4PSXA

Crystal structure of histone acetyltransferase complex
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
313
structure length
313
Chain Sequence
KPETWTSSANEALRVSIVGENAVQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDSVTFKPYVNVKYSAKLGDDNIVDVEKKLLSFLPKDDVIVRDEAKWVDCFAEERKTHNLSDVFEKVSEYSLNGEEFVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLLNKKTKELIGFVTTYKYWHYLGAKSFDEDIDKKFRAKISQFLIFPPYQNKGHGSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKLGYDAVFQKHSDLSDEFLESSRKSLKLEERQFNRLVEMLLLLNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone acetyltransferase type B catalytic subunit
publication title Hat2p recognizes the histone H3 tail to specify the acetylation of the newly synthesized H3/H4 heterodimer by the Hat1p/Hat2p complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Histone/transferase
total genus 98
structure length 313
sequence length 313
chains with identical sequence D
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2014-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4psxA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4psxA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 4psxA01
4IF5A 2R7HA 3D2MA 2KCWA 4MHDA 2D4PA 3TOAA 2HV2A 3FBUA 1J4JA 3F5BA 4YGOA 4DNCA 3OWCA 1UFHA 1SQHA 1R57A 4UWJA 2JEVA 3UY5A 4H89A 2I79A 3EFAA 3EY5A 4AVAA 1RXTA 2G3TA 4KLWA 4U9YA 4YFJA 4EVYA 3BJ7A 1Z9UA 3V8IA 2ZPAA 3JVNA 5KTCA 3W6XA 1S60A 2OH1A 3RYOA 3TCVA 1B6BA 2R8VA 1K4JA 4ORFA 3S6GA 1TIQA 2HUZA 2PQ8A 1M1DA 4JD6A 1NMTA 1XEBA 4PK2A 4IUSA 4QUSA 2FL4A 4L89A 1QSTA 4NCZA 2J8RA 4QB9A 5DWNA 1IB1E 1IYKA 2B3VA 2P6EA 2VZYA 3R9FA 2FE7A 5F47A 1MJAA 4LX9A 2Z11A 3E0KA 4B5PB 1KUYA 3VWDA 3WR7A 3FXTA 4H6UA 3SHPA 4KVME 2CY2A 4RI1A 3LODA 5IX3A 2C27A 3EXNA 3CXQA 4KUAA 4KOSA 1S7FA 2CNMA 4MI4A 1YK3A 4OAEA 4KOWA 1XE4A 2OZUA 2P6GA 3NE7A 2Z10A 1I21A 2QECA 2PDOA 4CS0B 5F49A 4E2AA 4NXYA 2B3UA 2FIAA 3G3SA 2D4OA 2O28A 2Q4YA 5HMNA 3TOBA 2VXKA 5GCNA 4I49A 5FVJA 4R87A 4JXRA 4MY3A 1S7LA 1V0CA 2I00A 5CNPA 1M4GA 5F46A 3MGDA 4B5PA 4M85A 1Q2YA 5EC4A 2PC1A 5H86A 5HH1A 3VWEA 2FSRA 1VHSA 2R98A 2P0WA 2H5MA 5KTAA 4CAXA 3IWGA 1BO4A 4H6ZA 1M4DA 2G0BA 3KKWA 4RS2A 5J8FA 5C82A 4LUAA 1Y9KA 3TE4A 5H84A 1P0HA 3C26A 4XPKA 1QSNA 2Q4VA 1OZPA 1YLEA 4GS4A 3TO9A 5JPHA 2OZHA 1M4IA 3SXOA 2BEIA 1NE9A 2JLMA 3ZJ0A 3W6SA 2F5IA 4HNXB 2EVNA 2FIWA 2ARHA 2VEZA 2Z0ZA 3FRMA 2B4DB 2PR8A 2OZGA 2DXQA 2ZW6A 3TFYA 2GE3A 1KUXA 3I9SA 1S7KA 4HKFA 2VI7A 3GY9A 4AG7A 3SXNA 2FCKA 4HNYB 2FXFA 2AJ6A 2OU2A 4YRHA 4BMHA 2WPWA 4FD4A 1L0CA 3LD2A 4UWIA 2EUIA 2WPXA 1RO5A 4NF1A 4ZBGA 3W91A 4AVBA 3EO4A 3PGPA 4XNHB 1QSOA 2NMTA 5IB0A 4MY0A 2VZZA 3QB8A 1IIDA 3DNSA 2PR1A 3N7ZA 2G3AA 1YVKA 5DWMA 4FD6A 4CAVA 3F8KA 2CNTA 1XMTA 1YX0A 4XPLA 4R3KA 3S6HA 2AE6A 2X7BA 4ONUA 4JXQA 2A4NA 2B4DA 4U5YA 3FB3A 4JLYA 1KZFA 1MJ9A 3S6FA 4E0AA 5F48A 3B8GA 1GHEA 1I1DA 1YR0A 3QAHA 2ZW7A 1P4NA 1KUVA 2ZXVA 2JDDA 3TO7A 2BL1A 3F0AA 1B87A 3R1KA 1XIXA 4F0YA 2B5GB 2OB0A 2P6FA 5E96A 3T90A 4AG9A 3R9EA 2GANA 4QC6A 1MJBA 4AB7A 4X5KA 4NSQA 4J3GA 1N71A 1S3ZA 2BSWA 2RC4A 3R96A 4K30A 3I3GA 2Q04A 1QSMA 3D3SA 3DR6A 1ON0A 1I12A 1IYLA 1QSRA 3PZJA 4KOYA 2JDCA 2REFA 3TTHA 3BLNA 4PSXA 3DDDA 2HQYA 3FNCA 2PSWA 5KTDA 4UA3A 3GKRA 4XPDB 4Y49B 3JUWA 3S6KA 2BUEA 4KOTA 4CRZB 2IL4A 4HNWB 1Z4RA 1NSLA 2CNSA 4CAWA 4B5OA 4FD5A 4OLLA 5J8CA 3T9YA 2B5GA 4U9ZA 2R1IA 4JJXA 2ZW5A 4KVXA 2Q44A 4KVOE 3DR8A 3BJ8A 1Y7RA 1BOBA 4XNHC 3DSBA 4OADA 3D8PA 2FT0A 1Z4EA 2K5TA 3P2FA 4KLVA 4KOUA 4R3LA 1WK4A 1MK4A 4R57A 1YGHA 5IV0A 1FY7A 2ZW4A 2B58A 3IGRA 4NEXA 3D2PA 5JQ4A 1YREA 4II9A 4PSWA 3H4QA 1Y9WA 4FD7A 4JWPA 1M44A 2PRBA 1IICA 1YVOA 1U6MA 4AVCA 3CXPA 4M3SA 2FS5A 2Q0YA 3TO6A 2B4BA 1VKCA 3R95A 5EBVA 4E8OA 2GIVA 2J8NA 2VQYA 3GYAA 1WWZA 4MBUA 2Q7BA 4KORA 4UBRA 2J8MA 3K9UA 4KZTA 3R9GA 1Q2CA 4L8AA 2VBQA 3FIXA 4QBJA 3CXSA 5I0CA 1XF8A 3EC4A 3TT2A 1S5KA 4KOXA 1PU9A 4KOVA 2QMLA 5C88A 1S7NA 2ATRA 3G8WA 4CRYB 3P2HA 4PK3A 4PV6A 4KUBA 4MJ8A 1LRZA 4F6AA 1CM0A 1PUAA 2Y0MA 5ISVA 3FYNA 4QVTA 4R9MA 3ZZIA 1Q2DA 2QIRA 2REEA 1CJWA 4XPDC 4Y49C 3PP9A
chains in the Genus database with same CATH superfamily
1GVDA 4C2MJ 3S15J 4UWIA 2CQKA 2JK3A 3D2MA 2ZEFA 1E17A 2IPQX 4Y33A 4LLGF 1BIAA 1Y39A 4MHDA 4MNUA 4E7IA 5BPIA 1WJ5A 4I09A 4M3BA 3F5BA 1K4SA 4H4KC 4E7HA 1G2HA 4OC2A 3G1MA 4YGOA 5IP6A 2W7NA 3I4PA 2V6CA 2M3AA 3FKJA 3UY5A 1R43A 3ZN1A 4A2ZA 1X1CA 4CCLA 1YIOA 2HTJA 2CQQA 3QPSA 2XRLA 4U9YA 4YFJA 1Y8QB 5JFRA 3IWWA 4EVYA 2L4MA 2C6PA 4UY8I 3H9QA 4KSFA 2V1UA 2H94A 2K9MA 1ZYRF 1GV2A 1UZCA 2FJ1A 1ETVA 2GIZA 1ETQA 4MTEA 4HG2A 5G21A 3FX6A 4ZY0A 2GLOA 2FBHA 3V7ZA 5GAEJ 1S60A 2WAQA 2L0KA 2P7VB 1QMUA 2ZBKA 2OH1A 2QEXI 3S32A 3RYOA 1IXRC 2NS8A 3L2RA 1B6BA 1I1GA 1LKXA 2IVMA 1LCPA 1S3JA 1YFHA 2K9SA 3ZQGA 3J7YJ 3GTLJ 3H5NA 5FFZA 1TIQA 2X51A 2Y2ZA 1BI0A 2JPCA 1J0RA 2M8EA 1X4OA 1BL0A 3LMSA 2KFDA 1R1UA 2QKLB 1M1DA 5TISC 4BACA 1WPKA 3LSIA 4F3QA 2DK5A 3KR4A 3KEYA 3B3TA 2OZ6A 4XBFA 1YQEA 2FEZA 2HKXA 2ZENA 4Y17A 3F8BA 5JVTA 1H9TA 3JTKA 1A04A 4Z65A 1I39A 2WADA 4M3EA 1QSTA 2R5YB 1TWHJ 2NOGA 3IL2A 5DWNA 2L7MP 1IB1E 1YW8A 4F55A 4O5VA 2GM4A 2B3VA 2KJCA 2P6EA 3R0JA 1QO0D 3V38A 4V2GA 3CDLA 4HPSA 2B63J 3FMSA 1K78B 1HDPA 2FX0A 1VQOI 2ZEPA 3E0KA 2XKPA 1KUYA 2L01A 2W00A 2GOMA 2HDWA 3BR5A 4HSTA 5A2QK 2ZXIA 2ECCA 3Q9VA 4A3JJ 3ECHA 1WVRA 2HXIA 3F8NA 3SHPA 2EINH 2O4HA 4D1QA 1WGXA 2ADUA 5DD8A 1O4XA 2R7VA 1E3PA 2ACJA 1ETXA 4KFCA 4F9UA 1JTXA 4AIKA 1NG7A 4CUGA 4HA8A 3BZ6A 2WAEA 1N25A 1QQIA 4MEXF 2EJRA 2NS7A 1XSDA 1N77A 3CXQA 3PSIA 4MCRA 1BW5A 2F4MB 2G7HA 3G1LA 1JGGA 4P55A 4P96A 3OYDA 1TKJA 1P6RA 4KSIA 4OAEA 3L2WA 4L9JA 3I56I 1NK3P 3HOZJ 4KOWA 2LLKA 4WXHA 4JZ0A 3O6BB 3GFJA 1XE4A 3CMMA 3OS0A 2Z10A 4RGXA 1YRNA 5D6FA 3DCFA 4BQQA 4G7OF 3KP6A 2RV8A 2PDOA 2KQRA 2MW8A 3W6KB 4UF4A 5TGTA 5F49A 4G7HF 4N9HA 3K70D 2B3UA 3EUHA 3K7AJ 2DBBA 2HU9A 2FU4A 5K5OA 4ENNA 1M1EB 2PRQA 1Z3XA 3S3NA 2Q4YA 2Y0SA 2JA7J 3K4MA 1ZG9A 3D66A 3IEHA 2STTA 2PJ7A 2DLLA 2DA4A 1X2MA 2KIQA 3FHNA 4ZYGA 1VQKI 5FVJA 1SANA 3I59B 1K7AA 4MQVA 2GZWA 2DW4A 4F92B 5H2FC 4E6KG 1OCOH 2K9LA 2X1DA 5K8PA 4BHCA 1S8NA 3WTXC 3I55I 4WF2A 5FB2A 4U88A 4UUTA 2HYGD 4RLQA 3QP5A 3W2VA 4OC5A 3EQLF 2VBXA 4Y4RA 5HH1A 2R92J 1I6XA 1Q7LA 2Z33A 1YX3A 5IT9Z 1SAXA 2ETHA 1WH7A 1Q1HA 1ZN2A 1F43A 1XCBA 3ULQB 2NVXJ 3WC5A 1Z1DA 2BY3A 1BO4A 4BY1J 5TJJA 4PGGA 2CJJA 2GXAA 4UEFA 5C82A 4Q47A 1ZLJA 2WYRA 3DEUA 3TE4A 5HLIA 1T0FA 4BXUA 3GF2A 4TWEA 3VOEA 3WE3A 4XPKA 2Q1ZB 1W0UA 2KZVA 2MD0A 2R7ZJ 4RBOA 3TL4X 5F0FA 2E2JJ 5JPHA 2QBYA 2OZHA 4EQQA 1M4IA 2MG4A 4CCJA 3SXOA 1QHGA 1R5HA 3ZMZA 1MH4A 2Q8KA 1ITYA 1TT5B 2BEIA 2JLMA 2ZEOA 4UEEA 4LFUA 3ZPLA 1DU6A 1E0EA 3NH5A 3L2CA 4HNUA 1YW4A 2RFHA 3SI1A 4XK4A 1B8IB 2PR8A 1R9TJ 1FJLA 4KMUX 2OZGA 2RDPA 4LK1F 4EGYA 4IVNA 2RGVA 2B0LA 3EUHC 3I9SA 5D5VB 1F4KA 3FK6A 3I64A 4FE4A 5HDKA 1KWMA 2VI7A 3CCEI 5K8MA 3IU2A 3CUQC 3V8KA 4WWCA 1O3RA 6PAXA 4U0VA 2C6CA 2V8GA 2A5WA 3BJOA 4MFDA 2DCEA 1I5ZA 2OU2A 3P7NA 2QYOA 5EYRA 5IYBJ 2E1MC 1EH7A 2WB1A 4GXOA 1Z8XA 4FD4A 4KN4X 4U87A 3M4OJ 1UB9A 4NF1A 5D8LB 2ZSIB 3JRGA 3KYLA 5CBMA 4RAGA 2YR2A 4E7KA 1X3UA 3HOSA 1V4RA 3QB8A 4NC6A 1OKRA 4IHXA 1IIDA 2Z3KA 2EBJA 5DWMA 3JR9A 2X48A 4HSRA 1Y1WJ 2V4JC 4RB0A 2HTSA 1RNLA 1KQ9A 2EBIA 3H36A 4BEHB 2WTEA 1LANA 3E3VA 2CNTA 1R5GA 1T0FC 1ZELA 4M3GA 5HLHA 2ANPA 5ICGA 2DTZA 2FE3A 4DYCA 3GTMJ 2AE6A 1ARLA 3S6HA 3NQOA 2EFQA 3HSEA 3HEFA 3RQIA 4ENJA 3WU2C 4R8HA 2VODA 4ONUA 5LFAA 2WA0A 3A9LA 3CCQI 3N5FA 1MH3A 4I01A 2BOAA 4B10A 1ZG5A 2A4NA 2AFZA 3S2HJ 3FX3A 3G1OA 4BQOA 1LVKA 2Z2SB 4CYNA 2AHQA 2HZTA 3SDBA 5HVQC 2YU3A 1PUEE 3ZQLA 2K3FA 5ICCA 3D7HA 1MJ9A 2F2EA 2KDOA 2PEXA 3L00A 1K79A 1FYKA 2ELHA 4RB3C 1QZZA 4UB6C 2X9DA 3N97A 5B1BH 3H0DA 3WG7H 3FMQA 3JRBA 3FXRA 3E0JB 1KUVA 2VT2A 2Z5UA 4Y15A 3OIPA 2M7BA 1ON1A 3QOEA 4ZYEA 2NVUB 1B87A 1T98A 4BYYA 1CQTA 4RAZA 1XIXA 2HWVA 4UXNA 4F52A 4CGLA 2QJ8A 3BR3A 2Y9ZA 5J1RA 2KRCA 3GFIA 3CPAA 4AG9A 1MJBA 4AB7A 1XC5A 3B6CA 2VXDA 4EMEA 3D1NI 3M1EA 5EZGA 4NHJA 4A93J 3IRRA 1B9MA 1S3ZA 4AIDA 5K5QA 2PJBA 5DTDA 1DGRM 4LD5A 3FDYA 1MMNA 2BSWA 2XPUA 5L3GA 1ZQ3P 2DT6A 1TQPA 2L02A 1BI2A 4II2A 3TC8A 2Q04A 4JX5A 4A0XA 5BS6A 2AFMA 4MFKA 1I12A 3BCBA 2CO5A 4UFVA 1N75A 1FZPB 4C7HA 1VQ7I 4MHGA 1OYWA 3PZJA 1BR1A 1GXQA 2P4WA 1BLLE 2EILH 2V77A 4PSXA 2IGOA 2XAGA 4XLPF 5ICFA 2V1DA 4Z2YA 2L9RA 4LIVA 4BY7J 3RJPA 4EM2A 2KZGA 2O53A 3WTWC 3BJAA 5D4SA 2D2WA 4MXUA 2MBFA 4ZY1A 1ZG3A 1LUJB 3E6DA 3W2WA 5FKNA 2XV4S 4BS9A 4Y7NJ 2EK9A 2L2OA 3F8CA 2R7XA 5IT9K 4XPDB 3MZ8A 2CYYA 2OOTA 1BI3A 4RGRA 4KOTA 1VQLI 4O3MA 4CRZB 4DQ2A 1NSLA 1XMXA 1OMIA 1RESA 1F2PA 4B5OA 1BI1A 4B47A 1W36C 2UV1A 3U2RA 2ECBA 4A37A 2FVGA 2LBFA 2XRNA 1JT0A 4BXFA 2XEGA 3T9YA 2B5GA 4WWVA 4A69C 1FNOA 1S72I 3ISXA 5F6FA 4WXDA 2YNCA 2VQCA 5B1AH 1H9GA 1O57A 1RTQA 4ZZDA 3BR0A 1Y7RA 3TW7A 1X19A 2OQGA 3KZZA 3M07A 4MRIA 3WODF 1BOBA 4AU7A 4PXBA 3QPHA 1POGA 3S93A 3BLYA 3PQJA 3DSBA 1XSXA 4JX4A 2DN0A 2XAHA 2HVSA 4NFRA 3D8PA 4OADA 2DK8A 2NXNB 5J1UA 3BTLA 2RB7A 1ZRDA 2K5TA 3NWSA 4R3LA 3ABMH 1D1CA 1PJRA 1MK4A 5LYIA 3MD2A 5FFXA 4CYCA 5IV0A 3LNQA 2F4OB 4NGTA 4B4CA 3ZOBA 2DMQA 3B02A 4OIRF 3KGQA 2NS0A 3RPUA 1USTA 4HX8A 4PJNA 4LIUA 1W5SA 1XTAA 2AO9A 4N4OB 4PJMA 1YW7A 1F5TA 2ID3A 3MWMA 2IQ6A 3ONQA 4II9A 2MLGA 3HSFA 2XGDA 1M44A 3F6VA 2R5ZB 3RKQA 2PRBA 2IJLA 1X12A 1AYEA 3BQZA 1U6MA 4XRSA 1TTYA 3KP5A 2OUMA 5DCFA 4BL0B 2D5VA 1ETKA 2AQEA 2C6GA 1UHSA 2OF7A 1HC8A 2B4BA 3PJRA 4MFLA 3OOPA 4EJOA 2R7QA 1IZ1A 4TNUA 3HRUA 3ZMTA 2WSAA 2DFHA 2KMUA 4HX4A 2GIVA 2J8NA 1EH8A 3CC2I 4CAEA 3GYAA 2JEWA 3CMAI 4UCMA 2HDCA 5LHGA 5FKMA 4O23A 2BO9A 3IKTA 4CYOA 4A5MA 5DCMB 2CU7A 2K86A 1UAAA 3K9UA 2DT7B 4F0XA 3VODA 5FROA 4GYGA 1Q2CA 1FIAA 1XSVA 3CTAA 3K4JA 2QYVA 2VBQA 3FIXA 2WWYA 4L8AA 5GTHC 3K1PA 5FD5A 3PSFA 4A0ZA 5THWA 1LJ9A 4RB1A 3Q0WA 4KDPA 3FBNB 1BPMA 1ZK8A 2X85A 1RKWA 2KKOA 2Q51A 3O8GA 1S5KA 4OIWA 1R4NB 3BG9A 7CPAA 3NA6A 3N4MA 2MLKA 1X1AA 4XL9A 2BW3B 2QMLA 2MABA 3TDUC 4OWRB 3S9MA 3T5XA 3G8WA 2ZNYA 2YNEA 1J9IA 2M1BA 5GTIC 1IXSB 1P7JA 1HSJA 1ZKGA 1WI3A 1MGTA 1MD0A 4UNOA 4KUBA 2WAQN 2XDVA 1FOWA 1JHFA 2L7FP 1LRZA 1D8JA 4KIBA 1CM0A 1IN8A 1PUAA 3DBRB 1GV5A 4BKXA 3TEDA 4HF0A 3T8WA 3KP2A 5M5WJ 4G9YA 4FX0A 2EPFA 4MFQA 2QIRA 4D7NA 3S16J 1CJWA 2VJJA 1E3HA 4Y49C 2EB7A 3RQ4A 5M5XJ 3GB0A 3F9KA 2GA1A 3LSHA 1DDNA 1Y0UA 2HVRA 1XFOA 3D5LA 5GP9A 1I50J 4C3HJ 1ZLIA 2M30A 3CCLI 4A33A 3K1NA 5LRRA 2D4PA 1MBEA 2H8WA 2POKA 3FBUA 3IV5A 4V19K 3HUVA 2RVCA 4QSHA 4A38A 1BIBA 3KP7A 2LF7A 4XOTA 3OWCA 3SJMA 5GAHJ 4ONWA 1R57A 4UWJA 4ZZLA 3B3CA 2M9HA 3KFWX 3CJQB 4CDGA 4Y13A 1WJFA 4ZX8A 2I79A 3LWFA 4IX7A 3LSPA 1RXTA 4KLWA 3QYFA 3M1CA 2DO7A 2HC9A 1J5YA 1O3SA 1S7AA 4PFPA 3JTHA 2PVWA 3HPHA 1T56A 2E35A 2NOJB 5ED4A 1CX8A 3W6XA 2QSGX 1YW6A 4A3MJ 2ZOGA 1ETWA 2ZXHA 5JI6A 4A6DA 3BDDA 3UKGA 4NQWA 2XPWA 3BCAA 5IYCJ 1VQNI 5F0HA 4WCGA 2R8VA 3JRHA 2O7OA 4B48A 3KHZA 1K4JA 4ORFA 3AG1H 3SJGA 3OIQA 2HUZA 1WFXA 2OCEA 2L5QA 2P5KA 2LVSA 3D5SC 4M6VA 3ZP5A 4WK8F 2DA6A 4ITVA 3GTOJ 2IJZA 3IWEA 5HVHA 3DKWA 2MGQA 2IAIA 1XEBA 3GBGA 3GZ6A 3QP6A 1HKTA 2O8XA 2OAZA 2LOOA 2JZYA 3JTGA 2GLJA 2IGNA 2YX4A 4IUSA 2R7RA 2FNPA 3PFIA 2K85A 3ZRGA 5E3NA 4M3DA 2E34A 2FBIA 2LFBA 4PCQA 1J59A 3ZMVA 2Y0SN 2VZYA 2CMPA 3UR3C 2HS5A 4ON0A 1APLC 4LX9A 1RZ4A 3A01A 2CW7A 3IFEA 2LK2A 1U9OA 1YS6A 3KIOA 5F0CA 4B5PB 3VWDA 1R23A 3IJ3A 4JQFA 4NGSA 3S8PA 1B59A 3QYBA 2D45A 3ROUA 2W84A 1TW2A 3FXTA 5E1WA 4H6UA 1IO2A 4L5IA 1AWCA 4FISA 2EFWA 4KVME 5FO5A 4C2TA 5G20A 2A69F 2P81A 3K2AA 1P4AA 4A6EA 1EA3A 3BROA 4F7ZA 2C27A 1T6SA 4MGRA 3V42A 4FWUA 4LB6B 4IPAA 3I5UA 4CCOA 4EGZA 2H27A 4FUUA 2DMUA 4X2TA 4B1RA 1S7FA 1A5JA 4KOSA 3RPUD 3MKYB 2CNMA 2V9KA 3QODA 4IKFA 2VONA 5IP7J 5LEJA 1KQ8A 2V8HA 2TDXA 2RQPA 2QWWA 3CO7C 3AG3H 1CPXA 5KNLA 1USSA 4RM3A 4A2UA 2OZUA 2P6GA 1JKQC 5HS8A 2DDAA 1VF9A 2FA5A 2VL8A 1LDJA 5LLQA 4MHZA 1YJNI 4E2AA 1U0JA 1G6NA 2V26A 4D5FA 2HFHA 5M5YJ 4HAMA 2JTVA 3OYKA 3M8EA 1CBXA 4AVZA 2EQRA 1NH3A 2Z3MA 3GUXA 3TOBA 1GXPA 4CZCA 3JRCA 4IHSA 2LC2A 1Z7UA 3IAS2 3CCJI 2ISYA 5CJ9A 4CHUA 1EV7A 1FC3A 1FWZA 4QIWN 1OLTA 2PJ2A 4DYOA 3B6AA 1PUFB 4JXRA 2UXNA 2NYQA 1R3NA 4WX9A 3S17J 3I0TA 1G3WA 4XSZF 4EM0B 2VBZA 1M4GA 4M6YA 1R1VA 1FNNA 1D5YA 1W1WE 5HVFA 1U6GA 1BC8C 4AIJA 2PCUA 3PNYA 3SZPA 2CXAA 3HJEA 1I6HJ 5H86A 3RAMA 2KLOA 1H89C 2WY8Q 1GUUA 1RR7A 5AIQA 4U7BA 2F6CA 1TWGJ 1U9NA 2IT0A 1TXRA 2XEFA 2IS1A 3F8MA 4XN0A 4LMYA 4E4HA 2ZB9A 5L3FA 2H5MA 4Q48A 4F93B 1WJCA 3D7FA 1SFXA 4LG0B 1M4DA 2G0BA 4MQ9F 2NVYJ 5J8FA 1DQUA 3KZIC 4UB8C 3FIWA 2IGMA 1VI0A 2JJ7A 4P4BA 2EIKH 6CPAA 1BJZA 1R5ID 2E19A 5AG5A 4C30A 2PMZA 4ZDLA 4UFXA 1QSNA 4M6IA 1WKMA 2FXAA 3KYDB 3OV8A 1R71A 2DA7A 1HDUA 1YLEA 3DV8A 1A2ZA 1K61A 2DJIA 2Z3OA 2LRDA 3J81Z 1VFCA 4IQJA 1NE9A 3FZVA 1YQAA 3ZJ0A 1KYWA 4E7JA 1YI2I 3VSLA 4HNXB 2ZFUA 4L5EA 2W4SA 1BM9A 3LA7A 2XUBA 1LFUP 1MSFC 1T38A 3J80Z 1S5LC 1JI8A 2ARHA 2JA5J 1Q1VA 2VEZA 2Z0ZA 2ZEGA 3PB6X 5DEQA 3K4CA 1AKHA 3WC7A 2ZW6A 4EJVA 4C7IA 2EFPA 3H3VK 3TFYA 2GE3A 1WWXA 1KUXA 2BHYA 2H1LA 2O61A 2Q2EB 1BR2A 2XF7A 5AONA 2RAEA 4EFDA 1XD7A 2E71A 5ILSA 1JJ8C 1XGSA 3GY9A 4B09A 3P9IA 4AG7A 1P4WA 3BR6A 4B3AA 4LG3A 3S2DJ 1AMPA 1IU8A 2O5RA 1TW3A 4B12A 3KL9A 2MA3A 5DUIA 2VE9A 2P6SA 1D3YA 5JM6A 1OR7A 1G3SA 4OAZA 4A3BJ 4YRHA 4BMHA 5HODA 1I1SA 2WPWA 1W5TA 3H8FA 4S05A 4A32A 1BBYA 2DPUA 2MH2A 2AS5F 1ZH5A 4C3JJ 4ZBGA 5EG0B 1IRXA 3W91A 1S7EA 1YYVA 3OYEA 4L9NA 4FBEA 3EO4A 2UZKA 4I0BA 4LB5A 2V1NA 3GIUA 2EWBA 2NMTA 4ZGYB 3CDIA 5EZHA 4XRMA 3H0GJ 2DEAA 5CPRB 3QU6A 2VZZA 1RUNA 4ZY2A 3VYTB 2NNYA 2BV6A 4AXVA 2H1KA 1MSEC 1ZO0A 4JYKA 2HGCA 1GVJA 1RETA 2W25A 3EETA 3D68A 3DTEA 3KP4A 4KIFA 4FD6A 2DOEA 2Z1DA 4Q4ZF 1OQYA 3IO1A 4CAVA 1FBUA 2Z99A 3WG9A 4Q7AA 5LRJA 1XCVA 2DA3A 4XPLA 4DOZA 1AHDP 1X3ZB 4OU0A 3ERED 2OTJI 4R3KA 2BZTA 4PK4A 2Q43A 3VDXA 2Z3LA 3O8HA 2M4KA 3T8TA 4HW0A 1BOAA 4B13A 2L54A 3GTKJ 2OCCH 3KE2A 4Q36A 2PI0A 2LG4A 1LAPA 4CPAA 5HDNA 1LVAA 4UEZA 1ZR4A 4MO7A 2B4DA 4A95A 1Y0NA 3V7CA 2BHZA 4TV7A 3KZYA 3K1MA 4JLYA 1T08B 5IB9A 4OOIA 1HW5A 4AM3A 1IGNA 4PXEA 3C3WA 2YNDA 2I5UA 4E0AA 5D6EA 3FK7A 4DIQA 3B8GA 1BC7C 3SDGA 4IRGA 1YSJA 4KMFA 3E5UA 3BC8A 1P4NA 3R60A 4P5OA 3KQXA 3TO7A 1XJOA 2P5LC 4ZC3A 3PM1A 1A6IA 1OCCH 4BQAA 3CUQA 4UUSA 2JWTA 4A94A 4P4JA 1B9NA 4F0YA 2AXTC 1QPMA 1MMAA 2V9PA 3ABLH 1OR7C 2ZMEA 2P6FA 1X4PA 1NSAA 4BBHA 5E17F 3R9EA 1Z3YA 3MFKA 3CCMI 4FCYA 2IEKA 1ZRFA 2AFSA 3DP7A 2GANA 1R22A 3AL0C 4X5KA 1R36A 1SC7A 4NC8A 1FLIA 2CFOA 3E7LA 3VPRA 3HRSA 4NSQA 4J3GA 2DQRA 2EZKA 4I0AA 1SFOJ 4D5CA 1JKPC 3DKYA 2G9WA 4LJZF 5LYLA 1PCAA 2HI3A 3R96A 4K30A 3K4LA 1FMVA 3OL3A 4XONA 4AVPA 2NSMA 2L7ZA 3NARA 3FWEA 1KZHA 3GTPJ 1QSMA 3D3SA 3DR6A 4OIOF 3H3ZA 5CQEA 1IYLA 3HKZN 4XR6A 3R6SA 2VUMJ 1XMBA 2GAUA 3FM3A 4PUSA 1DE4C 5LBQA 3KETA 3VB2A 1VHOA 3C18A 4DZPA 1LB2A 2REFA 3CP8A 2EFOA 1OBRA 1QVTA 3QAYA 1TQIA 1M4LA 3DDDA 4CGMA 1U5TB 2DQLA 2HPIA 3FNCA 1ZGAA 2RQQA 2EK5A 5M3MJ 3C2GA 5IOZA 1REPC 4RGSA 1UG2A 3I9V2 5KTDA 5EJCA 3GKRA 3QOPA 2W24A 2K9QA 2K40A 3JUWA 2KDZA 1IW7F 3TW6A 2W1OA 1LE8B 3FEDA 3S6KA 4OIDA 2NYXA 1OCTC 2M87A 2I10A 1F36A 4HNWB 5GPCA 3LAPA 3CPXA 4CAWA 2XASA 4C9YA 4RM2A 3OMYA 5E1XA 3TQNA 5LD2C 2TCTA 5J8CA 4EWTA 3ZQFA 1DPRA 4UIBA 4AWXB 3CMEI 3SJXA 4CGZA 5CLSA 2H6CA 4D0PA 4U9ZA 4U0YA 3ASNH 1R4MB 2YSRA 2R1IA 3BY6A 5JGFA 2OTLI 4B11A 3PQKA 5LYFA 4K2EA 1XRYA 5E3LA 2FOWA 2Q44A 4OC1A 2VBWA 2OC6A 4UV9A 5EEAA 3J81K 3M8FA 1I3QJ 2ZMEC 1Z77A 3NEUA 1FX7A 2FQ4A 2JPBA 4XNHC 2DOFA 3G71I 3MAJA 4WJBA 2DT5A 4UFWA 3DPUA 5E8IA 4NGQA 1LOKA 4OMZA 3AG4H 3J80K 2KT0A 4IO9F 5KK1A 4E70A 3P2FA 4OINF 3EUKL 4YFKF 1JKRC 5AIPA 4OMYA 2Z3PA 3TP0A 2YX7A 1CF7A 4BNCA 4X6AJ 5K8OA 2L7KA 2LP0A 1ODDA 3GXOA 1YGHA 4A3DJ 5FLXZ 4RAFA 4A3FJ 3H9JA 1MBKA 2KIFA 1MIJA 1V5EA 2MD5A 3FBIB 3VEPA 5K7ZA 4ZYDA 2CV1A 3OYAA 3QQAA 1EF4A 3NH4A 2XVCA 2N8GA 3WGIA 1WJAA 1VQ8I 1LAMA 5KAIC 1MMDA 5L3DA 2ABZA 3R4KA 1JUPA 2PJRA 1Y9WA 1XG1A 3ISPA 2VJIA 4OP4A 3BR2A 3MN8A 1YVOA 3BT9A 2A6TA 3S3OA 4G1PA 2CUEA 1IG7A 1XB4A 4KN7X 4Y3OA 2EV6A 1YMEA 2V79A 3HOYJ 2ZKZA 1KQ0A 1ONVA 1QQ9A 2Q0YA 3U1KA 3U1DA 2IA2A 2GXBA 2BGCA 2RREA 1VKCA 3R95A 2K4JA 4LLNA 2HKOA 5AGEA 4E8OA 1OYYA 1IRFA 2VQYA 4CYQA 2COBA 4HBLA 4ABZA 4MBUA 1JJ6C 4KORA 3ZGKA 1SD5A 3JRDA 4YG2F 2J8MA 2TRTA 3QPTA 1ZREA 5KVRA 3K2KA 4BINA 3GZ5A 1X1PA 1IV8A 4XMYA 4X0GA 4HOBA 2BY1A 4BU2A 3MZHA 1SFUA 2VPLA 5I4MA 4II3A 1Z05A 3F22A 4QBJA 1MDMA 1UMQA 3CXSA 1SMYF 2A3SA 3MVPA 5LGTA 3EC4A 2IS6A 2ZJRF 3DTIA 2A61A 2EK8A 1SD7A 4PXDA 2ZC2A 2R7UA 4KOXA 4G6QA 1KU3A 4EJTA 4O6JA 5EGOA 4GFBA 3DEEA 1TWAJ 2RKHA 2QA4I 4A31A 1XPXA 1IC8A 1XBUA 2BXYA 3HGGA 4KITB 4XKVA 5D4RA 1MNMC 2AFXA 4KOVA 1JXSA 1HDDC 4MMOA 4A3LJ 2CW0F 2WC2A 5IT3A 1S7NA 4L0YB 2B9SA 3DXJF 3L2UA 3M8JA 2ZEHA 4EEFG 4PK3A 4PV6A 4DJAA 2FUG2 3K0LA 2KP6A 2ZEEA 2HB6A 5BPDA 1QHHD 2E1CA 1SAUA 1MMSA 1Y8RB 1PP7U 3OYFA 3ZN0A 3BR1A 1ETYA 4R1HA 2E60A 4HPQA 4HZFA 1Q2DA 1XS9A 1GDTA 4LK0F 4YIRX 1Z2LA 3HXLA 3MZYA 5DYMA 2EIJH 3HGYA 3OYHA 2JBJA 4YU9A 5F64A 2E1OA 2R7HA 2RNJA 1T2KA 4A3KJ 1W7PA 3O2PE 2KCWA 3AG2H 1ZLHA 2HVQA 1SVLA 3TOAA 3R61A 2IRFG 2HV2A 1J4JA 2R93J 4HRIA 3WC6A 1FP1D 1W4MA 4DNCA 2DPSA 3A0BC 3OYGA 1SQHA 3CF2A 4PGHA 1FTZA 3BTJA 4QTRA 3TDZC 1NG6A 3IH3A 5M3FJ 3OR1C 4ZTJA 5CVRA 3LSMA 3EFAA 4BD9A 2A07F 3CC7I 2PJ9A 3D7GA 3JSPA 2G3TA 4MFPA 4AVAA 4XN3A 1PYVA 2GOXB 3DPLC 3BJ7A 4XLHA 2P8TA 3Q5FA 2ZNZA 2PJ8A 3V8IA 1G3YA 3H9GA 3OYBA 4PPZA 4MIMA 3HOWJ 1ACIA 1P92A 3JVNA 5KTCA 4L18B 1TNSA 2Z3NA 2M45A 3F6OA 2Y9YA 5JLXA 3TCVA 3EYYA 4FASD 1Y0RA 1X2NA 3SEZA 5D8KB 4AC0A 4ANJA 1MBGA 5L3EA 4MEYF 2PQ8A 5E8GA 2XB5A 5IPAA 3WE2A 1SFKA 2JMWA 2UUZA 1NMTA 3D67A 2BEOA 3ABKH 3CCUI 2VOPA 2PJ1A 3CLOA 4ESFA 1RC9A 3T8RA 3OYIA 4FAIA 1C0WA 3FM5A 4PK2A 2RN7A 1JHHA 3WABA 5BQTA 1TKHA 4QUSA 2FL4A 3B3VA 2QSFX 1ZGWA 1TQMA 4P1WA 4DYRA 4IF4A 4GO1A 5HS9A 2MSYA 2WBMA 4RGUA 3JRIA 3CC4I 1IYKA 4C2ZA 2HEOA 2Z16A 3R9FA 1ON2A 3BPXA 3RYRA 2F5FA 2FE7A 5F47A 4BH9A 3HOVJ 1WRJA 2V8DA 1U3EM 1R6RA 2E1MB 4N9IA 1SVOA 4RMNA 5DUKA 3DLAA 4EJWA 1PDNC 4XLAA 1SMTA 3KLNA 3KASA 3BJ6A 4I98B 2O03A 3LFKA 5FLXK 2ZXWH 2VB6A 5JHUA 3PUFA 1PYTB 1MKMA 4HNVA 3WTZA 3KLOA 2NAZA 3RSNA 3K6GA 2XSDC 4P6YA 4I2OA 2H09A 2F8HA 2AFWA 4P4IA 3E5QA 5DDGA 4P44A 1MMGA 4CCKA 2DDBA 2GWRA 4MHNA 3GTJJ 2PFBA 2ZEMA 4C2XA 1Z67A 4IZZA 4CXFA 5F1RA 1VIXA 3ML6A 4KUAA 3K9TA 3LSJA 5HLTA 4MI4A 3GTQJ 2X6YA 4X8IA 3EDPA 1N78A 1FEXA 1R00A 2WV0A 1Y56A 1BN5A 3DEWA 2ZSHB 4YIFA 3OYMA 4OC3A 2R7SA 2QUFA 4KICA 3ISZA 4G12A 2VC0A 2M2EA 3GW2A 4I76A 2QBYB 3PBBA 5F09A 5ERIA 3NE7A 5D8NA 4P4DA 1FSEA 1I21A 2QECA 2OD5A 4I6ZA 4LITA 4OC0A 3ZQCA 1DTDA 1LPQA 4B8XA 4NXYA 2QVOA 3FXKA 3I71A 2FIAA 4BBSJ 3H1CA 4IXAA 1P9QC 2D4OA 1FSHA 2FF4A 4M73A 4P4EA 3IIBA 2R5YA 2K4BA 1SD6A 2Y69H 3PNTA 2CW8A 2HXOA 5C4XJ 4R87A 1EJ9A 1Z0XA 1YIJI 1UJ8A 3LL7A 1S7LA 3REOA 3LQRA 1V0CA 4IRIA 1W36D 1UG0A 2HR3A 2XIGA 1K78A 3IU1A 4PFOA 5F46A 3PB9X 5JR3A 3FF5A 3HOTA 4IOCF 2ZJQF 3B3WA 1Q2YA 4MFEA 1DP3A 3FXJA 2X1CA 2XHKA 4A39A 1O3QA 1X3WB 3DWLE 1K4TA 2EH3A 5F08A 1MNDA 3F23A 3GLLA 5C3EJ 5GAGJ 4BQNA 4E7SA 2FSRA 3VWEA 1HSTA 1UCRA 2HQRA 2HZDA 2LDUA 1VHSA 1VQPI 2CQXA 3HRTA 3FHZA 2O9LA 2VL1A 2P0WA 4BDZA 1NK2P 4CAXA 4XLCA 3K69A 1W5CC 2G7UA 2JRTA 2P6TA 1KU7A 2HDDA 3DBLB 1I3AA 1ETOA 3S2WA 2BCOA 4LUAA 1Y9KA 1KYZA 1BW6A 4IAVA 4OKOA 4I7HA 3FMRA 2OR4A 5H84A 2EV0A 3L09A 2LKSA 1JWQA 1P0HA 3G73A 3GLJA 3N05A 1TNTA 3P9CA 2FQ3A 4B44A 4NUBA 2Q4VA 3OWTA 2LY9A 3IWZA 1OZPA 3HTUA 4ZH4F 4C68A 3TO9A 3OL4A 1IOFA 4GYIA 4IL6C 4FT8A 1IRZA 1K83J 5J4VA 2F5IA 2A6HF 4NJQA 3FH4A 4M9ZA 1K6OA 3DGVA 3PFEA 2QKMB 2GBYA 5FRMA 3KPHA 1JKOC 2FIWA 3HTSB 1WZ2A 2R7TA 1HF0A 4BE1A 1XDSA 2P7CB 3FRMA 3NWTA 2GFQA 2NRAC 3IHUA 1F9NA 4CGOA 3P9KA 3SI0A 2X1EA 3FVLA 2DTRA 1WH5A 1VGYA 1Y6IA 3I59A 4E7ZA 2EFNA 1BPNA 5J47A 3OYNA 2O8KA 2FCKA 3DTKA 1VQ4I 3BZCA 1QA6A 3F0CA 2ZFWA 5CVIA 3PO2J 4LLLA 2FXFA 4HNYB 2PBIA 3QRFF 2AJ6A 1G3TA 2VKVA 4I02A 4BDYA 4A3IJ 3IRQA 1ULYA 1WHUA 1O3TA 1YTYA 4U0WA 1L0CA 4XKCA 3H3UA 2EUIA 3LD2A 3E6BA 2K3PA 2CV2A 3K2ZA 3AFHA 3BG6A 1RO5A 1ZG8A 2BYVE 4C2YA 4AVBA 2MC4A 3W6JB 3PGPA 1VQ5I 2LNBA 3S3MA 2QQAA 5DS9A 3V7SA 1H8LA 1TKFA 5IB0A 2LD5A 4XSXF 4XOPA 4BAYA 2BY2A 4A0YA 2F4IA 5HVGA 3DNSA 3OR2C 1HDQA 2PLYA 2PR1A 2FRHA 3H5RA 1YG2A 2OA4A 3A02A 1YVKA 2B7EA 3I3LA 2XEJA 3M9AA 2XB0X 5C4JJ 3E6MA 4NB5A 3BQYA 3WU0A 5LYDA 4CO8A 3F8KA 2DFIA 2IS4A 1YX0A 3NAUA 2EZHA 2XAUA 2QVPA 3ZCOA 3HUGB 2X7BA 2QM3A 3UNGC 1HA8A 2XGXA 3LMMA 4PZJA 3B3SA 1B72B 4JXQA 4NGMA 1TF9A 5LRGA 2I3CA 1B8IA 5FGMA 4XKWA 4A3EJ 4XNFA 4DBRA 1ZGJA 4KJZA 3L2QA 3I53A 1LEAA 3SZGA 3S6FA 4BJ6C 4UV8A 4CH7A 1KA8A 2E36A 1RKTA 2VI6A 3NRVA 4HYEA 4IHWA 3B73A 3ZR8X 3J7AY 3S14J 3I4NJ 4M71A 4KIGA 1I1DA 1YR0A 2LY1A 3RO0A 4B43A 2ZXVA 3DFGA 2JDDA 1FBQA 3I1UA 3HSRA 3OSGA 2M34A 5K7FA 2QLZA 3JRAA 3CF5F 2EO8A 3F0AA 4G6TB 2JQ7A 3SEQA 3SYTA 2YNCC 2LBFB 3R1KA 5J1YA 1YO5C 5JHFA 2CGPA 2B5GB 3FXLA 4EJUA 3IC1A 3MRUA 5K7HA 9ANTA 5E96A 1IDZA 1UFMA 1B1BA 2W48A 4XRSG 3KEQA 3SJEA 2H6BA 2HYFA 1V5FA 4QC6A 2FOKA 4YIIA 1UELB 4DJLA 1UHMA 3LA3A 4E7LA 1T39A 4ESJA 4ZYAA 1N71A 2DI3A 5J1QA 2Y31A 2LKPA 1TWFJ 4GCVA 4ETSA 3OS2A 2RC4A 4HF1A 4X3RA 4OIPF 3RIRA 2IS2A 1WJEA 4P9UA 4ESBA 3QWLA 3V8LA 4BEHA 5DS0A 3IH2A 2QGUA 2AQFA 2WB1N 3W3CA 4XLFA 4AYBA 3VYSB 2C1CA 3IWFA 3CCSI 4CYCB 1QSRA 3RKXA 4KSAA 2CTCA 3GEZA 4WXCA 4FX4A 4KOYA 1FOXA 2F5DA 1B4AA 4CAFA 2DU9A 2X4HA 3PB4X 1WJDA 2XC7A 2KRFA 3H35A 2VLAA 3BLNA 1A36A 3W2AA 4NDLA 3ZQHA 4PJ0C 3K70C 1J75A 2ME0A 5CVUA 4F91B 2VKDA 3MKLA 2DF5A 2Y30A 1RI7A 2VKEA 3NFZA 5BNGA 2PSWA 5A28A 1H88C 4UA3A 5L3CA 4Y49B 5CPAA 4MHYA 1WCMJ 2F5EA 2GU2A 2FBKA 3K10A 2HNHA 4IOAF 1FT9A 2IL4A 5ELYA 3V4GA 1Z4RA 2CNSA 3FEEA 1BAVA 3PEIA 3O3KA 2VQLA 3OYLA 3ZMSA 4HF2A 2V1XA 4FD5A 2O0YA 4L9TA 4OLLA 3RZAA 2JSCA 5IY5H 4CA0A 1LDDA 1P4XA 4RA2A 3PIPF 2BOLA 3CDHA 3E1SA 2CUJA 2ELJA 1LDKB 3PFYA 2ZW5A 4JJXA 2K02A 4KVXA 2QF7A 2FNAA 1R58A 2DODA 2ID6A 1JTYA 4FQGA 3S1RJ 4H0EA 3BJ8A 3HIFA 2AFOA 1Y0YA 1Z6RA 2LREA 3TMOA 2DXIA 2OQRA 2DFEA 4MLOA 2Q0OA 3J7ZI 4IQ4A 2PVVA 3BTIA 2FT0A 2CUZA 3WTUC 4QWQA 4BE0A 3PUBA 1IOIA 4KLVA 1R1TA 2CSOA 2VIXA 2PG4A 4Z6YA 4B14A 4R57A 2AXLA 1FY7A 3MQ0A 3RKYA 3T1BA 3ZXSA 4NNJA 4EV0A 4EM1A 3CQZJ 4XIDA 5IYDJ 3IGRA 2JVGA 3SI2A 3Q9SA 4MFJA 4HDVA 3PL8A 2JA8J 3D2PA 3FF3A 5EMIA 4M3FA 3RDIA 5FLMJ 5LRSA 2PIZA 1TLHB 4PSWA 2PJ5A 3H4QA 1U8BA 2VT3A 3CESA 3OSFA 3KZWA 2Y48A 2K7LA 2OV7A 1IGBA 3LWUA 3GLXA 3VARA 1VHEA 4AVCA 3CXPA 4ZX9A 5ILUA 2R3SA 3DLLF 5LRKA 3WU1B 3JW4A 1SEUA 1JUMA 1VTNC 4YRVA 2F48A 3U21A 2ZEDA 3IP4B 3ABUA 2HOAA 4S04A 1E3OC 5EBVA 4BGDA 4M72A 4PXCA 5KAFC 2M4GA 2JBKA 1YW9A 3EUAA 3PFOA 1FMWA 2CUFA 4FETA 3H5ZA 1ELLP 2UWMA 4UBRA 3L1PA 2F7VA 4KZTA 2HPMA 3AAFA 1TF8A 4RB2C 3IUOA 4R76A 3E6CC 2HOTA 3KI9A 2M0CA 3QNVA 4F8ZA 5I0CA 3FKIJ 3S1NJ 4JYWA 3TT2A 4OC4A 1Y1VJ 1TT0A 3CZ6A 4YFXF 1PU9A 3OY9A 2LF8A 2XGCA 1FTTA 2KJBA 3BG7A 1OCZH 1U2WA 2ME6A 1D1BA 1XMKA 1V5GA 3FXQA 4G6DA 5E20A 1AUGA 4CRYB 2CG4A 4NQWB 1Z9CA 3KHXA 1HKSA 3RKWA 4MCSA 1QU3A 3EPZA 4MJ8A 4UCNA 2I8DA 3A03A 1RR8C 4NGRA 2HYJA 2VE8A 5J6XA 1OISA 1DP7P 1FPQA 4CCMA 4A3GJ 2LYCA 2Y0MA 3LSKA 2R5ZA 3WHBA 1QZYA 5ICEA 1IJWC 5ISVA 3GVAA 1P7IA 3CMYA 2A05A 2GLFA 1Y7EA 1FBSA 1L0OC 4XPDC 5K8NA 3WGHA 2DPTA 1IUYA 2QZ8A 2K9NA 5E1ZB 4C2UA 2PJ4A 5LHIA 2E5ZA 3KYCB 4IF5A 3QPLA 1O7FA 4FTHA 4D7MA 5K5RA 3G6EI 2LR8A 5FRNA 3KQZA 2ELKA 2DA1A 2VASA 1PP8F 5HNHA 2M5WA 3V8JA 3WGGA 3X2QH 4RUHA 4CZZA 1HQCA 4JOMA 3A01B 4XLNF 5FKOA 4MHPA 5DCMA 2DA2A 1MW7A 1YS7A 2E7XA 2JA2A 2JVHA 2VKHA 4QLCU 1UFHA 5DD4A 4HV5A 4LOCA 2JEVA 4UUVA 5FD6A 4ENKA 2ODFA 2XAFA 1ZARA 1RIOH 1S9HA 2LMDA 4H89A 1IV6A 2ZO4A 3EY5A 2CIJA 3CP2A 2YPRA 2IA1A 2VQHA 4GGGA 2AFUA 2DMPA 2R7FA 1Z9UA 2PJ3A 1VQMI 4EATA 3OYJA 2ZPAA 4LQGA 4NGPA 2R0QC 5A27A 2ISZA 2BW3A 4IHYA 4KA4A 4P4FA 4DBQA 3SZTA 3HBLA 1HXDA 2XEIA 3H92A 3PB8X 3RI4A 4M9XA 3OYCA 1FT7A 3G2BA 4M74A 2KHMA 3JAMZ 3TBIA 3S6GA 5KCMA 1MBJA 1SFEA 1MNEA 3B35A 3K4KA 3BXMA 4JD6A 4M6XA 2XAQA 3SFIA 2BY0A 4BJTA 1DGWY 4AD9A 4AUXA 5FJ8J 1Z8LA 4L89A 4NCZA 4A30A 1S6LA 1SVMA 2J8RA 3LA2A 2ESNA 4QB9A 2Z3YA 3FXUA 5HS7A 1FOKA 1QRYA 2GREA 4HQEA 2XF5A 3JSOA 1EH6A 1HKQA 1MJAA 3TX8A 2KIMA 4HQMA 5J3LA 1A31A 2R7DA 2Z11A 1KU9A 3RCOA 3ASOH 3BG5A 4LGWA 2FSWA 2L3DA 3HHHA 1WQ2A 2M0MA 3VH9A 3WR7A 3B7IA 3BPVA 5GADJ 1IF1A 2LTPA 3HZJA 2O6GE 4Y52J 1UWYA 1TWCJ 1J7KA 2V8VA 2VQGA 1L3LA 3RNZA 2CY2A 1J2XA 3DU6A 4W9YA 4RI1A 2QENA 3LODA 2QQBA 2HQ5A 4XLEA 1ZG7A 4P45A 2JT1A 3I58A 3FJUA 5IX3A 2DMTA 2UXXA 2CTBA 3EXNA 4OMEA 1Z21A 5J4YA 1QGPA 1RPWA 1V54H 2D1VA 3HC7A 5CYVA 4BJ5C 5F1JA 4UIAA 3IC7A 5GPAA 2GA2A 4L9VA 2ZJ2A 4L0ZB 1H8AC 2XSJC 4IK2A 3BWGA 3L7WA 3HG9A 5H6QA 1YK3A 2G9DA 4Q38A 2EWNA 3GFMA 3BG3A 2CFXA 3CO6C 2G0EA 3WTTC 5CQGA 3LQQA 4W1UA 3I54A 2WUUA 4J19A 2YU9J 1KONA 1QVUA 4V2FA 4B3XA 3WTSC 2VOOA 1Z5RA 3SJFA 4CS0B 1O7LA 1ARMA 4ZYHA 4G7ZF 4XKBA 3TGNA 3G3SA 2O28A 2DMNA 5DV5A 5E18F 5HMNA 1IN5A 1AKHB 2VXKA 3CZXA 4DUKA 1HW2A 5GCNA 2R4GA 4I49A 1IDYA 2JSPA 3SXYA 1HEEA 2O3FA 3HPGA 4D9JA 2IW5A 3F72A 1CGPA 3JRUA 3CJTB 3CLQA 4MY3A 4L5JA 2JUCA 2QQ9A 2M7AA 2NNNA 3JCUC 3LACA 4LQ6A 1YJ9I 2EA4A 2I00A 3F3XA 1ZAOA 5CNPA 8CPAA 2GQQA 3OIOA 4OIQF 3MGDA 4B5PA 4M85A 2ZELA 2NVTJ 2XKOA 2MC3A 4C3IJ 5EC4A 5LGNA 1S7OA 4MTDA 2PC1A 2KPMA 1YX5A 2R7OA 1STZA 3VFZA 4HLYA 3TP3A 2PE3A 4UVBA 3SFZA 3AL0B 3H5AA 2R98A 1YHQI 3FISA 5DM6F 2XAJA 1HW1A 4PJJA 2WZNA 5KTAA 3ZMUA 3IWGA 4M9SA 4H2KA 3KR5A 3HUGA 4H6ZA 3KKWA 2A6EF 2PJAA 1LFWA 4P9FA 1D1AA 4RS2A 5ILVA 1JGSA 3OS1A 3LOCA 3DPTA 1EKEA 4KUMA 2CH0A 4FHTA 1B72A 5JH9A 1WJBA 3DQVC 5F04A 3S9NA 3C26A 2L9VA 2VJ4A 3D4UA 4KT6A 1F1ZA 3G3ZA 4CICA 3JRFA 4J01A 4GS4A 1NTCA 3MKWB 4XQFA 1XX5A 5LEKA 2CV0A 3W6SA 3D0SA 5EEGA 3Q0VA 4NGNA 3FXMA 2EVNA 2NVQJ 2PN6A 1IN7A 1XDUA 5AG6A 2HOEA 3LSRA 4DZJA 3CCRI 3ESWB 5E3OA 3Q3SA 4QPQA 2B4DB 2COMA 2X6WA 1R49A 2DXQA 1OJLA 3CJRB 2PJ6A 1LEBA 4A5NA 3KCCA 2CF4A 3ERMA 2IMOA 1S7KA 3E5XA 4XORA 4HKFA 1YRNB 5J40A 2OJED 1PUFA 2CWEA 1TC3C 5KHDA 1RRJA 2W85A 1YLOA 1JE8A 3SXNA 4N0BA 4CSWA 3BZKA 3RPQA 2D1HA 2PJCA 2V6EA 1LFBA 2J5OA 2DPDA 1DPUA 2XGEA 1OYIA 2ZJPF 2QQ8A 5BOXA 2Z9OA 3H8GA 2JUGA 2DYRH 1JT6A 1OCPA 1VZ0A 2VN2A 1G8XA 2W57A 3CUQB 4ZDPA 3M7GA 4UUSB 1IAWA 4KYWA 2WPXA 2E5NA 3HKZA 1TZLA 4IRHA 2E2HJ 2ZMEB 3V7RA 1CPSA 2C6YA 1F57A 4XNHB 4ZYQA 1QSOA 4A12A 1U8RA 1ZG1A 1Z6TA 3JAMK 1LFPA 1FYLA 4MY0A 1X58A 3C2HA 2IP2A 1T33A 4RAYA 3MCZA 4LG0A 2XROA 5AG4A 1IN4A 2DA5A 1CG2A 2G3AA 1NHAA 3N7ZA 5B5EC 4ZDOA 3NE8A 2V7FA 4XRFA 4PQAA 3KEOA 2J9AA 2HQAA 4UCPA 2EZLA 5C44J 4BBRJ 5E3MA 2BVLA 1XMTA 1ORKA 1JUSA 5B66C 3GWZA 5F27A 3CCYA 2JRMA 4R8FA 1D0ZA 1XOVA 3D5RC 2YUSA 1AU7A 3A4CA 1FOYA 5CVJA 2MYSA 3W6VA 2A5YB 3VSKA 3RYPA 2JA6J 5EDNA 4IHMA 4BUPA 5D5WB 3RBUA 5D5UB 4HDUA 4F9VA 3MMYB 2L9NA 4AYBN 2M8GX 4A3CJ 1AOYA 5TRDA 3MEXA 1K6YA 3R0AA 1WI9A 1H0MA 1UHWA 1X1DA 4U5YA 3FB3A 3CCVI 3GO5A 4IHVA 1DUXC 3PBEA 3RZDJ 1TBXA 3GFLA 1IUFA 3DLJA 5CKTA 4DYQA 1FYMA 1BJAA 3F8FA 5HDGA 2Q2EA 4G8XA 2PMZN 1U78A 1KZFA 1A35A 1YOVB 1BA5A 4GM5A 2DJNA 5F48A 3L9FA 3PNVA 2PMHA 3FXOA 3DKXA 1GHEA 4S0HB 3QAHA 3HDDA 2ZW7A 2P5VA 4BXXJ 2FMLA 5CVVA 5B3SH 5HOOA 3PB7X 4M6HA 4ZI6A 2BL1A 1E2XA 5AG7A 4HEA2 3COAC 1P2FA 2BXZA 4NBQA 1HBXG 3BP8A 4GXHA 5H20A 1HCRA 1V55H 1XMAA 2V9VA 4HV6A 3IKVA 3PRTA 5EG0A 2OB0A 1LNWA 2FD5A 3T90A 4R7MA 2LKXA 2KISA 3CDXA 2QSHX 4MFZA 1JQGA 2WAFA 1VQ6I 3CT9A 2BVMA 3LSGA 2BE5F 4DW6A 2X0LA 1QZEA 1GT0C 2EIMH 1MBFA 1YITI 1VQ9I 1TL8A 4N4NB 4KT5C 4UVCA 3CJNA 5DM7F 2STWA 3GTGJ 3C7JA 3L2NA 1ZHFA 3HOUJ 1XGNA 4YEJA 1QPIA 3F21A 3DBHB 1D8KA 3I3GA 4K3NA 1X1BA 4KS9A 1X10A 1CF7B 3EYIA 3WTYC 4ZJZA 1ON0A 4M6GA 3GZNB 3BI0A 2Y75A 2HOSA 2VPRA 2OBPA 4GDFA 4BE2A 5L3BA 2X6OA 2JDCA 1Z8TA 1QBJA 3HRMA 3TTHA 3RZOJ 3MN2A 3FECA 2QCOA 1ENHA 5E79C 3Q0UA 1Z91A 4G94A 1QNTA 2HQYA 2DOAA 4JX6A 2PJRB 1D0XA 3VATA 4CYDA 3AKZA 5FKLA 4YWYA 3TKYA 2KL4A 3ELKA 2EV5A 3LSTA 4RN7A 3DF8A 3ECOA 3HOXJ 5LGUA 1ZR2A 1IRGA 2BUEA 3T0YA 3ABTA 1XN7A 2E7WA 2EA2A 2F5VA 2OPTA 4KISA 4EVIA 2GXGA 2Q7SA 2BBYA 1IY7A 3GX4X 2W82A 4YELA 2VC1A 2HQNA 4NC7A 2DAOA 3S1MJ 4ZTFA 2E2IJ 4KNYA 3M3YJ 4HLXA 1W7PD 1OPCA 4OAYA 5BMZA 4IJAA 4JBAA 1CP7A 1OFCX 1R7JA 3CD6I 1YJWI 1F2OA 2Q4ZA 2VXZA 2PIYA 3VWBA 4KVOE 4GRIA 1HOMA 4JP0A 3DR8A 4R6TA 3ZQ7A 3HB9A 1T95A 2JN6A 5JVGF 2CQNA 2VJ5A 3GYHX 1CP6A 1ZTRA 2IGKA 3ZQQA 1VNDA 5LHHA 1SD4A 2CS3A 1MDMB 5K1YA 2IA0A 4RDUA 5IOYA 3BI1A 5JLWA 4JK1X 5EF6A 1OCRH 2K27A 1Z4EA 1D5VA 1MZBA 3KP3A 1ELMP 4KOUA 2X6XA 5G22A 1I27A 5EGOB 3S1QJ 1WK4A 2FMYA 4DGWB 5A2QZ 3I4MJ 1KGSA 2ZW4A 1IN6A 1D0YA 4HNTA 1ZLKA 3BOQA 2B58A 3B2YA 3D7DA 1DU0A 3HHGA 2KIUA 2WV1A 4B6ZA 1KU2A 3J7AO 2IXSA 4J00A 4CYPA 5D5XB 3LAJA 4X1EA 4NEXA 4QPOA 4XICA 4UHTA 1T8IA 3E97A 4PJLA 5FKKA 1YREA 5JQ4A 2ZXJA 4XM3A 3K4BA 3LFUA 4BHPA 5D29A 1U5TA 4FE7A 3U9GA 4FD7A 5HNFA 4JWPA 3K4NA 2MFZA 2RNGA 1IICA 3NH8A 1B6AA 2ZOFA 2WY7Q 3H8EA 3S9LA 1LE8A 4M3SA 1PVEA 2CQ7A 2DYSH 3BTCA 4ENMA 1IXCA 4MCPA 2FS5A 1FP2A 2MH9A 3C2BA 3DU5A 5HLGA 3HL2A 3TO6A 2DFFA 3KX2A 4U7DA 4YFNF 3HLPA 4MCQA 1YLFA 4RLFA 3GCMA 4IEJA 3RTRA 4UVAA 3QYEA 2L9SA 1W7PB 3JREA 2E1NA 1WWZA 2PJ0A 5G1ZA 1A6QA 3L2VA 1RUOA 4EMSA 2Q7BA 2YGWA 4I99C 2LY2A 3IH4A 3ZMDA 3A1YA 5EEHA 5H6RA 3A2KA 3R9GA 1GHCA 2KRHA 3WHCA 3IAM2 3G4SI 1HLVA 2PX9A 3GMEA 1XF8A 3VYUB 4R79A 1Z7LA 4PDKA 2K5CA 2XF6A 1LQ1A 4Q5SF 1MBHA 2R7WA 3ZQIA 2VBYA 1G4DA 5FLVA 3P5JA 1ZRCA 2ZCWA 2XPVA 1TP4A 2LH9A 1J09A 1S29A 2PJPA 3FMCA 5C88A 1XGMA 3MKZA 3OOUA 2ATRA 4AIHA 2IBDA 2PMUA 3C1DA 4ASNA 4IHTA 3P2HA 4W97A 2CRGA 1ERDA 2F5CA 3VYRB 1BR4A 3CUOA 4BHBA 2L4AA 1Z8WA 3SQNA 3QU3A 3BHXA 1W0TA 2LSOA 2H8RA 3WT4A 4HX7A 2EZIA 2A68F 3HYIA 4F6AA 5HXDA 3WTVC 3A0HC 1XGOA 1G59A 1WSUA 4P10A 4CGPA 4CCNA 2ESHA 1AA7A 1GLNA 1V3FA 3PO3J 5BWAB 3FYNA 1U5TC 4NJRA 1EE3P 1GYTA 1FIPA 4QVTA 4R9MA 2ICWG 3ZZIA 4CGNA 3SHFA 3PIOF 3GUDA 1YE9A 2REEA 2J5PA 4RS8A 5IP9J 2YS9A 3PP9A 3HM5A
chains in the Genus database with same CATH topology
3F9KA 3LSHA 2HVRA 3OYHA 4C2UA 2DPTA 2E5ZA 3D5LA 4IF5A 2R7HA 4UWIA 3D2MA 5FRNA 4YFJA 4A33A 2KCWA 4Y33A 4MHDA 2VASA 2D4PA 2HVQA 5HNHA 3TOAA 2HV2A 3FBUA 4E7IA 1J4JA 4HRIA 1WJ5A 4JOMA 3F5BA 4H4KC 1MW7A 4E7HA 2JA2A 2JVHA 4XOTA 4YGOA 2VKHA 2DPSA 2W7NA 1UFHA 3OWCA 3OYGA 4DNCA 1SQHA 3CF2A 1R57A 4FD4A 2M3AA 3FKJA 2JEVA 4UWJA 3UY5A 1NG6A 4A2ZA 1X1CA 3CJQB 1S9HA 4CCLA 3OR1C 4ZTJA 1WJFA 3LSMA 2I79A 4H89A 3EFAA 4IX7A 3EY5A 4MFPA 4AVAA 3CP2A 1RXTA 2G3TA 3QYFA 3M1CA 4XN3A 4KLWA 4U9YA 2VQHA 1PYVA 2GOXB 3DPLC 3BJ7A 4EVYA 3H9QA 4XLHA 4KSFA 1Z9UA 3V8IA 2K9MA 3H9GA 3OYBA 4EATA 4PFPA 3OYJA 3HPHA 2ZPAA 4HG2A 2NOJB 5G21A 3JVNA 5A27A 3W6XA 5KTCA 1S60A 2BW3A 2Z3NA 2WAQA 4DBQA 2OH1A 2ZXHA 3S32A 3RYOA 3TCVA 3OYCA 3L2RA 3BCAA 3G2BA 4FASD 1B6BA 1LKXA 2R8VA 2KHMA 4B48A 3SEZA 1K4JA 4ORFA 4ANJA 3S6GA 3TBIA 3H5NA 3OIQA 5KCMA 2X51A 1WFXA 1TIQA 2HUZA 2L5QA 2PQ8A 1X4OA 3D5SC 1MNEA 3IWEA 4ITVA 2QKLB 1M1DA 1SFKA 3K4KA 4BACA 3LSIA 4F3QA 2UUZA 1NMTA 4JD6A 3KEYA 1XEBA 3GBGA 4BJTA 3OYIA 1DGWY 2LOOA 3JTKA 4PK2A 2IGNA 4IUSA 2WADA 2R7RA 2FL4A 4L89A 1QSTA 4NCZA 4QUSA 4A30A 2J8RA 4P1WA 3ZRGA 4QB9A 2WBMA 5DWNA 1IB1E 4E8OA 4F55A 1IYKA 4C2ZA 2Z16A 2B3VA 2XF5A 2P6EA 2VZYA 3R9FA 2FE7A 5F47A 2CMPA 3UR3C 1R6RA 1MJAA 2E1MB 4RMNA 2Z11A 4LX9A 3DLAA 2CW7A 3E0KA 4XLAA 3RCOA 4B5PB 1KUYA 2W00A 2GOMA 2HDWA 4HSTA 4JQFA 3VWDA 2ZXIA 3S8PA 2M0MA 3WR7A 2VB6A 3QYBA 3FXTA 4H6UA 3SHPA 4KVME 4D1QA 2VQGA 2R7VA 3RSNA 4C2TA 2CY2A 3DU6A 3K6GA 5G20A 4RI1A 3LODA 5IX3A 1EA3A 4XLEA 2C27A 1NG7A 4CUGA 3EXNA 1MMGA 1Z21A 2WAEA 4CCKA 3V42A 4C2XA 4IZZA 4CCOA 3HC7A 1N77A 4BJ5C 3CXQA 4KOSA 1S7FA 3PSIA 4KUAA 5HLTA 3RPUD 3MKYB 2CNMA 4MI4A 2X6YA 2XSJC 1N78A 1YK3A 3OYDA 2V9KA 3HG9A 1Y56A 3QODA 3OYMA 2ZSHB 4IKFA 3LD2A 4OAEA 3L2WA 2R7SA 4Q38A 4KOWA 5KNLA 4RM3A 1XE4A 2OZUA 3CMMA 2P6GA 3OS0A 3NE7A 2Z10A 1I21A 2VL8A 2QECA 4BQQA 5CQGA 2PDOA 2WUUA 2KQRA 1KONA 4LITA 5TGTA 4B3XA 5F49A 4CS0B 4E2AA 1U0JA 4NXYA 2V26A 3K70D 2B3UA 2FIAA 3OYKA 4XKBA 2HU9A 3G3SA 1P9QC 2D4OA 2O28A 2WPXA 1Z3XA 4AVZA 3S3NA 2Y0SA 2Q4YA 3K4MA 2Z3MA 2VXKA 4CZCA 3TOBA 5HMNA 2LC2A 3IAS2 5GCNA 2R4GA 4I49A 2JSPA 3FHNA 3HPGA 4D9JA 3PNTA 5FVJA 2CW8A 4R87A 1OLTA 4JXRA 4MY3A 3LL7A 4F92B 1S7LA 1V0CA 2M7AA 4E6KG 1W36D 1UG0A 2K9LA 2X1DA 2I00A 3IU1A 5CNPA 4PFOA 1M4GA 5F46A 3HOTA 3MGDA 4B5PA 4M85A 1Q2YA 1DP3A 2X1CA 5EC4A 4RLQA 3PNYA 2CXAA 3DWLE 3W2VA 2PC1A 5H86A 1MNDA 4Y4RA 2KPMA 1YX5A 2KLOA 2R7OA 4BQNA 4E7SA 2FSRA 5HH1A 3VWEA 3AL0B 2WY8Q 2HZDA 1VHSA 3H5AA 2R98A 1YX3A 4U7BA 4XPKA 2F6CA 2IS1A 4E4HA 4XN0A 2P0WA 4BDZA 2H5MA 4PJJA 4F93B 5KTAA 1WJCA 4XLCA 3IWGA 1BO4A 4CAXA 4H6ZA 1M4DA 2G0BA 3KKWA 4RS2A 5J8FA 1D1AA 1DQUA 5C82A 3OS1A 4LUAA 3DPTA 1Y9KA 2IGMA 3TE4A 2CH0A 5H84A 4UFXA 1WJBA 3DQVC 1P0HA 5AG5A 4C30A 3C26A 3N05A 2PMZA 2Q1ZB 2VJ4A 4ZDLA 4B44A 4NUBA 1QSNA 3OWTA 2KZVA 2Q4VA 2MD0A 4KT6A 1OZPA 1YLEA 3TL4X 4J01A 4GS4A 3TO9A 3OL4A 4C68A 5JPHA 3MKWB 2OZHA 2DJIA 1M4IA 2Z3OA 2LRDA 4CCJA 1QHGA 4XQFA 4IQJA 2BEIA 1NE9A 2JLMA 3SXOA 2CV0A 3ZJ0A 3W6SA 4E7JA 2F5IA 3VSLA 4HNXB 2ZFUA 1E0EA 2W4SA 2QKMB 2EVNA 5FRMA 4HNUA 5AG6A 2FIWA 2R7TA 4BE1A 1JI8A 2ARHA 2VEZA 2Z0ZA 3FRMA 4QPQA 3NWTA 2B4DB 2OZGA 2PR8A 2X6WA 3K4CA 4CGOA 2DXQA 2X1EA 3CJRB 2ZW6A 4C7IA 3TFYA 2GE3A 3EUHC 1KUXA 3I9SA 2Q2EB 1BR2A 2XF7A 1S7KA 4XORA 4HKFA 1Y6IA 5C88A 2VI7A 4E7ZA 3GY9A 3IU2A 5KHDA 4AG7A 3OYNA 4LG3A 3SXNA 2FCKA 3DTKA 2O5RA 2YNCA 4CSWA 4HNYB 4B12A 2FXFA 2V6EA 2AJ6A 2A5WA 2DCEA 4BDYA 2OU2A 4OAZA 4YRHA 4BMHA 2WPWA 2JUGA 4A32A 2E1MC 1VZ0A 2WB1A 1G8XA 4XKCA 4ZDPA 1L0CA 2EUIA 4U87A 2K3PA 2CV2A 1RO5A 2E5NA 3AFHA 1TZLA 3BG6A 3HKZA 4NF1A 4ZBGA 2ZSIB 1IRXA 3W91A 4AVBA 4C2YA 3OYEA 2MC4A 3KYLA 3EO4A 3PGPA 4XNHB 1QSOA 2V1NA 3S3MA 1LFPA 2NMTA 4E7KA 4ZGYB 5IB0A 3HOSA 4XOPA 3C2HA 2VZZA 4MY0A 5CPRB 3QB8A 5AG4A 2Z3KA 2F4IA 1IIDA 3DNSA 3OR2C 2PR1A 3N7ZA 3VYTB 3H5RA 2G3AA 1YVKA 5DWMA 3I3LA 4HSRA 1ZO0A 2V4JC 4ZDOA 2V7FA 3DTEA 2HQAA 4FD6A 4UCPA 2Z1DA 4BEHB 4CAVA 3F8KA 2CNTA 2BVLA 1XMTA 2IS4A 1T0FC 1ZELA 1YX0A 1D0ZA 2XAUA 4XPLA 3D5RC 3ZCOA 4DOZA 3A4CA 2MYSA 3HUGB 2AE6A 4R3KA 4PK4A 3VSKA 2X7BA 3VDXA 2Z3LA 3S6HA 3UNGC 4BUPA 2M4KA 1HA8A 4ONUA 5LFAA 2WA0A 3MMYB 3LMMA 3A9LA 4B13A 2L9NA 4Q36A 2LG4A 4JXQA 1K6YA 4B10A 2A4NA 1X1DA 4XKWA 4BQOA 1LVKA 2Z2SB 2B4DA 4XNFA 3FB3A 4DBRA 4U5YA 4A95A 4KJZA 3SDBA 3L2QA 4CYNA 4JLYA 5HVQC 5CKTA 1KZFA 3SZGA 1MJ9A 2KDOA 2YNDA 3S6FA 4E0AA 4BJ6C 4CH7A 5F48A 3PNVA 4DIQA 3B8GA 3ZR8X 3J7AY 1GHEA 3DKXA 3H0DA 1I1DA 1YR0A 3QAHA 2LY1A 3BC8A 3E0JB 1P4NA 4B43A 1KUVA 2JDDA 4P5OA 2ZW7A 5HOOA 2ZXVA 3OIPA 2M7BA 4ZC3A 3QOEA 2BL1A 5AG7A 3F0AA 3TO7A 4HEA2 4G6TB 3SEQA 3SYTA 1B87A 2LBFB 2YNCC 3R1KA 1XIXA 5JHFA 4F0YA 2B5GB 4F52A 1MMAA 4CGLA 1OR7C 2OB0A 2P6FA 5E96A 1X4PA 3T90A 4BBHA 2KRCA 4AG9A 3R9EA 1Z3YA 1V5FA 2GANA 2WAFA 1MJBA 4MFZA 4QC6A 4AB7A 1UELB 2VXDA 4E7LA 2BVMA 3AL0C 3LSGA 4X5KA 4NC8A 4NSQA 2CFOA 4ZYAA 4J3GA 1N71A 1S3ZA 1DGRM 3DKYA 4N4NB 3FDYA 1MMNA 3OS2A 2BSWA 2RC4A 3R96A 2IS2A 1WJEA 2DT6A 3K4LA 1FMVA 3OL3A 4XONA 4YEJA 4K30A 4BEHA 4II2A 3I3GA 2Q04A 1X1BA 4KS9A 2AQFA 3W3CA 1QSMA 4XLFA 1ON0A 4ZJZA 4AYBA 3D3SA 3DR6A 3VYSB 5CQEA 3BCBA 1IYLA 1I12A 4XR6A 4MFKA 4UFVA 1QSRA 1N75A 4KSAA 4C7HA 4PUSA 3PZJA 4BE2A 4KOYA 1BR1A 2JDCA 4CAFA 2REFA 1WJDA 2XC7A 2VLAA 3H35A 3TTHA 3BLNA 4PSXA 2IGOA 3W2AA 3CP8A 4LIVA 4CGMA 3DDDA 3K70C 2HQYA 2DOAA 2PJRB 1D0XA 2HPIA 4F91B 2VKDA 2RQQA 3FNCA 3AKZA 3C2GA 3W2WA 2PSWA 5A28A 3I9V2 2KL4A 4BS9A 3GKRA 2L2OA 2R7XA 4UA3A 4XPDB 4Y49B 5KTDA 3JUWA 3S6KA 2W1OA 2BUEA 4KOTA 2F5VA 4KISA 3K10A 2HNHA 4CRZB 2IL4A 4HNWB 1Z4RA 1NSLA 2CNSA 2W82A 4YELA 4RM2A 3OMYA 4C9YA 4B5OA 2VQLA 3OYLA 4B47A 4NC7A 2UV1A 5LD2C 1W36C 4FD5A 4OLLA 5J8CA 4ZTFA 2LBFA 4BXFA 3T9YA 2B5GA 4U9ZA 4CA0A 4OAYA 2R1IA 2BOLA 4CAWA 4B11A 3E1SA 4JJXA 2CUJA 2ELJA 1LDKB 3PFYA 2VXZA 2ZW5A 2VQCA 3VWBA 2Q44A 4GRIA 4KVXA 3DR8A 4KVOE 1T95A 2OC6A 3BJ8A 1Y7RA 1X19A 2VJ5A 1BOBA 4AU7A 4XNHC 2IGKA 3ZQQA 2LREA 2DXIA 3TMOA 2CS3A 4MLOA 3S93A 3BLYA 3DSBA 4UFWA 4IQ4A 3DPUA 2HVSA 4OADA 3D8PA 2FT0A 2CUZA 4BE0A 1Z4EA 2K5TA 5G22A 3PUBA 3P2FA 3NWSA 3EUKL 2X6XA 2Z3PA 4KLVA 4KOUA 4R3LA 2VIXA 1D1CA 2L7KA 4B14A 1WK4A 1PJRA 4DGWB 1MK4A 4R57A 1YGHA 3MD2A 5IV0A 1FY7A 3ZXSA 1D0YA 4HNTA 3H9JA 4NNJA 2B58A 2CV1A 1V5EA 2ZW4A 3IGRA 3FBIB 2JVGA 4MFJA 2IXSA 4J00A 4PJNA 3OYAA 3PL8A 4LIUA 4CYPA 4NEXA 4PJMA 4N4OB 4QPOA 3D2PA 4PJLA 5JQ4A 1WJAA 1YREA 4XM3A 1MMDA 3K4BA 3LFUA 3ONQA 4II9A 4PSWA 3H4QA 2PJRA 1Y9WA 4FD7A 3CESA 5HNFA 2VJIA 1M44A 4JWPA 2PRBA 2OV7A 3K4NA 2MFZA 2RNGA 1IICA 2A6TA 3S3OA 1YVOA 1U6MA 2WY7Q 4AVCA 3CXPA 4Y3OA 4M3SA 2OUMA 4BL0B 2AQEA 2FS5A 3DU5A 2Q0YA 3HL2A 3TO6A 3KX2A 4YRVA 2B4BA 3U21A 2RREA 4RLFA 3IP4B 3PJRA 2R7QA 1VKCA 4MFLA 5EBVA 3RTRA 3R95A 4BGDA 3QYEA 2KMUA 2WSAA 5AGEA 2GIVA 2J8NA 2L9SA 4CAEA 2M4GA 2VQYA 3GYAA 1WWZA 4CYQA 3EUAA 5G1ZA 1FMWA 4UCMA 3L2VA 4FETA 3H5ZA 4MBUA 4CYOA 2Q7BA 4KORA 2YGWA 3ZGKA 2UWMA 2J8MA 4UBRA 2LY2A 3K9UA 1UAAA 4KZTA 2DT7B 2HPMA 4F0XA 3A1YA 4XMYA 5FROA 3A2KA 4X0GA 1Q2CA 2VPLA 4BU2A 3R9GA 2KRHA 3K4JA 2VBQA 3IAM2 3IUOA 4II3A 3FIXA 4L8AA 4QBJA 3PSFA 3CXSA 5I0CA 1XF8A 3FBNB 3EC4A 2IS6A 3VYUB 2X85A 3DTIA 4R79A 1Z7LA 3TT2A 1S5KA 2R7UA 2K5CA 2XF6A 4KOXA 2R7WA 1TT0A 3DEEA 4A31A 3CZ6A 1PU9A 4KITB 3OY9A 4XKVA 4KOVA 2LH9A 1J09A 3BG7A 1X1AA 2BW3B 4XL9A 2QMLA 2MABA 3MKZA 1D1BA 3OOUA 4OWRB 1S7NA 1V5GA 2ATRA 2YNEA 3G8WA 4CRYB 3P2HA 3L2UA 3M8JA 4NQWB 4PK3A 1ERDA 4PV6A 3VYRB 4DJAA 1BR4A 2FUG2 2KP6A 1QU3A 3EPZA 4KUBA 4MJ8A 4UCNA 2I8DA 1QHHD 2XDVA 1SAUA 1LRZA 4F6AA 1CM0A 1PUAA 4CCMA 3OYFA 2LYCA 2Y0MA 3LSKA 1G59A 4CGPA 4CCNA 1AA7A 1GLNA 5ISVA 5BWAB 3FYNA 2E60A 4HPQA 4QVTA 4R9MA 4MFQA 3ZZIA 4CGNA 1Q2DA 2QIRA 2REEA 1YE9A 1CJWA 3HXLA 2VJJA 4XPDC 4Y49C 3PP9A 3RQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IF5 A;  2R7H A;  3D2M A;  2KCW A;  4MHD A;  2D4P A;  3TOA A;  2HV2 A;  3FBU A;  1J4J A;  3F5B A;  4YGO A;  4DNC A;  3OWC A;  1UFH A;  1SQH A;  1R57 A;  4UWJ A;  2JEV A;  3UY5 A;  4H89 A;  2I79 A;  3EFA A;  3EY5 A;  4AVA A;  1RXT A;  2G3T A;  4KLW A;  4U9Y A;  4YFJ A;  4EVY A;  3BJ7 A;  1Z9U A;  3V8I A;  2ZPA A;  3JVN A;  5KTC A;  3W6X A;  1S60 A;  2OH1 A;  3RYO A;  3TCV A;  1B6B A;  2R8V A;  1K4J A;  4ORF A;  3S6G A;  1TIQ A;  2HUZ A;  2PQ8 A;  1M1D A;  4JD6 A;  1NMT A;  1XEB A;  4PK2 A;  4IUS A;  4QUS A;  2FL4 A;  4L89 A;  1QST A;  4NCZ A;  2J8R A;  4QB9 A;  5DWN A;  1IB1 E;  1IYK A;  2B3V A;  2P6E A;  2VZY A;  3R9F A;  2FE7 A;  5F47 A;  1MJA A;  4LX9 A;  2Z11 A;  3E0K A;  4B5P B;  1KUY A;  3VWD A;  3WR7 A;  3FXT A;  4H6U A;  3SHP A;  4KVM E;  2CY2 A;  4RI1 A;  3LOD A;  5IX3 A;  2C27 A;  3EXN A;  3CXQ A;  4KUA A;  4KOS A;  1S7F A;  2CNM A;  4MI4 A;  1YK3 A;  4OAE A;  4KOW A;  1XE4 A;  2OZU A;  2P6G A;  3NE7 A;  2Z10 A;  1I21 A;  2QEC A;  2PDO A;  4CS0 B;  5F49 A;  4E2A A;  4NXY A;  2B3U A;  2FIA A;  3G3S A;  2D4O A;  2O28 A;  2Q4Y A;  5HMN A;  3TOB A;  2VXK A;  5GCN A;  4I49 A;  5FVJ A;  4R87 A;  4JXR A;  4MY3 A;  1S7L A;  1V0C A;  2I00 A;  5CNP A;  1M4G A;  5F46 A;  3MGD A;  4B5P A;  4M85 A;  1Q2Y A;  5EC4 A;  2PC1 A;  5H86 A;  5HH1 A;  3VWE A;  2FSR A;  1VHS A;  2R98 A;  2P0W A;  2H5M A;  5KTA A;  4CAX A;  3IWG A;  1BO4 A;  4H6Z A;  1M4D A;  2G0B A;  3KKW A;  4RS2 A;  5J8F A;  5C82 A;  4LUA A;  1Y9K A;  3TE4 A;  5H84 A;  1P0H A;  3C26 A;  4XPK A;  1QSN A;  2Q4V A;  1OZP A;  1YLE A;  4GS4 A;  3TO9 A;  5JPH A;  2OZH A;  1M4I A;  3SXO A;  2BEI A;  1NE9 A;  2JLM A;  3ZJ0 A;  3W6S A;  2F5I A;  4HNX B;  2EVN A;  2FIW A;  2ARH A;  2VEZ A;  2Z0Z A;  3FRM A;  2B4D B;  2PR8 A;  2OZG A;  2DXQ A;  2ZW6 A;  3TFY A;  2GE3 A;  1KUX A;  3I9S A;  1S7K A;  4HKF A;  2VI7 A;  3GY9 A;  4AG7 A;  3SXN A;  2FCK A;  4HNY B;  2FXF A;  2AJ6 A;  2OU2 A;  4YRH A;  4BMH A;  2WPW A;  4FD4 A;  1L0C A;  3LD2 A;  4UWI A;  2EUI A;  2WPX A;  1RO5 A;  4NF1 A;  4ZBG A;  3W91 A;  4AVB A;  3EO4 A;  3PGP A;  4XNH B;  1QSO A;  2NMT A;  5IB0 A;  4MY0 A;  2VZZ A;  3QB8 A;  1IID A;  3DNS A;  2PR1 A;  3N7Z A;  2G3A A;  1YVK A;  5DWM A;  4FD6 A;  4CAV A;  3F8K A;  2CNT A;  1XMT A;  1YX0 A;  4XPL A;  4R3K A;  3S6H A;  2AE6 A;  2X7B A;  4ONU A;  4JXQ A;  2A4N A;  2B4D A;  4U5Y A;  3FB3 A;  4JLY A;  1KZF A;  1MJ9 A;  3S6F A;  4E0A A;  5F48 A;  3B8G A;  1GHE A;  1I1D A;  1YR0 A;  3QAH A;  2ZW7 A;  1P4N A;  1KUV A;  2ZXV A;  2JDD A;  3TO7 A;  2BL1 A;  3F0A A;  1B87 A;  3R1K A;  1XIX A;  4F0Y A;  2B5G B;  2OB0 A;  2P6F A;  5E96 A;  3T90 A;  4AG9 A;  3R9E A;  2GAN A;  4QC6 A;  1MJB A;  4AB7 A;  4X5K A;  4NSQ A;  4J3G A;  1N71 A;  1S3Z A;  2BSW A;  2RC4 A;  3R96 A;  4K30 A;  3I3G A;  2Q04 A;  1QSM A;  3D3S A;  3DR6 A;  1ON0 A;  1I12 A;  1IYL A;  1QSR A;  3PZJ A;  4KOY A;  2JDC A;  2REF A;  3TTH A;  3BLN A;  4PSX A;  3DDD A;  2HQY A;  3FNC A;  2PSW A;  5KTD A;  4UA3 A;  3GKR A;  4XPD B;  4Y49 B;  3JUW A;  3S6K A;  2BUE A;  4KOT A;  4CRZ B;  2IL4 A;  4HNW B;  1Z4R A;  1NSL A;  2CNS A;  4CAW A;  4B5O A;  4FD5 A;  4OLL A;  5J8C A;  3T9Y A;  2B5G A;  4U9Z A;  2R1I A;  4JJX A;  2ZW5 A;  4KVX A;  2Q44 A;  4KVO E;  3DR8 A;  3BJ8 A;  1Y7R A;  1BOB A;  4XNH C;  3DSB A;  4OAD A;  3D8P A;  2FT0 A;  1Z4E A;  2K5T A;  3P2F A;  4KLV A;  4KOU A;  4R3L A;  1WK4 A;  1MK4 A;  4R57 A;  1YGH A;  5IV0 A;  1FY7 A;  2ZW4 A;  2B58 A;  3IGR A;  4NEX A;  3D2P A;  5JQ4 A;  1YRE A;  4II9 A;  4PSW A;  3H4Q A;  1Y9W A;  4FD7 A;  4JWP A;  1M44 A;  2PRB A;  1IIC A;  1YVO A;  1U6M A;  4AVC A;  3CXP A;  4M3S A;  2FS5 A;  2Q0Y A;  3TO6 A;  2B4B A;  1VKC A;  3R95 A;  5EBV A;  4E8O A;  2GIV A;  2J8N A;  2VQY A;  3GYA A;  1WWZ A;  4MBU A;  2Q7B A;  4KOR A;  4UBR A;  2J8M A;  3K9U A;  4KZT A;  3R9G A;  1Q2C A;  4L8A A;  2VBQ A;  3FIX A;  4QBJ A;  3CXS A;  5I0C A;  1XF8 A;  3EC4 A;  3TT2 A;  1S5K A;  4KOX A;  1PU9 A;  4KOV A;  2QML A;  5C88 A;  1S7N A;  2ATR A;  3G8W A;  4CRY B;  3P2H A;  4PK3 A;  4PV6 A;  4KUB A;  4MJ8 A;  1LRZ A;  4F6A A;  1CM0 A;  1PUA A;  2Y0M A;  5ISV A;  3FYN A;  4QVT A;  4R9M A;  3ZZI A;  1Q2D A;  2QIR A;  2REE A;  1CJW A;  4XPD C;  4Y49 C;  3PP9 A; 
#chains in the Genus database with same CATH topology
 1GVD A;  4C2M J;  3S15 J;  4UWI A;  2CQK A;  2JK3 A;  3D2M A;  2ZEF A;  1E17 A;  2IPQ X;  4Y33 A;  4LLG F;  1BIA A;  1Y39 A;  4MHD A;  4MNU A;  4E7I A;  5BPI A;  1WJ5 A;  4I09 A;  4M3B A;  3F5B A;  1K4S A;  4H4K C;  4E7H A;  1G2H A;  4OC2 A;  3G1M A;  4YGO A;  5IP6 A;  2W7N A;  3I4P A;  2V6C A;  2M3A A;  3FKJ A;  3UY5 A;  1R43 A;  3ZN1 A;  4A2Z A;  1X1C A;  4CCL A;  1YIO A;  2HTJ A;  2CQQ A;  3QPS A;  2XRL A;  4U9Y A;  4YFJ A;  1Y8Q B;  5JFR A;  3IWW A;  4EVY A;  2L4M A;  2C6P A;  4UY8 I;  3H9Q A;  4KSF A;  2V1U A;  2H94 A;  2K9M A;  1ZYR F;  1GV2 A;  1UZC A;  2FJ1 A;  1ETV A;  2GIZ A;  1ETQ A;  4MTE A;  4HG2 A;  5G21 A;  3FX6 A;  4ZY0 A;  2GLO A;  2FBH A;  3V7Z A;  5GAE J;  1S60 A;  2WAQ A;  2L0K A;  2P7V B;  1QMU A;  2ZBK A;  2OH1 A;  2QEX I;  3S32 A;  3RYO A;  1IXR C;  2NS8 A;  3L2R A;  1B6B A;  1I1G A;  1LKX A;  2IVM A;  1LCP A;  1S3J A;  1YFH A;  2K9S A;  3ZQG A;  3J7Y J;  3GTL J;  3H5N A;  5FFZ A;  1TIQ A;  2X51 A;  2Y2Z A;  1BI0 A;  2JPC A;  1J0R A;  2M8E A;  1X4O A;  1BL0 A;  3LMS A;  2KFD A;  1R1U A;  2QKL B;  1M1D A;  5TIS C;  4BAC A;  1WPK A;  3LSI A;  4F3Q A;  2DK5 A;  3KR4 A;  3KEY A;  3B3T A;  2OZ6 A;  4XBF A;  1YQE A;  2FEZ A;  2HKX A;  2ZEN A;  4Y17 A;  3F8B A;  5JVT A;  1H9T A;  3JTK A;  1A04 A;  4Z65 A;  1I39 A;  2WAD A;  4M3E A;  1QST A;  2R5Y B;  1TWH J;  2NOG A;  3IL2 A;  5DWN A;  2L7M P;  1IB1 E;  1YW8 A;  4F55 A;  4O5V A;  2GM4 A;  2B3V A;  2KJC A;  2P6E A;  3R0J A;  1QO0 D;  3V38 A;  4V2G A;  3CDL A;  4HPS A;  2B63 J;  3FMS A;  1K78 B;  1HDP A;  2FX0 A;  1VQO I;  2ZEP A;  3E0K A;  2XKP A;  1KUY A;  2L01 A;  2W00 A;  2GOM A;  2HDW A;  3BR5 A;  4HST A;  5A2Q K;  2ZXI A;  2ECC A;  3Q9V A;  4A3J J;  3ECH A;  1WVR A;  2HXI A;  3F8N A;  3SHP A;  2EIN H;  2O4H A;  4D1Q A;  1WGX A;  2ADU A;  5DD8 A;  1O4X A;  2R7V A;  1E3P A;  2ACJ A;  1ETX A;  4KFC A;  4F9U A;  1JTX A;  4AIK A;  1NG7 A;  4CUG A;  4HA8 A;  3BZ6 A;  2WAE A;  1N25 A;  1QQI A;  4MEX F;  2EJR A;  2NS7 A;  1XSD A;  1N77 A;  3CXQ A;  3PSI A;  4MCR A;  1BW5 A;  2F4M B;  2G7H A;  3G1L A;  1JGG A;  4P55 A;  4P96 A;  3OYD A;  1TKJ A;  1P6R A;  4KSI A;  4OAE A;  3L2W A;  4L9J A;  3I56 I;  1NK3 P;  3HOZ J;  4KOW A;  2LLK A;  4WXH A;  4JZ0 A;  3O6B B;  3GFJ A;  1XE4 A;  3CMM A;  3OS0 A;  2Z10 A;  4RGX A;  1YRN A;  5D6F A;  3DCF A;  4BQQ A;  4G7O F;  3KP6 A;  2RV8 A;  2PDO A;  2KQR A;  2MW8 A;  3W6K B;  4UF4 A;  5TGT A;  5F49 A;  4G7H F;  4N9H A;  3K70 D;  2B3U A;  3EUH A;  3K7A J;  2DBB A;  2HU9 A;  2FU4 A;  5K5O A;  4ENN A;  1M1E B;  2PRQ A;  1Z3X A;  3S3N A;  2Q4Y A;  2Y0S A;  2JA7 J;  3K4M A;  1ZG9 A;  3D66 A;  3IEH A;  2STT A;  2PJ7 A;  2DLL A;  2DA4 A;  1X2M A;  2KIQ A;  3FHN A;  4ZYG A;  1VQK I;  5FVJ A;  1SAN A;  3I59 B;  1K7A A;  4MQV A;  2GZW A;  2DW4 A;  4F92 B;  5H2F C;  4E6K G;  1OCO H;  2K9L A;  2X1D A;  5K8P A;  4BHC A;  1S8N A;  3WTX C;  3I55 I;  4WF2 A;  5FB2 A;  4U88 A;  4UUT A;  2HYG D;  4RLQ A;  3QP5 A;  3W2V A;  4OC5 A;  3EQL F;  2VBX A;  4Y4R A;  5HH1 A;  2R92 J;  1I6X A;  1Q7L A;  2Z33 A;  1YX3 A;  5IT9 Z;  1SAX A;  2ETH A;  1WH7 A;  1Q1H A;  1ZN2 A;  1F43 A;  1XCB A;  3ULQ B;  2NVX J;  3WC5 A;  1Z1D A;  2BY3 A;  1BO4 A;  4BY1 J;  5TJJ A;  4PGG A;  2CJJ A;  2GXA A;  4UEF A;  5C82 A;  4Q47 A;  1ZLJ A;  2WYR A;  3DEU A;  3TE4 A;  5HLI A;  1T0F A;  4BXU A;  3GF2 A;  4TWE A;  3VOE A;  3WE3 A;  4XPK A;  2Q1Z B;  1W0U A;  2KZV A;  2MD0 A;  2R7Z J;  4RBO A;  3TL4 X;  5F0F A;  2E2J J;  5JPH A;  2QBY A;  2OZH A;  4EQQ A;  1M4I A;  2MG4 A;  4CCJ A;  3SXO A;  1QHG A;  1R5H A;  3ZMZ A;  1MH4 A;  2Q8K A;  1ITY A;  1TT5 B;  2BEI A;  2JLM A;  2ZEO A;  4UEE A;  4LFU A;  3ZPL A;  1DU6 A;  1E0E A;  3NH5 A;  3L2C A;  4HNU A;  1YW4 A;  2RFH A;  3SI1 A;  4XK4 A;  1B8I B;  2PR8 A;  1R9T J;  1FJL A;  4KMU X;  2OZG A;  2RDP A;  4LK1 F;  4EGY A;  4IVN A;  2RGV A;  2B0L A;  3EUH C;  3I9S A;  5D5V B;  1F4K A;  3FK6 A;  3I64 A;  4FE4 A;  5HDK A;  1KWM A;  2VI7 A;  3CCE I;  5K8M A;  3IU2 A;  3CUQ C;  3V8K A;  4WWC A;  1O3R A;  6PAX A;  4U0V A;  2C6C A;  2V8G A;  2A5W A;  3BJO A;  4MFD A;  2DCE A;  1I5Z A;  2OU2 A;  3P7N A;  2QYO A;  5EYR A;  5IYB J;  2E1M C;  1EH7 A;  2WB1 A;  4GXO A;  1Z8X A;  4FD4 A;  4KN4 X;  4U87 A;  3M4O J;  1UB9 A;  4NF1 A;  5D8L B;  2ZSI B;  3JRG A;  3KYL A;  5CBM A;  4RAG A;  2YR2 A;  4E7K A;  1X3U A;  3HOS A;  1V4R A;  3QB8 A;  4NC6 A;  1OKR A;  4IHX A;  1IID A;  2Z3K A;  2EBJ A;  5DWM A;  3JR9 A;  2X48 A;  4HSR A;  1Y1W J;  2V4J C;  4RB0 A;  2HTS A;  1RNL A;  1KQ9 A;  2EBI A;  3H36 A;  4BEH B;  2WTE A;  1LAN A;  3E3V A;  2CNT A;  1R5G A;  1T0F C;  1ZEL A;  4M3G A;  5HLH A;  2ANP A;  5ICG A;  2DTZ A;  2FE3 A;  4DYC A;  3GTM J;  2AE6 A;  1ARL A;  3S6H A;  3NQO A;  2EFQ A;  3HSE A;  3HEF A;  3RQI A;  4ENJ A;  3WU2 C;  4R8H A;  2VOD A;  4ONU A;  5LFA A;  2WA0 A;  3A9L A;  3CCQ I;  3N5F A;  1MH3 A;  4I01 A;  2BOA A;  4B10 A;  1ZG5 A;  2A4N A;  2AFZ A;  3S2H J;  3FX3 A;  3G1O A;  4BQO A;  1LVK A;  2Z2S B;  4CYN A;  2AHQ A;  2HZT A;  3SDB A;  5HVQ C;  2YU3 A;  1PUE E;  3ZQL A;  2K3F A;  5ICC A;  3D7H A;  1MJ9 A;  2F2E A;  2KDO A;  2PEX A;  3L00 A;  1K79 A;  1FYK A;  2ELH A;  4RB3 C;  1QZZ A;  4UB6 C;  2X9D A;  3N97 A;  5B1B H;  3H0D A;  3WG7 H;  3FMQ A;  3JRB A;  3FXR A;  3E0J B;  1KUV A;  2VT2 A;  2Z5U A;  4Y15 A;  3OIP A;  2M7B A;  1ON1 A;  3QOE A;  4ZYE A;  2NVU B;  1B87 A;  1T98 A;  4BYY A;  1CQT A;  4RAZ A;  1XIX A;  2HWV A;  4UXN A;  4F52 A;  4CGL A;  2QJ8 A;  3BR3 A;  2Y9Z A;  5J1R A;  2KRC A;  3GFI A;  3CPA A;  4AG9 A;  1MJB A;  4AB7 A;  1XC5 A;  3B6C A;  2VXD A;  4EME A;  3D1N I;  3M1E A;  5EZG A;  4NHJ A;  4A93 J;  3IRR A;  1B9M A;  1S3Z A;  4AID A;  5K5Q A;  2PJB A;  5DTD A;  1DGR M;  4LD5 A;  3FDY A;  1MMN A;  2BSW A;  2XPU A;  5L3G A;  1ZQ3 P;  2DT6 A;  1TQP A;  2L02 A;  1BI2 A;  4II2 A;  3TC8 A;  2Q04 A;  4JX5 A;  4A0X A;  5BS6 A;  2AFM A;  4MFK A;  1I12 A;  3BCB A;  2CO5 A;  4UFV A;  1N75 A;  1FZP B;  4C7H A;  1VQ7 I;  4MHG A;  1OYW A;  3PZJ A;  1BR1 A;  1GXQ A;  2P4W A;  1BLL E;  2EIL H;  2V77 A;  4PSX A;  2IGO A;  2XAG A;  4XLP F;  5ICF A;  2V1D A;  4Z2Y A;  2L9R A;  4LIV A;  4BY7 J;  3RJP A;  4EM2 A;  2KZG A;  2O53 A;  3WTW C;  3BJA A;  5D4S A;  2D2W A;  4MXU A;  2MBF A;  4ZY1 A;  1ZG3 A;  1LUJ B;  3E6D A;  3W2W A;  5FKN A;  2XV4 S;  4BS9 A;  4Y7N J;  2EK9 A;  2L2O A;  3F8C A;  2R7X A;  5IT9 K;  4XPD B;  3MZ8 A;  2CYY A;  2OOT A;  1BI3 A;  4RGR A;  4KOT A;  1VQL I;  4O3M A;  4CRZ B;  4DQ2 A;  1NSL A;  1XMX A;  1OMI A;  1RES A;  1F2P A;  4B5O A;  1BI1 A;  4B47 A;  1W36 C;  2UV1 A;  3U2R A;  2ECB A;  4A37 A;  2FVG A;  2LBF A;  2XRN A;  1JT0 A;  4BXF A;  2XEG A;  3T9Y A;  2B5G A;  4WWV A;  4A69 C;  1FNO A;  1S72 I;  3ISX A;  5F6F A;  4WXD A;  2YNC A;  2VQC A;  5B1A H;  1H9G A;  1O57 A;  1RTQ A;  4ZZD A;  3BR0 A;  1Y7R A;  3TW7 A;  1X19 A;  2OQG A;  3KZZ A;  3M07 A;  4MRI A;  3WOD F;  1BOB A;  4AU7 A;  4PXB A;  3QPH A;  1POG A;  3S93 A;  3BLY A;  3PQJ A;  3DSB A;  1XSX A;  4JX4 A;  2DN0 A;  2XAH A;  2HVS A;  4NFR A;  3D8P A;  4OAD A;  2DK8 A;  2NXN B;  5J1U A;  3BTL A;  2RB7 A;  1ZRD A;  2K5T A;  3NWS A;  4R3L A;  3ABM H;  1D1C A;  1PJR A;  1MK4 A;  5LYI A;  3MD2 A;  5FFX A;  4CYC A;  5IV0 A;  3LNQ A;  2F4O B;  4NGT A;  4B4C A;  3ZOB A;  2DMQ A;  3B02 A;  4OIR F;  3KGQ A;  2NS0 A;  3RPU A;  1UST A;  4HX8 A;  4PJN A;  4LIU A;  1W5S A;  1XTA A;  2AO9 A;  4N4O B;  4PJM A;  1YW7 A;  1F5T A;  2ID3 A;  3MWM A;  2IQ6 A;  3ONQ A;  4II9 A;  2MLG A;  3HSF A;  2XGD A;  1M44 A;  3F6V A;  2R5Z B;  3RKQ A;  2PRB A;  2IJL A;  1X12 A;  1AYE A;  3BQZ A;  1U6M A;  4XRS A;  1TTY A;  3KP5 A;  2OUM A;  5DCF A;  4BL0 B;  2D5V A;  1ETK A;  2AQE A;  2C6G A;  1UHS A;  2OF7 A;  1HC8 A;  2B4B A;  3PJR A;  4MFL A;  3OOP A;  4EJO A;  2R7Q A;  1IZ1 A;  4TNU A;  3HRU A;  3ZMT A;  2WSA A;  2DFH A;  2KMU A;  4HX4 A;  2GIV A;  2J8N A;  1EH8 A;  3CC2 I;  4CAE A;  3GYA A;  2JEW A;  3CMA I;  4UCM A;  2HDC A;  5LHG A;  5FKM A;  4O23 A;  2BO9 A;  3IKT A;  4CYO A;  4A5M A;  5DCM B;  2CU7 A;  2K86 A;  1UAA A;  3K9U A;  2DT7 B;  4F0X A;  3VOD A;  5FRO A;  4GYG A;  1Q2C A;  1FIA A;  1XSV A;  3CTA A;  3K4J A;  2QYV A;  2VBQ A;  3FIX A;  2WWY A;  4L8A A;  5GTH C;  3K1P A;  5FD5 A;  3PSF A;  4A0Z A;  5THW A;  1LJ9 A;  4RB1 A;  3Q0W A;  4KDP A;  3FBN B;  1BPM A;  1ZK8 A;  2X85 A;  1RKW A;  2KKO A;  2Q51 A;  3O8G A;  1S5K A;  4OIW A;  1R4N B;  3BG9 A;  7CPA A;  3NA6 A;  3N4M A;  2MLK A;  1X1A A;  4XL9 A;  2BW3 B;  2QML A;  2MAB A;  3TDU C;  4OWR B;  3S9M A;  3T5X A;  3G8W A;  2ZNY A;  2YNE A;  1J9I A;  2M1B A;  5GTI C;  1IXS B;  1P7J A;  1HSJ A;  1ZKG A;  1WI3 A;  1MGT A;  1MD0 A;  4UNO A;  4KUB A;  2WAQ N;  2XDV A;  1FOW A;  1JHF A;  2L7F P;  1LRZ A;  1D8J A;  4KIB A;  1CM0 A;  1IN8 A;  1PUA A;  3DBR B;  1GV5 A;  4BKX A;  3TED A;  4HF0 A;  3T8W A;  3KP2 A;  5M5W J;  4G9Y A;  4FX0 A;  2EPF A;  4MFQ A;  2QIR A;  4D7N A;  3S16 J;  1CJW A;  2VJJ A;  1E3H A;  4Y49 C;  2EB7 A;  3RQ4 A;  5M5X J;  3GB0 A;  3F9K A;  2GA1 A;  3LSH A;  1DDN A;  1Y0U A;  2HVR A;  1XFO A;  3D5L A;  5GP9 A;  1I50 J;  4C3H J;  1ZLI A;  2M30 A;  3CCL I;  4A33 A;  3K1N A;  5LRR A;  2D4P A;  1MBE A;  2H8W A;  2POK A;  3FBU A;  3IV5 A;  4V19 K;  3HUV A;  2RVC A;  4QSH A;  4A38 A;  1BIB A;  3KP7 A;  2LF7 A;  4XOT A;  3OWC A;  3SJM A;  5GAH J;  4ONW A;  1R57 A;  4UWJ A;  4ZZL A;  3B3C A;  2M9H A;  3KFW X;  3CJQ B;  4CDG A;  4Y13 A;  1WJF A;  4ZX8 A;  2I79 A;  3LWF A;  4IX7 A;  3LSP A;  1RXT A;  4KLW A;  3QYF A;  3M1C A;  2DO7 A;  2HC9 A;  1J5Y A;  1O3S A;  1S7A A;  4PFP A;  3JTH A;  2PVW A;  3HPH A;  1T56 A;  2E35 A;  2NOJ B;  5ED4 A;  1CX8 A;  3W6X A;  2QSG X;  1YW6 A;  4A3M J;  2ZOG A;  1ETW A;  2ZXH A;  5JI6 A;  4A6D A;  3BDD A;  3UKG A;  4NQW A;  2XPW A;  3BCA A;  5IYC J;  1VQN I;  5F0H A;  4WCG A;  2R8V A;  3JRH A;  2O7O A;  4B48 A;  3KHZ A;  1K4J A;  4ORF A;  3AG1 H;  3SJG A;  3OIQ A;  2HUZ A;  1WFX A;  2OCE A;  2L5Q A;  2P5K A;  2LVS A;  3D5S C;  4M6V A;  3ZP5 A;  4WK8 F;  2DA6 A;  4ITV A;  3GTO J;  2IJZ A;  3IWE A;  5HVH A;  3DKW A;  2MGQ A;  2IAI A;  1XEB A;  3GBG A;  3GZ6 A;  3QP6 A;  1HKT A;  2O8X A;  2OAZ A;  2LOO A;  2JZY A;  3JTG A;  2GLJ A;  2IGN A;  2YX4 A;  4IUS A;  2R7R A;  2FNP A;  3PFI A;  2K85 A;  3ZRG A;  5E3N A;  4M3D A;  2E34 A;  2FBI A;  2LFB A;  4PCQ A;  1J59 A;  3ZMV A;  2Y0S N;  2VZY A;  2CMP A;  3UR3 C;  2HS5 A;  4ON0 A;  1APL C;  4LX9 A;  1RZ4 A;  3A01 A;  2CW7 A;  3IFE A;  2LK2 A;  1U9O A;  1YS6 A;  3KIO A;  5F0C A;  4B5P B;  3VWD A;  1R23 A;  3IJ3 A;  4JQF A;  4NGS A;  3S8P A;  1B59 A;  3QYB A;  2D45 A;  3ROU A;  2W84 A;  1TW2 A;  3FXT A;  5E1W A;  4H6U A;  1IO2 A;  4L5I A;  1AWC A;  4FIS A;  2EFW A;  4KVM E;  5FO5 A;  4C2T A;  5G20 A;  2A69 F;  2P81 A;  3K2A A;  1P4A A;  4A6E A;  1EA3 A;  3BRO A;  4F7Z A;  2C27 A;  1T6S A;  4MGR A;  3V42 A;  4FWU A;  4LB6 B;  4IPA A;  3I5U A;  4CCO A;  4EGZ A;  2H27 A;  4FUU A;  2DMU A;  4X2T A;  4B1R A;  1S7F A;  1A5J A;  4KOS A;  3RPU D;  3MKY B;  2CNM A;  2V9K A;  3QOD A;  4IKF A;  2VON A;  5IP7 J;  5LEJ A;  1KQ8 A;  2V8H A;  2TDX A;  2RQP A;  2QWW A;  3CO7 C;  3AG3 H;  1CPX A;  5KNL A;  1USS A;  4RM3 A;  4A2U A;  2OZU A;  2P6G A;  1JKQ C;  5HS8 A;  2DDA A;  1VF9 A;  2FA5 A;  2VL8 A;  1LDJ A;  5LLQ A;  4MHZ A;  1YJN I;  4E2A A;  1U0J A;  1G6N A;  2V26 A;  4D5F A;  2HFH A;  5M5Y J;  4HAM A;  2JTV A;  3OYK A;  3M8E A;  1CBX A;  4AVZ A;  2EQR A;  1NH3 A;  2Z3M A;  3GUX A;  3TOB A;  1GXP A;  4CZC A;  3JRC A;  4IHS A;  2LC2 A;  1Z7U A;  3IAS 2;  3CCJ I;  2ISY A;  5CJ9 A;  4CHU A;  1EV7 A;  1FC3 A;  1FWZ A;  4QIW N;  1OLT A;  2PJ2 A;  4DYO A;  3B6A A;  1PUF B;  4JXR A;  2UXN A;  2NYQ A;  1R3N A;  4WX9 A;  3S17 J;  3I0T A;  1G3W A;  4XSZ F;  4EM0 B;  2VBZ A;  1M4G A;  4M6Y A;  1R1V A;  1FNN A;  1D5Y A;  1W1W E;  5HVF A;  1U6G A;  1BC8 C;  4AIJ A;  2PCU A;  3PNY A;  3SZP A;  2CXA A;  3HJE A;  1I6H J;  5H86 A;  3RAM A;  2KLO A;  1H89 C;  2WY8 Q;  1GUU A;  1RR7 A;  5AIQ A;  4U7B A;  2F6C A;  1TWG J;  1U9N A;  2IT0 A;  1TXR A;  2XEF A;  2IS1 A;  3F8M A;  4XN0 A;  4LMY A;  4E4H A;  2ZB9 A;  5L3F A;  2H5M A;  4Q48 A;  4F93 B;  1WJC A;  3D7F A;  1SFX A;  4LG0 B;  1M4D A;  2G0B A;  4MQ9 F;  2NVY J;  5J8F A;  1DQU A;  3KZI C;  4UB8 C;  3FIW A;  2IGM A;  1VI0 A;  2JJ7 A;  4P4B A;  2EIK H;  6CPA A;  1BJZ A;  1R5I D;  2E19 A;  5AG5 A;  4C30 A;  2PMZ A;  4ZDL A;  4UFX A;  1QSN A;  4M6I A;  1WKM A;  2FXA A;  3KYD B;  3OV8 A;  1R71 A;  2DA7 A;  1HDU A;  1YLE A;  3DV8 A;  1A2Z A;  1K61 A;  2DJI A;  2Z3O A;  2LRD A;  3J81 Z;  1VFC A;  4IQJ A;  1NE9 A;  3FZV A;  1YQA A;  3ZJ0 A;  1KYW A;  4E7J A;  1YI2 I;  3VSL A;  4HNX B;  2ZFU A;  4L5E A;  2W4S A;  1BM9 A;  3LA7 A;  2XUB A;  1LFU P;  1MSF C;  1T38 A;  3J80 Z;  1S5L C;  1JI8 A;  2ARH A;  2JA5 J;  1Q1V A;  2VEZ A;  2Z0Z A;  2ZEG A;  3PB6 X;  5DEQ A;  3K4C A;  1AKH A;  3WC7 A;  2ZW6 A;  4EJV A;  4C7I A;  2EFP A;  3H3V K;  3TFY A;  2GE3 A;  1WWX A;  1KUX A;  2BHY A;  2H1L A;  2O61 A;  2Q2E B;  1BR2 A;  2XF7 A;  5AON A;  2RAE A;  4EFD A;  1XD7 A;  2E71 A;  5ILS A;  1JJ8 C;  1XGS A;  3GY9 A;  4B09 A;  3P9I A;  4AG7 A;  1P4W A;  3BR6 A;  4B3A A;  4LG3 A;  3S2D J;  1AMP A;  1IU8 A;  2O5R A;  1TW3 A;  4B12 A;  3KL9 A;  2MA3 A;  5DUI A;  2VE9 A;  2P6S A;  1D3Y A;  5JM6 A;  1OR7 A;  1G3S A;  4OAZ A;  4A3B J;  4YRH A;  4BMH A;  5HOD A;  1I1S A;  2WPW A;  1W5T A;  3H8F A;  4S05 A;  4A32 A;  1BBY A;  2DPU A;  2MH2 A;  2AS5 F;  1ZH5 A;  4C3J J;  4ZBG A;  5EG0 B;  1IRX A;  3W91 A;  1S7E A;  1YYV A;  3OYE A;  4L9N A;  4FBE A;  3EO4 A;  2UZK A;  4I0B A;  4LB5 A;  2V1N A;  3GIU A;  2EWB A;  2NMT A;  4ZGY B;  3CDI A;  5EZH A;  4XRM A;  3H0G J;  2DEA A;  5CPR B;  3QU6 A;  2VZZ A;  1RUN A;  4ZY2 A;  3VYT B;  2NNY A;  2BV6 A;  4AXV A;  2H1K A;  1MSE C;  1ZO0 A;  4JYK A;  2HGC A;  1GVJ A;  1RET A;  2W25 A;  3EET A;  3D68 A;  3DTE A;  3KP4 A;  4KIF A;  4FD6 A;  2DOE A;  2Z1D A;  4Q4Z F;  1OQY A;  3IO1 A;  4CAV A;  1FBU A;  2Z99 A;  3WG9 A;  4Q7A A;  5LRJ A;  1XCV A;  2DA3 A;  4XPL A;  4DOZ A;  1AHD P;  1X3Z B;  4OU0 A;  3ERE D;  2OTJ I;  4R3K A;  2BZT A;  4PK4 A;  2Q43 A;  3VDX A;  2Z3L A;  3O8H A;  2M4K A;  3T8T A;  4HW0 A;  1BOA A;  4B13 A;  2L54 A;  3GTK J;  2OCC H;  3KE2 A;  4Q36 A;  2PI0 A;  2LG4 A;  1LAP A;  4CPA A;  5HDN A;  1LVA A;  4UEZ A;  1ZR4 A;  4MO7 A;  2B4D A;  4A95 A;  1Y0N A;  3V7C A;  2BHZ A;  4TV7 A;  3KZY A;  3K1M A;  4JLY A;  1T08 B;  5IB9 A;  4OOI A;  1HW5 A;  4AM3 A;  1IGN A;  4PXE A;  3C3W A;  2YND A;  2I5U A;  4E0A A;  5D6E A;  3FK7 A;  4DIQ A;  3B8G A;  1BC7 C;  3SDG A;  4IRG A;  1YSJ A;  4KMF A;  3E5U A;  3BC8 A;  1P4N A;  3R60 A;  4P5O A;  3KQX A;  3TO7 A;  1XJO A;  2P5L C;  4ZC3 A;  3PM1 A;  1A6I A;  1OCC H;  4BQA A;  3CUQ A;  4UUS A;  2JWT A;  4A94 A;  4P4J A;  1B9N A;  4F0Y A;  2AXT C;  1QPM A;  1MMA A;  2V9P A;  3ABL H;  1OR7 C;  2ZME A;  2P6F A;  1X4P A;  1NSA A;  4BBH A;  5E17 F;  3R9E A;  1Z3Y A;  3MFK A;  3CCM I;  4FCY A;  2IEK A;  1ZRF A;  2AFS A;  3DP7 A;  2GAN A;  1R22 A;  3AL0 C;  4X5K A;  1R36 A;  1SC7 A;  4NC8 A;  1FLI A;  2CFO A;  3E7L A;  3VPR A;  3HRS A;  4NSQ A;  4J3G A;  2DQR A;  2EZK A;  4I0A A;  1SFO J;  4D5C A;  1JKP C;  3DKY A;  2G9W A;  4LJZ F;  5LYL A;  1PCA A;  2HI3 A;  3R96 A;  4K30 A;  3K4L A;  1FMV A;  3OL3 A;  4XON A;  4AVP A;  2NSM A;  2L7Z A;  3NAR A;  3FWE A;  1KZH A;  3GTP J;  1QSM A;  3D3S A;  3DR6 A;  4OIO F;  3H3Z A;  5CQE A;  1IYL A;  3HKZ N;  4XR6 A;  3R6S A;  2VUM J;  1XMB A;  2GAU A;  3FM3 A;  4PUS A;  1DE4 C;  5LBQ A;  3KET A;  3VB2 A;  1VHO A;  3C18 A;  4DZP A;  1LB2 A;  2REF A;  3CP8 A;  2EFO A;  1OBR A;  1QVT A;  3QAY A;  1TQI A;  1M4L A;  3DDD A;  4CGM A;  1U5T B;  2DQL A;  2HPI A;  3FNC A;  1ZGA A;  2RQQ A;  2EK5 A;  5M3M J;  3C2G A;  5IOZ A;  1REP C;  4RGS A;  1UG2 A;  3I9V 2;  5KTD A;  5EJC A;  3GKR A;  3QOP A;  2W24 A;  2K9Q A;  2K40 A;  3JUW A;  2KDZ A;  1IW7 F;  3TW6 A;  2W1O A;  1LE8 B;  3FED A;  3S6K A;  4OID A;  2NYX A;  1OCT C;  2M87 A;  2I10 A;  1F36 A;  4HNW B;  5GPC A;  3LAP A;  3CPX A;  4CAW A;  2XAS A;  4C9Y A;  4RM2 A;  3OMY A;  5E1X A;  3TQN A;  5LD2 C;  2TCT A;  5J8C A;  4EWT A;  3ZQF A;  1DPR A;  4UIB A;  4AWX B;  3CME I;  3SJX A;  4CGZ A;  5CLS A;  2H6C A;  4D0P A;  4U9Z A;  4U0Y A;  3ASN H;  1R4M B;  2YSR A;  2R1I A;  3BY6 A;  5JGF A;  2OTL I;  4B11 A;  3PQK A;  5LYF A;  4K2E A;  1XRY A;  5E3L A;  2FOW A;  2Q44 A;  4OC1 A;  2VBW A;  2OC6 A;  4UV9 A;  5EEA A;  3J81 K;  3M8F A;  1I3Q J;  2ZME C;  1Z77 A;  3NEU A;  1FX7 A;  2FQ4 A;  2JPB A;  4XNH C;  2DOF A;  3G71 I;  3MAJ A;  4WJB A;  2DT5 A;  4UFW A;  3DPU A;  5E8I A;  4NGQ A;  1LOK A;  4OMZ A;  3AG4 H;  3J80 K;  2KT0 A;  4IO9 F;  5KK1 A;  4E70 A;  3P2F A;  4OIN F;  3EUK L;  4YFK F;  1JKR C;  5AIP A;  4OMY A;  2Z3P A;  3TP0 A;  2YX7 A;  1CF7 A;  4BNC A;  4X6A J;  5K8O A;  2L7K A;  2LP0 A;  1ODD A;  3GXO A;  1YGH A;  4A3D J;  5FLX Z;  4RAF A;  4A3F J;  3H9J A;  1MBK A;  2KIF A;  1MIJ A;  1V5E A;  2MD5 A;  3FBI B;  3VEP A;  5K7Z A;  4ZYD A;  2CV1 A;  3OYA A;  3QQA A;  1EF4 A;  3NH4 A;  2XVC A;  2N8G A;  3WGI A;  1WJA A;  1VQ8 I;  1LAM A;  5KAI C;  1MMD A;  5L3D A;  2ABZ A;  3R4K A;  1JUP A;  2PJR A;  1Y9W A;  1XG1 A;  3ISP A;  2VJI A;  4OP4 A;  3BR2 A;  3MN8 A;  1YVO A;  3BT9 A;  2A6T A;  3S3O A;  4G1P A;  2CUE A;  1IG7 A;  1XB4 A;  4KN7 X;  4Y3O A;  2EV6 A;  1YME A;  2V79 A;  3HOY J;  2ZKZ A;  1KQ0 A;  1ONV A;  1QQ9 A;  2Q0Y A;  3U1K A;  3U1D A;  2IA2 A;  2GXB A;  2BGC A;  2RRE A;  1VKC A;  3R95 A;  2K4J A;  4LLN A;  2HKO A;  5AGE A;  4E8O A;  1OYY A;  1IRF A;  2VQY A;  4CYQ A;  2COB A;  4HBL A;  4ABZ A;  4MBU A;  1JJ6 C;  4KOR A;  3ZGK A;  1SD5 A;  3JRD A;  4YG2 F;  2J8M A;  2TRT A;  3QPT A;  1ZRE A;  5KVR A;  3K2K A;  4BIN A;  3GZ5 A;  1X1P A;  1IV8 A;  4XMY A;  4X0G A;  4HOB A;  2BY1 A;  4BU2 A;  3MZH A;  1SFU A;  2VPL A;  5I4M A;  4II3 A;  1Z05 A;  3F22 A;  4QBJ A;  1MDM A;  1UMQ A;  3CXS A;  1SMY F;  2A3S A;  3MVP A;  5LGT A;  3EC4 A;  2IS6 A;  2ZJR F;  3DTI A;  2A61 A;  2EK8 A;  1SD7 A;  4PXD A;  2ZC2 A;  2R7U A;  4KOX A;  4G6Q A;  1KU3 A;  4EJT A;  4O6J A;  5EGO A;  4GFB A;  3DEE A;  1TWA J;  2RKH A;  2QA4 I;  4A31 A;  1XPX A;  1IC8 A;  1XBU A;  2BXY A;  3HGG A;  4KIT B;  4XKV A;  5D4R A;  1MNM C;  2AFX A;  4KOV A;  1JXS A;  1HDD C;  4MMO A;  4A3L J;  2CW0 F;  2WC2 A;  5IT3 A;  1S7N A;  4L0Y B;  2B9S A;  3DXJ F;  3L2U A;  3M8J A;  2ZEH A;  4EEF G;  4PK3 A;  4PV6 A;  4DJA A;  2FUG 2;  3K0L A;  2KP6 A;  2ZEE A;  2HB6 A;  5BPD A;  1QHH D;  2E1C A;  1SAU A;  1MMS A;  1Y8R B;  1PP7 U;  3OYF A;  3ZN0 A;  3BR1 A;  1ETY A;  4R1H A;  2E60 A;  4HPQ A;  4HZF A;  1Q2D A;  1XS9 A;  1GDT A;  4LK0 F;  4YIR X;  1Z2L A;  3HXL A;  3MZY A;  5DYM A;  2EIJ H;  3HGY A;  3OYH A;  2JBJ A;  4YU9 A;  5F64 A;  2E1O A;  2R7H A;  2RNJ A;  1T2K A;  4A3K J;  1W7P A;  3O2P E;  2KCW A;  3AG2 H;  1ZLH A;  2HVQ A;  1SVL A;  3TOA A;  3R61 A;  2IRF G;  2HV2 A;  1J4J A;  2R93 J;  4HRI A;  3WC6 A;  1FP1 D;  1W4M A;  4DNC A;  2DPS A;  3A0B C;  3OYG A;  1SQH A;  3CF2 A;  4PGH A;  1FTZ A;  3BTJ A;  4QTR A;  3TDZ C;  1NG6 A;  3IH3 A;  5M3F J;  3OR1 C;  4ZTJ A;  5CVR A;  3LSM A;  3EFA A;  4BD9 A;  2A07 F;  3CC7 I;  2PJ9 A;  3D7G A;  3JSP A;  2G3T A;  4MFP A;  4AVA A;  4XN3 A;  1PYV A;  2GOX B;  3DPL C;  3BJ7 A;  4XLH A;  2P8T A;  3Q5F A;  2ZNZ A;  2PJ8 A;  3V8I A;  1G3Y A;  3H9G A;  3OYB A;  4PPZ A;  4MIM A;  3HOW J;  1ACI A;  1P92 A;  3JVN A;  5KTC A;  4L18 B;  1TNS A;  2Z3N A;  2M45 A;  3F6O A;  2Y9Y A;  5JLX A;  3TCV A;  3EYY A;  4FAS D;  1Y0R A;  1X2N A;  3SEZ A;  5D8K B;  4AC0 A;  4ANJ A;  1MBG A;  5L3E A;  4MEY F;  2PQ8 A;  5E8G A;  2XB5 A;  5IPA A;  3WE2 A;  1SFK A;  2JMW A;  2UUZ A;  1NMT A;  3D67 A;  2BEO A;  3ABK H;  3CCU I;  2VOP A;  2PJ1 A;  3CLO A;  4ESF A;  1RC9 A;  3T8R A;  3OYI A;  4FAI A;  1C0W A;  3FM5 A;  4PK2 A;  2RN7 A;  1JHH A;  3WAB A;  5BQT A;  1TKH A;  4QUS A;  2FL4 A;  3B3V A;  2QSF X;  1ZGW A;  1TQM A;  4P1W A;  4DYR A;  4IF4 A;  4GO1 A;  5HS9 A;  2MSY A;  2WBM A;  4RGU A;  3JRI A;  3CC4 I;  1IYK A;  4C2Z A;  2HEO A;  2Z16 A;  3R9F A;  1ON2 A;  3BPX A;  3RYR A;  2F5F A;  2FE7 A;  5F47 A;  4BH9 A;  3HOV J;  1WRJ A;  2V8D A;  1U3E M;  1R6R A;  2E1M B;  4N9I A;  1SVO A;  4RMN A;  5DUK A;  3DLA A;  4EJW A;  1PDN C;  4XLA A;  1SMT A;  3KLN A;  3KAS A;  3BJ6 A;  4I98 B;  2O03 A;  3LFK A;  5FLX K;  2ZXW H;  2VB6 A;  5JHU A;  3PUF A;  1PYT B;  1MKM A;  4HNV A;  3WTZ A;  3KLO A;  2NAZ A;  3RSN A;  3K6G A;  2XSD C;  4P6Y A;  4I2O A;  2H09 A;  2F8H A;  2AFW A;  4P4I A;  3E5Q A;  5DDG A;  4P44 A;  1MMG A;  4CCK A;  2DDB A;  2GWR A;  4MHN A;  3GTJ J;  2PFB A;  2ZEM A;  4C2X A;  1Z67 A;  4IZZ A;  4CXF A;  5F1R A;  1VIX A;  3ML6 A;  4KUA A;  3K9T A;  3LSJ A;  5HLT A;  4MI4 A;  3GTQ J;  2X6Y A;  4X8I A;  3EDP A;  1N78 A;  1FEX A;  1R00 A;  2WV0 A;  1Y56 A;  1BN5 A;  3DEW A;  2ZSH B;  4YIF A;  3OYM A;  4OC3 A;  2R7S A;  2QUF A;  4KIC A;  3ISZ A;  4G12 A;  2VC0 A;  2M2E A;  3GW2 A;  4I76 A;  2QBY B;  3PBB A;  5F09 A;  5ERI A;  3NE7 A;  5D8N A;  4P4D A;  1FSE A;  1I21 A;  2QEC A;  2OD5 A;  4I6Z A;  4LIT A;  4OC0 A;  3ZQC A;  1DTD A;  1LPQ A;  4B8X A;  4NXY A;  2QVO A;  3FXK A;  3I71 A;  2FIA A;  4BBS J;  3H1C A;  4IXA A;  1P9Q C;  2D4O A;  1FSH A;  2FF4 A;  4M73 A;  4P4E A;  3IIB A;  2R5Y A;  2K4B A;  1SD6 A;  2Y69 H;  3PNT A;  2CW8 A;  2HXO A;  5C4X J;  4R87 A;  1EJ9 A;  1Z0X A;  1YIJ I;  1UJ8 A;  3LL7 A;  1S7L A;  3REO A;  3LQR A;  1V0C A;  4IRI A;  1W36 D;  1UG0 A;  2HR3 A;  2XIG A;  1K78 A;  3IU1 A;  4PFO A;  5F46 A;  3PB9 X;  5JR3 A;  3FF5 A;  3HOT A;  4IOC F;  2ZJQ F;  3B3W A;  1Q2Y A;  4MFE A;  1DP3 A;  3FXJ A;  2X1C A;  2XHK A;  4A39 A;  1O3Q A;  1X3W B;  3DWL E;  1K4T A;  2EH3 A;  5F08 A;  1MND A;  3F23 A;  3GLL A;  5C3E J;  5GAG J;  4BQN A;  4E7S A;  2FSR A;  3VWE A;  1HST A;  1UCR A;  2HQR A;  2HZD A;  2LDU A;  1VHS A;  1VQP I;  2CQX A;  3HRT A;  3FHZ A;  2O9L A;  2VL1 A;  2P0W A;  4BDZ A;  1NK2 P;  4CAX A;  4XLC A;  3K69 A;  1W5C C;  2G7U A;  2JRT A;  2P6T A;  1KU7 A;  2HDD A;  3DBL B;  1I3A A;  1ETO A;  3S2W A;  2BCO A;  4LUA A;  1Y9K A;  1KYZ A;  1BW6 A;  4IAV A;  4OKO A;  4I7H A;  3FMR A;  2OR4 A;  5H84 A;  2EV0 A;  3L09 A;  2LKS A;  1JWQ A;  1P0H A;  3G73 A;  3GLJ A;  3N05 A;  1TNT A;  3P9C A;  2FQ3 A;  4B44 A;  4NUB A;  2Q4V A;  3OWT A;  2LY9 A;  3IWZ A;  1OZP A;  3HTU A;  4ZH4 F;  4C68 A;  3TO9 A;  3OL4 A;  1IOF A;  4GYI A;  4IL6 C;  4FT8 A;  1IRZ A;  1K83 J;  5J4V A;  2F5I A;  2A6H F;  4NJQ A;  3FH4 A;  4M9Z A;  1K6O A;  3DGV A;  3PFE A;  2QKM B;  2GBY A;  5FRM A;  3KPH A;  1JKO C;  2FIW A;  3HTS B;  1WZ2 A;  2R7T A;  1HF0 A;  4BE1 A;  1XDS A;  2P7C B;  3FRM A;  3NWT A;  2GFQ A;  2NRA C;  3IHU A;  1F9N A;  4CGO A;  3P9K A;  3SI0 A;  2X1E A;  3FVL A;  2DTR A;  1WH5 A;  1VGY A;  1Y6I A;  3I59 A;  4E7Z A;  2EFN A;  1BPN A;  5J47 A;  3OYN A;  2O8K A;  2FCK A;  3DTK A;  1VQ4 I;  3BZC A;  1QA6 A;  3F0C A;  2ZFW A;  5CVI A;  3PO2 J;  4LLL A;  2FXF A;  4HNY B;  2PBI A;  3QRF F;  2AJ6 A;  1G3T A;  2VKV A;  4I02 A;  4BDY A;  4A3I J;  3IRQ A;  1ULY A;  1WHU A;  1O3T A;  1YTY A;  4U0W A;  1L0C A;  4XKC A;  3H3U A;  2EUI A;  3LD2 A;  3E6B A;  2K3P A;  2CV2 A;  3K2Z A;  3AFH A;  3BG6 A;  1RO5 A;  1ZG8 A;  2BYV E;  4C2Y A;  4AVB A;  2MC4 A;  3W6J B;  3PGP A;  1VQ5 I;  2LNB A;  3S3M A;  2QQA A;  5DS9 A;  3V7S A;  1H8L A;  1TKF A;  5IB0 A;  2LD5 A;  4XSX F;  4XOP A;  4BAY A;  2BY2 A;  4A0Y A;  2F4I A;  5HVG A;  3DNS A;  3OR2 C;  1HDQ A;  2PLY A;  2PR1 A;  2FRH A;  3H5R A;  1YG2 A;  2OA4 A;  3A02 A;  1YVK A;  2B7E A;  3I3L A;  2XEJ A;  3M9A A;  2XB0 X;  5C4J J;  3E6M A;  4NB5 A;  3BQY A;  3WU0 A;  5LYD A;  4CO8 A;  3F8K A;  2DFI A;  2IS4 A;  1YX0 A;  3NAU A;  2EZH A;  2XAU A;  2QVP A;  3ZCO A;  3HUG B;  2X7B A;  2QM3 A;  3UNG C;  1HA8 A;  2XGX A;  3LMM A;  4PZJ A;  3B3S A;  1B72 B;  4JXQ A;  4NGM A;  1TF9 A;  5LRG A;  2I3C A;  1B8I A;  5FGM A;  4XKW A;  4A3E J;  4XNF A;  4DBR A;  1ZGJ A;  4KJZ A;  3L2Q A;  3I53 A;  1LEA A;  3SZG A;  3S6F A;  4BJ6 C;  4UV8 A;  4CH7 A;  1KA8 A;  2E36 A;  1RKT A;  2VI6 A;  3NRV A;  4HYE A;  4IHW A;  3B73 A;  3ZR8 X;  3J7A Y;  3S14 J;  3I4N J;  4M71 A;  4KIG A;  1I1D A;  1YR0 A;  2LY1 A;  3RO0 A;  4B43 A;  2ZXV A;  3DFG A;  2JDD A;  1FBQ A;  3I1U A;  3HSR A;  3OSG A;  2M34 A;  5K7F A;  2QLZ A;  3JRA A;  3CF5 F;  2EO8 A;  3F0A A;  4G6T B;  2JQ7 A;  3SEQ A;  3SYT A;  2YNC C;  2LBF B;  3R1K A;  5J1Y A;  1YO5 C;  5JHF A;  2CGP A;  2B5G B;  3FXL A;  4EJU A;  3IC1 A;  3MRU A;  5K7H A;  9ANT A;  5E96 A;  1IDZ A;  1UFM A;  1B1B A;  2W48 A;  4XRS G;  3KEQ A;  3SJE A;  2H6B A;  2HYF A;  1V5F A;  4QC6 A;  2FOK A;  4YII A;  1UEL B;  4DJL A;  1UHM A;  3LA3 A;  4E7L A;  1T39 A;  4ESJ A;  4ZYA A;  1N71 A;  2DI3 A;  5J1Q A;  2Y31 A;  2LKP A;  1TWF J;  4GCV A;  4ETS A;  3OS2 A;  2RC4 A;  4HF1 A;  4X3R A;  4OIP F;  3RIR A;  2IS2 A;  1WJE A;  4P9U A;  4ESB A;  3QWL A;  3V8L A;  4BEH A;  5DS0 A;  3IH2 A;  2QGU A;  2AQF A;  2WB1 N;  3W3C A;  4XLF A;  4AYB A;  3VYS B;  2C1C A;  3IWF A;  3CCS I;  4CYC B;  1QSR A;  3RKX A;  4KSA A;  2CTC A;  3GEZ A;  4WXC A;  4FX4 A;  4KOY A;  1FOX A;  2F5D A;  1B4A A;  4CAF A;  2DU9 A;  2X4H A;  3PB4 X;  1WJD A;  2XC7 A;  2KRF A;  3H35 A;  2VLA A;  3BLN A;  1A36 A;  3W2A A;  4NDL A;  3ZQH A;  4PJ0 C;  3K70 C;  1J75 A;  2ME0 A;  5CVU A;  4F91 B;  2VKD A;  3MKL A;  2DF5 A;  2Y30 A;  1RI7 A;  2VKE A;  3NFZ A;  5BNG A;  2PSW A;  5A28 A;  1H88 C;  4UA3 A;  5L3C A;  4Y49 B;  5CPA A;  4MHY A;  1WCM J;  2F5E A;  2GU2 A;  2FBK A;  3K10 A;  2HNH A;  4IOA F;  1FT9 A;  2IL4 A;  5ELY A;  3V4G A;  1Z4R A;  2CNS A;  3FEE A;  1BAV A;  3PEI A;  3O3K A;  2VQL A;  3OYL A;  3ZMS A;  4HF2 A;  2V1X A;  4FD5 A;  2O0Y A;  4L9T A;  4OLL A;  3RZA A;  2JSC A;  5IY5 H;  4CA0 A;  1LDD A;  1P4X A;  4RA2 A;  3PIP F;  2BOL A;  3CDH A;  3E1S A;  2CUJ A;  2ELJ A;  1LDK B;  3PFY A;  2ZW5 A;  4JJX A;  2K02 A;  4KVX A;  2QF7 A;  2FNA A;  1R58 A;  2DOD A;  2ID6 A;  1JTY A;  4FQG A;  3S1R J;  4H0E A;  3BJ8 A;  3HIF A;  2AFO A;  1Y0Y A;  1Z6R A;  2LRE A;  3TMO A;  2DXI A;  2OQR A;  2DFE A;  4MLO A;  2Q0O A;  3J7Z I;  4IQ4 A;  2PVV A;  3BTI A;  2FT0 A;  2CUZ A;  3WTU C;  4QWQ A;  4BE0 A;  3PUB A;  1IOI A;  4KLV A;  1R1T A;  2CSO A;  2VIX A;  2PG4 A;  4Z6Y A;  4B14 A;  4R57 A;  2AXL A;  1FY7 A;  3MQ0 A;  3RKY A;  3T1B A;  3ZXS A;  4NNJ A;  4EV0 A;  4EM1 A;  3CQZ J;  4XID A;  5IYD J;  3IGR A;  2JVG A;  3SI2 A;  3Q9S A;  4MFJ A;  4HDV A;  3PL8 A;  2JA8 J;  3D2P A;  3FF3 A;  5EMI A;  4M3F A;  3RDI A;  5FLM J;  5LRS A;  2PIZ A;  1TLH B;  4PSW A;  2PJ5 A;  3H4Q A;  1U8B A;  2VT3 A;  3CES A;  3OSF A;  3KZW A;  2Y48 A;  2K7L A;  2OV7 A;  1IGB A;  3LWU A;  3GLX A;  3VAR A;  1VHE A;  4AVC A;  3CXP A;  4ZX9 A;  5ILU A;  2R3S A;  3DLL F;  5LRK A;  3WU1 B;  3JW4 A;  1SEU A;  1JUM A;  1VTN C;  4YRV A;  2F48 A;  3U21 A;  2ZED A;  3IP4 B;  3ABU A;  2HOA A;  4S04 A;  1E3O C;  5EBV A;  4BGD A;  4M72 A;  4PXC A;  5KAF C;  2M4G A;  2JBK A;  1YW9 A;  3EUA A;  3PFO A;  1FMW A;  2CUF A;  4FET A;  3H5Z A;  1ELL P;  2UWM A;  4UBR A;  3L1P A;  2F7V A;  4KZT A;  2HPM A;  3AAF A;  1TF8 A;  4RB2 C;  3IUO A;  4R76 A;  3E6C C;  2HOT A;  3KI9 A;  2M0C A;  3QNV A;  4F8Z A;  5I0C A;  3FKI J;  3S1N J;  4JYW A;  3TT2 A;  4OC4 A;  1Y1V J;  1TT0 A;  3CZ6 A;  4YFX F;  1PU9 A;  3OY9 A;  2LF8 A;  2XGC A;  1FTT A;  2KJB A;  3BG7 A;  1OCZ H;  1U2W A;  2ME6 A;  1D1B A;  1XMK A;  1V5G A;  3FXQ A;  4G6D A;  5E20 A;  1AUG A;  4CRY B;  2CG4 A;  4NQW B;  1Z9C A;  3KHX A;  1HKS A;  3RKW A;  4MCS A;  1QU3 A;  3EPZ A;  4MJ8 A;  4UCN A;  2I8D A;  3A03 A;  1RR8 C;  4NGR A;  2HYJ A;  2VE8 A;  5J6X A;  1OIS A;  1DP7 P;  1FPQ A;  4CCM A;  4A3G J;  2LYC A;  2Y0M A;  3LSK A;  2R5Z A;  3WHB A;  1QZY A;  5ICE A;  1IJW C;  5ISV A;  3GVA A;  1P7I A;  3CMY A;  2A05 A;  2GLF A;  1Y7E A;  1FBS A;  1L0O C;  4XPD C;  5K8N A;  3WGH A;  2DPT A;  1IUY A;  2QZ8 A;  2K9N A;  5E1Z B;  4C2U A;  2PJ4 A;  5LHI A;  2E5Z A;  3KYC B;  4IF5 A;  3QPL A;  1O7F A;  4FTH A;  4D7M A;  5K5R A;  3G6E I;  2LR8 A;  5FRN A;  3KQZ A;  2ELK A;  2DA1 A;  2VAS A;  1PP8 F;  5HNH A;  2M5W A;  3V8J A;  3WGG A;  3X2Q H;  4RUH A;  4CZZ A;  1HQC A;  4JOM A;  3A01 B;  4XLN F;  5FKO A;  4MHP A;  5DCM A;  2DA2 A;  1MW7 A;  1YS7 A;  2E7X A;  2JA2 A;  2JVH A;  2VKH A;  4QLC U;  1UFH A;  5DD4 A;  4HV5 A;  4LOC A;  2JEV A;  4UUV A;  5FD6 A;  4ENK A;  2ODF A;  2XAF A;  1ZAR A;  1RIO H;  1S9H A;  2LMD A;  4H89 A;  1IV6 A;  2ZO4 A;  3EY5 A;  2CIJ A;  3CP2 A;  2YPR A;  2IA1 A;  2VQH A;  4GGG A;  2AFU A;  2DMP A;  2R7F A;  1Z9U A;  2PJ3 A;  1VQM I;  4EAT A;  3OYJ A;  2ZPA A;  4LQG A;  4NGP A;  2R0Q C;  5A27 A;  2ISZ A;  2BW3 A;  4IHY A;  4KA4 A;  4P4F A;  4DBQ A;  3SZT A;  3HBL A;  1HXD A;  2XEI A;  3H92 A;  3PB8 X;  3RI4 A;  4M9X A;  3OYC A;  1FT7 A;  3G2B A;  4M74 A;  2KHM A;  3JAM Z;  3TBI A;  3S6G A;  5KCM A;  1MBJ A;  1SFE A;  1MNE A;  3B35 A;  3K4K A;  3BXM A;  4JD6 A;  4M6X A;  2XAQ A;  3SFI A;  2BY0 A;  4BJT A;  1DGW Y;  4AD9 A;  4AUX A;  5FJ8 J;  1Z8L A;  4L89 A;  4NCZ A;  4A30 A;  1S6L A;  1SVM A;  2J8R A;  3LA2 A;  2ESN A;  4QB9 A;  2Z3Y A;  3FXU A;  5HS7 A;  1FOK A;  1QRY A;  2GRE A;  4HQE A;  2XF5 A;  3JSO A;  1EH6 A;  1HKQ A;  1MJA A;  3TX8 A;  2KIM A;  4HQM A;  5J3L A;  1A31 A;  2R7D A;  2Z11 A;  1KU9 A;  3RCO A;  3ASO H;  3BG5 A;  4LGW A;  2FSW A;  2L3D A;  3HHH A;  1WQ2 A;  2M0M A;  3VH9 A;  3WR7 A;  3B7I A;  3BPV A;  5GAD J;  1IF1 A;  2LTP A;  3HZJ A;  2O6G E;  4Y52 J;  1UWY A;  1TWC J;  1J7K A;  2V8V A;  2VQG A;  1L3L A;  3RNZ A;  2CY2 A;  1J2X A;  3DU6 A;  4W9Y A;  4RI1 A;  2QEN A;  3LOD A;  2QQB A;  2HQ5 A;  4XLE A;  1ZG7 A;  4P45 A;  2JT1 A;  3I58 A;  3FJU A;  5IX3 A;  2DMT A;  2UXX A;  2CTB A;  3EXN A;  4OME A;  1Z21 A;  5J4Y A;  1QGP A;  1RPW A;  1V54 H;  2D1V A;  3HC7 A;  5CYV A;  4BJ5 C;  5F1J A;  4UIA A;  3IC7 A;  5GPA A;  2GA2 A;  4L9V A;  2ZJ2 A;  4L0Z B;  1H8A C;  2XSJ C;  4IK2 A;  3BWG A;  3L7W A;  3HG9 A;  5H6Q A;  1YK3 A;  2G9D A;  4Q38 A;  2EWN A;  3GFM A;  3BG3 A;  2CFX A;  3CO6 C;  2G0E A;  3WTT C;  5CQG A;  3LQQ A;  4W1U A;  3I54 A;  2WUU A;  4J19 A;  2YU9 J;  1KON A;  1QVU A;  4V2F A;  4B3X A;  3WTS C;  2VOO A;  1Z5R A;  3SJF A;  4CS0 B;  1O7L A;  1ARM A;  4ZYH A;  4G7Z F;  4XKB A;  3TGN A;  3G3S A;  2O28 A;  2DMN A;  5DV5 A;  5E18 F;  5HMN A;  1IN5 A;  1AKH B;  2VXK A;  3CZX A;  4DUK A;  1HW2 A;  5GCN A;  2R4G A;  4I49 A;  1IDY A;  2JSP A;  3SXY A;  1HEE A;  2O3F A;  3HPG A;  4D9J A;  2IW5 A;  3F72 A;  1CGP A;  3JRU A;  3CJT B;  3CLQ A;  4MY3 A;  4L5J A;  2JUC A;  2QQ9 A;  2M7A A;  2NNN A;  3JCU C;  3LAC A;  4LQ6 A;  1YJ9 I;  2EA4 A;  2I00 A;  3F3X A;  1ZAO A;  5CNP A;  8CPA A;  2GQQ A;  3OIO A;  4OIQ F;  3MGD A;  4B5P A;  4M85 A;  2ZEL A;  2NVT J;  2XKO A;  2MC3 A;  4C3I J;  5EC4 A;  5LGN A;  1S7O A;  4MTD A;  2PC1 A;  2KPM A;  1YX5 A;  2R7O A;  1STZ A;  3VFZ A;  4HLY A;  3TP3 A;  2PE3 A;  4UVB A;  3SFZ A;  3AL0 B;  3H5A A;  2R98 A;  1YHQ I;  3FIS A;  5DM6 F;  2XAJ A;  1HW1 A;  4PJJ A;  2WZN A;  5KTA A;  3ZMU A;  3IWG A;  4M9S A;  4H2K A;  3KR5 A;  3HUG A;  4H6Z A;  3KKW A;  2A6E F;  2PJA A;  1LFW A;  4P9F A;  1D1A A;  4RS2 A;  5ILV A;  1JGS A;  3OS1 A;  3LOC A;  3DPT A;  1EKE A;  4KUM A;  2CH0 A;  4FHT A;  1B72 A;  5JH9 A;  1WJB A;  3DQV C;  5F04 A;  3S9N A;  3C26 A;  2L9V A;  2VJ4 A;  3D4U A;  4KT6 A;  1F1Z A;  3G3Z A;  4CIC A;  3JRF A;  4J01 A;  4GS4 A;  1NTC A;  3MKW B;  4XQF A;  1XX5 A;  5LEK A;  2CV0 A;  3W6S A;  3D0S A;  5EEG A;  3Q0V A;  4NGN A;  3FXM A;  2EVN A;  2NVQ J;  2PN6 A;  1IN7 A;  1XDU A;  5AG6 A;  2HOE A;  3LSR A;  4DZJ A;  3CCR I;  3ESW B;  5E3O A;  3Q3S A;  4QPQ A;  2B4D B;  2COM A;  2X6W A;  1R49 A;  2DXQ A;  1OJL A;  3CJR B;  2PJ6 A;  1LEB A;  4A5N A;  3KCC A;  2CF4 A;  3ERM A;  2IMO A;  1S7K A;  3E5X A;  4XOR A;  4HKF A;  1YRN B;  5J40 A;  2OJE D;  1PUF A;  2CWE A;  1TC3 C;  5KHD A;  1RRJ A;  2W85 A;  1YLO A;  1JE8 A;  3SXN A;  4N0B A;  4CSW A;  3BZK A;  3RPQ A;  2D1H A;  2PJC A;  2V6E A;  1LFB A;  2J5O A;  2DPD A;  1DPU A;  2XGE A;  1OYI A;  2ZJP F;  2QQ8 A;  5BOX A;  2Z9O A;  3H8G A;  2JUG A;  2DYR H;  1JT6 A;  1OCP A;  1VZ0 A;  2VN2 A;  1G8X A;  2W57 A;  3CUQ B;  4ZDP A;  3M7G A;  4UUS B;  1IAW A;  4KYW A;  2WPX A;  2E5N A;  3HKZ A;  1TZL A;  4IRH A;  2E2H J;  2ZME B;  3V7R A;  1CPS A;  2C6Y A;  1F57 A;  4XNH B;  4ZYQ A;  1QSO A;  4A12 A;  1U8R A;  1ZG1 A;  1Z6T A;  3JAM K;  1LFP A;  1FYL A;  4MY0 A;  1X58 A;  3C2H A;  2IP2 A;  1T33 A;  4RAY A;  3MCZ A;  4LG0 A;  2XRO A;  5AG4 A;  1IN4 A;  2DA5 A;  1CG2 A;  2G3A A;  1NHA A;  3N7Z A;  5B5E C;  4ZDO A;  3NE8 A;  2V7F A;  4XRF A;  4PQA A;  3KEO A;  2J9A A;  2HQA A;  4UCP A;  2EZL A;  5C44 J;  4BBR J;  5E3M A;  2BVL A;  1XMT A;  1ORK A;  1JUS A;  5B66 C;  3GWZ A;  5F27 A;  3CCY A;  2JRM A;  4R8F A;  1D0Z A;  1XOV A;  3D5R C;  2YUS A;  1AU7 A;  3A4C A;  1FOY A;  5CVJ A;  2MYS A;  3W6V A;  2A5Y B;  3VSK A;  3RYP A;  2JA6 J;  5EDN A;  4IHM A;  4BUP A;  5D5W B;  3RBU A;  5D5U B;  4HDU A;  4F9V A;  3MMY B;  2L9N A;  4AYB N;  2M8G X;  4A3C J;  1AOY A;  5TRD A;  3MEX A;  1K6Y A;  3R0A A;  1WI9 A;  1H0M A;  1UHW A;  1X1D A;  4U5Y A;  3FB3 A;  3CCV I;  3GO5 A;  4IHV A;  1DUX C;  3PBE A;  3RZD J;  1TBX A;  3GFL A;  1IUF A;  3DLJ A;  5CKT A;  4DYQ A;  1FYM A;  1BJA A;  3F8F A;  5HDG A;  2Q2E A;  4G8X A;  2PMZ N;  1U78 A;  1KZF A;  1A35 A;  1YOV B;  1BA5 A;  4GM5 A;  2DJN A;  5F48 A;  3L9F A;  3PNV A;  2PMH A;  3FXO A;  3DKX A;  1GHE A;  4S0H B;  3QAH A;  3HDD A;  2ZW7 A;  2P5V A;  4BXX J;  2FML A;  5CVV A;  5B3S H;  5HOO A;  3PB7 X;  4M6H A;  4ZI6 A;  2BL1 A;  1E2X A;  5AG7 A;  4HEA 2;  3COA C;  1P2F A;  2BXZ A;  4NBQ A;  1HBX G;  3BP8 A;  4GXH A;  5H20 A;  1HCR A;  1V55 H;  1XMA A;  2V9V A;  4HV6 A;  3IKV A;  3PRT A;  5EG0 A;  2OB0 A;  1LNW A;  2FD5 A;  3T90 A;  4R7M A;  2LKX A;  2KIS A;  3CDX A;  2QSH X;  4MFZ A;  1JQG A;  2WAF A;  1VQ6 I;  3CT9 A;  2BVM A;  3LSG A;  2BE5 F;  4DW6 A;  2X0L A;  1QZE A;  1GT0 C;  2EIM H;  1MBF A;  1YIT I;  1VQ9 I;  1TL8 A;  4N4N B;  4KT5 C;  4UVC A;  3CJN A;  5DM7 F;  2STW A;  3GTG J;  3C7J A;  3L2N A;  1ZHF A;  3HOU J;  1XGN A;  4YEJ A;  1QPI A;  3F21 A;  3DBH B;  1D8K A;  3I3G A;  4K3N A;  1X1B A;  4KS9 A;  1X10 A;  1CF7 B;  3EYI A;  3WTY C;  4ZJZ A;  1ON0 A;  4M6G A;  3GZN B;  3BI0 A;  2Y75 A;  2HOS A;  2VPR A;  2OBP A;  4GDF A;  4BE2 A;  5L3B A;  2X6O A;  2JDC A;  1Z8T A;  1QBJ A;  3HRM A;  3TTH A;  3RZO J;  3MN2 A;  3FEC A;  2QCO A;  1ENH A;  5E79 C;  3Q0U A;  1Z91 A;  4G94 A;  1QNT A;  2HQY A;  2DOA A;  4JX6 A;  2PJR B;  1D0X A;  3VAT A;  4CYD A;  3AKZ A;  5FKL A;  4YWY A;  3TKY A;  2KL4 A;  3ELK A;  2EV5 A;  3LST A;  4RN7 A;  3DF8 A;  3ECO A;  3HOX J;  5LGU A;  1ZR2 A;  1IRG A;  2BUE A;  3T0Y A;  3ABT A;  1XN7 A;  2E7W A;  2EA2 A;  2F5V A;  2OPT A;  4KIS A;  4EVI A;  2GXG A;  2Q7S A;  2BBY A;  1IY7 A;  3GX4 X;  2W82 A;  4YEL A;  2VC1 A;  2HQN A;  4NC7 A;  2DAO A;  3S1M J;  4ZTF A;  2E2I J;  4KNY A;  3M3Y J;  4HLX A;  1W7P D;  1OPC A;  4OAY A;  5BMZ A;  4IJA A;  4JBA A;  1CP7 A;  1OFC X;  1R7J A;  3CD6 I;  1YJW I;  1F2O A;  2Q4Z A;  2VXZ A;  2PIY A;  3VWB A;  4KVO E;  4GRI A;  1HOM A;  4JP0 A;  3DR8 A;  4R6T A;  3ZQ7 A;  3HB9 A;  1T95 A;  2JN6 A;  5JVG F;  2CQN A;  2VJ5 A;  3GYH X;  1CP6 A;  1ZTR A;  2IGK A;  3ZQQ A;  1VND A;  5LHH A;  1SD4 A;  2CS3 A;  1MDM B;  5K1Y A;  2IA0 A;  4RDU A;  5IOY A;  3BI1 A;  5JLW A;  4JK1 X;  5EF6 A;  1OCR H;  2K27 A;  1Z4E A;  1D5V A;  1MZB A;  3KP3 A;  1ELM P;  4KOU A;  2X6X A;  5G22 A;  1I27 A;  5EGO B;  3S1Q J;  1WK4 A;  2FMY A;  4DGW B;  5A2Q Z;  3I4M J;  1KGS A;  2ZW4 A;  1IN6 A;  1D0Y A;  4HNT A;  1ZLK A;  3BOQ A;  2B58 A;  3B2Y A;  3D7D A;  1DU0 A;  3HHG A;  2KIU A;  2WV1 A;  4B6Z A;  1KU2 A;  3J7A O;  2IXS A;  4J00 A;  4CYP A;  5D5X B;  3LAJ A;  4X1E A;  4NEX A;  4QPO A;  4XIC A;  4UHT A;  1T8I A;  3E97 A;  4PJL A;  5FKK A;  1YRE A;  5JQ4 A;  2ZXJ A;  4XM3 A;  3K4B A;  3LFU A;  4BHP A;  5D29 A;  1U5T A;  4FE7 A;  3U9G A;  4FD7 A;  5HNF A;  4JWP A;  3K4N A;  2MFZ A;  2RNG A;  1IIC A;  3NH8 A;  1B6A A;  2ZOF A;  2WY7 Q;  3H8E A;  3S9L A;  1LE8 A;  4M3S A;  1PVE A;  2CQ7 A;  2DYS H;  3BTC A;  4ENM A;  1IXC A;  4MCP A;  2FS5 A;  1FP2 A;  2MH9 A;  3C2B A;  3DU5 A;  5HLG A;  3HL2 A;  3TO6 A;  2DFF A;  3KX2 A;  4U7D A;  4YFN F;  3HLP A;  4MCQ A;  1YLF A;  4RLF A;  3GCM A;  4IEJ A;  3RTR A;  4UVA A;  3QYE A;  2L9S A;  1W7P B;  3JRE A;  2E1N A;  1WWZ A;  2PJ0 A;  5G1Z A;  1A6Q A;  3L2V A;  1RUO A;  4EMS A;  2Q7B A;  2YGW A;  4I99 C;  2LY2 A;  3IH4 A;  3ZMD A;  3A1Y A;  5EEH A;  5H6R A;  3A2K A;  3R9G A;  1GHC A;  2KRH A;  3WHC A;  3IAM 2;  3G4S I;  1HLV A;  2PX9 A;  3GME A;  1XF8 A;  3VYU B;  4R79 A;  1Z7L A;  4PDK A;  2K5C A;  2XF6 A;  1LQ1 A;  4Q5S F;  1MBH A;  2R7W A;  3ZQI A;  2VBY A;  1G4D A;  5FLV A;  3P5J A;  1ZRC A;  2ZCW A;  2XPV A;  1TP4 A;  2LH9 A;  1J09 A;  1S29 A;  2PJP A;  3FMC A;  5C88 A;  1XGM A;  3MKZ A;  3OOU A;  2ATR A;  4AIH A;  2IBD A;  2PMU A;  3C1D A;  4ASN A;  4IHT A;  3P2H A;  4W97 A;  2CRG A;  1ERD A;  2F5C A;  3VYR B;  1BR4 A;  3CUO A;  4BHB A;  2L4A A;  1Z8W A;  3SQN A;  3QU3 A;  3BHX A;  1W0T A;  2LSO A;  2H8R A;  3WT4 A;  4HX7 A;  2EZI A;  2A68 F;  3HYI A;  4F6A A;  5HXD A;  3WTV C;  3A0H C;  1XGO A;  1G59 A;  1WSU A;  4P10 A;  4CGP A;  4CCN A;  2ESH A;  1AA7 A;  1GLN A;  1V3F A;  3PO3 J;  5BWA B;  3FYN A;  1U5T C;  4NJR A;  1EE3 P;  1GYT A;  1FIP A;  4QVT A;  4R9M A;  2ICW G;  3ZZI A;  4CGN A;  3SHF A;  3PIO F;  3GUD A;  1YE9 A;  2REE A;  2J5P A;  4RS8 A;  5IP9 J;  2YS9 A;  3PP9 A;  3HM5 A; 
#chains in the Genus database with same CATH homology
 3F9K A;  3LSH A;  2HVR A;  3OYH A;  4C2U A;  2DPT A;  2E5Z A;  3D5L A;  4IF5 A;  2R7H A;  4UWI A;  3D2M A;  5FRN A;  4YFJ A;  4A33 A;  2KCW A;  4Y33 A;  4MHD A;  2VAS A;  2D4P A;  2HVQ A;  5HNH A;  3TOA A;  2HV2 A;  3FBU A;  4E7I A;  1J4J A;  4HRI A;  1WJ5 A;  4JOM A;  3F5B A;  4H4K C;  1MW7 A;  4E7H A;  2JA2 A;  2JVH A;  4XOT A;  4YGO A;  2VKH A;  2DPS A;  2W7N A;  1UFH A;  3OWC A;  3OYG A;  4DNC A;  1SQH A;  3CF2 A;  1R57 A;  4FD4 A;  2M3A A;  3FKJ A;  2JEV A;  4UWJ A;  3UY5 A;  1NG6 A;  4A2Z A;  1X1C A;  3CJQ B;  1S9H A;  4CCL A;  3OR1 C;  4ZTJ A;  1WJF A;  3LSM A;  2I79 A;  4H89 A;  3EFA A;  4IX7 A;  3EY5 A;  4MFP A;  4AVA A;  3CP2 A;  1RXT A;  2G3T A;  3QYF A;  3M1C A;  4XN3 A;  4KLW A;  4U9Y A;  2VQH A;  1PYV A;  2GOX B;  3DPL C;  3BJ7 A;  4EVY A;  3H9Q A;  4XLH A;  4KSF A;  1Z9U A;  3V8I A;  2K9M A;  3H9G A;  3OYB A;  4EAT A;  4PFP A;  3OYJ A;  3HPH A;  2ZPA A;  4HG2 A;  2NOJ B;  5G21 A;  3JVN A;  5A27 A;  3W6X A;  5KTC A;  1S60 A;  2BW3 A;  2Z3N A;  2WAQ A;  4DBQ A;  2OH1 A;  2ZXH A;  3S32 A;  3RYO A;  3TCV A;  3OYC A;  3L2R A;  3BCA A;  3G2B A;  4FAS D;  1B6B A;  1LKX A;  2R8V A;  2KHM A;  4B48 A;  3SEZ A;  1K4J A;  4ORF A;  4ANJ A;  3S6G A;  3TBI A;  3H5N A;  3OIQ A;  5KCM A;  2X51 A;  1WFX A;  1TIQ A;  2HUZ A;  2L5Q A;  2PQ8 A;  1X4O A;  3D5S C;  1MNE A;  3IWE A;  4ITV A;  2QKL B;  1M1D A;  1SFK A;  3K4K A;  4BAC A;  3LSI A;  4F3Q A;  2UUZ A;  1NMT A;  4JD6 A;  3KEY A;  1XEB A;  3GBG A;  4BJT A;  3OYI A;  1DGW Y;  2LOO A;  3JTK A;  4PK2 A;  2IGN A;  4IUS A;  2WAD A;  2R7R A;  2FL4 A;  4L89 A;  1QST A;  4NCZ A;  4QUS A;  4A30 A;  2J8R A;  4P1W A;  3ZRG A;  4QB9 A;  2WBM A;  5DWN A;  1IB1 E;  4E8O A;  4F55 A;  1IYK A;  4C2Z A;  2Z16 A;  2B3V A;  2XF5 A;  2P6E A;  2VZY A;  3R9F A;  2FE7 A;  5F47 A;  2CMP A;  3UR3 C;  1R6R A;  1MJA A;  2E1M B;  4RMN A;  2Z11 A;  4LX9 A;  3DLA A;  2CW7 A;  3E0K A;  4XLA A;  3RCO A;  4B5P B;  1KUY A;  2W00 A;  2GOM A;  2HDW A;  4HST A;  4JQF A;  3VWD A;  2ZXI A;  3S8P A;  2M0M A;  3WR7 A;  2VB6 A;  3QYB A;  3FXT A;  4H6U A;  3SHP A;  4KVM E;  4D1Q A;  2VQG A;  2R7V A;  3RSN A;  4C2T A;  2CY2 A;  3DU6 A;  3K6G A;  5G20 A;  4RI1 A;  3LOD A;  5IX3 A;  1EA3 A;  4XLE A;  2C27 A;  1NG7 A;  4CUG A;  3EXN A;  1MMG A;  1Z21 A;  2WAE A;  4CCK A;  3V42 A;  4C2X A;  4IZZ A;  4CCO A;  3HC7 A;  1N77 A;  4BJ5 C;  3CXQ A;  4KOS A;  1S7F A;  3PSI A;  4KUA A;  5HLT A;  3RPU D;  3MKY B;  2CNM A;  4MI4 A;  2X6Y A;  2XSJ C;  1N78 A;  1YK3 A;  3OYD A;  2V9K A;  3HG9 A;  1Y56 A;  3QOD A;  3OYM A;  2ZSH B;  4IKF A;  3LD2 A;  4OAE A;  3L2W A;  2R7S A;  4Q38 A;  4KOW A;  5KNL A;  4RM3 A;  1XE4 A;  2OZU A;  3CMM A;  2P6G A;  3OS0 A;  3NE7 A;  2Z10 A;  1I21 A;  2VL8 A;  2QEC A;  4BQQ A;  5CQG A;  2PDO A;  2WUU A;  2KQR A;  1KON A;  4LIT A;  5TGT A;  4B3X A;  5F49 A;  4CS0 B;  4E2A A;  1U0J A;  4NXY A;  2V26 A;  3K70 D;  2B3U A;  2FIA A;  3OYK A;  4XKB A;  2HU9 A;  3G3S A;  1P9Q C;  2D4O A;  2O28 A;  2WPX A;  1Z3X A;  4AVZ A;  3S3N A;  2Y0S A;  2Q4Y A;  3K4M A;  2Z3M A;  2VXK A;  4CZC A;  3TOB A;  5HMN A;  2LC2 A;  3IAS 2;  5GCN A;  2R4G A;  4I49 A;  2JSP A;  3FHN A;  3HPG A;  4D9J A;  3PNT A;  5FVJ A;  2CW8 A;  4R87 A;  1OLT A;  4JXR A;  4MY3 A;  3LL7 A;  4F92 B;  1S7L A;  1V0C A;  2M7A A;  4E6K G;  1W36 D;  1UG0 A;  2K9L A;  2X1D A;  2I00 A;  3IU1 A;  5CNP A;  4PFO A;  1M4G A;  5F46 A;  3HOT A;  3MGD A;  4B5P A;  4M85 A;  1Q2Y A;  1DP3 A;  2X1C A;  5EC4 A;  4RLQ A;  3PNY A;  2CXA A;  3DWL E;  3W2V A;  2PC1 A;  5H86 A;  1MND A;  4Y4R A;  2KPM A;  1YX5 A;  2KLO A;  2R7O A;  4BQN A;  4E7S A;  2FSR A;  5HH1 A;  3VWE A;  3AL0 B;  2WY8 Q;  2HZD A;  1VHS A;  3H5A A;  2R98 A;  1YX3 A;  4U7B A;  4XPK A;  2F6C A;  2IS1 A;  4E4H A;  4XN0 A;  2P0W A;  4BDZ A;  2H5M A;  4PJJ A;  4F93 B;  5KTA A;  1WJC A;  4XLC A;  3IWG A;  1BO4 A;  4CAX A;  4H6Z A;  1M4D A;  2G0B A;  3KKW A;  4RS2 A;  5J8F A;  1D1A A;  1DQU A;  5C82 A;  3OS1 A;  4LUA A;  3DPT A;  1Y9K A;  2IGM A;  3TE4 A;  2CH0 A;  5H84 A;  4UFX A;  1WJB A;  3DQV C;  1P0H A;  5AG5 A;  4C30 A;  3C26 A;  3N05 A;  2PMZ A;  2Q1Z B;  2VJ4 A;  4ZDL A;  4B44 A;  4NUB A;  1QSN A;  3OWT A;  2KZV A;  2Q4V A;  2MD0 A;  4KT6 A;  1OZP A;  1YLE A;  3TL4 X;  4J01 A;  4GS4 A;  3TO9 A;  3OL4 A;  4C68 A;  5JPH A;  3MKW B;  2OZH A;  2DJI A;  1M4I A;  2Z3O A;  2LRD A;  4CCJ A;  1QHG A;  4XQF A;  4IQJ A;  2BEI A;  1NE9 A;  2JLM A;  3SXO A;  2CV0 A;  3ZJ0 A;  3W6S A;  4E7J A;  2F5I A;  3VSL A;  4HNX B;  2ZFU A;  1E0E A;  2W4S A;  2QKM B;  2EVN A;  5FRM A;  4HNU A;  5AG6 A;  2FIW A;  2R7T A;  4BE1 A;  1JI8 A;  2ARH A;  2VEZ A;  2Z0Z A;  3FRM A;  4QPQ A;  3NWT A;  2B4D B;  2OZG A;  2PR8 A;  2X6W A;  3K4C A;  4CGO A;  2DXQ A;  2X1E A;  3CJR B;  2ZW6 A;  4C7I A;  3TFY A;  2GE3 A;  3EUH C;  1KUX A;  3I9S A;  2Q2E B;  1BR2 A;  2XF7 A;  1S7K A;  4XOR A;  4HKF A;  1Y6I A;  5C88 A;  2VI7 A;  4E7Z A;  3GY9 A;  3IU2 A;  5KHD A;  4AG7 A;  3OYN A;  4LG3 A;  3SXN A;  2FCK A;  3DTK A;  2O5R A;  2YNC A;  4CSW A;  4HNY B;  4B12 A;  2FXF A;  2V6E A;  2AJ6 A;  2A5W A;  2DCE A;  4BDY A;  2OU2 A;  4OAZ A;  4YRH A;  4BMH A;  2WPW A;  2JUG A;  4A32 A;  2E1M C;  1VZ0 A;  2WB1 A;  1G8X A;  4XKC A;  4ZDP A;  1L0C A;  2EUI A;  4U87 A;  2K3P A;  2CV2 A;  1RO5 A;  2E5N A;  3AFH A;  1TZL A;  3BG6 A;  3HKZ A;  4NF1 A;  4ZBG A;  2ZSI B;  1IRX A;  3W91 A;  4AVB A;  4C2Y A;  3OYE A;  2MC4 A;  3KYL A;  3EO4 A;  3PGP A;  4XNH B;  1QSO A;  2V1N A;  3S3M A;  1LFP A;  2NMT A;  4E7K A;  4ZGY B;  5IB0 A;  3HOS A;  4XOP A;  3C2H A;  2VZZ A;  4MY0 A;  5CPR B;  3QB8 A;  5AG4 A;  2Z3K A;  2F4I A;  1IID A;  3DNS A;  3OR2 C;  2PR1 A;  3N7Z A;  3VYT B;  3H5R A;  2G3A A;  1YVK A;  5DWM A;  3I3L A;  4HSR A;  1ZO0 A;  2V4J C;  4ZDO A;  2V7F A;  3DTE A;  2HQA A;  4FD6 A;  4UCP A;  2Z1D A;  4BEH B;  4CAV A;  3F8K A;  2CNT A;  2BVL A;  1XMT A;  2IS4 A;  1T0F C;  1ZEL A;  1YX0 A;  1D0Z A;  2XAU A;  4XPL A;  3D5R C;  3ZCO A;  4DOZ A;  3A4C A;  2MYS A;  3HUG B;  2AE6 A;  4R3K A;  4PK4 A;  3VSK A;  2X7B A;  3VDX A;  2Z3L A;  3S6H A;  3UNG C;  4BUP A;  2M4K A;  1HA8 A;  4ONU A;  5LFA A;  2WA0 A;  3MMY B;  3LMM A;  3A9L A;  4B13 A;  2L9N A;  4Q36 A;  2LG4 A;  4JXQ A;  1K6Y A;  4B10 A;  2A4N A;  1X1D A;  4XKW A;  4BQO A;  1LVK A;  2Z2S B;  2B4D A;  4XNF A;  3FB3 A;  4DBR A;  4U5Y A;  4A95 A;  4KJZ A;  3SDB A;  3L2Q A;  4CYN A;  4JLY A;  5HVQ C;  5CKT A;  1KZF A;  3SZG A;  1MJ9 A;  2KDO A;  2YND A;  3S6F A;  4E0A A;  4BJ6 C;  4CH7 A;  5F48 A;  3PNV A;  4DIQ A;  3B8G A;  3ZR8 X;  3J7A Y;  1GHE A;  3DKX A;  3H0D A;  1I1D A;  1YR0 A;  3QAH A;  2LY1 A;  3BC8 A;  3E0J B;  1P4N A;  4B43 A;  1KUV A;  2JDD A;  4P5O A;  2ZW7 A;  5HOO A;  2ZXV A;  3OIP A;  2M7B A;  4ZC3 A;  3QOE A;  2BL1 A;  5AG7 A;  3F0A A;  3TO7 A;  4HEA 2;  4G6T B;  3SEQ A;  3SYT A;  1B87 A;  2LBF B;  2YNC C;  3R1K A;  1XIX A;  5JHF A;  4F0Y A;  2B5G B;  4F52 A;  1MMA A;  4CGL A;  1OR7 C;  2OB0 A;  2P6F A;  5E96 A;  1X4P A;  3T90 A;  4BBH A;  2KRC A;  4AG9 A;  3R9E A;  1Z3Y A;  1V5F A;  2GAN A;  2WAF A;  1MJB A;  4MFZ A;  4QC6 A;  4AB7 A;  1UEL B;  2VXD A;  4E7L A;  2BVM A;  3AL0 C;  3LSG A;  4X5K A;  4NC8 A;  4NSQ A;  2CFO A;  4ZYA A;  4J3G A;  1N71 A;  1S3Z A;  1DGR M;  3DKY A;  4N4N B;  3FDY A;  1MMN A;  3OS2 A;  2BSW A;  2RC4 A;  3R96 A;  2IS2 A;  1WJE A;  2DT6 A;  3K4L A;  1FMV A;  3OL3 A;  4XON A;  4YEJ A;  4K30 A;  4BEH A;  4II2 A;  3I3G A;  2Q04 A;  1X1B A;  4KS9 A;  2AQF A;  3W3C A;  1QSM A;  4XLF A;  1ON0 A;  4ZJZ A;  4AYB A;  3D3S A;  3DR6 A;  3VYS B;  5CQE A;  3BCB A;  1IYL A;  1I12 A;  4XR6 A;  4MFK A;  4UFV A;  1QSR A;  1N75 A;  4KSA A;  4C7H A;  4PUS A;  3PZJ A;  4BE2 A;  4KOY A;  1BR1 A;  2JDC A;  4CAF A;  2REF A;  1WJD A;  2XC7 A;  2VLA A;  3H35 A;  3TTH A;  3BLN A;  4PSX A;  2IGO A;  3W2A A;  3CP8 A;  4LIV A;  4CGM A;  3DDD A;  3K70 C;  2HQY A;  2DOA A;  2PJR B;  1D0X A;  2HPI A;  4F91 B;  2VKD A;  2RQQ A;  3FNC A;  3AKZ A;  3C2G A;  3W2W A;  2PSW A;  5A28 A;  3I9V 2;  2KL4 A;  4BS9 A;  3GKR A;  2L2O A;  2R7X A;  4UA3 A;  4XPD B;  4Y49 B;  5KTD A;  3JUW A;  3S6K A;  2W1O A;  2BUE A;  4KOT A;  2F5V A;  4KIS A;  3K10 A;  2HNH A;  4CRZ B;  2IL4 A;  4HNW B;  1Z4R A;  1NSL A;  2CNS A;  2W82 A;  4YEL A;  4RM2 A;  3OMY A;  4C9Y A;  4B5O A;  2VQL A;  3OYL A;  4B47 A;  4NC7 A;  2UV1 A;  5LD2 C;  1W36 C;  4FD5 A;  4OLL A;  5J8C A;  4ZTF A;  2LBF A;  4BXF A;  3T9Y A;  2B5G A;  4U9Z A;  4CA0 A;  4OAY A;  2R1I A;  2BOL A;  4CAW A;  4B11 A;  3E1S A;  4JJX A;  2CUJ A;  2ELJ A;  1LDK B;  3PFY A;  2VXZ A;  2ZW5 A;  2VQC A;  3VWB A;  2Q44 A;  4GRI A;  4KVX A;  3DR8 A;  4KVO E;  1T95 A;  2OC6 A;  3BJ8 A;  1Y7R A;  1X19 A;  2VJ5 A;  1BOB A;  4AU7 A;  4XNH C;  2IGK A;  3ZQQ A;  2LRE A;  2DXI A;  3TMO A;  2CS3 A;  4MLO A;  3S93 A;  3BLY A;  3DSB A;  4UFW A;  4IQ4 A;  3DPU A;  2HVS A;  4OAD A;  3D8P A;  2FT0 A;  2CUZ A;  4BE0 A;  1Z4E A;  2K5T A;  5G22 A;  3PUB A;  3P2F A;  3NWS A;  3EUK L;  2X6X A;  2Z3P A;  4KLV A;  4KOU A;  4R3L A;  2VIX A;  1D1C A;  2L7K A;  4B14 A;  1WK4 A;  1PJR A;  4DGW B;  1MK4 A;  4R57 A;  1YGH A;  3MD2 A;  5IV0 A;  1FY7 A;  3ZXS A;  1D0Y A;  4HNT A;  3H9J A;  4NNJ A;  2B58 A;  2CV1 A;  1V5E A;  2ZW4 A;  3IGR A;  3FBI B;  2JVG A;  4MFJ A;  2IXS A;  4J00 A;  4PJN A;  3OYA A;  3PL8 A;  4LIU A;  4CYP A;  4NEX A;  4PJM A;  4N4O B;  4QPO A;  3D2P A;  4PJL A;  5JQ4 A;  1WJA A;  1YRE A;  4XM3 A;  1MMD A;  3K4B A;  3LFU A;  3ONQ A;  4II9 A;  4PSW A;  3H4Q A;  2PJR A;  1Y9W A;  4FD7 A;  3CES A;  5HNF A;  2VJI A;  1M44 A;  4JWP A;  2PRB A;  2OV7 A;  3K4N A;  2MFZ A;  2RNG A;  1IIC A;  2A6T A;  3S3O A;  1YVO A;  1U6M A;  2WY7 Q;  4AVC A;  3CXP A;  4Y3O A;  4M3S A;  2OUM A;  4BL0 B;  2AQE A;  2FS5 A;  3DU5 A;  2Q0Y A;  3HL2 A;  3TO6 A;  3KX2 A;  4YRV A;  2B4B A;  3U21 A;  2RRE A;  4RLF A;  3IP4 B;  3PJR A;  2R7Q A;  1VKC A;  4MFL A;  5EBV A;  3RTR A;  3R95 A;  4BGD A;  3QYE A;  2KMU A;  2WSA A;  5AGE A;  2GIV A;  2J8N A;  2L9S A;  4CAE A;  2M4G A;  2VQY A;  3GYA A;  1WWZ A;  4CYQ A;  3EUA A;  5G1Z A;  1FMW A;  4UCM A;  3L2V A;  4FET A;  3H5Z A;  4MBU A;  4CYO A;  2Q7B A;  4KOR A;  2YGW A;  3ZGK A;  2UWM A;  2J8M A;  4UBR A;  2LY2 A;  3K9U A;  1UAA A;  4KZT A;  2DT7 B;  2HPM A;  4F0X A;  3A1Y A;  4XMY A;  5FRO A;  3A2K A;  4X0G A;  1Q2C A;  2VPL A;  4BU2 A;  3R9G A;  2KRH A;  3K4J A;  2VBQ A;  3IAM 2;  3IUO A;  4II3 A;  3FIX A;  4L8A A;  4QBJ A;  3PSF A;  3CXS A;  5I0C A;  1XF8 A;  3FBN B;  3EC4 A;  2IS6 A;  3VYU B;  2X85 A;  3DTI A;  4R79 A;  1Z7L A;  3TT2 A;  1S5K A;  2R7U A;  2K5C A;  2XF6 A;  4KOX A;  2R7W A;  1TT0 A;  3DEE A;  4A31 A;  3CZ6 A;  1PU9 A;  4KIT B;  3OY9 A;  4XKV A;  4KOV A;  2LH9 A;  1J09 A;  3BG7 A;  1X1A A;  2BW3 B;  4XL9 A;  2QML A;  2MAB A;  3MKZ A;  1D1B A;  3OOU A;  4OWR B;  1S7N A;  1V5G A;  2ATR A;  2YNE A;  3G8W A;  4CRY B;  3P2H A;  3L2U A;  3M8J A;  4NQW B;  4PK3 A;  1ERD A;  4PV6 A;  3VYR B;  4DJA A;  1BR4 A;  2FUG 2;  2KP6 A;  1QU3 A;  3EPZ A;  4KUB A;  4MJ8 A;  4UCN A;  2I8D A;  1QHH D;  2XDV A;  1SAU A;  1LRZ A;  4F6A A;  1CM0 A;  1PUA A;  4CCM A;  3OYF A;  2LYC A;  2Y0M A;  3LSK A;  1G59 A;  4CGP A;  4CCN A;  1AA7 A;  1GLN A;  5ISV A;  5BWA B;  3FYN A;  2E60 A;  4HPQ A;  4QVT A;  4R9M A;  4MFQ A;  3ZZI A;  4CGN A;  1Q2D A;  2QIR A;  2REE A;  1YE9 A;  1CJW A;  3HXL A;  2VJJ A;  4XPD C;  4Y49 C;  3PP9 A;  3RQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...