4PSXA

Crystal structure of histone acetyltransferase complex
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
313
structure length
313
Chain Sequence
b'KPETWTSSANEALRVSIVGENAVQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDSVTFKPYVNVKYSAKLGDDNIVDVEKKLLSFLPKDDVIVRDEAKWVDCFAEERKTHNLSDVFEKVSEYSLNGEEFVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLLNKKTKELIGFVTTYKYWHYLGAKSFDEDIDKKFRAKISQFLIFPPYQNKGHGSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKLGYDAVFQKHSDLSDEFLESSRKSLKLEERQFNRLVEMLLLLNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone acetyltransferase type B catalytic subunit
publication title Hat2p recognizes the histone H3 tail to specify the acetylation of the newly synthesized H3/H4 heterodimer by the Hat1p/Hat2p complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Histone/transferase
total genus 98
structure length 313
sequence length 313
chains with identical sequence D
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2014-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4psxA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4psxA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 4psxA01
2I79A 1KUVA 4XNHB 3D2PA 3T90A 2FS5A 3RYOA 4QB9A 4B5PA 3F8KA 4LX9A 2Q7BA 2PC1A 3W6XA 1KUXA 4AVBA 2GE3A 3FNCA 4X5KA 4KOWA 3TOBA 2B4DB 5C82A 1J4JA 5KTDA 4Y49B 3S6HA 4CRZB 3G8WA 2F5IA 3EFAA 4U9ZA 4UA3A 1V0CA 2D4PA 1PU9A 2H5MA 2R1IA 4M3SA 5H84A 4L89A 4CAVA 4HKFA 3V8IA 2RC4A 3ZZIA 4UWJA 5C88A 1LRZA 3BJ7A 1VHSA 4J3GA 2G3AA 4MY3A 1P0HA 1Z9UA 3DNSA 2OU2A 1MJAA 3R9EA 1Y7RA 4KVME 3W6SA 2FT0A 2KCWA 2FIWA 5JPHA 1XE4A 3E0KA 1VKCA 2ZW7A 2FIAA 4XPDC 2WPXA 2OH1A 4IUSA 2R98A 2O28A 2C27A 5CNPA 1QSMA 4H6UA 1Z4EA 2J8NA 4U9YA 1SQHA 2VZYA 2OZUA 1Q2CA 2X7BA 1Q2YA 5J8FA 4R57A 3P2HA 3FRMA 3GKRA 2G0BA 4KUAA 1YX0A 1IIDA 1Y9KA 1YK3A 2ZW4A 1QSRA 2J8RA 1S3ZA 4E8OA 4MY0A 1NE9A 2K5TA 4MI4A 3ZJ0A 4RI1A 4FD6A 1KZFA 2OZHA 3IGRA 2A4NA 1I1DA 2EVNA 1NSLA 2CY2A 4QBJA 1WWZA 5DWMA 3TT2A 1XEBA 2Z0ZA 3PZJA 3BLNA 2PRBA 3VWEA 3GY9A 2PR1A 4KORA 2FCKA 3TTHA 4OADA 3N7ZA 3FB3A 3SXOA 3TO9A 1B6BA 2VBQA 1QSTA 4II9A 4KLVA 2QECA 2B4DA 3R9GA 2B4BA 1TIQA 4UBRA 1S7FA 3R1KA 2AE6A 2NMTA 3SXNA 3NE7A 4PSWA 2P6GA 2HUZA 1S7NA 4AVAA 4JLYA 4I49A 4NSQA 2DXQA 1YVKA 4ZBGA 5F46A 1MJ9A 3KKWA 4HNYB 4R3LA 1QSNA 4MBUA 2Y0MA 2JDCA 3R95A 2IL4A 3B8GA 2R8VA 1FY7A 2Q04A 5F49A 4KOXA 1P4NA 3VWDA 2B3UA 2REEA 1S5KA 4NXYA 3D3SA 5KTCA 5GCNA 1PUAA 4KVXA 2VI7A 2BEIA 3LD2A 2WPWA 2FXFA 1BO4A 4E2AA 3LODA 4MJ8A 5KTAA 2I00A 4QVTA 1Y9WA 5I0CA 1R57A 2FE7A 4YFJA 2P6FA 4Y49C 1L0CA 3JVNA 1WK4A 3TO7A 2PQ8A 4H89A 2BSWA 2B58A 3DR8A 3EXNA 2Z11A 1S7LA 2Q4YA 4KOSA 2GIVA 2ZW6A 4ONUA 4PSXA 4LUAA 2ZXVA 4NF1A 4R3KA 3UY5A 1IYLA 4KVOE 1CM0A 1M4GA 2Q4VA 2ZPAA 2Q0YA 3TO6A 3CXQA 1UFHA 2PR8A 3W91A 4QUSA 2G3TA 3JUWA 2OB0A 4FD5A 3H4QA 4R9MA 2AJ6A 4PK3A 5F47A 5HH1A 4L8AA 4U5YA 1M44A 4NEXA 2ZW5A 5ISVA 1BOBA 2JDDA 1XMTA 3K9UA 4JXRA 4H6ZA 4JJXA 4UWIA 2Z10A 4AB7A 3S6FA 4ORFA 2JEVA 3OWCA 4GS4A 3DSBA 4AG9A 2QIRA 2QMLA 4CAXA 3TCVA 5E96A 3CXPA 3FBUA 4JXQA 4MHDA 2ATRA 2BUEA 5JQ4A 2FSRA 3WR7A 5IX3A 4NCZA 2B5GB 3DR6A 2R7HA 3TOAA 2VXKA 4KLWA 1M4IA 2FL4A 1IICA 4M85A 3SHPA 5J8CA 3D8PA 2P6EA 5FVJA 3R96A 4CAWA 2EUIA 2PDOA 3FIXA 1YREA 2VQYA 1Z4RA 2GANA 1YGHA 2Q44A 3BJ8A 5IB0A 1MK4A 2CNSA 3F0AA 4K30A 1QSOA 5EBVA 4YRHA 4XPLA 5H86A 3S6KA 4KUBA 4DNCA 4XNHC 4R87A 1I21A 3G3SA 3PGPA 4B5PB 2CNMA 1I12A 1IB1E 3F5BA 2REFA 3QB8A 3TE4A 4XPDB 1YLEA 2HV2A 4JWPA 1YR0A 3DDDA 3I3GA 1RO5A 3TFYA 1RXTA 1N71A 1NMTA 4CS0B 4YGOA 4PK2A 1YVOA 3FYNA 2OZGA 4QC6A 3S6GA 1B87A 3I9SA 4OAEA 3PP9A 2HQYA 3EY5A 4FD7A 2BL1A 4EVYA 4XPKA 4IF5A 1XF8A 4AG7A 5HMNA 4RS2A 2ARHA 2P0WA 2D4OA 1GHEA 1MJBA 1OZPA 4B5OA 1ON0A 4KZTA 3T9YA 1M4DA 5F48A 4KOUA 4PV6A 4HNXB 2VZZA 4KOVA 2PSWA 5EC4A 2B5GA 3GYAA 3R9FA 4FD4A 4JD6A 3CXSA 1XIXA 1IYKA 3P2FA 5IV0A 3EC4A 4KOYA 1Q2DA 1U6MA 5DWNA 2J8MA 4F6AA 1S60A 4AVCA 4E0AA 4BMHA 2CNTA 2JLMA 4CRYB 4HNWB 3QAHA 1KUYA 3IWGA 4F0YA 3FXTA 3EO4A 1M1DA 2VEZA 4KOTA 3MGDA 2B3VA 1S7KA 1CJWA 3C26A 1K4JA 4OLLA 3D2MA
chains in the Genus database with same CATH superfamily
2V1UA 4PK4A 3U2RA 2QSHX 3E6DA 1LJ9A 3MWMA 3G3ZA 2A3SA 4B5PA 5D8NA 2CO5A 2FBIA 1QRYA 2K3FA 3S9LA 2WAQN 1IN4A 1KUXA 5G1ZA 4HV5A 4DZJA 5DD4A 4ENJA 4NGNA 4NGRA 1O7FA 3L09A 1U5TA 3F8MA 3COAC 4YWYA 1A6IA 1MGTA 4EEFG 3CPAA 3UKGA 1BAVA 2EB7A 3P9KA 3D1NI 1R4MB 1OR7A 5IP6A 3G8WA 1FWZA 2EQRA 4EGZA 1JWQA 2F5IA 3EFAA 2I3CA 4U9ZA 2B0LA 1YW4A 4A2UA 1PU9A 2ZXJA 4ENNA 2R1IA 4M3SA 2QQ8A 3EQLF 2XVCA 1FBQA 4HKFA 1XSXA 2PJ8A 4D7MA 4XQFA 2Z3OA 1VQPI 2VKDA 3MKYB 4CCKA 5KNLA 5B1BH 3RIRA 2JZYA 1QVUA 3HSFA 4NGQA 5C88A 2DFIA 3IHUA 4IPAA 1Z8LA 2BVMA 3I53A 1ON2A 1IN5A 2C1CA 2R5ZA 3EPZA 4AVPA 3KETA 3HBLA 1QNTA 4ONWA 1U0JA 3A03A 3FK6A 3D7FA 2HR3A 2RN7A 1XTAA 4CA0A 3NWTA 4MY3A 4CYPA 1OCCH 1V5EA 4XM3A 1I1SA 3QPTA 1UHWA 4NB5A 2OU2A 2CRGA 1X2MA 1G8XA 5J40A 3TBIA 4S0HB 3S17J 3R9EA 2IBDA 4U87A 3E1SA 4GGGA 3U21A 4KVME 4CGLA 3ESWB 4P5OA 2PMZA 1SANA 2GIZA 4XLHA 3E6BA 3ASNH 3CESA 1YSJA 3V8LA 4L9TA 3SYTA 4EWTA 2M45A 1OMIA 1XC5A 4OOIA 3FXLA 2FIAA 1D5VA 1HDDC 1JHFA 2Q7SA 4XPDC 2WPXA 2OH1A 2EFNA 1FT9A 2CJJA 1X1PA 2L4AA 2WBMA 5LGTA 1CBXA 4IUSA 2R98A 4R1HA 3D5LA 1TC3C 3C7JA 2XEJA 2CUZA 2O28A 2L01A 4P4IA 5F09A 3JSPA 3UNGC 1E3OC 3IU2A 4KT6A 2QKLB 1ZRDA 2PJRB 4CDGA 3TGNA 1HDUA 2GXBA 4II3A 4LLGF 4WWCA 1Z4EA 1GDTA 2OOTA 3FXMA 2M4KA 1Z7LA 2HKXA 2RNJA 4AIKA 2VZYA 1ZG5A 1RR8C 1UHMA 2OZUA 4M6IA 3B3CA 1Q2CA 4X6AJ 2X7BA 3DU5A 4HG2A 4B48A 3M7GA 1Q2YA 4E7KA 4NJRA 4AIHA 4F7ZA 1ZH5A 2ESNA 2M7BA 2CQKA 3RPUD 2JN6A 2HU9A 3AG2H 1S72I 4TWEA 2E60A 2G0BA 1FPQA 1YX0A 1K4SA 1FIPA 4GXHA 2R5YA 1B8IA 5DM7F 1IIDA 1IZ1A 3F0CA 3H5RA 3CDLA 2HB6A 2NS0A 1SFKA 5I4MA 2XGXA 3ABTA 2X6OA 4MFZA 2XKOA 1QSRA 3CUOA 2ELJA 3GF2A 3GWZA 4CAFA 4A3EJ 1XGOA 1DDNA 2PBIA 3OL3A 1A36A 4Z6YA 4RI1A 4E7ZA 4FD6A 4OMEA 2ZSHB 4NNJA 5A2QZ 3TW6A 4OIWA 2DEAA 1KZFA 2DMTA 2PJAA 1LOKA 4C3JJ 3LSKA 5FKMA 1FOYA 1MSEC 3BR2A 3GCMA 2OZHA 2V8VA 4MCRA 5AGEA 1BA5A 3VDXA 1I1DA 1NSLA 2W82A 2JRMA 3DEEA 3O6BB 3L2CA 3BDDA 2GQQA 5CPRB 1XEBA 2DA4A 5CJ9A 3F22A 2R7SA 3BLNA 4C7HA 2F4MB 4L0ZB 1O3QA 4Y17A 4KORA 2HQNA 3ZMSA 2EV5A 3J81K 3HSRA 3CMMA 2CYYA 1IRFA 2XPVA 3D67A 3FB3A 2ZEGA 3TO9A 3SJGA 3FKIJ 4LOCA 3I4NJ 5F64A 1F1ZA 3BR1A 1YIJI 2G9WA 3H0GJ 4BS9A 5DS9A 2NAZA 3P9IA 3VATA 4M6HA 3TX8A 3R0AA 5LYLA 2QECA 3JRBA 2B4DA 3R9GA 2V1NA 2KDZA 1TIQA 1F43A 1KU9A 4B43A 2QLZA 3HB9A 2PJ1A 2A6HF 5EEGA 4X1EA 3QWLA 3HHHA 1WKMA 2QQBA 2KQRA 1A04A 4UB6C 4ZC3A 1YRNA 2AE6A 3C18A 3R6SA 1BC7C 3JRFA 4XRMA 2P6GA 1FP1D 5CQEA 3WG9A 5CVVA 1AMPA 4CGPA 4Q47A 1EKEA 4OAYA 2MC3A 1JKRC 2Q51A 3OOUA 1FYMA 1T38A 2FQ3A 2NVQJ 2R7TA 3PB4X 4NSQA 4NC7A 2XGCA 4M3EA 3KKWA 4G7HF 1BJZA 2DODA 1QQ9A 3OR1C 2VC0A 5JR3A 1ZAOA 1LUJB 4BXXJ 1H88C 2PI0A 3GFJA 1R36A 2DW4A 3SDBA 2JDCA 2ODFA 3AG4H 2LOOA 1IG7A 4LD5A 2R8VA 3OYCA 2L0KA 2QYOA 3K0LA 1W36D 4NQWB 2COBA 5F49A 4KOXA 1F9NA 2EV6A 3L2UA 5ICFA 2M1BA 2HNHA 5GTIC 3I71A 4AVZA 2VBYA 5J1UA 2CUJA 1XGMA 5TISC 1PUAA 3WT4A 3OYHA 3GFIA 4IKFA 1IV6A 5AIQA 3F8CA 1ETYA 1NK2P 3TP3A 1WJ5A 2NS7A 4KN4X 2IEKA 3B3SA 1BN5A 2OUMA 2X0LA 1OCTC 2BHYA 2LKPA 3ECOA 1SD5A 4DYOA 1Y9WA 3ZMUA 3KP6A 2Y9ZA 3F72A 3L2RA 2R93J 2HDCA 1Z3YA 1OJLA 5M5XJ 2VONA 2QVPA 1AYEA 4G1PA 1GXPA 1MZBA 2PLYA 1V3FA 2QZ8A 3FXQA 1DQUA 1VQMI 2W57A 4ZYDA 1XDSA 3P7NA 2PQ8A 3VYSB 3J7AY 3EXNA 4N9HA 5IP9J 2HDDA 2Z11A 1S7LA 4B1RA 1S6LA 3O3KA 4X8IA 2BBYA 1YQAA 3OL4A 5HDKA 3CZXA 2GIVA 4UCNA 2GREA 2ZW6A 3BJAA 2XSJC 4ONUA 3BCAA 4LUAA 2DLLA 3TMOA 3MEXA 2PJ3A 5D4SA 3LA7A 3T5XA 2V77A 4PJ0C 3IH3A 1R3NA 1MMDA 3K1PA 2VBXA 2XC7A 3S32A 1WJBA 2A69F 4G7OF 2ADUA 4FE7A 2TCTA 3FIWA 3TQNA 3ZR8X 4PXCA 3DEWA 1U2WA 4HOBA 3A9LA 4R9MA 2BE5F 3KEOA 4LG0A 1I6HJ 1XD7A 4BACA 3EUAA 2HPIA 5HH1A 5IT9Z 4L8AA 1Z6TA 1ZO0A 5HVFA 1SAUA 1RETA 2M87A 5DEQA 3K2KA 3MQ0A 2ZW5A 4MHZA 2FMLA 2EIJH 2DT7B 3VYUB 5J4YA 4H6ZA 1Y0NA 3ZMTA 2ZEHA 4C68A 2M4GA 3EUHC 3TDZC 3GX4X 2BYVE 4F9VA 1IV8A 1WGXA 3PM1A 1IDYA 4NUBA 5DV5A 5ERIA 3RKQA 3S6FA 4M71A 2XUBA 4F93B 4UEZA 3SJFA 3U1DA 5GPCA 1H0MA 1H89C 5JM6A 2WSAA 1YMEA 4ZH4F 2P5LC 3ZN0A 5K8OA 1G4DA 3E5QA 5FLMJ 1U78A 3TCVA 2ZNYA 1TXRA 1QMUA 4WXCA 4PXEA 5L3FA 2DPUA 3AFHA 3HRUA 1LE8B 2W1OA 2VC1A 4UXNA 3J7ZI 3WC7A 4A94A 1VQ5I 2W85A 1RIOH 2MD0A 1LQ1A 3R0JA 5H2FC 2ATRA 4YRVA 2NOJB 1Y0RA 2PVVA 1Y8QB 2BUEA 2PJ2A 2LBFA 5HS9A 1RKTA 1HLVA 3NE8A 1DU6A 3Q0WA 1T6SA 3DWLE 2R7RA 5ILVA 1W7PA 4KMUX 5L3BA 1XFOA 3DR6A 2NXNB 4BUPA 1ZGAA 2J5OA 1TNTA 2X6YA 2ABZA 3MN2A 2XF5A 2VUMJ 2BCOA 3TOAA 4F55A 2R7HA 3DKXA 2DA5A 2LKSA 2Y48A 2QBYA 5E20A 1IXCA 3ZRGA 2F7VA 1M4IA 4ZGYB 4PGHA 5E3LA 2HVQA 4IZZA 5LHGA 5E79C 4WXHA 4P4DA 4PGGA 3V42A 5LYFA 5J8CA 4A0YA 2YNEA 4YU9A 1J5YA 3HTUA 4I7HA 2HZDA 1T39A 4I02A 3HM5A 4MHNA 1KU3A 3KP7A 2L7ZA 2AQFA 3HGGA 2A07F 2CFXA 3WC6A 4RM3A 2GANA 4HLXA 2Q44A 4K3NA 2F5DA 1MK4A 3HUVA 4WF2A 2DMUA 1YITI 1TKJA 4L5JA 3HRMA 1JT0A 1YX5A 2Q0OA 3X2QH 4BEHA 5BPIA 4O5VA 1KYWA 4EJVA 4IQ4A 4XPLA 2K4JA 4KUBA 4LIVA 3QU6A 3FMQA 4R87A 1I21A 4IHTA 3OYKA 4P6YA 4ZYQA 4ZDLA 4MXUA 2KFDA 1V4RA 1T33A 3O2PE 3IWEA 1ZHFA 2WV1A 2B63J 3H0DA 2VLAA 3IUOA 2CNMA 3IFEA 3DV8A 1I12A 3GYHX 2QEXI 2REFA 1YX3A 5CVJA 2XROA 2FBHA 4J01A 3PSIA 2ESHA 4Q7AA 3PFEA 2WC2A 2IA0A 2HYJA 3SI1A 3TFYA 2PMZN 1Z0XA 3NQOA 4P9FA 4XLFA 1B6AA 4CHUA 5F6FA 2KRHA 3ZP5A 4UNOA 1VQLI 1IAWA 1RXTA 1H8LA 4BINA 2H27A 3I3LA 3RYRA 2IXSA 2OZGA 2LKXA 4OKOA 3H5AA 4FWUA 3I64A 1MH3A 1B87A 4OAEA 2F5CA 3ABKH 4LQGA 4F91B 1IXRC 2YX7A 3WTTC 3REOA 2D5VA 3AL0C 2NVTJ 3BHXA 4RM2A 1Y39A 4EVYA 1N75A 4XPKA 4IF5A 1UB9A 1U8RA 5BWAB 1K61A 2DYRH 3LAJA 2HOTA 2VJIA 5DM6F 5DTDA 3J80K 4X2TA 1FIAA 5M5YJ 2JA2A 3B7IA 1PVEA 2ZEMA 2X85A 3RJPA 2O3FA 2ZJRF 2D4OA 4KNYA 3Q5FA 1W4MA 1I3QJ 3SZTA 1P6RA 1YTYA 3CUQB 2RREA 3CCUI 1VHEA 3FX3A 1P7JA 2L7KA 3DU6A 1S7OA 2DFFA 2HS5A 4MTDA 4O3MA 2DO7A 2H94A 4YELA 3WGIA 1IGNA 2Z3PA 3S1MJ 2OA4A 5FLXK 1LAPA 4IK2A 2GXAA 2XPUA 4BQAA 5THWA 5HNHA 1IF1A 3MZYA 3PFYA 5EG0A 4BQQA 2A5YB 1PUFA 1DU0A 4FD4A 4KN7X 4M3DA 3A01A 1XX5A 3DPLC 2WV0A 4XL9A 1HC8A 3RQ4A 1Z21A 1XCBA 4ETSA 3EC4A 3JAMZ 2JPCA 3RDIA 2DMPA 3HXLA 4BBRJ 3SZPA 2R7FA 4F6AA 2PJCA 3CDIA 1AHDP 4E0AA 2EK5A 4G6DA 4BMHA 2UXXA 1OYYA 1TQIA 2F5VA 2DA3A 2CNTA 3IRRA 4FISA 2IS2A 1VZ0A 3ZQQA 2CQ7A 3QAHA 5LBQA 3H3VK 3IWGA 1N77A 3WC5A 4BY7J 2CFOA 4KOTA 3JRGA 2DOEA 1CF7B 4IF4A 2KZVA 1YJWI 3MGDA 3KASA 3T1BA 2LP0A 1YW9A 4DZPA 3GO5A 3OYBA 1BR2A 3A0BC 1TT0A 1CJWA 3DBRB 2STTA 3M8EA 5E1WA 3PRTA 5J6XA 2MFZA 4R6TA 1NSAA 3D2MA 1SFEA 2R3SA 1Z7UA 4KJZA 2HOAA 3G1LA 2OJED 2O8XA 3D2PA 2FS5A 5HNFA 1WPKA 3RYOA 3F8FA 4BHBA 3BQYA 5C44J 4LK1F 2W84A 1EH6A 2DFEA 2RGVA 1D1BA 3ZQHA 2DYSH 1D8KA 1BW6A 4D5CA 3LSGA 3SZGA 3QYBA 3FNCA 4MIMA 1MDMB 2IP2A 3PNTA 3H36A 4HDVA 1WRJA 1XSVA 2BW3A 2X6WA 4Q4ZF 1HEEA 2LC2A 1MW7A 4HNUA 2BY3A 1ACIA 3M9AA 4RGRA 1TQMA 3F8NA 7CPAA 2I5UA 4M9ZA 4RAGA 1YW8A 4LB6B 3LWUA 2DU9A 4U7DA 3WGGA 4WK8F 4EGYA 4AC0A 4BDYA 2D4PA 3IAS2 3S14J 1TWAJ 1J0RA 2M3AA 1JE8A 2V4JC 4UY8I 4L89A 4CAVA 1QO0D 4QWQA 2VKHA 1Y6IA 2DOAA 4E7LA 2X1DA 3H8GA 4MHYA 3QNVA 4HX8A 4UWJA 3V8IA 4BDZA 2OC6A 1FC3A 5FRMA 4KUMA 3DTEA 4CYDA 1LRZA 3K4NA 1O4XA 3BJ7A 3O8HA 1MNDA 1R58A 1XGSA 2K9MA 4KDPA 1F2OA 3P5JA 2VBZA 1D0XA 5GAGJ 3HOZJ 3BJOA 3BZ6A 2BOAA 3WHBA 1UELB 4CZCA 1ZLKA 2YR2A 3K70D 3S16J 3FMCA 3HOYJ 5FLVA 4F3QA 3RZAA 2E1MB 4O23A 1XRYA 1MKMA 1X1CA 2XB5A 1Y7RA 3PB9X 4Q5SF 5D5UB 4UCMA 2ETHA 3UR3C 2FVGA 2FIWA 2DA1A 2L3DA 1LPQA 2ZOGA 4MFQA 5KAIC 5JPHA 1WJFA 2ZENA 2MC4A 3VODA 3KR5A 4EJWA 1UJ8A 2ZW7A 4P96A 4U0WA 5LEJA 2QA4I 1JI8A 1W0UA 2VT2A 4QTRA 3DQVC 1J09A 1MIJA 2J5PA 2L9VA 4OMYA 2FUG2 5CLSA 1Z77A 1B1BA 3NEUA 1MBKA 2NRAC 3D66A 4XORA 4B8XA 4DBQA 5LD2C 4AM3A 2XV4S 1WJCA 2E5ZA 4W1UA 1E17A 1JUMA 2J8NA 2ZOFA 4NC8A 4L9NA 3L2QA 3CMEI 2HQRA 1G59A 4LG3A 1DTDA 1SQHA 2PJ5A 3FXJA 1Y56A 4A39A 2DDAA 4XICA 4Y13A 3P2HA 4RMNA 3J7AO 3DBHB 6CPAA 4MLOA 4MHGA 4XLEA 4A38A 2ZB9A 3CC7I 2GLFA 5LGUA 3FRMA 1SD6A 3GKRA 2QKMB 3TC8A 4EQQA 3FMSA 4R8HA 5J3LA 2O7OA 4RGUA 2KPMA 5IP7J 4V2FA 1YK3A 2GA2A 2DTRA 4C2ZA 4HEA2 3HUGB 4I76A 1S3ZA 4CCJA 1NG6A 2K5TA 5ICEA 3ZJ0A 5FGMA 2JVHA 3FWEA 1SAXA 3AG1H 1JGSA 1ZTRA 2R7XA 2EA4A 1SVOA 2E19A 1SD7A 4KICA 3IGRA 1VF9A 3CCYA 4UEFA 3F6VA 1VQKI 3M1EA 4HDUA 2FU4A 5D29A 3NRVA 4A3CJ 1BI2A 2CY2A 4QBJA 3B6CA 2E1CA 2CQQA 2ZBKA 5DWMA 3TT2A 2EPFA 1FMWA 1XGNA 4EATA 3KQZA 3B3VA 3V7RA 1SVLA 2DCEA 3FK7A 5DUIA 2FCKA 2CGPA 1AA7A 1CGPA 3GTJJ 4OADA 2W25A 3FECA 2MABA 2VE9A 2NOGA 3LL7A 4A0ZA 3S1RJ 1HDQA 1YE9A 1B72B 2M5WA 1IRGA 4KLVA 3L1PA 5JI6A 1JUSA 2B4BA 4GCVA 4IHVA 3NH5A 2B7EA 3BTIA 3ROUA 1X3WB 2XDVA 2ZXHA 3KLNA 5HDNA 3BR0A 2M8GX 1LKXA 1TP4A 2JA8J 3R1KA 3SJEA 3QOEA 4D5FA 1IY7A 1OCZH 5M5WJ 1GUUA 2VBWA 4LLLA 3ZMDA 3SXNA 1DP7P 3GVAA 4JLYA 4I49A 5GPAA 2CIJA 4A3IJ 2PCUA 1B4AA 2DXQA 2PJ0A 1KYZA 1U6GA 2GZWA 4ZBGA 1YI2I 4YFXF 5HLTA 3L2VA 2Q2EA 1QSNA 2BV6A 3CQZJ 5EEAA 2L02A 4KFCA 1ZGJA 2O61A 3FH4A 3SXYA 1KU7A 4A37A 3RNZA 4FQGA 1NK3P 1GV2A 2X48A 4FTHA 1KA8A 2IL4A 5D5WB 3B8GA 4QIWN 2XHKA 3RPQA 2X4HA 1HKTA 1FY7A 3W6KB 3MKZA 2KISA 1QQIA 2FOWA 2JSPA 1JQGA 2Q04A 2H8RA 3TKYA 4YEJA 1DP3A 2KIFA 4N4OB 5F08A 1S5KA 1XCVA 2BO9A 2REEA 4NXYA 5KTCA 5HS8A 3W2VA 3LD2A 2WPWA 2JJ7A 1BO4A 2FXFA 4R79A 4FAIA 3LODA 2E1NA 3KZYA 3EUHA 1R4NB 1GHCA 4F9UA 2O6GE 1R5HA 3OS1A 1UAAA 4B13A 2MA3A 5KTAA 2DTZA 3OYJA 1FP2A 5I0CA 4UCPA 2WAEA 4ZY2A 2V9VA 2FE7A 2CV0A 3G4SI 4DGWB 3LMSA 4YIRX 2LK2A 2XIGA 4IRGA 1BW5A 4L18B 1A31A 4G9YA 3TO7A 2EIMH 3D7DA 5HOOA 1ZG1A 4H89A 2IGNA 2QQAA 1LCPA 2YSRA 2BSWA 2C6CA 3LA2A 3ZQFA 5F27A 2VPRA 2YX4A 3JTGA 1J9IA 3LSHA 3K1NA 3F21A 2MLKA 4TV7A 4A93J 1AUGA 3K7AJ 1X19A 1IC8A 4PSXA 3CZ6A 5IYDJ 1S7AA 3WU2C 5H6QA 2RFHA 2ZXVA 2GM4A 3RQIA 4R3KA 2MH2A 3I55I 2HOEA 1I50J 2HI3A 5FROA 1IYLA 4KVOE 3UY5A 3QPHA 2LF8A 3WTXC 2ZPAA 1BR1A 4WXDA 1NHAA 2ISZA 3CXQA 1UFHA 2PR8A 5A2QK 4QUSA 2JK3A 2GXGA 3JUWA 3DCFA 1TF8A 2STWA 3H4QA 4PK3A 3MCZA 2EBJA 2LMDA 1GT0C 1Y0YA 3Q9VA 3VFZA 3GZNB 4NEXA 5HXDA 1ZG3A 4H2KA 4D0PA 2Z5UA 4EM0B 4JX4A 2EA2A 5H6RA 3VEPA 1JKOC 2F5FA 1RRJA 3RSNA 1JJ8C 4NHJA 1N78A 1S5LC 4UWIA 4X3RA 2CTBA 1KU2A 1VI0A 2Z10A 3MD2A 1ZYRF 1LEBA 4A5NA 4AU7A 3ONQA 1WWXA 1OLTA 3HRTA 2R0QC 4BQNA 2E34A 2JUCA 4C2MJ 5L3GA 1X3ZB 3ERMA 1XMBA 2OR4A 4AG9A 1YG2A 2QMLA 3L2NA 4G6TB 2DDBA 3KYCB 2X51A 4LLNA 2CW7A 1BPNA 3B73A 3HEFA 4KSIA 4RS8A 4XRSA 2QSGX 3FBUA 1AKHB 2VKEA 1IW7F 1IOFA 4HQEA 3SJXA 2FX0A 4XBFA 3D5SC 3S3OA 4L9VA 1V55H 1R43A 4CYCB 4MFJA 1T56A 4QPOA 3H3ZA 1SFOJ 2V6EA 1SMTA 1F2PA 4A12A 4KYWA 1LDDA 3GFLA 2B5GB 3JTKA 4EM2A 1SFUA 4CAEA 4B09A 2KDOA 3NFZA 4M6XA 3VSKA 4A5MA 1YFHA 4MFPA 4HSTA 4NDLA 1L3LA 1ENHA 1I6XA 4G12A 2X1EA 1Z9CA 3IC7A 3CF5F 5LHIA 2FL4A 1B9NA 5B3SH 4MRIA 1IICA 4P1WA 3TW7A 4NFRA 1IN7A 3MZHA 1W36C 3KP4A 3D8PA 4G8XA 4PXBA 3JRHA 5FVJA 2EUIA 4YFKF 3R96A 1TL8A 4CAWA 5K8PA 2VJJA 2LVSA 2PDOA 2DPTA 4OIRF 3DKYA 1VQ7I 2QQ9A 5DCMA 4U0YA 3A1YA 4I99C 1Q1VA 2E71A 3VARA 5IB0A 3FF5A 4E7JA 2FOKA 1CQTA 2CNSA 2ZEFA 1G3SA 3ZMZA 4K30A 2WY8Q 2EFQA 4EFDA 5EBVA 5JH9A 4RLFA 3WTWC 2IS1A 2PJ6A 4IL6C 1OQYA 4LFUA 3S6KA 2M2EA 2K7LA 4XNHC 4I6ZA 2I8DA 1H9GA 4M9XA 2IW5A 1UFMA 3WTVC 1TNSA 3IWFA 4ESBA 3IU1A 4HBLA 5D5XB 1DPUA 2POKA 2V7FA 4B5PB 3Q3SA 4ZDPA 3JCUC 2Y0SA 3PB6X 1DGRM 1LEAA 2Z2SB 1O57A 3NAUA 1K6YA 4XSZF 2EO8A 5J1YA 2KKOA 3CT9A 1YLEA 1IGBA 1U5TB 3R4KA 2EK8A 1LFBA 3I3GA 1U9OA 2L2OA 3GTGJ 1BOAA 2RVCA 3CDHA 2L5QA 3S93A 4ZTJA 2IJZA 1IJWC 3FX6A 2WA0A 3H8FA 1N71A 4OC4A 4ZI6A 3H35A 4Y33A 5IY5H 2EZHA 4E7IA 4W9YA 2DMNA 1TQPA 2C6PA 5CVIA 3V4GA 1LDJA 1BM9A 3GLXA 3TL4X 2OTLI 4QC6A 1BR4A 1Z1DA 2CG4A 2FMYA 1W5SA 3LFKA 4BAYA 4B47A 4NGSA 1DGWY 3GXOA 4A30A 4ZZDA 1F4KA 1ZRFA 3GIUA 1CG2A 3HPHA 5FD5A 3CO7C 3JW4A 3CJRB 1TT5B 1J7KA 1WHUA 3IWWA 2V79A 2FJ1A 2E7XA 2K85A 3N97A 5IT9K 3RO0A 4CYQA 3BI0A 4YIIA 3K10A 4RS2A 4F92B 3RKYA 2ARHA 3FJUA 2DK5A 4UVCA 1RZ4A 3HRSA 2R5ZB 3Q9SA 5HS7A 1SMYF 1R7JA 2P0WA 2GWRA 3BCBA 4JZ0A 3G6EI 5HLHA 5FB2A 3ZQCA 2Y75A 2ZFWA 2PMHA 1ZG9A 3T8WA 3VYRB 4B3AA 4OC1A 1MJBA 4GM5A 3H8EA 1OZPA 1RTQA 2IPQX 2OZ6A 4XOTA 2GLOA 2CXAA 4KZTA 2PJBA 1FMVA 2EZIA 1R6RA 2O0YA 4XKBA 3I56I 3HOTA 3T9YA 1QPIA 2L9NA 1M4DA 1PP8F 3GTOJ 4KOUA 3BG9A 2VOOA 1FNOA 4GRIA 2CF4A 3HC7A 3I5UA 3ZOBA 4PV6A 3G71I 4HPSA 2KIQA 3RAMA 4JP0A 4XKVA 2LLKA 3KIOA 2ZMEC 1X1AA 1BIBA 1Z6RA 3E6CC 1X3UA 5CPAA 1UG0A 4ESJA 5D4RA 3GYAA 4UA3A 3O8GA 5F0FA 1OYWA 1VQ9I 3DLAA 2Y69H 2ACJA 2RKHA 2K9NA 4I09A 2ISYA 2VN2A 2X1CA 4NGTA 1XIXA 1HBXG 3Q0VA 4AIJA 2VQCA 3P2FA 1W5TA 2RV8A 3IP4B 4PDKA 4RGXA 4BKXA 5EF6A 2HVSA 3PFIA 1BI0A 2NVYJ 3PNVA 4P9UA 4LB5A 5E1ZB 2XAUA 2EFOA 4IHSA 1FZPB 4IHXA 1Y1VJ 1P2FA 1FOKA 2JQ7A 2HPMA 1S60A 3B35A 3IEHA 2K86A 5BQTA 4P44A 2QVOA 4Q48A 2W48A 2XRNA 5HLIA 1YW7A 5IYBJ 1JKPC 1XN7A 2R5YB 1IXSB 2IA1A 4LITA 3W6JB 4UUSA 1B8IB 3HPGA 3FEEA 1WCMJ 3PIOF 4IEJA 4HYEA 2K5CA 3CD6I 3GTQJ 3RCOA 2PFBA 5L3CA 3FF3A 4F0YA 3W2AA 3KHZA 4CCNA 1P9QC 2B3VA 4NGPA 3C26A 3KL9A 1BBYA 5JLXA 1ZGWA 1LB2A 3ZN1A 1K4JA 3NH8A 3PB8X 3IIBA 3BR3A 1IDZA 1YHQI 2MG4A 1D1CA 5E8GA 1W1WE 2P5VA 2D1HA 3PB7X 3FM5A 2IGOA 4QB9A 2L7MP 4LK0F 5GP9A 1XS9A 3BXMA 2AXLA 1ETKA 3F8KA 3KHXA 1Q7LA 3M8FA 4M3GA 5DS0A 2Q7BA 3L9FA 1S9HA 1TZLA 3W6XA 3NWSA 4EVIA 4AVBA 2K4BA 3WG7H 2GE3A 2FE3A 1XOVA 4IHMA 4X5KA 2X9DA 3OSFA 1MBGA 2VXDA 4HV6A 1KQ8A 1YS6A 2XAGA 4AUXA 2XEIA 4Y4RA 4UB8C 2B4DB 5LHHA 3FXOA 5KTDA 4Y49B 1YYVA 3QYFA 4HAMA 4ITVA 3JSOA 2BY0A 2ZELA 3GUXA 2HVRA 3CMAI 4CRZB 2K9QA 2V9PA 4MFKA 5K1YA 1T95A 2D1VA 2VL1A 1YRNB 1V0CA 2F8HA 2ZC2A 4P4JA 2FNAA 5BOXA 1YJ9I 2H5MA 2PIYA 3D4UA 5H84A 3RTRA 1RC9A 5AG7A 3OS2A 4II2A 1VNDA 2Z3KA 4M72A 5AG6A 2NNNA 5HVGA 2RC4A 2E35A 3HJEA 3ZZIA 4BQOA 1BJAA 2P81A 4RA2A 1FLIA 3PL8A 1VHSA 5F04A 5D8LB 4DQ2A 4A3JJ 2AFUA 3HTSB 1R71A 2PJPA 1MBEA 2G3AA 4HF2A 3VSLA 3A2KA 3E0JB 3FM3A 4RAFA 5AG5A 3V8JA 4GFBA 3B3WA 3HSEA 2M9HA 3LQQA 1R22A 2IRFG 3BG7A 1K4TA 3DSBA 3JRAA 1Z9UA 3DNSA 1MJAA 5E3NA 5FKKA 1TWGJ 2ZXWH 3ASOH 1I1GA 3W6SA 1ZARA 4FE4A 1TF9A 2FT0A 2GLJA 2NVXJ 2KCWA 1PCAA 4XRSG 2LD5A 3ZQIA 2V26A 1XE4A 5LRJA 2DMQA 3E0KA 2ID3A 1K78A 1ZG7A 4CPAA 3BQZA 2V8HA 1MMNA 1YW6A 4UFVA 2UUZA 5E3MA 4YG2F 2N8GA 1Z91A 1SEUA 4B10A 2ZKZA 4MNUA 4OINF 1OCOH 2A6EF 2OQGA 5JHFA 3G73A 2R7WA 3PJRA 2C27A 4JK1X 5CNPA 3AAFA 1XJOA 4H6UA 2QCOA 4A32A 4ZDOA 2G9DA 2IMOA 5FKNA 4G94A 1FSEA 5HVHA 5K8MA 4HSRA 5J8FA 3HOXJ 4F52A 4ENKA 5CYVA 1OFCX 2HQAA 4PZJA 2EV0A 3LFUA 3N05A 3W2WA 2O03A 2K3PA 1JT6A 4L0YB 4KUAA 2G7UA 5K7HA 4HNTA 1YOVB 3K4CA 4M6GA 2HFHA 3N5FA 2ZW4A 3KPHA 4MQVA 3CTAA 3ZQGA 2J8RA 3W6VA 5LLQA 4BD9A 5IT3A 1P7IA 5E3OA 3VWBA 1NE9A 3MN8A 3QPLA 4HX4A 1OBRA 2VJ4A 3I59A 2V6CA 1VQ4I 4GYGA 4KIBA 3DTIA 2XAHA 5DDGA 1X4OA 2ZJQF 1S7EA 1MMAA 4LG0B 3CUQC 4RB2C 2VJ5A 4AD9A 3KYDB 4B14A 4CICA 4A6EA 2P5KA 1CP7A 5KCMA 4A3BJ 3I1UA 2HKOA 2LF7A 4C3IJ 2AS5F 3SI2A 2Z0ZA 2LYCA 2JBJA 3VWEA 1EF4A 2HDWA 1B59A 3VOEA 3GY9A 2PR1A 1R1UA 2VQGA 2WTEA 4MGRA 2DBBA 3EUKL 4UFXA 4HNVA 3SEZA 1H8AC 4M73A 3SJMA 3TTHA 5KVRA 1D8JA 4XKWA 5H20A 2G7HA 1IN6A 2C6GA 3N7ZA 4FT8A 1A6QA 3V7CA 1M4LA 5IPAA 3FISA 1P92A 3H9QA 1WZ2A 2EJRA 1A2ZA 2DN0A 2WAFA 4B44A 1ERDA 4UBRA 5EJCA 3K9TA 2IJLA 2JRTA 3VH9A 2M8EA 4OC3A 4B12A 1S7FA 4XK4A 3BP8A 2LNBA 3MKLA 1TWCJ 4N4NB 1USTA 2NMTA 2HQ5A 3BPVA 1TW2A 2KL4A 3QRFF 1J75A 2PRQA 5K7FA 2LBFB 3QP5A 3KP2A 3RPUA 1FTZA 2XRLA 2BHZA 1WH7A 4XKCA 1XSDA 3PBEA 1W7PB 3S8PA 2V1XA 3IC1A 1FYKA 3WTZA 1JHHA 2R7QA 3ZGKA 5K5QA 3CPXA 4HNYB 4UUSB 2L7FP 2Y0SN 1T0FC 2V1DA 1K6OA 4EMEA 4NBQA 4V2GA 1WQ2A 4PJLA 3EETA 5CQGA 3GBGA 2QBYB 3CP8A 3E3VA 2Y0MA 2HGCA 1IOIA 4N9IA 3R95A 5J1RA 3K70C 3H1CA 3GZ6A 3CF2A 4G6QA 4GXOA 3JRCA 2KIMA 4P55A 1OCRH 2JT1A 3VWDA 1QGPA 2GAUA 3WE3A 3WU1B 1I39A 2GOXB 1W0TA 2EILH 4EV0A 1WI9A 3HGYA 3SDGA 2Z3LA 1G3WA 3MKWB 5GCNA 4KVXA 3FHNA 1J59A 1BI3A 2GFQA 2PG4A 4XLCA 4MQ9F 1Z2LA 5DCFA 4BHPA 2AFOA 1AOYA 1P4AA 4MJ8A 1Y8RB 4JX6A 2XPWA 3WE2A 2EWNA 2ZCWA 4M6YA 1H9TA 2JEWA 4QVTA 1OCPA 2W4SA 4BEHB 4UF4A 3SFZA 1K79A 1RR7A 1R9TJ 2DQRA 2OTJI 3HLPA 1R57A 3OIPA 4YFJA 1QHGA 4IHYA 2XASA 4XNFA 2PJRA 4M3FA 1VQ6I 4RN7A 2VASA 3PSFA 5F1RA 1FYLA 5LGNA 3OYGA 2Y2ZA 2DXIA 3R61A 1HKQA 2NNYA 1VQNI 3FXKA 3CLOA 4PJNA 2Z99A 4HZFA 2B58A 3DPTA 3OIQA 4GDFA 3DR8A 4HF1A 4A69C 4KOSA 4C3HJ 3FXUA 3BTLA 4H0EA 1BIAA 3I0TA 1ETXA 5AIPA 4HX7A 1O3RA 1MD0A 4E4HA 4CZZA 2P8TA 3HZJA 1UMQA 3OYNA 4PCQA 2IGMA 2H6BA 1CM0A 5JVTA 1ARLA 4Z65A 4XLNF 3TO6A 1IRZA 2XGDA 3CCSI 2E2IJ 4MCSA 1Z67A 1HW1A 3A4CA 4X0GA 1ZQ3P 1BC8C 3WGHA 2G3TA 4PFPA 2E1MC 2DFHA 4C2TA 1IN8A 2DA7A 2LDUA 2R7DA 1NH3A 2AJ6A 2KJBA 1GXQA 4Y7NJ 2IQ6A 4UVAA 3BZCA 2EWBA 4RAYA 2EINH 5LYDA 4U5YA 1M44A 3EYYA 5LRGA 4JYKA 5ISVA 4F0XA 2JDDA 2NS8A 4RBOA 1XMTA 3K9UA 1U9NA 1FOWA 1LFUP 1K78B 2YU9J 3BY6A 4JYWA 4AB7A 1S3JA 2KIUA 2VT3A 2JEVA 4RUHA 1FT7A 1KONA 2MSYA 2MYSA 3KX2A 4MFLA 2P6SA 1ELLP 4ZX8A 8CPAA 2QIRA 2OBPA 3GTLJ 3CXPA 1G3YA 3PEIA 5BS6A 4EJTA 5LRSA 3N4MA 1USSA 4IOCF 1RESA 4P10A 2IS4A 1E3PA 3QU3A 2HTJA 2LR8A 1IRXA 4UIBA 1UHSA 3C2GA 1XBUA 4EJUA 2YGWA 1M1EB 3WR7A 4BJ5C 3MAJA 3PNYA 4C9YA 5IOZA 3DLLF 2XF6A 5FJ8J 4KA4A 2PN6A 4IVNA 5EG0B 4KMFA 1HOMA 4NCZA 1PUFB 4XRFA 4A0XA 2DT5A 2ICWG 5EEHA 4ZTFA 2Y30A 4U88A 4QLCU 3A01B 1HDPA 2RQQA 2VXKA 2L54A 4JBAA 5E1XA 3ZQLA 4OIDA 2OD5A 3S9MA 4OC0A 2KRCA 4GYIA 2R7OA 1PUEE 3PO3J 1HA8A 1NTCA 3SXOA 3SHPA 2BXZA 2E2HJ 4NQWA 2P6EA 4J19A 2JA7J 4IRHA 5LRKA 3NA6A 2M30A 2XAQA 5GAEJ 3OYMA 1MH4A 1RNLA 4ON0A 2BY2A 5LYIA 4XLAA 4XOPA 1YREA 2VQYA 1AWCA 5GAHJ 3IH4A 1YGHA 3BJ8A 2CH0A 2MGQA 3CLQA 3GLLA 2QF7A 3KEYA 4UV9A 1MSFC 1QSOA 3F0AA 2V8DA 2TRTA 4YRHA 3K2ZA 5G22A 2VQHA 3BOQA 4XIDA 3DKWA 1JKQC 3V38A 4OIOF 2YU3A 3OYFA 2LH9A 3HOSA 1JTXA 2LY2A 3G3SA 4A3KJ 4BH9A 2PX9A 3ZQ7A 3PQJA 5LEKA 3QP6A 2BZTA 3IRQA 1IB1E 1Z3XA 2JUGA 3F5BA 4XPDB 2HV2A 4JWPA 3MMYB 5E17F 1YR0A 2AFZA 2XKPA 2ZMEA 4UEEA 5EZGA 3LSMA 4PJMA 2BW3B 4RB3C 1FBSA 1ZELA 4CGMA 4DOZA 3FMRA 2OF7A 2VKVA 1ELMP 6PAXA 1BL0A 3CC4I 3DPUA 3EYIA 1NMTA 5ICGA 1VGYA 2HXOA 3HYIA 4EJOA 1FOXA 4CS0B 1FNNA 2HYGD 1Z8TA 4ZY1A 2XAFA 3DBLB 2OCCH 3M4OJ 3I9SA 2KP6A 1DE4C 2LY1A 3V7SA 1P4XA 1MMSA 3L00A 1EH8A 3CCQI 2AFXA 4OIQF 3EY5A 5HLGA 1FBUA 2QSFX 1X10A 1MBHA 2IA2A 4M3BA 3HOVJ 1XF8A 4OP4A 4AG7A 5HMNA 4LIUA 3T8RA 1N25A 5K5RA 2CV2A 3T8TA 1D1AA 1XMKA 4ZY0A 3ZXSA 3CMYA 1HSJA 4XSXF 4ZYHA 2MD5A 3Q0UA 4A3GJ 2PEXA 2Q8KA 5J1QA 1MMGA 2H09A 1QZEA 2MLGA 3IH2A 4OIPF 1SFXA 5IYCJ 3K4JA 3LSIA 1JJ6C 1ZN2A 2V9KA 1UZCA 1X4PA 2KHMA 1ON0A 3WTYC 2YPRA 5IB9A 1F36A 2RNGA 5F0CA 1R23A 3K4MA 5ED4A 4UFWA 1LE8A 2Z9OA 4NC6A 4I0BA 5F48A 1RKWA 5LFAA 2D45A 2JWTA 3PUFA 2QYVA 2NYXA 1LNWA 3CJQB 5EGOA 5G21A 2WUUA 3JR9A 4R76A 2NVUB 3D68A 3DLJA 4BGDA 3HG9A 5BMZA 4B11A 4AIDA 2VB6A 3K4BA 4MCPA 3BLYA 3K69A 1ETOA 1Z8XA 3R9FA 1Y1WJ 2BGCA 4OU0A 3A0HC 3GLJA 3IWZA 2ELHA 4UUVA 4JD6A 5K7ZA 3H9GA 1YO5C 4ESFA 2YNDA 1V5GA 1IYKA 3C3WA 2WB1A 3GUDA 5FFXA 4KOYA 1Q2DA 1U6MA 1ODDA 1R1TA 4IX7A 3LACA 3C2HA 4I0AA 4AYBA 1WFXA 3I4PA 2WYRA 2FF4A 1STZA 3KEQA 1KGSA 4M9SA 4AVCA 2ZNZA 4MTEA 5L3DA 3BG6A 2VI6A 2G0EA 3F6OA 2ZO4A 5BPDA 2JLMA 5FRNA 1MBFA 1JTYA 3CCMI 2IS6A 4C7IA 3I54A 5D8KB 2GOMA 1VIXA 4R8FA 3CDXA 3JREA 1KUYA 4S05A 3FXTA 1HXDA 2RQPA 4A3DJ 1M1DA 2VEZA 3EO4A 2Z33A 1XPXA 2FSWA 1S7KA 3FBNB 3B3TA 4UVBA 4CO8A 1CPSA 4ABZA 3SHFA 2DPSA 2YUSA 4PFOA 4HNWB 4KITB 3J7YJ 2I79A 5A27A 1KUVA 4XNHB 2DA6A 2LREA 2HC9A 4ZZLA 4HPQA 2FXAA 3EDPA 2D2WA 4XR6A 1VQOI 2PJ4A 3T90A 4ASNA 2EFPA 3BR6A 2P7VB 2CWEA 1X1DA 1LAMA 4LX9A 5GTHC 4MHPA 2PC1A 3J81Z 2GU2A 4CYOA 4D9JA 2IVMA 5CKTA 4BE2A 1UG2A 4A2ZA 1ETWA 1G3TA 2CSOA 2M34A 4AXVA 3CC2I 4RB0A 2E7WA 2Y31A 5JVGF 1O7LA 3JRUA 4LJZF 3RZOJ 4KOWA 3TOBA 2ZJ2A 4R7MA 5C82A 1J4JA 1TW3A 4DYCA 1WJAA 1EE3P 2QM3A 3JRDA 4PPZA 2AFMA 3S6HA 4RLQA 3DP7A 1APLC 3S3MA 2YNCC 2A61A 4DYQA 2MBFA 4FX4A 4XONA 1D3YA 4E70A 1D5YA 4NJQA 2KT0A 1BLLE 4E6KG 3LQRA 5E18F 3BR5A 4IXAA 2R7UA 4B3XA 4YIFA 3ISXA 5JHUA 2CMPA 3AG3H 3M1CA 1HSTA 5KAFC 4ZJZA 2VE8A 4KIGA 2Q2EB 2PVWA 4OC5A 1XB4A 2Q4ZA 4J3GA 3GW2A 4BBSJ 2CUFA 5G20A 2R7ZJ 1HKSA 3HOWJ 5ELYA 4YFNF 1J2XA 3VB2A 2PJ9A 2A6TA 4MEXF 1GVJA 4CH7A 4Q38A 1HW5A 1LVAA 2AO9A 3LAPA 1P0HA 2QUFA 2NYQA 3CUQA 3HKZA 2JA5J 3FKJA 1JUPA 2HXIA 4BHCA 4WCGA 1FJLA 1QU3A 1ITYA 1VQ8I 1K83J 2Q1ZB 2P4WA 4H4KC 1KQ0A 1I27A 2E1OA 3OR2C 4KISA 3C2BA 4BJ6C 1T8IA 1VKCA 1Q1HA 3HOUJ 5D5VB 4E7SA 3QOPA 4B6ZA 2KRFA 1U5TC 2DJIA 3RZDJ 2UZKA 2EZKA 3L7WA 2ELKA 1JGGA 2ZMEB 4GO1A 2CTCA 3V7ZA 5CVUA 4W97A 5TRDA 2ZXIA 3WTSC 1QSMA 3FHZA 1R5GA 3JRIA 3KYLA 5M3FJ 1OR7C 1ZLHA 3MZ8A 2BXYA 3OYLA 4FBEA 2ZEOA 1TLHB 2CQXA 3K6GA 4U9YA 1OPCA 2ECCA 2VOPA 2VIXA 1D0ZA 1VHOA 4C2YA 1GVDA 2LSOA 4R57A 4IHWA 1LFWA 3DTKA 1WJDA 4C2UA 2Y9YA 1HQCA 4A3LJ 1IUFA 5EYRA 4MFDA 1DPRA 2BY1A 4PJJA 1QA6A 1C0WA 3S9NA 2HWVA 1Y9KA 1R5ID 3BT9A 1QVTA 1RUOA 1TBXA 4IJAA 1T0FA 4PUSA 4RGSA 3WHCA 1REPC 4NGMA 5HODA 1I3AA 4I01A 3G2BA 4E8OA 3AKZA 4MY0A 1V54H 4KT5C 5C3EJ 1CF7A 1G2HA 1LVKA 1QHHD 4DIQA 4MI4A 1A5JA 1YLOA 3G1MA 1S8NA 2PE3A 2F2EA 2UV1A 3F3XA 3S15J 1U8BA 5B66C 1SC7A 2A4NA 2ZEPA 1ORKA 3CJTB 4CYNA 4OC2A 3ABUA 4XN0A 2EVNA 5FD6A 2L9SA 3KCCA 3VYTB 4CCLA 2M7AA 1WWZA 5FKOA 1O3SA 5FKLA 3PZJA 3PIPF 1ONVA 2PRBA 2EIKH 4DYRA 1TWHJ 5EGOB 2R7VA 3BWGA 5JLWA 3GMEA 3FZVA 1WSUA 3BI1A 1MDMA 3PQKA 3CCLI 2LFBA 1B6BA 2DI3A 5EMIA 4L5EA 2VBQA 5FFZA 1QSTA 3P9CA 4II9A 1Y0UA 1QZZA 2CU7A 2EFWA 4AWXB 4FX0A 3KFWX 4DUKA 5HDGA 3BPXA 2VQLA 4WX9A 1SVMA 2FNPA 4TNUA 4ANJA 1CPXA 5GADJ 2PJ7A 4ZYGA 3LNQA 3OYAA 3NE7A 4PSWA 2M0CA 2H6CA 3ERED 1VTNC 1GYTA 2CQNA 2HUZA 1S7NA 1Y7EA 4RDUA 4AVAA 2VPLA 1ZK8A 1YLFA 1HW2A 4A33A 1DUXC 1PDNC 2IGKA 4FASD 2HYFA 3RKXA 1YVKA 5F46A 2K02A 2AQEA 1MJ9A 2AHQA 2Z1DA 4IAVA 3TP0A 2F5EA 4R3LA 3D0SA 1MNEA 4MBUA 5ILUA 4M74A 3D7GA 1T08B 2KZGA 2MW8A 5HVQC 4U7BA 3F8BA 2XEGA 2Z3MA 1XDUA 2AXTC 3SQNA 1ZLIA 3G1OA 1RUNA 2WY7Q 5IX3A 3MFKA 3DF8A 3RKWA 4BXFA 1YIOA 4HF0A 2P7CB 1UWYA 2WAQA 3AL0B 4CGOA 2LTPA 2ID6A 1A35A 1P4NA 4K2EA 4IOAF 2L4MA 2B3UA 5F1JA 3PO2J 3KZIC 3LSPA 1TKFA 1U3EM 3D3SA 3BROA 2B9SA 4HLYA 4BL0B 2VI7A 2BEIA 2F6CA 2W7NA 3E5UA 3C1DA 5DCMB 4UIAA 5TJJA 3FVLA 2UXNA 3I58A 4E2AA 2C6YA 2OQRA 3VPRA 4HRIA 4BXUA 3LSTA 5F0HA 3H5NA 1MNMC 3JTHA 3HDDA 5AG4A 1FSHA 4FETA 5B5EC 4XMYA 2A05A 3HHGA 4BU2A 2I00A 1UCRA 2JPBA 4CCOA 1TTYA 2JMWA 2JTVA 3BJ6A 3HIFA 2QJ8A 2ZEEA 2CS3A 1X12A 3V8KA 2VODA 2P6FA 1ETQA 1X1BA 4DJAA 1L0CA 2JBKA 3M07A 1OISA 4HQMA 1VFCA 3JVNA 4L5IA 1WK4A 3MRUA 3GEZA 4A3FJ 3ULQB 2X6XA 3ELKA 2CUEA 4CXFA 3PUBA 2DA2A 5TGTA 4I2OA 1S29A 3B02A 2Q4YA 3HL2A 3KI9A 2KJCA 1YS7A 1X58A 2LG4A 3F9KA 5A28A 4EMSA 2BVLA 2FRHA 3S3NA 5C4XJ 3OYIA 3QQAA 2DPDA 3A02A 4PXDA 4A6DA 5ICCA 4NF1A 3F23A 3DFGA 2P6TA 3HUGA 1M4GA 2Q4VA 2FD5A 1LFPA 3E7LA 5KHDA 1RPWA 4EM1A 3JAMK 4RB1A 2Q0YA 4UUTA 5J4VA 4C2XA 1WH5A 3W91A 1R1VA 3CCRI 4F8ZA 3LA3A 4M6VA 3RI4A 1F5TA 2EK9A 2OB0A 4FD5A 4RAZA 3H3UA 3IAM2 4BE1A 3CCEI 5LRRA 2O8KA 5ILSA 5F47A 4JOMA 1PJRA 2LRDA 3M8JA 4Y49C 2WB1N 1Z8WA 3R60A 3J80Z 1BOBA 3IKVA 3OSGA 2OCEA 4JXRA 2DAOA 1EA3A 2DJNA 3S2DJ 1EV7A 4QSHA 4JJXA 4AYBN 4A3MJ 2M0MA 3RBUA 2JSCA 4Q36A 2E36A 4ORFA 3GTKJ 1IO2A 2ANPA 3OWCA 4GS4A 3BTJA 3U9GA 2H1KA 2IAIA 5EZHA 4ZYAA 1B72A 2L9RA 3H92A 3ZPLA 4LQ6A 4ENMA 3LWFA 3WABA 4IO9F 4A95A 4CAXA 3K2AA 3KLOA 5E96A 2A68F 4CUGA 3MVPA 3QPSA 3FDYA 4MO7A 2AFSA 3KGQA 4JXQA 1G6NA 2OPTA 3GZ5A 3BTCA 4LGWA 2MH9A 4CGZA 4MHDA 5E8IA 4BNCA 5DUKA 3CCVI 3GTMJ 4B4CA 2E2JJ 4UHTA 4A31A 2JA6J 5FLXZ 3IKTA 3OYDA 3FBIB 4KIFA 4BY1J 2Z3NA 4BBHA 5JQ4A 2FSRA 5BNGA 2DT6A 1KWMA 3OV8A 3SI0A 1PYVA 3B2YA 2DOFA 2H8WA 3K4LA 2BOLA 4KLWA 4MEYF 4OAZA 1OYIA 4MFEA 2ZEDA 2RDPA 3QAYA 4V19K 2WADA 2K9SA 5FO5A 2O4HA 2FQ4A 3BG5A 1LDKB 3I9V2 5B1AH 2ZJPF 4M85A 4CCMA 2HTSA 3E97A 9ANTA 3B6AA 1TWFJ 3T0YA 2KMUA 4N0BA 1ON1A 1EJ9A 4P4FA 4Y3OA 1R00A 2Q43A 2J9AA 3FIXA 3GFMA 4CSWA 1FX7A 1EH7A 1NG7A 1PYTB 1Z4RA 5M3MJ 5C4JJ 3L2WA 2CW0F 4JQFA 1ZR4A 3QYEA 3ZCOA 4O6JA 5CVRA 1FTTA 2K27A 2JVGA 1ZR2A 2OV7A 5IOYA 5H86A 1E3HA 2Z3YA 2BEOA 4DNCA 2XSDC 4U0VA 4Y52J 2OAZA 3E5XA 4WWVA 1GV5A 4QPQA 2ZFUA 4OMZA 4XN3A 2F4IA 3U1KA 3ZMVA 3IV5A 1YJNI 2R92J 3NH4A 2ME6A 3PGPA 1XMXA 2XAJA 4DBRA 4IRIA 5JGFA 3BZKA 2R4GA 2K9LA 1AU7A 2HEOA 2YS9A 3KR4A 1ZKGA 3QB8A 2EBIA 1E0EA 1T98A 3OOPA 3TE4A 3CJNA 3IJ3A 3DXJF 5DYMA 2W00A 3HKZN 3S1NJ 3DDDA 3OYEA 1RO5A 3CP2A 4J00A 4Z2YA 3OS0A 1F57A 1YQEA 2V8GA 4Y15A 3TDUC 1XG1A 1W5CC 1HCRA 1ZLJA 5K8NA 3SEQA 1E2XA 2I10A 4D1QA 2UWMA 3H5ZA 2XGEA 4JX5A 3PFOA 3KQXA 4BE0A 2QENA 3RYPA 3TEDA 1CX8A 3LMMA 1YVOA 3FYNA 4PK2A 4YGOA 2DQLA 3K1MA 4HA8A 3W3CA 2E5NA 1PP7U 3KZZA 1ZREA 3S6GA 3E6MA 3WU0A 1ARMA 3LSJA 1IU8A 1BPMA 3BC8A 2H1LA 4BYYA 1V5FA 1OKRA 3PP9A 3GB0A 2HQYA 3ABMH 2PIZA 3NARA 4FD7A 2CW8A 2BL1A 5D6FA 1W7PD 3WTUC 2NSMA 1XMAA 1K7AA 2W24A 1R49A 4HW0A 1ZG8A 4C30A 3DGVA 1LANA 2HZTA 1KQ9A 2KLOA 1QBJA 3S1QJ 1WVRA 2F4OB 3LOCA 5K5OA 3M3YJ 4KS9A 2TDXA 2EH3A 2QGUA 3ML6A 4WJBA 2ME0A 1ULYA 2RB7A 2XB0X 1WI3A 2PMUA 5CBMA 3DEUA 1GLNA 3KP5A 4I98B 1D0YA 5DD8A 2O9LA 1CP6A 1JXSA 4PQAA 2GBYA 1GHEA 4B5OA 2VL8A 4UV8A 5D6EA 1TKHA 4D7NA 4CGNA 4E7HA 3H9JA 1AKHA 4LMYA 4DW6A 3S2HJ 3D5RC 3GTPJ 4HNXB 5KK1A 2Z16A 2VZZA 4KOVA 2VXZA 2GA1A 3FXRA 1ETVA 2A5WA 2PSWA 4P4BA 5EC4A 4FHTA 4CYCA 3WODF 3IO1A 1O3TA 1FEXA 1B9MA 2EZLA 3IL2A 4FUUA 4P4EA 2B5GA 1BI1A 5JFRA 1KZHA 4ZX9A 4IQJA 4FCYA 2XEFA 2DK8A 3D7HA 5AONA 2DF5A 1RI7A 2F48A 2HOSA 2ECBA 1POGA 1I5ZA 3KE2A 1P4WA 3CXSA 2YNCA 1ZRCA 3PBBA 1L0OC 4MCQA 3OWTA 5IV0A 1QZYA 2IT0A 3OIOA 4MMOA 3LSRA 4KSAA 3OY9A 1Z5RA 4L9JA 2J8MA 3CCJI 5DWNA 2CV1A 3KZWA 2WZNA 3QODA 3OMYA 1SD4A 3SFIA 3ISPA 1IUYA 3KP3A 1X2NA 3I4MJ 3BG3A 3K4KA 2K40A 5L3EA 1QPMA 1Z05A 1MBJA 1WJEA 4S04A 4CRYB 1HF0A 2O5RA 4KSFA 1T2KA 2O53A 4ZYEA 4G7ZF 2ZSIB 2FBKA 5J47A 3S2WA 4XLPF 3CO6C 3ISZA 3I59B 4BJTA 4P45A 3ABLH 2RAEA 2XF7A 2FA5A 4OWRB 3ECHA 5EDNA 2WWYA 4OLLA 2AFWA 4DJLA 2COMA 2FEZA 2QWWA 2LY9A 3FEDA
chains in the Genus database with same CATH topology
4KITB 4PK4A 2I79A 5A27A 1KUVA 4KJZA 1D1CA 2LREA 4XNHB 4HPQA 3D2PA 2IGOA 4XR6A 5HNFA 2FS5A 4QB9A 3RYOA 3T90A 4B5PA 3F8KA 1X1DA 4LX9A 2Q7BA 1S9HA 1D1BA 1TZLA 2PC1A 3W6XA 3NWSA 1KUXA 5G1ZA 4AVBA 4CYOA 3LSGA 4D9JA 3SZGA 3QYBA 2GE3A 5CKTA 4BE2A 3FNCA 4X5KA 4A2ZA 3PNTA 2VXDA 2BW3A 2X6WA 4KOWA 3TOBA 4Y4RA 2LC2A 2B4DB 1MW7A 4HNUA 1J4JA 5C82A 5KTDA 1WJAA 4Y49B 3QYFA 4ITVA 3S6HA 4RLQA 2HVRA 4CRZB 3G8WA 3S3MA 2F5IA 2YNCC 3EFAA 4MFKA 1T95A 4UA3A 4U9ZA 4UFVA 4XONA 1V0CA 4BDYA 2D4PA 1PU9A 3IAS2 2H5MA 2R1IA 4M3SA 4QBJA 2M3AA 4E6KG 3RTRA 4L89A 2V4JC 5H84A 4HKFA 5AG7A 4CAVA 3OS2A 4II2A 2VKHA 1Y6IA 2DOAA 4B3XA 2X1DA 4E7LA 4XQFA 2CMPA 3M1CA 2R7UA 2RC4A 4BQOA 2VKDA 3MKYB 4CCKA 2OC6A 4BDZA 4ZJZA 5KNLA 5FRMA 5C88A 2Q2EB 3DTEA 1LRZA 3K4NA 3BJ7A 3PL8A 1VHSA 4J3GA 1MNDA 2BVMA 5G20A 2K9MA 2G3AA 3EPZA 1D0XA 3VSLA 3E0JB 3A2KA 1U0JA 5AG5A 2A6TA 1UELB 4CZCA 4CA0A 4MY3A 3NWTA 4CYPA 4CH7A 3K70D 4Q38A 3BG7A 4F3QA 1V5EA 2E1MB 4XM3A 1P0HA 1Z9UA 3DNSA 3TBIA 1MJAA 2OU2A 1G8XA 3R9EA 1X1CA 3HKZA 1Y7RA 4U87A 4KVME 3E1SA 3FKJA 3U21A 1QU3A 4UCMA 3W6SA 4CGLA 2FT0A 3UR3C 4P5OA 2KCWA 2FIWA 2PMZA 2Q1ZB 4MFQA 4XLHA 4H4KC 5JPHA 1WJFA 3CESA 2V26A 1XE4A 2MC4A 3OR2C 3SYTA 4KISA 3E0KA 4BJ6C 1VKCA 2ZW7A 1MMNA 2FIAA 2UUZA 1JI8A 4E7SA 4XPDC 3DQVC 1J09A 2WPXA 2OH1A 2DJIA 4B10A 2FUG2 4IUSA 2WBMA 2R7WA 5JHFA 2R98A 3D5LA 3PJRA 4XORA 2ZXIA 2CUZA 2O28A 4DBQA 5LD2C 2C27A 3UNGC 3IU2A 5CNPA 1QSMA 3KYLA 1WJCA 1OR7C 2QKLB 4KT6A 2PJRB 3OYLA 4H6UA 2E5ZA 4II3A 4A32A 4C7HA 1Z4EA 2J8NA 4NC8A 4U9YA 3K6GA 3L2QA 1G59A 2M4KA 1Z7LA 1SQHA 4LG3A 4ZDOA 2VZYA 2OZUA 1Y56A 1Q2CA 2X7BA 2VIXA 1D0ZA 3DU5A 4HG2A 4HSRA 4B48A 4F52A 4E7KA 2HQAA 1Q2YA 3P2HA 4R57A 4RMNA 3DTKA 2M7BA 1WJDA 3LFUA 4MLOA 3RPUD 4XLEA 4C2UA 3N05A 3W2WA 2HU9A 3FRMA 2K3PA 3GKRA 2E60A 2QKMB 2G0BA 4KUAA 1YX0A 4HNTA 3K4CA 1IIDA 1Y9KA 2KPMA 3H5RA 1YK3A 1SFKA 4PUSA 2ZW4A 4C2ZA 4HEA2 4MFZA 1QSRA 4CAFA 2ELJA 3HUGB 3G2BA 1S3ZA 3AKZA 4CCJA 2J8RA 1NG6A 3VWBA 3OL3A 1NE9A 2K5TA 1LVKA 1QHHD 4DIQA 4MI4A 4RI1A 3ZJ0A 2VJ4A 4E7ZA 4FD6A 2JVHA 2ZSHB 4NNJA 2UV1A 3DTIA 1KZFA 2R7XA 3LSKA 1X4OA 5AGEA 2OZHA 3IGRA 2A4NA 1MMAA 4CYNA 2VJ5A 4XN0A 3VDXA 1I1DA 2L9SA 2EVNA 2W82A 1NSLA 3DEEA 4B14A 3VYTB 5KCMA 4CCLA 2M7AA 1WWZA 2CY2A 5DWMA 5CPRB 3TT2A 4C2YA 1XEBA 2Z0ZA 2LYCA 3BLNA 2R7SA 2PRBA 1FMWA 3PZJA 4EATA 2HDWA 3GY9A 3VWEA 2PR1A 2VQGA 4KORA 2DCEA 3EUKL 4UFXA 2FCKA 1AA7A 3SEZA 3CMMA 2R7VA 3TTHA 4OADA 3N7ZA 4XKWA 3FB3A 2MABA 3SXOA 3TO9A 3LL7A 1B6BA 4BS9A 1YE9A 2VBQA 1QSTA 4II9A 4KLVA 3H9QA 2QECA 2B4DA 3R9GA 2V1NA 2B4BA 2WAFA 1TIQA 4B43A 4B44A 1ERDA 4UBRA 2XDVA 2ZXHA 2VQLA 4B12A 1S7FA 1LKXA 4ANJA 3R1KA 3QOEA 2KQRA 4ZC3A 4N4NB 2AE6A 2NMTA 3OYAA 3SXNA 3NE7A 4PSWA 2KL4A 2P6GA 5CQEA 2LBFB 2HUZA 4CGPA 1S7NA 4AVAA 4OAYA 4JLYA 4XKCA 3OOUA 2VPLA 4I49A 2R7TA 4NSQA 4A33A 2DXQA 3S8PA 2IGKA 4NC7A 4FASD 1YVKA 4UWJA 4ZBGA 5HLTA 2AQEA 3L2VA 5F46A 2Z1DA 3ZGKA 2R7QA 1MJ9A 3KKWA 4HNYB 4R3LA 1QSNA 1MNEA 1T0FC 3OR1C 4MBUA 4PJLA 2Z3MA 5HVQC 4U7BA 5CQGA 3GBGA 3CP8A 2WY7Q 2Y0MA 3SDBA 2JDCA 4BXFA 3R95A 2LOOA 3K70C 2IL4A 3B8GA 3CF2A 2R8VA 3OYCA 2WAQA 3AL0B 4CGOA 1W36D 1FY7A 4NQWB 3MKZA 2Q04A 2JSPA 5F49A 4KOXA 1P4NA 3VWDA 3L2UA 2B3UA 4YEJA 2GOXB 2HNHA 4N4OB 1DP3A 1S5KA 4AVZA 2REEA 4NXYA 3D3SA 2CUJA 5KTCA 2Z3LA 5GCNA 3MKWB 4BL0B 1PUAA 3W2VA 2BEIA 2F6CA 2W7NA 2VI7A 3OYHA 4IKFA 4KVXA 3LD2A 3FHNA 2WPWA 2FXFA 1BO4A 4E2AA 4R79A 4HRIA 4XLCA 3LODA 1WJ5A 3H5NA 4MJ8A 2OUMA 5AG4A 3OS1A 1UAAA 4B13A 4FETA 5KTAA 4PFOA 4XMYA 2I00A 3OYJA 4BU2A 1Y9WA 4QVTA 2W4SA 4BEHB 5I0CA 4CCOA 4UCPA 3L2RA 2WAEA 1R57A 1Z3YA 3OIPA 1QHGA 4DGWB 2CS3A 2CV0A 2FE7A 2P6FA 4XNFA 4Y49C 1X1BA 4DJAA 2PJRA 1L0CA 3JVNA 2VASA 3PSFA 3OYGA 2DXIA 1DQUA 1WK4A 3TO7A 4PJNA 5HOOA 2PQ8A 3VYSB 2IGNA 2BSWA 2X6XA 2B58A 4H89A 3DPTA 3OIQA 3PUBA 3J7AY 3DR8A 3EXNA 5TGTA 2Z11A 1S7LA 3LSHA 2Q4YA 4KOSA 3HL2A 2LG4A 3OL4A 3F9KA 5A28A 2GIVA 4UCNA 2ZW6A 2BVLA 1X19A 3S3NA 4YFJA 3OYIA 2XSJC 4ONUA 4PSXA 3BCAA 3CZ6A 4LUAA 2ZXVA 3TMOA 4E4HA 4NF1A 4R3KA 3UY5A 1IYLA 5FROA 4KVOE 1CM0A 3OYNA 1M4GA 2IGMA 2Q4VA 2ZPAA 3ZZIA 1BR1A 1MMDA 1LFPA 5KHDA 2Q0YA 3TO6A 2XC7A 3S32A 1WJBA 3CXQA 4C2XA 1UFHA 2PR8A 3W91A 3A4CA 3ZR8X 4X0GA 4QUSA 2G3TA 4PFPA 3JUWA 2E1MC 2OB0A 3A9LA 4C2TA 3H4QA 4FD5A 4R9MA 3IAM2 2AJ6A 4PK3A 4BE1A 4BACA 3EUAA 2HPIA 5F47A 5HH1A 4JOMA 4L8AA 1ZO0A 1PJRA 1SAUA 2LRDA 3M8JA 1M44A 4U5YA 4NEXA 2ZW5A 5ISVA 1BOBA 2JDDA 1XMTA 4F0XA 3K9UA 2DT7B 3VYUB 4JXRA 1EA3A 4H6ZA 4JJXA 4UWIA 3RSNA 4C68A 1N78A 2M4GA 3EUHC 2M0MA 2Z10A 4Q36A 4NUBA 4AB7A 3MD2A 4ORFA 2Z3OA 3S6FA 4F93B 2JEVA 3OWCA 4GS4A 4AU7A 4ZYAA 3ONQA 1KONA 1OLTA 2MYSA 3KX2A 4BQNA 3DSBA 2WSAA 4MFLA 4E8OA 4AG9A 2QIRA 2QMLA 4A95A 4G6TB 4MY0A 2X51A 3TCVA 5E96A 4CAXA 2CW7A 4CUGA 3CXPA 3FDYA 3AFHA 3FBUA 2W1OA 4JXQA 2MD0A 2IS4A 4MHDA 2ATRA 4YRVA 2NOJB 3D5SC 1IRXA 3S3OA 3C2GA 2BUEA 2LBFA 4A31A 5JQ4A 3OYDA 3FBIB 2Z3NA 2Z3KA 4BBHA 2YGWA 3DWLE 2R7RA 2FSRA 4MFJA 3WR7A 4BJ5C 2DT6A 3PNYA 4QPOA 4C9YA 4E7HA 2XF6A 2V6EA 5IX3A 4NCZA 3TE4A 2B5GB 3JTKA 3DR6A 1PYVA 4BUPA 4CAEA 2X6YA 2R7HA 2XF5A 3K4LA 2KDOA 4F55A 2BOLA 3TOAA 4ZTFA 2VXKA 4KLWA 3DKXA 3VSKA 4OAZA 2RQQA 4MFPA 4HSTA 3ZRGA 2X1EA 2WADA 1M4IA 2FL4A 4ZGYB 2HVQA 2KRCA 4P1WA 2R7OA 4IZZA 1HA8A 1IICA 1LDKB 3I9V2 1W36C 4M85A 3V42A 3SHPA 5J8CA 4CCMA 3D8PA 2P6EA 2YNEA 5FVJA 3R96A 2EUIA 4CAWA 2KMUA 2VJJA 4F0YA 2PDOA 2HZDA 4Y3OA 2DPTA 3OYMA 3FIXA 4XLAA 3DKYA 4XOPA 4CSWA 2AQFA 1YREA 2VQYA 1NG7A 3A1YA 1Z4RA 4RM3A 3L2WA 2GANA 1YGHA 2Q44A 2CH0A 4JQFA 4E7JA 3QYEA 3BJ8A 3ZCOA 1MK4A 2CNSA 5IB0A 3F0AA 3KEYA 4K30A 2WY8Q 1QSOA 2JVGA 5EBVA 4YRHA 4RLFA 2IS1A 2OV7A 1YX5A 5G22A 2VQHA 4BEHA 4XPLA 5H86A 4IQ4A 3S6KA 4KUBA 4DNCA 4LIVA 4XNHC 3OYFA 2I8DA 4R87A 2LH9A 3HOSA 2LY2A 1I21A 3V8IA 3OYKA 4QPQA 3IU1A 2ZFUA 4XN3A 4ZDLA 2F4IA 3G3SA 3PGPA 2V7FA 4B5PB 3IWEA 4ZDPA 2CNMA 4DBRA 3H0DA 2VLAA 2Y0SA 3IUOA 1DGRM 2R4GA 2K9LA 2Z2SB 1I12A 1K6YA 1IB1E 1Z3XA 2JUGA 3F5BA 2REFA 3QB8A 1E0EA 1YX3A 1YLEA 2HV2A 4JWPA 3MMYB 4J01A 4XPDB 1YR0A 2W00A 3PSIA 3DDDA 2L2OA 3OYEA 1RO5A 3I3GA 3CP2A 3LSMA 4PJMA 2BW3B 4J00A 3OS0A 1ZELA 4CGMA 4DOZA 3TFYA 2L5QA 4XLFA 3S93A 4ZTJA 2KRHA 2WA0A 1N71A 1RXTA 3SEQA 3DPUA 4D1QA 2UWMA 3H35A 4Y33A 1NMTA 4E7IA 3H5ZA 4CS0B 4BE0A 3I3LA 4YGOA 4PK2A 3LMMA 2IXSA 1YVOA 3FYNA 3TL4X 3W3CA 2OZGA 4QC6A 2E5NA 1BR4A 3H5AA 3S6GA 1B87A 2KP6A 3I9SA 2LY1A 4B47A 1DGWY 3BC8A 4OAEA 1V5FA 4A30A 3PP9A 4F91B 2HQYA 3AL0C 3EY5A 4FD7A 3HPHA 2CW8A 4RM2A 2BL1A 4EVYA 3CJRB 1N75A 4XPKA 4IF5A 4CYQA 1XF8A 5BWAB 4AG7A 5HMNA 4LIUA 3K10A 2VJIA 4RS2A 4F92B 2CV2A 2ARHA 4C30A 1D1AA 3ZXSA 2JA2A 2KLOA 2X85A 4KS9A 2P0WA 2D4OA 3BCBA 1MMGA 1GLNA 3VYRB 1D0YA 3K4JA 3LSIA 1GHEA 1MJBA 2RREA 2V9KA 1OZPA 1X4PA 4B5OA 4XOTA 2KHMA 2VL8A 2L7KA 1ON0A 2CXAA 4KZTA 1FMVA 1R6RA 2RNGA 3DU6A 4XKBA 3HOTA 4CGNA 3K4MA 4UFWA 5J8FA 3H9JA 3T9YA 2L9NA 4YELA 1M4DA 5F48A 4KOUA 5LFAA 2Z3PA 3D5RC 4GRIA 3HC7A 4HNXB 4PV6A 3CJQB 2Z16A 2VZZA 4KOVA 2VXZA 5G21A 2WUUA 4XKVA 2A5WA 2PSWA 5EC4A 4BGDA 3HG9A 4B11A 1X1AA 2VB6A 3K4BA 5HNHA 3BLYA 1UG0A 3PFYA 2B5GA 4BQQA 3GYAA 3R9FA 4IQJA 4FD4A 3DLAA 3DPLC 4JD6A 3CXSA 3H9GA 4XL9A 2X1CA 1XIXA 2YNDA 1V5GA 1IYKA 2YNCA 3RQ4A 1Z21A 2VQCA 2WB1A 3OWTA 3P2FA 5IV0A 3IP4B 3EC4A 2HVSA 4KOYA 1Q2DA 1U6MA 4IX7A 3PNVA 4KSAA 2XAUA 3C2HA 3HXLA 3OY9A 5DWNA 4AYBA 1WFXA 2J8MA 2CV1A 4F6AA 3QODA 3OMYA 2HPMA 1S60A 4AVCA 4E0AA 3BG6A 4BMHA 2F5VA 5FRNA 2CNTA 3K4KA 4LITA 2JLMA 4C7IA 2IS6A 1WJEA 3HPGA 4CRYB 2GOMA 2IS2A 4HNWB 1VZ0A 2K5CA 2O5RA 4KSFA 3ZQQA 3RCOA 3QAHA 1KUYA 2ZSIB 1N77A 3W2AA 3FXTA 3EO4A 2CFOA 1M1DA 2VEZA 4CCNA 3IWGA 4KOTA 2KZVA 3MGDA 1P9QC 2B3VA 4BJTA 3OYBA 1S7KA 1BR2A 3FBNB 1TT0A 1CJWA 2XF7A 4OWRB 1K4JA 3C26A 4OLLA 2DPSA 2MFZA 4PJJA 5AG6A 3D2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I79 A;  1KUV A;  4XNH B;  3D2P A;  3T90 A;  2FS5 A;  3RYO A;  4QB9 A;  4B5P A;  3F8K A;  4LX9 A;  2Q7B A;  2PC1 A;  3W6X A;  1KUX A;  4AVB A;  2GE3 A;  3FNC A;  4X5K A;  4KOW A;  3TOB A;  2B4D B;  5C82 A;  1J4J A;  5KTD A;  4Y49 B;  3S6H A;  4CRZ B;  3G8W A;  2F5I A;  3EFA A;  4U9Z A;  4UA3 A;  1V0C A;  2D4P A;  1PU9 A;  2H5M A;  2R1I A;  4M3S A;  5H84 A;  4L89 A;  4CAV A;  4HKF A;  3V8I A;  2RC4 A;  3ZZI A;  4UWJ A;  5C88 A;  1LRZ A;  3BJ7 A;  1VHS A;  4J3G A;  2G3A A;  4MY3 A;  1P0H A;  1Z9U A;  3DNS A;  2OU2 A;  1MJA A;  3R9E A;  1Y7R A;  4KVM E;  3W6S A;  2FT0 A;  2KCW A;  2FIW A;  5JPH A;  1XE4 A;  3E0K A;  1VKC A;  2ZW7 A;  2FIA A;  4XPD C;  2WPX A;  2OH1 A;  4IUS A;  2R98 A;  2O28 A;  2C27 A;  5CNP A;  1QSM A;  4H6U A;  1Z4E A;  2J8N A;  4U9Y A;  1SQH A;  2VZY A;  2OZU A;  1Q2C A;  2X7B A;  1Q2Y A;  5J8F A;  4R57 A;  3P2H A;  3FRM A;  3GKR A;  2G0B A;  4KUA A;  1YX0 A;  1IID A;  1Y9K A;  1YK3 A;  2ZW4 A;  1QSR A;  2J8R A;  1S3Z A;  4E8O A;  4MY0 A;  1NE9 A;  2K5T A;  4MI4 A;  3ZJ0 A;  4RI1 A;  4FD6 A;  1KZF A;  2OZH A;  3IGR A;  2A4N A;  1I1D A;  2EVN A;  1NSL A;  2CY2 A;  4QBJ A;  1WWZ A;  5DWM A;  3TT2 A;  1XEB A;  2Z0Z A;  3PZJ A;  3BLN A;  2PRB A;  3VWE A;  3GY9 A;  2PR1 A;  4KOR A;  2FCK A;  3TTH A;  4OAD A;  3N7Z A;  3FB3 A;  3SXO A;  3TO9 A;  1B6B A;  2VBQ A;  1QST A;  4II9 A;  4KLV A;  2QEC A;  2B4D A;  3R9G A;  2B4B A;  1TIQ A;  4UBR A;  1S7F A;  3R1K A;  2AE6 A;  2NMT A;  3SXN A;  3NE7 A;  4PSW A;  2P6G A;  2HUZ A;  1S7N A;  4AVA A;  4JLY A;  4I49 A;  4NSQ A;  2DXQ A;  1YVK A;  4ZBG A;  5F46 A;  1MJ9 A;  3KKW A;  4HNY B;  4R3L A;  1QSN A;  4MBU A;  2Y0M A;  2JDC A;  3R95 A;  2IL4 A;  3B8G A;  2R8V A;  1FY7 A;  2Q04 A;  5F49 A;  4KOX A;  1P4N A;  3VWD A;  2B3U A;  2REE A;  1S5K A;  4NXY A;  3D3S A;  5KTC A;  5GCN A;  1PUA A;  4KVX A;  2VI7 A;  2BEI A;  3LD2 A;  2WPW A;  2FXF A;  1BO4 A;  4E2A A;  3LOD A;  4MJ8 A;  5KTA A;  2I00 A;  4QVT A;  1Y9W A;  5I0C A;  1R57 A;  2FE7 A;  4YFJ A;  2P6F A;  4Y49 C;  1L0C A;  3JVN A;  1WK4 A;  3TO7 A;  2PQ8 A;  4H89 A;  2BSW A;  2B58 A;  3DR8 A;  3EXN A;  2Z11 A;  1S7L A;  2Q4Y A;  4KOS A;  2GIV A;  2ZW6 A;  4ONU A;  4PSX A;  4LUA A;  2ZXV A;  4NF1 A;  4R3K A;  3UY5 A;  1IYL A;  4KVO E;  1CM0 A;  1M4G A;  2Q4V A;  2ZPA A;  2Q0Y A;  3TO6 A;  3CXQ A;  1UFH A;  2PR8 A;  3W91 A;  4QUS A;  2G3T A;  3JUW A;  2OB0 A;  4FD5 A;  3H4Q A;  4R9M A;  2AJ6 A;  4PK3 A;  5F47 A;  5HH1 A;  4L8A A;  4U5Y A;  1M44 A;  4NEX A;  2ZW5 A;  5ISV A;  1BOB A;  2JDD A;  1XMT A;  3K9U A;  4JXR A;  4H6Z A;  4JJX A;  4UWI A;  2Z10 A;  4AB7 A;  3S6F A;  4ORF A;  2JEV A;  3OWC A;  4GS4 A;  3DSB A;  4AG9 A;  2QIR A;  2QML A;  4CAX A;  3TCV A;  5E96 A;  3CXP A;  3FBU A;  4JXQ A;  4MHD A;  2ATR A;  2BUE A;  5JQ4 A;  2FSR A;  3WR7 A;  5IX3 A;  4NCZ A;  2B5G B;  3DR6 A;  2R7H A;  3TOA A;  2VXK A;  4KLW A;  1M4I A;  2FL4 A;  1IIC A;  4M85 A;  3SHP A;  5J8C A;  3D8P A;  2P6E A;  5FVJ A;  3R96 A;  4CAW A;  2EUI A;  2PDO A;  3FIX A;  1YRE A;  2VQY A;  1Z4R A;  2GAN A;  1YGH A;  2Q44 A;  3BJ8 A;  5IB0 A;  1MK4 A;  2CNS A;  3F0A A;  4K30 A;  1QSO A;  5EBV A;  4YRH A;  4XPL A;  5H86 A;  3S6K A;  4KUB A;  4DNC A;  4XNH C;  4R87 A;  1I21 A;  3G3S A;  3PGP A;  4B5P B;  2CNM A;  1I12 A;  1IB1 E;  3F5B A;  2REF A;  3QB8 A;  3TE4 A;  4XPD B;  1YLE A;  2HV2 A;  4JWP A;  1YR0 A;  3DDD A;  3I3G A;  1RO5 A;  3TFY A;  1RXT A;  1N71 A;  1NMT A;  4CS0 B;  4YGO A;  4PK2 A;  1YVO A;  3FYN A;  2OZG A;  4QC6 A;  3S6G A;  1B87 A;  3I9S A;  4OAE A;  3PP9 A;  2HQY A;  3EY5 A;  4FD7 A;  2BL1 A;  4EVY A;  4XPK A;  4IF5 A;  1XF8 A;  4AG7 A;  5HMN A;  4RS2 A;  2ARH A;  2P0W A;  2D4O A;  1GHE A;  1MJB A;  1OZP A;  4B5O A;  1ON0 A;  4KZT A;  3T9Y A;  1M4D A;  5F48 A;  4KOU A;  4PV6 A;  4HNX B;  2VZZ A;  4KOV A;  2PSW A;  5EC4 A;  2B5G A;  3GYA A;  3R9F A;  4FD4 A;  4JD6 A;  3CXS A;  1XIX A;  1IYK A;  3P2F A;  5IV0 A;  3EC4 A;  4KOY A;  1Q2D A;  1U6M A;  5DWN A;  2J8M A;  4F6A A;  1S60 A;  4AVC A;  4E0A A;  4BMH A;  2CNT A;  2JLM A;  4CRY B;  4HNW B;  3QAH A;  1KUY A;  3IWG A;  4F0Y A;  3FXT A;  3EO4 A;  1M1D A;  2VEZ A;  4KOT A;  3MGD A;  2B3V A;  1S7K A;  1CJW A;  3C26 A;  1K4J A;  4OLL A;  3D2M A; 
#chains in the Genus database with same CATH topology
 2V1U A;  4PK4 A;  3U2R A;  2QSH X;  3E6D A;  1LJ9 A;  3MWM A;  3G3Z A;  2A3S A;  4B5P A;  5D8N A;  2CO5 A;  2FBI A;  1QRY A;  2K3F A;  3S9L A;  2WAQ N;  1IN4 A;  1KUX A;  5G1Z A;  4HV5 A;  4DZJ A;  5DD4 A;  4ENJ A;  4NGN A;  4NGR A;  1O7F A;  3L09 A;  1U5T A;  3F8M A;  3COA C;  4YWY A;  1A6I A;  1MGT A;  4EEF G;  3CPA A;  3UKG A;  1BAV A;  2EB7 A;  3P9K A;  3D1N I;  1R4M B;  1OR7 A;  5IP6 A;  3G8W A;  1FWZ A;  2EQR A;  4EGZ A;  1JWQ A;  2F5I A;  3EFA A;  2I3C A;  4U9Z A;  2B0L A;  1YW4 A;  4A2U A;  1PU9 A;  2ZXJ A;  4ENN A;  2R1I A;  4M3S A;  2QQ8 A;  3EQL F;  2XVC A;  1FBQ A;  4HKF A;  1XSX A;  2PJ8 A;  4D7M A;  4XQF A;  2Z3O A;  1VQP I;  2VKD A;  3MKY B;  4CCK A;  5KNL A;  5B1B H;  3RIR A;  2JZY A;  1QVU A;  3HSF A;  4NGQ A;  5C88 A;  2DFI A;  3IHU A;  4IPA A;  1Z8L A;  2BVM A;  3I53 A;  1ON2 A;  1IN5 A;  2C1C A;  2R5Z A;  3EPZ A;  4AVP A;  3KET A;  3HBL A;  1QNT A;  4ONW A;  1U0J A;  3A03 A;  3FK6 A;  3D7F A;  2HR3 A;  2RN7 A;  1XTA A;  4CA0 A;  3NWT A;  4MY3 A;  4CYP A;  1OCC H;  1V5E A;  4XM3 A;  1I1S A;  3QPT A;  1UHW A;  4NB5 A;  2OU2 A;  2CRG A;  1X2M A;  1G8X A;  5J40 A;  3TBI A;  4S0H B;  3S17 J;  3R9E A;  2IBD A;  4U87 A;  3E1S A;  4GGG A;  3U21 A;  4KVM E;  4CGL A;  3ESW B;  4P5O A;  2PMZ A;  1SAN A;  2GIZ A;  4XLH A;  3E6B A;  3ASN H;  3CES A;  1YSJ A;  3V8L A;  4L9T A;  3SYT A;  4EWT A;  2M45 A;  1OMI A;  1XC5 A;  4OOI A;  3FXL A;  2FIA A;  1D5V A;  1HDD C;  1JHF A;  2Q7S A;  4XPD C;  2WPX A;  2OH1 A;  2EFN A;  1FT9 A;  2CJJ A;  1X1P A;  2L4A A;  2WBM A;  5LGT A;  1CBX A;  4IUS A;  2R98 A;  4R1H A;  3D5L A;  1TC3 C;  3C7J A;  2XEJ A;  2CUZ A;  2O28 A;  2L01 A;  4P4I A;  5F09 A;  3JSP A;  3UNG C;  1E3O C;  3IU2 A;  4KT6 A;  2QKL B;  1ZRD A;  2PJR B;  4CDG A;  3TGN A;  1HDU A;  2GXB A;  4II3 A;  4LLG F;  4WWC A;  1Z4E A;  1GDT A;  2OOT A;  3FXM A;  2M4K A;  1Z7L A;  2HKX A;  2RNJ A;  4AIK A;  2VZY A;  1ZG5 A;  1RR8 C;  1UHM A;  2OZU A;  4M6I A;  3B3C A;  1Q2C A;  4X6A J;  2X7B A;  3DU5 A;  4HG2 A;  4B48 A;  3M7G A;  1Q2Y A;  4E7K A;  4NJR A;  4AIH A;  4F7Z A;  1ZH5 A;  2ESN A;  2M7B A;  2CQK A;  3RPU D;  2JN6 A;  2HU9 A;  3AG2 H;  1S72 I;  4TWE A;  2E60 A;  2G0B A;  1FPQ A;  1YX0 A;  1K4S A;  1FIP A;  4GXH A;  2R5Y A;  1B8I A;  5DM7 F;  1IID A;  1IZ1 A;  3F0C A;  3H5R A;  3CDL A;  2HB6 A;  2NS0 A;  1SFK A;  5I4M A;  2XGX A;  3ABT A;  2X6O A;  4MFZ A;  2XKO A;  1QSR A;  3CUO A;  2ELJ A;  3GF2 A;  3GWZ A;  4CAF A;  4A3E J;  1XGO A;  1DDN A;  2PBI A;  3OL3 A;  1A36 A;  4Z6Y A;  4RI1 A;  4E7Z A;  4FD6 A;  4OME A;  2ZSH B;  4NNJ A;  5A2Q Z;  3TW6 A;  4OIW A;  2DEA A;  1KZF A;  2DMT A;  2PJA A;  1LOK A;  4C3J J;  3LSK A;  5FKM A;  1FOY A;  1MSE C;  3BR2 A;  3GCM A;  2OZH A;  2V8V A;  4MCR A;  5AGE A;  1BA5 A;  3VDX A;  1I1D A;  1NSL A;  2W82 A;  2JRM A;  3DEE A;  3O6B B;  3L2C A;  3BDD A;  2GQQ A;  5CPR B;  1XEB A;  2DA4 A;  5CJ9 A;  3F22 A;  2R7S A;  3BLN A;  4C7H A;  2F4M B;  4L0Z B;  1O3Q A;  4Y17 A;  4KOR A;  2HQN A;  3ZMS A;  2EV5 A;  3J81 K;  3HSR A;  3CMM A;  2CYY A;  1IRF A;  2XPV A;  3D67 A;  3FB3 A;  2ZEG A;  3TO9 A;  3SJG A;  3FKI J;  4LOC A;  3I4N J;  5F64 A;  1F1Z A;  3BR1 A;  1YIJ I;  2G9W A;  3H0G J;  4BS9 A;  5DS9 A;  2NAZ A;  3P9I A;  3VAT A;  4M6H A;  3TX8 A;  3R0A A;  5LYL A;  2QEC A;  3JRB A;  2B4D A;  3R9G A;  2V1N A;  2KDZ A;  1TIQ A;  1F43 A;  1KU9 A;  4B43 A;  2QLZ A;  3HB9 A;  2PJ1 A;  2A6H F;  5EEG A;  4X1E A;  3QWL A;  3HHH A;  1WKM A;  2QQB A;  2KQR A;  1A04 A;  4UB6 C;  4ZC3 A;  1YRN A;  2AE6 A;  3C18 A;  3R6S A;  1BC7 C;  3JRF A;  4XRM A;  2P6G A;  1FP1 D;  5CQE A;  3WG9 A;  5CVV A;  1AMP A;  4CGP A;  4Q47 A;  1EKE A;  4OAY A;  2MC3 A;  1JKR C;  2Q51 A;  3OOU A;  1FYM A;  1T38 A;  2FQ3 A;  2NVQ J;  2R7T A;  3PB4 X;  4NSQ A;  4NC7 A;  2XGC A;  4M3E A;  3KKW A;  4G7H F;  1BJZ A;  2DOD A;  1QQ9 A;  3OR1 C;  2VC0 A;  5JR3 A;  1ZAO A;  1LUJ B;  4BXX J;  1H88 C;  2PI0 A;  3GFJ A;  1R36 A;  2DW4 A;  3SDB A;  2JDC A;  2ODF A;  3AG4 H;  2LOO A;  1IG7 A;  4LD5 A;  2R8V A;  3OYC A;  2L0K A;  2QYO A;  3K0L A;  1W36 D;  4NQW B;  2COB A;  5F49 A;  4KOX A;  1F9N A;  2EV6 A;  3L2U A;  5ICF A;  2M1B A;  2HNH A;  5GTI C;  3I71 A;  4AVZ A;  2VBY A;  5J1U A;  2CUJ A;  1XGM A;  5TIS C;  1PUA A;  3WT4 A;  3OYH A;  3GFI A;  4IKF A;  1IV6 A;  5AIQ A;  3F8C A;  1ETY A;  1NK2 P;  3TP3 A;  1WJ5 A;  2NS7 A;  4KN4 X;  2IEK A;  3B3S A;  1BN5 A;  2OUM A;  2X0L A;  1OCT C;  2BHY A;  2LKP A;  3ECO A;  1SD5 A;  4DYO A;  1Y9W A;  3ZMU A;  3KP6 A;  2Y9Z A;  3F72 A;  3L2R A;  2R93 J;  2HDC A;  1Z3Y A;  1OJL A;  5M5X J;  2VON A;  2QVP A;  1AYE A;  4G1P A;  1GXP A;  1MZB A;  2PLY A;  1V3F A;  2QZ8 A;  3FXQ A;  1DQU A;  1VQM I;  2W57 A;  4ZYD A;  1XDS A;  3P7N A;  2PQ8 A;  3VYS B;  3J7A Y;  3EXN A;  4N9H A;  5IP9 J;  2HDD A;  2Z11 A;  1S7L A;  4B1R A;  1S6L A;  3O3K A;  4X8I A;  2BBY A;  1YQA A;  3OL4 A;  5HDK A;  3CZX A;  2GIV A;  4UCN A;  2GRE A;  2ZW6 A;  3BJA A;  2XSJ C;  4ONU A;  3BCA A;  4LUA A;  2DLL A;  3TMO A;  3MEX A;  2PJ3 A;  5D4S A;  3LA7 A;  3T5X A;  2V77 A;  4PJ0 C;  3IH3 A;  1R3N A;  1MMD A;  3K1P A;  2VBX A;  2XC7 A;  3S32 A;  1WJB A;  2A69 F;  4G7O F;  2ADU A;  4FE7 A;  2TCT A;  3FIW A;  3TQN A;  3ZR8 X;  4PXC A;  3DEW A;  1U2W A;  4HOB A;  3A9L A;  4R9M A;  2BE5 F;  3KEO A;  4LG0 A;  1I6H J;  1XD7 A;  4BAC A;  3EUA A;  2HPI A;  5HH1 A;  5IT9 Z;  4L8A A;  1Z6T A;  1ZO0 A;  5HVF A;  1SAU A;  1RET A;  2M87 A;  5DEQ A;  3K2K A;  3MQ0 A;  2ZW5 A;  4MHZ A;  2FML A;  2EIJ H;  2DT7 B;  3VYU B;  5J4Y A;  4H6Z A;  1Y0N A;  3ZMT A;  2ZEH A;  4C68 A;  2M4G A;  3EUH C;  3TDZ C;  3GX4 X;  2BYV E;  4F9V A;  1IV8 A;  1WGX A;  3PM1 A;  1IDY A;  4NUB A;  5DV5 A;  5ERI A;  3RKQ A;  3S6F A;  4M71 A;  2XUB A;  4F93 B;  4UEZ A;  3SJF A;  3U1D A;  5GPC A;  1H0M A;  1H89 C;  5JM6 A;  2WSA A;  1YME A;  4ZH4 F;  2P5L C;  3ZN0 A;  5K8O A;  1G4D A;  3E5Q A;  5FLM J;  1U78 A;  3TCV A;  2ZNY A;  1TXR A;  1QMU A;  4WXC A;  4PXE A;  5L3F A;  2DPU A;  3AFH A;  3HRU A;  1LE8 B;  2W1O A;  2VC1 A;  4UXN A;  3J7Z I;  3WC7 A;  4A94 A;  1VQ5 I;  2W85 A;  1RIO H;  2MD0 A;  1LQ1 A;  3R0J A;  5H2F C;  2ATR A;  4YRV A;  2NOJ B;  1Y0R A;  2PVV A;  1Y8Q B;  2BUE A;  2PJ2 A;  2LBF A;  5HS9 A;  1RKT A;  1HLV A;  3NE8 A;  1DU6 A;  3Q0W A;  1T6S A;  3DWL E;  2R7R A;  5ILV A;  1W7P A;  4KMU X;  5L3B A;  1XFO A;  3DR6 A;  2NXN B;  4BUP A;  1ZGA A;  2J5O A;  1TNT A;  2X6Y A;  2ABZ A;  3MN2 A;  2XF5 A;  2VUM J;  2BCO A;  3TOA A;  4F55 A;  2R7H A;  3DKX A;  2DA5 A;  2LKS A;  2Y48 A;  2QBY A;  5E20 A;  1IXC A;  3ZRG A;  2F7V A;  1M4I A;  4ZGY B;  4PGH A;  5E3L A;  2HVQ A;  4IZZ A;  5LHG A;  5E79 C;  4WXH A;  4P4D A;  4PGG A;  3V42 A;  5LYF A;  5J8C A;  4A0Y A;  2YNE A;  4YU9 A;  1J5Y A;  3HTU A;  4I7H A;  2HZD A;  1T39 A;  4I02 A;  3HM5 A;  4MHN A;  1KU3 A;  3KP7 A;  2L7Z A;  2AQF A;  3HGG A;  2A07 F;  2CFX A;  3WC6 A;  4RM3 A;  2GAN A;  4HLX A;  2Q44 A;  4K3N A;  2F5D A;  1MK4 A;  3HUV A;  4WF2 A;  2DMU A;  1YIT I;  1TKJ A;  4L5J A;  3HRM A;  1JT0 A;  1YX5 A;  2Q0O A;  3X2Q H;  4BEH A;  5BPI A;  4O5V A;  1KYW A;  4EJV A;  4IQ4 A;  4XPL A;  2K4J A;  4KUB A;  4LIV A;  3QU6 A;  3FMQ A;  4R87 A;  1I21 A;  4IHT A;  3OYK A;  4P6Y A;  4ZYQ A;  4ZDL A;  4MXU A;  2KFD A;  1V4R A;  1T33 A;  3O2P E;  3IWE A;  1ZHF A;  2WV1 A;  2B63 J;  3H0D A;  2VLA A;  3IUO A;  2CNM A;  3IFE A;  3DV8 A;  1I12 A;  3GYH X;  2QEX I;  2REF A;  1YX3 A;  5CVJ A;  2XRO A;  2FBH A;  4J01 A;  3PSI A;  2ESH A;  4Q7A A;  3PFE A;  2WC2 A;  2IA0 A;  2HYJ A;  3SI1 A;  3TFY A;  2PMZ N;  1Z0X A;  3NQO A;  4P9F A;  4XLF A;  1B6A A;  4CHU A;  5F6F A;  2KRH A;  3ZP5 A;  4UNO A;  1VQL I;  1IAW A;  1RXT A;  1H8L A;  4BIN A;  2H27 A;  3I3L A;  3RYR A;  2IXS A;  2OZG A;  2LKX A;  4OKO A;  3H5A A;  4FWU A;  3I64 A;  1MH3 A;  1B87 A;  4OAE A;  2F5C A;  3ABK H;  4LQG A;  4F91 B;  1IXR C;  2YX7 A;  3WTT C;  3REO A;  2D5V A;  3AL0 C;  2NVT J;  3BHX A;  4RM2 A;  1Y39 A;  4EVY A;  1N75 A;  4XPK A;  4IF5 A;  1UB9 A;  1U8R A;  5BWA B;  1K61 A;  2DYR H;  3LAJ A;  2HOT A;  2VJI A;  5DM6 F;  5DTD A;  3J80 K;  4X2T A;  1FIA A;  5M5Y J;  2JA2 A;  3B7I A;  1PVE A;  2ZEM A;  2X85 A;  3RJP A;  2O3F A;  2ZJR F;  2D4O A;  4KNY A;  3Q5F A;  1W4M A;  1I3Q J;  3SZT A;  1P6R A;  1YTY A;  3CUQ B;  2RRE A;  3CCU I;  1VHE A;  3FX3 A;  1P7J A;  2L7K A;  3DU6 A;  1S7O A;  2DFF A;  2HS5 A;  4MTD A;  4O3M A;  2DO7 A;  2H94 A;  4YEL A;  3WGI A;  1IGN A;  2Z3P A;  3S1M J;  2OA4 A;  5FLX K;  1LAP A;  4IK2 A;  2GXA A;  2XPU A;  4BQA A;  5THW A;  5HNH A;  1IF1 A;  3MZY A;  3PFY A;  5EG0 A;  4BQQ A;  2A5Y B;  1PUF A;  1DU0 A;  4FD4 A;  4KN7 X;  4M3D A;  3A01 A;  1XX5 A;  3DPL C;  2WV0 A;  4XL9 A;  1HC8 A;  3RQ4 A;  1Z21 A;  1XCB A;  4ETS A;  3EC4 A;  3JAM Z;  2JPC A;  3RDI A;  2DMP A;  3HXL A;  4BBR J;  3SZP A;  2R7F A;  4F6A A;  2PJC A;  3CDI A;  1AHD P;  4E0A A;  2EK5 A;  4G6D A;  4BMH A;  2UXX A;  1OYY A;  1TQI A;  2F5V A;  2DA3 A;  2CNT A;  3IRR A;  4FIS A;  2IS2 A;  1VZ0 A;  3ZQQ A;  2CQ7 A;  3QAH A;  5LBQ A;  3H3V K;  3IWG A;  1N77 A;  3WC5 A;  4BY7 J;  2CFO A;  4KOT A;  3JRG A;  2DOE A;  1CF7 B;  4IF4 A;  2KZV A;  1YJW I;  3MGD A;  3KAS A;  3T1B A;  2LP0 A;  1YW9 A;  4DZP A;  3GO5 A;  3OYB A;  1BR2 A;  3A0B C;  1TT0 A;  1CJW A;  3DBR B;  2STT A;  3M8E A;  5E1W A;  3PRT A;  5J6X A;  2MFZ A;  4R6T A;  1NSA A;  3D2M A;  1SFE A;  2R3S A;  1Z7U A;  4KJZ A;  2HOA A;  3G1L A;  2OJE D;  2O8X A;  3D2P A;  2FS5 A;  5HNF A;  1WPK A;  3RYO A;  3F8F A;  4BHB A;  3BQY A;  5C44 J;  4LK1 F;  2W84 A;  1EH6 A;  2DFE A;  2RGV A;  1D1B A;  3ZQH A;  2DYS H;  1D8K A;  1BW6 A;  4D5C A;  3LSG A;  3SZG A;  3QYB A;  3FNC A;  4MIM A;  1MDM B;  2IP2 A;  3PNT A;  3H36 A;  4HDV A;  1WRJ A;  1XSV A;  2BW3 A;  2X6W A;  4Q4Z F;  1HEE A;  2LC2 A;  1MW7 A;  4HNU A;  2BY3 A;  1ACI A;  3M9A A;  4RGR A;  1TQM A;  3F8N A;  7CPA A;  2I5U A;  4M9Z A;  4RAG A;  1YW8 A;  4LB6 B;  3LWU A;  2DU9 A;  4U7D A;  3WGG A;  4WK8 F;  4EGY A;  4AC0 A;  4BDY A;  2D4P A;  3IAS 2;  3S14 J;  1TWA J;  1J0R A;  2M3A A;  1JE8 A;  2V4J C;  4UY8 I;  4L89 A;  4CAV A;  1QO0 D;  4QWQ A;  2VKH A;  1Y6I A;  2DOA A;  4E7L A;  2X1D A;  3H8G A;  4MHY A;  3QNV A;  4HX8 A;  4UWJ A;  3V8I A;  4BDZ A;  2OC6 A;  1FC3 A;  5FRM A;  4KUM A;  3DTE A;  4CYD A;  1LRZ A;  3K4N A;  1O4X A;  3BJ7 A;  3O8H A;  1MND A;  1R58 A;  1XGS A;  2K9M A;  4KDP A;  1F2O A;  3P5J A;  2VBZ A;  1D0X A;  5GAG J;  3HOZ J;  3BJO A;  3BZ6 A;  2BOA A;  3WHB A;  1UEL B;  4CZC A;  1ZLK A;  2YR2 A;  3K70 D;  3S16 J;  3FMC A;  3HOY J;  5FLV A;  4F3Q A;  3RZA A;  2E1M B;  4O23 A;  1XRY A;  1MKM A;  1X1C A;  2XB5 A;  1Y7R A;  3PB9 X;  4Q5S F;  5D5U B;  4UCM A;  2ETH A;  3UR3 C;  2FVG A;  2FIW A;  2DA1 A;  2L3D A;  1LPQ A;  2ZOG A;  4MFQ A;  5KAI C;  5JPH A;  1WJF A;  2ZEN A;  2MC4 A;  3VOD A;  3KR5 A;  4EJW A;  1UJ8 A;  2ZW7 A;  4P96 A;  4U0W A;  5LEJ A;  2QA4 I;  1JI8 A;  1W0U A;  2VT2 A;  4QTR A;  3DQV C;  1J09 A;  1MIJ A;  2J5P A;  2L9V A;  4OMY A;  2FUG 2;  5CLS A;  1Z77 A;  1B1B A;  3NEU A;  1MBK A;  2NRA C;  3D66 A;  4XOR A;  4B8X A;  4DBQ A;  5LD2 C;  4AM3 A;  2XV4 S;  1WJC A;  2E5Z A;  4W1U A;  1E17 A;  1JUM A;  2J8N A;  2ZOF A;  4NC8 A;  4L9N A;  3L2Q A;  3CME I;  2HQR A;  1G59 A;  4LG3 A;  1DTD A;  1SQH A;  2PJ5 A;  3FXJ A;  1Y56 A;  4A39 A;  2DDA A;  4XIC A;  4Y13 A;  3P2H A;  4RMN A;  3J7A O;  3DBH B;  6CPA A;  4MLO A;  4MHG A;  4XLE A;  4A38 A;  2ZB9 A;  3CC7 I;  2GLF A;  5LGU A;  3FRM A;  1SD6 A;  3GKR A;  2QKM B;  3TC8 A;  4EQQ A;  3FMS A;  4R8H A;  5J3L A;  2O7O A;  4RGU A;  2KPM A;  5IP7 J;  4V2F A;  1YK3 A;  2GA2 A;  2DTR A;  4C2Z A;  4HEA 2;  3HUG B;  4I76 A;  1S3Z A;  4CCJ A;  1NG6 A;  2K5T A;  5ICE A;  3ZJ0 A;  5FGM A;  2JVH A;  3FWE A;  1SAX A;  3AG1 H;  1JGS A;  1ZTR A;  2R7X A;  2EA4 A;  1SVO A;  2E19 A;  1SD7 A;  4KIC A;  3IGR A;  1VF9 A;  3CCY A;  4UEF A;  3F6V A;  1VQK I;  3M1E A;  4HDU A;  2FU4 A;  5D29 A;  3NRV A;  4A3C J;  1BI2 A;  2CY2 A;  4QBJ A;  3B6C A;  2E1C A;  2CQQ A;  2ZBK A;  5DWM A;  3TT2 A;  2EPF A;  1FMW A;  1XGN A;  4EAT A;  3KQZ A;  3B3V A;  3V7R A;  1SVL A;  2DCE A;  3FK7 A;  5DUI A;  2FCK A;  2CGP A;  1AA7 A;  1CGP A;  3GTJ J;  4OAD A;  2W25 A;  3FEC A;  2MAB A;  2VE9 A;  2NOG A;  3LL7 A;  4A0Z A;  3S1R J;  1HDQ A;  1YE9 A;  1B72 B;  2M5W A;  1IRG A;  4KLV A;  3L1P A;  5JI6 A;  1JUS A;  2B4B A;  4GCV A;  4IHV A;  3NH5 A;  2B7E A;  3BTI A;  3ROU A;  1X3W B;  2XDV A;  2ZXH A;  3KLN A;  5HDN A;  3BR0 A;  2M8G X;  1LKX A;  1TP4 A;  2JA8 J;  3R1K A;  3SJE A;  3QOE A;  4D5F A;  1IY7 A;  1OCZ H;  5M5W J;  1GUU A;  2VBW A;  4LLL A;  3ZMD A;  3SXN A;  1DP7 P;  3GVA A;  4JLY A;  4I49 A;  5GPA A;  2CIJ A;  4A3I J;  2PCU A;  1B4A A;  2DXQ A;  2PJ0 A;  1KYZ A;  1U6G A;  2GZW A;  4ZBG A;  1YI2 I;  4YFX F;  5HLT A;  3L2V A;  2Q2E A;  1QSN A;  2BV6 A;  3CQZ J;  5EEA A;  2L02 A;  4KFC A;  1ZGJ A;  2O61 A;  3FH4 A;  3SXY A;  1KU7 A;  4A37 A;  3RNZ A;  4FQG A;  1NK3 P;  1GV2 A;  2X48 A;  4FTH A;  1KA8 A;  2IL4 A;  5D5W B;  3B8G A;  4QIW N;  2XHK A;  3RPQ A;  2X4H A;  1HKT A;  1FY7 A;  3W6K B;  3MKZ A;  2KIS A;  1QQI A;  2FOW A;  2JSP A;  1JQG A;  2Q04 A;  2H8R A;  3TKY A;  4YEJ A;  1DP3 A;  2KIF A;  4N4O B;  5F08 A;  1S5K A;  1XCV A;  2BO9 A;  2REE A;  4NXY A;  5KTC A;  5HS8 A;  3W2V A;  3LD2 A;  2WPW A;  2JJ7 A;  1BO4 A;  2FXF A;  4R79 A;  4FAI A;  3LOD A;  2E1N A;  3KZY A;  3EUH A;  1R4N B;  1GHC A;  4F9U A;  2O6G E;  1R5H A;  3OS1 A;  1UAA A;  4B13 A;  2MA3 A;  5KTA A;  2DTZ A;  3OYJ A;  1FP2 A;  5I0C A;  4UCP A;  2WAE A;  4ZY2 A;  2V9V A;  2FE7 A;  2CV0 A;  3G4S I;  4DGW B;  3LMS A;  4YIR X;  2LK2 A;  2XIG A;  4IRG A;  1BW5 A;  4L18 B;  1A31 A;  4G9Y A;  3TO7 A;  2EIM H;  3D7D A;  5HOO A;  1ZG1 A;  4H89 A;  2IGN A;  2QQA A;  1LCP A;  2YSR A;  2BSW A;  2C6C A;  3LA2 A;  3ZQF A;  5F27 A;  2VPR A;  2YX4 A;  3JTG A;  1J9I A;  3LSH A;  3K1N A;  3F21 A;  2MLK A;  4TV7 A;  4A93 J;  1AUG A;  3K7A J;  1X19 A;  1IC8 A;  4PSX A;  3CZ6 A;  5IYD J;  1S7A A;  3WU2 C;  5H6Q A;  2RFH A;  2ZXV A;  2GM4 A;  3RQI A;  4R3K A;  2MH2 A;  3I55 I;  2HOE A;  1I50 J;  2HI3 A;  5FRO A;  1IYL A;  4KVO E;  3UY5 A;  3QPH A;  2LF8 A;  3WTX C;  2ZPA A;  1BR1 A;  4WXD A;  1NHA A;  2ISZ A;  3CXQ A;  1UFH A;  2PR8 A;  5A2Q K;  4QUS A;  2JK3 A;  2GXG A;  3JUW A;  3DCF A;  1TF8 A;  2STW A;  3H4Q A;  4PK3 A;  3MCZ A;  2EBJ A;  2LMD A;  1GT0 C;  1Y0Y A;  3Q9V A;  3VFZ A;  3GZN B;  4NEX A;  5HXD A;  1ZG3 A;  4H2K A;  4D0P A;  2Z5U A;  4EM0 B;  4JX4 A;  2EA2 A;  5H6R A;  3VEP A;  1JKO C;  2F5F A;  1RRJ A;  3RSN A;  1JJ8 C;  4NHJ A;  1N78 A;  1S5L C;  4UWI A;  4X3R A;  2CTB A;  1KU2 A;  1VI0 A;  2Z10 A;  3MD2 A;  1ZYR F;  1LEB A;  4A5N A;  4AU7 A;  3ONQ A;  1WWX A;  1OLT A;  3HRT A;  2R0Q C;  4BQN A;  2E34 A;  2JUC A;  4C2M J;  5L3G A;  1X3Z B;  3ERM A;  1XMB A;  2OR4 A;  4AG9 A;  1YG2 A;  2QML A;  3L2N A;  4G6T B;  2DDB A;  3KYC B;  2X51 A;  4LLN A;  2CW7 A;  1BPN A;  3B73 A;  3HEF A;  4KSI A;  4RS8 A;  4XRS A;  2QSG X;  3FBU A;  1AKH B;  2VKE A;  1IW7 F;  1IOF A;  4HQE A;  3SJX A;  2FX0 A;  4XBF A;  3D5S C;  3S3O A;  4L9V A;  1V55 H;  1R43 A;  4CYC B;  4MFJ A;  1T56 A;  4QPO A;  3H3Z A;  1SFO J;  2V6E A;  1SMT A;  1F2P A;  4A12 A;  4KYW A;  1LDD A;  3GFL A;  2B5G B;  3JTK A;  4EM2 A;  1SFU A;  4CAE A;  4B09 A;  2KDO A;  3NFZ A;  4M6X A;  3VSK A;  4A5M A;  1YFH A;  4MFP A;  4HST A;  4NDL A;  1L3L A;  1ENH A;  1I6X A;  4G12 A;  2X1E A;  1Z9C A;  3IC7 A;  3CF5 F;  5LHI A;  2FL4 A;  1B9N A;  5B3S H;  4MRI A;  1IIC A;  4P1W A;  3TW7 A;  4NFR A;  1IN7 A;  3MZH A;  1W36 C;  3KP4 A;  3D8P A;  4G8X A;  4PXB A;  3JRH A;  5FVJ A;  2EUI A;  4YFK F;  3R96 A;  1TL8 A;  4CAW A;  5K8P A;  2VJJ A;  2LVS A;  2PDO A;  2DPT A;  4OIR F;  3DKY A;  1VQ7 I;  2QQ9 A;  5DCM A;  4U0Y A;  3A1Y A;  4I99 C;  1Q1V A;  2E71 A;  3VAR A;  5IB0 A;  3FF5 A;  4E7J A;  2FOK A;  1CQT A;  2CNS A;  2ZEF A;  1G3S A;  3ZMZ A;  4K30 A;  2WY8 Q;  2EFQ A;  4EFD A;  5EBV A;  5JH9 A;  4RLF A;  3WTW C;  2IS1 A;  2PJ6 A;  4IL6 C;  1OQY A;  4LFU A;  3S6K A;  2M2E A;  2K7L A;  4XNH C;  4I6Z A;  2I8D A;  1H9G A;  4M9X A;  2IW5 A;  1UFM A;  3WTV C;  1TNS A;  3IWF A;  4ESB A;  3IU1 A;  4HBL A;  5D5X B;  1DPU A;  2POK A;  2V7F A;  4B5P B;  3Q3S A;  4ZDP A;  3JCU C;  2Y0S A;  3PB6 X;  1DGR M;  1LEA A;  2Z2S B;  1O57 A;  3NAU A;  1K6Y A;  4XSZ F;  2EO8 A;  5J1Y A;  2KKO A;  3CT9 A;  1YLE A;  1IGB A;  1U5T B;  3R4K A;  2EK8 A;  1LFB A;  3I3G A;  1U9O A;  2L2O A;  3GTG J;  1BOA A;  2RVC A;  3CDH A;  2L5Q A;  3S93 A;  4ZTJ A;  2IJZ A;  1IJW C;  3FX6 A;  2WA0 A;  3H8F A;  1N71 A;  4OC4 A;  4ZI6 A;  3H35 A;  4Y33 A;  5IY5 H;  2EZH A;  4E7I A;  4W9Y A;  2DMN A;  1TQP A;  2C6P A;  5CVI A;  3V4G A;  1LDJ A;  1BM9 A;  3GLX A;  3TL4 X;  2OTL I;  4QC6 A;  1BR4 A;  1Z1D A;  2CG4 A;  2FMY A;  1W5S A;  3LFK A;  4BAY A;  4B47 A;  4NGS A;  1DGW Y;  3GXO A;  4A30 A;  4ZZD A;  1F4K A;  1ZRF A;  3GIU A;  1CG2 A;  3HPH A;  5FD5 A;  3CO7 C;  3JW4 A;  3CJR B;  1TT5 B;  1J7K A;  1WHU A;  3IWW A;  2V79 A;  2FJ1 A;  2E7X A;  2K85 A;  3N97 A;  5IT9 K;  3RO0 A;  4CYQ A;  3BI0 A;  4YII A;  3K10 A;  4RS2 A;  4F92 B;  3RKY A;  2ARH A;  3FJU A;  2DK5 A;  4UVC A;  1RZ4 A;  3HRS A;  2R5Z B;  3Q9S A;  5HS7 A;  1SMY F;  1R7J A;  2P0W A;  2GWR A;  3BCB A;  4JZ0 A;  3G6E I;  5HLH A;  5FB2 A;  3ZQC A;  2Y75 A;  2ZFW A;  2PMH A;  1ZG9 A;  3T8W A;  3VYR B;  4B3A A;  4OC1 A;  1MJB A;  4GM5 A;  3H8E A;  1OZP A;  1RTQ A;  2IPQ X;  2OZ6 A;  4XOT A;  2GLO A;  2CXA A;  4KZT A;  2PJB A;  1FMV A;  2EZI A;  1R6R A;  2O0Y A;  4XKB A;  3I56 I;  3HOT A;  3T9Y A;  1QPI A;  2L9N A;  1M4D A;  1PP8 F;  3GTO J;  4KOU A;  3BG9 A;  2VOO A;  1FNO A;  4GRI A;  2CF4 A;  3HC7 A;  3I5U A;  3ZOB A;  4PV6 A;  3G71 I;  4HPS A;  2KIQ A;  3RAM A;  4JP0 A;  4XKV A;  2LLK A;  3KIO A;  2ZME C;  1X1A A;  1BIB A;  1Z6R A;  3E6C C;  1X3U A;  5CPA A;  1UG0 A;  4ESJ A;  5D4R A;  3GYA A;  4UA3 A;  3O8G A;  5F0F A;  1OYW A;  1VQ9 I;  3DLA A;  2Y69 H;  2ACJ A;  2RKH A;  2K9N A;  4I09 A;  2ISY A;  2VN2 A;  2X1C A;  4NGT A;  1XIX A;  1HBX G;  3Q0V A;  4AIJ A;  2VQC A;  3P2F A;  1W5T A;  2RV8 A;  3IP4 B;  4PDK A;  4RGX A;  4BKX A;  5EF6 A;  2HVS A;  3PFI A;  1BI0 A;  2NVY J;  3PNV A;  4P9U A;  4LB5 A;  5E1Z B;  2XAU A;  2EFO A;  4IHS A;  1FZP B;  4IHX A;  1Y1V J;  1P2F A;  1FOK A;  2JQ7 A;  2HPM A;  1S60 A;  3B35 A;  3IEH A;  2K86 A;  5BQT A;  4P44 A;  2QVO A;  4Q48 A;  2W48 A;  2XRN A;  5HLI A;  1YW7 A;  5IYB J;  1JKP C;  1XN7 A;  2R5Y B;  1IXS B;  2IA1 A;  4LIT A;  3W6J B;  4UUS A;  1B8I B;  3HPG A;  3FEE A;  1WCM J;  3PIO F;  4IEJ A;  4HYE A;  2K5C A;  3CD6 I;  3GTQ J;  3RCO A;  2PFB A;  5L3C A;  3FF3 A;  4F0Y A;  3W2A A;  3KHZ A;  4CCN A;  1P9Q C;  2B3V A;  4NGP A;  3C26 A;  3KL9 A;  1BBY A;  5JLX A;  1ZGW A;  1LB2 A;  3ZN1 A;  1K4J A;  3NH8 A;  3PB8 X;  3IIB A;  3BR3 A;  1IDZ A;  1YHQ I;  2MG4 A;  1D1C A;  5E8G A;  1W1W E;  2P5V A;  2D1H A;  3PB7 X;  3FM5 A;  2IGO A;  4QB9 A;  2L7M P;  4LK0 F;  5GP9 A;  1XS9 A;  3BXM A;  2AXL A;  1ETK A;  3F8K A;  3KHX A;  1Q7L A;  3M8F A;  4M3G A;  5DS0 A;  2Q7B A;  3L9F A;  1S9H A;  1TZL A;  3W6X A;  3NWS A;  4EVI A;  4AVB A;  2K4B A;  3WG7 H;  2GE3 A;  2FE3 A;  1XOV A;  4IHM A;  4X5K A;  2X9D A;  3OSF A;  1MBG A;  2VXD A;  4HV6 A;  1KQ8 A;  1YS6 A;  2XAG A;  4AUX A;  2XEI A;  4Y4R A;  4UB8 C;  2B4D B;  5LHH A;  3FXO A;  5KTD A;  4Y49 B;  1YYV A;  3QYF A;  4HAM A;  4ITV A;  3JSO A;  2BY0 A;  2ZEL A;  3GUX A;  2HVR A;  3CMA I;  4CRZ B;  2K9Q A;  2V9P A;  4MFK A;  5K1Y A;  1T95 A;  2D1V A;  2VL1 A;  1YRN B;  1V0C A;  2F8H A;  2ZC2 A;  4P4J A;  2FNA A;  5BOX A;  1YJ9 I;  2H5M A;  2PIY A;  3D4U A;  5H84 A;  3RTR A;  1RC9 A;  5AG7 A;  3OS2 A;  4II2 A;  1VND A;  2Z3K A;  4M72 A;  5AG6 A;  2NNN A;  5HVG A;  2RC4 A;  2E35 A;  3HJE A;  3ZZI A;  4BQO A;  1BJA A;  2P81 A;  4RA2 A;  1FLI A;  3PL8 A;  1VHS A;  5F04 A;  5D8L B;  4DQ2 A;  4A3J J;  2AFU A;  3HTS B;  1R71 A;  2PJP A;  1MBE A;  2G3A A;  4HF2 A;  3VSL A;  3A2K A;  3E0J B;  3FM3 A;  4RAF A;  5AG5 A;  3V8J A;  4GFB A;  3B3W A;  3HSE A;  2M9H A;  3LQQ A;  1R22 A;  2IRF G;  3BG7 A;  1K4T A;  3DSB A;  3JRA A;  1Z9U A;  3DNS A;  1MJA A;  5E3N A;  5FKK A;  1TWG J;  2ZXW H;  3ASO H;  1I1G A;  3W6S A;  1ZAR A;  4FE4 A;  1TF9 A;  2FT0 A;  2GLJ A;  2NVX J;  2KCW A;  1PCA A;  4XRS G;  2LD5 A;  3ZQI A;  2V26 A;  1XE4 A;  5LRJ A;  2DMQ A;  3E0K A;  2ID3 A;  1K78 A;  1ZG7 A;  4CPA A;  3BQZ A;  2V8H A;  1MMN A;  1YW6 A;  4UFV A;  2UUZ A;  5E3M A;  4YG2 F;  2N8G A;  1Z91 A;  1SEU A;  4B10 A;  2ZKZ A;  4MNU A;  4OIN F;  1OCO H;  2A6E F;  2OQG A;  5JHF A;  3G73 A;  2R7W A;  3PJR A;  2C27 A;  4JK1 X;  5CNP A;  3AAF A;  1XJO A;  4H6U A;  2QCO A;  4A32 A;  4ZDO A;  2G9D A;  2IMO A;  5FKN A;  4G94 A;  1FSE A;  5HVH A;  5K8M A;  4HSR A;  5J8F A;  3HOX J;  4F52 A;  4ENK A;  5CYV A;  1OFC X;  2HQA A;  4PZJ A;  2EV0 A;  3LFU A;  3N05 A;  3W2W A;  2O03 A;  2K3P A;  1JT6 A;  4L0Y B;  4KUA A;  2G7U A;  5K7H A;  4HNT A;  1YOV B;  3K4C A;  4M6G A;  2HFH A;  3N5F A;  2ZW4 A;  3KPH A;  4MQV A;  3CTA A;  3ZQG A;  2J8R A;  3W6V A;  5LLQ A;  4BD9 A;  5IT3 A;  1P7I A;  5E3O A;  3VWB A;  1NE9 A;  3MN8 A;  3QPL A;  4HX4 A;  1OBR A;  2VJ4 A;  3I59 A;  2V6C A;  1VQ4 I;  4GYG A;  4KIB A;  3DTI A;  2XAH A;  5DDG A;  1X4O A;  2ZJQ F;  1S7E A;  1MMA A;  4LG0 B;  3CUQ C;  4RB2 C;  2VJ5 A;  4AD9 A;  3KYD B;  4B14 A;  4CIC A;  4A6E A;  2P5K A;  1CP7 A;  5KCM A;  4A3B J;  3I1U A;  2HKO A;  2LF7 A;  4C3I J;  2AS5 F;  3SI2 A;  2Z0Z A;  2LYC A;  2JBJ A;  3VWE A;  1EF4 A;  2HDW A;  1B59 A;  3VOE A;  3GY9 A;  2PR1 A;  1R1U A;  2VQG A;  2WTE A;  4MGR A;  2DBB A;  3EUK L;  4UFX A;  4HNV A;  3SEZ A;  1H8A C;  4M73 A;  3SJM A;  3TTH A;  5KVR A;  1D8J A;  4XKW A;  5H20 A;  2G7H A;  1IN6 A;  2C6G A;  3N7Z A;  4FT8 A;  1A6Q A;  3V7C A;  1M4L A;  5IPA A;  3FIS A;  1P92 A;  3H9Q A;  1WZ2 A;  2EJR A;  1A2Z A;  2DN0 A;  2WAF A;  4B44 A;  1ERD A;  4UBR A;  5EJC A;  3K9T A;  2IJL A;  2JRT A;  3VH9 A;  2M8E A;  4OC3 A;  4B12 A;  1S7F A;  4XK4 A;  3BP8 A;  2LNB A;  3MKL A;  1TWC J;  4N4N B;  1UST A;  2NMT A;  2HQ5 A;  3BPV A;  1TW2 A;  2KL4 A;  3QRF F;  1J75 A;  2PRQ A;  5K7F A;  2LBF B;  3QP5 A;  3KP2 A;  3RPU A;  1FTZ A;  2XRL A;  2BHZ A;  1WH7 A;  4XKC A;  1XSD A;  3PBE A;  1W7P B;  3S8P A;  2V1X A;  3IC1 A;  1FYK A;  3WTZ A;  1JHH A;  2R7Q A;  3ZGK A;  5K5Q A;  3CPX A;  4HNY B;  4UUS B;  2L7F P;  2Y0S N;  1T0F C;  2V1D A;  1K6O A;  4EME A;  4NBQ A;  4V2G A;  1WQ2 A;  4PJL A;  3EET A;  5CQG A;  3GBG A;  2QBY B;  3CP8 A;  3E3V A;  2Y0M A;  2HGC A;  1IOI A;  4N9I A;  3R95 A;  5J1R A;  3K70 C;  3H1C A;  3GZ6 A;  3CF2 A;  4G6Q A;  4GXO A;  3JRC A;  2KIM A;  4P55 A;  1OCR H;  2JT1 A;  3VWD A;  1QGP A;  2GAU A;  3WE3 A;  3WU1 B;  1I39 A;  2GOX B;  1W0T A;  2EIL H;  4EV0 A;  1WI9 A;  3HGY A;  3SDG A;  2Z3L A;  1G3W A;  3MKW B;  5GCN A;  4KVX A;  3FHN A;  1J59 A;  1BI3 A;  2GFQ A;  2PG4 A;  4XLC A;  4MQ9 F;  1Z2L A;  5DCF A;  4BHP A;  2AFO A;  1AOY A;  1P4A A;  4MJ8 A;  1Y8R B;  4JX6 A;  2XPW A;  3WE2 A;  2EWN A;  2ZCW A;  4M6Y A;  1H9T A;  2JEW A;  4QVT A;  1OCP A;  2W4S A;  4BEH B;  4UF4 A;  3SFZ A;  1K79 A;  1RR7 A;  1R9T J;  2DQR A;  2OTJ I;  3HLP A;  1R57 A;  3OIP A;  4YFJ A;  1QHG A;  4IHY A;  2XAS A;  4XNF A;  2PJR A;  4M3F A;  1VQ6 I;  4RN7 A;  2VAS A;  3PSF A;  5F1R A;  1FYL A;  5LGN A;  3OYG A;  2Y2Z A;  2DXI A;  3R61 A;  1HKQ A;  2NNY A;  1VQN I;  3FXK A;  3CLO A;  4PJN A;  2Z99 A;  4HZF A;  2B58 A;  3DPT A;  3OIQ A;  4GDF A;  3DR8 A;  4HF1 A;  4A69 C;  4KOS A;  4C3H J;  3FXU A;  3BTL A;  4H0E A;  1BIA A;  3I0T A;  1ETX A;  5AIP A;  4HX7 A;  1O3R A;  1MD0 A;  4E4H A;  4CZZ A;  2P8T A;  3HZJ A;  1UMQ A;  3OYN A;  4PCQ A;  2IGM A;  2H6B A;  1CM0 A;  5JVT A;  1ARL A;  4Z65 A;  4XLN F;  3TO6 A;  1IRZ A;  2XGD A;  3CCS I;  2E2I J;  4MCS A;  1Z67 A;  1HW1 A;  3A4C A;  4X0G A;  1ZQ3 P;  1BC8 C;  3WGH A;  2G3T A;  4PFP A;  2E1M C;  2DFH A;  4C2T A;  1IN8 A;  2DA7 A;  2LDU A;  2R7D A;  1NH3 A;  2AJ6 A;  2KJB A;  1GXQ A;  4Y7N J;  2IQ6 A;  4UVA A;  3BZC A;  2EWB A;  4RAY A;  2EIN H;  5LYD A;  4U5Y A;  1M44 A;  3EYY A;  5LRG A;  4JYK A;  5ISV A;  4F0X A;  2JDD A;  2NS8 A;  4RBO A;  1XMT A;  3K9U A;  1U9N A;  1FOW A;  1LFU P;  1K78 B;  2YU9 J;  3BY6 A;  4JYW A;  4AB7 A;  1S3J A;  2KIU A;  2VT3 A;  2JEV A;  4RUH A;  1FT7 A;  1KON A;  2MSY A;  2MYS A;  3KX2 A;  4MFL A;  2P6S A;  1ELL P;  4ZX8 A;  8CPA A;  2QIR A;  2OBP A;  3GTL J;  3CXP A;  1G3Y A;  3PEI A;  5BS6 A;  4EJT A;  5LRS A;  3N4M A;  1USS A;  4IOC F;  1RES A;  4P10 A;  2IS4 A;  1E3P A;  3QU3 A;  2HTJ A;  2LR8 A;  1IRX A;  4UIB A;  1UHS A;  3C2G A;  1XBU A;  4EJU A;  2YGW A;  1M1E B;  3WR7 A;  4BJ5 C;  3MAJ A;  3PNY A;  4C9Y A;  5IOZ A;  3DLL F;  2XF6 A;  5FJ8 J;  4KA4 A;  2PN6 A;  4IVN A;  5EG0 B;  4KMF A;  1HOM A;  4NCZ A;  1PUF B;  4XRF A;  4A0X A;  2DT5 A;  2ICW G;  5EEH A;  4ZTF A;  2Y30 A;  4U88 A;  4QLC U;  3A01 B;  1HDP A;  2RQQ A;  2VXK A;  2L54 A;  4JBA A;  5E1X A;  3ZQL A;  4OID A;  2OD5 A;  3S9M A;  4OC0 A;  2KRC A;  4GYI A;  2R7O A;  1PUE E;  3PO3 J;  1HA8 A;  1NTC A;  3SXO A;  3SHP A;  2BXZ A;  2E2H J;  4NQW A;  2P6E A;  4J19 A;  2JA7 J;  4IRH A;  5LRK A;  3NA6 A;  2M30 A;  2XAQ A;  5GAE J;  3OYM A;  1MH4 A;  1RNL A;  4ON0 A;  2BY2 A;  5LYI A;  4XLA A;  4XOP A;  1YRE A;  2VQY A;  1AWC A;  5GAH J;  3IH4 A;  1YGH A;  3BJ8 A;  2CH0 A;  2MGQ A;  3CLQ A;  3GLL A;  2QF7 A;  3KEY A;  4UV9 A;  1MSF C;  1QSO A;  3F0A A;  2V8D A;  2TRT A;  4YRH A;  3K2Z A;  5G22 A;  2VQH A;  3BOQ A;  4XID A;  3DKW A;  1JKQ C;  3V38 A;  4OIO F;  2YU3 A;  3OYF A;  2LH9 A;  3HOS A;  1JTX A;  2LY2 A;  3G3S A;  4A3K J;  4BH9 A;  2PX9 A;  3ZQ7 A;  3PQJ A;  5LEK A;  3QP6 A;  2BZT A;  3IRQ A;  1IB1 E;  1Z3X A;  2JUG A;  3F5B A;  4XPD B;  2HV2 A;  4JWP A;  3MMY B;  5E17 F;  1YR0 A;  2AFZ A;  2XKP A;  2ZME A;  4UEE A;  5EZG A;  3LSM A;  4PJM A;  2BW3 B;  4RB3 C;  1FBS A;  1ZEL A;  4CGM A;  4DOZ A;  3FMR A;  2OF7 A;  2VKV A;  1ELM P;  6PAX A;  1BL0 A;  3CC4 I;  3DPU A;  3EYI A;  1NMT A;  5ICG A;  1VGY A;  2HXO A;  3HYI A;  4EJO A;  1FOX A;  4CS0 B;  1FNN A;  2HYG D;  1Z8T A;  4ZY1 A;  2XAF A;  3DBL B;  2OCC H;  3M4O J;  3I9S A;  2KP6 A;  1DE4 C;  2LY1 A;  3V7S A;  1P4X A;  1MMS A;  3L00 A;  1EH8 A;  3CCQ I;  2AFX A;  4OIQ F;  3EY5 A;  5HLG A;  1FBU A;  2QSF X;  1X10 A;  1MBH A;  2IA2 A;  4M3B A;  3HOV J;  1XF8 A;  4OP4 A;  4AG7 A;  5HMN A;  4LIU A;  3T8R A;  1N25 A;  5K5R A;  2CV2 A;  3T8T A;  1D1A A;  1XMK A;  4ZY0 A;  3ZXS A;  3CMY A;  1HSJ A;  4XSX F;  4ZYH A;  2MD5 A;  3Q0U A;  4A3G J;  2PEX A;  2Q8K A;  5J1Q A;  1MMG A;  2H09 A;  1QZE A;  2MLG A;  3IH2 A;  4OIP F;  1SFX A;  5IYC J;  3K4J A;  3LSI A;  1JJ6 C;  1ZN2 A;  2V9K A;  1UZC A;  1X4P A;  2KHM A;  1ON0 A;  3WTY C;  2YPR A;  5IB9 A;  1F36 A;  2RNG A;  5F0C A;  1R23 A;  3K4M A;  5ED4 A;  4UFW A;  1LE8 A;  2Z9O A;  4NC6 A;  4I0B A;  5F48 A;  1RKW A;  5LFA A;  2D45 A;  2JWT A;  3PUF A;  2QYV A;  2NYX A;  1LNW A;  3CJQ B;  5EGO A;  5G21 A;  2WUU A;  3JR9 A;  4R76 A;  2NVU B;  3D68 A;  3DLJ A;  4BGD A;  3HG9 A;  5BMZ A;  4B11 A;  4AID A;  2VB6 A;  3K4B A;  4MCP A;  3BLY A;  3K69 A;  1ETO A;  1Z8X A;  3R9F A;  1Y1W J;  2BGC A;  4OU0 A;  3A0H C;  3GLJ A;  3IWZ A;  2ELH A;  4UUV A;  4JD6 A;  5K7Z A;  3H9G A;  1YO5 C;  4ESF A;  2YND A;  1V5G A;  1IYK A;  3C3W A;  2WB1 A;  3GUD A;  5FFX A;  4KOY A;  1Q2D A;  1U6M A;  1ODD A;  1R1T A;  4IX7 A;  3LAC A;  3C2H A;  4I0A A;  4AYB A;  1WFX A;  3I4P A;  2WYR A;  2FF4 A;  1STZ A;  3KEQ A;  1KGS A;  4M9S A;  4AVC A;  2ZNZ A;  4MTE A;  5L3D A;  3BG6 A;  2VI6 A;  2G0E A;  3F6O A;  2ZO4 A;  5BPD A;  2JLM A;  5FRN A;  1MBF A;  1JTY A;  3CCM I;  2IS6 A;  4C7I A;  3I54 A;  5D8K B;  2GOM A;  1VIX A;  4R8F A;  3CDX A;  3JRE A;  1KUY A;  4S05 A;  3FXT A;  1HXD A;  2RQP A;  4A3D J;  1M1D A;  2VEZ A;  3EO4 A;  2Z33 A;  1XPX A;  2FSW A;  1S7K A;  3FBN B;  3B3T A;  4UVB A;  4CO8 A;  1CPS A;  4ABZ A;  3SHF A;  2DPS A;  2YUS A;  4PFO A;  4HNW B;  4KIT B;  3J7Y J;  2I79 A;  5A27 A;  1KUV A;  4XNH B;  2DA6 A;  2LRE A;  2HC9 A;  4ZZL A;  4HPQ A;  2FXA A;  3EDP A;  2D2W A;  4XR6 A;  1VQO I;  2PJ4 A;  3T90 A;  4ASN A;  2EFP A;  3BR6 A;  2P7V B;  2CWE A;  1X1D A;  1LAM A;  4LX9 A;  5GTH C;  4MHP A;  2PC1 A;  3J81 Z;  2GU2 A;  4CYO A;  4D9J A;  2IVM A;  5CKT A;  4BE2 A;  1UG2 A;  4A2Z A;  1ETW A;  1G3T A;  2CSO A;  2M34 A;  4AXV A;  3CC2 I;  4RB0 A;  2E7W A;  2Y31 A;  5JVG F;  1O7L A;  3JRU A;  4LJZ F;  3RZO J;  4KOW A;  3TOB A;  2ZJ2 A;  4R7M A;  5C82 A;  1J4J A;  1TW3 A;  4DYC A;  1WJA A;  1EE3 P;  2QM3 A;  3JRD A;  4PPZ A;  2AFM A;  3S6H A;  4RLQ A;  3DP7 A;  1APL C;  3S3M A;  2YNC C;  2A61 A;  4DYQ A;  2MBF A;  4FX4 A;  4XON A;  1D3Y A;  4E70 A;  1D5Y A;  4NJQ A;  2KT0 A;  1BLL E;  4E6K G;  3LQR A;  5E18 F;  3BR5 A;  4IXA A;  2R7U A;  4B3X A;  4YIF A;  3ISX A;  5JHU A;  2CMP A;  3AG3 H;  3M1C A;  1HST A;  5KAF C;  4ZJZ A;  2VE8 A;  4KIG A;  2Q2E B;  2PVW A;  4OC5 A;  1XB4 A;  2Q4Z A;  4J3G A;  3GW2 A;  4BBS J;  2CUF A;  5G20 A;  2R7Z J;  1HKS A;  3HOW J;  5ELY A;  4YFN F;  1J2X A;  3VB2 A;  2PJ9 A;  2A6T A;  4MEX F;  1GVJ A;  4CH7 A;  4Q38 A;  1HW5 A;  1LVA A;  2AO9 A;  3LAP A;  1P0H A;  2QUF A;  2NYQ A;  3CUQ A;  3HKZ A;  2JA5 J;  3FKJ A;  1JUP A;  2HXI A;  4BHC A;  4WCG A;  1FJL A;  1QU3 A;  1ITY A;  1VQ8 I;  1K83 J;  2Q1Z B;  2P4W A;  4H4K C;  1KQ0 A;  1I27 A;  2E1O A;  3OR2 C;  4KIS A;  3C2B A;  4BJ6 C;  1T8I A;  1VKC A;  1Q1H A;  3HOU J;  5D5V B;  4E7S A;  3QOP A;  4B6Z A;  2KRF A;  1U5T C;  2DJI A;  3RZD J;  2UZK A;  2EZK A;  3L7W A;  2ELK A;  1JGG A;  2ZME B;  4GO1 A;  2CTC A;  3V7Z A;  5CVU A;  4W97 A;  5TRD A;  2ZXI A;  3WTS C;  1QSM A;  3FHZ A;  1R5G A;  3JRI A;  3KYL A;  5M3F J;  1OR7 C;  1ZLH A;  3MZ8 A;  2BXY A;  3OYL A;  4FBE A;  2ZEO A;  1TLH B;  2CQX A;  3K6G A;  4U9Y A;  1OPC A;  2ECC A;  2VOP A;  2VIX A;  1D0Z A;  1VHO A;  4C2Y A;  1GVD A;  2LSO A;  4R57 A;  4IHW A;  1LFW A;  3DTK A;  1WJD A;  4C2U A;  2Y9Y A;  1HQC A;  4A3L J;  1IUF A;  5EYR A;  4MFD A;  1DPR A;  2BY1 A;  4PJJ A;  1QA6 A;  1C0W A;  3S9N A;  2HWV A;  1Y9K A;  1R5I D;  3BT9 A;  1QVT A;  1RUO A;  1TBX A;  4IJA A;  1T0F A;  4PUS A;  4RGS A;  3WHC A;  1REP C;  4NGM A;  5HOD A;  1I3A A;  4I01 A;  3G2B A;  4E8O A;  3AKZ A;  4MY0 A;  1V54 H;  4KT5 C;  5C3E J;  1CF7 A;  1G2H A;  1LVK A;  1QHH D;  4DIQ A;  4MI4 A;  1A5J A;  1YLO A;  3G1M A;  1S8N A;  2PE3 A;  2F2E A;  2UV1 A;  3F3X A;  3S15 J;  1U8B A;  5B66 C;  1SC7 A;  2A4N A;  2ZEP A;  1ORK A;  3CJT B;  4CYN A;  4OC2 A;  3ABU A;  4XN0 A;  2EVN A;  5FD6 A;  2L9S A;  3KCC A;  3VYT B;  4CCL A;  2M7A A;  1WWZ A;  5FKO A;  1O3S A;  5FKL A;  3PZJ A;  3PIP F;  1ONV A;  2PRB A;  2EIK H;  4DYR A;  1TWH J;  5EGO B;  2R7V A;  3BWG A;  5JLW A;  3GME A;  3FZV A;  1WSU A;  3BI1 A;  1MDM A;  3PQK A;  3CCL I;  2LFB A;  1B6B A;  2DI3 A;  5EMI A;  4L5E A;  2VBQ A;  5FFZ A;  1QST A;  3P9C A;  4II9 A;  1Y0U A;  1QZZ A;  2CU7 A;  2EFW A;  4AWX B;  4FX0 A;  3KFW X;  4DUK A;  5HDG A;  3BPX A;  2VQL A;  4WX9 A;  1SVM A;  2FNP A;  4TNU A;  4ANJ A;  1CPX A;  5GAD J;  2PJ7 A;  4ZYG A;  3LNQ A;  3OYA A;  3NE7 A;  4PSW A;  2M0C A;  2H6C A;  3ERE D;  1VTN C;  1GYT A;  2CQN A;  2HUZ A;  1S7N A;  1Y7E A;  4RDU A;  4AVA A;  2VPL A;  1ZK8 A;  1YLF A;  1HW2 A;  4A33 A;  1DUX C;  1PDN C;  2IGK A;  4FAS D;  2HYF A;  3RKX A;  1YVK A;  5F46 A;  2K02 A;  2AQE A;  1MJ9 A;  2AHQ A;  2Z1D A;  4IAV A;  3TP0 A;  2F5E A;  4R3L A;  3D0S A;  1MNE A;  4MBU A;  5ILU A;  4M74 A;  3D7G A;  1T08 B;  2KZG A;  2MW8 A;  5HVQ C;  4U7B A;  3F8B A;  2XEG A;  2Z3M A;  1XDU A;  2AXT C;  3SQN A;  1ZLI A;  3G1O A;  1RUN A;  2WY7 Q;  5IX3 A;  3MFK A;  3DF8 A;  3RKW A;  4BXF A;  1YIO A;  4HF0 A;  2P7C B;  1UWY A;  2WAQ A;  3AL0 B;  4CGO A;  2LTP A;  2ID6 A;  1A35 A;  1P4N A;  4K2E A;  4IOA F;  2L4M A;  2B3U A;  5F1J A;  3PO2 J;  3KZI C;  3LSP A;  1TKF A;  1U3E M;  3D3S A;  3BRO A;  2B9S A;  4HLY A;  4BL0 B;  2VI7 A;  2BEI A;  2F6C A;  2W7N A;  3E5U A;  3C1D A;  5DCM B;  4UIA A;  5TJJ A;  3FVL A;  2UXN A;  3I58 A;  4E2A A;  2C6Y A;  2OQR A;  3VPR A;  4HRI A;  4BXU A;  3LST A;  5F0H A;  3H5N A;  1MNM C;  3JTH A;  3HDD A;  5AG4 A;  1FSH A;  4FET A;  5B5E C;  4XMY A;  2A05 A;  3HHG A;  4BU2 A;  2I00 A;  1UCR A;  2JPB A;  4CCO A;  1TTY A;  2JMW A;  2JTV A;  3BJ6 A;  3HIF A;  2QJ8 A;  2ZEE A;  2CS3 A;  1X12 A;  3V8K A;  2VOD A;  2P6F A;  1ETQ A;  1X1B A;  4DJA A;  1L0C A;  2JBK A;  3M07 A;  1OIS A;  4HQM A;  1VFC A;  3JVN A;  4L5I A;  1WK4 A;  3MRU A;  3GEZ A;  4A3F J;  3ULQ B;  2X6X A;  3ELK A;  2CUE A;  4CXF A;  3PUB A;  2DA2 A;  5TGT A;  4I2O A;  1S29 A;  3B02 A;  2Q4Y A;  3HL2 A;  3KI9 A;  2KJC A;  1YS7 A;  1X58 A;  2LG4 A;  3F9K A;  5A28 A;  4EMS A;  2BVL A;  2FRH A;  3S3N A;  5C4X J;  3OYI A;  3QQA A;  2DPD A;  3A02 A;  4PXD A;  4A6D A;  5ICC A;  4NF1 A;  3F23 A;  3DFG A;  2P6T A;  3HUG A;  1M4G A;  2Q4V A;  2FD5 A;  1LFP A;  3E7L A;  5KHD A;  1RPW A;  4EM1 A;  3JAM K;  4RB1 A;  2Q0Y A;  4UUT A;  5J4V A;  4C2X A;  1WH5 A;  3W91 A;  1R1V A;  3CCR I;  4F8Z A;  3LA3 A;  4M6V A;  3RI4 A;  1F5T A;  2EK9 A;  2OB0 A;  4FD5 A;  4RAZ A;  3H3U A;  3IAM 2;  4BE1 A;  3CCE I;  5LRR A;  2O8K A;  5ILS A;  5F47 A;  4JOM A;  1PJR A;  2LRD A;  3M8J A;  4Y49 C;  2WB1 N;  1Z8W A;  3R60 A;  3J80 Z;  1BOB A;  3IKV A;  3OSG A;  2OCE A;  4JXR A;  2DAO A;  1EA3 A;  2DJN A;  3S2D J;  1EV7 A;  4QSH A;  4JJX A;  4AYB N;  4A3M J;  2M0M A;  3RBU A;  2JSC A;  4Q36 A;  2E36 A;  4ORF A;  3GTK J;  1IO2 A;  2ANP A;  3OWC A;  4GS4 A;  3BTJ A;  3U9G A;  2H1K A;  2IAI A;  5EZH A;  4ZYA A;  1B72 A;  2L9R A;  3H92 A;  3ZPL A;  4LQ6 A;  4ENM A;  3LWF A;  3WAB A;  4IO9 F;  4A95 A;  4CAX A;  3K2A A;  3KLO A;  5E96 A;  2A68 F;  4CUG A;  3MVP A;  3QPS A;  3FDY A;  4MO7 A;  2AFS A;  3KGQ A;  4JXQ A;  1G6N A;  2OPT A;  3GZ5 A;  3BTC A;  4LGW A;  2MH9 A;  4CGZ A;  4MHD A;  5E8I A;  4BNC A;  5DUK A;  3CCV I;  3GTM J;  4B4C A;  2E2J J;  4UHT A;  4A31 A;  2JA6 J;  5FLX Z;  3IKT A;  3OYD A;  3FBI B;  4KIF A;  4BY1 J;  2Z3N A;  4BBH A;  5JQ4 A;  2FSR A;  5BNG A;  2DT6 A;  1KWM A;  3OV8 A;  3SI0 A;  1PYV A;  3B2Y A;  2DOF A;  2H8W A;  3K4L A;  2BOL A;  4KLW A;  4MEY F;  4OAZ A;  1OYI A;  4MFE A;  2ZED A;  2RDP A;  3QAY A;  4V19 K;  2WAD A;  2K9S A;  5FO5 A;  2O4H A;  2FQ4 A;  3BG5 A;  1LDK B;  3I9V 2;  5B1A H;  2ZJP F;  4M85 A;  4CCM A;  2HTS A;  3E97 A;  9ANT A;  3B6A A;  1TWF J;  3T0Y A;  2KMU A;  4N0B A;  1ON1 A;  1EJ9 A;  4P4F A;  4Y3O A;  1R00 A;  2Q43 A;  2J9A A;  3FIX A;  3GFM A;  4CSW A;  1FX7 A;  1EH7 A;  1NG7 A;  1PYT B;  1Z4R A;  5M3M J;  5C4J J;  3L2W A;  2CW0 F;  4JQF A;  1ZR4 A;  3QYE A;  3ZCO A;  4O6J A;  5CVR A;  1FTT A;  2K27 A;  2JVG A;  1ZR2 A;  2OV7 A;  5IOY A;  5H86 A;  1E3H A;  2Z3Y A;  2BEO A;  4DNC A;  2XSD C;  4U0V A;  4Y52 J;  2OAZ A;  3E5X A;  4WWV A;  1GV5 A;  4QPQ A;  2ZFU A;  4OMZ A;  4XN3 A;  2F4I A;  3U1K A;  3ZMV A;  3IV5 A;  1YJN I;  2R92 J;  3NH4 A;  2ME6 A;  3PGP A;  1XMX A;  2XAJ A;  4DBR A;  4IRI A;  5JGF A;  3BZK A;  2R4G A;  2K9L A;  1AU7 A;  2HEO A;  2YS9 A;  3KR4 A;  1ZKG A;  3QB8 A;  2EBI A;  1E0E A;  1T98 A;  3OOP A;  3TE4 A;  3CJN A;  3IJ3 A;  3DXJ F;  5DYM A;  2W00 A;  3HKZ N;  3S1N J;  3DDD A;  3OYE A;  1RO5 A;  3CP2 A;  4J00 A;  4Z2Y A;  3OS0 A;  1F57 A;  1YQE A;  2V8G A;  4Y15 A;  3TDU C;  1XG1 A;  1W5C C;  1HCR A;  1ZLJ A;  5K8N A;  3SEQ A;  1E2X A;  2I10 A;  4D1Q A;  2UWM A;  3H5Z A;  2XGE A;  4JX5 A;  3PFO A;  3KQX A;  4BE0 A;  2QEN A;  3RYP A;  3TED A;  1CX8 A;  3LMM A;  1YVO A;  3FYN A;  4PK2 A;  4YGO A;  2DQL A;  3K1M A;  4HA8 A;  3W3C A;  2E5N A;  1PP7 U;  3KZZ A;  1ZRE A;  3S6G A;  3E6M A;  3WU0 A;  1ARM A;  3LSJ A;  1IU8 A;  1BPM A;  3BC8 A;  2H1L A;  4BYY A;  1V5F A;  1OKR A;  3PP9 A;  3GB0 A;  2HQY A;  3ABM H;  2PIZ A;  3NAR A;  4FD7 A;  2CW8 A;  2BL1 A;  5D6F A;  1W7P D;  3WTU C;  2NSM A;  1XMA A;  1K7A A;  2W24 A;  1R49 A;  4HW0 A;  1ZG8 A;  4C30 A;  3DGV A;  1LAN A;  2HZT A;  1KQ9 A;  2KLO A;  1QBJ A;  3S1Q J;  1WVR A;  2F4O B;  3LOC A;  5K5O A;  3M3Y J;  4KS9 A;  2TDX A;  2EH3 A;  2QGU A;  3ML6 A;  4WJB A;  2ME0 A;  1ULY A;  2RB7 A;  2XB0 X;  1WI3 A;  2PMU A;  5CBM A;  3DEU A;  1GLN A;  3KP5 A;  4I98 B;  1D0Y A;  5DD8 A;  2O9L A;  1CP6 A;  1JXS A;  4PQA A;  2GBY A;  1GHE A;  4B5O A;  2VL8 A;  4UV8 A;  5D6E A;  1TKH A;  4D7N A;  4CGN A;  4E7H A;  3H9J A;  1AKH A;  4LMY A;  4DW6 A;  3S2H J;  3D5R C;  3GTP J;  4HNX B;  5KK1 A;  2Z16 A;  2VZZ A;  4KOV A;  2VXZ A;  2GA1 A;  3FXR A;  1ETV A;  2A5W A;  2PSW A;  4P4B A;  5EC4 A;  4FHT A;  4CYC A;  3WOD F;  3IO1 A;  1O3T A;  1FEX A;  1B9M A;  2EZL A;  3IL2 A;  4FUU A;  4P4E A;  2B5G A;  1BI1 A;  5JFR A;  1KZH A;  4ZX9 A;  4IQJ A;  4FCY A;  2XEF A;  2DK8 A;  3D7H A;  5AON A;  2DF5 A;  1RI7 A;  2F48 A;  2HOS A;  2ECB A;  1POG A;  1I5Z A;  3KE2 A;  1P4W A;  3CXS A;  2YNC A;  1ZRC A;  3PBB A;  1L0O C;  4MCQ A;  3OWT A;  5IV0 A;  1QZY A;  2IT0 A;  3OIO A;  4MMO A;  3LSR A;  4KSA A;  3OY9 A;  1Z5R A;  4L9J A;  2J8M A;  3CCJ I;  5DWN A;  2CV1 A;  3KZW A;  2WZN A;  3QOD A;  3OMY A;  1SD4 A;  3SFI A;  3ISP A;  1IUY A;  3KP3 A;  1X2N A;  3I4M J;  3BG3 A;  3K4K A;  2K40 A;  5L3E A;  1QPM A;  1Z05 A;  1MBJ A;  1WJE A;  4S04 A;  4CRY B;  1HF0 A;  2O5R A;  4KSF A;  1T2K A;  2O53 A;  4ZYE A;  4G7Z F;  2ZSI B;  2FBK A;  5J47 A;  3S2W A;  4XLP F;  3CO6 C;  3ISZ A;  3I59 B;  4BJT A;  4P45 A;  3ABL H;  2RAE A;  2XF7 A;  2FA5 A;  4OWR B;  3ECH A;  5EDN A;  2WWY A;  4OLL A;  2AFW A;  4DJL A;  2COM A;  2FEZ A;  2QWW A;  2LY9 A;  3FED A; 
#chains in the Genus database with same CATH homology
 4KIT B;  4PK4 A;  2I79 A;  5A27 A;  1KUV A;  4KJZ A;  1D1C A;  2LRE A;  4XNH B;  4HPQ A;  3D2P A;  2IGO A;  4XR6 A;  5HNF A;  2FS5 A;  4QB9 A;  3RYO A;  3T90 A;  4B5P A;  3F8K A;  1X1D A;  4LX9 A;  2Q7B A;  1S9H A;  1D1B A;  1TZL A;  2PC1 A;  3W6X A;  3NWS A;  1KUX A;  5G1Z A;  4AVB A;  4CYO A;  3LSG A;  4D9J A;  3SZG A;  3QYB A;  2GE3 A;  5CKT A;  4BE2 A;  3FNC A;  4X5K A;  4A2Z A;  3PNT A;  2VXD A;  2BW3 A;  2X6W A;  4KOW A;  3TOB A;  4Y4R A;  2LC2 A;  2B4D B;  1MW7 A;  4HNU A;  1J4J A;  5C82 A;  5KTD A;  1WJA A;  4Y49 B;  3QYF A;  4ITV A;  3S6H A;  4RLQ A;  2HVR A;  4CRZ B;  3G8W A;  3S3M A;  2F5I A;  2YNC C;  3EFA A;  4MFK A;  1T95 A;  4UA3 A;  4U9Z A;  4UFV A;  4XON A;  1V0C A;  4BDY A;  2D4P A;  1PU9 A;  3IAS 2;  2H5M A;  2R1I A;  4M3S A;  4QBJ A;  2M3A A;  4E6K G;  3RTR A;  4L89 A;  2V4J C;  5H84 A;  4HKF A;  5AG7 A;  4CAV A;  3OS2 A;  4II2 A;  2VKH A;  1Y6I A;  2DOA A;  4B3X A;  2X1D A;  4E7L A;  4XQF A;  2CMP A;  3M1C A;  2R7U A;  2RC4 A;  4BQO A;  2VKD A;  3MKY B;  4CCK A;  2OC6 A;  4BDZ A;  4ZJZ A;  5KNL A;  5FRM A;  5C88 A;  2Q2E B;  3DTE A;  1LRZ A;  3K4N A;  3BJ7 A;  3PL8 A;  1VHS A;  4J3G A;  1MND A;  2BVM A;  5G20 A;  2K9M A;  2G3A A;  3EPZ A;  1D0X A;  3VSL A;  3E0J B;  3A2K A;  1U0J A;  5AG5 A;  2A6T A;  1UEL B;  4CZC A;  4CA0 A;  4MY3 A;  3NWT A;  4CYP A;  4CH7 A;  3K70 D;  4Q38 A;  3BG7 A;  4F3Q A;  1V5E A;  2E1M B;  4XM3 A;  1P0H A;  1Z9U A;  3DNS A;  3TBI A;  1MJA A;  2OU2 A;  1G8X A;  3R9E A;  1X1C A;  3HKZ A;  1Y7R A;  4U87 A;  4KVM E;  3E1S A;  3FKJ A;  3U21 A;  1QU3 A;  4UCM A;  3W6S A;  4CGL A;  2FT0 A;  3UR3 C;  4P5O A;  2KCW A;  2FIW A;  2PMZ A;  2Q1Z B;  4MFQ A;  4XLH A;  4H4K C;  5JPH A;  1WJF A;  3CES A;  2V26 A;  1XE4 A;  2MC4 A;  3OR2 C;  3SYT A;  4KIS A;  3E0K A;  4BJ6 C;  1VKC A;  2ZW7 A;  1MMN A;  2FIA A;  2UUZ A;  1JI8 A;  4E7S A;  4XPD C;  3DQV C;  1J09 A;  2WPX A;  2OH1 A;  2DJI A;  4B10 A;  2FUG 2;  4IUS A;  2WBM A;  2R7W A;  5JHF A;  2R98 A;  3D5L A;  3PJR A;  4XOR A;  2ZXI A;  2CUZ A;  2O28 A;  4DBQ A;  5LD2 C;  2C27 A;  3UNG C;  3IU2 A;  5CNP A;  1QSM A;  3KYL A;  1WJC A;  1OR7 C;  2QKL B;  4KT6 A;  2PJR B;  3OYL A;  4H6U A;  2E5Z A;  4II3 A;  4A32 A;  4C7H A;  1Z4E A;  2J8N A;  4NC8 A;  4U9Y A;  3K6G A;  3L2Q A;  1G59 A;  2M4K A;  1Z7L A;  1SQH A;  4LG3 A;  4ZDO A;  2VZY A;  2OZU A;  1Y56 A;  1Q2C A;  2X7B A;  2VIX A;  1D0Z A;  3DU5 A;  4HG2 A;  4HSR A;  4B48 A;  4F52 A;  4E7K A;  2HQA A;  1Q2Y A;  3P2H A;  4R57 A;  4RMN A;  3DTK A;  2M7B A;  1WJD A;  3LFU A;  4MLO A;  3RPU D;  4XLE A;  4C2U A;  3N05 A;  3W2W A;  2HU9 A;  3FRM A;  2K3P A;  3GKR A;  2E60 A;  2QKM B;  2G0B A;  4KUA A;  1YX0 A;  4HNT A;  3K4C A;  1IID A;  1Y9K A;  2KPM A;  3H5R A;  1YK3 A;  1SFK A;  4PUS A;  2ZW4 A;  4C2Z A;  4HEA 2;  4MFZ A;  1QSR A;  4CAF A;  2ELJ A;  3HUG B;  3G2B A;  1S3Z A;  3AKZ A;  4CCJ A;  2J8R A;  1NG6 A;  3VWB A;  3OL3 A;  1NE9 A;  2K5T A;  1LVK A;  1QHH D;  4DIQ A;  4MI4 A;  4RI1 A;  3ZJ0 A;  2VJ4 A;  4E7Z A;  4FD6 A;  2JVH A;  2ZSH B;  4NNJ A;  2UV1 A;  3DTI A;  1KZF A;  2R7X A;  3LSK A;  1X4O A;  5AGE A;  2OZH A;  3IGR A;  2A4N A;  1MMA A;  4CYN A;  2VJ5 A;  4XN0 A;  3VDX A;  1I1D A;  2L9S A;  2EVN A;  2W82 A;  1NSL A;  3DEE A;  4B14 A;  3VYT B;  5KCM A;  4CCL A;  2M7A A;  1WWZ A;  2CY2 A;  5DWM A;  5CPR B;  3TT2 A;  4C2Y A;  1XEB A;  2Z0Z A;  2LYC A;  3BLN A;  2R7S A;  2PRB A;  1FMW A;  3PZJ A;  4EAT A;  2HDW A;  3GY9 A;  3VWE A;  2PR1 A;  2VQG A;  4KOR A;  2DCE A;  3EUK L;  4UFX A;  2FCK A;  1AA7 A;  3SEZ A;  3CMM A;  2R7V A;  3TTH A;  4OAD A;  3N7Z A;  4XKW A;  3FB3 A;  2MAB A;  3SXO A;  3TO9 A;  3LL7 A;  1B6B A;  4BS9 A;  1YE9 A;  2VBQ A;  1QST A;  4II9 A;  4KLV A;  3H9Q A;  2QEC A;  2B4D A;  3R9G A;  2V1N A;  2B4B A;  2WAF A;  1TIQ A;  4B43 A;  4B44 A;  1ERD A;  4UBR A;  2XDV A;  2ZXH A;  2VQL A;  4B12 A;  1S7F A;  1LKX A;  4ANJ A;  3R1K A;  3QOE A;  2KQR A;  4ZC3 A;  4N4N B;  2AE6 A;  2NMT A;  3OYA A;  3SXN A;  3NE7 A;  4PSW A;  2KL4 A;  2P6G A;  5CQE A;  2LBF B;  2HUZ A;  4CGP A;  1S7N A;  4AVA A;  4OAY A;  4JLY A;  4XKC A;  3OOU A;  2VPL A;  4I49 A;  2R7T A;  4NSQ A;  4A33 A;  2DXQ A;  3S8P A;  2IGK A;  4NC7 A;  4FAS D;  1YVK A;  4UWJ A;  4ZBG A;  5HLT A;  2AQE A;  3L2V A;  5F46 A;  2Z1D A;  3ZGK A;  2R7Q A;  1MJ9 A;  3KKW A;  4HNY B;  4R3L A;  1QSN A;  1MNE A;  1T0F C;  3OR1 C;  4MBU A;  4PJL A;  2Z3M A;  5HVQ C;  4U7B A;  5CQG A;  3GBG A;  3CP8 A;  2WY7 Q;  2Y0M A;  3SDB A;  2JDC A;  4BXF A;  3R95 A;  2LOO A;  3K70 C;  2IL4 A;  3B8G A;  3CF2 A;  2R8V A;  3OYC A;  2WAQ A;  3AL0 B;  4CGO A;  1W36 D;  1FY7 A;  4NQW B;  3MKZ A;  2Q04 A;  2JSP A;  5F49 A;  4KOX A;  1P4N A;  3VWD A;  3L2U A;  2B3U A;  4YEJ A;  2GOX B;  2HNH A;  4N4O B;  1DP3 A;  1S5K A;  4AVZ A;  2REE A;  4NXY A;  3D3S A;  2CUJ A;  5KTC A;  2Z3L A;  5GCN A;  3MKW B;  4BL0 B;  1PUA A;  3W2V A;  2BEI A;  2F6C A;  2W7N A;  2VI7 A;  3OYH A;  4IKF A;  4KVX A;  3LD2 A;  3FHN A;  2WPW A;  2FXF A;  1BO4 A;  4E2A A;  4R79 A;  4HRI A;  4XLC A;  3LOD A;  1WJ5 A;  3H5N A;  4MJ8 A;  2OUM A;  5AG4 A;  3OS1 A;  1UAA A;  4B13 A;  4FET A;  5KTA A;  4PFO A;  4XMY A;  2I00 A;  3OYJ A;  4BU2 A;  1Y9W A;  4QVT A;  2W4S A;  4BEH B;  5I0C A;  4CCO A;  4UCP A;  3L2R A;  2WAE A;  1R57 A;  1Z3Y A;  3OIP A;  1QHG A;  4DGW B;  2CS3 A;  2CV0 A;  2FE7 A;  2P6F A;  4XNF A;  4Y49 C;  1X1B A;  4DJA A;  2PJR A;  1L0C A;  3JVN A;  2VAS A;  3PSF A;  3OYG A;  2DXI A;  1DQU A;  1WK4 A;  3TO7 A;  4PJN A;  5HOO A;  2PQ8 A;  3VYS B;  2IGN A;  2BSW A;  2X6X A;  2B58 A;  4H89 A;  3DPT A;  3OIQ A;  3PUB A;  3J7A Y;  3DR8 A;  3EXN A;  5TGT A;  2Z11 A;  1S7L A;  3LSH A;  2Q4Y A;  4KOS A;  3HL2 A;  2LG4 A;  3OL4 A;  3F9K A;  5A28 A;  2GIV A;  4UCN A;  2ZW6 A;  2BVL A;  1X19 A;  3S3N A;  4YFJ A;  3OYI A;  2XSJ C;  4ONU A;  4PSX A;  3BCA A;  3CZ6 A;  4LUA A;  2ZXV A;  3TMO A;  4E4H A;  4NF1 A;  4R3K A;  3UY5 A;  1IYL A;  5FRO A;  4KVO E;  1CM0 A;  3OYN A;  1M4G A;  2IGM A;  2Q4V A;  2ZPA A;  3ZZI A;  1BR1 A;  1MMD A;  1LFP A;  5KHD A;  2Q0Y A;  3TO6 A;  2XC7 A;  3S32 A;  1WJB A;  3CXQ A;  4C2X A;  1UFH A;  2PR8 A;  3W91 A;  3A4C A;  3ZR8 X;  4X0G A;  4QUS A;  2G3T A;  4PFP A;  3JUW A;  2E1M C;  2OB0 A;  3A9L A;  4C2T A;  3H4Q A;  4FD5 A;  4R9M A;  3IAM 2;  2AJ6 A;  4PK3 A;  4BE1 A;  4BAC A;  3EUA A;  2HPI A;  5F47 A;  5HH1 A;  4JOM A;  4L8A A;  1ZO0 A;  1PJR A;  1SAU A;  2LRD A;  3M8J A;  1M44 A;  4U5Y A;  4NEX A;  2ZW5 A;  5ISV A;  1BOB A;  2JDD A;  1XMT A;  4F0X A;  3K9U A;  2DT7 B;  3VYU B;  4JXR A;  1EA3 A;  4H6Z A;  4JJX A;  4UWI A;  3RSN A;  4C68 A;  1N78 A;  2M4G A;  3EUH C;  2M0M A;  2Z10 A;  4Q36 A;  4NUB A;  4AB7 A;  3MD2 A;  4ORF A;  2Z3O A;  3S6F A;  4F93 B;  2JEV A;  3OWC A;  4GS4 A;  4AU7 A;  4ZYA A;  3ONQ A;  1KON A;  1OLT A;  2MYS A;  3KX2 A;  4BQN A;  3DSB A;  2WSA A;  4MFL A;  4E8O A;  4AG9 A;  2QIR A;  2QML A;  4A95 A;  4G6T B;  4MY0 A;  2X51 A;  3TCV A;  5E96 A;  4CAX A;  2CW7 A;  4CUG A;  3CXP A;  3FDY A;  3AFH A;  3FBU A;  2W1O A;  4JXQ A;  2MD0 A;  2IS4 A;  4MHD A;  2ATR A;  4YRV A;  2NOJ B;  3D5S C;  1IRX A;  3S3O A;  3C2G A;  2BUE A;  2LBF A;  4A31 A;  5JQ4 A;  3OYD A;  3FBI B;  2Z3N A;  2Z3K A;  4BBH A;  2YGW A;  3DWL E;  2R7R A;  2FSR A;  4MFJ A;  3WR7 A;  4BJ5 C;  2DT6 A;  3PNY A;  4QPO A;  4C9Y A;  4E7H A;  2XF6 A;  2V6E A;  5IX3 A;  4NCZ A;  3TE4 A;  2B5G B;  3JTK A;  3DR6 A;  1PYV A;  4BUP A;  4CAE A;  2X6Y A;  2R7H A;  2XF5 A;  3K4L A;  2KDO A;  4F55 A;  2BOL A;  3TOA A;  4ZTF A;  2VXK A;  4KLW A;  3DKX A;  3VSK A;  4OAZ A;  2RQQ A;  4MFP A;  4HST A;  3ZRG A;  2X1E A;  2WAD A;  1M4I A;  2FL4 A;  4ZGY B;  2HVQ A;  2KRC A;  4P1W A;  2R7O A;  4IZZ A;  1HA8 A;  1IIC A;  1LDK B;  3I9V 2;  1W36 C;  4M85 A;  3V42 A;  3SHP A;  5J8C A;  4CCM A;  3D8P A;  2P6E A;  2YNE A;  5FVJ A;  3R96 A;  2EUI A;  4CAW A;  2KMU A;  2VJJ A;  4F0Y A;  2PDO A;  2HZD A;  4Y3O A;  2DPT A;  3OYM A;  3FIX A;  4XLA A;  3DKY A;  4XOP A;  4CSW A;  2AQF A;  1YRE A;  2VQY A;  1NG7 A;  3A1Y A;  1Z4R A;  4RM3 A;  3L2W A;  2GAN A;  1YGH A;  2Q44 A;  2CH0 A;  4JQF A;  4E7J A;  3QYE A;  3BJ8 A;  3ZCO A;  1MK4 A;  2CNS A;  5IB0 A;  3F0A A;  3KEY A;  4K30 A;  2WY8 Q;  1QSO A;  2JVG A;  5EBV A;  4YRH A;  4RLF A;  2IS1 A;  2OV7 A;  1YX5 A;  5G22 A;  2VQH A;  4BEH A;  4XPL A;  5H86 A;  4IQ4 A;  3S6K A;  4KUB A;  4DNC A;  4LIV A;  4XNH C;  3OYF A;  2I8D A;  4R87 A;  2LH9 A;  3HOS A;  2LY2 A;  1I21 A;  3V8I A;  3OYK A;  4QPQ A;  3IU1 A;  2ZFU A;  4XN3 A;  4ZDL A;  2F4I A;  3G3S A;  3PGP A;  2V7F A;  4B5P B;  3IWE A;  4ZDP A;  2CNM A;  4DBR A;  3H0D A;  2VLA A;  2Y0S A;  3IUO A;  1DGR M;  2R4G A;  2K9L A;  2Z2S B;  1I12 A;  1K6Y A;  1IB1 E;  1Z3X A;  2JUG A;  3F5B A;  2REF A;  3QB8 A;  1E0E A;  1YX3 A;  1YLE A;  2HV2 A;  4JWP A;  3MMY B;  4J01 A;  4XPD B;  1YR0 A;  2W00 A;  3PSI A;  3DDD A;  2L2O A;  3OYE A;  1RO5 A;  3I3G A;  3CP2 A;  3LSM A;  4PJM A;  2BW3 B;  4J00 A;  3OS0 A;  1ZEL A;  4CGM A;  4DOZ A;  3TFY A;  2L5Q A;  4XLF A;  3S93 A;  4ZTJ A;  2KRH A;  2WA0 A;  1N71 A;  1RXT A;  3SEQ A;  3DPU A;  4D1Q A;  2UWM A;  3H35 A;  4Y33 A;  1NMT A;  4E7I A;  3H5Z A;  4CS0 B;  4BE0 A;  3I3L A;  4YGO A;  4PK2 A;  3LMM A;  2IXS A;  1YVO A;  3FYN A;  3TL4 X;  3W3C A;  2OZG A;  4QC6 A;  2E5N A;  1BR4 A;  3H5A A;  3S6G A;  1B87 A;  2KP6 A;  3I9S A;  2LY1 A;  4B47 A;  1DGW Y;  3BC8 A;  4OAE A;  1V5F A;  4A30 A;  3PP9 A;  4F91 B;  2HQY A;  3AL0 C;  3EY5 A;  4FD7 A;  3HPH A;  2CW8 A;  4RM2 A;  2BL1 A;  4EVY A;  3CJR B;  1N75 A;  4XPK A;  4IF5 A;  4CYQ A;  1XF8 A;  5BWA B;  4AG7 A;  5HMN A;  4LIU A;  3K10 A;  2VJI A;  4RS2 A;  4F92 B;  2CV2 A;  2ARH A;  4C30 A;  1D1A A;  3ZXS A;  2JA2 A;  2KLO A;  2X85 A;  4KS9 A;  2P0W A;  2D4O A;  3BCB A;  1MMG A;  1GLN A;  3VYR B;  1D0Y A;  3K4J A;  3LSI A;  1GHE A;  1MJB A;  2RRE A;  2V9K A;  1OZP A;  1X4P A;  4B5O A;  4XOT A;  2KHM A;  2VL8 A;  2L7K A;  1ON0 A;  2CXA A;  4KZT A;  1FMV A;  1R6R A;  2RNG A;  3DU6 A;  4XKB A;  3HOT A;  4CGN A;  3K4M A;  4UFW A;  5J8F A;  3H9J A;  3T9Y A;  2L9N A;  4YEL A;  1M4D A;  5F48 A;  4KOU A;  5LFA A;  2Z3P A;  3D5R C;  4GRI A;  3HC7 A;  4HNX B;  4PV6 A;  3CJQ B;  2Z16 A;  2VZZ A;  4KOV A;  2VXZ A;  5G21 A;  2WUU A;  4XKV A;  2A5W A;  2PSW A;  5EC4 A;  4BGD A;  3HG9 A;  4B11 A;  1X1A A;  2VB6 A;  3K4B A;  5HNH A;  3BLY A;  1UG0 A;  3PFY A;  2B5G A;  4BQQ A;  3GYA A;  3R9F A;  4IQJ A;  4FD4 A;  3DLA A;  3DPL C;  4JD6 A;  3CXS A;  3H9G A;  4XL9 A;  2X1C A;  1XIX A;  2YND A;  1V5G A;  1IYK A;  2YNC A;  3RQ4 A;  1Z21 A;  2VQC A;  2WB1 A;  3OWT A;  3P2F A;  5IV0 A;  3IP4 B;  3EC4 A;  2HVS A;  4KOY A;  1Q2D A;  1U6M A;  4IX7 A;  3PNV A;  4KSA A;  2XAU A;  3C2H A;  3HXL A;  3OY9 A;  5DWN A;  4AYB A;  1WFX A;  2J8M A;  2CV1 A;  4F6A A;  3QOD A;  3OMY A;  2HPM A;  1S60 A;  4AVC A;  4E0A A;  3BG6 A;  4BMH A;  2F5V A;  5FRN A;  2CNT A;  3K4K A;  4LIT A;  2JLM A;  4C7I A;  2IS6 A;  1WJE A;  3HPG A;  4CRY B;  2GOM A;  2IS2 A;  4HNW B;  1VZ0 A;  2K5C A;  2O5R A;  4KSF A;  3ZQQ A;  3RCO A;  3QAH A;  1KUY A;  2ZSI B;  1N77 A;  3W2A A;  3FXT A;  3EO4 A;  2CFO A;  1M1D A;  2VEZ A;  4CCN A;  3IWG A;  4KOT A;  2KZV A;  3MGD A;  1P9Q C;  2B3V A;  4BJT A;  3OYB A;  1S7K A;  1BR2 A;  3FBN B;  1TT0 A;  1CJW A;  2XF7 A;  4OWR B;  1K4J A;  3C26 A;  4OLL A;  2DPS A;  2MFZ A;  4PJJ A;  5AG6 A;  3D2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...