2DEAA

Crystal structure of the aminopeptidase of aeromonas proteolytica at ph 4.7
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
publication title The high-resolution structures of the neutral and the low pH crystals of aminopeptidase from Aeromonas proteolytica.
pubmed doi rcsb
source organism Vibrio proteolyticus
molecule tags Hydrolase
total genus 110
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2006-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2deaA00
1BLLE 4P4FA 3GB0A 2HB6A 5JH9A 2PVWA 4R76A 2ZEEA 1YMEA 3H8FA 4AXVA 4MHPA 2IJZA 3TC8A 3KI9A 3WT4A 2ZEGA 3PRTA 2Q4ZA 4R6TA 4X8IA 3PB4X 4MHZA 3KHZA 4PQAA 1XFOA 1TKHA 4MHNA 2PJ2A 1FNOA 1HDUA 3IFEA 5LYFA 2ZEMA 2ZEPA 2IMOA 2V8HA 3IJ3A 2EK8A 1KWMA 2V8VA 3IC1A 3HUVA 2XEFA 5K8PA 4ONWA 4OP4A 8CPAA 3WC5A 2BO9A 3TX8A 2AFWA 4NJQA 3VH9A 4NJRA 2G9DA 3IIBA 3ISZA 4P4BA 2I3CA 2C1CA 4P4JA 2GLJA 3CT9A 3I1UA 3BI0A 4NFRA 1VHEA 3B3CA 2CF4A 4CPAA 2AFMA 4NGQA 1F57A 2AFOA 4NGRA 2POKA 4FBEA 3S9NA 2AFZA 4UEFA 2QYVA 4GM5A 3PBBA 4EMEA 1HDQA 4NGSA 4EWTA 3BXMA 3D68A 3S9LA 5DS0A 1NSAA 2ZEDA 4TWEA 3IWWA 4OC0A 3HLPA 4MCSA 3CPXA 4RUHA 4P6YA 1ZLHA 1YW4A 1Z5RA 2GU2A 4PXCA 3PB6X 1F2OA 4X3RA 3RAMA 1CP6A 1XBUA 5HXDA 2V77A 3KR5A 4OC4A 3KHXA 1PYTB 3PB8X 2ZOFA 3H8GA 3PEIA 3N5FA 1R3NA 5HVFA 4F9VA 3FH4A 3CDXA 3GUXA 4ZY0A 1Y7EA 3CPAA 2JBKA 3D66A 2IQ6A 2RFHA 2ZOGA 4W9YA 2PCUA 5K8NA 3FECA 4DUKA 1TXRA 1YSJA 2WZNA 3NH8A 3PFEA 1BAVA 3PFOA 1JQGA 1ZG9A 2XEJA 4FAIA 4G1PA 3FJUA 1CPXA 2EK9A 1Z8LA 5K8OA 1DTDA 4R7MA 3D7FA 2ZEFA 4X2TA 3ISXA 1TKFA 2QJ8A 4P45A 2PJ4A 3NFZA 3FEEA 4OC3A 1VGYA 4PPZA 1ELMP 4WWVA 4Z65A 2Q43A 3B35A 3NH4A 4A37A 3DLJA 4MXUA 5LRKA 2AFXA 3B3TA 4ZX8A 4UF4A 1BPNA 3FEDA 3KGQA 3WC6A 1LANA 2C6PA 1RTQA 5JM6A 3QNVA 1LAPA 3D7DA 3V38A 1H8LA 4NGMA 1Z2LA 1BPMA 2NYQA 4UIBA 4P44A 5LRGA 2JEWA 4JZ0A 2AFUA 5I4MA 2V8DA 4OC1A 1PCAA 2RB7A 3SJEA 4A94A 1Q7LA 5CPAA 3B3SA 4H2KA 4DYOA 3PBEA 3PB7X 2O53A 1Y0YA 3MN8A 5LYDA 4FUUA 4R8FA 5K8MA 3SI1A 4F8ZA 4OKOA 3PB9X 3S9MA 2V8GA 5LRJA 1CP7A 2J9AA 2PJ9A 3KQXA 3V7ZA 3D67A 1IY7A 3MRUA 4A38A 2CTCA 1LFWA 4ZY1A 1ELLP 5THWA 3IO1A 2PJ7A 4DJLA 2ZENA 1TF8A 4ZY2A 2ZELA 1LOKA 5D29A 3KL9A 4K3NA 2PE3A 3KASA 4F9UA 2C6GA 3NH5A 1ARMA 2HC9A 2DEAA 4OMEA 3K9TA 3SI0A 4NGNA 3SJGA 2AFSA 2PJAA 4NGTA 1QMUA 2WYRA 2PIYA 3KQZA 3D7HA 1AMPA 3K2KA 4PXDA 5CBMA 4IK2A 1LCPA 2F7VA 3SJFA 3LWUA 6CPAA 4P4DA 1DE4C 1FT7A 1M4LA 1IGBA 4MHYA 2ANPA 2CIJA 2VL1A 4O23A 4JYWA 4YU9A 2PJ8A 2O4HA 1ZG8A 2FVGA 2QVPA 2JBJA 3D7GA 4MCPA 2BCOA 4MCQA 1XMBA 1AYEA 1UWYA 2PJ1A 4UEZA 1YLOA 1XJOA 3H8EA 4UIAA 2BOAA 3B2YA 5ELYA 1VIXA 4KSIA 4OC5A 7CPAA 2CTBA 4ZYQA 4LQGA 3GLJA 4PXEA 4NGPA 3JRUA 1CBXA 3B3WA 2PRQA 1TKJA 5HVGA 4WJBA 1QQ9A 4BD9A 3WC7A 3VATA 5IB9A 4P10A 3RBUA 5LYLA 4Q7AA 4P4IA 3SI2A 4OC2A 2EWBA 2PJ0A 3D4UA 3DGVA 2PJBA 2ZEHA 3L2NA 3SJXA 3B7IA 1GYTA 1Y0RA 4MMOA 4UEEA 3FX6A 1OBRA 1TF9A 4ZI6A 5LYIA 4IHMA 3B3VA 1XRYA 4A39A 3KR4A 2Q51A 1ARLA 2GLFA 4P4EA 1ZG7A 2PIZA 2XEIA 4PXBA 3WABA 2ZEOA 1CPSA 2XEGA 4YWYA 3KZWA 2NSMA 1CG2A 4OIDA 2F8HA 2GREA 2PJ3A 4OIWA 3RZAA 3BI1A 5J1QA 4FWUA 5D8NA 4EFDA 3T8WA 5HVHA 4ZX9A 5JGFA 4IAVA 1VHOA 2PJ5A 3FVLA 2PJCA 1ZLIA 3BHXA 2PJ6A 1CX8A 5F09A 1LAMA 4TNUA 1R43A 2OR4A 2ABZA 2PVVA 1F2PA 3FMCA 1EE3P 4MRIA 3IEHA 3FF3A 4B6ZA 2OOTA 2C6CA 1YW6A 3LMSA 3NA6A 1HEEA 4MCRA 3VARA
chains in the Genus database with same CATH superfamily
1BLLE 4P4FA 1YK3A 4CS0B 3EC4A 2BEIA 3GB0A 5KTCA 2FXFA 4KUAA 4KOVA 3TO7A 2HB6A 5JH9A 2PVWA 4JJXA 4R76A 3E0KA 2ZEEA 4H6ZA 1YMEA 1K4JA 4KOWA 2OH1A 3EY5A 3H8FA 4AXVA 4RS2A 4MHPA 2IJZA 3F5BA 1QSOA 4CRYB 3TC8A 4KORA 5J8CA 3IGRA 3KI9A 2GIVA 3WT4A 1VKCA 4JD6A 5CNPA 2ZEGA 1M4IA 3PRTA 4LX9A 2Q4ZA 2D4PA 4LQ6A 4E0AA 2OZHA 4R6TA 2PQ8A 2CY2A 4C2XA 2PSWA 4B5OA 4X8IA 2Z10A 3PB4X 4MFJA 4DNCA 4MHZA 2A4NA 3KHZA 1P0HA 4M85A 1CM0A 2CNTA 4PQAA 1Z8XA 1XMTA 4F0YA 1XFOA 2HV2A 5AG6A 1TKHA 4MHNA 2PJ2A 3JTKA 3TT2A 1MK4A 4FD4A 1FNOA 2P0WA 5EMIA 1HDUA 3R95A 2R7HA 3IFEA 1KZFA 5LYFA 2ZEMA 2ZEPA 2FIWA 2R8VA 2IMOA 2V8HA 3IJ3A 4Q36A 2EK8A 4CYOA 4MFPA 4NF1A 1KWMA 2Q7SA 2V8VA 4Q38A 4UBRA 2Z3NA 3IC1A 1BOBA 2XEFA 3HUVA 4MFZA 5K8PA 4CAEA 2B4DB 2JEVA 4GS4A 4XPDB 2P6FA 1BO4A 1X12A 3TTHA 1IYLA 4ONWA 4OP4A 4B10A 8CPAA 3WC5A 2ATRA 2BO9A 4KSFA 1Q2YA 2AFWA 4NJQA 4M6GA 4PSWA 3TX8A 3VH9A 4B11A 4JLYA 4NJRA 4E2AA 4CGPA 2G9DA 3IIBA 5F46A 3ISZA 4P4BA 4H89A 2I3CA 3SHPA 2CXAA 2C1CA 3QB8A 1U6MA 2ZW4A 3LODA 1YREA 4P4JA 2J8NA 2F5IA 3N7ZA 1Z4RA 2WPWA 2WSAA 4KOUA 2D4OA 3ZJ0A 2GLJA 4U9ZA 4UFXA 2OZGA 2KCWA 3CT9A 4JXRA 4C2ZA 3QAHA 3I1UA 3BI0A 4KVXA 3VWEA 4A33A 4NFRA 4KOSA 4UCPA 1VHEA 3B3CA 2CF4A 3V8IA 4R3LA 4CPAA 2AFMA 4NGQA 2FSRA 1F57A 4XPDC 2Z3LA 4I49A 4C7IA 3A9LA 1S5KA 3GYAA 1KUVA 2AFOA 4NXYA 3QAYA 4NGRA 3W6SA 2POKA 1B87A 4FBEA 3PGPA 3S9NA 3ZZIA 2AFZA 3H4QA 4UEFA 3EXNA 2QYVA 4GM5A 3PBBA 4EMEA 2CNMA 1RXTA 1IB1E 4XPKA 2B3VA 1HDQA 5AG7A 4B12A 4II9A 2REEA 4CGLA 2B4DA 4NGSA 3TCVA 4B5PA 3BXMA 3D68A 4EWTA 3S9LA 5DS0A 1NSAA 2ZEDA 4TWEA 2OB0A 3IWWA 4OC0A 3HLPA 2B5GB 4MCSA 2EVNA 2ZW7A 3CPXA 4RUHA 4P6YA 2ZXVA 2H5MA 4AB7A 4OADA 3VWDA 1ZLHA 1YW4A 1N71A 1Z5RA 1P4NA 3R1KA 3BJ8A 5F47A 4MFQA 2GU2A 4PXCA 2BUEA 3PB6X 3OWCA 1M44A 1F2OA 4X3RA 2Z3PA 1TIQA 3RAMA 3TOBA 1CP6A 1XBUA 5HXDA 5IV0A 1I21A 2V77A 3JVNA 3KR5A 5AG4A 5EC4A 4OC4A 3KHXA 1L0CA 4UWJA 1PYTB 3PB8X 1YQEA 4A32A 2ZOFA 3H8GA 3PEIA 3N5FA 1R3NA 5HVFA 1VHSA 5G21A 2Z0ZA 1SQHA 1Z8WA 4F9VA 3FH4A 1QSRA 3CDXA 3D3SA 3GUXA 1Y7EA 4ZY0A 2VZYA 3CPAA 4MJ8A 2JBKA 1IICA 3D66A 4A95A 2IQ6A 2RFHA 2ZOGA 4W9YA 2PCUA 5K8NA 1YGHA 3FECA 1MJBA 3P2FA 4DUKA 1TXRA 4R57A 1YSJA 4A30A 1QSTA 2WZNA 4QB9A 5F49A 3NH8A 3B8GA 4Y49B 3PFEA 4CYPA 1BAVA 2QIRA 3PFOA 1JQGA 2Q0YA 1ZG9A 3R96A 2XEJA 4FAIA 1XF8A 3FJUA 4G1PA 4M3SA 1LRZA 3RYOA 1CPXA 2EK9A 4ONUA 5E96A 3H5ZA 1Z8LA 2G0BA 2B5GA 5K8OA 1DTDA 4R7MA 3D7FA 2ZEFA 4X2TA 2AJ6A 3ISXA 1S3ZA 1TKFA 2HQYA 2QJ8A 4P45A 2PJ4A 4JWPA 4KVME 2VEZA 3NFZA 3G8WA 3FYNA 3D2PA 3FEEA 4OC3A 4R3KA 1VGYA 1Q2DA 2AE6A 3BJ7A 4PPZA 2JDDA 3W91A 1ELMP 1ZO0A 4WWVA 4Z65A 5H84A 4Y49C 2R98A 4B5PB 2Q43A 3B35A 2OU2A 3K9UA 3NH4A 4A37A 3DLJA 2VI7A 3D2MA 4U5YA 4MXUA 5LRKA 2AFXA 2O28A 3B3TA 3IWGA 3S6FA 1OZPA 1CJWA 3S6GA 4BBHA 4ZX8A 4UF4A 1M1DA 1BPNA 3FEDA 4KLWA 1FY7A 3KGQA 4AVAA 3WC6A 1LANA 4HPSA 4C2YA 2C6PA 1RTQA 3R9EA 3CXPA 5JM6A 3QNVA 3FRMA 2G3AA 1LAPA 4F6AA 3D7DA 3V38A 3FNCA 5JPHA 1H8LA 4HNXB 1Z2LA 4FD5A 4NGMA 3P2HA 4QVTA 4CGMA 1BPMA 2K5TA 2NYQA 4UIBA 4BINA 4P44A 5LRGA 4UFVA 2JEWA 3LACA 4JZ0A 5AG5A 2AFUA 5I4MA 4NCZA 2CNSA 3EFAA 2V8DA 1S7LA 3G3SA 4OC1A 1PCAA 1XEBA 1A2ZA 2RB7A 3SJEA 5EBVA 4A94A 1Q7LA 4X5KA 5CPAA 4MI4A 4RN7A 3B3SA 4H2KA 1PU9A 4J3GA 4DYOA 3PBEA 3PB7X 2O53A 3D8PA 3IWEA 4YGOA 1Y0YA 3MGDA 3MN8A 4KOXA 5LYDA 4FUUA 4R8FA 5K8MA 3SXNA 2FS5A 3SI1A 2IL4A 4F8ZA 2J8MA 2R1IA 3LD2A 4OKOA 1UFHA 4B13A 3PB9X 3S9MA 4UCMA 2P6GA 3GKRA 2V8GA 4ZBGA 5LRJA 5A28A 1CP7A 1NSLA 2J9AA 2PJ9A 3KQXA 4L8AA 2JLMA 1YR0A 3V7ZA 3D67A 4KOYA 3CXSA 4UFWA 4C68A 1IY7A 5JQ4A 3MRUA 5AGEA 4A38A 2CTCA 1M4DA 1LFWA 4CYNA 3FB3A 4ZY1A 4HNWB 1KUXA 1ELLP 2Q04A 3IO1A 5THWA 4NEXA 4A31A 2B3UA 2PJ7A 3DDDA 2REFA 2BSWA 3W6XA 4MFLA 2X7BA 2BL1A 4IF5A 4U9YA 5G20A 4DJLA 2ZENA 3BLNA 1TF8A 4ZY2A 2EUIA 2VZZA 2ZELA 5A27A 1LOKA 2G3TA 2Q4VA 5D29A 4YRHA 3CXQA 3DR6A 3KL9A 4K3NA 2YNCC 2C27A 2PE3A 3KASA 3S6KA 4F9UA 2Z3MA 3IU2A 4A2ZA 2C6GA 4QBJA 3NH5A 1ARMA 2HC9A 2DEAA 4OMEA 2Z3KA 3K9TA 2P6EA 4UA3A 4PK2A 3SI0A 4NGNA 3PP9A 3SJGA 2AFSA 2PJAA 4KSAA 3JUWA 4FD6A 2HUZA 4OLLA 4KUBA 2Z11A 4UWIA 5FVJA 3T90A 4HKFA 1YVOA 4NGTA 1QMUA 1NE9A 2YNCA 2NMTA 2Y0MA 2WYRA 5HH1A 4AVBA 1GHEA 5GCNA 2PIYA 2Z3OA 3D7HA 2ODFA 3KQZA 1AMPA 3K2KA 4KLVA 4PXDA 4R87A 5CBMA 4IK2A 1LCPA 2F7VA 1M4GA 3FBUA 3SJFA 4CAFA 3LWUA 5J8FA 4C7HA 1Y9WA 3NE7A 6CPAA 4P4DA 1DE4C 1FT7A 5G1ZA 1M4LA 1IGBA 2CIJA 2ANPA 4MHYA 4KS9A 4XNHB 2VL1A 1YX0A 3C26A 1QSMA 4O23A 3FXTA 1ON0A 3T9YA 1V0CA 1Z9UA 1IU8A 4JYWA 4YU9A 4CAVA 5H86A 3UY5A 4K30A 2DPTA 2PJ8A 5IX3A 1I12A 5DWNA 4KVOE 4KOTA 2FL4A 2O4HA 1ZG8A 1IIDA 2FVGA 2QVPA 3DSBA 4H6UA 2JBJA 1IOIA 3D7GA 3CZXA 5KTAA 4MCPA 1Y9KA 2BCOA 4MCQA 1XMBA 4MHDA 3GIUA 1AYEA 1UWYA 2PJ1A 4UEZA 2WUUA 1YLOA 1XJOA 3H8EA 2EO8A 4UIAA 2BOAA 2YNDA 3B2YA 1NMTA 3F0AA 4KZTA 5ELYA 2QMLA 1VIXA 4KSIA 4OC5A 3DR8A 2PR1A 7CPAA 2I79A 4PSXA 2CTBA 1MJAA 2DXQA 4ZYQA 4LQGA 3GLJA 3TFYA 2J8RA 2WPXA 4PXEA 4XNHC 1R57A 5I0CA 4NGPA 3JRUA 1CBXA 1PUAA 2GFQA 3I9SA 4AG7A 3B3WA 2PRQA 4FD7A 1RO5A 2FE7A 1TKJA 1YLEA 5HVGA 4L89A 4WJBA 1QQ9A 5DWMA 4BD9A 3WC7A 3VATA 2DF5A 2B58A 4P10A 5IB9A 2PC1A 3RBUA 5LYLA 1S7FA 5ISVA 2VQYA 4Q7AA 4P4IA 3SI2A 3S6HA 4OC2A 3GY9A 2EWBA 4HNYB 2PJ0A 3IU1A 4QUSA 4MFKA 3D4UA 3DGVA 1S7NA 2GANA 4CGNA 2VBQA 2PJBA 3R9FA 2ZEHA 3WR7A 2FCKA 4MBUA 3L2NA 2B4BA 3SJXA 3B7IA 1Z4EA 4MY3A 1GYTA 2I00A 1Y0RA 4MMOA 1S60A 4PV6A 4B14A 3FIXA 4UEEA 2FIAA 3TO9A 3FX6A 1OBRA 1TF9A 4ZI6A 2JDCA 5LYIA 4IHMA 3B3VA 1YVKA 5IB0A 1XRYA 2YGWA 1AUGA 4CAWA 2YNEA 4BMHA 4IUSA 2DPSA 4LUAA 4CGOA 4A39A 1Y7RA 1KUYA 2ZPAA 3RO0A 1IYKA 2Q51A 3KR4A 1ARLA 2GLFA 4P4EA 1ZG7A 4M6IA 4AG9A 3RNZA 2PIZA 1QSNA 2XEIA 4MY0A 4PXBA 1Q2CA 3WABA 1I1DA 1CPSA 2XEGA 2ZEOA 4YWYA 3KKWA 1WWZA 3KZWA 4R9MA 2ZW6A 4CYQA 1Z8TA 2NSMA 2PDOA 2EBJA 1CG2A 4OIDA 1MJ9A 2F8HA 2GREA 2FT0A 2PJ3A 4OIWA 3BI1A 5G22A 3RZAA 4EVYA 3DNSA 3TO6A 4ORFA 1IOFA 2PR8A 3NE8A 5J1QA 1XOVA 3I3GA 3EO4A 2GE3A 4PK3A 3TOAA 4FWUA 4E8OA 2Q4YA 4M6HA 2OZUA 4OAEA 5D8NA 1S7KA 1J4JA 2QECA 2Q7BA 4F0XA 3SXOA 4EFDA 3T8WA 4CRZB 4GXHA 4ZX9A 5HVHA 4RI1A 5JGFA 5KTDA 2ZW5A 1X10A 4IAVA 5F48A 1VHOA 4AVCA 5C82A 1XIXA 2PJ5A 3FVLA 2PJCA 2Q44A 2RC4A 4JXQA 5BWAB 1ZLIA 3PZJA 5HMNA 3TE4A 3BHXA 2PJ6A 1CX8A 5F09A 4XPLA 1LAMA 2ARHA 4TNUA 5C88A 1R43A 1XE4A 2OR4A 4UCNA 1B6BA 2ABZA 2PVVA 3R9GA 1F2PA 3FMCA 1EE3P 2PRBA 3IEHA 3FF3A 1JWQA 4MRIA 4B6ZA 4NSQA 4YFJA 2OOTA 2C6CA 1YW6A 3LMSA 4QC6A 4ZGYB 3NA6A 1HEEA 1WK4A 4CAXA 4MCRA 3VARA 2VXKA 3F8KA
chains in the Genus database with same CATH topology
1BLLE 4P4FA 3GB0A 2HB6A 5JH9A 2PVWA 4R76A 2ZEEA 1YMEA 3H8FA 4AXVA 4MHPA 2IJZA 3TC8A 3KI9A 3WT4A 2ZEGA 3PRTA 2Q4ZA 4R6TA 4X8IA 3PB4X 4MHZA 3KHZA 4PQAA 1XFOA 1TKHA 4MHNA 2PJ2A 1FNOA 1HDUA 3IFEA 5LYFA 2ZEMA 2ZEPA 2IMOA 2V8HA 3IJ3A 2EK8A 1KWMA 2V8VA 3IC1A 3HUVA 2XEFA 5K8PA 4ONWA 4OP4A 8CPAA 3WC5A 2BO9A 3TX8A 2AFWA 4NJQA 3VH9A 4NJRA 2G9DA 3IIBA 3ISZA 4P4BA 2I3CA 2C1CA 4P4JA 2GLJA 3CT9A 3I1UA 3BI0A 4NFRA 1VHEA 3B3CA 2CF4A 4CPAA 2AFMA 4NGQA 1F57A 2AFOA 4NGRA 2POKA 4FBEA 3S9NA 2AFZA 4UEFA 2QYVA 4GM5A 3PBBA 4EMEA 1HDQA 4NGSA 4EWTA 3BXMA 3D68A 3S9LA 5DS0A 1NSAA 2ZEDA 4TWEA 3IWWA 4OC0A 3HLPA 4MCSA 3CPXA 4RUHA 4P6YA 1ZLHA 1YW4A 1Z5RA 2GU2A 4PXCA 3PB6X 1F2OA 4X3RA 3RAMA 1CP6A 1XBUA 5HXDA 2V77A 3KR5A 4OC4A 3KHXA 1PYTB 3PB8X 2ZOFA 3H8GA 3PEIA 3N5FA 1R3NA 5HVFA 4F9VA 3FH4A 3CDXA 3GUXA 4ZY0A 1Y7EA 3CPAA 2JBKA 3D66A 2IQ6A 2RFHA 2ZOGA 4W9YA 2PCUA 5K8NA 3FECA 4DUKA 1TXRA 1YSJA 2WZNA 3NH8A 3PFEA 1BAVA 3PFOA 1JQGA 1ZG9A 2XEJA 4FAIA 4G1PA 3FJUA 1CPXA 2EK9A 1Z8LA 5K8OA 1DTDA 4R7MA 3D7FA 2ZEFA 4X2TA 3ISXA 1TKFA 2QJ8A 4P45A 2PJ4A 3NFZA 3FEEA 4OC3A 1VGYA 4PPZA 1ELMP 4WWVA 4Z65A 2Q43A 3B35A 3NH4A 4A37A 3DLJA 4MXUA 5LRKA 2AFXA 3B3TA 4ZX8A 4UF4A 1BPNA 3FEDA 3KGQA 3WC6A 1LANA 2C6PA 1RTQA 5JM6A 3QNVA 1LAPA 3D7DA 3V38A 1H8LA 4NGMA 1Z2LA 1BPMA 2NYQA 4UIBA 4P44A 5LRGA 2JEWA 4JZ0A 2AFUA 5I4MA 2V8DA 4OC1A 1PCAA 2RB7A 3SJEA 4A94A 1Q7LA 5CPAA 3B3SA 4H2KA 4DYOA 3PBEA 3PB7X 2O53A 1Y0YA 3MN8A 5LYDA 4FUUA 4R8FA 5K8MA 3SI1A 4F8ZA 4OKOA 3PB9X 3S9MA 2V8GA 5LRJA 1CP7A 2J9AA 2PJ9A 3KQXA 3V7ZA 3D67A 1IY7A 3MRUA 4A38A 2CTCA 1LFWA 4ZY1A 1ELLP 5THWA 3IO1A 2PJ7A 4DJLA 2ZENA 1TF8A 4ZY2A 2ZELA 1LOKA 5D29A 3KL9A 4K3NA 2PE3A 3KASA 4F9UA 2C6GA 3NH5A 1ARMA 2HC9A 2DEAA 4OMEA 3K9TA 3SI0A 4NGNA 3SJGA 2AFSA 2PJAA 4NGTA 1QMUA 2WYRA 2PIYA 3KQZA 3D7HA 1AMPA 3K2KA 4PXDA 5CBMA 4IK2A 1LCPA 2F7VA 3SJFA 3LWUA 6CPAA 4P4DA 1DE4C 1FT7A 1M4LA 1IGBA 4MHYA 2ANPA 2CIJA 2VL1A 4O23A 4JYWA 4YU9A 2PJ8A 2O4HA 1ZG8A 2FVGA 2QVPA 2JBJA 3D7GA 4MCPA 2BCOA 4MCQA 1XMBA 1AYEA 1UWYA 2PJ1A 4UEZA 1YLOA 1XJOA 3H8EA 4UIAA 2BOAA 3B2YA 5ELYA 1VIXA 4KSIA 4OC5A 7CPAA 2CTBA 4ZYQA 4LQGA 3GLJA 4PXEA 4NGPA 3JRUA 1CBXA 3B3WA 2PRQA 1TKJA 5HVGA 4WJBA 1QQ9A 4BD9A 3WC7A 3VATA 5IB9A 4P10A 3RBUA 5LYLA 4Q7AA 4P4IA 3SI2A 4OC2A 2EWBA 2PJ0A 3D4UA 3DGVA 2PJBA 2ZEHA 3L2NA 3SJXA 3B7IA 1GYTA 1Y0RA 4MMOA 4UEEA 3FX6A 1OBRA 1TF9A 4ZI6A 5LYIA 4IHMA 3B3VA 1XRYA 4A39A 3KR4A 2Q51A 1ARLA 2GLFA 4P4EA 1ZG7A 2PIZA 2XEIA 4PXBA 3WABA 2ZEOA 1CPSA 2XEGA 4YWYA 3KZWA 2NSMA 1CG2A 4OIDA 2F8HA 2GREA 2PJ3A 4OIWA 3RZAA 3BI1A 5J1QA 4FWUA 5D8NA 4EFDA 3T8WA 5HVHA 4ZX9A 5JGFA 4IAVA 1VHOA 2PJ5A 3FVLA 2PJCA 1ZLIA 3BHXA 2PJ6A 1CX8A 5F09A 1LAMA 4TNUA 1R43A 2OR4A 2ABZA 2PVVA 1F2PA 3FMCA 1EE3P 4MRIA 3IEHA 3FF3A 4B6ZA 2OOTA 2C6CA 1YW6A 3LMSA 3NA6A 1HEEA 4MCRA 3VARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BLL E;  4P4F A;  3GB0 A;  2HB6 A;  5JH9 A;  2PVW A;  4R76 A;  2ZEE A;  1YME A;  3H8F A;  4AXV A;  4MHP A;  2IJZ A;  3TC8 A;  3KI9 A;  3WT4 A;  2ZEG A;  3PRT A;  2Q4Z A;  4R6T A;  4X8I A;  3PB4 X;  4MHZ A;  3KHZ A;  4PQA A;  1XFO A;  1TKH A;  4MHN A;  2PJ2 A;  1FNO A;  1HDU A;  3IFE A;  5LYF A;  2ZEM A;  2ZEP A;  2IMO A;  2V8H A;  3IJ3 A;  2EK8 A;  1KWM A;  2V8V A;  3IC1 A;  3HUV A;  2XEF A;  5K8P A;  4ONW A;  4OP4 A;  8CPA A;  3WC5 A;  2BO9 A;  3TX8 A;  2AFW A;  4NJQ A;  3VH9 A;  4NJR A;  2G9D A;  3IIB A;  3ISZ A;  4P4B A;  2I3C A;  2C1C A;  4P4J A;  2GLJ A;  3CT9 A;  3I1U A;  3BI0 A;  4NFR A;  1VHE A;  3B3C A;  2CF4 A;  4CPA A;  2AFM A;  4NGQ A;  1F57 A;  2AFO A;  4NGR A;  2POK A;  4FBE A;  3S9N A;  2AFZ A;  4UEF A;  2QYV A;  4GM5 A;  3PBB A;  4EME A;  1HDQ A;  4NGS A;  4EWT A;  3BXM A;  3D68 A;  3S9L A;  5DS0 A;  1NSA A;  2ZED A;  4TWE A;  3IWW A;  4OC0 A;  3HLP A;  4MCS A;  3CPX A;  4RUH A;  4P6Y A;  1ZLH A;  1YW4 A;  1Z5R A;  2GU2 A;  4PXC A;  3PB6 X;  1F2O A;  4X3R A;  3RAM A;  1CP6 A;  1XBU A;  5HXD A;  2V77 A;  3KR5 A;  4OC4 A;  3KHX A;  1PYT B;  3PB8 X;  2ZOF A;  3H8G A;  3PEI A;  3N5F A;  1R3N A;  5HVF A;  4F9V A;  3FH4 A;  3CDX A;  3GUX A;  4ZY0 A;  1Y7E A;  3CPA A;  2JBK A;  3D66 A;  2IQ6 A;  2RFH A;  2ZOG A;  4W9Y A;  2PCU A;  5K8N A;  3FEC A;  4DUK A;  1TXR A;  1YSJ A;  2WZN A;  3NH8 A;  3PFE A;  1BAV A;  3PFO A;  1JQG A;  1ZG9 A;  2XEJ A;  4FAI A;  4G1P A;  3FJU A;  1CPX A;  2EK9 A;  1Z8L A;  5K8O A;  1DTD A;  4R7M A;  3D7F A;  2ZEF A;  4X2T A;  3ISX A;  1TKF A;  2QJ8 A;  4P45 A;  2PJ4 A;  3NFZ A;  3FEE A;  4OC3 A;  1VGY A;  4PPZ A;  1ELM P;  4WWV A;  4Z65 A;  2Q43 A;  3B35 A;  3NH4 A;  4A37 A;  3DLJ A;  4MXU A;  5LRK A;  2AFX A;  3B3T A;  4ZX8 A;  4UF4 A;  1BPN A;  3FED A;  3KGQ A;  3WC6 A;  1LAN A;  2C6P A;  1RTQ A;  5JM6 A;  3QNV A;  1LAP A;  3D7D A;  3V38 A;  1H8L A;  4NGM A;  1Z2L A;  1BPM A;  2NYQ A;  4UIB A;  4P44 A;  5LRG A;  2JEW A;  4JZ0 A;  2AFU A;  5I4M A;  2V8D A;  4OC1 A;  1PCA A;  2RB7 A;  3SJE A;  4A94 A;  1Q7L A;  5CPA A;  3B3S A;  4H2K A;  4DYO A;  3PBE A;  3PB7 X;  2O53 A;  1Y0Y A;  3MN8 A;  5LYD A;  4FUU A;  4R8F A;  5K8M A;  3SI1 A;  4F8Z A;  4OKO A;  3PB9 X;  3S9M A;  2V8G A;  5LRJ A;  1CP7 A;  2J9A A;  2PJ9 A;  3KQX A;  3V7Z A;  3D67 A;  1IY7 A;  3MRU A;  4A38 A;  2CTC A;  1LFW A;  4ZY1 A;  1ELL P;  5THW A;  3IO1 A;  2PJ7 A;  4DJL A;  2ZEN A;  1TF8 A;  4ZY2 A;  2ZEL A;  1LOK A;  5D29 A;  3KL9 A;  4K3N A;  2PE3 A;  3KAS A;  4F9U A;  2C6G A;  3NH5 A;  1ARM A;  2HC9 A;  2DEA A;  4OME A;  3K9T A;  3SI0 A;  4NGN A;  3SJG A;  2AFS A;  2PJA A;  4NGT A;  1QMU A;  2WYR A;  2PIY A;  3KQZ A;  3D7H A;  1AMP A;  3K2K A;  4PXD A;  5CBM A;  4IK2 A;  1LCP A;  2F7V A;  3SJF A;  3LWU A;  6CPA A;  4P4D A;  1DE4 C;  1FT7 A;  1M4L A;  1IGB A;  4MHY A;  2ANP A;  2CIJ A;  2VL1 A;  4O23 A;  4JYW A;  4YU9 A;  2PJ8 A;  2O4H A;  1ZG8 A;  2FVG A;  2QVP A;  2JBJ A;  3D7G A;  4MCP A;  2BCO A;  4MCQ A;  1XMB A;  1AYE A;  1UWY A;  2PJ1 A;  4UEZ A;  1YLO A;  1XJO A;  3H8E A;  4UIA A;  2BOA A;  3B2Y A;  5ELY A;  1VIX A;  4KSI A;  4OC5 A;  7CPA A;  2CTB A;  4ZYQ A;  4LQG A;  3GLJ A;  4PXE A;  4NGP A;  3JRU A;  1CBX A;  3B3W A;  2PRQ A;  1TKJ A;  5HVG A;  4WJB A;  1QQ9 A;  4BD9 A;  3WC7 A;  3VAT A;  5IB9 A;  4P10 A;  3RBU A;  5LYL A;  4Q7A A;  4P4I A;  3SI2 A;  4OC2 A;  2EWB A;  2PJ0 A;  3D4U A;  3DGV A;  2PJB A;  2ZEH A;  3L2N A;  3SJX A;  3B7I A;  1GYT A;  1Y0R A;  4MMO A;  4UEE A;  3FX6 A;  1OBR A;  1TF9 A;  4ZI6 A;  5LYI A;  4IHM A;  3B3V A;  1XRY A;  4A39 A;  3KR4 A;  2Q51 A;  1ARL A;  2GLF A;  4P4E A;  1ZG7 A;  2PIZ A;  2XEI A;  4PXB A;  3WAB A;  2ZEO A;  1CPS A;  2XEG A;  4YWY A;  3KZW A;  2NSM A;  1CG2 A;  4OID A;  2F8H A;  2GRE A;  2PJ3 A;  4OIW A;  3RZA A;  3BI1 A;  5J1Q A;  4FWU A;  5D8N A;  4EFD A;  3T8W A;  5HVH A;  4ZX9 A;  5JGF A;  4IAV A;  1VHO A;  2PJ5 A;  3FVL A;  2PJC A;  1ZLI A;  3BHX A;  2PJ6 A;  1CX8 A;  5F09 A;  1LAM A;  4TNU A;  1R43 A;  2OR4 A;  2ABZ A;  2PVV A;  1F2P A;  3FMC A;  1EE3 P;  4MRI A;  3IEH A;  3FF3 A;  4B6Z A;  2OOT A;  2C6C A;  1YW6 A;  3LMS A;  3NA6 A;  1HEE A;  4MCR A;  3VAR A; 
#chains in the Genus database with same CATH topology
 1BLL E;  4P4F A;  1YK3 A;  4CS0 B;  3EC4 A;  2BEI A;  3GB0 A;  5KTC A;  2FXF A;  4KUA A;  4KOV A;  3TO7 A;  2HB6 A;  5JH9 A;  2PVW A;  4JJX A;  4R76 A;  3E0K A;  2ZEE A;  4H6Z A;  1YME A;  1K4J A;  4KOW A;  2OH1 A;  3EY5 A;  3H8F A;  4AXV A;  4RS2 A;  4MHP A;  2IJZ A;  3F5B A;  1QSO A;  4CRY B;  3TC8 A;  4KOR A;  5J8C A;  3IGR A;  3KI9 A;  2GIV A;  3WT4 A;  1VKC A;  4JD6 A;  5CNP A;  2ZEG A;  1M4I A;  3PRT A;  4LX9 A;  2Q4Z A;  2D4P A;  4LQ6 A;  4E0A A;  2OZH A;  4R6T A;  2PQ8 A;  2CY2 A;  4C2X A;  2PSW A;  4B5O A;  4X8I A;  2Z10 A;  3PB4 X;  4MFJ A;  4DNC A;  4MHZ A;  2A4N A;  3KHZ A;  1P0H A;  4M85 A;  1CM0 A;  2CNT A;  4PQA A;  1Z8X A;  1XMT A;  4F0Y A;  1XFO A;  2HV2 A;  5AG6 A;  1TKH A;  4MHN A;  2PJ2 A;  3JTK A;  3TT2 A;  1MK4 A;  4FD4 A;  1FNO A;  2P0W A;  5EMI A;  1HDU A;  3R95 A;  2R7H A;  3IFE A;  1KZF A;  5LYF A;  2ZEM A;  2ZEP A;  2FIW A;  2R8V A;  2IMO A;  2V8H A;  3IJ3 A;  4Q36 A;  2EK8 A;  4CYO A;  4MFP A;  4NF1 A;  1KWM A;  2Q7S A;  2V8V A;  4Q38 A;  4UBR A;  2Z3N A;  3IC1 A;  1BOB A;  2XEF A;  3HUV A;  4MFZ A;  5K8P A;  4CAE A;  2B4D B;  2JEV A;  4GS4 A;  4XPD B;  2P6F A;  1BO4 A;  1X12 A;  3TTH A;  1IYL A;  4ONW A;  4OP4 A;  4B10 A;  8CPA A;  3WC5 A;  2ATR A;  2BO9 A;  4KSF A;  1Q2Y A;  2AFW A;  4NJQ A;  4M6G A;  4PSW A;  3TX8 A;  3VH9 A;  4B11 A;  4JLY A;  4NJR A;  4E2A A;  4CGP A;  2G9D A;  3IIB A;  5F46 A;  3ISZ A;  4P4B A;  4H89 A;  2I3C A;  3SHP A;  2CXA A;  2C1C A;  3QB8 A;  1U6M A;  2ZW4 A;  3LOD A;  1YRE A;  4P4J A;  2J8N A;  2F5I A;  3N7Z A;  1Z4R A;  2WPW A;  2WSA A;  4KOU A;  2D4O A;  3ZJ0 A;  2GLJ A;  4U9Z A;  4UFX A;  2OZG A;  2KCW A;  3CT9 A;  4JXR A;  4C2Z A;  3QAH A;  3I1U A;  3BI0 A;  4KVX A;  3VWE A;  4A33 A;  4NFR A;  4KOS A;  4UCP A;  1VHE A;  3B3C A;  2CF4 A;  3V8I A;  4R3L A;  4CPA A;  2AFM A;  4NGQ A;  2FSR A;  1F57 A;  4XPD C;  2Z3L A;  4I49 A;  4C7I A;  3A9L A;  1S5K A;  3GYA A;  1KUV A;  2AFO A;  4NXY A;  3QAY A;  4NGR A;  3W6S A;  2POK A;  1B87 A;  4FBE A;  3PGP A;  3S9N A;  3ZZI A;  2AFZ A;  3H4Q A;  4UEF A;  3EXN A;  2QYV A;  4GM5 A;  3PBB A;  4EME A;  2CNM A;  1RXT A;  1IB1 E;  4XPK A;  2B3V A;  1HDQ A;  5AG7 A;  4B12 A;  4II9 A;  2REE A;  4CGL A;  2B4D A;  4NGS A;  3TCV A;  4B5P A;  3BXM A;  3D68 A;  4EWT A;  3S9L A;  5DS0 A;  1NSA A;  2ZED A;  4TWE A;  2OB0 A;  3IWW A;  4OC0 A;  3HLP A;  2B5G B;  4MCS A;  2EVN A;  2ZW7 A;  3CPX A;  4RUH A;  4P6Y A;  2ZXV A;  2H5M A;  4AB7 A;  4OAD A;  3VWD A;  1ZLH A;  1YW4 A;  1N71 A;  1Z5R A;  1P4N A;  3R1K A;  3BJ8 A;  5F47 A;  4MFQ A;  2GU2 A;  4PXC A;  2BUE A;  3PB6 X;  3OWC A;  1M44 A;  1F2O A;  4X3R A;  2Z3P A;  1TIQ A;  3RAM A;  3TOB A;  1CP6 A;  1XBU A;  5HXD A;  5IV0 A;  1I21 A;  2V77 A;  3JVN A;  3KR5 A;  5AG4 A;  5EC4 A;  4OC4 A;  3KHX A;  1L0C A;  4UWJ A;  1PYT B;  3PB8 X;  1YQE A;  4A32 A;  2ZOF A;  3H8G A;  3PEI A;  3N5F A;  1R3N A;  5HVF A;  1VHS A;  5G21 A;  2Z0Z A;  1SQH A;  1Z8W A;  4F9V A;  3FH4 A;  1QSR A;  3CDX A;  3D3S A;  3GUX A;  1Y7E A;  4ZY0 A;  2VZY A;  3CPA A;  4MJ8 A;  2JBK A;  1IIC A;  3D66 A;  4A95 A;  2IQ6 A;  2RFH A;  2ZOG A;  4W9Y A;  2PCU A;  5K8N A;  1YGH A;  3FEC A;  1MJB A;  3P2F A;  4DUK A;  1TXR A;  4R57 A;  1YSJ A;  4A30 A;  1QST A;  2WZN A;  4QB9 A;  5F49 A;  3NH8 A;  3B8G A;  4Y49 B;  3PFE A;  4CYP A;  1BAV A;  2QIR A;  3PFO A;  1JQG A;  2Q0Y A;  1ZG9 A;  3R96 A;  2XEJ A;  4FAI A;  1XF8 A;  3FJU A;  4G1P A;  4M3S A;  1LRZ A;  3RYO A;  1CPX A;  2EK9 A;  4ONU A;  5E96 A;  3H5Z A;  1Z8L A;  2G0B A;  2B5G A;  5K8O A;  1DTD A;  4R7M A;  3D7F A;  2ZEF A;  4X2T A;  2AJ6 A;  3ISX A;  1S3Z A;  1TKF A;  2HQY A;  2QJ8 A;  4P45 A;  2PJ4 A;  4JWP A;  4KVM E;  2VEZ A;  3NFZ A;  3G8W A;  3FYN A;  3D2P A;  3FEE A;  4OC3 A;  4R3K A;  1VGY A;  1Q2D A;  2AE6 A;  3BJ7 A;  4PPZ A;  2JDD A;  3W91 A;  1ELM P;  1ZO0 A;  4WWV A;  4Z65 A;  5H84 A;  4Y49 C;  2R98 A;  4B5P B;  2Q43 A;  3B35 A;  2OU2 A;  3K9U A;  3NH4 A;  4A37 A;  3DLJ A;  2VI7 A;  3D2M A;  4U5Y A;  4MXU A;  5LRK A;  2AFX A;  2O28 A;  3B3T A;  3IWG A;  3S6F A;  1OZP A;  1CJW A;  3S6G A;  4BBH A;  4ZX8 A;  4UF4 A;  1M1D A;  1BPN A;  3FED A;  4KLW A;  1FY7 A;  3KGQ A;  4AVA A;  3WC6 A;  1LAN A;  4HPS A;  4C2Y A;  2C6P A;  1RTQ A;  3R9E A;  3CXP A;  5JM6 A;  3QNV A;  3FRM A;  2G3A A;  1LAP A;  4F6A A;  3D7D A;  3V38 A;  3FNC A;  5JPH A;  1H8L A;  4HNX B;  1Z2L A;  4FD5 A;  4NGM A;  3P2H A;  4QVT A;  4CGM A;  1BPM A;  2K5T A;  2NYQ A;  4UIB A;  4BIN A;  4P44 A;  5LRG A;  4UFV A;  2JEW A;  3LAC A;  4JZ0 A;  5AG5 A;  2AFU A;  5I4M A;  4NCZ A;  2CNS A;  3EFA A;  2V8D A;  1S7L A;  3G3S A;  4OC1 A;  1PCA A;  1XEB A;  1A2Z A;  2RB7 A;  3SJE A;  5EBV A;  4A94 A;  1Q7L A;  4X5K A;  5CPA A;  4MI4 A;  4RN7 A;  3B3S A;  4H2K A;  1PU9 A;  4J3G A;  4DYO A;  3PBE A;  3PB7 X;  2O53 A;  3D8P A;  3IWE A;  4YGO A;  1Y0Y A;  3MGD A;  3MN8 A;  4KOX A;  5LYD A;  4FUU A;  4R8F A;  5K8M A;  3SXN A;  2FS5 A;  3SI1 A;  2IL4 A;  4F8Z A;  2J8M A;  2R1I A;  3LD2 A;  4OKO A;  1UFH A;  4B13 A;  3PB9 X;  3S9M A;  4UCM A;  2P6G A;  3GKR A;  2V8G A;  4ZBG A;  5LRJ A;  5A28 A;  1CP7 A;  1NSL A;  2J9A A;  2PJ9 A;  3KQX A;  4L8A A;  2JLM A;  1YR0 A;  3V7Z A;  3D67 A;  4KOY A;  3CXS A;  4UFW A;  4C68 A;  1IY7 A;  5JQ4 A;  3MRU A;  5AGE A;  4A38 A;  2CTC A;  1M4D A;  1LFW A;  4CYN A;  3FB3 A;  4ZY1 A;  4HNW B;  1KUX A;  1ELL P;  2Q04 A;  3IO1 A;  5THW A;  4NEX A;  4A31 A;  2B3U A;  2PJ7 A;  3DDD A;  2REF A;  2BSW A;  3W6X A;  4MFL A;  2X7B A;  2BL1 A;  4IF5 A;  4U9Y A;  5G20 A;  4DJL A;  2ZEN A;  3BLN A;  1TF8 A;  4ZY2 A;  2EUI A;  2VZZ A;  2ZEL A;  5A27 A;  1LOK A;  2G3T A;  2Q4V A;  5D29 A;  4YRH A;  3CXQ A;  3DR6 A;  3KL9 A;  4K3N A;  2YNC C;  2C27 A;  2PE3 A;  3KAS A;  3S6K A;  4F9U A;  2Z3M A;  3IU2 A;  4A2Z A;  2C6G A;  4QBJ A;  3NH5 A;  1ARM A;  2HC9 A;  2DEA A;  4OME A;  2Z3K A;  3K9T A;  2P6E A;  4UA3 A;  4PK2 A;  3SI0 A;  4NGN A;  3PP9 A;  3SJG A;  2AFS A;  2PJA A;  4KSA A;  3JUW A;  4FD6 A;  2HUZ A;  4OLL A;  4KUB A;  2Z11 A;  4UWI A;  5FVJ A;  3T90 A;  4HKF A;  1YVO A;  4NGT A;  1QMU A;  1NE9 A;  2YNC A;  2NMT A;  2Y0M A;  2WYR A;  5HH1 A;  4AVB A;  1GHE A;  5GCN A;  2PIY A;  2Z3O A;  3D7H A;  2ODF A;  3KQZ A;  1AMP A;  3K2K A;  4KLV A;  4PXD A;  4R87 A;  5CBM A;  4IK2 A;  1LCP A;  2F7V A;  1M4G A;  3FBU A;  3SJF A;  4CAF A;  3LWU A;  5J8F A;  4C7H A;  1Y9W A;  3NE7 A;  6CPA A;  4P4D A;  1DE4 C;  1FT7 A;  5G1Z A;  1M4L A;  1IGB A;  2CIJ A;  2ANP A;  4MHY A;  4KS9 A;  4XNH B;  2VL1 A;  1YX0 A;  3C26 A;  1QSM A;  4O23 A;  3FXT A;  1ON0 A;  3T9Y A;  1V0C A;  1Z9U A;  1IU8 A;  4JYW A;  4YU9 A;  4CAV A;  5H86 A;  3UY5 A;  4K30 A;  2DPT A;  2PJ8 A;  5IX3 A;  1I12 A;  5DWN A;  4KVO E;  4KOT A;  2FL4 A;  2O4H A;  1ZG8 A;  1IID A;  2FVG A;  2QVP A;  3DSB A;  4H6U A;  2JBJ A;  1IOI A;  3D7G A;  3CZX A;  5KTA A;  4MCP A;  1Y9K A;  2BCO A;  4MCQ A;  1XMB A;  4MHD A;  3GIU A;  1AYE A;  1UWY A;  2PJ1 A;  4UEZ A;  2WUU A;  1YLO A;  1XJO A;  3H8E A;  2EO8 A;  4UIA A;  2BOA A;  2YND A;  3B2Y A;  1NMT A;  3F0A A;  4KZT A;  5ELY A;  2QML A;  1VIX A;  4KSI A;  4OC5 A;  3DR8 A;  2PR1 A;  7CPA A;  2I79 A;  4PSX A;  2CTB A;  1MJA A;  2DXQ A;  4ZYQ A;  4LQG A;  3GLJ A;  3TFY A;  2J8R A;  2WPX A;  4PXE A;  4XNH C;  1R57 A;  5I0C A;  4NGP A;  3JRU A;  1CBX A;  1PUA A;  2GFQ A;  3I9S A;  4AG7 A;  3B3W A;  2PRQ A;  4FD7 A;  1RO5 A;  2FE7 A;  1TKJ A;  1YLE A;  5HVG A;  4L89 A;  4WJB A;  1QQ9 A;  5DWM A;  4BD9 A;  3WC7 A;  3VAT A;  2DF5 A;  2B58 A;  4P10 A;  5IB9 A;  2PC1 A;  3RBU A;  5LYL A;  1S7F A;  5ISV A;  2VQY A;  4Q7A A;  4P4I A;  3SI2 A;  3S6H A;  4OC2 A;  3GY9 A;  2EWB A;  4HNY B;  2PJ0 A;  3IU1 A;  4QUS A;  4MFK A;  3D4U A;  3DGV A;  1S7N A;  2GAN A;  4CGN A;  2VBQ A;  2PJB A;  3R9F A;  2ZEH A;  3WR7 A;  2FCK A;  4MBU A;  3L2N A;  2B4B A;  3SJX A;  3B7I A;  1Z4E A;  4MY3 A;  1GYT A;  2I00 A;  1Y0R A;  4MMO A;  1S60 A;  4PV6 A;  4B14 A;  3FIX A;  4UEE A;  2FIA A;  3TO9 A;  3FX6 A;  1OBR A;  1TF9 A;  4ZI6 A;  2JDC A;  5LYI A;  4IHM A;  3B3V A;  1YVK A;  5IB0 A;  1XRY A;  2YGW A;  1AUG A;  4CAW A;  2YNE A;  4BMH A;  4IUS A;  2DPS A;  4LUA A;  4CGO A;  4A39 A;  1Y7R A;  1KUY A;  2ZPA A;  3RO0 A;  1IYK A;  2Q51 A;  3KR4 A;  1ARL A;  2GLF A;  4P4E A;  1ZG7 A;  4M6I A;  4AG9 A;  3RNZ A;  2PIZ A;  1QSN A;  2XEI A;  4MY0 A;  4PXB A;  1Q2C A;  3WAB A;  1I1D A;  1CPS A;  2XEG A;  2ZEO A;  4YWY A;  3KKW A;  1WWZ A;  3KZW A;  4R9M A;  2ZW6 A;  4CYQ A;  1Z8T A;  2NSM A;  2PDO A;  2EBJ A;  1CG2 A;  4OID A;  1MJ9 A;  2F8H A;  2GRE A;  2FT0 A;  2PJ3 A;  4OIW A;  3BI1 A;  5G22 A;  3RZA A;  4EVY A;  3DNS A;  3TO6 A;  4ORF A;  1IOF A;  2PR8 A;  3NE8 A;  5J1Q A;  1XOV A;  3I3G A;  3EO4 A;  2GE3 A;  4PK3 A;  3TOA A;  4FWU A;  4E8O A;  2Q4Y A;  4M6H A;  2OZU A;  4OAE A;  5D8N A;  1S7K A;  1J4J A;  2QEC A;  2Q7B A;  4F0X A;  3SXO A;  4EFD A;  3T8W A;  4CRZ B;  4GXH A;  4ZX9 A;  5HVH A;  4RI1 A;  5JGF A;  5KTD A;  2ZW5 A;  1X10 A;  4IAV A;  5F48 A;  1VHO A;  4AVC A;  5C82 A;  1XIX A;  2PJ5 A;  3FVL A;  2PJC A;  2Q44 A;  2RC4 A;  4JXQ A;  5BWA B;  1ZLI A;  3PZJ A;  5HMN A;  3TE4 A;  3BHX A;  2PJ6 A;  1CX8 A;  5F09 A;  4XPL A;  1LAM A;  2ARH A;  4TNU A;  5C88 A;  1R43 A;  1XE4 A;  2OR4 A;  4UCN A;  1B6B A;  2ABZ A;  2PVV A;  3R9G A;  1F2P A;  3FMC A;  1EE3 P;  2PRB A;  3IEH A;  3FF3 A;  1JWQ A;  4MRI A;  4B6Z A;  4NSQ A;  4YFJ A;  2OOT A;  2C6C A;  1YW6 A;  3LMS A;  4QC6 A;  4ZGY B;  3NA6 A;  1HEE A;  1WK4 A;  4CAX A;  4MCR A;  3VAR A;  2VXK A;  3F8K A; 
#chains in the Genus database with same CATH homology
 1BLL E;  4P4F A;  3GB0 A;  2HB6 A;  5JH9 A;  2PVW A;  4R76 A;  2ZEE A;  1YME A;  3H8F A;  4AXV A;  4MHP A;  2IJZ A;  3TC8 A;  3KI9 A;  3WT4 A;  2ZEG A;  3PRT A;  2Q4Z A;  4R6T A;  4X8I A;  3PB4 X;  4MHZ A;  3KHZ A;  4PQA A;  1XFO A;  1TKH A;  4MHN A;  2PJ2 A;  1FNO A;  1HDU A;  3IFE A;  5LYF A;  2ZEM A;  2ZEP A;  2IMO A;  2V8H A;  3IJ3 A;  2EK8 A;  1KWM A;  2V8V A;  3IC1 A;  3HUV A;  2XEF A;  5K8P A;  4ONW A;  4OP4 A;  8CPA A;  3WC5 A;  2BO9 A;  3TX8 A;  2AFW A;  4NJQ A;  3VH9 A;  4NJR A;  2G9D A;  3IIB A;  3ISZ A;  4P4B A;  2I3C A;  2C1C A;  4P4J A;  2GLJ A;  3CT9 A;  3I1U A;  3BI0 A;  4NFR A;  1VHE A;  3B3C A;  2CF4 A;  4CPA A;  2AFM A;  4NGQ A;  1F57 A;  2AFO A;  4NGR A;  2POK A;  4FBE A;  3S9N A;  2AFZ A;  4UEF A;  2QYV A;  4GM5 A;  3PBB A;  4EME A;  1HDQ A;  4NGS A;  4EWT A;  3BXM A;  3D68 A;  3S9L A;  5DS0 A;  1NSA A;  2ZED A;  4TWE A;  3IWW A;  4OC0 A;  3HLP A;  4MCS A;  3CPX A;  4RUH A;  4P6Y A;  1ZLH A;  1YW4 A;  1Z5R A;  2GU2 A;  4PXC A;  3PB6 X;  1F2O A;  4X3R A;  3RAM A;  1CP6 A;  1XBU A;  5HXD A;  2V77 A;  3KR5 A;  4OC4 A;  3KHX A;  1PYT B;  3PB8 X;  2ZOF A;  3H8G A;  3PEI A;  3N5F A;  1R3N A;  5HVF A;  4F9V A;  3FH4 A;  3CDX A;  3GUX A;  4ZY0 A;  1Y7E A;  3CPA A;  2JBK A;  3D66 A;  2IQ6 A;  2RFH A;  2ZOG A;  4W9Y A;  2PCU A;  5K8N A;  3FEC A;  4DUK A;  1TXR A;  1YSJ A;  2WZN A;  3NH8 A;  3PFE A;  1BAV A;  3PFO A;  1JQG A;  1ZG9 A;  2XEJ A;  4FAI A;  4G1P A;  3FJU A;  1CPX A;  2EK9 A;  1Z8L A;  5K8O A;  1DTD A;  4R7M A;  3D7F A;  2ZEF A;  4X2T A;  3ISX A;  1TKF A;  2QJ8 A;  4P45 A;  2PJ4 A;  3NFZ A;  3FEE A;  4OC3 A;  1VGY A;  4PPZ A;  1ELM P;  4WWV A;  4Z65 A;  2Q43 A;  3B35 A;  3NH4 A;  4A37 A;  3DLJ A;  4MXU A;  5LRK A;  2AFX A;  3B3T A;  4ZX8 A;  4UF4 A;  1BPN A;  3FED A;  3KGQ A;  3WC6 A;  1LAN A;  2C6P A;  1RTQ A;  5JM6 A;  3QNV A;  1LAP A;  3D7D A;  3V38 A;  1H8L A;  4NGM A;  1Z2L A;  1BPM A;  2NYQ A;  4UIB A;  4P44 A;  5LRG A;  2JEW A;  4JZ0 A;  2AFU A;  5I4M A;  2V8D A;  4OC1 A;  1PCA A;  2RB7 A;  3SJE A;  4A94 A;  1Q7L A;  5CPA A;  3B3S A;  4H2K A;  4DYO A;  3PBE A;  3PB7 X;  2O53 A;  1Y0Y A;  3MN8 A;  5LYD A;  4FUU A;  4R8F A;  5K8M A;  3SI1 A;  4F8Z A;  4OKO A;  3PB9 X;  3S9M A;  2V8G A;  5LRJ A;  1CP7 A;  2J9A A;  2PJ9 A;  3KQX A;  3V7Z A;  3D67 A;  1IY7 A;  3MRU A;  4A38 A;  2CTC A;  1LFW A;  4ZY1 A;  1ELL P;  5THW A;  3IO1 A;  2PJ7 A;  4DJL A;  2ZEN A;  1TF8 A;  4ZY2 A;  2ZEL A;  1LOK A;  5D29 A;  3KL9 A;  4K3N A;  2PE3 A;  3KAS A;  4F9U A;  2C6G A;  3NH5 A;  1ARM A;  2HC9 A;  2DEA A;  4OME A;  3K9T A;  3SI0 A;  4NGN A;  3SJG A;  2AFS A;  2PJA A;  4NGT A;  1QMU A;  2WYR A;  2PIY A;  3KQZ A;  3D7H A;  1AMP A;  3K2K A;  4PXD A;  5CBM A;  4IK2 A;  1LCP A;  2F7V A;  3SJF A;  3LWU A;  6CPA A;  4P4D A;  1DE4 C;  1FT7 A;  1M4L A;  1IGB A;  4MHY A;  2ANP A;  2CIJ A;  2VL1 A;  4O23 A;  4JYW A;  4YU9 A;  2PJ8 A;  2O4H A;  1ZG8 A;  2FVG A;  2QVP A;  2JBJ A;  3D7G A;  4MCP A;  2BCO A;  4MCQ A;  1XMB A;  1AYE A;  1UWY A;  2PJ1 A;  4UEZ A;  1YLO A;  1XJO A;  3H8E A;  4UIA A;  2BOA A;  3B2Y A;  5ELY A;  1VIX A;  4KSI A;  4OC5 A;  7CPA A;  2CTB A;  4ZYQ A;  4LQG A;  3GLJ A;  4PXE A;  4NGP A;  3JRU A;  1CBX A;  3B3W A;  2PRQ A;  1TKJ A;  5HVG A;  4WJB A;  1QQ9 A;  4BD9 A;  3WC7 A;  3VAT A;  5IB9 A;  4P10 A;  3RBU A;  5LYL A;  4Q7A A;  4P4I A;  3SI2 A;  4OC2 A;  2EWB A;  2PJ0 A;  3D4U A;  3DGV A;  2PJB A;  2ZEH A;  3L2N A;  3SJX A;  3B7I A;  1GYT A;  1Y0R A;  4MMO A;  4UEE A;  3FX6 A;  1OBR A;  1TF9 A;  4ZI6 A;  5LYI A;  4IHM A;  3B3V A;  1XRY A;  4A39 A;  3KR4 A;  2Q51 A;  1ARL A;  2GLF A;  4P4E A;  1ZG7 A;  2PIZ A;  2XEI A;  4PXB A;  3WAB A;  2ZEO A;  1CPS A;  2XEG A;  4YWY A;  3KZW A;  2NSM A;  1CG2 A;  4OID A;  2F8H A;  2GRE A;  2PJ3 A;  4OIW A;  3RZA A;  3BI1 A;  5J1Q A;  4FWU A;  5D8N A;  4EFD A;  3T8W A;  5HVH A;  4ZX9 A;  5JGF A;  4IAV A;  1VHO A;  2PJ5 A;  3FVL A;  2PJC A;  1ZLI A;  3BHX A;  2PJ6 A;  1CX8 A;  5F09 A;  1LAM A;  4TNU A;  1R43 A;  2OR4 A;  2ABZ A;  2PVV A;  1F2P A;  3FMC A;  1EE3 P;  4MRI A;  3IEH A;  3FF3 A;  4B6Z A;  2OOT A;  2C6C A;  1YW6 A;  3LMS A;  3NA6 A;  1HEE A;  4MCR A;  3VAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...