2DEAA

Crystal structure of the aminopeptidase of aeromonas proteolytica at ph 4.7
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
publication title The high-resolution structures of the neutral and the low pH crystals of aminopeptidase from Aeromonas proteolytica.
pubmed doi rcsb
source organism Vibrio proteolyticus
molecule tags Hydrolase
total genus 110
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2006-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2deaA00
2C6CA 3BXMA 1TKJA 1F2OA 2CF4A 4EWTA 2Q43A 4NGMA 2OOTA 5LRJA 1DE4C 4B6ZA 5F09A 5JM6A 2PVWA 3GUXA 4A37A 3WT4A 5HVGA 4FUUA 3I1UA 2PIYA 3TC8A 1Y0YA 2ZOGA 3CT9A 3D67A 4K3NA 4OC3A 3NH4A 4NGRA 5K8MA 3MRUA 2PJ8A 1YSJA 1DTDA 1ZG9A 2PJ4A 3KHZA 4NGPA 2I3CA 4FWUA 2CTCA 2EK9A 4JZ0A 4IK2A 2PJ3A 3DLJA 2EWBA 4P4JA 2V8VA 1OBRA 1TXRA 4R7MA 2PCUA 3FEDA 1TKFA 2ANPA 5LYLA 6CPAA 3PFEA 2XEGA 3VARA 2PVVA 5JGFA 2HC9A 1EE3P 3NFZA 2PJ0A 1CBXA 5K8PA 3LWUA 4X2TA 2O53A 4MCPA 1R43A 3D4UA 1LCPA 3WC5A 2QVPA 3CPAA 4MCSA 2HB6A 3KI9A 4MRIA 1CPSA 1BPNA 3N5FA 2PIZA 3B3WA 2V77A 4UIAA 4CPAA 3KGQA 3BI1A 3D66A 4P44A 1CG2A 4NGSA 3B35A 4OKOA 3GLJA 4P4FA 4BD9A 3D68A 3B2YA 3H8FA 2PJ5A 3IO1A 3S9NA 3BHXA 4UEEA 3PB7X 4FAIA 2AFZA 3H8GA 3ISZA 1NSAA 5HXDA 5J1QA 3TX8A 5HVHA 2ZENA 3D7FA 1TF9A 1PYTB 4PQAA 4A38A 4NJQA 4TWEA 1H8LA 2C1CA 2ZOFA 1XRYA 3K9TA 4LQGA 1ZLHA 1BPMA 1Y7EA 4OC5A 3B3CA 2WZNA 4A39A 1TF8A 2EK8A 3D7HA 3IJ3A 4G1PA 4PXDA 4P4IA 4MCRA 4F9VA 4Q7AA 2IMOA 2JEWA 2CTBA 2ZEDA 4DJLA 4IHMA 5D29A 1IY7A 1F2PA 1Q7LA 4MHYA 4ZY2A 3HLPA 1Z5RA 2F7VA 2AFOA 3KASA 4DUKA 4X3RA 3WC6A 4NJRA 1FNOA 4UIBA 3PFOA 3IIBA 3FH4A 3GB0A 1FT7A 5JH9A 3VH9A 3FMCA 1HDQA 2PRQA 4RUHA 3PB6X 3KR4A 5LRKA 3PRTA 5LYDA 7CPAA 4PPZA 1TKHA 4WWVA 1CX8A 2RFHA 2IQ6A 1LOKA 2ZEGA 2PJBA 1BLLE 4NGQA 1Z2LA 1XJOA 4R8FA 1LFWA 3T8WA 2JBKA 1ELMP 2AFSA 3PB4X 1Z8LA 4W9YA 2V8HA 3FF3A 4R76A 2PJ1A 4F8ZA 1LANA 1CPXA 3IFEA 4PXCA 4WJBA 3MN8A 3RBUA 4ZX9A 2O4HA 2PJ7A 1PCAA 1ARMA 4UF4A 1ELLP 1XFOA 1M4LA 5HVFA 2OR4A 4MMOA 4OIWA 3FJUA 3NH8A 3D7GA 2GLJA 3IWWA 4NGTA 3PBEA 3BI0A 2C6GA 4X8IA 5K8OA 2AFXA 2QYVA 1VGYA 3HUVA 2V8DA 2PJ2A 3FX6A 2GU2A 3DGVA 2POKA 3WABA 2Q4ZA 1QMUA 5ELYA 2BOAA 8CPAA 4MCQA 4IAVA 3B3VA 4F9UA 4FBEA 4ZI6A 3SJEA 4MHPA 3JRUA 4OC1A 4OP4A 1VHEA 4MHZA 5I4MA 2ZEOA 2BCOA 1IGBA 1HEEA 1RTQA 5IB9A 4H2KA 3ISXA 2XEFA 1XBUA 2PJ6A 1KWMA 3PB8X 2AFMA 4OC0A 3SI0A 1UWYA 5DS0A 4ZYQA 2BO9A 1ZLIA 2F8HA 1YW4A 5LRGA 3PBBA 4PXEA 1JQGA 2ABZA 3B3TA 5K8NA 3FECA 2PJCA 3LMSA 4P4BA 2ZEHA 1LAPA 1GYTA 3FEEA 2ZEPA 2ZELA 1VHOA 4NFRA 3SJGA 3SI2A 3KQZA 3B7IA 2C6PA 4A94A 2AFWA 4KSIA 4YWYA 3NA6A 4NGNA 1CP7A 2QJ8A 3SJXA 3H8EA 4OMEA 4OC4A 1LAMA 1VIXA 4GM5A 5THWA 3D7DA 1XMBA 4ZX8A 3RZAA 3V7ZA 4P45A 4P6YA 1HDUA 4OC2A 3S9MA 5CBMA 4P4EA 4EFDA 4MXUA 2J9AA 3FVLA 1ARLA 4EMEA 2VL1A 2GREA 4ONWA 2WYRA 3L2NA 2ZEMA 1YLOA 1F57A 3CDXA 1YW6A 3V38A 3NH5A 2FVGA 4O23A 3QNVA 5LYIA 4OIDA 4MHNA 2IJZA 5D8NA 2PJAA 1AMPA 4R6TA 3SI1A 4UEFA 4P10A 3K2KA 1CP6A 3KR5A 3B3SA 2XEJA 5LYFA 3KHXA 4Z65A 3RAMA 2GLFA 2PE3A 4PXBA 2NYQA 3IC1A 1AYEA 3CPXA 2JBJA 4AXVA 4P4DA 4ZY1A 3KZWA 4DYOA 2G9DA 2ZEEA 1ZG7A 2V8GA 3S9LA 3PEIA 4TNUA 3KL9A 4JYWA 1YMEA 2ZEFA 2AFUA 5CPAA 1BAVA 2RB7A 1ZG8A 3VATA 3SJFA 2DEAA 3IEHA 4ZY0A 4UEZA 3PB9X 2Q51A 3WC7A 3KQXA 1QQ9A 2PJ9A 2CIJA 2NSMA 1R3NA 4YU9A 2XEIA 1Y0RA
chains in the Genus database with same CATH superfamily
2G3TA 2C6CA 3BXMA 4KLWA 4PSXA 1TKJA 1F2OA 2CF4A 4IUSA 4UCPA 4EWTA 4UA3A 5I0CA 2Q43A 1V0CA 4NGMA 2OOTA 2RC4A 4QUSA 5LRJA 1DE4C 4B6ZA 5F09A 4KOYA 4Y49B 2PVWA 1U6MA 2P0WA 3DR8A 3LD2A 5HH1A 5F46A 1XMTA 3GUXA 4XPDB 4A37A 4CYOA 1TIQA 1SQHA 1I12A 3VWDA 3IWEA 3WT4A 4FUUA 4KOXA 5E96A 5HVGA 3I1UA 1S7FA 2PIYA 1Y0YA 2Q4YA 2ZOGA 5AG6A 2CNTA 3TC8A 4A30A 3CT9A 3D67A 3DSBA 3FB3A 4K3NA 4OC3A 3NH4A 4NGRA 4MFZA 2GIVA 1I21A 2WUUA 4GXHA 4R57A 5K8MA 3MRUA 2PJ8A 1YSJA 1DTDA 1ZG9A 2PJ4A 2WPXA 3FIXA 3KHZA 4NGPA 3S6KA 2I3CA 1RO5A 4FWUA 3C26A 2CTCA 2EO8A 5ISVA 1VKCA 2EK9A 4ZBGA 4JZ0A 4B5OA 1Z9UA 3FNCA 4IK2A 4UCNA 3VWEA 4B5PB 4C7IA 4JWPA 4F0XA 3I3GA 1X12A 2PJ3A 3DLJA 2EWBA 3PZJA 3EO4A 2V8VA 4KOUA 4P4JA 1OBRA 1TXRA 4L8AA 4R7MA 3ZZIA 2PCUA 4B14A 3FEDA 2P6GA 3TE4A 1TKFA 4II9A 2ANPA 5LYLA 6CPAA 3PFEA 3KKWA 1QSRA 2XEGA 4K30A 1S7KA 3VARA 1S3ZA 2PVVA 5DWNA 2HC9A 1EE3P 2EVNA 3LODA 1CM0A 3F5BA 2PJ0A 1CBXA 3NFZA 4KOVA 4CAVA 2Q44A 4MFQA 4PK3A 2AE6A 5K8PA 3LWUA 4X2TA 1P4NA 2O53A 3S6GA 1M44A 3D3SA 4U9ZA 4MCPA 1R43A 3D4UA 3TOBA 1LCPA 4MFLA 3WC5A 4NEXA 4B13A 2QVPA 3D2PA 2JEVA 3CPAA 2PC1A 1Z8WA 2JDCA 3GYAA 3IU1A 4KUAA 3CXQA 4MCSA 2HB6A 3KI9A 5H84A 1M4DA 4MRIA 1L0CA 5J8CA 1QSNA 1YVKA 2OB0A 2B5GB 3TTHA 4HNXB 3TO7A 1CPSA 1BPNA 3R1KA 3N5FA 2FSRA 2PIZA 1X10A 3B3WA 1MK4A 2V77A 3T90A 3P2FA 4UIAA 4CPAA 4CAEA 3KGQA 3BI1A 1S60A 2VQYA 3JUWA 4OADA 2Z10A 3D66A 2B3UA 3OWCA 2A4NA 4P44A 2ZW7A 2VI7A 1CG2A 4MY3A 2Q0YA 1XE4A 4NGSA 3B35A 3BJ7A 4OKOA 3GLJA 4P4FA 3H4QA 2YNCA 4BD9A 3D68A 2VXKA 3B2YA 2PJ5A 3H8FA 3IO1A 4H6UA 4L89A 4JJXA 1Q2DA 4B11A 4CS0B 2VBQA 1A2ZA 3S9NA 1M4IA 3BHXA 4UEEA 3PB7X 4KS9A 2FIWA 4FAIA 2AFZA 3EFAA 3H8GA 3ISZA 1JWQA 1NSAA 5HXDA 2OZGA 2D4OA 4BINA 5J1QA 3TX8A 4BBHA 1P0HA 5HVHA 2ZENA 4UFXA 4CGLA 1TF9A 1PYTB 3D7FA 4PV6A 3A9LA 4PQAA 3TOAA 4CYPA 1Z4EA 4A38A 2YGWA 4NJQA 4PSWA 4NSQA 4TWEA 1H8LA 1XF8A 2PDOA 2PR8A 1OZPA 2C1CA 2ZOFA 3DDDA 4RN7A 4A32A 1S5KA 2JDDA 4NCZA 5KTCA 1XRYA 1XIXA 3K9TA 3NE7A 1IB1E 4LQGA 2ZW4A 1ZLHA 1BPMA 4DNCA 5JQ4A 4OLLA 5GCNA 1Y7EA 5HMNA 4OC5A 3B3CA 2WZNA 4MFKA 3IU2A 4A39A 1TF8A 4C68A 2EK8A 3D7HA 3IJ3A 2YNCC 4G1PA 4FD5A 4PXDA 2PSWA 4P4IA 4MCRA 4F9VA 3CXSA 4Q7AA 4F6AA 4XNHB 1KUYA 1IYLA 2DXQA 2BEIA 2IMOA 2JEWA 1VHSA 3RO0A 3P2HA 2ZEDA 4DJLA 1YVOA 4C7HA 2H5MA 4CRZB 2J8MA 2YNDA 2D4PA 3MGDA 4KSFA 1QSTA 4IHMA 2Q7SA 5D29A 1YR0A 2JLMA 3F0AA 1IY7A 4KVOE 2DPTA 2G0BA 1F2PA 1Q7LA 4MHYA 4ZY2A 3HLPA 2PR1A 2Q04A 1Z5RA 2F7VA 1KZFA 2AFOA 3KASA 2PQ8A 4DUKA 4X3RA 3WC6A 4NJRA 1FNOA 3JVNA 4UIBA 2FT0A 3IIBA 3FH4A 1S7LA 2K5TA 3PFOA 2Z3NA 1MJBA 3GB0A 1FT7A 5IX3A 5JH9A 3VH9A 1QSOA 2GANA 1HDQA 2PRQA 3FMCA 3PB6X 4RUHA 3KR4A 1N71A 3SHPA 5JGFA 4U5YA 5LRKA 3IWGA 4KSAA 3PRTA 3CXPA 5LYDA 7CPAA 3FRMA 4UCMA 4PPZA 3G8WA 1B6BA 1TKHA 4WWVA 1CX8A 1ON0A 2Q4VA 4KLVA 2RFHA 2IQ6A 1Z4RA 1LOKA 2ZEGA 3TO9A 2GE3A 2J8RA 2PJBA 1K4JA 1I1DA 3EC4A 1BLLE 4NGQA 1Z2LA 1Q2YA 1XJOA 1J4JA 4R8FA 1LFWA 3T8WA 2JBKA 1ELMP 2AFSA 3PB4X 1Z8LA 3H5ZA 1IOFA 4W9YA 3SXOA 3FXTA 5C82A 2V8HA 2ATRA 4UBRA 1YGHA 3FF3A 4R76A 5AG7A 3QB8A 4GS4A 2I00A 3WR7A 4B10A 4MBUA 2PJ1A 4F8ZA 3I9SA 1LANA 1ZO0A 2B4DA 4PK2A 1CPXA 3UY5A 2Z11A 3IFEA 3QAHA 4PXCA 4WJBA 4X5KA 3MN8A 4XPKA 3CZXA 3RBUA 4E0AA 1CJWA 4ZX9A 2O4HA 4F0YA 2PJ7A 3TFYA 1IU8A 3RYOA 4MFJA 1PCAA 2Z3OA 4R9MA 1ARMA 4CGMA 4UF4A 1ELLP 3D2MA 3PGPA 2Q7BA 2EBJA 1S7NA 4YGOA 1XFOA 5IV0A 1M4LA 5HVFA 2OR4A 5EMIA 3W91A 1FY7A 3N7ZA 5AG5A 4MMOA 2BSWA 4ORFA 4OIWA 3FJUA 3NH8A 3D7GA 3R95A 2GLJA 3FBUA 3TO6A 3IWWA 4NGTA 3PBEA 4E8OA 3BI0A 2C6GA 4KORA 2B4BA 4X8IA 5K8OA 2AFXA 3E0KA 4YRHA 2QYVA 1VGYA 3FYNA 2REFA 3LACA 3HUVA 1IOIA 2V8DA 2PJ2A 2R8VA 2GU2A 3FX6A 3DGVA 4OAEA 2POKA 4I49A 4CGNA 3WABA 2Q4ZA 1QMUA 2QMLA 2X7BA 2J8NA 3S6HA 5ELYA 2BOAA 3GY9A 4A2ZA 8CPAA 4MCQA 4KOTA 2HV2A 2C27A 4IAVA 4B5PA 4HNYB 3B3VA 4F9UA 4LX9A 2DPSA 4FBEA 1WWZA 2AJ6A 2R7HA 4Q38A 3W6SA 4ZI6A 4MY0A 3SJEA 2B58A 4C2XA 2XEIA 4MHPA 2CNMA 2VEZA 3JRUA 4OC1A 4OP4A 1VHEA 3S6FA 3W6XA 4CAWA 4MHZA 5I4MA 2ZEOA 5A27A 4NXYA 2BCOA 2GFQA 1IGBA 1HEEA 3JTKA 4M85A 4MJ8A 3EXNA 4UFVA 2HUZA 1RTQA 2O28A 4Y49C 3T9YA 3GKRA 5IB9A 4KVME 5JPHA 4C2YA 4H2KA 3ISXA 2XEFA 4JD6A 1XBUA 2B4DB 2PRBA 1BOBA 2IL4A 1PU9A 1KWMA 2PJ6A 2Z3PA 5EBVA 3PB8X 2AFMA 4OC0A 5KTAA 1IYKA 3IGRA 1UWYA 2B5GA 3SI0A 5A28A 5DS0A 2ZW5A 4JXRA 4NF1A 1IICA 4ZYQA 4R3KA 1UFHA 1ZLIA 2BO9A 2F8HA 4QBJA 2DF5A 2HQYA 4H89A 1YW4A 3RNZA 5H86A 5LRGA 2FL4A 3PBBA 4J3GA 4PXEA 1JQGA 1Z8XA 2ABZA 3B3TA 2I79A 5K8NA 4XPLA 3FECA 4FD4A 1YREA 2PJCA 2ZXVA 1PUAA 3QAYA 3LMSA 2FXFA 5AGEA 5BWAB 4P4BA 2ZEHA 1MJAA 4M6IA 1LAPA 1GYTA 2VZZA 1BO4A 3FEEA 2FIAA 4AVCA 4RS2A 2ZEPA 4H6ZA 2ZELA 4MHDA 4UWIA 1VHOA 4NFRA 3SJGA 3SI2A 3KQZA 3B7IA 2OU2A 4KUBA 2FCKA 3TCVA 2C6PA 2KCWA 2AFWA 1NE9A 4KSIA 4A94A 1Y7RA 2QECA 1YX0A 4FD7A 4M3SA 4ONUA 2BUEA 4CAFA 4YWYA 4CGPA 4CYNA 1LRZA 1M1DA 5G21A 3NA6A 4NGNA 1CP7A 2QJ8A 3SJXA 2CNSA 2P6EA 3H8EA 3V8IA 3GIUA 3DNSA 4OMEA 2REEA 2ZPAA 4MI4A 1LAMA 1VIXA 4OC4A 2ZW6A 5C88A 4GM5A 4HPSA 5F49A 5THWA 4E2AA 3D7DA 1XMBA 4ZX8A 5FVJA 4M6GA 3RZAA 3V7ZA 4P45A 4P6YA 1HDUA 4OC2A 3S9MA 4AVBA 5CBMA 2NMTA 4QVTA 4CRYB 2YNEA 4P4EA 4EFDA 4AB7A 4MXUA 2OZHA 2J9AA 5G20A 5IB0A 4AG7A 1RXTA 3FVLA 3PP9A 1ARLA 2Z3MA 4EMEA 2VL1A 2F5IA 4R87A 4ZGYB 2GREA 4ONWA 4Q36A 2WYRA 3L2NA 1NMTA 4HNWB 2ZEMA 3BLNA 3TT2A 1YLOA 4M6HA 2ARHA 4UWJA 4A31A 2OH1A 1F57A 3CDXA 1YK3A 1YW6A 4MFPA 3V38A 1Y9WA 3NH5A 2FVGA 4O23A 3QNVA 2QIRA 5LYIA 4OIDA 4KOWA 4JLYA 2R1IA 4KOSA 4MHNA 4AVAA 3F8KA 2IJZA 4CYQA 5D8NA 2PJAA 4BMHA 1AMPA 4R6TA 2B3VA 3SI1A 4CGOA 3G3SA 1M4GA 4KVXA 1XOVA 3BJ8A 4UEFA 5G22A 4P10A 2G3AA 3K2KA 1CP6A 3KR5A 1WK4A 3R9EA 4YFJA 5AG4A 3B3SA 3B8GA 4IF5A 4JXQA 5KTDA 1KUXA 3K9UA 2Z3LA 3NE8A 2XEJA 5LYFA 3ZJ0A 4U9YA 3R96A 3KHXA 4R3LA 4Z65A 1AUGA 4QB9A 3RAMA 1B87A 3D8PA 2GLFA 2OZUA 2PE3A 1YLEA 4PXBA 2Y0MA 4RI1A 2NYQA 3IC1A 1AYEA 3CPXA 5DWMA 5G1ZA 4XNHC 2FE7A 2JBJA 1IIDA 4P4DA 4AXVA 4ZY1A 4HKFA 5F48A 3SXNA 5JM6A 3KZWA 2CY2A 2R98A 4DYOA 2BL1A 2G9DA 2ZEEA 5J8FA 1ZG7A 2V8GA 2FS5A 4CAXA 3DR6A 4LUAA 3PEIA 4C2ZA 2Z3KA 4A33A 5CNPA 3S9LA 2WSAA 4QC6A 1XEBA 4TNUA 3KL9A 4JYWA 1YMEA 1YQEA 1Q2CA 2WPWA 2ZEFA 2AFUA 5CPAA 4XPDC 1BAVA 2RB7A 1ZG8A 3R9GA 2ODFA 2EUIA 4EVYA 3VATA 4KZTA 3SJFA 2DEAA 1R57A 3IEHA 4A95A 1NSLA 4ZY0A 4UEZA 1KUVA 1MJ9A 2CXAA 1Y9KA 1QSMA 1Z8TA 5F47A 3EY5A 2P6FA 3PB9X 2Q51A 4FD6A 3WC7A 1GHEA 3KQXA 4AG9A 1QQ9A 2PJ9A 2CIJA 2NSMA 4B12A 1R3NA 4YU9A 2VZYA 2Z0ZA 4UFWA 5EC4A 2CTBA 4LQ6A 3R9FA 1Y0RA
chains in the Genus database with same CATH topology
2C6CA 3BXMA 1TKJA 1F2OA 2CF4A 4EWTA 2Q43A 4NGMA 2OOTA 5LRJA 1DE4C 4B6ZA 5F09A 5JM6A 2PVWA 3GUXA 4A37A 3WT4A 5HVGA 4FUUA 3I1UA 2PIYA 3TC8A 1Y0YA 2ZOGA 3CT9A 3D67A 4K3NA 4OC3A 3NH4A 4NGRA 5K8MA 3MRUA 2PJ8A 1YSJA 1DTDA 1ZG9A 2PJ4A 3KHZA 4NGPA 2I3CA 4FWUA 2CTCA 2EK9A 4JZ0A 4IK2A 2PJ3A 3DLJA 2EWBA 4P4JA 2V8VA 1OBRA 1TXRA 4R7MA 2PCUA 3FEDA 1TKFA 2ANPA 5LYLA 6CPAA 3PFEA 2XEGA 3VARA 2PVVA 5JGFA 2HC9A 1EE3P 3NFZA 2PJ0A 1CBXA 5K8PA 3LWUA 4X2TA 2O53A 4MCPA 1R43A 3D4UA 1LCPA 3WC5A 2QVPA 3CPAA 4MCSA 2HB6A 3KI9A 4MRIA 1CPSA 1BPNA 3N5FA 2PIZA 3B3WA 2V77A 4UIAA 4CPAA 3KGQA 3BI1A 3D66A 4P44A 1CG2A 4NGSA 3B35A 4OKOA 3GLJA 4P4FA 4BD9A 3D68A 3B2YA 3H8FA 2PJ5A 3IO1A 3S9NA 3BHXA 4UEEA 3PB7X 4FAIA 2AFZA 3H8GA 3ISZA 1NSAA 5HXDA 5J1QA 3TX8A 5HVHA 2ZENA 3D7FA 1TF9A 1PYTB 4PQAA 4A38A 4NJQA 4TWEA 1H8LA 2C1CA 2ZOFA 1XRYA 3K9TA 4LQGA 1ZLHA 1BPMA 1Y7EA 4OC5A 3B3CA 2WZNA 4A39A 1TF8A 2EK8A 3D7HA 3IJ3A 4G1PA 4PXDA 4P4IA 4MCRA 4F9VA 4Q7AA 2IMOA 2JEWA 2CTBA 2ZEDA 4DJLA 4IHMA 5D29A 1IY7A 1F2PA 1Q7LA 4MHYA 4ZY2A 3HLPA 1Z5RA 2F7VA 2AFOA 3KASA 4DUKA 4X3RA 3WC6A 4NJRA 1FNOA 4UIBA 3PFOA 3IIBA 3FH4A 3GB0A 1FT7A 5JH9A 3VH9A 3FMCA 1HDQA 2PRQA 4RUHA 3PB6X 3KR4A 5LRKA 3PRTA 5LYDA 7CPAA 4PPZA 1TKHA 4WWVA 1CX8A 2RFHA 2IQ6A 1LOKA 2ZEGA 2PJBA 1BLLE 4NGQA 1Z2LA 1XJOA 4R8FA 1LFWA 3T8WA 2JBKA 1ELMP 2AFSA 3PB4X 1Z8LA 4W9YA 2V8HA 3FF3A 4R76A 2PJ1A 4F8ZA 1LANA 1CPXA 3IFEA 4PXCA 4WJBA 3MN8A 3RBUA 4ZX9A 2O4HA 2PJ7A 1PCAA 1ARMA 4UF4A 1ELLP 1XFOA 1M4LA 5HVFA 2OR4A 4MMOA 4OIWA 3FJUA 3NH8A 3D7GA 2GLJA 3IWWA 4NGTA 3PBEA 3BI0A 2C6GA 4X8IA 5K8OA 2AFXA 2QYVA 1VGYA 3HUVA 2V8DA 2PJ2A 3FX6A 2GU2A 3DGVA 2POKA 3WABA 2Q4ZA 1QMUA 5ELYA 2BOAA 8CPAA 4MCQA 4IAVA 3B3VA 4F9UA 4FBEA 4ZI6A 3SJEA 4MHPA 3JRUA 4OC1A 4OP4A 1VHEA 4MHZA 5I4MA 2ZEOA 2BCOA 1IGBA 1HEEA 1RTQA 5IB9A 4H2KA 3ISXA 2XEFA 1XBUA 2PJ6A 1KWMA 3PB8X 2AFMA 4OC0A 3SI0A 1UWYA 5DS0A 4ZYQA 2BO9A 1ZLIA 2F8HA 1YW4A 5LRGA 3PBBA 4PXEA 1JQGA 2ABZA 3B3TA 5K8NA 3FECA 2PJCA 3LMSA 4P4BA 2ZEHA 1LAPA 1GYTA 3FEEA 2ZEPA 2ZELA 1VHOA 4NFRA 3SJGA 3SI2A 3KQZA 3B7IA 2C6PA 4A94A 2AFWA 4KSIA 4YWYA 3NA6A 4NGNA 1CP7A 2QJ8A 3SJXA 3H8EA 4OMEA 4OC4A 1LAMA 1VIXA 4GM5A 5THWA 3D7DA 1XMBA 4ZX8A 3RZAA 3V7ZA 4P45A 4P6YA 1HDUA 4OC2A 3S9MA 5CBMA 4P4EA 4EFDA 4MXUA 2J9AA 3FVLA 1ARLA 4EMEA 2VL1A 2GREA 4ONWA 2WYRA 3L2NA 2ZEMA 1YLOA 1F57A 3CDXA 1YW6A 3V38A 3NH5A 2FVGA 4O23A 3QNVA 5LYIA 4OIDA 4MHNA 2IJZA 5D8NA 2PJAA 1AMPA 4R6TA 3SI1A 4UEFA 4P10A 3K2KA 1CP6A 3KR5A 3B3SA 2XEJA 5LYFA 3KHXA 4Z65A 3RAMA 2GLFA 2PE3A 4PXBA 2NYQA 3IC1A 1AYEA 3CPXA 2JBJA 4AXVA 4P4DA 4ZY1A 3KZWA 4DYOA 2G9DA 2ZEEA 1ZG7A 2V8GA 3S9LA 3PEIA 4TNUA 3KL9A 4JYWA 1YMEA 2ZEFA 2AFUA 5CPAA 1BAVA 2RB7A 1ZG8A 3VATA 3SJFA 2DEAA 3IEHA 4ZY0A 4UEZA 3PB9X 2Q51A 3WC7A 3KQXA 1QQ9A 2PJ9A 2CIJA 2NSMA 1R3NA 4YU9A 2XEIA 1Y0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C6C A;  3BXM A;  1TKJ A;  1F2O A;  2CF4 A;  4EWT A;  2Q43 A;  4NGM A;  2OOT A;  5LRJ A;  1DE4 C;  4B6Z A;  5F09 A;  5JM6 A;  2PVW A;  3GUX A;  4A37 A;  3WT4 A;  5HVG A;  4FUU A;  3I1U A;  2PIY A;  3TC8 A;  1Y0Y A;  2ZOG A;  3CT9 A;  3D67 A;  4K3N A;  4OC3 A;  3NH4 A;  4NGR A;  5K8M A;  3MRU A;  2PJ8 A;  1YSJ A;  1DTD A;  1ZG9 A;  2PJ4 A;  3KHZ A;  4NGP A;  2I3C A;  4FWU A;  2CTC A;  2EK9 A;  4JZ0 A;  4IK2 A;  2PJ3 A;  3DLJ A;  2EWB A;  4P4J A;  2V8V A;  1OBR A;  1TXR A;  4R7M A;  2PCU A;  3FED A;  1TKF A;  2ANP A;  5LYL A;  6CPA A;  3PFE A;  2XEG A;  3VAR A;  2PVV A;  5JGF A;  2HC9 A;  1EE3 P;  3NFZ A;  2PJ0 A;  1CBX A;  5K8P A;  3LWU A;  4X2T A;  2O53 A;  4MCP A;  1R43 A;  3D4U A;  1LCP A;  3WC5 A;  2QVP A;  3CPA A;  4MCS A;  2HB6 A;  3KI9 A;  4MRI A;  1CPS A;  1BPN A;  3N5F A;  2PIZ A;  3B3W A;  2V77 A;  4UIA A;  4CPA A;  3KGQ A;  3BI1 A;  3D66 A;  4P44 A;  1CG2 A;  4NGS A;  3B35 A;  4OKO A;  3GLJ A;  4P4F A;  4BD9 A;  3D68 A;  3B2Y A;  3H8F A;  2PJ5 A;  3IO1 A;  3S9N A;  3BHX A;  4UEE A;  3PB7 X;  4FAI A;  2AFZ A;  3H8G A;  3ISZ A;  1NSA A;  5HXD A;  5J1Q A;  3TX8 A;  5HVH A;  2ZEN A;  3D7F A;  1TF9 A;  1PYT B;  4PQA A;  4A38 A;  4NJQ A;  4TWE A;  1H8L A;  2C1C A;  2ZOF A;  1XRY A;  3K9T A;  4LQG A;  1ZLH A;  1BPM A;  1Y7E A;  4OC5 A;  3B3C A;  2WZN A;  4A39 A;  1TF8 A;  2EK8 A;  3D7H A;  3IJ3 A;  4G1P A;  4PXD A;  4P4I A;  4MCR A;  4F9V A;  4Q7A A;  2IMO A;  2JEW A;  2CTB A;  2ZED A;  4DJL A;  4IHM A;  5D29 A;  1IY7 A;  1F2P A;  1Q7L A;  4MHY A;  4ZY2 A;  3HLP A;  1Z5R A;  2F7V A;  2AFO A;  3KAS A;  4DUK A;  4X3R A;  3WC6 A;  4NJR A;  1FNO A;  4UIB A;  3PFO A;  3IIB A;  3FH4 A;  3GB0 A;  1FT7 A;  5JH9 A;  3VH9 A;  3FMC A;  1HDQ A;  2PRQ A;  4RUH A;  3PB6 X;  3KR4 A;  5LRK A;  3PRT A;  5LYD A;  7CPA A;  4PPZ A;  1TKH A;  4WWV A;  1CX8 A;  2RFH A;  2IQ6 A;  1LOK A;  2ZEG A;  2PJB A;  1BLL E;  4NGQ A;  1Z2L A;  1XJO A;  4R8F A;  1LFW A;  3T8W A;  2JBK A;  1ELM P;  2AFS A;  3PB4 X;  1Z8L A;  4W9Y A;  2V8H A;  3FF3 A;  4R76 A;  2PJ1 A;  4F8Z A;  1LAN A;  1CPX A;  3IFE A;  4PXC A;  4WJB A;  3MN8 A;  3RBU A;  4ZX9 A;  2O4H A;  2PJ7 A;  1PCA A;  1ARM A;  4UF4 A;  1ELL P;  1XFO A;  1M4L A;  5HVF A;  2OR4 A;  4MMO A;  4OIW A;  3FJU A;  3NH8 A;  3D7G A;  2GLJ A;  3IWW A;  4NGT A;  3PBE A;  3BI0 A;  2C6G A;  4X8I A;  5K8O A;  2AFX A;  2QYV A;  1VGY A;  3HUV A;  2V8D A;  2PJ2 A;  3FX6 A;  2GU2 A;  3DGV A;  2POK A;  3WAB A;  2Q4Z A;  1QMU A;  5ELY A;  2BOA A;  8CPA A;  4MCQ A;  4IAV A;  3B3V A;  4F9U A;  4FBE A;  4ZI6 A;  3SJE A;  4MHP A;  3JRU A;  4OC1 A;  4OP4 A;  1VHE A;  4MHZ A;  5I4M A;  2ZEO A;  2BCO A;  1IGB A;  1HEE A;  1RTQ A;  5IB9 A;  4H2K A;  3ISX A;  2XEF A;  1XBU A;  2PJ6 A;  1KWM A;  3PB8 X;  2AFM A;  4OC0 A;  3SI0 A;  1UWY A;  5DS0 A;  4ZYQ A;  2BO9 A;  1ZLI A;  2F8H A;  1YW4 A;  5LRG A;  3PBB A;  4PXE A;  1JQG A;  2ABZ A;  3B3T A;  5K8N A;  3FEC A;  2PJC A;  3LMS A;  4P4B A;  2ZEH A;  1LAP A;  1GYT A;  3FEE A;  2ZEP A;  2ZEL A;  1VHO A;  4NFR A;  3SJG A;  3SI2 A;  3KQZ A;  3B7I A;  2C6P A;  4A94 A;  2AFW A;  4KSI A;  4YWY A;  3NA6 A;  4NGN A;  1CP7 A;  2QJ8 A;  3SJX A;  3H8E A;  4OME A;  4OC4 A;  1LAM A;  1VIX A;  4GM5 A;  5THW A;  3D7D A;  1XMB A;  4ZX8 A;  3RZA A;  3V7Z A;  4P45 A;  4P6Y A;  1HDU A;  4OC2 A;  3S9M A;  5CBM A;  4P4E A;  4EFD A;  4MXU A;  2J9A A;  3FVL A;  1ARL A;  4EME A;  2VL1 A;  2GRE A;  4ONW A;  2WYR A;  3L2N A;  2ZEM A;  1YLO A;  1F57 A;  3CDX A;  1YW6 A;  3V38 A;  3NH5 A;  2FVG A;  4O23 A;  3QNV A;  5LYI A;  4OID A;  4MHN A;  2IJZ A;  5D8N A;  2PJA A;  1AMP A;  4R6T A;  3SI1 A;  4UEF A;  4P10 A;  3K2K A;  1CP6 A;  3KR5 A;  3B3S A;  2XEJ A;  5LYF A;  3KHX A;  4Z65 A;  3RAM A;  2GLF A;  2PE3 A;  4PXB A;  2NYQ A;  3IC1 A;  1AYE A;  3CPX A;  2JBJ A;  4AXV A;  4P4D A;  4ZY1 A;  3KZW A;  4DYO A;  2G9D A;  2ZEE A;  1ZG7 A;  2V8G A;  3S9L A;  3PEI A;  4TNU A;  3KL9 A;  4JYW A;  1YME A;  2ZEF A;  2AFU A;  5CPA A;  1BAV A;  2RB7 A;  1ZG8 A;  3VAT A;  3SJF A;  2DEA A;  3IEH A;  4ZY0 A;  4UEZ A;  3PB9 X;  2Q51 A;  3WC7 A;  3KQX A;  1QQ9 A;  2PJ9 A;  2CIJ A;  2NSM A;  1R3N A;  4YU9 A;  2XEI A;  1Y0R A; 
#chains in the Genus database with same CATH topology
 2G3T A;  2C6C A;  3BXM A;  4KLW A;  4PSX A;  1TKJ A;  1F2O A;  2CF4 A;  4IUS A;  4UCP A;  4EWT A;  4UA3 A;  5I0C A;  2Q43 A;  1V0C A;  4NGM A;  2OOT A;  2RC4 A;  4QUS A;  5LRJ A;  1DE4 C;  4B6Z A;  5F09 A;  4KOY A;  4Y49 B;  2PVW A;  1U6M A;  2P0W A;  3DR8 A;  3LD2 A;  5HH1 A;  5F46 A;  1XMT A;  3GUX A;  4XPD B;  4A37 A;  4CYO A;  1TIQ A;  1SQH A;  1I12 A;  3VWD A;  3IWE A;  3WT4 A;  4FUU A;  4KOX A;  5E96 A;  5HVG A;  3I1U A;  1S7F A;  2PIY A;  1Y0Y A;  2Q4Y A;  2ZOG A;  5AG6 A;  2CNT A;  3TC8 A;  4A30 A;  3CT9 A;  3D67 A;  3DSB A;  3FB3 A;  4K3N A;  4OC3 A;  3NH4 A;  4NGR A;  4MFZ A;  2GIV A;  1I21 A;  2WUU A;  4GXH A;  4R57 A;  5K8M A;  3MRU A;  2PJ8 A;  1YSJ A;  1DTD A;  1ZG9 A;  2PJ4 A;  2WPX A;  3FIX A;  3KHZ A;  4NGP A;  3S6K A;  2I3C A;  1RO5 A;  4FWU A;  3C26 A;  2CTC A;  2EO8 A;  5ISV A;  1VKC A;  2EK9 A;  4ZBG A;  4JZ0 A;  4B5O A;  1Z9U A;  3FNC A;  4IK2 A;  4UCN A;  3VWE A;  4B5P B;  4C7I A;  4JWP A;  4F0X A;  3I3G A;  1X12 A;  2PJ3 A;  3DLJ A;  2EWB A;  3PZJ A;  3EO4 A;  2V8V A;  4KOU A;  4P4J A;  1OBR A;  1TXR A;  4L8A A;  4R7M A;  3ZZI A;  2PCU A;  4B14 A;  3FED A;  2P6G A;  3TE4 A;  1TKF A;  4II9 A;  2ANP A;  5LYL A;  6CPA A;  3PFE A;  3KKW A;  1QSR A;  2XEG A;  4K30 A;  1S7K A;  3VAR A;  1S3Z A;  2PVV A;  5DWN A;  2HC9 A;  1EE3 P;  2EVN A;  3LOD A;  1CM0 A;  3F5B A;  2PJ0 A;  1CBX A;  3NFZ A;  4KOV A;  4CAV A;  2Q44 A;  4MFQ A;  4PK3 A;  2AE6 A;  5K8P A;  3LWU A;  4X2T A;  1P4N A;  2O53 A;  3S6G A;  1M44 A;  3D3S A;  4U9Z A;  4MCP A;  1R43 A;  3D4U A;  3TOB A;  1LCP A;  4MFL A;  3WC5 A;  4NEX A;  4B13 A;  2QVP A;  3D2P A;  2JEV A;  3CPA A;  2PC1 A;  1Z8W A;  2JDC A;  3GYA A;  3IU1 A;  4KUA A;  3CXQ A;  4MCS A;  2HB6 A;  3KI9 A;  5H84 A;  1M4D A;  4MRI A;  1L0C A;  5J8C A;  1QSN A;  1YVK A;  2OB0 A;  2B5G B;  3TTH A;  4HNX B;  3TO7 A;  1CPS A;  1BPN A;  3R1K A;  3N5F A;  2FSR A;  2PIZ A;  1X10 A;  3B3W A;  1MK4 A;  2V77 A;  3T90 A;  3P2F A;  4UIA A;  4CPA A;  4CAE A;  3KGQ A;  3BI1 A;  1S60 A;  2VQY A;  3JUW A;  4OAD A;  2Z10 A;  3D66 A;  2B3U A;  3OWC A;  2A4N A;  4P44 A;  2ZW7 A;  2VI7 A;  1CG2 A;  4MY3 A;  2Q0Y A;  1XE4 A;  4NGS A;  3B35 A;  3BJ7 A;  4OKO A;  3GLJ A;  4P4F A;  3H4Q A;  2YNC A;  4BD9 A;  3D68 A;  2VXK A;  3B2Y A;  2PJ5 A;  3H8F A;  3IO1 A;  4H6U A;  4L89 A;  4JJX A;  1Q2D A;  4B11 A;  4CS0 B;  2VBQ A;  1A2Z A;  3S9N A;  1M4I A;  3BHX A;  4UEE A;  3PB7 X;  4KS9 A;  2FIW A;  4FAI A;  2AFZ A;  3EFA A;  3H8G A;  3ISZ A;  1JWQ A;  1NSA A;  5HXD A;  2OZG A;  2D4O A;  4BIN A;  5J1Q A;  3TX8 A;  4BBH A;  1P0H A;  5HVH A;  2ZEN A;  4UFX A;  4CGL A;  1TF9 A;  1PYT B;  3D7F A;  4PV6 A;  3A9L A;  4PQA A;  3TOA A;  4CYP A;  1Z4E A;  4A38 A;  2YGW A;  4NJQ A;  4PSW A;  4NSQ A;  4TWE A;  1H8L A;  1XF8 A;  2PDO A;  2PR8 A;  1OZP A;  2C1C A;  2ZOF A;  3DDD A;  4RN7 A;  4A32 A;  1S5K A;  2JDD A;  4NCZ A;  5KTC A;  1XRY A;  1XIX A;  3K9T A;  3NE7 A;  1IB1 E;  4LQG A;  2ZW4 A;  1ZLH A;  1BPM A;  4DNC A;  5JQ4 A;  4OLL A;  5GCN A;  1Y7E A;  5HMN A;  4OC5 A;  3B3C A;  2WZN A;  4MFK A;  3IU2 A;  4A39 A;  1TF8 A;  4C68 A;  2EK8 A;  3D7H A;  3IJ3 A;  2YNC C;  4G1P A;  4FD5 A;  4PXD A;  2PSW A;  4P4I A;  4MCR A;  4F9V A;  3CXS A;  4Q7A A;  4F6A A;  4XNH B;  1KUY A;  1IYL A;  2DXQ A;  2BEI A;  2IMO A;  2JEW A;  1VHS A;  3RO0 A;  3P2H A;  2ZED A;  4DJL A;  1YVO A;  4C7H A;  2H5M A;  4CRZ B;  2J8M A;  2YND A;  2D4P A;  3MGD A;  4KSF A;  1QST A;  4IHM A;  2Q7S A;  5D29 A;  1YR0 A;  2JLM A;  3F0A A;  1IY7 A;  4KVO E;  2DPT A;  2G0B A;  1F2P A;  1Q7L A;  4MHY A;  4ZY2 A;  3HLP A;  2PR1 A;  2Q04 A;  1Z5R A;  2F7V A;  1KZF A;  2AFO A;  3KAS A;  2PQ8 A;  4DUK A;  4X3R A;  3WC6 A;  4NJR A;  1FNO A;  3JVN A;  4UIB A;  2FT0 A;  3IIB A;  3FH4 A;  1S7L A;  2K5T A;  3PFO A;  2Z3N A;  1MJB A;  3GB0 A;  1FT7 A;  5IX3 A;  5JH9 A;  3VH9 A;  1QSO A;  2GAN A;  1HDQ A;  2PRQ A;  3FMC A;  3PB6 X;  4RUH A;  3KR4 A;  1N71 A;  3SHP A;  5JGF A;  4U5Y A;  5LRK A;  3IWG A;  4KSA A;  3PRT A;  3CXP A;  5LYD A;  7CPA A;  3FRM A;  4UCM A;  4PPZ A;  3G8W A;  1B6B A;  1TKH A;  4WWV A;  1CX8 A;  1ON0 A;  2Q4V A;  4KLV A;  2RFH A;  2IQ6 A;  1Z4R A;  1LOK A;  2ZEG A;  3TO9 A;  2GE3 A;  2J8R A;  2PJB A;  1K4J A;  1I1D A;  3EC4 A;  1BLL E;  4NGQ A;  1Z2L A;  1Q2Y A;  1XJO A;  1J4J A;  4R8F A;  1LFW A;  3T8W A;  2JBK A;  1ELM P;  2AFS A;  3PB4 X;  1Z8L A;  3H5Z A;  1IOF A;  4W9Y A;  3SXO A;  3FXT A;  5C82 A;  2V8H A;  2ATR A;  4UBR A;  1YGH A;  3FF3 A;  4R76 A;  5AG7 A;  3QB8 A;  4GS4 A;  2I00 A;  3WR7 A;  4B10 A;  4MBU A;  2PJ1 A;  4F8Z A;  3I9S A;  1LAN A;  1ZO0 A;  2B4D A;  4PK2 A;  1CPX A;  3UY5 A;  2Z11 A;  3IFE A;  3QAH A;  4PXC A;  4WJB A;  4X5K A;  3MN8 A;  4XPK A;  3CZX A;  3RBU A;  4E0A A;  1CJW A;  4ZX9 A;  2O4H A;  4F0Y A;  2PJ7 A;  3TFY A;  1IU8 A;  3RYO A;  4MFJ A;  1PCA A;  2Z3O A;  4R9M A;  1ARM A;  4CGM A;  4UF4 A;  1ELL P;  3D2M A;  3PGP A;  2Q7B A;  2EBJ A;  1S7N A;  4YGO A;  1XFO A;  5IV0 A;  1M4L A;  5HVF A;  2OR4 A;  5EMI A;  3W91 A;  1FY7 A;  3N7Z A;  5AG5 A;  4MMO A;  2BSW A;  4ORF A;  4OIW A;  3FJU A;  3NH8 A;  3D7G A;  3R95 A;  2GLJ A;  3FBU A;  3TO6 A;  3IWW A;  4NGT A;  3PBE A;  4E8O A;  3BI0 A;  2C6G A;  4KOR A;  2B4B A;  4X8I A;  5K8O A;  2AFX A;  3E0K A;  4YRH A;  2QYV A;  1VGY A;  3FYN A;  2REF A;  3LAC A;  3HUV A;  1IOI A;  2V8D A;  2PJ2 A;  2R8V A;  2GU2 A;  3FX6 A;  3DGV A;  4OAE A;  2POK A;  4I49 A;  4CGN A;  3WAB A;  2Q4Z A;  1QMU A;  2QML A;  2X7B A;  2J8N A;  3S6H A;  5ELY A;  2BOA A;  3GY9 A;  4A2Z A;  8CPA A;  4MCQ A;  4KOT A;  2HV2 A;  2C27 A;  4IAV A;  4B5P A;  4HNY B;  3B3V A;  4F9U A;  4LX9 A;  2DPS A;  4FBE A;  1WWZ A;  2AJ6 A;  2R7H A;  4Q38 A;  3W6S A;  4ZI6 A;  4MY0 A;  3SJE A;  2B58 A;  4C2X A;  2XEI A;  4MHP A;  2CNM A;  2VEZ A;  3JRU A;  4OC1 A;  4OP4 A;  1VHE A;  3S6F A;  3W6X A;  4CAW A;  4MHZ A;  5I4M A;  2ZEO A;  5A27 A;  4NXY A;  2BCO A;  2GFQ A;  1IGB A;  1HEE A;  3JTK A;  4M85 A;  4MJ8 A;  3EXN A;  4UFV A;  2HUZ A;  1RTQ A;  2O28 A;  4Y49 C;  3T9Y A;  3GKR A;  5IB9 A;  4KVM E;  5JPH A;  4C2Y A;  4H2K A;  3ISX A;  2XEF A;  4JD6 A;  1XBU A;  2B4D B;  2PRB A;  1BOB A;  2IL4 A;  1PU9 A;  1KWM A;  2PJ6 A;  2Z3P A;  5EBV A;  3PB8 X;  2AFM A;  4OC0 A;  5KTA A;  1IYK A;  3IGR A;  1UWY A;  2B5G A;  3SI0 A;  5A28 A;  5DS0 A;  2ZW5 A;  4JXR A;  4NF1 A;  1IIC A;  4ZYQ A;  4R3K A;  1UFH A;  1ZLI A;  2BO9 A;  2F8H A;  4QBJ A;  2DF5 A;  2HQY A;  4H89 A;  1YW4 A;  3RNZ A;  5H86 A;  5LRG A;  2FL4 A;  3PBB A;  4J3G A;  4PXE A;  1JQG A;  1Z8X A;  2ABZ A;  3B3T A;  2I79 A;  5K8N A;  4XPL A;  3FEC A;  4FD4 A;  1YRE A;  2PJC A;  2ZXV A;  1PUA A;  3QAY A;  3LMS A;  2FXF A;  5AGE A;  5BWA B;  4P4B A;  2ZEH A;  1MJA A;  4M6I A;  1LAP A;  1GYT A;  2VZZ A;  1BO4 A;  3FEE A;  2FIA A;  4AVC A;  4RS2 A;  2ZEP A;  4H6Z A;  2ZEL A;  4MHD A;  4UWI A;  1VHO A;  4NFR A;  3SJG A;  3SI2 A;  3KQZ A;  3B7I A;  2OU2 A;  4KUB A;  2FCK A;  3TCV A;  2C6P A;  2KCW A;  2AFW A;  1NE9 A;  4KSI A;  4A94 A;  1Y7R A;  2QEC A;  1YX0 A;  4FD7 A;  4M3S A;  4ONU A;  2BUE A;  4CAF A;  4YWY A;  4CGP A;  4CYN A;  1LRZ A;  1M1D A;  5G21 A;  3NA6 A;  4NGN A;  1CP7 A;  2QJ8 A;  3SJX A;  2CNS A;  2P6E A;  3H8E A;  3V8I A;  3GIU A;  3DNS A;  4OME A;  2REE A;  2ZPA A;  4MI4 A;  1LAM A;  1VIX A;  4OC4 A;  2ZW6 A;  5C88 A;  4GM5 A;  4HPS A;  5F49 A;  5THW A;  4E2A A;  3D7D A;  1XMB A;  4ZX8 A;  5FVJ A;  4M6G A;  3RZA A;  3V7Z A;  4P45 A;  4P6Y A;  1HDU A;  4OC2 A;  3S9M A;  4AVB A;  5CBM A;  2NMT A;  4QVT A;  4CRY B;  2YNE A;  4P4E A;  4EFD A;  4AB7 A;  4MXU A;  2OZH A;  2J9A A;  5G20 A;  5IB0 A;  4AG7 A;  1RXT A;  3FVL A;  3PP9 A;  1ARL A;  2Z3M A;  4EME A;  2VL1 A;  2F5I A;  4R87 A;  4ZGY B;  2GRE A;  4ONW A;  4Q36 A;  2WYR A;  3L2N A;  1NMT A;  4HNW B;  2ZEM A;  3BLN A;  3TT2 A;  1YLO A;  4M6H A;  2ARH A;  4UWJ A;  4A31 A;  2OH1 A;  1F57 A;  3CDX A;  1YK3 A;  1YW6 A;  4MFP A;  3V38 A;  1Y9W A;  3NH5 A;  2FVG A;  4O23 A;  3QNV A;  2QIR A;  5LYI A;  4OID A;  4KOW A;  4JLY A;  2R1I A;  4KOS A;  4MHN A;  4AVA A;  3F8K A;  2IJZ A;  4CYQ A;  5D8N A;  2PJA A;  4BMH A;  1AMP A;  4R6T A;  2B3V A;  3SI1 A;  4CGO A;  3G3S A;  1M4G A;  4KVX A;  1XOV A;  3BJ8 A;  4UEF A;  5G22 A;  4P10 A;  2G3A A;  3K2K A;  1CP6 A;  3KR5 A;  1WK4 A;  3R9E A;  4YFJ A;  5AG4 A;  3B3S A;  3B8G A;  4IF5 A;  4JXQ A;  5KTD A;  1KUX A;  3K9U A;  2Z3L A;  3NE8 A;  2XEJ A;  5LYF A;  3ZJ0 A;  4U9Y A;  3R96 A;  3KHX A;  4R3L A;  4Z65 A;  1AUG A;  4QB9 A;  3RAM A;  1B87 A;  3D8P A;  2GLF A;  2OZU A;  2PE3 A;  1YLE A;  4PXB A;  2Y0M A;  4RI1 A;  2NYQ A;  3IC1 A;  1AYE A;  3CPX A;  5DWM A;  5G1Z A;  4XNH C;  2FE7 A;  2JBJ A;  1IID A;  4P4D A;  4AXV A;  4ZY1 A;  4HKF A;  5F48 A;  3SXN A;  5JM6 A;  3KZW A;  2CY2 A;  2R98 A;  4DYO A;  2BL1 A;  2G9D A;  2ZEE A;  5J8F A;  1ZG7 A;  2V8G A;  2FS5 A;  4CAX A;  3DR6 A;  4LUA A;  3PEI A;  4C2Z A;  2Z3K A;  4A33 A;  5CNP A;  3S9L A;  2WSA A;  4QC6 A;  1XEB A;  4TNU A;  3KL9 A;  4JYW A;  1YME A;  1YQE A;  1Q2C A;  2WPW A;  2ZEF A;  2AFU A;  5CPA A;  4XPD C;  1BAV A;  2RB7 A;  1ZG8 A;  3R9G A;  2ODF A;  2EUI A;  4EVY A;  3VAT A;  4KZT A;  3SJF A;  2DEA A;  1R57 A;  3IEH A;  4A95 A;  1NSL A;  4ZY0 A;  4UEZ A;  1KUV A;  1MJ9 A;  2CXA A;  1Y9K A;  1QSM A;  1Z8T A;  5F47 A;  3EY5 A;  2P6F A;  3PB9 X;  2Q51 A;  4FD6 A;  3WC7 A;  1GHE A;  3KQX A;  4AG9 A;  1QQ9 A;  2PJ9 A;  2CIJ A;  2NSM A;  4B12 A;  1R3N A;  4YU9 A;  2VZY A;  2Z0Z A;  4UFW A;  5EC4 A;  2CTB A;  4LQ6 A;  3R9F A;  1Y0R A; 
#chains in the Genus database with same CATH homology
 2C6C A;  3BXM A;  1TKJ A;  1F2O A;  2CF4 A;  4EWT A;  2Q43 A;  4NGM A;  2OOT A;  5LRJ A;  1DE4 C;  4B6Z A;  5F09 A;  5JM6 A;  2PVW A;  3GUX A;  4A37 A;  3WT4 A;  5HVG A;  4FUU A;  3I1U A;  2PIY A;  3TC8 A;  1Y0Y A;  2ZOG A;  3CT9 A;  3D67 A;  4K3N A;  4OC3 A;  3NH4 A;  4NGR A;  5K8M A;  3MRU A;  2PJ8 A;  1YSJ A;  1DTD A;  1ZG9 A;  2PJ4 A;  3KHZ A;  4NGP A;  2I3C A;  4FWU A;  2CTC A;  2EK9 A;  4JZ0 A;  4IK2 A;  2PJ3 A;  3DLJ A;  2EWB A;  4P4J A;  2V8V A;  1OBR A;  1TXR A;  4R7M A;  2PCU A;  3FED A;  1TKF A;  2ANP A;  5LYL A;  6CPA A;  3PFE A;  2XEG A;  3VAR A;  2PVV A;  5JGF A;  2HC9 A;  1EE3 P;  3NFZ A;  2PJ0 A;  1CBX A;  5K8P A;  3LWU A;  4X2T A;  2O53 A;  4MCP A;  1R43 A;  3D4U A;  1LCP A;  3WC5 A;  2QVP A;  3CPA A;  4MCS A;  2HB6 A;  3KI9 A;  4MRI A;  1CPS A;  1BPN A;  3N5F A;  2PIZ A;  3B3W A;  2V77 A;  4UIA A;  4CPA A;  3KGQ A;  3BI1 A;  3D66 A;  4P44 A;  1CG2 A;  4NGS A;  3B35 A;  4OKO A;  3GLJ A;  4P4F A;  4BD9 A;  3D68 A;  3B2Y A;  3H8F A;  2PJ5 A;  3IO1 A;  3S9N A;  3BHX A;  4UEE A;  3PB7 X;  4FAI A;  2AFZ A;  3H8G A;  3ISZ A;  1NSA A;  5HXD A;  5J1Q A;  3TX8 A;  5HVH A;  2ZEN A;  3D7F A;  1TF9 A;  1PYT B;  4PQA A;  4A38 A;  4NJQ A;  4TWE A;  1H8L A;  2C1C A;  2ZOF A;  1XRY A;  3K9T A;  4LQG A;  1ZLH A;  1BPM A;  1Y7E A;  4OC5 A;  3B3C A;  2WZN A;  4A39 A;  1TF8 A;  2EK8 A;  3D7H A;  3IJ3 A;  4G1P A;  4PXD A;  4P4I A;  4MCR A;  4F9V A;  4Q7A A;  2IMO A;  2JEW A;  2CTB A;  2ZED A;  4DJL A;  4IHM A;  5D29 A;  1IY7 A;  1F2P A;  1Q7L A;  4MHY A;  4ZY2 A;  3HLP A;  1Z5R A;  2F7V A;  2AFO A;  3KAS A;  4DUK A;  4X3R A;  3WC6 A;  4NJR A;  1FNO A;  4UIB A;  3PFO A;  3IIB A;  3FH4 A;  3GB0 A;  1FT7 A;  5JH9 A;  3VH9 A;  3FMC A;  1HDQ A;  2PRQ A;  4RUH A;  3PB6 X;  3KR4 A;  5LRK A;  3PRT A;  5LYD A;  7CPA A;  4PPZ A;  1TKH A;  4WWV A;  1CX8 A;  2RFH A;  2IQ6 A;  1LOK A;  2ZEG A;  2PJB A;  1BLL E;  4NGQ A;  1Z2L A;  1XJO A;  4R8F A;  1LFW A;  3T8W A;  2JBK A;  1ELM P;  2AFS A;  3PB4 X;  1Z8L A;  4W9Y A;  2V8H A;  3FF3 A;  4R76 A;  2PJ1 A;  4F8Z A;  1LAN A;  1CPX A;  3IFE A;  4PXC A;  4WJB A;  3MN8 A;  3RBU A;  4ZX9 A;  2O4H A;  2PJ7 A;  1PCA A;  1ARM A;  4UF4 A;  1ELL P;  1XFO A;  1M4L A;  5HVF A;  2OR4 A;  4MMO A;  4OIW A;  3FJU A;  3NH8 A;  3D7G A;  2GLJ A;  3IWW A;  4NGT A;  3PBE A;  3BI0 A;  2C6G A;  4X8I A;  5K8O A;  2AFX A;  2QYV A;  1VGY A;  3HUV A;  2V8D A;  2PJ2 A;  3FX6 A;  2GU2 A;  3DGV A;  2POK A;  3WAB A;  2Q4Z A;  1QMU A;  5ELY A;  2BOA A;  8CPA A;  4MCQ A;  4IAV A;  3B3V A;  4F9U A;  4FBE A;  4ZI6 A;  3SJE A;  4MHP A;  3JRU A;  4OC1 A;  4OP4 A;  1VHE A;  4MHZ A;  5I4M A;  2ZEO A;  2BCO A;  1IGB A;  1HEE A;  1RTQ A;  5IB9 A;  4H2K A;  3ISX A;  2XEF A;  1XBU A;  2PJ6 A;  1KWM A;  3PB8 X;  2AFM A;  4OC0 A;  3SI0 A;  1UWY A;  5DS0 A;  4ZYQ A;  2BO9 A;  1ZLI A;  2F8H A;  1YW4 A;  5LRG A;  3PBB A;  4PXE A;  1JQG A;  2ABZ A;  3B3T A;  5K8N A;  3FEC A;  2PJC A;  3LMS A;  4P4B A;  2ZEH A;  1LAP A;  1GYT A;  3FEE A;  2ZEP A;  2ZEL A;  1VHO A;  4NFR A;  3SJG A;  3SI2 A;  3KQZ A;  3B7I A;  2C6P A;  4A94 A;  2AFW A;  4KSI A;  4YWY A;  3NA6 A;  4NGN A;  1CP7 A;  2QJ8 A;  3SJX A;  3H8E A;  4OME A;  4OC4 A;  1LAM A;  1VIX A;  4GM5 A;  5THW A;  3D7D A;  1XMB A;  4ZX8 A;  3RZA A;  3V7Z A;  4P45 A;  4P6Y A;  1HDU A;  4OC2 A;  3S9M A;  5CBM A;  4P4E A;  4EFD A;  4MXU A;  2J9A A;  3FVL A;  1ARL A;  4EME A;  2VL1 A;  2GRE A;  4ONW A;  2WYR A;  3L2N A;  2ZEM A;  1YLO A;  1F57 A;  3CDX A;  1YW6 A;  3V38 A;  3NH5 A;  2FVG A;  4O23 A;  3QNV A;  5LYI A;  4OID A;  4MHN A;  2IJZ A;  5D8N A;  2PJA A;  1AMP A;  4R6T A;  3SI1 A;  4UEF A;  4P10 A;  3K2K A;  1CP6 A;  3KR5 A;  3B3S A;  2XEJ A;  5LYF A;  3KHX A;  4Z65 A;  3RAM A;  2GLF A;  2PE3 A;  4PXB A;  2NYQ A;  3IC1 A;  1AYE A;  3CPX A;  2JBJ A;  4AXV A;  4P4D A;  4ZY1 A;  3KZW A;  4DYO A;  2G9D A;  2ZEE A;  1ZG7 A;  2V8G A;  3S9L A;  3PEI A;  4TNU A;  3KL9 A;  4JYW A;  1YME A;  2ZEF A;  2AFU A;  5CPA A;  1BAV A;  2RB7 A;  1ZG8 A;  3VAT A;  3SJF A;  2DEA A;  3IEH A;  4ZY0 A;  4UEZ A;  3PB9 X;  2Q51 A;  3WC7 A;  3KQX A;  1QQ9 A;  2PJ9 A;  2CIJ A;  2NSM A;  1R3N A;  4YU9 A;  2XEI A;  1Y0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...