4JLYA

Dodecameric structure of spermidine n-acetyltransferase from vibrio cholerae
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
172
structure length
172
Chain Sequence
NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Spermidine n1-acetyltransferase
publication title Substrate-Induced Allosteric Change in the Quaternary Structure of the Spermidine N-Acetyltransferase SpeG.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar eltor
total genus 49
structure length 172
sequence length 172
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2013-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4jlyA00
2DXQA 4L8AA 3ZZIA 2QIRA 4KOVA 4Y49C 3OWCA 4AVBA 3V8IA 1Y9KA 1VHSA 2H5MA 2NMTA 1LRZA 4OLLA 4U9YA 1MK4A 4AB7A 3WR7A 4NF1A 1QSTA 2KCWA 2F5IA 2J8RA 2VZZA 5KTAA 3CXPA 4PK3A 4JLYA 2C27A 2JDCA 3F0AA 4F0YA 1PU9A 3R9FA 3VWEA 3SHPA 1S60A 1I21A 1I12A 1TIQA 3EXNA 2PSWA 4ONUA 2Z0ZA 4PSXA 5DWMA 5IV0A 4IUSA 4CS0B 4KOXA 1NSLA 4XNHC 4KLWA 2VBQA 1MJ9A 3D3SA 4JXQA 3FNCA 3D2MA 2G3AA 2FL4A 5H84A 2R1IA 3QB8A 2FT0A 3FBUA 4KUBA 5I0CA 2EVNA 2CNSA 4KLVA 1S5KA 1K4JA 4E0AA 4NSQA 4FD7A 1V0CA 1YGHA 1S7NA 4FD6A 2B58A 2HV2A 3S6FA 1YLEA 1IYKA 4KVXA 5E96A 1FY7A 3VWDA 3JVNA 4ZBGA 1N71A 4I49A 1M4DA 5F47A 2HQYA 3R95A 2Q4YA 1NMTA 3D2PA 1NE9A 3QAHA 2CY2A 3T9YA 4RI1A 1KUXA 4BMHA 3E0KA 1B6BA 1KZFA 3GKRA 2VQYA 1Y9WA 2B3UA 3EO4A 3EY5A 2AJ6A 4H6UA 1Y7RA 2AE6A 1YX0A 4CAVA 1S3ZA 3H4QA 2OU2A 4DNCA 5J8FA 2K5TA 4MHDA 5C88A 4II9A 1XIXA 1GHEA 2P6EA 4KOUA 4MY3A 3FRMA 4XNHB 4E2AA 4KOYA 1S7FA 2FIAA 1M44A 2JDDA 5IX3A 1M4IA 1OZPA 2P6GA 3W6SA 1YVKA 3R9EA 2G0BA 2VEZA 3R96A 3TTHA 4JJXA 4QVTA 4FD4A 4YFJA 3TOBA 1ON0A 3SXOA 2PR8A 5J8CA 2HUZA 4MBUA 4MJ8A 1RXTA 5HH1A 1XE4A 3BJ7A 5EC4A 3EC4A 4RS2A 2FE7A 2WPXA 2Q0YA 5ISVA 4XPKA 1BOBA 4LUAA 4U5YA 4KOSA 1S7KA 4KORA 2P6FA 3C26A 3BJ8A 3BLNA 2FIWA 2QMLA 4M85A 3TO6A 1J4JA 2REFA 4U9ZA 4HNWB 4AVCA 4NEXA 2EUIA 4M3SA 4KVME 3TO7A 2R8VA 1B87A 4AG7A 3TT2A 1IB1E 1SQHA 3W6XA 4H6ZA 4KUAA 2I79A 4K30A 4KOTA 1CJWA 2CNMA 1XF8A 4FD5A 3ZJ0A 4QC6A 2ZW6A 1QSOA 4E8OA 3DDDA 4NCZA 3S6GA 4CRZB 4KZTA 1Z9UA 5DWNA 4CRYB 2D4PA 3K9UA 1U6MA 3NE7A 2PRBA 4L89A 3MGDA 5F46A 4XPDB 2OB0A 3SXNA 4QBJA 2R7HA 1QSMA 2I00A 2REEA 3DR6A 2Z11A 4Y49B 2GE3A 2BL1A 5CNPA 5HMNA 1YVOA 2VZYA 1YREA 2Q44A 4GS4A 1IICA 3TE4A 3FB3A 4CAWA 3F8KA 2O28A 2CNTA 3FYNA 5JPHA 4EVYA 4B5OA 4XPLA 2Q04A 4LX9A 2ZW4A 4KVOE 3PP9A 4YRHA 4B5PA 4HKFA 5H86A 4F6AA 4QUSA 4JD6A 1IYLA 4UWIA 4KOWA 1MJAA 4R87A 3DR8A 3R9GA 3DSBA 3P2FA 4PK2A 5F48A 2ZPAA 5JQ4A 1Z4RA 2J8NA 2B4BA 3FXTA 3GY9A 1MJBA 2PDOA 2PQ8A 4QB9A 2JEVA 1Q2CA 5GCNA 2FS5A 3LD2A 3D8PA 2B3VA 3EFAA 2B5GB 1Q2YA 1BO4A 1I1DA 2OH1A 2GIVA 3IGRA 4MY0A 2FSRA 1S7LA 2P0WA 2J8MA 3W91A 1L0CA 4UWJA 2BEIA 1RO5A 3S6HA 2ZW5A 1UFHA 2ZW7A 2B4DB 4B5PB 2BSWA 2D4OA 4R3LA 4R3KA 4X5KA 1IIDA 2QECA 4HNXB 3P2HA 4YGOA 2GANA 4OADA 3PZJA 4MI4A 4UA3A 3CXQA 5F49A 1XEBA 3R1KA 3LODA 3RYOA 2PC1A 2FCKA 1PUAA 4HNYB 5IB0A 1QSNA 2VI7A 1VKCA 3I3GA 2OZUA 3TO9A 2Q7BA 4AVAA 3IWGA 5KTCA 3GYAA 2A4NA 4JXRA 2BUEA 2ZXVA 3F5BA 2OZGA 3PGPA 4OAEA 4R57A 5FVJA 1P0HA 1M1DA 2Q4VA 2IL4A 3TOAA 4H89A 1YK3A 1P4NA 3CXSA 1YR0A 2Y0MA 2G3TA 2B5GA 3G8WA 4NXYA 3S6KA 1QSRA 1KUYA 2OZHA 3I9SA 4PSWA 3UY5A 2VXKA 1CM0A 1R57A 3DNSA 2R98A 1KUVA 5EBVA 3TCVA 5KTDA 2Z10A 1WWZA 3TFYA 2B4DA 1Z4EA 2RC4A 2ATRA 2X7BA 4R9MA 4IF5A 4CAXA 4ORFA 3KKWA 3N7ZA 2PR1A 2WPWA 1M4GA 3T90A 5C82A 3G3SA 2FXFA 1WK4A 1Q2DA 1XMTA 3B8GA 4JWPA 3FIXA 4UBRA 2ARHA 4AG9A 3JUWA 4XPDC 2JLMA 4PV6A 4J3GA
chains in the Genus database with same CATH superfamily
3JTKA 2DXQA 4L8AA 4M6HA 3ZZIA 2QIRA 4KOVA 4Y49C 3B3WA 1TKHA 2PRQA 3OWCA 4AVBA 3V8IA 1Y9KA 4GXHA 1VHSA 2H5MA 2NMTA 1AYEA 1LRZA 4OLLA 4U9YA 1MK4A 4FUUA 5K8OA 4AB7A 4Q36A 3WR7A 5K8MA 4NF1A 1QSTA 2KCWA 3RAMA 2F5IA 4FAIA 2J8RA 2VZZA 5KTAA 3CXPA 2EO8A 1LFWA 4JLYA 4PK3A 2Z3KA 2C27A 2JDCA 2PIYA 2PJ4A 3F0AA 3KL9A 4F0YA 3B3VA 2O4HA 1PU9A 3KGQA 3R9FA 3VWEA 3SHPA 5F09A 1XMBA 1S60A 5AG7A 1GYTA 1I12A 1I21A 1TIQA 3EXNA 2PSWA 1QMUA 4MHZA 2Z0ZA 4ONUA 5EMIA 4A37A 3KQXA 2EK8A 4M6GA 4PSXA 4O23A 5DWMA 4FWUA 5IV0A 4IUSA 4CS0B 4KOXA 2Z3NA 3I1UA 3SJXA 1NSLA 4A39A 1Z8XA 4XNHC 2PVWA 4KLWA 3SJEA 2VBQA 3FJUA 1CPXA 1VHOA 1IGBA 4KSFA 4JYWA 1LAPA 1MJ9A 2GU2A 3D3SA 4JXQA 3FNCA 3D2MA 1Z8TA 3IEHA 2G3AA 1F57A 4A33A 1LCPA 2C1CA 4NGSA 2FL4A 3RNZA 1BAVA 3PBBA 2R1IA 3QB8A 5H84A 4AXVA 2FT0A 3FBUA 4KUBA 4NFRA 4C2XA 5I0CA 4A95A 2EVNA 5AG5A 2CIJA 2ODFA 2CNSA 3CDXA 4G1PA 4BINA 4KLVA 4MCRA 3PB9X 4CGOA 1S5KA 1K4JA 4E0AA 4K3NA 4NSQA 3BHXA 4Q38A 4PXBA 5HVHA 4FD7A 1ZG8A 3K2KA 2YNEA 1V0CA 1YGHA 4UFVA 4IAVA 4ZGYB 4MMOA 4NGTA 1LANA 4R8FA 4A38A 3KR5A 1S7NA 8CPAA 4FD6A 2B58A 2HV2A 4R6TA 2CTBA 3S6FA 1YLEA 1IYKA 4KVXA 5A28A 2YGWA 1HDQA 1Z8WA 3D7FA 3WT4A 4MFLA 4CAEA 5E96A 3H8FA 1FY7A 3IWEA 3FEDA 3VARA 3VWDA 3JVNA 4ZBGA 3NH5A 1N71A 4I49A 4OC1A 2O53A 1BPNA 1M4DA 2PJ8A 2ZEFA 2CTCA 5F47A 2HQYA 2EWBA 5LRGA 4UCPA 3FH4A 3R95A 2DF5A 3L2NA 2Q4YA 1NMTA 3D2PA 3CPAA 4YU9A 1NE9A 1X12A 2AFZA 2Z3MA 2WSAA 1YSJA 2CY2A 3QAHA 4JZ0A 4KSAA 4UEEA 3T9YA 2QVPA 4RI1A 1KUXA 2ZEEA 4BMHA 3T8WA 3E0KA 1B6BA 4DJLA 1KZFA 3GKRA 2VQYA 2XEGA 3PBEA 1IOFA 3PB8X 5HVGA 4MCPA 5LYDA 1XBUA 1LOKA 1Y9WA 3V38A 5LYFA 2B3UA 3S9MA 5AGEA 4A30A 4ZI6A 3EO4A 3EY5A 1FNOA 7CPAA 2AJ6A 2CF4A 2ZOGA 1ARLA 2C6CA 4H6UA 1XOVA 1Y7RA 4EWTA 4Z65A 2AE6A 1LAMA 1YX0A 4OIWA 4CAVA 1S3ZA 3H4QA 2OU2A 3CZXA 4DNCA 3S9LA 5J8FA 1ELLP 3SI0A 2K5TA 4MHDA 3FMCA 5CBMA 5C88A 4II9A 4UF4A 5G21A 1XIXA 4CGMA 1GHEA 5JGFA 4CGNA 2P6EA 1FT7A 4KOUA 4UCMA 2ZEMA 2AFXA 4X8IA 4MY3A 3GIUA 1ARMA 3FRMA 4OC0A 1ZG7A 4XNHB 4E2AA 4KOYA 1S7FA 2FIAA 1M44A 2JDDA 5IX3A 1M4IA 1OZPA 2PJ3A 2P6GA 2PCUA 4OC2A 3W6SA 4MHPA 1YVKA 5LYIA 5DS0A 3WC7A 3PFEA 3R9EA 2G0BA 1A2ZA 3IO1A 4W9YA 2VEZA 3B3TA 3CPXA 1CX8A 5IB9A 3D66A 3R96A 3TTHA 2OOTA 1Z2LA 4JJXA 2PJAA 4QVTA 4FD4A 4YFJA 3TOBA 2YNDA 2PJ7A 1ON0A 2JBJA 4A94A 3SXOA 2F8HA 2PR8A 4OC3A 5J8CA 2HUZA 4MBUA 4MJ8A 4ZY1A 4ZY0A 1RXTA 4YWYA 4CYNA 2PJ5A 5HH1A 1F2PA 4CPAA 1XE4A 3BJ7A 4UIBA 5EC4A 3EC4A 1F2OA 4RS2A 2FE7A 2WPXA 2XEJA 2Q0YA 5ISVA 1Y7EA 4XPKA 3WC6A 1BOBA 4P4FA 4LUAA 4ZX9A 2WZNA 4U5YA 3D67A 3LACA 4PPZA 4KOSA 1XFOA 4PQAA 5LYLA 1S7KA 4KORA 3VH9A 2P6FA 4GM5A 3C26A 3BJ8A 2ZEOA 3BLNA 3NFZA 3SI1A 2FIWA 2QMLA 2PJ1A 4EFDA 1VHEA 1KWMA 2YNCC 4M85A 3RZAA 1J4JA 2REFA 4U9ZA 3D7HA 3TO6A 4HNWB 4HPSA 4AVCA 5JM6A 5D29A 4MFJA 4UEZA 1IY7A 4NEXA 3IC1A 1VIXA 2EUIA 3MRUA 3FX6A 2EK9A 4M3SA 4KVME 1H8LA 3TO7A 4C7IA 4EMEA 2Q51A 3TC8A 2R8VA 4KS9A 1B87A 4AG7A 4UEFA 3TT2A 3JRUA 1IB1E 4LQGA 1Z8LA 2Q7SA 4OIDA 4OC4A 4MFQA 1SQHA 5LRKA 1CG2A 4RUHA 3W6XA 4MXUA 4H6ZA 1Y0YA 4KUAA 2I79A 1CJWA 4K30A 2V77A 2CNMA 1CBXA 1XF8A 4FD5A 4KOTA 4MFKA 4OKOA 3SJGA 3ZJ0A 2IJZA 1Y0RA 4NGNA 1XRYA 3CT9A 4QC6A 4MHYA 2ZW6A 2BCOA 1QSOA 4ONWA 4NGRA 4E8OA 1R3NA 3PB4X 3DDDA 4NCZA 3S6GA 2WUUA 4CRZB 3A9LA 1XJOA 1Z9UA 4KZTA 3PB7X 4NGMA 4ZYQA 1BLLE 4ZY2A 5DWNA 4CRYB 2POKA 3D68A 2D4PA 3K9UA 1IU8A 1YW6A 1U6MA 3NE7A 2PRBA 4L89A 2PJ0A 3MGDA 5F46A 2V8DA 3FF3A 4XPDB 1UWYA 1TKFA 2PJ9A 2OB0A 3SXNA 4QBJA 2ABZA 2R7HA 2ZEDA 1QSMA 2I00A 2REEA 2PJBA 3DR6A 3H5ZA 2Z11A 1DE4C 4Y49B 1TKJA 2GE3A 2BL1A 3B35A 3NH4A 4P4EA 1YMEA 5CNPA 5HMNA 1YVOA 2VZYA 1YREA 2Q44A 4GS4A 4NGPA 4B6ZA 4CYOA 1OBRA 2PVVA 3N5FA 1IICA 3TE4A 3FB3A 1ZLIA 2RFHA 3NA6A 2GLFA 1HEEA 3H8EA 1QQ9A 2J9AA 3IU1A 4R7MA 3F8KA 4A31A 4CAWA 4F9VA 2O28A 2CNTA 3FYNA 5JPHA 5K8NA 1AUGA 3PEIA 4EVYA 3B3SA 3IIBA 3PFOA 4B5OA 2FVGA 4XPLA 3S9NA 4OC5A 2Q04A 4RN7A 4LX9A 2ZW4A 5K8PA 6CPAA 4KVOE 4UFXA 3NH8A 3PP9A 1VGYA 4IK2A 1R43A 4YRHA 4B5PA 1AMPA 3H8GA 2ZEHA 2GREA 1CP6A 4HKFA 5H86A 4F6AA 4UFWA 4NJQA 5ELYA 4B13A 4QUSA 3TX8A 4JD6A 4NJRA 1IYLA 2Z3LA 2PJ2A 4WJBA 4UWIA 2IMOA 4KOWA 4Q7AA 1MJAA 4R87A 2AFWA 3DR8A 3DSBA 3R9GA 3P2FA 4PK2A 5F48A 3K9TA 2ZPAA 5JQ4A 1Z4RA 3PB6X 5D8NA 3BI0A 2BOAA 2J8NA 3B7IA 2B4BA 1RTQA 3RO0A 1ZLHA 1ELMP 2ANPA 4FBEA 3FXTA 2GFQA 2V8HA 3ISXA 2XEFA 2NSMA 4MCSA 1TF9A 4A32A 4F0XA 4F9UA 3KHXA 1Q7LA 3GY9A 3BI1A 1MJBA 2PDOA 2ZEGA 3BXMA 2PQ8A 4QB9A 5G1ZA 5A27A 2JEVA 2F7VA 4TWEA 1Q2CA 4DUKA 5GCNA 2EBJA 2FS5A 3LD2A 3D8PA 3KR4A 2B3VA 3WC5A 2QYVA 3DGVA 3EFAA 2B5GB 4B11A 2Z3OA 3KASA 4X3RA 1Q2YA 2V8VA 1BO4A 4H2KA 1I1DA 3VATA 2OH1A 4CAFA 2GIVA 3IGRA 4MY0A 1X10A 1S7LA 2P0WA 2FSRA 2J8MA 2DPTA 2VL1A 3D7DA 1L0CA 2C6GA 3IU2A 4UWJA 4P10A 2ZEPA 2AFSA 3KQZA 2BEIA 1ZG9A 2JBKA 3MN8A 4CYPA 3GUXA 1RO5A 2Q43A 2ZW5A 4OMEA 3S6HA 3IJ3A 3KZWA 2OR4A 1UFHA 2ZW7A 2B4DB 2DEAA 2ZENA 2BSWA 2ZOFA 3QAYA 4B5PB 2D4OA 4C68A 2CXAA 1YW4A 4R3LA 4TNUA 4R3KA 4X5KA 1IIDA 5HXDA 2QECA 1CP7A 3D4UA 4UIAA 4HNXB 3P2HA 4YGOA 2GANA 4OADA 3V7ZA 1ZO0A 3PZJA 4MI4A 4UA3A 3CXQA 2QJ8A 5F49A 1XEBA 3R1KA 1Z5RA 3LODA 3RYOA 1DTDA 2PC1A 4X2TA 2AFOA 4B14A 1NSAA 4B10A 5G22A 2FCKA 1PUAA 2PJ6A 5J1QA 4HNYB 4IHMA 5IB0A 1EE3P 1QSNA 2VI7A 4CGPA 1VKCA 2NYQA 3I3GA 4C2YA 2Q4ZA 2OZUA 5AG6A 2YNCA 3GB0A 3LWUA 2Q7BA 3TO9A 2V8GA 3HLPA 4AVAA 3IWGA 5I4MA 2I3CA 5KTCA 3GYAA 2A4NA 3RBUA 3FEEA 4B12A 2XEIA 4CYQA 4JXRA 3DLJA 2BUEA 2ZXVA 3F5BA 4M6IA 4MRIA 2OZGA 5JH9A 2BO9A 2HB6A 3D7GA 3PGPA 4KSIA 3FVLA 4OAEA 5HVFA 3LMSA 2HC9A 4P4BA 4P44A 3GLJA 4R57A 5THWA 1BPMA 2PIZA 4P6YA 5FVJA 5LRJA 1P0HA 5AG4A 1M1DA 2Q4VA 3FECA 2IL4A 3TOAA 4H89A 4P45A 1YK3A 1P4NA 1PCAA 3CXSA 2AFUA 1JQGA 3KHZA 2DPSA 3B2YA 1YR0A 2Y0MA 5BWAB 1TXRA 2G3TA 2B5GA 3G8WA 4NXYA 3HUVA 4PXCA 4PXEA 3S6KA 4UCNA 1QSRA 1KUYA 1YQEA 2OZHA 2ZELA 3I9SA 4PSWA 4BBHA 4OP4A 3UY5A 2VXKA 4P4IA 1CM0A 5G20A 1R57A 2C6PA 4MCQA 3DNSA 2WYRA 4F8ZA 2R98A 3KI9A 1KUVA 4NGQA 5EBVA 3TCVA 2Z10A 1WWZA 4C2ZA 5KTDA 3QNVA 4MHNA 1PYTB 4DYOA 3TFYA 2B4DA 1Z4EA 4P4JA 3SJFA 2RC4A 2G9DA 2ATRA 1M4LA 1YLOA 2X7BA 2Z3PA 4MFPA 4R9MA 4IF5A 3NE8A 4BD9A 4CAXA 4ORFA 3W91A 3IWWA 3KKWA 4WWVA 4CGLA 3SI2A 3N7ZA 2PE3A 2AFMA 1TF8A 1M4GA 2PR1A 2WPWA 3T90A 4A2ZA 1JWQA 5C82A 1CPSA 3B3CA 3PRTA 3WABA 2JEWA 3G3SA 2FXFA 4R76A 1WK4A 1Q2DA 2PJCA 1XMTA 3B8GA 1IOIA 2RB7A 4JWPA 5CPAA 3FIXA 4UBRA 2GLJA 2ARHA 4ZX8A 4PXDA 4P4DA 2IQ6A 4LQ6A 4AG9A 3JUWA 1HDUA 3ISZA 2JLMA 4PV6A 4XPDC 4C7HA 3IFEA 4J3GA 4MFZA
chains in the Genus database with same CATH topology
3JTKA 2DXQA 4L8AA 3ZZIA 2QIRA 4KOVA 4Y49C 3OWCA 4AVBA 3V8IA 1Y9KA 1VHSA 2H5MA 2NMTA 1LRZA 4OLLA 4U9YA 1MK4A 4AB7A 4Q36A 3WR7A 4NF1A 1QSTA 2KCWA 2F5IA 2J8RA 2VZZA 5KTAA 3CXPA 4PK3A 4JLYA 2Z3KA 2C27A 2JDCA 3F0AA 4F0YA 1PU9A 3R9FA 3VWEA 3SHPA 5AG7A 1S60A 1I21A 1I12A 1TIQA 3EXNA 2PSWA 4ONUA 2Z0ZA 4PSXA 5DWMA 5IV0A 4IUSA 4CS0B 4KOXA 2Z3NA 1NSLA 4XNHC 4KLWA 2VBQA 4KSFA 1MJ9A 3D3SA 4JXQA 3FNCA 3D2MA 2G3AA 4A33A 2FL4A 5H84A 2R1IA 3QB8A 2FT0A 3FBUA 4KUBA 4C2XA 5I0CA 4A95A 2EVNA 5AG5A 2CNSA 4KLVA 4CGOA 1S5KA 1K4JA 4E0AA 4NSQA 4Q38A 4FD7A 2YNEA 1V0CA 1YGHA 4UFVA 4ZGYB 1S7NA 4FD6A 2B58A 2HV2A 3S6FA 1YLEA 1IYKA 4KVXA 5A28A 2YGWA 4MFLA 4CAEA 5E96A 1FY7A 3IWEA 3VWDA 3JVNA 4ZBGA 1N71A 4I49A 1M4DA 5F47A 2HQYA 4UCPA 3R95A 2Q4YA 1NMTA 3D2PA 1NE9A 2Z3MA 2WSAA 2CY2A 3QAHA 4KSAA 3T9YA 4RI1A 1KUXA 4BMHA 3E0KA 1B6BA 1KZFA 3GKRA 2VQYA 1Y9WA 2B3UA 5AGEA 4A30A 3EO4A 3EY5A 2AJ6A 4H6UA 1Y7RA 2AE6A 1YX0A 4CAVA 1S3ZA 3H4QA 2OU2A 4DNCA 5J8FA 2K5TA 4MHDA 5C88A 4II9A 5G21A 1XIXA 4CGMA 1GHEA 4CGNA 2P6EA 4KOUA 4UCMA 4MY3A 3FRMA 4XNHB 4E2AA 4KOYA 1S7FA 2FIAA 1M44A 2JDDA 5IX3A 1M4IA 1OZPA 2P6GA 3W6SA 1YVKA 3R9EA 2G0BA 2VEZA 3R96A 3TTHA 4JJXA 4QVTA 4FD4A 4YFJA 3TOBA 2YNDA 1ON0A 3SXOA 2PR8A 5J8CA 2HUZA 4MBUA 4MJ8A 1RXTA 4CYNA 5HH1A 1XE4A 3BJ7A 5EC4A 3EC4A 4RS2A 2FE7A 2WPXA 2Q0YA 5ISVA 4XPKA 1BOBA 4LUAA 4U5YA 4KOSA 1S7KA 4KORA 2P6FA 3C26A 3BJ8A 3BLNA 2FIWA 2QMLA 4M85A 2YNCC 3TO6A 1J4JA 2REFA 4U9ZA 4HNWB 4AVCA 4MFJA 4NEXA 2EUIA 4M3SA 4KVME 3TO7A 4C7IA 2R8VA 4KS9A 1B87A 4AG7A 3TT2A 1IB1E 4MFQA 1SQHA 3W6XA 4H6ZA 4KUAA 2I79A 1CJWA 4K30A 4KOTA 2CNMA 1XF8A 4MFKA 4FD5A 3ZJ0A 4QC6A 2ZW6A 1QSOA 4E8OA 3DDDA 4NCZA 3S6GA 2WUUA 4CRZB 3A9LA 4KZTA 1Z9UA 5DWNA 4CRYB 2D4PA 3K9UA 1U6MA 3NE7A 2PRBA 4L89A 3MGDA 5F46A 4XPDB 2OB0A 3SXNA 4QBJA 2R7HA 1QSMA 2I00A 2REEA 3DR6A 3H5ZA 2Z11A 4Y49B 2GE3A 2BL1A 5CNPA 5HMNA 1YVOA 2VZYA 1YREA 2Q44A 4GS4A 4CYOA 1IICA 3TE4A 3FB3A 3IU1A 4CAWA 4A31A 3F8KA 2O28A 2CNTA 3FYNA 5JPHA 4EVYA 4B5OA 4XPLA 2Q04A 4LX9A 2ZW4A 4KVOE 4UFXA 3PP9A 4YRHA 4B5PA 4HKFA 5H86A 4F6AA 4UFWA 4B13A 4QUSA 4JD6A 1IYLA 2Z3LA 4UWIA 4KOWA 1MJAA 4R87A 3DR8A 3R9GA 3DSBA 3P2FA 4PK2A 5F48A 2ZPAA 5JQ4A 1Z4RA 2J8NA 2B4BA 3FXTA 4F0XA 4A32A 3GY9A 1MJBA 2PDOA 2PQ8A 4QB9A 5G1ZA 5A27A 2JEVA 1Q2CA 5GCNA 2FS5A 3LD2A 3D8PA 2B3VA 3EFAA 2B5GB 4B11A 2Z3OA 1Q2YA 1BO4A 1I1DA 2OH1A 4CAFA 2GIVA 3IGRA 4MY0A 2FSRA 1S7LA 2P0WA 2J8MA 2DPTA 3W91A 1L0CA 3IU2A 4UWJA 2BEIA 4CYPA 1RO5A 3S6HA 2ZW5A 1UFHA 2ZW7A 2B4DB 4B5PB 2BSWA 2D4OA 4C68A 2CXAA 4R3LA 4R3KA 4X5KA 1IIDA 2QECA 4HNXB 3P2HA 4YGOA 2GANA 4OADA 1ZO0A 3PZJA 4MI4A 4UA3A 3CXQA 5F49A 1XEBA 3R1KA 3LODA 3RYOA 2PC1A 4B14A 4B10A 5G22A 2FCKA 1PUAA 4HNYB 5IB0A 1QSNA 4CGPA 2VI7A 1VKCA 3I3GA 4C2YA 2OZUA 5AG6A 2YNCA 3TO9A 2Q7BA 4AVAA 3IWGA 5KTCA 3GYAA 2A4NA 4B12A 4CYQA 4JXRA 2BUEA 2ZXVA 3F5BA 2OZGA 3PGPA 4OAEA 4R57A 5FVJA 1P0HA 5AG4A 1M1DA 2Q4VA 2IL4A 3TOAA 4H89A 1YK3A 1P4NA 3CXSA 2DPSA 5BWAB 1YR0A 2Y0MA 2G3TA 2B5GA 3G8WA 4NXYA 3S6KA 4UCNA 1QSRA 1KUYA 2OZHA 3I9SA 4PSWA 4BBHA 3UY5A 2VXKA 1CM0A 5G20A 1R57A 3DNSA 2R98A 1KUVA 5EBVA 3TCVA 5KTDA 2Z10A 1WWZA 4C2ZA 3TFYA 2B4DA 1Z4EA 2RC4A 2ATRA 2X7BA 2Z3PA 4MFPA 4R9MA 4IF5A 4CAXA 4ORFA 3KKWA 4CGLA 3N7ZA 2PR1A 2WPWA 1M4GA 3T90A 4A2ZA 5C82A 3G3SA 2FXFA 1WK4A 1Q2DA 1XMTA 3B8GA 4JWPA 3FIXA 4UBRA 2ARHA 4AG9A 3JUWA 4XPDC 2JLMA 4PV6A 4C7HA 4J3GA 4MFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXQ A;  4L8A A;  3ZZI A;  2QIR A;  4KOV A;  4Y49 C;  3OWC A;  4AVB A;  3V8I A;  1Y9K A;  1VHS A;  2H5M A;  2NMT A;  1LRZ A;  4OLL A;  4U9Y A;  1MK4 A;  4AB7 A;  3WR7 A;  4NF1 A;  1QST A;  2KCW A;  2F5I A;  2J8R A;  2VZZ A;  5KTA A;  3CXP A;  4PK3 A;  4JLY A;  2C27 A;  2JDC A;  3F0A A;  4F0Y A;  1PU9 A;  3R9F A;  3VWE A;  3SHP A;  1S60 A;  1I21 A;  1I12 A;  1TIQ A;  3EXN A;  2PSW A;  4ONU A;  2Z0Z A;  4PSX A;  5DWM A;  5IV0 A;  4IUS A;  4CS0 B;  4KOX A;  1NSL A;  4XNH C;  4KLW A;  2VBQ A;  1MJ9 A;  3D3S A;  4JXQ A;  3FNC A;  3D2M A;  2G3A A;  2FL4 A;  5H84 A;  2R1I A;  3QB8 A;  2FT0 A;  3FBU A;  4KUB A;  5I0C A;  2EVN A;  2CNS A;  4KLV A;  1S5K A;  1K4J A;  4E0A A;  4NSQ A;  4FD7 A;  1V0C A;  1YGH A;  1S7N A;  4FD6 A;  2B58 A;  2HV2 A;  3S6F A;  1YLE A;  1IYK A;  4KVX A;  5E96 A;  1FY7 A;  3VWD A;  3JVN A;  4ZBG A;  1N71 A;  4I49 A;  1M4D A;  5F47 A;  2HQY A;  3R95 A;  2Q4Y A;  1NMT A;  3D2P A;  1NE9 A;  3QAH A;  2CY2 A;  3T9Y A;  4RI1 A;  1KUX A;  4BMH A;  3E0K A;  1B6B A;  1KZF A;  3GKR A;  2VQY A;  1Y9W A;  2B3U A;  3EO4 A;  3EY5 A;  2AJ6 A;  4H6U A;  1Y7R A;  2AE6 A;  1YX0 A;  4CAV A;  1S3Z A;  3H4Q A;  2OU2 A;  4DNC A;  5J8F A;  2K5T A;  4MHD A;  5C88 A;  4II9 A;  1XIX A;  1GHE A;  2P6E A;  4KOU A;  4MY3 A;  3FRM A;  4XNH B;  4E2A A;  4KOY A;  1S7F A;  2FIA A;  1M44 A;  2JDD A;  5IX3 A;  1M4I A;  1OZP A;  2P6G A;  3W6S A;  1YVK A;  3R9E A;  2G0B A;  2VEZ A;  3R96 A;  3TTH A;  4JJX A;  4QVT A;  4FD4 A;  4YFJ A;  3TOB A;  1ON0 A;  3SXO A;  2PR8 A;  5J8C A;  2HUZ A;  4MBU A;  4MJ8 A;  1RXT A;  5HH1 A;  1XE4 A;  3BJ7 A;  5EC4 A;  3EC4 A;  4RS2 A;  2FE7 A;  2WPX A;  2Q0Y A;  5ISV A;  4XPK A;  1BOB A;  4LUA A;  4U5Y A;  4KOS A;  1S7K A;  4KOR A;  2P6F A;  3C26 A;  3BJ8 A;  3BLN A;  2FIW A;  2QML A;  4M85 A;  3TO6 A;  1J4J A;  2REF A;  4U9Z A;  4HNW B;  4AVC A;  4NEX A;  2EUI A;  4M3S A;  4KVM E;  3TO7 A;  2R8V A;  1B87 A;  4AG7 A;  3TT2 A;  1IB1 E;  1SQH A;  3W6X A;  4H6Z A;  4KUA A;  2I79 A;  4K30 A;  4KOT A;  1CJW A;  2CNM A;  1XF8 A;  4FD5 A;  3ZJ0 A;  4QC6 A;  2ZW6 A;  1QSO A;  4E8O A;  3DDD A;  4NCZ A;  3S6G A;  4CRZ B;  4KZT A;  1Z9U A;  5DWN A;  4CRY B;  2D4P A;  3K9U A;  1U6M A;  3NE7 A;  2PRB A;  4L89 A;  3MGD A;  5F46 A;  4XPD B;  2OB0 A;  3SXN A;  4QBJ A;  2R7H A;  1QSM A;  2I00 A;  2REE A;  3DR6 A;  2Z11 A;  4Y49 B;  2GE3 A;  2BL1 A;  5CNP A;  5HMN A;  1YVO A;  2VZY A;  1YRE A;  2Q44 A;  4GS4 A;  1IIC A;  3TE4 A;  3FB3 A;  4CAW A;  3F8K A;  2O28 A;  2CNT A;  3FYN A;  5JPH A;  4EVY A;  4B5O A;  4XPL A;  2Q04 A;  4LX9 A;  2ZW4 A;  4KVO E;  3PP9 A;  4YRH A;  4B5P A;  4HKF A;  5H86 A;  4F6A A;  4QUS A;  4JD6 A;  1IYL A;  4UWI A;  4KOW A;  1MJA A;  4R87 A;  3DR8 A;  3R9G A;  3DSB A;  3P2F A;  4PK2 A;  5F48 A;  2ZPA A;  5JQ4 A;  1Z4R A;  2J8N A;  2B4B A;  3FXT A;  3GY9 A;  1MJB A;  2PDO A;  2PQ8 A;  4QB9 A;  2JEV A;  1Q2C A;  5GCN A;  2FS5 A;  3LD2 A;  3D8P A;  2B3V A;  3EFA A;  2B5G B;  1Q2Y A;  1BO4 A;  1I1D A;  2OH1 A;  2GIV A;  3IGR A;  4MY0 A;  2FSR A;  1S7L A;  2P0W A;  2J8M A;  3W91 A;  1L0C A;  4UWJ A;  2BEI A;  1RO5 A;  3S6H A;  2ZW5 A;  1UFH A;  2ZW7 A;  2B4D B;  4B5P B;  2BSW A;  2D4O A;  4R3L A;  4R3K A;  4X5K A;  1IID A;  2QEC A;  4HNX B;  3P2H A;  4YGO A;  2GAN A;  4OAD A;  3PZJ A;  4MI4 A;  4UA3 A;  3CXQ A;  5F49 A;  1XEB A;  3R1K A;  3LOD A;  3RYO A;  2PC1 A;  2FCK A;  1PUA A;  4HNY B;  5IB0 A;  1QSN A;  2VI7 A;  1VKC A;  3I3G A;  2OZU A;  3TO9 A;  2Q7B A;  4AVA A;  3IWG A;  5KTC A;  3GYA A;  2A4N A;  4JXR A;  2BUE A;  2ZXV A;  3F5B A;  2OZG A;  3PGP A;  4OAE A;  4R57 A;  5FVJ A;  1P0H A;  1M1D A;  2Q4V A;  2IL4 A;  3TOA A;  4H89 A;  1YK3 A;  1P4N A;  3CXS A;  1YR0 A;  2Y0M A;  2G3T A;  2B5G A;  3G8W A;  4NXY A;  3S6K A;  1QSR A;  1KUY A;  2OZH A;  3I9S A;  4PSW A;  3UY5 A;  2VXK A;  1CM0 A;  1R57 A;  3DNS A;  2R98 A;  1KUV A;  5EBV A;  3TCV A;  5KTD A;  2Z10 A;  1WWZ A;  3TFY A;  2B4D A;  1Z4E A;  2RC4 A;  2ATR A;  2X7B A;  4R9M A;  4IF5 A;  4CAX A;  4ORF A;  3KKW A;  3N7Z A;  2PR1 A;  2WPW A;  1M4G A;  3T90 A;  5C82 A;  3G3S A;  2FXF A;  1WK4 A;  1Q2D A;  1XMT A;  3B8G A;  4JWP A;  3FIX A;  4UBR A;  2ARH A;  4AG9 A;  3JUW A;  4XPD C;  2JLM A;  4PV6 A;  4J3G A; 
#chains in the Genus database with same CATH topology
 3JTK A;  2DXQ A;  4L8A A;  4M6H A;  3ZZI A;  2QIR A;  4KOV A;  4Y49 C;  3B3W A;  1TKH A;  2PRQ A;  3OWC A;  4AVB A;  3V8I A;  1Y9K A;  4GXH A;  1VHS A;  2H5M A;  2NMT A;  1AYE A;  1LRZ A;  4OLL A;  4U9Y A;  1MK4 A;  4FUU A;  5K8O A;  4AB7 A;  4Q36 A;  3WR7 A;  5K8M A;  4NF1 A;  1QST A;  2KCW A;  3RAM A;  2F5I A;  4FAI A;  2J8R A;  2VZZ A;  5KTA A;  3CXP A;  2EO8 A;  1LFW A;  4JLY A;  4PK3 A;  2Z3K A;  2C27 A;  2JDC A;  2PIY A;  2PJ4 A;  3F0A A;  3KL9 A;  4F0Y A;  3B3V A;  2O4H A;  1PU9 A;  3KGQ A;  3R9F A;  3VWE A;  3SHP A;  5F09 A;  1XMB A;  1S60 A;  5AG7 A;  1GYT A;  1I12 A;  1I21 A;  1TIQ A;  3EXN A;  2PSW A;  1QMU A;  4MHZ A;  2Z0Z A;  4ONU A;  5EMI A;  4A37 A;  3KQX A;  2EK8 A;  4M6G A;  4PSX A;  4O23 A;  5DWM A;  4FWU A;  5IV0 A;  4IUS A;  4CS0 B;  4KOX A;  2Z3N A;  3I1U A;  3SJX A;  1NSL A;  4A39 A;  1Z8X A;  4XNH C;  2PVW A;  4KLW A;  3SJE A;  2VBQ A;  3FJU A;  1CPX A;  1VHO A;  1IGB A;  4KSF A;  4JYW A;  1LAP A;  1MJ9 A;  2GU2 A;  3D3S A;  4JXQ A;  3FNC A;  3D2M A;  1Z8T A;  3IEH A;  2G3A A;  1F57 A;  4A33 A;  1LCP A;  2C1C A;  4NGS A;  2FL4 A;  3RNZ A;  1BAV A;  3PBB A;  2R1I A;  3QB8 A;  5H84 A;  4AXV A;  2FT0 A;  3FBU A;  4KUB A;  4NFR A;  4C2X A;  5I0C A;  4A95 A;  2EVN A;  5AG5 A;  2CIJ A;  2ODF A;  2CNS A;  3CDX A;  4G1P A;  4BIN A;  4KLV A;  4MCR A;  3PB9 X;  4CGO A;  1S5K A;  1K4J A;  4E0A A;  4K3N A;  4NSQ A;  3BHX A;  4Q38 A;  4PXB A;  5HVH A;  4FD7 A;  1ZG8 A;  3K2K A;  2YNE A;  1V0C A;  1YGH A;  4UFV A;  4IAV A;  4ZGY B;  4MMO A;  4NGT A;  1LAN A;  4R8F A;  4A38 A;  3KR5 A;  1S7N A;  8CPA A;  4FD6 A;  2B58 A;  2HV2 A;  4R6T A;  2CTB A;  3S6F A;  1YLE A;  1IYK A;  4KVX A;  5A28 A;  2YGW A;  1HDQ A;  1Z8W A;  3D7F A;  3WT4 A;  4MFL A;  4CAE A;  5E96 A;  3H8F A;  1FY7 A;  3IWE A;  3FED A;  3VAR A;  3VWD A;  3JVN A;  4ZBG A;  3NH5 A;  1N71 A;  4I49 A;  4OC1 A;  2O53 A;  1BPN A;  1M4D A;  2PJ8 A;  2ZEF A;  2CTC A;  5F47 A;  2HQY A;  2EWB A;  5LRG A;  4UCP A;  3FH4 A;  3R95 A;  2DF5 A;  3L2N A;  2Q4Y A;  1NMT A;  3D2P A;  3CPA A;  4YU9 A;  1NE9 A;  1X12 A;  2AFZ A;  2Z3M A;  2WSA A;  1YSJ A;  2CY2 A;  3QAH A;  4JZ0 A;  4KSA A;  4UEE A;  3T9Y A;  2QVP A;  4RI1 A;  1KUX A;  2ZEE A;  4BMH A;  3T8W A;  3E0K A;  1B6B A;  4DJL A;  1KZF A;  3GKR A;  2VQY A;  2XEG A;  3PBE A;  1IOF A;  3PB8 X;  5HVG A;  4MCP A;  5LYD A;  1XBU A;  1LOK A;  1Y9W A;  3V38 A;  5LYF A;  2B3U A;  3S9M A;  5AGE A;  4A30 A;  4ZI6 A;  3EO4 A;  3EY5 A;  1FNO A;  7CPA A;  2AJ6 A;  2CF4 A;  2ZOG A;  1ARL A;  2C6C A;  4H6U A;  1XOV A;  1Y7R A;  4EWT A;  4Z65 A;  2AE6 A;  1LAM A;  1YX0 A;  4OIW A;  4CAV A;  1S3Z A;  3H4Q A;  2OU2 A;  3CZX A;  4DNC A;  3S9L A;  5J8F A;  1ELL P;  3SI0 A;  2K5T A;  4MHD A;  3FMC A;  5CBM A;  5C88 A;  4II9 A;  4UF4 A;  5G21 A;  1XIX A;  4CGM A;  1GHE A;  5JGF A;  4CGN A;  2P6E A;  1FT7 A;  4KOU A;  4UCM A;  2ZEM A;  2AFX A;  4X8I A;  4MY3 A;  3GIU A;  1ARM A;  3FRM A;  4OC0 A;  1ZG7 A;  4XNH B;  4E2A A;  4KOY A;  1S7F A;  2FIA A;  1M44 A;  2JDD A;  5IX3 A;  1M4I A;  1OZP A;  2PJ3 A;  2P6G A;  2PCU A;  4OC2 A;  3W6S A;  4MHP A;  1YVK A;  5LYI A;  5DS0 A;  3WC7 A;  3PFE A;  3R9E A;  2G0B A;  1A2Z A;  3IO1 A;  4W9Y A;  2VEZ A;  3B3T A;  3CPX A;  1CX8 A;  5IB9 A;  3D66 A;  3R96 A;  3TTH A;  2OOT A;  1Z2L A;  4JJX A;  2PJA A;  4QVT A;  4FD4 A;  4YFJ A;  3TOB A;  2YND A;  2PJ7 A;  1ON0 A;  2JBJ A;  4A94 A;  3SXO A;  2F8H A;  2PR8 A;  4OC3 A;  5J8C A;  2HUZ A;  4MBU A;  4MJ8 A;  4ZY1 A;  4ZY0 A;  1RXT A;  4YWY A;  4CYN A;  2PJ5 A;  5HH1 A;  1F2P A;  4CPA A;  1XE4 A;  3BJ7 A;  4UIB A;  5EC4 A;  3EC4 A;  1F2O A;  4RS2 A;  2FE7 A;  2WPX A;  2XEJ A;  2Q0Y A;  5ISV A;  1Y7E A;  4XPK A;  3WC6 A;  1BOB A;  4P4F A;  4LUA A;  4ZX9 A;  2WZN A;  4U5Y A;  3D67 A;  3LAC A;  4PPZ A;  4KOS A;  1XFO A;  4PQA A;  5LYL A;  1S7K A;  4KOR A;  3VH9 A;  2P6F A;  4GM5 A;  3C26 A;  3BJ8 A;  2ZEO A;  3BLN A;  3NFZ A;  3SI1 A;  2FIW A;  2QML A;  2PJ1 A;  4EFD A;  1VHE A;  1KWM A;  2YNC C;  4M85 A;  3RZA A;  1J4J A;  2REF A;  4U9Z A;  3D7H A;  3TO6 A;  4HNW B;  4HPS A;  4AVC A;  5JM6 A;  5D29 A;  4MFJ A;  4UEZ A;  1IY7 A;  4NEX A;  3IC1 A;  1VIX A;  2EUI A;  3MRU A;  3FX6 A;  2EK9 A;  4M3S A;  4KVM E;  1H8L A;  3TO7 A;  4C7I A;  4EME A;  2Q51 A;  3TC8 A;  2R8V A;  4KS9 A;  1B87 A;  4AG7 A;  4UEF A;  3TT2 A;  3JRU A;  1IB1 E;  4LQG A;  1Z8L A;  2Q7S A;  4OID A;  4OC4 A;  4MFQ A;  1SQH A;  5LRK A;  1CG2 A;  4RUH A;  3W6X A;  4MXU A;  4H6Z A;  1Y0Y A;  4KUA A;  2I79 A;  1CJW A;  4K30 A;  2V77 A;  2CNM A;  1CBX A;  1XF8 A;  4FD5 A;  4KOT A;  4MFK A;  4OKO A;  3SJG A;  3ZJ0 A;  2IJZ A;  1Y0R A;  4NGN A;  1XRY A;  3CT9 A;  4QC6 A;  4MHY A;  2ZW6 A;  2BCO A;  1QSO A;  4ONW A;  4NGR A;  4E8O A;  1R3N A;  3PB4 X;  3DDD A;  4NCZ A;  3S6G A;  2WUU A;  4CRZ B;  3A9L A;  1XJO A;  1Z9U A;  4KZT A;  3PB7 X;  4NGM A;  4ZYQ A;  1BLL E;  4ZY2 A;  5DWN A;  4CRY B;  2POK A;  3D68 A;  2D4P A;  3K9U A;  1IU8 A;  1YW6 A;  1U6M A;  3NE7 A;  2PRB A;  4L89 A;  2PJ0 A;  3MGD A;  5F46 A;  2V8D A;  3FF3 A;  4XPD B;  1UWY A;  1TKF A;  2PJ9 A;  2OB0 A;  3SXN A;  4QBJ A;  2ABZ A;  2R7H A;  2ZED A;  1QSM A;  2I00 A;  2REE A;  2PJB A;  3DR6 A;  3H5Z A;  2Z11 A;  1DE4 C;  4Y49 B;  1TKJ A;  2GE3 A;  2BL1 A;  3B35 A;  3NH4 A;  4P4E A;  1YME A;  5CNP A;  5HMN A;  1YVO A;  2VZY A;  1YRE A;  2Q44 A;  4GS4 A;  4NGP A;  4B6Z A;  4CYO A;  1OBR A;  2PVV A;  3N5F A;  1IIC A;  3TE4 A;  3FB3 A;  1ZLI A;  2RFH A;  3NA6 A;  2GLF A;  1HEE A;  3H8E A;  1QQ9 A;  2J9A A;  3IU1 A;  4R7M A;  3F8K A;  4A31 A;  4CAW A;  4F9V A;  2O28 A;  2CNT A;  3FYN A;  5JPH A;  5K8N A;  1AUG A;  3PEI A;  4EVY A;  3B3S A;  3IIB A;  3PFO A;  4B5O A;  2FVG A;  4XPL A;  3S9N A;  4OC5 A;  2Q04 A;  4RN7 A;  4LX9 A;  2ZW4 A;  5K8P A;  6CPA A;  4KVO E;  4UFX A;  3NH8 A;  3PP9 A;  1VGY A;  4IK2 A;  1R43 A;  4YRH A;  4B5P A;  1AMP A;  3H8G A;  2ZEH A;  2GRE A;  1CP6 A;  4HKF A;  5H86 A;  4F6A A;  4UFW A;  4NJQ A;  5ELY A;  4B13 A;  4QUS A;  3TX8 A;  4JD6 A;  4NJR A;  1IYL A;  2Z3L A;  2PJ2 A;  4WJB A;  4UWI A;  2IMO A;  4KOW A;  4Q7A A;  1MJA A;  4R87 A;  2AFW A;  3DR8 A;  3DSB A;  3R9G A;  3P2F A;  4PK2 A;  5F48 A;  3K9T A;  2ZPA A;  5JQ4 A;  1Z4R A;  3PB6 X;  5D8N A;  3BI0 A;  2BOA A;  2J8N A;  3B7I A;  2B4B A;  1RTQ A;  3RO0 A;  1ZLH A;  1ELM P;  2ANP A;  4FBE A;  3FXT A;  2GFQ A;  2V8H A;  3ISX A;  2XEF A;  2NSM A;  4MCS A;  1TF9 A;  4A32 A;  4F0X A;  4F9U A;  3KHX A;  1Q7L A;  3GY9 A;  3BI1 A;  1MJB A;  2PDO A;  2ZEG A;  3BXM A;  2PQ8 A;  4QB9 A;  5G1Z A;  5A27 A;  2JEV A;  2F7V A;  4TWE A;  1Q2C A;  4DUK A;  5GCN A;  2EBJ A;  2FS5 A;  3LD2 A;  3D8P A;  3KR4 A;  2B3V A;  3WC5 A;  2QYV A;  3DGV A;  3EFA A;  2B5G B;  4B11 A;  2Z3O A;  3KAS A;  4X3R A;  1Q2Y A;  2V8V A;  1BO4 A;  4H2K A;  1I1D A;  3VAT A;  2OH1 A;  4CAF A;  2GIV A;  3IGR A;  4MY0 A;  1X10 A;  1S7L A;  2P0W A;  2FSR A;  2J8M A;  2DPT A;  2VL1 A;  3D7D A;  1L0C A;  2C6G A;  3IU2 A;  4UWJ A;  4P10 A;  2ZEP A;  2AFS A;  3KQZ A;  2BEI A;  1ZG9 A;  2JBK A;  3MN8 A;  4CYP A;  3GUX A;  1RO5 A;  2Q43 A;  2ZW5 A;  4OME A;  3S6H A;  3IJ3 A;  3KZW A;  2OR4 A;  1UFH A;  2ZW7 A;  2B4D B;  2DEA A;  2ZEN A;  2BSW A;  2ZOF A;  3QAY A;  4B5P B;  2D4O A;  4C68 A;  2CXA A;  1YW4 A;  4R3L A;  4TNU A;  4R3K A;  4X5K A;  1IID A;  5HXD A;  2QEC A;  1CP7 A;  3D4U A;  4UIA A;  4HNX B;  3P2H A;  4YGO A;  2GAN A;  4OAD A;  3V7Z A;  1ZO0 A;  3PZJ A;  4MI4 A;  4UA3 A;  3CXQ A;  2QJ8 A;  5F49 A;  1XEB A;  3R1K A;  1Z5R A;  3LOD A;  3RYO A;  1DTD A;  2PC1 A;  4X2T A;  2AFO A;  4B14 A;  1NSA A;  4B10 A;  5G22 A;  2FCK A;  1PUA A;  2PJ6 A;  5J1Q A;  4HNY B;  4IHM A;  5IB0 A;  1EE3 P;  1QSN A;  2VI7 A;  4CGP A;  1VKC A;  2NYQ A;  3I3G A;  4C2Y A;  2Q4Z A;  2OZU A;  5AG6 A;  2YNC A;  3GB0 A;  3LWU A;  2Q7B A;  3TO9 A;  2V8G A;  3HLP A;  4AVA A;  3IWG A;  5I4M A;  2I3C A;  5KTC A;  3GYA A;  2A4N A;  3RBU A;  3FEE A;  4B12 A;  2XEI A;  4CYQ A;  4JXR A;  3DLJ A;  2BUE A;  2ZXV A;  3F5B A;  4M6I A;  4MRI A;  2OZG A;  5JH9 A;  2BO9 A;  2HB6 A;  3D7G A;  3PGP A;  4KSI A;  3FVL A;  4OAE A;  5HVF A;  3LMS A;  2HC9 A;  4P4B A;  4P44 A;  3GLJ A;  4R57 A;  5THW A;  1BPM A;  2PIZ A;  4P6Y A;  5FVJ A;  5LRJ A;  1P0H A;  5AG4 A;  1M1D A;  2Q4V A;  3FEC A;  2IL4 A;  3TOA A;  4H89 A;  4P45 A;  1YK3 A;  1P4N A;  1PCA A;  3CXS A;  2AFU A;  1JQG A;  3KHZ A;  2DPS A;  3B2Y A;  1YR0 A;  2Y0M A;  5BWA B;  1TXR A;  2G3T A;  2B5G A;  3G8W A;  4NXY A;  3HUV A;  4PXC A;  4PXE A;  3S6K A;  4UCN A;  1QSR A;  1KUY A;  1YQE A;  2OZH A;  2ZEL A;  3I9S A;  4PSW A;  4BBH A;  4OP4 A;  3UY5 A;  2VXK A;  4P4I A;  1CM0 A;  5G20 A;  1R57 A;  2C6P A;  4MCQ A;  3DNS A;  2WYR A;  4F8Z A;  2R98 A;  3KI9 A;  1KUV A;  4NGQ A;  5EBV A;  3TCV A;  2Z10 A;  1WWZ A;  4C2Z A;  5KTD A;  3QNV A;  4MHN A;  1PYT B;  4DYO A;  3TFY A;  2B4D A;  1Z4E A;  4P4J A;  3SJF A;  2RC4 A;  2G9D A;  2ATR A;  1M4L A;  1YLO A;  2X7B A;  2Z3P A;  4MFP A;  4R9M A;  4IF5 A;  3NE8 A;  4BD9 A;  4CAX A;  4ORF A;  3W91 A;  3IWW A;  3KKW A;  4WWV A;  4CGL A;  3SI2 A;  3N7Z A;  2PE3 A;  2AFM A;  1TF8 A;  1M4G A;  2PR1 A;  2WPW A;  3T90 A;  4A2Z A;  1JWQ A;  5C82 A;  1CPS A;  3B3C A;  3PRT A;  3WAB A;  2JEW A;  3G3S A;  2FXF A;  4R76 A;  1WK4 A;  1Q2D A;  2PJC A;  1XMT A;  3B8G A;  1IOI A;  2RB7 A;  4JWP A;  5CPA A;  3FIX A;  4UBR A;  2GLJ A;  2ARH A;  4ZX8 A;  4PXD A;  4P4D A;  2IQ6 A;  4LQ6 A;  4AG9 A;  3JUW A;  1HDU A;  3ISZ A;  2JLM A;  4PV6 A;  4XPD C;  4C7H A;  3IFE A;  4J3G A;  4MFZ A; 
#chains in the Genus database with same CATH homology
 3JTK A;  2DXQ A;  4L8A A;  3ZZI A;  2QIR A;  4KOV A;  4Y49 C;  3OWC A;  4AVB A;  3V8I A;  1Y9K A;  1VHS A;  2H5M A;  2NMT A;  1LRZ A;  4OLL A;  4U9Y A;  1MK4 A;  4AB7 A;  4Q36 A;  3WR7 A;  4NF1 A;  1QST A;  2KCW A;  2F5I A;  2J8R A;  2VZZ A;  5KTA A;  3CXP A;  4PK3 A;  4JLY A;  2Z3K A;  2C27 A;  2JDC A;  3F0A A;  4F0Y A;  1PU9 A;  3R9F A;  3VWE A;  3SHP A;  5AG7 A;  1S60 A;  1I21 A;  1I12 A;  1TIQ A;  3EXN A;  2PSW A;  4ONU A;  2Z0Z A;  4PSX A;  5DWM A;  5IV0 A;  4IUS A;  4CS0 B;  4KOX A;  2Z3N A;  1NSL A;  4XNH C;  4KLW A;  2VBQ A;  4KSF A;  1MJ9 A;  3D3S A;  4JXQ A;  3FNC A;  3D2M A;  2G3A A;  4A33 A;  2FL4 A;  5H84 A;  2R1I A;  3QB8 A;  2FT0 A;  3FBU A;  4KUB A;  4C2X A;  5I0C A;  4A95 A;  2EVN A;  5AG5 A;  2CNS A;  4KLV A;  4CGO A;  1S5K A;  1K4J A;  4E0A A;  4NSQ A;  4Q38 A;  4FD7 A;  2YNE A;  1V0C A;  1YGH A;  4UFV A;  4ZGY B;  1S7N A;  4FD6 A;  2B58 A;  2HV2 A;  3S6F A;  1YLE A;  1IYK A;  4KVX A;  5A28 A;  2YGW A;  4MFL A;  4CAE A;  5E96 A;  1FY7 A;  3IWE A;  3VWD A;  3JVN A;  4ZBG A;  1N71 A;  4I49 A;  1M4D A;  5F47 A;  2HQY A;  4UCP A;  3R95 A;  2Q4Y A;  1NMT A;  3D2P A;  1NE9 A;  2Z3M A;  2WSA A;  2CY2 A;  3QAH A;  4KSA A;  3T9Y A;  4RI1 A;  1KUX A;  4BMH A;  3E0K A;  1B6B A;  1KZF A;  3GKR A;  2VQY A;  1Y9W A;  2B3U A;  5AGE A;  4A30 A;  3EO4 A;  3EY5 A;  2AJ6 A;  4H6U A;  1Y7R A;  2AE6 A;  1YX0 A;  4CAV A;  1S3Z A;  3H4Q A;  2OU2 A;  4DNC A;  5J8F A;  2K5T A;  4MHD A;  5C88 A;  4II9 A;  5G21 A;  1XIX A;  4CGM A;  1GHE A;  4CGN A;  2P6E A;  4KOU A;  4UCM A;  4MY3 A;  3FRM A;  4XNH B;  4E2A A;  4KOY A;  1S7F A;  2FIA A;  1M44 A;  2JDD A;  5IX3 A;  1M4I A;  1OZP A;  2P6G A;  3W6S A;  1YVK A;  3R9E A;  2G0B A;  2VEZ A;  3R96 A;  3TTH A;  4JJX A;  4QVT A;  4FD4 A;  4YFJ A;  3TOB A;  2YND A;  1ON0 A;  3SXO A;  2PR8 A;  5J8C A;  2HUZ A;  4MBU A;  4MJ8 A;  1RXT A;  4CYN A;  5HH1 A;  1XE4 A;  3BJ7 A;  5EC4 A;  3EC4 A;  4RS2 A;  2FE7 A;  2WPX A;  2Q0Y A;  5ISV A;  4XPK A;  1BOB A;  4LUA A;  4U5Y A;  4KOS A;  1S7K A;  4KOR A;  2P6F A;  3C26 A;  3BJ8 A;  3BLN A;  2FIW A;  2QML A;  4M85 A;  2YNC C;  3TO6 A;  1J4J A;  2REF A;  4U9Z A;  4HNW B;  4AVC A;  4MFJ A;  4NEX A;  2EUI A;  4M3S A;  4KVM E;  3TO7 A;  4C7I A;  2R8V A;  4KS9 A;  1B87 A;  4AG7 A;  3TT2 A;  1IB1 E;  4MFQ A;  1SQH A;  3W6X A;  4H6Z A;  4KUA A;  2I79 A;  1CJW A;  4K30 A;  4KOT A;  2CNM A;  1XF8 A;  4MFK A;  4FD5 A;  3ZJ0 A;  4QC6 A;  2ZW6 A;  1QSO A;  4E8O A;  3DDD A;  4NCZ A;  3S6G A;  2WUU A;  4CRZ B;  3A9L A;  4KZT A;  1Z9U A;  5DWN A;  4CRY B;  2D4P A;  3K9U A;  1U6M A;  3NE7 A;  2PRB A;  4L89 A;  3MGD A;  5F46 A;  4XPD B;  2OB0 A;  3SXN A;  4QBJ A;  2R7H A;  1QSM A;  2I00 A;  2REE A;  3DR6 A;  3H5Z A;  2Z11 A;  4Y49 B;  2GE3 A;  2BL1 A;  5CNP A;  5HMN A;  1YVO A;  2VZY A;  1YRE A;  2Q44 A;  4GS4 A;  4CYO A;  1IIC A;  3TE4 A;  3FB3 A;  3IU1 A;  4CAW A;  4A31 A;  3F8K A;  2O28 A;  2CNT A;  3FYN A;  5JPH A;  4EVY A;  4B5O A;  4XPL A;  2Q04 A;  4LX9 A;  2ZW4 A;  4KVO E;  4UFX A;  3PP9 A;  4YRH A;  4B5P A;  4HKF A;  5H86 A;  4F6A A;  4UFW A;  4B13 A;  4QUS A;  4JD6 A;  1IYL A;  2Z3L A;  4UWI A;  4KOW A;  1MJA A;  4R87 A;  3DR8 A;  3R9G A;  3DSB A;  3P2F A;  4PK2 A;  5F48 A;  2ZPA A;  5JQ4 A;  1Z4R A;  2J8N A;  2B4B A;  3FXT A;  4F0X A;  4A32 A;  3GY9 A;  1MJB A;  2PDO A;  2PQ8 A;  4QB9 A;  5G1Z A;  5A27 A;  2JEV A;  1Q2C A;  5GCN A;  2FS5 A;  3LD2 A;  3D8P A;  2B3V A;  3EFA A;  2B5G B;  4B11 A;  2Z3O A;  1Q2Y A;  1BO4 A;  1I1D A;  2OH1 A;  4CAF A;  2GIV A;  3IGR A;  4MY0 A;  2FSR A;  1S7L A;  2P0W A;  2J8M A;  2DPT A;  3W91 A;  1L0C A;  3IU2 A;  4UWJ A;  2BEI A;  4CYP A;  1RO5 A;  3S6H A;  2ZW5 A;  1UFH A;  2ZW7 A;  2B4D B;  4B5P B;  2BSW A;  2D4O A;  4C68 A;  2CXA A;  4R3L A;  4R3K A;  4X5K A;  1IID A;  2QEC A;  4HNX B;  3P2H A;  4YGO A;  2GAN A;  4OAD A;  1ZO0 A;  3PZJ A;  4MI4 A;  4UA3 A;  3CXQ A;  5F49 A;  1XEB A;  3R1K A;  3LOD A;  3RYO A;  2PC1 A;  4B14 A;  4B10 A;  5G22 A;  2FCK A;  1PUA A;  4HNY B;  5IB0 A;  1QSN A;  4CGP A;  2VI7 A;  1VKC A;  3I3G A;  4C2Y A;  2OZU A;  5AG6 A;  2YNC A;  3TO9 A;  2Q7B A;  4AVA A;  3IWG A;  5KTC A;  3GYA A;  2A4N A;  4B12 A;  4CYQ A;  4JXR A;  2BUE A;  2ZXV A;  3F5B A;  2OZG A;  3PGP A;  4OAE A;  4R57 A;  5FVJ A;  1P0H A;  5AG4 A;  1M1D A;  2Q4V A;  2IL4 A;  3TOA A;  4H89 A;  1YK3 A;  1P4N A;  3CXS A;  2DPS A;  5BWA B;  1YR0 A;  2Y0M A;  2G3T A;  2B5G A;  3G8W A;  4NXY A;  3S6K A;  4UCN A;  1QSR A;  1KUY A;  2OZH A;  3I9S A;  4PSW A;  4BBH A;  3UY5 A;  2VXK A;  1CM0 A;  5G20 A;  1R57 A;  3DNS A;  2R98 A;  1KUV A;  5EBV A;  3TCV A;  5KTD A;  2Z10 A;  1WWZ A;  4C2Z A;  3TFY A;  2B4D A;  1Z4E A;  2RC4 A;  2ATR A;  2X7B A;  2Z3P A;  4MFP A;  4R9M A;  4IF5 A;  4CAX A;  4ORF A;  3KKW A;  4CGL A;  3N7Z A;  2PR1 A;  2WPW A;  1M4G A;  3T90 A;  4A2Z A;  5C82 A;  3G3S A;  2FXF A;  1WK4 A;  1Q2D A;  1XMT A;  3B8G A;  4JWP A;  3FIX A;  4UBR A;  2ARH A;  4AG9 A;  3JUW A;  4XPD C;  2JLM A;  4PV6 A;  4C7H A;  4J3G A;  4MFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...