B A;  4EVY A;  3IO1 A;  4A39 A;  2JBJ A;  4AVA A;  4NJR A;  4F8Z A;  3SXN A;  3L2N A;  2PJ7 A;  1LAM A;  2HC9 A;  4QC6 A;  2REE A;  3EXN A;  3KZW A;  2PVV A;  4L8A A;  2FE7 A;  2BO9 A;  4C68 A;  3FRM A;  2ATR A;  2CF4 A;  3MGD A;  4BBH A;  4BMH A;  3D7D A;  4FAI A;  2V77 A;  5FVJ A;  5JQ4 A;  3CDX A;  4IHM A;  2GIV A;  3N5F A;  3PFE A;  3KAS A;  2P6E A;  3S9M A;  3GUX A;  2ZPA A;  1LAN A;  3WC5 A;  1S7L A;  3IU2 A;  2J8N A;  4MCS A;  1Y9K A;  4HNY B;  4IAV A;  5H86 A;  4CYN A;  4LQ6 A;  4MY0 A;  4A30 A;  1YSJ A;  4A31 A;  4NGT A;  3TE4 A;  3ISZ A;  1IIC A;  5HH1 A;  3GY9 A;  3IWE A;  3TOA A;  1TKF A;  3GLJ A;  3I1U A;  4FUU A;  4MHY A;  1MJA A;  4MMO A;  4R6T A;  4FD5 A;  2PJ4 A;  2VZZ A;  4UEZ A;  3F8K A;  4K30 A;  4PXE A;  4RI1 A;  3SI1 A;  3H8E A;  4UEE A;  1GHE A;  4B11 A;  1CM0 A;  4HNW B;  2V8H A;  3S6H A;  2PJ1 A;  2WPW A;  5G20 A;  4LUA A;  7CPA A;  4MFP A;  1XE4 A;  2B4D B;  4A38 A;  4DUK A;  2QYV A;  2WUU A;  1UWY A;  2AFW A;  3EO4 A;  4MXU A;  2B58 A;  3S6F A;  1LRZ A;  1S60 A;  2OOT A;  2ZEL A;  3LD2 A;  4NGM A;  1M4I A;  3KL9 A;  2NYQ A;  4OID A;  4OC2 A;  3IC1 A;  2Q4Z A;  4KVM E;  1DTD A;  4Y49 C;  2Q7S A;  1YW4 A;  3D66 A;  4OC3 A;  3D7H A;  4AXV A;  4MFL A;  3R1K A;  5I4M A;  4R76 A;  2Q04 A;  1B6B A;  1KUV A;  2PJA A;  4NF1 A;  4P4E A;  2PSW A;  2HUZ A;  5AG4 A;  4OC5 A;  2REF A;  1XF8 A;  3TCV A;  4MFZ A;  1HEE A;  2PJ0 A;  5JH9 A;  3HUV A;  1PYT B;  5F47 A;  4B5O A;  4ZX8 A;  4XPL A;  1ELM P;  5ELY A;  2BSW A;  2PVW A;  3EFA A;  4KSI A;  3D7G A;  3PBB A;  1YRE A;  4RN7 A;  3BJ7 A;  4CGP A;  4OC0 A;  2CNM A;  2EO8 A;  4CS0 B;  2Q4Y A;  4A94 A;  2K5T A;  1LAP A;  4OME A;  4PQA A;  2V8V A;  2VXK A;  3CXP A;  2PIY A;  4CYQ A;  4GS4 A;  3KHZ A;  2O53 A;  3GYA A;  1CBX A;  4JXR A;  3VAT A;  1FNO A;  2F8H A;  3PB7 X;  4A32 A;  4MRI A;  1Z8L A;  5EBV A;  3IFE A;  4J3G A;  2PRB A;  2CY2 A;  2XEF A;  4XPD C;  1S7K A;  1QSN A;  1TF8 A;  2I3C A;  2ZED A;  2ZEO A;  2NMT A;  5BWA B;  1I12 A;  1IY7 A;  4LQG A;  2KCW A;  4E2A A;  2FXF A;  4RUH A;  1AUG A;  1H8L A;  3DR8 A;  1ELL P;  2EK9 A;  4OAE A;  1ZLH A;  3NE7 A;  2FT0 A;  4O23 A;  4M85 A;  4KZT A;  4NSQ A;  2Q4V A;  2QML A;  5IX3 A;  5J8F A;  4KOW A;  4KOT A;  3BI0 A;  1FT7 A;  2ZEE A;  3B3V A;  1Z5R A;  4KUA A;  4NGS A;  5AG7 A;  5LYL A;  2ZOG A;  1AMP A;  3IJ3 A;  3EC4 A;  1VIX A;  3WAB A;  3PBE A;  2XEI A;  2GRE A;  4AVC A;  3B3C A;  2ZXV A;  2J8R A;  2ZEG A;  4NCZ A;  4Z65 A;  2JEV A;  4FD7 A;  2AFZ A;  4NGQ A;  1YR0 A;  3JTK A;  1CG2 A;  3NA6 A;  3R96 A;  3E0K A;  3DSB A;  4CRY B;  1CP7 A;  1Z4E A;  3MN8 A;  5GCN A;  4KUB A;  1IYL A;  3TX8 A;  2B5G A;  2JBK A;  1WK4 A;  2P0W A;  3S9L A;  2B3V A;  3R9F A;  3KR4 A;  2AFO A;  1ZG8 A;  1Z8W A;  2A4N A;  2AFS A;  2C6C A;  2PE3 A;  3CXQ A;  4KOS A;  5AG6 A;  4B10 A;  4B6Z A;  4CGN A;  5EC4 A;  2DXQ A;  1TF9 A;  2OB0 A;  5CPA A;  6CPA A;  1WWZ A;  2R7H A;  1PU9 A;  1X10 A;  4X2T A;  4K3N A;  1UFH A;  4CAV A;  4M3S A;  5K8N A;  3K9T A;  3GKR A;  1Q2C A;  3CT9 A;  1XBU A;  4R57 A;  5A27 A;  1IOI A;  1IGB A;  2G3A A;  2ANP A;  1VHE A;  4KSF A;  2P6F A;  1V0C A;  3H4Q A;  3PRT A;  3TT2 A;  5F46 A;  5ISV A;  3D2P A;  4JWP A;  4FD6 A;  4P4F A;  2AFM A;  4P45 A;  4JYW A;  2C6G A;  4AB7 A;  2VZY A;  1IOF A;  3B8G A;  4C2Z A;  3T8W A;  1CPX A;  1XFO A;  3RO0 A;  3RZA A;  2FIW A;  3FNC A;  4P4I A;  3KKW A;  3NE8 A;  1ZLI A;  3SI2 A;  3W6S A;  4TNU A;  4CYO A;  2PQ8 A;  1J4J A;  3FMC A;  1IB1 E;  2PJ5 A;  3IEH A;  4XNH C;  4UCP A;  1P4N A;  1VGY A;  3FXT A;  2JDD A;  2WZN A;  5G1Z A;  4II9 A;  3D3S A;  2Q43 A;  1YGH A;  3B3T A;  1Y7E A;  2FCK A;  3WR7 A;  3V7Z A;  2B5G B;  1ZG7 A;  3OWC A;  1JWQ A;  2ZW5 A;  3FVL A;  2PJ2 A;  3IWG A;  2ZW4 A;  4B5P B;  1VHS A;  3GB0 A;  1YLE A;  1OBR A;  1S7N A;  4X5K A;  1HDU A;  4YGO A;  3LOD A;  4P10 A;  1EE3 P;  4KOR A;  1YW6 A;  2BUE A;  2F7V A;  3LWU A;  2JDC A;  1BLL E;  1M4D A;  1Z2L A;  2O28 A;  2H5M A;  4OAD A;  4NGN A;  4X8I A;  1JQG A;  4IK2 A;  1I1D A;  2CTC A;  1BPN A;  3K2K A;  2BEI A;  2XEJ A;  1M4L A;  2DPT A;  2JLM A;  4PSW A;  2FL4 A;  4E8O A;  5CBM A;  4CPA A;  2PJ9 A;  4HKF A;  3V8I A;  2DF5 A;  3KHX A;  2IL4 A;  4AG7 A;  3R9G A;  5I0C A;  3CZX A;  3QB8 A;  2R98 A;  2GU2 A;  5KTC A;  3IIB A;  4NFR A;  1KZF A;  4MHN A;  5C82 A;  4ZYQ A;  4JD6 A;  3D67 A;  2B4B A;  4NJQ A;  2PIZ A;  2ZW7 A;  2PR8 A;  4Q36 A;  4MFK A;  2ZEH A;  1PCA A;  1Q2D A;  3B7I A;  5AGE A;  5E96 A;  2DPS A;  4A37 A;  4B5P A;  4ONU A;  1BO4 A;  1CP6 A;  2FIA A;  2Z11 A;  4PK2 A;  3FYN A;  4P4B A;  3T90 A;  4EME A;  4EWT A;  2C6P A;  2BOA A;  2FS5 A;  2OU2 A;  2PRQ A;  1QSM A;  3I3G A;  3QAY A;  4OKO A;  4ZY1 A;  2HB6 A;  3PB8 X;  4IF5 A;  4B12 A;  3NH8 A;  4A95 A;  5IB0 A;  2P6G A;  2EWB A;  3FEC A;  4R7M A;  3BXM A;  2OR4 A;  5LRJ A;  2V8D A;  3PB6 X;  3TO7 A;  4ZY2 A;  5C88 A;  5F49 A;  5LYI A;  3G8W A;  4CGM A;  4EFD A;  4FWU A;  3PB9 X;  3I9S A;  2CNS A;  5D8N A;  1QSR A;  1S3Z A;  2AFU A;  2I00 A;  2PCU A;  3PB4 X;  4OC4 A;  2Z0Z A;  4BIN A;  4L89 A;  3RBU A;  5AG5 A;  4UFX A;  3FB3 A;  4Q7A A;  4PSX A;  4C2Y A;  1AYE A;  3PP9 A;  5A28 A;  3LAC A;  1TIQ A;  1ZO0 A;  4R87 A;  4W9Y A;  4MCP A;  2CIJ A;  3PGP A;  4MCQ A;  4KOU A;  4MI4 A;  3B2Y A;  4U5Y A;  2XEG A;  1DE4 C;  1Y0Y A;  4YWY A;  4CAW A;  4ONW A;  1PUA A;  2PJ6 A;  1XJO A;  1YVK A;  2QJ8 A;  2OH1 A;  3IU1 A;  4HPS A;  4KOY A;  2ARH A;  1MK4 A;  4KVO E;  4PXC A;  2ZW6 A;  4PXB A;  2GLF A;  3FJU A;  4WWV A;  3TOB A;  4CYP A;  2QIR A;  4MHP A;  3SJG A;  2F5I A;  4UIB A;  4B13 A;  1YK3 A;  3WC7 A;  3DR6 A;  1F2O A;  1QQ9 A;  3D8P A;  3KR5 A;  3LMS A;  2D4P A;  4MY3 A;  4UFV A;  4NGP A;  3D68 A;  5IB9 A;  4FBE A;  4P4D A;  2ZEF A;  2OZH A;  4TWE A;  1YX0 A;  3S9N A;  2VEZ A;  4GM5 A;  4ZGY B;  3FIX A;  1Z9U A;  3K9U A;  4ZX9 A;  3TO9 A;  3EY5 A;  2QEC A;  4U9Y A;  4C2X A;  1XIX A;  2BL1 A;  2YGW A;  3G3S A;  1OZP A;  1M1D A;  1KUX A;  4KVX A;  3H8G A;  1M4G A;  2B3U A;  2GLJ A;  3PFO A;  1ARL A;  2J9A A;  1U6M A;  3QNV A;  4I49 A;  4ORF A;  5IV0 A;  4F0Y A;  3D7F A;  4CAX A;  4CRZ B;  1BPM A;  2HQY A;  4KSA A;  2PDO A;  2G0B A;  1YQE A;  3BHX A;  1HDQ A;  2IQ6 A;  3SJX A;  1MJB A;  4JXQ A;  1YME A;  4M6G A;  5K8O A;  1NE9 A;  2WSA A;  4JJX A;  4KLW A;  3T9Y A;  2CNT A;  3VWE A;  4A33 A;  1L0C A;  3MRU A;  4NXY A;  4UCM A;  5F48 A;  3B35 A;  5JPH A;  1XOV A;  2Q0Y A;  2V8G A;  2Z3M A;  3SHP A;  4NEX A;  5HVF A;  5KTA A;  1MJ9 A;  4UIA A;  4H6Z A;  4CAE A;  2ABZ A;  4AVB A;  5J8C A;  3W91 A;  4QB9 A;  4ZY0 A;  4F6A A;  1N71 A;  2VI7 A;  3CPA A;  3H5Z A;  4OC1 A;  1BOB A;  4XPK A;  2G3T A;  5LRG A;  4QBJ A;  4ZI6 A;  5KTD A;  2X7B A;  3NH5 A;  1QST A;  3FED A;  4M6H A;  3PZJ A;  1XMB A;  2PC1 A;  2GFQ A;  2YNC C;  3VAR A;  4MHD A;  1RTQ A;  1I21 A;  4B14 A;  4OLL A;  3GIU A;  1K4J A;  4YRH A;  4P44 A;  3SXO A;  3TC8 A;  4CGL A;  4Q38 A;  4XPD B;  3ZJ0 A;  2IMO A;  2FSR A;  1TKH A;  3DGV A;  2YND A;  3KGQ A;  3QAH A;  3CPX A;  4P6Y A;  4F9U A;  5JGF A;  2GAN A;  1A2Z A;  4MBU A;  2OZU A;  1KUY A;  4OIW A;  4YU9 A;  4MFJ A;  2PR1 A;  3NH4 A;  4R9M A;  4UBR A;  5CNP A;  5LYD A;  3H8F A;  2AFX A;  1Q7L A;  2IJZ A;  4UFW A;  4UWJ A;  4AG9 A;  3RNZ A;  1LOK A;  2Z3O A;  4PXD A;  1CJW A;  3IGR A;  4DYO A;  3KQX A;  4R8F A;  2C27 A;  2G9D A;  5LYF A;  2WYR A;  1IID A;  4PPZ A;  4P4J A;  1Y0R A;  2RB7 A;  3BI1 A;  3WT4 A;  4UCN A;  1GYT A;  3NFZ A;  5HVH A;  5JM6 A;  1R3N A;  1VHO A;  3IWW A;  1FY7 A;  3FF3 A;  1Z4R A;  2Z3K A;  4JLY A;  4KOX A;  3W6X A;  2R1I A;  4CAF A;  4MJ8 A;  4ZBG A;  2CXA A;  4UF4 A;  4H89 A;  1Y9W A;  2JEW A;  4MHZ A;  2PJ8 A;  2Z10 A;  1LFW A;  4X3R A;  4HNX B;  4R3L A;  3R95 A;  2AE6 A;  2EUI A;  2OZG A;  3S6G A;  5LRK A;  1R43 A;  4UEF A;  1SQH A;  2RFH A;  3N7Z A;  2EVN A;  4QUS A;  5HVG A;  1NSA A;  3F0A A;  1TXR A;  5J1Q A;  1TKJ A;  1IYK A;  1B87 A;  5K8M A;  4UA3 A;  2ZEP A;  4A2Z A;  4C7I A;  2EBJ A;  1QSO A;  2VBQ A;  3SJE A;  1RO5 A;  2POK A;  1ZG9 A;  2CTB A;  3HLP A;  4RS2 A;  4C7H A;  3D2M A;  3RYO A;  3FBU A;  2VL1 A;  5H84 A;  2O4H A;  4DJL A;  2PJ3 A;  5G22 A;  5HXD A;  3ISX A;  3JRU A;  2I79 A;  2YNC A;  5EMI A;  4XNH B;  5K8P A;  1LCP A;  3DLJ A;  5HMN A;  1VKC A;  1ON0 A;  1YVO A;  2R8V A;  4MFQ A;  3S6K A;  4F9V A;  3CXS A;  1S5K A;  5F09 A;  2BCO A;  1RXT A;  1BAV A;  1F57 A; 
#chains in the Genus database with same CATH homology
 3P2H A;  4E0A A;  4YFJ A;  2Q44 A;  3VWD A;  2WPX A;  4IUS A;  4QVT A;  2Z3P A;  3UY5 A;  1M44 A;  1NMT A;  2VQY A;  4KS9 A;  2J8M A;  3TFY A;  4KOV A;  2D4O A;  5DWN A;  1Y7R A;  1XEB A;  2GE3 A;  4CGO A;  1R57 A;  4LX9 A;  4UWI A;  1Q2Y A;  2Z3N A;  5G21 A;  2AJ6 A;  1XMT A;  2RC4 A;  3R9E A;  1P0H A;  3JUW A;  3C26 A;  4H6U A;  3BJ8 A;  3P2F A;  3BLN A;  2YNE A;  4PK3 A;  2Y0M A;  1S7F A;  3F5B A;  3DDD A;  4U9Z A;  5DWM A;  3JVN A;  3ZZI A;  4FD4 A;  4R3K A;  4F0X A;  1NSL A;  2HV2 A;  4KLV A;  2Z3L A;  4Y49 B;  4DNC A;  3TTH A;  3A9L A;  3DNS A;  4PV6 A;  2B4D A;  3TO6 A;  2Q7B A;  4EVY A;  4AVA A;  3SXN A;  4QC6 A;  2REE A;  3EXN A;  4L8A A;  2FE7 A;  4C68 A;  3FRM A;  2ATR A;  3MGD A;  4BBH A;  4BMH A;  5FVJ A;  5JQ4 A;  2GIV A;  2P6E A;  2ZPA A;  1S7L A;  3IU2 A;  2J8N A;  5H86 A;  1Y9K A;  4HNY B;  4CYN A;  4MY0 A;  4A30 A;  4A31 A;  3TE4 A;  1IIC A;  5HH1 A;  3GY9 A;  3IWE A;  3TOA A;  1MJA A;  4FD5 A;  2VZZ A;  3F8K A;  4K30 A;  4RI1 A;  1GHE A;  4B11 A;  1CM0 A;  4HNW B;  3S6H A;  2WPW A;  5G20 A;  4LUA A;  4MFP A;  1XE4 A;  2B4D B;  2WUU A;  3EO4 A;  3S6F A;  2B58 A;  1LRZ A;  1S60 A;  3LD2 A;  1M4I A;  4KVM E;  4Y49 C;  4MFL A;  3R1K A;  2Q04 A;  1B6B A;  1KUV A;  4NF1 A;  2PSW A;  2HUZ A;  5AG4 A;  2REF A;  1XF8 A;  3TCV A;  4MFZ A;  5F47 A;  4B5O A;  4XPL A;  2BSW A;  3EFA A;  1YRE A;  3BJ7 A;  4CGP A;  2CNM A;  4CS0 B;  2Q4Y A;  2K5T A;  2VXK A;  3CXP A;  4CYQ A;  4GS4 A;  3GYA A;  4JXR A;  4A32 A;  5EBV A;  4J3G A;  2PRB A;  2CY2 A;  4XPD C;  1S7K A;  1QSN A;  5BWA B;  2NMT A;  1I12 A;  2KCW A;  4E2A A;  2FXF A;  3DR8 A;  4OAE A;  3NE7 A;  2FT0 A;  4M85 A;  4KZT A;  4NSQ A;  2Q4V A;  2QML A;  5IX3 A;  5J8F A;  4KOW A;  4KOT A;  5AG7 A;  4KUA A;  3EC4 A;  4AVC A;  2ZXV A;  2J8R A;  4NCZ A;  2JEV A;  4FD7 A;  1YR0 A;  3JTK A;  3R96 A;  3E0K A;  3DSB A;  4CRY B;  1Z4E A;  5GCN A;  4KUB A;  1IYL A;  2B5G A;  1WK4 A;  2P0W A;  2B3V A;  3R9F A;  5AG6 A;  2A4N A;  4B10 A;  4KOS A;  3CXQ A;  4CGN A;  5EC4 A;  2DXQ A;  2OB0 A;  1WWZ A;  2R7H A;  1PU9 A;  1UFH A;  4CAV A;  4M3S A;  3GKR A;  1Q2C A;  4R57 A;  5A27 A;  2G3A A;  4KSF A;  2P6F A;  1V0C A;  3H4Q A;  3TT2 A;  5F46 A;  5ISV A;  3D2P A;  4JWP A;  4FD6 A;  4AB7 A;  2VZY A;  4C2Z A;  3B8G A;  2FIW A;  3FNC A;  3KKW A;  3W6S A;  4CYO A;  2PQ8 A;  1J4J A;  1IB1 E;  4XNH C;  4UCP A;  1P4N A;  3FXT A;  2JDD A;  5G1Z A;  4II9 A;  3D3S A;  1YGH A;  2FCK A;  3WR7 A;  2B5G B;  3OWC A;  2ZW5 A;  3IWG A;  2ZW4 A;  4B5P B;  1VHS A;  1YLE A;  1S7N A;  4X5K A;  4YGO A;  3LOD A;  4KOR A;  2BUE A;  2JDC A;  1M4D A;  2O28 A;  2H5M A;  4OAD A;  1I1D A;  2BEI A;  2JLM A;  2DPT A;  4PSW A;  2FL4 A;  4E8O A;  4HKF A;  3V8I A;  4AG7 A;  2IL4 A;  3R9G A;  5I0C A;  3QB8 A;  2R98 A;  5KTC A;  1KZF A;  5C82 A;  4JD6 A;  2B4B A;  2ZW7 A;  2PR8 A;  4Q36 A;  4MFK A;  1Q2D A;  5AGE A;  5E96 A;  2DPS A;  4B5P A;  4ONU A;  1BO4 A;  2FIA A;  4PK2 A;  2Z11 A;  3T90 A;  3FYN A;  2FS5 A;  2OU2 A;  1QSM A;  3I3G A;  4IF5 A;  4B12 A;  4A95 A;  5IB0 A;  2P6G A;  3TO7 A;  5C88 A;  5F49 A;  3G8W A;  4CGM A;  3I9S A;  2CNS A;  1QSR A;  1S3Z A;  2I00 A;  2Z0Z A;  4L89 A;  5AG5 A;  4UFX A;  3FB3 A;  4PSX A;  4C2Y A;  3PP9 A;  5A28 A;  1TIQ A;  1ZO0 A;  4R87 A;  3PGP A;  4KOU A;  4MI4 A;  4U5Y A;  4CAW A;  1PUA A;  1YVK A;  2OH1 A;  3IU1 A;  4KOY A;  2ARH A;  1MK4 A;  4KVO E;  2ZW6 A;  3TOB A;  4CYP A;  2QIR A;  2F5I A;  4B13 A;  1YK3 A;  3DR6 A;  3D8P A;  4UFV A;  2D4P A;  4MY3 A;  2OZH A;  1YX0 A;  2VEZ A;  4ZGY B;  3FIX A;  1Z9U A;  3K9U A;  3TO9 A;  3EY5 A;  2QEC A;  4U9Y A;  4C2X A;  1XIX A;  2BL1 A;  3G3S A;  2YGW A;  1OZP A;  1M1D A;  1KUX A;  4KVX A;  1M4G A;  2B3U A;  1U6M A;  4I49 A;  4ORF A;  5IV0 A;  4F0Y A;  4CAX A;  4CRZ B;  2HQY A;  4KSA A;  2PDO A;  2G0B A;  1MJB A;  4JXQ A;  1NE9 A;  2WSA A;  4JJX A;  4KLW A;  3T9Y A;  2CNT A;  3VWE A;  4A33 A;  1L0C A;  4NXY A;  4UCM A;  5F48 A;  5JPH A;  2Q0Y A;  2Z3M A;  3SHP A;  4NEX A;  5KTA A;  1MJ9 A;  4H6Z A;  4CAE A;  5J8C A;  4AVB A;  3W91 A;  4QB9 A;  4F6A A;  1N71 A;  2VI7 A;  4QBJ A;  3H5Z A;  1BOB A;  4XPK A;  2G3T A;  5KTD A;  2X7B A;  1QST A;  3PZJ A;  2PC1 A;  2YNC C;  4MHD A;  4B14 A;  1I21 A;  4OLL A;  1K4J A;  4YRH A;  3SXO A;  4CGL A;  4Q38 A;  4XPD B;  3ZJ0 A;  2FSR A;  2YND A;  3QAH A;  2GAN A;  4MBU A;  2OZU A;  1KUY A;  4MFJ A;  2PR1 A;  4R9M A;  4UBR A;  5CNP A;  4UFW A;  4UWJ A;  4AG9 A;  2Z3O A;  1CJW A;  3IGR A;  2C27 A;  1IID A;  4UCN A;  1FY7 A;  1Z4R A;  2Z3K A;  4JLY A;  4KOX A;  3W6X A;  2R1I A;  4CAF A;  4MJ8 A;  4ZBG A;  2CXA A;  4H89 A;  1Y9W A;  2Z10 A;  4HNX B;  4R3L A;  3R95 A;  2AE6 A;  2EUI A;  2OZG A;  3S6G A;  1SQH A;  3N7Z A;  2EVN A;  4QUS A;  3F0A A;  1IYK A;  1B87 A;  4UA3 A;  4A2Z A;  4C7I A;  1QSO A;  2VBQ A;  1RO5 A;  4C7H A;  4RS2 A;  3D2M A;  3RYO A;  3FBU A;  5H84 A;  5G22 A;  2I79 A;  2YNC A;  5HMN A;  1VKC A;  1ON0 A;  1YVO A;  2R8V A;  4MFQ A;  3S6K A;  3CXS A;  1S5K A;  1RXT A;  4XNH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...