2DEAA

Crystal structure of the aminopeptidase of aeromonas proteolytica at ph 4.7
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Bacterial leucyl aminopeptidase
publication title The high-resolution structures of the neutral and the low pH crystals of aminopeptidase from Aeromonas proteolytica.
pubmed doi rcsb
source organism Vibrio proteolyticus
total genus 110
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2006-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2deaA00
1VIXA 3KR5A 2GLJA 2WZNA 5DS0A 1TF9A 2ZOFA 2V77A 4UEEA 2PE3A 3CDXA 3SI0A 5IB9A 1ARMA 3KZWA 3FF3A 3I1UA 3D4UA 3B3TA 2XEIA 2PJ8A 1VHOA 1ARLA 3S9LA 4IK2A 1CP7A 2PJBA 3GLJA 1ELLP 2JEWA 3NA6A 2IQ6A 1TF8A 2QYVA 4Z65A 1Y0YA 1PCAA 4YU9A 2PJ6A 3WABA 2PJ4A 3S9MA 1Q7LA 2XEFA 1XMBA 2CIJA 1FT7A 3IWWA 2OOTA 2CF4A 4MRIA 4NGTA 1CBXA 3D68A 2PVVA 4IAVA 4UEZA 2BOAA 4FAIA 2PJ3A 5LRKA 4MCRA 4OC4A 3H8EA 4NFRA 3DLJA 5K8OA 1ZG8A 1IGBA 4DUKA 3ISZA 3D7FA 3FMCA 5THWA 4EFDA 4ZX8A 3PFEA 3B3VA 3SJFA 1LAMA 2G9DA 2ZEEA 3LMSA 1YLOA 3PBBA 2QJ8A 4TWEA 1KWMA 4K3NA 1IY7A 2I3CA 4EWTA 4LQGA 3B3SA 1TKJA 4ZI6A 4DJLA 4P4FA 5HVFA 4R76A 5K8PA 1EE3P 4PXCA 3MN8A 3GB0A 2O4HA 2CTCA 4MHPA 4R8FA 4ZY1A 4UIBA 1F2PA 1HDUA 4FUUA 3HUVA 5JGFA 5LYLA 3PB9X 2GREA 4DYOA 4F9UA 3HLPA 1YW6A 4YWYA 2PJAA 2QVPA 3RZAA 2DEAA 4EMEA 4KSIA 4PXBA 2GU2A 1ZLIA 4F8ZA 3N5FA 2AFOA 3ISXA 5LYIA 2PJ0A 1YW4A 2PJCA 5HVHA 3WC5A 4OC1A 1OBRA 1TKFA 3IC1A 2AFMA 2EK8A 2ZEHA 2WYRA 1UWYA 2HB6A 4MHNA 4OC3A 3PB8X 5HXDA 4OMEA 5LRJA 4P4JA 2PJ9A 3V38A 3PBEA 2F8HA 8CPAA 2AFZA 3KI9A 3PRTA 5D8NA 4ZX9A 1GYTA 4OKOA 4UEFA 1CP6A 3H8FA 4NGPA 4X8IA 3K9TA 3V7ZA 1LFWA 4P44A 4OC5A 4FBEA 5I4MA 3WC6A 4MMOA 4BD9A 1XRYA 2Q51A 4PXDA 2ANPA 2NSMA 4P10A 3PB6X 2O53A 5CBMA 4A38A 1Z8LA 4O23A 3KQXA 1CG2A 4NGRA 4PPZA 4PXEA 3KQZA 2ZEFA 3B7IA 2PRQA 4H2KA 3BHXA 5F09A 4OC0A 2IMOA 2FVGA 4OC2A 2AFSA 1Z2LA 1XFOA 1CPSA 4ZYQA 1R43A 1M4LA 3VH9A 1CX8A 2V8VA 3PFOA 3BI0A 2XEJA 2PJ1A 3TX8A 3NH8A 3IO1A 4P45A 2C6PA 4ONWA 1R3NA 4P4BA 3FVLA 2AFWA 2PCUA 2F7VA 2PJ5A 4NGSA 4X3RA 3B3CA 5JM6A 3CT9A 2Q4ZA 3S9NA 3LWUA 4NGNA 4MHYA 3D7GA 3FEDA 1TKHA 3TC8A 1LOKA 5JH9A 2JBJA 2ZENA 3K2KA 3GUXA 4MXUA 3IJ3A 2ZELA 3T8WA 1LAPA 3PB7X 1Y7EA 1FNOA 3KR4A 4W9YA 2J9AA 5LRGA 4A37A 1DTDA 4RUHA 2RB7A 1HEEA 3L2NA 2V8HA 5LYFA 1CPXA 1XJOA 3PEIA 4UIAA 2ZEMA 4G1PA 3B35A 4FWUA 4WWVA 7CPAA 3BI1A 4GM5A 2VL1A 2BCOA 4CPAA 2PJ2A 2PJ7A 3SJGA 4OIWA 1YMEA 1F2OA 3NFZA 1HDQA 2XEGA 2C1CA 1AYEA 2AFUA 4X2TA 1ZG9A 1BLLE 4MCQA 3SJXA 1VGYA 2CTBA 2AFXA 4OP4A 2HC9A 3KL9A 2RFHA 2ZEOA 5LYDA 2C6GA 1LCPA 2ZEDA 2V8GA 3NH5A 3FX6A 3FJUA 4TNUA 3SJEA 4R7MA 3D66A 2ZEGA 2JBKA 3CPXA 3CPAA 4PQAA 3SI2A 4JYWA 3KHXA 5D29A 2POKA 3MRUA 1YSJA 3KGQA 4B6ZA 4P6YA 6CPAA 4MCSA 3VATA 3QNVA 1H8LA 3FEEA 3D67A 1ELMP 1ZLHA 3D7DA 2EWBA 4NGQA 4R6TA 1PYTB 4WJBA 2ABZA 1VHEA 4AXVA 3VARA 2PIYA 2NYQA 4A39A 1BPMA 1AMPA 3IIBA 3WC7A 2GLFA 3B3WA 4NGMA 3KHZA 2ZOGA 4A94A 1ZG7A 2IJZA 2PIZA 4Q7AA 1QQ9A 3DGVA 1BPNA 1XBUA 5ELYA 3SI1A 4P4IA 4IHMA 4JZ0A 3JRUA 2EK9A 2V8DA 2C6CA 4NJQA 3BXMA 2Q43A 4MHZA 3WT4A 2OR4A 3B2YA 5K8MA 5K8NA 4OIDA 2PVWA 2BO9A 3IFEA 1TXRA 4UF4A 4ZY0A 3PB4X 3FH4A 3RAMA 1JQGA 5HVGA 3D7HA 1RTQA 3H8GA 1DE4C 1NSAA 1Y0RA 3RBUA 1LANA 1F57A 4MCPA 4P4DA 5CPAA 1BAVA 3IEHA 1QMUA 3KASA 3NH4A 5J1QA 4NJRA 2ZEPA 4ZY2A 1Z5RA 4F9VA 3FECA 4P4EA
chains in the Genus database with same CATH superfamily
2YNEA 4B13A 3P2HA 1VIXA 3KR5A 1XEBA 3NE7A 2GLJA 4MBUA 2BUEA 2WZNA 3TOAA 5AG4A 1YVKA 3DNSA 3D2PA 3DR6A 3IGRA 4CYNA 1BO4A 5DS0A 2ZW7A 4A33A 1TF9A 2F5IA 2HV2A 4R87A 2ZOFA 2V77A 1N71A 2HQYA 4UEEA 3G3SA 4PSXA 4A30A 2PE3A 4UFVA 4FD6A 3CDXA 3SI0A 5IB9A 1ARMA 3KZWA 3FF3A 4B5PB 1CJWA 3I1UA 5AG6A 1M4IA 3D4UA 2JEVA 2XEIA 2Z3OA 3B3TA 2PJ8A 1IIDA 4A2ZA 2EVNA 1VHOA 1ARLA 4NSQA 3S9LA 1YVOA 4IK2A 2GFQA 1Y9KA 1CP7A 3GYAA 1M1DA 2PJBA 3RNZA 3GLJA 4EVYA 4ONUA 2WPXA 1ELLP 2JEWA 3NA6A 3BJ8A 2IQ6A 1IYLA 1CM0A 2B4BA 1TF8A 2PSWA 4E2AA 4QB9A 4C68A 1X12A 2B4DA 2QYVA 4KLVA 4ORFA 2VEZA 2AJ6A 4Z65A 3EXNA 1MJAA 1Y0YA 1PCAA 4YU9A 4B10A 2PJ6A 3WABA 4CGMA 2R7HA 2PJ4A 3S9MA 1Q7LA 4E8OA 3A9LA 3P2FA 4M85A 2YNCC 4CAFA 2XEFA 5AGEA 4YGOA 1XMBA 5A28A 1I21A 1FT7A 2CIJA 2Q4YA 3IWWA 2Z3KA 3DSBA 5A27A 1TIQA 2VZZA 4KOYA 1Y9WA 2CF4A 4MRIA 4NGTA 2OOTA 5F48A 1CBXA 5C82A 3D68A 2PVVA 4IAVA 4Q38A 4UEZA 4A95A 2BOAA 3FBUA 4A31A 4FAIA 2FT0A 2PJ3A 4C7HA 3ZJ0A 5LRKA 5HH1A 3FB3A 3QB8A 4MCRA 4OC4A 3H8EA 5G21A 4NFRA 4XPDB 3NE8A 5H84A 3DLJA 4JJXA 5K8OA 1YREA 1R57A 5KTCA 1ZG8A 2G3TA 1IGBA 3LACA 4L8AA 4KOWA 2IL4A 3CXQA 3ISZA 3D7FA 3MGDA 3DDDA 3FMCA 5THWA 4DUKA 4EFDA 5KTAA 2VZYA 4B12A 2Q7SA 4ZX8A 3IWEA 3PFEA 3B3VA 4OLLA 3SJFA 1LAMA 3EY5A 2G9DA 2ZEEA 3LMSA 4UWIA 3S6FA 1YLOA 3PBBA 2CNMA 2QJ8A 4JD6A 1S60A 4MFQA 4OAEA 1VHSA 4TWEA 2G3AA 1KWMA 4K3NA 2I00A 5KTDA 1KUYA 1IY7A 1ON0A 2I3CA 2OZGA 2G0BA 4IF5A 4EWTA 4LQGA 1B87A 3B3SA 1Q2CA 4UA3A 1U6MA 2EBJA 1TKJA 4KOTA 3GKRA 4DJLA 4ZI6A 5DWMA 4P4FA 5HVFA 4CYQA 4R76A 1WK4A 5K8PA 4KSAA 4KSFA 4YFJA 4AG9A 1EE3P 4PXCA 3EFAA 4CAEA 2VBQA 4KORA 1I1DA 3MN8A 2OB0A 3GB0A 1RXTA 1L0CA 3R9EA 1K4JA 5BWAB 5F46A 2O4HA 2BEIA 2CTCA 1S7NA 4U9ZA 4LQ6A 4MHPA 3I3GA 4R8FA 4UCPA 4ZBGA 4ZY1A 1Z9UA 4UIBA 1F2PA 4KVXA 1HDUA 3GY9A 4FUUA 3QAHA 3HUVA 2PDOA 4UFWA 2D4PA 5GCNA 5JGFA 5LYLA 3PB9X 4MFPA 2GREA 4DYOA 4F9UA 3HLPA 3OWCA 2R8VA 4KOVA 1YW6A 2H5MA 4YWYA 2PJAA 2QVPA 3RZAA 4R3LA 4MFJA 4FD4A 4HNYB 2DEAA 4EMEA 2DPSA 4KUAA 4KSIA 5EBVA 2I79A 4PXBA 2GU2A 1ZLIA 4F8ZA 3N5FA 4C7IA 2VXKA 2AFOA 2B3VA 3ISXA 4KZTA 5LYIA 4CGOA 4F6AA 2PJ0A 1YW4A 2PJCA 4PSWA 5HVHA 2ZW4A 3WC5A 5C88A 1NE9A 2CXAA 4KVME 4OC1A 4J3GA 2KCWA 4KOXA 1OBRA 1PUAA 1TKFA 3IC1A 4JWPA 4X5KA 2D4OA 2AFMA 4F9VA 2CY2A 2FCKA 2EK8A 2ZEHA 2WYRA 3IWGA 1UWYA 2OZHA 2QIRA 2DF5A 4HNWB 2HB6A 2QMLA 4MHNA 1KUVA 1QSOA 3PB8X 4OC3A 1JWQA 1P4NA 5HXDA 2FL4A 4OMEA 2GE3A 5LRJA 4AVBA 4P4JA 2PJ9A 3R96A 4L89A 3V38A 3PBEA 2F8HA 8CPAA 2RC4A 2AFZA 3VWEA 3KI9A 5F47A 3PRTA 2B5GB 1S3ZA 5D8NA 4GXHA 1Z8TA 3TFYA 4ZX9A 1GYTA 2DPTA 4OKOA 4UEFA 3T90A 4AVCA 4B5OA 1CP6A 3H8FA 2ZPAA 2EO8A 4NGPA 4X8IA 3K9TA 1B6BA 3V7ZA 1LFWA 3CXSA 4RS2A 4P44A 4OC5A 3W91A 1IB1E 4FBEA 5JQ4A 3R9GA 5I4MA 4II9A 1M44A 3WC6A 4C2XA 1X10A 4MMOA 4C2ZA 3EO4A 4BD9A 4FD5A 5G20A 1BOBA 1MJBA 1XRYA 2Q51A 1IICA 2JLMA 4PXDA 3SXNA 4AG7A 2ANPA 2NSMA 3G8WA 2REEA 4P10A 3PB6X 2O53A 1GHEA 3F5BA 4A38A 5CBMA 1Z8LA 3TT2A 4KUBA 2O28A 4O23A 3KQXA 1CG2A 4NGRA 2ZW5A 5EMIA 4PPZA 2Z3LA 4CS0B 4B5PA 2J8RA 3KQZA 3K9UA 4PXEA 4CAXA 3LODA 2ZEFA 5G1ZA 4MJ8A 3B7IA 4A32A 2REFA 1M4DA 3JUWA 4NF1A 2OZUA 2BSWA 2PRQA 4H2KA 4UWJA 5JPHA 3BHXA 2ZW6A 4M6HA 3RYOA 3T9YA 5F09A 4OC0A 2IMOA 4LX9A 2FVGA 2Z0ZA 1IYKA 4OC2A 3TOBA 2AFSA 1Z2LA 1FY7A 2B5GA 1XFOA 4UFXA 1CPSA 4PK2A 4R9MA 1R43A 4U9YA 4ZYQA 1M4LA 4JXQA 3VH9A 1CX8A 2PR8A 1I12A 5G22A 3B8GA 5IB0A 2FIAA 4MI4A 2V8VA 3PFOA 1S5KA 4DNCA 3BI0A 4H89A 2XEJA 2PJ1A 2PQ8A 3TX8A 1XOVA 3NH8A 3SHPA 1QSNA 3IO1A 5HMNA 4P45A 1YLEA 2C6PA 4ONWA 2R98A 4H6ZA 1R3NA 3D3SA 4P4BA 4R57A 3FVLA 5FVJA 3S6GA 2AFWA 4Y49C 2PCUA 2FS5A 2F7VA 2PJ5A 2JDCA 4NGSA 2AE6A 2BL1A 4B14A 4X3RA 4BMHA 3B3CA 1A2ZA 3R95A 3CT9A 4CRZB 5JM6A 5IV0A 2Q4ZA 1XE4A 3S9NA 2FXFA 3LWUA 4NGNA 3S6KA 1VKCA 5AG5A 1P0HA 4MHYA 3D7GA 3FEDA 2CNTA 1TKHA 4CGNA 3TC8A 3GIUA 2X7BA 1LOKA 2PRBA 3ZZIA 5JH9A 2JDDA 2JBJA 5F49A 2J8NA 2ZENA 3D2MA 4KOSA 2FE7A 3K2KA 3GUXA 4MXUA 4NXYA 4RN7A 2WUUA 2P6EA 3CZXA 4NCZA 3IJ3A 2ZELA 4XNHC 1LAPA 3T8WA 3F8KA 3N7ZA 1Y7EA 3PB7X 3PP9A 4CAVA 1FNOA 3KR4A 4HPSA 4W9YA 2J9AA 5LRGA 4A37A 1DTDA 3R1KA 3SXOA 2B4DB 4CGLA 4RUHA 2RB7A 4HNXB 1HEEA 1MJ9A 3FIXA 3L2NA 3W6XA 2V8HA 5LYFA 1CPXA 1XJOA 2OH1A 3PEIA 4CAWA 4UIAA 2ZEMA 4G1PA 3B35A 4FWUA 4ZGYB 4WWVA 7CPAA 4UCMA 1S7KA 2GIVA 2QECA 2FIWA 3BI1A 1S7FA 2WSAA 1Q2DA 2VL1A 4GM5A 4QBJA 2BCOA 1OZPA 4CPAA 2PJ2A 4I49A 4XPKA 2PJ7A 3SJGA 1XMTA 4OIWA 2P6FA 4F0YA 1QSMA 1YMEA 1F2OA 3NFZA 1HDQA 2NMTA 2XEGA 5ISVA 2C1CA 1AYEA 4MFLA 3WR7A 2AFUA 4R3KA 3JVNA 3E0KA 2P6GA 4X2TA 5EC4A 3PGPA 1ZG9A 4MY3A 3FXTA 5I0CA 2VQYA 1BLLE 2FSRA 1V0CA 4MCQA 4QVTA 3SJXA 1VGYA 4M6GA 1IU8A 2CTBA 2AFXA 4GS4A 4OP4A 4KS9A 1MK4A 2Z11A 3TO9A 1J4JA 4CGPA 2PR1A 4HKFA 2HC9A 2YNCA 2EUIA 3KL9A 2RFHA 2ZEOA 4JLYA 1Y7RA 5LYDA 1XIXA 2C6GA 3BJ7A 1LCPA 4PV6A 2ZEDA 2VI7A 4QUSA 2V8GA 3V8IA 3NH5A 3FX6A 2Z3PA 2A4NA 3FJUA 4UBRA 4TNUA 3PZJA 5E96A 3SJEA 2R1IA 3S6HA 4R7MA 3D66A 3W6SA 4RI1A 2ZEGA 2C27A 2JBKA 4B11A 3CPXA 3CPAA 4PQAA 4Y49B 1ZO0A 3SI2A 4AVAA 4JYWA 1IOFA 2HUZA 3KHXA 5D29A 2POKA 4KVOE 2ARHA 4E0AA 2ODFA 3MRUA 1YSJA 1QSTA 5J8CA 4KLWA 2Q4VA 3KGQA 2Q7BA 4B6ZA 4P6YA 5AG7A 3RO0A 6CPAA 3KKWA 1LRZA 4MCSA 3VATA 4K30A 3QNVA 1H8LA 3R9FA 3TTHA 3FEEA 3D67A 1ELMP 2Y0MA 1ZLHA 4LUAA 2J8MA 3D7DA 3CXPA 3H4QA 2EWBA 2DXQA 4KOUA 4U5YA 4XNHB 1Z8XA 2ATRA 5IX3A 3F0AA 4NGQA 2Q0YA 4PK3A 4CYPA 2B58A 1Q2YA 4R6TA 1PYTB 3UY5A 4WJBA 2ABZA 1VHEA 2GANA 2Z3NA 2YNDA 4AXVA 3VARA 2PIYA 2NYQA 1KUXA 2CNSA 4MFKA 1PU9A 2ZXVA 4M6IA 4A39A 4H6UA 1UFHA 4C2YA 2B3UA 3TE4A 1WWZA 2YGWA 3TCVA 2Q04A 4BBHA 1BPMA 1AMPA 1NMTA 1IOIA 3IIBA 4MY0A 2GLFA 3B3WA 3WC7A 4CYOA 4NGMA 3I9SA 3KHZA 2OU2A 4JXRA 2ZOGA 4YRHA 4A94A 3TO7A 1ZG7A 5CNPA 2IJZA 2PIZA 4Q7AA 1AUGA 1QQ9A 1YX0A 4XPLA 3DGVA 1BPNA 1XBUA 3VWDA 5ELYA 3IU1A 3SI1A 4QC6A 3FYNA 4IHMA 4P4IA 4JZ0A 1NSLA 2Z3MA 3JRUA 1M4GA 3D8PA 3FRMA 2EK9A 2K5TA 2V8DA 3EC4A 2C6CA 4NJQA 1Z4EA 1Z8WA 3BXMA 2Q43A 1S7LA 4Q36A 4MHZA 3WT4A 1YK3A 2OR4A 3FNCA 3B2YA 4OADA 5K8MA 4M3SA 5K8NA 4OIDA 2PVWA 2BO9A 3IFEA 1TXRA 4UF4A 4ZY0A 3DR8A 3H5ZA 3PB4X 3FH4A 1KZFA 4XPDC 3RAMA 5J8FA 4UCNA 1JQGA 3QAYA 3D7HA 5HVGA 1RTQA 2WPWA 3H8GA 1Z4RA 1DE4C 2PC1A 2Q44A 3TO6A 1NSAA 1Y0RA 1YR0A 3RBUA 1LANA 1F57A 1RO5A 3BLNA 3JTKA 1SQHA 5DWNA 4MCPA 4P4DA 1XF8A 5CPAA 2Z10A 4AB7A 1BAVA 3IEHA 5H86A 3IU2A 1QMUA 4BINA 3C26A 3KASA 3NH4A 5J1QA 4NJRA 2ZEPA 4MHDA 4MFZA 4ZY2A 1YGHA 1Z5RA 4FD7A 4F0XA 3FECA 2P0WA 1QSRA 3LD2A 1YQEA 4IUSA 4NEXA 4P4EA 4CRYB
chains in the Genus database with same CATH topology
1VIXA 3KR5A 2GLJA 2WZNA 5DS0A 1TF9A 2ZOFA 2V77A 4UEEA 2PE3A 3CDXA 3SI0A 5IB9A 1ARMA 3KZWA 3FF3A 3I1UA 3D4UA 3B3TA 2XEIA 2PJ8A 1VHOA 1ARLA 3S9LA 4IK2A 1CP7A 2PJBA 3GLJA 1ELLP 2JEWA 3NA6A 2IQ6A 1TF8A 2QYVA 4Z65A 1Y0YA 1PCAA 4YU9A 2PJ6A 3WABA 2PJ4A 3S9MA 1Q7LA 2XEFA 1XMBA 2CIJA 1FT7A 3IWWA 2OOTA 2CF4A 4MRIA 4NGTA 1CBXA 3D68A 2PVVA 4IAVA 4UEZA 2BOAA 4FAIA 2PJ3A 5LRKA 4MCRA 4OC4A 3H8EA 4NFRA 3DLJA 5K8OA 1ZG8A 1IGBA 4DUKA 3ISZA 3D7FA 3FMCA 5THWA 4EFDA 4ZX8A 3PFEA 3B3VA 3SJFA 1LAMA 2G9DA 2ZEEA 3LMSA 1YLOA 3PBBA 2QJ8A 4TWEA 1KWMA 4K3NA 1IY7A 2I3CA 4EWTA 4LQGA 3B3SA 1TKJA 4ZI6A 4DJLA 4P4FA 5HVFA 4R76A 5K8PA 1EE3P 4PXCA 3MN8A 3GB0A 2O4HA 2CTCA 4MHPA 4R8FA 4ZY1A 4UIBA 1F2PA 1HDUA 4FUUA 3HUVA 5JGFA 5LYLA 3PB9X 2GREA 4DYOA 4F9UA 3HLPA 1YW6A 4YWYA 2PJAA 2QVPA 3RZAA 2DEAA 4EMEA 4KSIA 4PXBA 2GU2A 1ZLIA 4F8ZA 3N5FA 2AFOA 3ISXA 5LYIA 2PJ0A 1YW4A 2PJCA 5HVHA 3WC5A 4OC1A 1OBRA 1TKFA 3IC1A 2AFMA 2EK8A 2ZEHA 2WYRA 1UWYA 2HB6A 4MHNA 4OC3A 3PB8X 5HXDA 4OMEA 5LRJA 4P4JA 2PJ9A 3V38A 3PBEA 2F8HA 8CPAA 2AFZA 3KI9A 3PRTA 5D8NA 4ZX9A 1GYTA 4OKOA 4UEFA 1CP6A 3H8FA 4NGPA 4X8IA 3K9TA 3V7ZA 1LFWA 4P44A 4OC5A 4FBEA 5I4MA 3WC6A 4MMOA 4BD9A 1XRYA 2Q51A 4PXDA 2ANPA 2NSMA 4P10A 3PB6X 2O53A 5CBMA 4A38A 1Z8LA 4O23A 3KQXA 1CG2A 4NGRA 4PPZA 4PXEA 3KQZA 2ZEFA 3B7IA 2PRQA 4H2KA 3BHXA 5F09A 4OC0A 2IMOA 2FVGA 4OC2A 2AFSA 1Z2LA 1XFOA 1CPSA 4ZYQA 1R43A 1M4LA 3VH9A 1CX8A 2V8VA 3PFOA 3BI0A 2XEJA 2PJ1A 3TX8A 3NH8A 3IO1A 4P45A 2C6PA 4ONWA 1R3NA 4P4BA 3FVLA 2AFWA 2PCUA 2F7VA 2PJ5A 4NGSA 4X3RA 3B3CA 5JM6A 3CT9A 2Q4ZA 3S9NA 3LWUA 4NGNA 4MHYA 3D7GA 3FEDA 1TKHA 3TC8A 1LOKA 5JH9A 2JBJA 2ZENA 3K2KA 3GUXA 4MXUA 3IJ3A 2ZELA 3T8WA 1LAPA 3PB7X 1Y7EA 1FNOA 3KR4A 4W9YA 2J9AA 5LRGA 4A37A 1DTDA 4RUHA 2RB7A 1HEEA 3L2NA 2V8HA 5LYFA 1CPXA 1XJOA 3PEIA 4UIAA 2ZEMA 4G1PA 3B35A 4FWUA 4WWVA 7CPAA 3BI1A 4GM5A 2VL1A 2BCOA 4CPAA 2PJ2A 2PJ7A 3SJGA 4OIWA 1YMEA 1F2OA 3NFZA 1HDQA 2XEGA 2C1CA 1AYEA 2AFUA 4X2TA 1ZG9A 1BLLE 4MCQA 3SJXA 1VGYA 2CTBA 2AFXA 4OP4A 2HC9A 3KL9A 2RFHA 2ZEOA 5LYDA 2C6GA 1LCPA 2ZEDA 2V8GA 3NH5A 3FX6A 3FJUA 4TNUA 3SJEA 4R7MA 3D66A 2ZEGA 2JBKA 3CPXA 3CPAA 4PQAA 3SI2A 4JYWA 3KHXA 5D29A 2POKA 3MRUA 1YSJA 3KGQA 4B6ZA 4P6YA 6CPAA 4MCSA 3VATA 3QNVA 1H8LA 3FEEA 3D67A 1ELMP 1ZLHA 3D7DA 2EWBA 4NGQA 4R6TA 1PYTB 4WJBA 2ABZA 1VHEA 4AXVA 3VARA 2PIYA 2NYQA 4A39A 1BPMA 1AMPA 3IIBA 3WC7A 2GLFA 3B3WA 4NGMA 3KHZA 2ZOGA 4A94A 1ZG7A 2IJZA 2PIZA 4Q7AA 1QQ9A 3DGVA 1BPNA 1XBUA 5ELYA 3SI1A 4P4IA 4IHMA 4JZ0A 3JRUA 2EK9A 2V8DA 2C6CA 4NJQA 3BXMA 2Q43A 4MHZA 3WT4A 2OR4A 3B2YA 5K8MA 5K8NA 4OIDA 2PVWA 2BO9A 3IFEA 1TXRA 4UF4A 4ZY0A 3PB4X 3FH4A 3RAMA 1JQGA 5HVGA 3D7HA 1RTQA 3H8GA 1DE4C 1NSAA 1Y0RA 3RBUA 1LANA 1F57A 4MCPA 4P4DA 5CPAA 1BAVA 3IEHA 1QMUA 3KASA 3NH4A 5J1QA 4NJRA 2ZEPA 4ZY2A 1Z5RA 4F9VA 3FECA 4P4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VIX A;  3KR5 A;  2GLJ A;  2WZN A;  5DS0 A;  1TF9 A;  2ZOF A;  2V77 A;  4UEE A;  2PE3 A;  3CDX A;  3SI0 A;  5IB9 A;  1ARM A;  3KZW A;  3FF3 A;  3I1U A;  3D4U A;  3B3T A;  2XEI A;  2PJ8 A;  1VHO A;  1ARL A;  3S9L A;  4IK2 A;  1CP7 A;  2PJB A;  3GLJ A;  1ELL P;  2JEW A;  3NA6 A;  2IQ6 A;  1TF8 A;  2QYV A;  4Z65 A;  1Y0Y A;  1PCA A;  4YU9 A;  2PJ6 A;  3WAB A;  2PJ4 A;  3S9M A;  1Q7L A;  2XEF A;  1XMB A;  2CIJ A;  1FT7 A;  3IWW A;  2OOT A;  2CF4 A;  4MRI A;  4NGT A;  1CBX A;  3D68 A;  2PVV A;  4IAV A;  4UEZ A;  2BOA A;  4FAI A;  2PJ3 A;  5LRK A;  4MCR A;  4OC4 A;  3H8E A;  4NFR A;  3DLJ A;  5K8O A;  1ZG8 A;  1IGB A;  4DUK A;  3ISZ A;  3D7F A;  3FMC A;  5THW A;  4EFD A;  4ZX8 A;  3PFE A;  3B3V A;  3SJF A;  1LAM A;  2G9D A;  2ZEE A;  3LMS A;  1YLO A;  3PBB A;  2QJ8 A;  4TWE A;  1KWM A;  4K3N A;  1IY7 A;  2I3C A;  4EWT A;  4LQG A;  3B3S A;  1TKJ A;  4ZI6 A;  4DJL A;  4P4F A;  5HVF A;  4R76 A;  5K8P A;  1EE3 P;  4PXC A;  3MN8 A;  3GB0 A;  2O4H A;  2CTC A;  4MHP A;  4R8F A;  4ZY1 A;  4UIB A;  1F2P A;  1HDU A;  4FUU A;  3HUV A;  5JGF A;  5LYL A;  3PB9 X;  2GRE A;  4DYO A;  4F9U A;  3HLP A;  1YW6 A;  4YWY A;  2PJA A;  2QVP A;  3RZA A;  2DEA A;  4EME A;  4KSI A;  4PXB A;  2GU2 A;  1ZLI A;  4F8Z A;  3N5F A;  2AFO A;  3ISX A;  5LYI A;  2PJ0 A;  1YW4 A;  2PJC A;  5HVH A;  3WC5 A;  4OC1 A;  1OBR A;  1TKF A;  3IC1 A;  2AFM A;  2EK8 A;  2ZEH A;  2WYR A;  1UWY A;  2HB6 A;  4MHN A;  4OC3 A;  3PB8 X;  5HXD A;  4OME A;  5LRJ A;  4P4J A;  2PJ9 A;  3V38 A;  3PBE A;  2F8H A;  8CPA A;  2AFZ A;  3KI9 A;  3PRT A;  5D8N A;  4ZX9 A;  1GYT A;  4OKO A;  4UEF A;  1CP6 A;  3H8F A;  4NGP A;  4X8I A;  3K9T A;  3V7Z A;  1LFW A;  4P44 A;  4OC5 A;  4FBE A;  5I4M A;  3WC6 A;  4MMO A;  4BD9 A;  1XRY A;  2Q51 A;  4PXD A;  2ANP A;  2NSM A;  4P10 A;  3PB6 X;  2O53 A;  5CBM A;  4A38 A;  1Z8L A;  4O23 A;  3KQX A;  1CG2 A;  4NGR A;  4PPZ A;  4PXE A;  3KQZ A;  2ZEF A;  3B7I A;  2PRQ A;  4H2K A;  3BHX A;  5F09 A;  4OC0 A;  2IMO A;  2FVG A;  4OC2 A;  2AFS A;  1Z2L A;  1XFO A;  1CPS A;  4ZYQ A;  1R43 A;  1M4L A;  3VH9 A;  1CX8 A;  2V8V A;  3PFO A;  3BI0 A;  2XEJ A;  2PJ1 A;  3TX8 A;  3NH8 A;  3IO1 A;  4P45 A;  2C6P A;  4ONW A;  1R3N A;  4P4B A;  3FVL A;  2AFW A;  2PCU A;  2F7V A;  2PJ5 A;  4NGS A;  4X3R A;  3B3C A;  5JM6 A;  3CT9 A;  2Q4Z A;  3S9N A;  3LWU A;  4NGN A;  4MHY A;  3D7G A;  3FED A;  1TKH A;  3TC8 A;  1LOK A;  5JH9 A;  2JBJ A;  2ZEN A;  3K2K A;  3GUX A;  4MXU A;  3IJ3 A;  2ZEL A;  3T8W A;  1LAP A;  3PB7 X;  1Y7E A;  1FNO A;  3KR4 A;  4W9Y A;  2J9A A;  5LRG A;  4A37 A;  1DTD A;  4RUH A;  2RB7 A;  1HEE A;  3L2N A;  2V8H A;  5LYF A;  1CPX A;  1XJO A;  3PEI A;  4UIA A;  2ZEM A;  4G1P A;  3B35 A;  4FWU A;  4WWV A;  7CPA A;  3BI1 A;  4GM5 A;  2VL1 A;  2BCO A;  4CPA A;  2PJ2 A;  2PJ7 A;  3SJG A;  4OIW A;  1YME A;  1F2O A;  3NFZ A;  1HDQ A;  2XEG A;  2C1C A;  1AYE A;  2AFU A;  4X2T A;  1ZG9 A;  1BLL E;  4MCQ A;  3SJX A;  1VGY A;  2CTB A;  2AFX A;  4OP4 A;  2HC9 A;  3KL9 A;  2RFH A;  2ZEO A;  5LYD A;  2C6G A;  1LCP A;  2ZED A;  2V8G A;  3NH5 A;  3FX6 A;  3FJU A;  4TNU A;  3SJE A;  4R7M A;  3D66 A;  2ZEG A;  2JBK A;  3CPX A;  3CPA A;  4PQA A;  3SI2 A;  4JYW A;  3KHX A;  5D29 A;  2POK A;  3MRU A;  1YSJ A;  3KGQ A;  4B6Z A;  4P6Y A;  6CPA A;  4MCS A;  3VAT A;  3QNV A;  1H8L A;  3FEE A;  3D67 A;  1ELM P;  1ZLH A;  3D7D A;  2EWB A;  4NGQ A;  4R6T A;  1PYT B;  4WJB A;  2ABZ A;  1VHE A;  4AXV A;  3VAR A;  2PIY A;  2NYQ A;  4A39 A;  1BPM A;  1AMP A;  3IIB A;  3WC7 A;  2GLF A;  3B3W A;  4NGM A;  3KHZ A;  2ZOG A;  4A94 A;  1ZG7 A;  2IJZ A;  2PIZ A;  4Q7A A;  1QQ9 A;  3DGV A;  1BPN A;  1XBU A;  5ELY A;  3SI1 A;  4P4I A;  4IHM A;  4JZ0 A;  3JRU A;  2EK9 A;  2V8D A;  2C6C A;  4NJQ A;  3BXM A;  2Q43 A;  4MHZ A;  3WT4 A;  2OR4 A;  3B2Y A;  5K8M A;  5K8N A;  4OID A;  2PVW A;  2BO9 A;  3IFE A;  1TXR A;  4UF4 A;  4ZY0 A;  3PB4 X;  3FH4 A;  3RAM A;  1JQG A;  5HVG A;  3D7H A;  1RTQ A;  3H8G A;  1DE4 C;  1NSA A;  1Y0R A;  3RBU A;  1LAN A;  1F57 A;  4MCP A;  4P4D A;  5CPA A;  1BAV A;  3IEH A;  1QMU A;  3KAS A;  3NH4 A;  5J1Q A;  4NJR A;  2ZEP A;  4ZY2 A;  1Z5R A;  4F9V A;  3FEC A;  4P4E A; 
#chains in the Genus database with same CATH topology
 2YNE A;  4B13 A;  3P2H A;  1VIX A;  3KR5 A;  1XEB A;  3NE7 A;  2GLJ A;  4MBU A;  2BUE A;  2WZN A;  3TOA A;  5AG4 A;  1YVK A;  3DNS A;  3D2P A;  3DR6 A;  3IGR A;  4CYN A;  1BO4 A;  5DS0 A;  2ZW7 A;  4A33 A;  1TF9 A;  2F5I A;  2HV2 A;  4R87 A;  2ZOF A;  2V77 A;  1N71 A;  2HQY A;  4UEE A;  3G3S A;  4PSX A;  4A30 A;  2PE3 A;  4UFV A;  4FD6 A;  3CDX A;  3SI0 A;  5IB9 A;  1ARM A;  3KZW A;  3FF3 A;  4B5P B;  1CJW A;  3I1U A;  5AG6 A;  1M4I A;  3D4U A;  2JEV A;  2XEI A;  2Z3O A;  3B3T A;  2PJ8 A;  1IID A;  4A2Z A;  2EVN A;  1VHO A;  1ARL A;  4NSQ A;  3S9L A;  1YVO A;  4IK2 A;  2GFQ A;  1Y9K A;  1CP7 A;  3GYA A;  1M1D A;  2PJB A;  3RNZ A;  3GLJ A;  4EVY A;  4ONU A;  2WPX A;  1ELL P;  2JEW A;  3NA6 A;  3BJ8 A;  2IQ6 A;  1IYL A;  1CM0 A;  2B4B A;  1TF8 A;  2PSW A;  4E2A A;  4QB9 A;  4C68 A;  1X12 A;  2B4D A;  2QYV A;  4KLV A;  4ORF A;  2VEZ A;  2AJ6 A;  4Z65 A;  3EXN A;  1MJA A;  1Y0Y A;  1PCA A;  4YU9 A;  4B10 A;  2PJ6 A;  3WAB A;  4CGM A;  2R7H A;  2PJ4 A;  3S9M A;  1Q7L A;  4E8O A;  3A9L A;  3P2F A;  4M85 A;  2YNC C;  4CAF A;  2XEF A;  5AGE A;  4YGO A;  1XMB A;  5A28 A;  1I21 A;  1FT7 A;  2CIJ A;  2Q4Y A;  3IWW A;  2Z3K A;  3DSB A;  5A27 A;  1TIQ A;  2VZZ A;  4KOY A;  1Y9W A;  2CF4 A;  4MRI A;  4NGT A;  2OOT A;  5F48 A;  1CBX A;  5C82 A;  3D68 A;  2PVV A;  4IAV A;  4Q38 A;  4UEZ A;  4A95 A;  2BOA A;  3FBU A;  4A31 A;  4FAI A;  2FT0 A;  2PJ3 A;  4C7H A;  3ZJ0 A;  5LRK A;  5HH1 A;  3FB3 A;  3QB8 A;  4MCR A;  4OC4 A;  3H8E A;  5G21 A;  4NFR A;  4XPD B;  3NE8 A;  5H84 A;  3DLJ A;  4JJX A;  5K8O A;  1YRE A;  1R57 A;  5KTC A;  1ZG8 A;  2G3T A;  1IGB A;  3LAC A;  4L8A A;  4KOW A;  2IL4 A;  3CXQ A;  3ISZ A;  3D7F A;  3MGD A;  3DDD A;  3FMC A;  5THW A;  4DUK A;  4EFD A;  5KTA A;  2VZY A;  4B12 A;  2Q7S A;  4ZX8 A;  3IWE A;  3PFE A;  3B3V A;  4OLL A;  3SJF A;  1LAM A;  3EY5 A;  2G9D A;  2ZEE A;  3LMS A;  4UWI A;  3S6F A;  1YLO A;  3PBB A;  2CNM A;  2QJ8 A;  4JD6 A;  1S60 A;  4MFQ A;  4OAE A;  1VHS A;  4TWE A;  2G3A A;  1KWM A;  4K3N A;  2I00 A;  5KTD A;  1KUY A;  1IY7 A;  1ON0 A;  2I3C A;  2OZG A;  2G0B A;  4IF5 A;  4EWT A;  4LQG A;  1B87 A;  3B3S A;  1Q2C A;  4UA3 A;  1U6M A;  2EBJ A;  1TKJ A;  4KOT A;  3GKR A;  4DJL A;  4ZI6 A;  5DWM A;  4P4F A;  5HVF A;  4CYQ A;  4R76 A;  1WK4 A;  5K8P A;  4KSA A;  4KSF A;  4YFJ A;  4AG9 A;  1EE3 P;  4PXC A;  3EFA A;  4CAE A;  2VBQ A;  4KOR A;  1I1D A;  3MN8 A;  2OB0 A;  3GB0 A;  1RXT A;  1L0C A;  3R9E A;  1K4J A;  5BWA B;  5F46 A;  2O4H A;  2BEI A;  2CTC A;  1S7N A;  4U9Z A;  4LQ6 A;  4MHP A;  3I3G A;  4R8F A;  4UCP A;  4ZBG A;  4ZY1 A;  1Z9U A;  4UIB A;  1F2P A;  4KVX A;  1HDU A;  3GY9 A;  4FUU A;  3QAH A;  3HUV A;  2PDO A;  4UFW A;  2D4P A;  5GCN A;  5JGF A;  5LYL A;  3PB9 X;  4MFP A;  2GRE A;  4DYO A;  4F9U A;  3HLP A;  3OWC A;  2R8V A;  4KOV A;  1YW6 A;  2H5M A;  4YWY A;  2PJA A;  2QVP A;  3RZA A;  4R3L A;  4MFJ A;  4FD4 A;  4HNY B;  2DEA A;  4EME A;  2DPS A;  4KUA A;  4KSI A;  5EBV A;  2I79 A;  4PXB A;  2GU2 A;  1ZLI A;  4F8Z A;  3N5F A;  4C7I A;  2VXK A;  2AFO A;  2B3V A;  3ISX A;  4KZT A;  5LYI A;  4CGO A;  4F6A A;  2PJ0 A;  1YW4 A;  2PJC A;  4PSW A;  5HVH A;  2ZW4 A;  3WC5 A;  5C88 A;  1NE9 A;  2CXA A;  4KVM E;  4OC1 A;  4J3G A;  2KCW A;  4KOX A;  1OBR A;  1PUA A;  1TKF A;  3IC1 A;  4JWP A;  4X5K A;  2D4O A;  2AFM A;  4F9V A;  2CY2 A;  2FCK A;  2EK8 A;  2ZEH A;  2WYR A;  3IWG A;  1UWY A;  2OZH A;  2QIR A;  2DF5 A;  4HNW B;  2HB6 A;  2QML A;  4MHN A;  1KUV A;  1QSO A;  3PB8 X;  4OC3 A;  1JWQ A;  1P4N A;  5HXD A;  2FL4 A;  4OME A;  2GE3 A;  5LRJ A;  4AVB A;  4P4J A;  2PJ9 A;  3R96 A;  4L89 A;  3V38 A;  3PBE A;  2F8H A;  8CPA A;  2RC4 A;  2AFZ A;  3VWE A;  3KI9 A;  5F47 A;  3PRT A;  2B5G B;  1S3Z A;  5D8N A;  4GXH A;  1Z8T A;  3TFY A;  4ZX9 A;  1GYT A;  2DPT A;  4OKO A;  4UEF A;  3T90 A;  4AVC A;  4B5O A;  1CP6 A;  3H8F A;  2ZPA A;  2EO8 A;  4NGP A;  4X8I A;  3K9T A;  1B6B A;  3V7Z A;  1LFW A;  3CXS A;  4RS2 A;  4P44 A;  4OC5 A;  3W91 A;  1IB1 E;  4FBE A;  5JQ4 A;  3R9G A;  5I4M A;  4II9 A;  1M44 A;  3WC6 A;  4C2X A;  1X10 A;  4MMO A;  4C2Z A;  3EO4 A;  4BD9 A;  4FD5 A;  5G20 A;  1BOB A;  1MJB A;  1XRY A;  2Q51 A;  1IIC A;  2JLM A;  4PXD A;  3SXN A;  4AG7 A;  2ANP A;  2NSM A;  3G8W A;  2REE A;  4P10 A;  3PB6 X;  2O53 A;  1GHE A;  3F5B A;  4A38 A;  5CBM A;  1Z8L A;  3TT2 A;  4KUB A;  2O28 A;  4O23 A;  3KQX A;  1CG2 A;  4NGR A;  2ZW5 A;  5EMI A;  4PPZ A;  2Z3L A;  4CS0 B;  4B5P A;  2J8R A;  3KQZ A;  3K9U A;  4PXE A;  4CAX A;  3LOD A;  2ZEF A;  5G1Z A;  4MJ8 A;  3B7I A;  4A32 A;  2REF A;  1M4D A;  3JUW A;  4NF1 A;  2OZU A;  2BSW A;  2PRQ A;  4H2K A;  4UWJ A;  5JPH A;  3BHX A;  2ZW6 A;  4M6H A;  3RYO A;  3T9Y A;  5F09 A;  4OC0 A;  2IMO A;  4LX9 A;  2FVG A;  2Z0Z A;  1IYK A;  4OC2 A;  3TOB A;  2AFS A;  1Z2L A;  1FY7 A;  2B5G A;  1XFO A;  4UFX A;  1CPS A;  4PK2 A;  4R9M A;  1R43 A;  4U9Y A;  4ZYQ A;  1M4L A;  4JXQ A;  3VH9 A;  1CX8 A;  2PR8 A;  1I12 A;  5G22 A;  3B8G A;  5IB0 A;  2FIA A;  4MI4 A;  2V8V A;  3PFO A;  1S5K A;  4DNC A;  3BI0 A;  4H89 A;  2XEJ A;  2PJ1 A;  2PQ8 A;  3TX8 A;  1XOV A;  3NH8 A;  3SHP A;  1QSN A;  3IO1 A;  5HMN A;  4P45 A;  1YLE A;  2C6P A;  4ONW A;  2R98 A;  4H6Z A;  1R3N A;  3D3S A;  4P4B A;  4R57 A;  3FVL A;  5FVJ A;  3S6G A;  2AFW A;  4Y49 C;  2PCU A;  2FS5 A;  2F7V A;  2PJ5 A;  2JDC A;  4NGS A;  2AE6 A;  2BL1 A;  4B14 A;  4X3R A;  4BMH A;  3B3C A;  1A2Z A;  3R95 A;  3CT9 A;  4CRZ B;  5JM6 A;  5IV0 A;  2Q4Z A;  1XE4 A;  3S9N A;  2FXF A;  3LWU A;  4NGN A;  3S6K A;  1VKC A;  5AG5 A;  1P0H A;  4MHY A;  3D7G A;  3FED A;  2CNT A;  1TKH A;  4CGN A;  3TC8 A;  3GIU A;  2X7B A;  1LOK A;  2PRB A;  3ZZI A;  5JH9 A;  2JDD A;  2JBJ A;  5F49 A;  2J8N A;  2ZEN A;  3D2M A;  4KOS A;  2FE7 A;  3K2K A;  3GUX A;  4MXU A;  4NXY A;  4RN7 A;  2WUU A;  2P6E A;  3CZX A;  4NCZ A;  3IJ3 A;  2ZEL A;  4XNH C;  1LAP A;  3T8W A;  3F8K A;  3N7Z A;  1Y7E A;  3PB7 X;  3PP9 A;  4CAV A;  1FNO A;  3KR4 A;  4HPS A;  4W9Y A;  2J9A A;  5LRG A;  4A37 A;  1DTD A;  3R1K A;  3SXO A;  2B4D B;  4CGL A;  4RUH A;  2RB7 A;  4HNX B;  1HEE A;  1MJ9 A;  3FIX A;  3L2N A;  3W6X A;  2V8H A;  5LYF A;  1CPX A;  1XJO A;  2OH1 A;  3PEI A;  4CAW A;  4UIA A;  2ZEM A;  4G1P A;  3B35 A;  4FWU A;  4ZGY B;  4WWV A;  7CPA A;  4UCM A;  1S7K A;  2GIV A;  2QEC A;  2FIW A;  3BI1 A;  1S7F A;  2WSA A;  1Q2D A;  2VL1 A;  4GM5 A;  4QBJ A;  2BCO A;  1OZP A;  4CPA A;  2PJ2 A;  4I49 A;  4XPK A;  2PJ7 A;  3SJG A;  1XMT A;  4OIW A;  2P6F A;  4F0Y A;  1QSM A;  1YME A;  1F2O A;  3NFZ A;  1HDQ A;  2NMT A;  2XEG A;  5ISV A;  2C1C A;  1AYE A;  4MFL A;  3WR7 A;  2AFU A;  4R3K A;  3JVN A;  3E0K A;  2P6G A;  4X2T A;  5EC4 A;  3PGP A;  1ZG9 A;  4MY3 A;  3FXT A;  5I0C A;  2VQY A;  1BLL E;  2FSR A;  1V0C A;  4MCQ A;  4QVT A;  3SJX A;  1VGY A;  4M6G A;  1IU8 A;  2CTB A;  2AFX A;  4GS4 A;  4OP4 A;  4KS9 A;  1MK4 A;  2Z11 A;  3TO9 A;  1J4J A;  4CGP A;  2PR1 A;  4HKF A;  2HC9 A;  2YNC A;  2EUI A;  3KL9 A;  2RFH A;  2ZEO A;  4JLY A;  1Y7R A;  5LYD A;  1XIX A;  2C6G A;  3BJ7 A;  1LCP A;  4PV6 A;  2ZED A;  2VI7 A;  4QUS A;  2V8G A;  3V8I A;  3NH5 A;  3FX6 A;  2Z3P A;  2A4N A;  3FJU A;  4UBR A;  4TNU A;  3PZJ A;  5E96 A;  3SJE A;  2R1I A;  3S6H A;  4R7M A;  3D66 A;  3W6S A;  4RI1 A;  2ZEG A;  2C27 A;  2JBK A;  4B11 A;  3CPX A;  3CPA A;  4PQA A;  4Y49 B;  1ZO0 A;  3SI2 A;  4AVA A;  4JYW A;  1IOF A;  2HUZ A;  3KHX A;  5D29 A;  2POK A;  4KVO E;  2ARH A;  4E0A A;  2ODF A;  3MRU A;  1YSJ A;  1QST A;  5J8C A;  4KLW A;  2Q4V A;  3KGQ A;  2Q7B A;  4B6Z A;  4P6Y A;  5AG7 A;  3RO0 A;  6CPA A;  3KKW A;  1LRZ A;  4MCS A;  3VAT A;  4K30 A;  3QNV A;  1H8L A;  3R9F A;  3TTH A;  3FEE A;  3D67 A;  1ELM P;  2Y0M A;  1ZLH A;  4LUA A;  2J8M A;  3D7D A;  3CXP A;  3H4Q A;  2EWB A;  2DXQ A;  4KOU A;  4U5Y A;  4XNH B;  1Z8X A;  2ATR A;  5IX3 A;  3F0A A;  4NGQ A;  2Q0Y A;  4PK3 A;  4CYP A;  2B58 A;  1Q2Y A;  4R6T A;  1PYT B;  3UY5 A;  4WJB A;  2ABZ A;  1VHE A;  2GAN A;  2Z3N A;  2YND A;  4AXV A;  3VAR A;  2PIY A;  2NYQ A;  1KUX A;  2CNS A;  4MFK A;  1PU9 A;  2ZXV A;  4M6I A;  4A39 A;  4H6U A;  1UFH A;  4C2Y A;  2B3U A;  3TE4 A;  1WWZ A;  2YGW A;  3TCV A;  2Q04 A;  4BBH A;  1BPM A;  1AMP A;  1NMT A;  1IOI A;  3IIB A;  4MY0 A;  2GLF A;  3B3W A;  3WC7 A;  4CYO A;  4NGM A;  3I9S A;  3KHZ A;  2OU2 A;  4JXR A;  2ZOG A;  4YRH A;  4A94 A;  3TO7 A;  1ZG7 A;  5CNP A;  2IJZ A;  2PIZ A;  4Q7A A;  1AUG A;  1QQ9 A;  1YX0 A;  4XPL A;  3DGV A;  1BPN A;  1XBU A;  3VWD A;  5ELY A;  3IU1 A;  3SI1 A;  4QC6 A;  3FYN A;  4IHM A;  4P4I A;  4JZ0 A;  1NSL A;  2Z3M A;  3JRU A;  1M4G A;  3D8P A;  3FRM A;  2EK9 A;  2K5T A;  2V8D A;  3EC4 A;  2C6C A;  4NJQ A;  1Z4E A;  1Z8W A;  3BXM A;  2Q43 A;  1S7L A;  4Q36 A;  4MHZ A;  3WT4 A;  1YK3 A;  2OR4 A;  3FNC A;  3B2Y A;  4OAD A;  5K8M A;  4M3S A;  5K8N A;  4OID A;  2PVW A;  2BO9 A;  3IFE A;  1TXR A;  4UF4 A;  4ZY0 A;  3DR8 A;  3H5Z A;  3PB4 X;  3FH4 A;  1KZF A;  4XPD C;  3RAM A;  5J8F A;  4UCN A;  1JQG A;  3QAY A;  3D7H A;  5HVG A;  1RTQ A;  2WPW A;  3H8G A;  1Z4R A;  1DE4 C;  2PC1 A;  2Q44 A;  3TO6 A;  1NSA A;  1Y0R A;  1YR0 A;  3RBU A;  1LAN A;  1F57 A;  1RO5 A;  3BLN A;  3JTK A;  1SQH A;  5DWN A;  4MCP A;  4P4D A;  1XF8 A;  5CPA A;  2Z10 A;  4AB7 A;  1BAV A;  3IEH A;  5H86 A;  3IU2 A;  1QMU A;  4BIN A;  3C26 A;  3KAS A;  3NH4 A;  5J1Q A;  4NJR A;  2ZEP A;  4MHD A;  4MFZ A;  4ZY2 A;  1YGH A;  1Z5R A;  4FD7 A;  4F0X A;  3FEC A;  2P0W A;  1QSR A;  3LD2 A;  1YQE A;  4IUS A;  4NEX A;  4P4E A;  4CRY B; 
#chains in the Genus database with same CATH homology
 1VIX A;  3KR5 A;  2GLJ A;  2WZN A;  5DS0 A;  1TF9 A;  2ZOF A;  2V77 A;  4UEE A;  2PE3 A;  3CDX A;  3SI0 A;  5IB9 A;  1ARM A;  3KZW A;  3FF3 A;  3I1U A;  3D4U A;  3B3T A;  2XEI A;  2PJ8 A;  1VHO A;  1ARL A;  3S9L A;  4IK2 A;  1CP7 A;  2PJB A;  3GLJ A;  1ELL P;  2JEW A;  3NA6 A;  2IQ6 A;  1TF8 A;  2QYV A;  4Z65 A;  1Y0Y A;  1PCA A;  4YU9 A;  2PJ6 A;  3WAB A;  2PJ4 A;  3S9M A;  1Q7L A;  2XEF A;  1XMB A;  2CIJ A;  1FT7 A;  3IWW A;  2OOT A;  2CF4 A;  4MRI A;  4NGT A;  1CBX A;  3D68 A;  2PVV A;  4IAV A;  4UEZ A;  2BOA A;  4FAI A;  2PJ3 A;  5LRK A;  4MCR A;  4OC4 A;  3H8E A;  4NFR A;  3DLJ A;  5K8O A;  1ZG8 A;  1IGB A;  4DUK A;  3ISZ A;  3D7F A;  3FMC A;  5THW A;  4EFD A;  4ZX8 A;  3PFE A;  3B3V A;  3SJF A;  1LAM A;  2G9D A;  2ZEE A;  3LMS A;  1YLO A;  3PBB A;  2QJ8 A;  4TWE A;  1KWM A;  4K3N A;  1IY7 A;  2I3C A;  4EWT A;  4LQG A;  3B3S A;  1TKJ A;  4ZI6 A;  4DJL A;  4P4F A;  5HVF A;  4R76 A;  5K8P A;  1EE3 P;  4PXC A;  3MN8 A;  3GB0 A;  2O4H A;  2CTC A;  4MHP A;  4R8F A;  4ZY1 A;  4UIB A;  1F2P A;  1HDU A;  4FUU A;  3HUV A;  5JGF A;  5LYL A;  3PB9 X;  2GRE A;  4DYO A;  4F9U A;  3HLP A;  1YW6 A;  4YWY A;  2PJA A;  2QVP A;  3RZA A;  2DEA A;  4EME A;  4KSI A;  4PXB A;  2GU2 A;  1ZLI A;  4F8Z A;  3N5F A;  2AFO A;  3ISX A;  5LYI A;  2PJ0 A;  1YW4 A;  2PJC A;  5HVH A;  3WC5 A;  4OC1 A;  1OBR A;  1TKF A;  3IC1 A;  2AFM A;  2EK8 A;  2ZEH A;  2WYR A;  1UWY A;  2HB6 A;  4MHN A;  4OC3 A;  3PB8 X;  5HXD A;  4OME A;  5LRJ A;  4P4J A;  2PJ9 A;  3V38 A;  3PBE A;  2F8H A;  8CPA A;  2AFZ A;  3KI9 A;  3PRT A;  5D8N A;  4ZX9 A;  1GYT A;  4OKO A;  4UEF A;  1CP6 A;  3H8F A;  4NGP A;  4X8I A;  3K9T A;  3V7Z A;  1LFW A;  4P44 A;  4OC5 A;  4FBE A;  5I4M A;  3WC6 A;  4MMO A;  4BD9 A;  1XRY A;  2Q51 A;  4PXD A;  2ANP A;  2NSM A;  4P10 A;  3PB6 X;  2O53 A;  5CBM A;  4A38 A;  1Z8L A;  4O23 A;  3KQX A;  1CG2 A;  4NGR A;  4PPZ A;  4PXE A;  3KQZ A;  2ZEF A;  3B7I A;  2PRQ A;  4H2K A;  3BHX A;  5F09 A;  4OC0 A;  2IMO A;  2FVG A;  4OC2 A;  2AFS A;  1Z2L A;  1XFO A;  1CPS A;  4ZYQ A;  1R43 A;  1M4L A;  3VH9 A;  1CX8 A;  2V8V A;  3PFO A;  3BI0 A;  2XEJ A;  2PJ1 A;  3TX8 A;  3NH8 A;  3IO1 A;  4P45 A;  2C6P A;  4ONW A;  1R3N A;  4P4B A;  3FVL A;  2AFW A;  2PCU A;  2F7V A;  2PJ5 A;  4NGS A;  4X3R A;  3B3C A;  5JM6 A;  3CT9 A;  2Q4Z A;  3S9N A;  3LWU A;  4NGN A;  4MHY A;  3D7G A;  3FED A;  1TKH A;  3TC8 A;  1LOK A;  5JH9 A;  2JBJ A;  2ZEN A;  3K2K A;  3GUX A;  4MXU A;  3IJ3 A;  2ZEL A;  3T8W A;  1LAP A;  3PB7 X;  1Y7E A;  1FNO A;  3KR4 A;  4W9Y A;  2J9A A;  5LRG A;  4A37 A;  1DTD A;  4RUH A;  2RB7 A;  1HEE A;  3L2N A;  2V8H A;  5LYF A;  1CPX A;  1XJO A;  3PEI A;  4UIA A;  2ZEM A;  4G1P A;  3B35 A;  4FWU A;  4WWV A;  7CPA A;  3BI1 A;  4GM5 A;  2VL1 A;  2BCO A;  4CPA A;  2PJ2 A;  2PJ7 A;  3SJG A;  4OIW A;  1YME A;  1F2O A;  3NFZ A;  1HDQ A;  2XEG A;  2C1C A;  1AYE A;  2AFU A;  4X2T A;  1ZG9 A;  1BLL E;  4MCQ A;  3SJX A;  1VGY A;  2CTB A;  2AFX A;  4OP4 A;  2HC9 A;  3KL9 A;  2RFH A;  2ZEO A;  5LYD A;  2C6G A;  1LCP A;  2ZED A;  2V8G A;  3NH5 A;  3FX6 A;  3FJU A;  4TNU A;  3SJE A;  4R7M A;  3D66 A;  2ZEG A;  2JBK A;  3CPX A;  3CPA A;  4PQA A;  3SI2 A;  4JYW A;  3KHX A;  5D29 A;  2POK A;  3MRU A;  1YSJ A;  3KGQ A;  4B6Z A;  4P6Y A;  6CPA A;  4MCS A;  3VAT A;  3QNV A;  1H8L A;  3FEE A;  3D67 A;  1ELM P;  1ZLH A;  3D7D A;  2EWB A;  4NGQ A;  4R6T A;  1PYT B;  4WJB A;  2ABZ A;  1VHE A;  4AXV A;  3VAR A;  2PIY A;  2NYQ A;  4A39 A;  1BPM A;  1AMP A;  3IIB A;  3WC7 A;  2GLF A;  3B3W A;  4NGM A;  3KHZ A;  2ZOG A;  4A94 A;  1ZG7 A;  2IJZ A;  2PIZ A;  4Q7A A;  1QQ9 A;  3DGV A;  1BPN A;  1XBU A;  5ELY A;  3SI1 A;  4P4I A;  4IHM A;  4JZ0 A;  3JRU A;  2EK9 A;  2V8D A;  2C6C A;  4NJQ A;  3BXM A;  2Q43 A;  4MHZ A;  3WT4 A;  2OR4 A;  3B2Y A;  5K8M A;  5K8N A;  4OID A;  2PVW A;  2BO9 A;  3IFE A;  1TXR A;  4UF4 A;  4ZY0 A;  3PB4 X;  3FH4 A;  3RAM A;  1JQG A;  5HVG A;  3D7H A;  1RTQ A;  3H8G A;  1DE4 C;  1NSA A;  1Y0R A;  3RBU A;  1LAN A;  1F57 A;  4MCP A;  4P4D A;  5CPA A;  1BAV A;  3IEH A;  1QMU A;  3KAS A;  3NH4 A;  5J1Q A;  4NJR A;  2ZEP A;  4ZY2 A;  1Z5R A;  4F9V A;  3FEC A;  4P4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...