4PSXA

Crystal structure of histone acetyltransferase complex
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
313
structure length
313
Chain Sequence
KPETWTSSANEALRVSIVGENAVQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDSVTFKPYVNVKYSAKLGDDNIVDVEKKLLSFLPKDDVIVRDEAKWVDCFAEERKTHNLSDVFEKVSEYSLNGEEFVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLLNKKTKELIGFVTTYKYWHYLGAKSFDEDIDKKFRAKISQFLIFPPYQNKGHGSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKLGYDAVFQKHSDLSDEFLESSRKSLKLEERQFNRLVEMLLLLNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hat2p recognizes the histone H3 tail to specify the acetylation of the newly synthesized H3/H4 heterodimer by the Hat1p/Hat2p complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Histone/transferase
molecule keywords Histone acetyltransferase type B catalytic subunit
total genus 98
structure length 313
sequence length 313
chains with identical sequence D
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2014-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4psxA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4psxA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 4psxA01
2R98A 5J8CA 2ATRA 5F46A 5C88A 3OWCA 2JEVA 4MJ8A 2Q4YA 3F5BA 5EBVA 3PZJA 2Z0ZA 4CRYB 4JLYA 3VWEA 2G0BA 4HNWB 2G3AA 4H6UA 1B87A 2VZZA 3ZZIA 3R96A 2RC4A 2VBQA 3FNCA 4L89A 2AE6A 2B58A 3S6GA 3SXNA 1IYKA 3TCVA 4KVOE 4KOXA 2FIAA 1PU9A 3IWGA 4QBJA 2PR1A 2JLMA 3W6XA 4KOVA 4HNXB 3R9GA 3D2PA 4I49A 3R1KA 5F48A 5IV0A 3V8IA 3TE4A 1MJBA 2B3VA 3LODA 4PSWA 3TO9A 2P6EA 2Q04A 5C82A 3SXOA 2BSWA 1Z4RA 5E96A 1S7FA 1Y9WA 1CM0A 3DR8A 3TOBA 3ZJ0A 1MJAA 2R7HA 2REFA 1Q2YA 3EY5A 3S6FA 2Q0YA 2HV2A 3TFYA 1M1DA 4OADA 1I12A 1KUVA 4U9YA 2Z10A 2BEIA 3EC4A 2CNTA 3SHPA 1QSTA 5KTDA 1Z9UA 2QIRA 3W6SA 2P0WA 1I21A 2VZYA 4DNCA 2A4NA 2ZW7A 3S6KA 4U9ZA 1BOBA 5F47A 4MY0A 2H5MA 3TOAA 2CNMA 3IGRA 1J4JA 4YGOA 2OB0A 4HKFA 3TO6A 4XNHB 4CRZB 4QVTA 1Y7RA 1P0HA 2O28A 3TO7A 4B5PA 4Y49B 2GE3A 1WK4A 4QC6A 2PSWA 3T9YA 4CAVA 2R8VA 2WPWA 4CAXA 4IUSA 3VWDA 2FE7A 5FVJA 4AB7A 4R3KA 4KOYA 3FB3A 5DWMA 2IL4A 1QSOA 2G3TA 2B5GA 4XPDB 2D4PA 2J8NA 2R1IA 4R87A 1IICA 2REEA 2Z11A 1BO4A 4NEXA 1NE9A 4M85A 1YX0A 4XPKA 3LD2A 1YVKA 1RXTA 4KORA 3CXQA 4E8OA 5GCNA 2ARHA 4AVAA 4MY3A 1WWZA 5H84A 2B3UA 4JJXA 1M44A 1RO5A 3K9UA 4KOTA 2B4DB 4LUAA 1LRZA 2Q7BA 3P2HA 4U5YA 2PQ8A 1S7LA 3R9FA 2FXFA 4KLWA 4CS0B 3D2MA 4XPLA 2PC1A 4NF1A 1OZPA 4AVCA 2BUEA 3R9EA 3I9SA 1FY7A 1VHSA 1V0CA 4R3LA 2X7BA 5HH1A 2FT0A 2Q4VA 3FBUA 2VQYA 3FXTA 3RYOA 1QSNA 1Z4EA 4CAWA 3W91A 4KUAA 1NSLA 3KKWA 4AG9A 1MK4A 4NXYA 3QB8A 4UA3A 4MBUA 4H89A 2WPXA 2GIVA 3BJ8A 3CXSA 2KCWA 2OZHA 4BMHA 2EUIA 2Q44A 4F0YA 1S3ZA 1Y9KA 2P6GA 1XIXA 4KVME 4RI1A 4R9MA 2HUZA 2OH1A 1Q2DA 1YR0A 4JD6A 4KLVA 1S60A 4YFJA 2QMLA 4KOWA 3D3SA 3JVNA 4KOUA 2CNSA 4R57A 3C26A 2B4BA 1M4GA 1ON0A 2PR8A 3DSBA 2FSRA 4AVBA 4FD4A 3BJ7A 3S6HA 5I0CA 2ZW5A 3B8GA 3EXNA 1L0CA 5IB0A 1GHEA 4FD6A 4QUSA 4NSQA 1KZFA 3QAHA 2JDDA 4L8AA 2HQYA 2OZUA 5JQ4A 3GYAA 4ONUA 2GANA 1VKCA 1YVOA 2VEZA 3DDDA 5EC4A 3P2FA 4HNYB 1I1DA 2AJ6A 4KUBA 4KOSA 4RS2A 2J8RA 4MHDA 1R57A 2OZGA 1IYLA 4IF5A 2FIWA 1XMTA 2D4OA 5DWNA 1S7KA 2OU2A 3FYNA 3DR6A 2ZW6A 4EVYA 1M4IA 2NMTA 4PV6A 5IX3A 2ZPAA 1SQHA 4II9A 3CXPA 5KTCA 4X5KA 2EVNA 3PP9A 1YREA 1XEBA 1M4DA 2Y0MA 4ZBGA 2PRBA 5ISVA 1IB1E 3FIXA 2QECA 5F49A 2VXKA 1UFHA 1KUXA 1CJWA 3N7ZA 1QSMA 4FD7A 2ZXVA 4QB9A 2B4DA 3GKRA 3R95A 3UY5A 2K5TA 4NCZA 4MI4A 2BL1A 4YRHA 3TTHA 2J8MA 3H4QA 2DXQA 3FRMA 1MJ9A 3TT2A 3NE7A 2F5IA 2I79A 4J3GA 4JXQA 5HMNA 2FCKA 3F0AA 4JWPA 2C27A 1QSRA 4AG7A 1U6MA 2I00A 4JXRA 1P4NA 3EFAA 4KZTA 5J8FA 4UWIA 2B5GB 4K30A 2P6FA 4OLLA 1XE4A 3MGDA 1B6BA 1NMTA 5H86A 3EO4A 1XF8A 3BLNA 4OAEA 1YGHA 4E2AA 4FD5A 3F8KA 3G8WA 1YK3A 3GY9A 1S5KA 1S7NA 2JDCA 2ZW4A 3WR7A 4UWJA 3PGPA 1TIQA 5CNPA 3T90A 5JPHA 1IIDA 4B5PB 4LX9A 3E0KA 2CY2A 1KUYA 1K4JA 4B5OA 4F6AA 2FS5A 1N71A 4XPDC 2PDOA 4PK3A 4PSXA 1Q2CA 3JUWA 1PUAA 4E0AA 1YLEA 4KVXA 5KTAA 4H6ZA 3D8PA 4Y49C 3DNSA 3G3SA 4UBRA 4M3SA 4GS4A 3I3GA 2VI7A 4PK2A 4XNHC 2FL4A 4ORFA
chains in the Genus database with same CATH superfamily
5J8CA 4CYCB 2ATRA 2R98A 4A31A 5F46A 3BG7A 5C88A 2YX7A 1T33A 1ZRDA 4UVCA 2JEVA 1OLTA 2Q7SA 3TW6A 5IT9Z 1P92A 1W5CC 1WJAA 4L5JA 2KRHA 1GUUA 3OL3A 1K78A 3CF5F 3KP3A 1Z9CA 2Z0ZA 4IOCF 2AFSA 4MFEA 2MC3A 5J1UA 2ME0A 2W84A 5AIQA 2K40A 4N9HA 3VSLA 3V8JA 5GAEJ 3CMAI 1HKTA 3K6GA 4HNWB 3BG9A 3ZZIA 3SDGA 2IBDA 1NG6A 4H0EA 4C3JJ 2G9WA 2RC4A 3KEYA 1XBUA 2RB7A 2K3PA 4J01A 4BBHA 2KMUA 2AE6A 2ZENA 3RKWA 1TC3C 2HB6A 4NGMA 1QHHD 3JRBA 5M3FJ 1JQGA 2ZEEA 1V5EA 3FWEA 4Y3OA 4ZDOA 1SD6A 3LNQA 2F4MB 2GREA 3CUQC 1FC3A 3LSIA 4EEFG 3RNZA 2EA4A 1IC8A 1EH8A 4NC7A 2ZMEC 3HC7A 2HOEA 3QYEA 2JQ7A 3NE8A 2FUG2 2M4GA 1I50J 3J7AO 2FIAA 2Y30A 2ECCA 2PR1A 3OR2C 2LF8A 3N4MA 3CCVI 1WZ2A 3BJAA 1BR2A 2J5PA 2X9DA 4RGRA 4RM3A 4S04A 3CCJI 4MCPA 2WAFA 3EUKL 2Y9ZA 5J4YA 3R1KA 2E1CA 4CCLA 3V8IA 2CQXA 2FX0A 3DLAA 4BD9A 3FIWA 2UV1A 3ONQA 4DZJA 3SJEA 4CPAA 4O6JA 4EVIA 2W1OA 1TWCJ 4LK1F 2ZFUA 2IQ6A 2OR4A 4L0YB 1MW7A 1SD7A 2GA2A 1R36A 4P1WA 3HHGA 3TO9A 3GZ6A 4HSTA 4MCSA 4NQWA 1VHEA 2L5QA 2Q04A 3SXOA 2A61A 1Z4RA 1W7PD 1R23A 2V26A 1YX3A 2H1LA 3BG6A 3P9IA 1KU7A 4I09A 2I3CA 3DR8A 2JA8J 4AXVA 1K6OA 1FX7A 4M6YA 2ZMEB 5CVUA 2DOAA 4C68A 5K7HA 2Q0YA 4G12A 3SZGA 3MKYB 2P6SA 3BR6A 1T56A 1T0FA 2FMLA 3ZRGA 5F1RA 5GPCA 5FD5A 3GTGJ 1SVMA 3HTUA 1YOVB 4W1UA 2ESHA 4HBLA 4RS8A 4IK2A 2E1MC 4UCMA 4LLNA 3WC7A 2XKOA 4PXEA 1D0ZA 3PIOF 2IS4A 5ERIA 4BXFA 1TWGJ 9ANTA 2CSOA 2BZTA 4DW6A 5J4VA 2XSDC 1VQLI 3D67A 5DDGA 3V7ZA 2AFZA 2ZW7A 2DJIA 4MFZA 1RUNA 2BXYA 3A01A 2CNMA 4B6ZA 4CCJA 2XAHA 2IRFG 1YFHA 3CP8A 1MD0A 2ZSIB 2EA2A 3VPRA 2QF7A 3KYCB 4I0AA 1J4JA 3SZTA 3L2CA 2JEWA 2OB0A 5L3DA 1H8LA 5HS7A 5FFZA 1B6AA 2JA2A 3F3XA 2ODFA 2BYVE 1EH6A 2NS0A 2WADA 1RUOA 4CRZB 4OC2A 2PMHA 1FIAA 1P0HA 6CPAA 4B5PA 2HXIA 5K7FA 3WODF 1ZG5A 2GE3A 4LMYA 3BR3A 2QJ8A 5CVIA 4MFPA 1U6GA 4JBAA 2EZLA 2NYQA 2WPWA 3QPSA 1T38A 1X1CA 3FK7A 3M4OJ 3VWDA 1U9NA 5AG4A 2FE7A 1TQIA 1ZRCA 5L3CA 2VLAA 2ANPA 2A3SA 4XBFA 4A2ZA 1P2FA 5DWMA 1Z05A 2PMZA 3BZ6A 5CVVA 3G71I 3HUGA 4PK4A 3WTTC 2Y69H 2HEOA 1NTCA 3AAFA 1HDPA 3EUAA 2X6WA 2X85A 5DUIA 2J8NA 3TX8A 1EKEA 3PFOA 2M5WA 2EO8A 1R1VA 4BY7J 4M73A 2FBKA 4L18B 5K8NA 2Z2SB 4PXBA 3RTRA 2V77A 2V9KA 1QQ9A 1MBGA 1BO4A 4BS9A 3KFWX 2VQHA 1NE9A 3TBIA 4WWVA 5KK1A 2R3SA 3NWSA 2BXZA 1SFXA 1HCRA 3ISPA 4IF4A 4KUMA 2AXLA 5LRRA 1SAXA 3T5XA 3OSFA 2NVUB 2CQKA 1SD5A 3EPZA 3R0JA 4RGSA 1WWZA 1ZN2A 3MKLA 2DYRH 4ZJZA 2H8WA 2XSJC 3JRHA 4KIBA 4UFVA 2VE8A 3BG3A 2L7ZA 4JX6A 3GTQJ 1RO5A 2HC9A 2ZEPA 2X6YA 4ZC3A 3ZMUA 2WAEA 5TISC 4A0ZA 4EJWA 1ZELA 3C2BA 1YJNI 2CV0A 1ACIA 1B4AA 4XN0A 1G3TA 3F0CA 4EATA 3K70D 1FLIA 1RI7A 2Q7BA 2D45A 4QWQA 3JW4A 2GM4A 3K4NA 4E7JA 3R9FA 5E18F 4CCOA 1BC8C 3HXLA 1EJ9A 1P4XA 3KZZA 2M0MA 2AS5F 3MMYB 2ME6A 4U87A 4BH9A 4KLWA 3DEWA 4CS0B 1YW7A 3KP4A 3BP8A 1Z8LA 4WXCA 4A3KJ 2ZOGA 2OC6A 2W82A 3SDBA 4PFOA 4XONA 4P55A 1APLC 4E4HA 1LUJB 3WTXC 4NF1A 2VN2A 1G8XA 5CVRA 3CO6C 3MAJA 2VT2A 2KHMA 4RB1A 2NNYA 2R5YA 1ELLP 5F04A 5FLXZ 3W2WA 3PSFA 1J9IA 3K4MA 3R9EA 1FNNA 2CRGA 4AD9A 4DIQA 3IV5A 4MFKA 2QGUA 3CD6I 2QWWA 3LA2A 2GFQA 3IUOA 4Z6YA 1IGBA 5BS6A 4JK1X 3RKQA 2X7BA 2WB1N 4MCRA 1P7JA 4R76A 3ZQQA 2FF4A 1Y39A 2JA5J 1ON2A 2DA5A 5ICFA 1B72A 3OYBA 3OWTA 3ZQFA 4CAWA 1Z4EA 1IZ1A 1ODDA 4BBRJ 4M6GA 4MRIA 3DP7A 5J40A 4A6DA 3KKWA 2WV1A 1UHMA 1TNSA 1FOYA 2ZO4A 3QB8A 2VE9A 3QOPA 4UVAA 3ZMDA 2ZFWA 1J0RA 4UEEA 2QUFA 1TF8A 1WJBA 2GIVA 4BBSJ 2QQBA 2W85A 3A02A 2W24A 3UKGA 3DCFA 3BJ8A 3KP7A 4G1PA 1W1WE 1XJOA 2DF5A 4CYPA 5CKTA 4P9UA 1O3SA 4BMHA 2PE3A 2E60A 2DK8A 1VGYA 1W5SA 2A07F 2ZXJA 4XN3A 3BJOA 2M1BA 4QTRA 3PUBA 1S3ZA 1Y9KA 3DGVA 2HR3A 2L9SA 3DF8A 4MXUA 1U8RA 4A69C 1JXSA 5JFRA 3PO3J 5ED4A 1S7OA 2DMUA 4AU7A 2OH1A 3BZCA 3S16J 2ELJA 4GDFA 4M3DA 5IYBJ 1NK3P 1AUGA 2XAGA 4CGZA 3KETA 2W25A 2D5VA 1OFCX 2IS1A 1V4RA 3BROA 5K5OA 4WCGA 3FMSA 3I64A 3HLPA 4MMOA 4NGRA 1ON0A 2PI0A 1RC9A 2HI3A 3DSBA 5JM6A 3LSPA 2FSRA 1HSTA 3ABTA 5HDKA 1ENHA 2R7RA 2ZW5A 3B8GA 2GIZA 3S6HA 5I0CA 4H2KA 2DW4A 1MKMA 3BR2A 4L0ZB 1SD4A 1L0CA 2HQRA 2NVXJ 1VIXA 4QUSA 2V4JC 3RO0A 5DCMB 4X1EA 1Y0RA 3WTZA 3KPHA 3D68A 4GGGA 5JVTA 3IEHA 3N5FA 2YR2A 1IYLA 5HS8A 2VL1A 1SVOA 1IUYA 4Q38A 3WTUC 1MBJA 3JTGA 5K7ZA 5EG0B 3DKWA 5LRKA 3M8EA 3EUHA 1T2KA 2H8RA 3FEDA 3KP6A 4A3FJ 2AFMA 3NH8A 4UIBA 3HOUJ 5DS0A 1N77A 2D2WA 5BPDA 5C4JJ 2O8XA 3QPHA 4Q48A 2B7EA 4Y4RA 1VKCA 1XDSA 3E3VA 3QOEA 4IXAA 4IAVA 3I58A 1YIOA 1DU0A 2AJ6A 2EIKH 2CUFA 4OOIA 1Y56A 2L9NA 1SANA 3WTWC 3DEUA 4OC1A 2PX9A 3OYCA 1UFMA 5DWNA 5DM7F 3K1PA 2P81A 3H1CA 4E70A 1PCAA 2OF7A 2OU2A 2EZHA 3CUOA 3RIRA 2R7SA 3CCEI 2DA2A 4ZH4F 2HVQA 3OR1C 4ZI6A 5IX3A 3ZQHA 2WA0A 4XOPA 1KZHA 1GVJA 2H09A 5IT3A 2Y9YA 4II9A 4CA0A 3CXPA 3WTSC 2MFZA 4GXOA 3KASA 4XRSG 2XIGA 5BPIA 2HQ5A 4JX5A 1W0TA 4ZGYB 1RNLA 1YREA 3PUFA 2HU9A 3IRQA 4BKXA 2EZIA 4ZBGA 1STZA 1R4NB 4P6YA 4L9JA 3SJMA 1R1TA 2LKSA 4LFUA 4C3HJ 1MSFC 5F0HA 3N7ZA 2XHKA 4GS4A 2DMPA 2DK5A 2V1XA 4L5EA 3HOXJ 1PUFA 3DPLC 3S2WA 2HKXA 1QBJA 2B4DA 1E3OC 3MEXA 4PXDA 3RZOJ 5FB2A 4WJBA 1Y0NA 2CW8A 4A5MA 5EEAA 1K79A 1LOKA 2CYYA 5E79C 1T8IA 2K5TA 4D5CA 1O7FA 4XQFA 2V8HA 3SYTA 5HODA 2JT1A 4MI4A 3D7GA 2JVHA 3TTHA 2CV1A 2NNNA 1HW2A 3FRMA 4GXHA 3FHNA 3DPTA 3TT2A 2QSGX 3NE7A 2F5FA 1ZKGA 2K3FA 4BQAA 3IU1A 2EJRA 2HTSA 1CPSA 2M87A 2EK8A 3JTKA 3SZPA 3DBLB 4J3GA 4JXQA 1DP3A 1CG2A 3FXLA 1QHGA 2O6GE 1MBFA 3DKYA 2FCKA 1VZ0A 2V8DA 3GLJA 3IIBA 4JWPA 3J81K 2TDXA 4EJUA 4RLQA 2EB7A 2I00A 2YU3A 1U8BA 2ZELA 4OC0A 2ZEOA 4LIUA 4UHTA 4IHXA 2PJ7A 2MC4A 3CQZJ 3CLOA 3H35A 1K6YA 4ZY0A 2P6FA 4OLLA 3VDXA 1B6BA 1ELMP 5H86A 2L4AA 3S15J 1BR4A 2IXSA 5K8MA 4OAEA 4BNCA 1WJCA 2FRHA 3CZ6A 2FOKA 2DMTA 1JUMA 1YGHA 1S7EA 3RQIA 1FT7A 5AG7A 2F5EA 1YK3A 3N97A 4OIDA 5JR3A 3HL2A 2VJ4A 4YIIA 1FYKA 3L9FA 3J80Z 2FOWA 3VATA 2O3FA 3KZIC 3DEEA 2NSMA 5JPHA 5LEKA 2HQAA 2C1CA 2ZEFA 2E19A 4JX4A 1IIDA 3NH5A 3QWLA 4B5PB 4LX9A 1R22A 2DA4A 1LANA 3E0KA 2C6GA 3TKYA 4B5OA 4HG2A 4F6AA 2FS5A 2E7XA 4KFCA 2JA6J 3HUVA 3KP5A 2AO9A 2ECBA 5C3EJ 3BQYA 1MBKA 2VQGA 1IG7A 1WJFA 3GUXA 5M5XJ 1N25A 4PK3A 3AG2H 1FP2A 1X1PA 3FMRA 4QPOA 2IW5A 4LQGA 3E6MA 2CFOA 2M8EA 1I6XA 3BWGA 3IWWA 3HRUA 3ML6A 4E0AA 4C30A 4KVXA 5F1JA 1FYMA 2X6XA 3GTMJ 2IGOA 4D7NA 4TWEA 1JT0A 2W7NA 1IAWA 5E3NA 3FF5A 2MH2A 3GWZA 3HSRA 2KL4A 4G6QA 4UEZA 4Y49C 3KZYA 3I0TA 4MHPA 1T08B 4XLPF 4NJQA 2VI7A 1TTYA 1XSVA 2O03A 4XNHC 4UUVA 2KJBA 1Z3YA 3DTKA 4HF2A 3ZQLA 4OIQF 3GFLA 3PL8A 4XR6A 3ZN1A 3HDDA 1Z3XA 4IQJA 1J2XA 2HDWA 3EUHC 4BXUA 2ZJPF 3R6SA 1OCTC 1BJZA 2Q4YA 3F5BA 1FIPA 1ZR2A 1AKHB 3K70C 3FEEA 5EBVA 3PM1A 3KLNA 5EGOB 4OP4A 2Z3NA 4CRYB 4FASD 4JLYA 4M71A 3VWEA 1OCZH 4EV0A 3H3VK 4DUKA 1B87A 2PJ2A 3R96A 2QVPA 3CCUI 2YS9A 1LEAA 4B4CA 4ZYEA 1CX8A 1D1BA 3BQZA 3C2HA 5FROA 3ECHA 4LIVA 3F8CA 4G6TB 3CPXA 1GT0C 3U2RA 4W97A 2B58A 3GB0A 2E2IJ 2K4BA 2E35A 4II3A 4HNUA 1F4KA 2NVQJ 4E7KA 3RZDJ 4A3DJ 2KFDA 4BDYA 1WFXA 1WJEA 2PLYA 4F8ZA 4D7MA 3BC8A 4UY8I 1QQIA 1BI1A 4HX8A 2A68F 3I54A 5CJ9A 5FKLA 4DGWB 4CCNA 4UIAA 2MD5A 1YS7A 1ZLJA 3W6XA 4A5NA 4U0WA 1LEBA 5HNFA 3QYBA 3IWFA 2OTLI 1RKTA 2E71A 2FQ4A 3B7IA 4I49A 3BI1A 3PB7X 3F8MA 2WBMA 3CCRI 2RQQA 4D5FA 2DMNA 3WT4A 3Q3SA 5E8IA 2KP6A 4YU9A 4UXNA 1U3EM 4NGPA 3J81Z 3S3NA 5EJCA 1GLNA 3NQOA 1MJBA 2B3VA 2XRLA 5G20A 3PO2J 4C7IA 2QYVA 1V54H 2DQLA 3WABA 4PSWA 5HOOA 1JTXA 2CH0A 2ZJRF 1CGPA 4IHWA 4NHJA 1AA7A 1LVKA 2BSWA 3I3LA 3BPVA 2H1KA 5EGOA 1TKFA 2CTBA 2KDOA 5E96A 3E1SA 1K78B 2M4KA 3E6BA 1YE9A 2JK3A 1S7FA 1IUFA 1ZGAA 4XNFA 3TOBA 1PUFB 2M8GX 1W4MA 3LWUA 3RBUA 4Q36A 2CIJA 1Q2YA 2REFA 2PG4A 3I59A 2V7FA 1WWXA 1Z6RA 3HJEA 4GM5A 4ZY2A 3TFYA 4OADA 3CMMA 1I12A 1KUVA 4UUTA 1YSJA 1JGGA 1YW8A 4XLCA 3MWMA 1TZLA 2OOTA 2L3DA 5JI6A 5E3LA 4AUXA 4LQ6A 4JQFA 3HPGA 2BEIA 5F0CA 2OZ6A 1KQ8A 5FRNA 3WGGA 5BNGA 5L3FA 3S1RJ 2EIJH 4PDKA 5KTDA 1YRNB 4HSRA 3W6SA 5E8GA 2V6EA 1TWFJ 1V55H 5A2QZ 3OYHA 4DYRA 3FXQA 1VFCA 2XEIA 2UWMA 3S6KA 2L4MA 2M3AA 4B43A 5E20A 4MY0A 2CQNA 2YNEA 1MDMA 1JUSA 3QU6A 3IGRA 4BJ5C 3OYNA 1I1GA 2CG4A 2LOOA 2NVTJ 1ORKA 1BPNA 4YGOA 4XNHB 1H9TA 4A95A 5DCFA 4MEYF 3JRAA 1IV6A 2JPCA 5F64A 4LLLA 1Y7RA 3O3KA 2VKEA 1LAPA 2O28A 3FHZA 3BT9A 3TO7A 3RAMA 5I4MA 2A69F 1WGXA 1WK4A 2ESNA 1ZYRF 3MZ8A 3KP2A 3T9YA 3K4JA 3ZQ7A 4CAVA 2POKA 2E34A 3IRRA 1JKPC 2PRQA 3U9GA 2R8VA 2BBYA 3B3SA 4CAXA 2AFUA 4K3NA 1I39A 3LACA 3KIOA 2DT7B 1MMSA 5IPAA 3GFIA 4GFBA 5FVJA 4AC0A 1UELB 1G4DA 5EZGA 2ICWG 1QMUA 4A32A 3CCSI 2NS7A 3H5AA 4EGZA 4HX4A 4XM3A 2ZB9A 1W36D 2WYRA 1BIAA 4IHTA 1QSOA 2WUUA 2IJLA 2KISA 2LMDA 3FDYA 1HW5A 3J7AY 1H8AC 2IEKA 4G6DA 5JLWA 4ENMA 2QM3A 4R8FA 4PCQA 4E7LA 8CPAA 3K4BA 2CFXA 5CPAA 4M74A 1B9MA 1IW7F 1QGPA 3WU0A 1P6RA 3HPHA 2E1NA 2LY2A 3BR5A 4M85A 4Q5SF 4XPKA 1G3WA 1YVKA 1OQYA 4G8XA 4E7IA 1XGSA 2QSFX 1O4XA 4FE4A 4B48A 2PJCA 4XLNF 2WAQN 2VONA 4JYWA 3ZQIA 4AVAA 3GTOJ 4KICA 4IZZA 4MY3A 2K02A 3H9GA 2H6CA 4OIOF 4MQ9F 3H3UA 4PZJA 5EG0A 4JJXA 4B47A 4BINA 1M44A 2ZXWH 3FH4A 4LLGF 1MGTA 2RDPA 4OINF 3G6EI 1S8NA 3BDDA 1X3WB 4RBOA 3S1NJ 2AQEA 4KOTA 2B4DB 2L02A 4M3FA 4UEFA 3P2HA 3WGHA 1WRJA 2LRDA 2LDUA 4OIRF 4Q4ZF 2DMQA 1TLHB 4BHBA 1HDUA 2R7TA 1XGOA 1SMTA 1QZYA 3CUQB 2M9HA 4AYBN 2FXFA 1MH3A 2GLJA 2XF7A 2YNCC 3H8FA 4X0GA 2X48A 2NXNB 2L7FP 2Q2EB 2QYOA 4ZYAA 3FX6A 3PJRA 1QA6A 5K8PA 2KJCA 3LSGA 2P6TA 4PJLA 4B3AA 1IGNA 4AVCA 5LRJA 4A3JJ 4BL0B 2BUEA 2VT3A 2Z3PA 4RM2A 1B72B 1ZR4A 2XKPA 4F92B 2F48A 3A0HC 1OR7C 5B5EC 1HDQA 3D4UA 4PQAA 2NOJB 2O7OA 1AYEA 3DBHB 1F2OA 4M9SA 1GV5A 1W7PB 1TP4A 2LG4A 4OU0A 1YW4A 3OY9A 3IO1A 2LH9A 4P5OA 2J5OA 3TL4X 5KAFC 5HH1A 4XLAA 3FBUA 3LSKA 4HV6A 1ZTRA 5CLSA 2R93J 3QODA 3D7HA 3KI9A 2RAEA 3G3ZA 3GLXA 5GTIC 1SEUA 3W91A 4CH7A 2LNBA 3O2PE 3K2ZA 1NHAA 3KR4A 2V1NA 1NSLA 4AG9A 3HSEA 5DD8A 4UA3A 3COAC 1WHUA 1Z8XA 4DJAA 2Z33A 5DV5A 2OTJI 4MBUA 3GX4X 4U7DA 1ZRFA 1TWAJ 1XMAA 2GU2A 5D8NA 2OQRA 1LPQA 4RB0A 5E17F 2A5WA 1U2WA 2NRAC 2QQ8A 4A3BJ 3CXSA 3TEDA 2Z3KA 2ETHA 4I76A 1FMWA 2EUIA 3F8BA 1USTA 2F8HA 2JUGA 1SC7A 1U78A 4F0YA 3JRGA 2LKXA 2PVVA 1QPMA 2ZJQF 2WV0A 2XEGA 3PIPF 1XIXA 1XSDA 2Q4ZA 4UB6C 3WTVC 2ZSHB 4A6EA 2LREA 3OYLA 4MGRA 2HUZA 1SFEA 5FLMJ 3HKZN 1XS9A 1YR0A 3KX2A 4B44A 4FQGA 2E5ZA 1YJ9I 4HF0A 5KAIC 4OC5A 2FJ1A 2YGWA 2VBYA 3I4PA 3WC6A 1QPIA 3H3ZA 2GLOA 4YFJA 5LRGA 2HTJA 3D3SA 2MABA 3JVNA 5TRDA 3IH2A 2B4BA 3R0AA 4P96A 5HDGA 2ADUA 3DLJA 3FXKA 1RESA 5FO5A 3FKIJ 2COMA 1EA3A 5EYRA 1BPMA 1VQPI 4FUUA 4I6ZA 4A0XA 1G6NA 1HW1A 4RAGA 1G3YA 2EBIA 2R7DA 1LE8B 2QENA 1Z67A 2HYGD 3B02A 4IHMA 3F22A 4NSQA 1L0OC 1YQEA 2FNAA 3GTPJ 4L8AA 3JSOA 1WI9A 2EIMH 1CF7A 5FKOA 3BCBA 3RKYA 4ZYQA 2XGDA 2P7VB 4CSWA 2DT5A 2ZXHA 2OZUA 4KN4X 3IU2A 2DTZA 3HZJA 4MFQA 3A03A 1BAVA 2DOFA 4ZX8A 3HRMA 3OMYA 2WC2A 1R6RA 3W3CA 2QZ8A 4ENKA 1A5JA 1D0XA 1A31A 1REPC 2VJIA 2AFXA 1ETXA 1JTYA 4UUSA 4ONUA 1D5VA 2GANA 2EPFA 5F08A 4XKVA 5TJJA 1VTNC 2QSHX 1JUPA 3PB6X 3V4GA 1YVOA 2VEZA 3HB9A 5IT9K 2KLOA 3P2FA 4HNYB 3ZXSA 2IVMA 3M1CA 3I71A 5HLIA 5ICEA 4RDUA 5LHGA 3F6VA 3H9JA 3IL2A 2PN6A 5ICGA 3PB9X 3RKXA 1K61A 4LG0B 2DA6A 1HEEA 4A0YA 4N4NB 1D8JA 2FIWA 1VQ7I 1YMEA 3RPQA 5FGMA 2P7CB 3JCUC 1ERDA 1WQ2A 3DR6A 3S9MA 3OS0A 5C4XJ 3JRDA 2ZEMA 1LFPA 2Z1DA 3DXJF 3L2RA 1SQHA 4EQQA 4F55A 4P4EA 4BU2A 4X5KA 3G1MA 4HRIA 1ZH5A 3PP9A 5DEQA 5EEHA 4HPSA 3NWTA 1Z8WA 1X19A 1UHSA 1BN5A 4F52A 4HQEA 1M4DA 2X4HA 3FF3A 2F5VA 2PRBA 3HSFA 1ZHFA 3CF2A 4RGUA 2QECA 1M4LA 1XN7A 2VC0A 3QPLA 5F49A 2DFFA 4MFDA 1XDUA 2F4IA 3CT9A 1UFHA 3IKTA 1BLLE 2XB0X 3ABKH 4C2UA 1CJWA 4QSHA 4ZX9A 2IS2A 2RNJA 2STTA 4MTDA 4IHVA 1R58A 2ZKZA 1R7JA 3F72A 3GYHX 2XPWA 2ZXVA 3CLQA 4PJMA 1ZG9A 3UY5A 2XAQA 3SI0A 1U5TB 3CDLA 2O61A 1YTYA 4P44A 4IPAA 5E3MA 3PNVA 3P9KA 2W57A 4IKFA 3MD2A 7CPAA 5CVJA 2BL1A 2D1VA 4KIFA 4E7ZA 2Z16A 1BJAA 3W2VA 1DPUA 3BPXA 3TMOA 1VQ6I 2HPMA 3E0JB 1VQ5I 2BGCA 2F7VA 2N8GA 2J9AA 3B3VA 2VB6A 3P7NA 4CAEA 2XVCA 2Z3YA 2UZKA 4F9UA 4MHGA 4MIMA 2WY7Q 1GHCA 1Z0XA 5IY5H 1I6HJ 3NH4A 3K4CA 1R9TJ 2QQ9A 1ZGJA 1GVDA 3HGYA 3PQKA 1M1EB 3CZXA 3M3YJ 1QSRA 3ZN0A 2K9SA 3ZP5A 2EFQA 2JRMA 3AL0B 5F27A 1S6LA 4P10A 3I56I 3EDPA 2VIXA 1F36A 4OC3A 4BACA 1B59A 2WZNA 1EE3P 1T6SA 3RSNA 4N0BA 5J8FA 1HA8A 4AIDA 3L7WA 1ITYA 2CMPA 1BW6A 1B9NA 3H0GJ 3B3TA 5GPAA 2PIYA 4K30A 1Z91A 3TW7A 3MGDA 2RN7A 3FISA 1NMTA 4MLOA 1E17A 2X6OA 1HQCA 2ZEGA 4LD5A 3QPTA 4CYNA 1QZZA 4RAYA 1BC7C 2QKLB 1WKMA 4E2AA 4FD5A 2DODA 1MH4A 3F8KA 2R92J 1JJ8C 1RTQA 1S5KA 1JHFA 1D1CA 2I10A 1D0YA 5DD4A 3X2QH 5FLVA 4UWJA 3DPUA 3FKJA 2FEZA 1TIQA 5CNPA 3T90A 4M3GA 3CDHA 3C1DA 4BEHA 5ELYA 3T8WA 4MHZA 5L3GA 4YIRX 1R3NA 4BY1J 2ZXIA 2JA7J 2XROA 2LKPA 4XOTA 3E6CC 4I2OA 1BW5A 1IU8A 1N71A 4MFLA 2A5YB 4P4JA 1HF0A 3VFZA 4PSXA 1XB4A 2L9VA 4KNYA 2O53A 2EV5A 2GBYA 2E7WA 4NGNA 1XC5A 3ULQB 2LF7A 3M8FA 5A27A 4OIWA 4Q47A 4V19K 3GZNB 1A6IA 5KTAA 1KYZA 2HS5A 5K1YA 3CJTB 4WXHA 4LB5A 3RCOA 4F93B 3HGGA 3DNSA 1Z77A 2JSCA 2PJPA 2BY1A 4WX9A 4M3SA 5BMZA 1K7AA 2JN6A 1SMYF 1N78A 2DPTA 3PBEA 2EFPA 2VQCA 4R1HA 4FISA 3I3GA 2EH3A 2HYFA 4YFXF 2C6YA 2VL8A 5GADJ 2IJZA 1JGSA 1YW9A 1XGNA 2KKOA 2R5ZB 2Y2ZA 3A2KA 1ETYA 4LJZF 4U88A 3WGIA 5LEJA 2DA7A 1HBXG 1VF9A 4L5IA 1NSAA 2DO7A 3RYRA 3ROUA 2XAFA 3VYRB 3OYJA 4MJ8A 2EK5A 1H0MA 1HXDA 1BI0A 1Y0UA 2LFBA 4LB6B 2DEAA 1ZG3A 2WTEA 5ILVA 3GCMA 4IO9F 5JLXA 1E2XA 2P4WA 1FEXA 2Z3LA 3MQ0A 1PVEA 4H6UA 4N4OB 1YQAA 5IYCJ 2E1MB 5FFXA 3DTEA 4XICA 1YLOA 3G4SI 2VZZA 3NA6A 4C2TA 3VYUB 3MCZA 4IX7A 2VBQA 3J80K 4L89A 4Z65A 2VKVA 2K27A 1L3LA 4RUHA 4Y15A 4HV5A 1TKJA 1CP7A 1IYKA 1SFOJ 4A33A 3CCYA 3H8GA 5CBMA 4HNVA 3IC1A 4OMEA 2EV0A 2VODA 4KOXA 4MHYA 4XKWA 1D8KA 3C18A 2PJ4A 3IWGA 4CICA 2PVWA 2JLMA 3Q0VA 3OOUA 3MFKA 4ZY1A 1J75A 3AG4H 1DUXC 3R9GA 3FM5A 1FP1D 1Q1VA 4Y17A 3D2PA 4P45A 2COBA 1OJLA 4UFXA 3PFYA 1FYLA 2ID6A 2XASA 1ON1A 5F48A 5IV0A 2PJ5A 4HX7A 3ESWB 2HQNA 1D3YA 4KIGA 4U7BA 1GYTA 4ZYGA 4UVBA 4FT8A 3TE4A 3WG9A 2Q0OA 3WE2A 1TXRA 2D1HA 5CQGA 3LODA 3LQQA 3TGNA 1JE8A 2FXAA 3GO5A 1XG1A 3KYDB 3CC7I 2CJJA 4U0YA 1IXSB 5FKMA 1MBEA 1IN4A 5J1RA 1OYYA 1PUEE 1MJAA 2KIFA 2R7HA 4DQ2A 3EY5A 3U1DA 4EM0B 3S6FA 1FBQA 1M1DA 1W5TA 2GA1A 2RREA 3M7GA 5D8LB 1FBUA 4U9YA 5AGEA 1WJ5A 3WE3A 4CGMA 4HDVA 3ZOBA 2LD5A 3ASOH 4CUGA 1WSUA 2CNTA 5ICCA 4HQMA 4A38A 5J47A 4F0XA 5JGFA 2HOTA 2JUCA 4J19A 3GFMA 3KR5A 4MFJA 4DYCA 5LHHA 2LTPA 3GTJJ 4NUBA 1XFOA 1Z2LA 2RFHA 1J09A 2VZYA 4P4IA 2HKOA 1NG7A 2F4OB 2B63J 2VKDA 1BOBA 2PIZA 5M3MJ 1CP6A 2A05A 2H5MA 3TOAA 1BM9A 3K10A 4V2GA 1A35A 2R7QA 1K83J 2CW7A 3Q0UA 4CYCA 2PMZN 5LYDA 1NH3A 4HKFA 3K7AJ 2DBBA 3G2BA 2Q8KA 4D9JA 4B13A 4RMNA 5E1XA 4QVTA 3OYFA 3J7ZI 1PP7U 1ARLA 3HTSB 2QEXI 4IHSA 3D1NI 2BY2A 3RDIA 5LYFA 5G21A 4IRGA 4QC6A 3LOCA 4O5VA 1OBRA 1AHDP 2OBPA 2ABZA 3WU2C 5IP7J 3T8TA 1F9NA 3CP2A 1C0WA 4BHPA 3NRVA 2DAOA 2AFOA 2XEFA 2P5KA 3L2VA 1ARMA 3H5RA 2PCUA 5G1ZA 1KU2A 4AB7A 4CGPA 4R3KA 3RPUD 4KOYA 3FXUA 5IYDJ 1JWQA 4PJJA 4Y52J 3FB3A 2JVGA 1X3UA 3BTCA 2L7KA 2CQQA 5H2FC 2IA2A 3WHCA 1PYTB 3H9QA 1IN6A 1F1ZA 4XKCA 5JVGF 2G3TA 3KHXA 2B5GA 3W2AA 2D4PA 2MLKA 1TKHA 2R1IA 1QRYA 3Q9VA 3JAMK 1B8IB 2EFOA 1LFWA 2REEA 3IJ3A 4UNOA 1MNMC 2CQ7A 4UV9A 3E6DA 4RAFA 5HNHA 1XTAA 3DBRB 2YNCA 2ZJ2A 4NEXA 5HVQC 5HXDA 4CYDA 2LC2A 2CWEA 5KCMA 3HOZJ 4O23A 1MMAA 1JKOC 1YX0A 2DFEA 2VI6A 2FSWA 4ESBA 3RI4A 3O6BB 1OCCH 3QP6A 1ZQ3P 4KORA 2RGVA 2H94A 3B73A 4JYKA 3S32A 2MH9A 1OR7A 1KQ9A 3IHUA 2IT0A 4OIPF 1IN7A 3OOPA 4LK0F 5HS9A 4Y13A 5B66C 4Y7NJ 3EYYA 1OYIA 5H84A 1S29A 2HZTA 4QIWN 3JAMZ 2WSAA 5EZHA 1FWZA 3MRUA 1ZLHA 2IGMA 4C2MJ 3L1PA 4IF5A 4XRSA 1HC8A 2ZNYA 1DQUA 2K4JA 1ZG8A 5M5YJ 3CJRB 2M34A 3H36A 3Q0WA 4CZCA 1CQTA 2DI3A 1P7IA 2BY0A 1X58A 2PQ8A 3QYFA 2F5DA 2W48A 3CCMI 2VC1A 3DWLE 5GP9A 1R5HA 4KMFA 4R6TA 4XPLA 4MHNA 1KWMA 4PGGA 1ZLIA 4AIJA 1T39A 2PC1A 1I27A 3BTIA 2OQGA 2XF5A 4XSZF 5IOZA 1VQ9I 1IOFA 4RB3C 4CYOA 1FJLA 1POGA 1TF9A 4HF1A 2F5CA 1ETKA 5LYIA 5D6FA 3KZWA 4DZPA 2R7ZJ 4Q7AA 5A2QK 3D7DA 1H88C 1XPXA 4MCQA 3KE2A 3SFZA 1FY7A 1VHSA 1W7PA 1XMKA 1RPWA 3MZHA 2YU9J 1V0CA 4NJRA 2QBYB 5A28A 1Z1DA 4HW0A 1DPRA 1WCMJ 4FHTA 3ZGKA 3L2UA 1G2HA 1I1SA 1HOMA 2FT0A 2FVGA 2Q4VA 2V8GA 3SXYA 1MIJA 2RNGA 3PNYA 2Z99A 3GUDA 3IWZA 1YI2I 1IOIA 5EMIA 3JREA 1WVRA 4KUAA 1ETVA 2CO5A 3OV8A 3FVLA 2PJ8A 4NXYA 4KDPA 2X1EA 2FA5A 2ACJA 1NK2P 4IRHA 1VHOA 2DN0A 1BBYA 5B1BH 4H89A 4OKOA 2WPXA 5D8KB 3PEIA 1X2MA 1QNTA 3D5SC 3K1MA 5BWAB 2G7UA 2NVYJ 3E97A 4DYQA 1MZBA 4BE1A 3SI1A 3EYIA 3HKZA 1SFUA 5AONA 5ILSA 3QAYA 3S17J 1HLVA 1JI8A 2KCWA 2OZHA 4M6XA 1O7LA 2AQFA 2OCCH 1J7KA 2I5UA 5LLQA 2XPUA 3QQAA 4C9YA 2FBHA 3VEPA 1BIBA 1WH5A 3DQVC 2PJBA 4KVME 1GXQA 4R9MA 1Q7LA 2C6PA 3WU1B 3IFEA 1X12A 1U9OA 2CW0F 2KQRA 2LVSA 1A04A 2M7AA 2JBJA 1Q2DA 3LMSA 3E5QA 3F8FA 4NC6A 4CZZA 2Q43A 3H8EA 1Q1HA 1DGRM 5HDNA 4LOCA 2Z9OA 3A1YA 2CV2A 1LDDA 4JD6A 4PPZA 4YG2F 1BR1A 3HHHA 4KLVA 3HRTA 4ONWA 2FNPA 2BVMA 4KOWA 4NBQA 3W6VA 1R5GA 2DJNA 4KOUA 3C26A 4ZYHA 1O3RA 1GXPA 3U21A 5KNLA 5J1YA 2PR8A 5E1ZB 3ELKA 3TP0A 5IP6A 1P9QC 3T1BA 1SAUA 2VBZA 4FD4A 2G7HA 2M45A 1T98A 4ON0A 2DQRA 2X51A 4L9VA 4BQOA 3EXNA 3LAJA 2HZDA 4RAZA 1LE8A 4L9TA 3V7RA 1GHEA 2MG4A 2QKMB 1LB2A 2EWNA 2UUZA 4A3CJ 3OSGA 1KZFA 3QAHA 3V42A 3VYTB 3IH4A 3KQXA 2WY8Q 1WJDA 4ESJA 2HQYA 3FZVA 2R5YB 2O5RA 5B1AH 2LP0A 3W6JB 1UMQA 3H5NA 2WWYA 3D0SA 3AG3H 4BXXJ 4F7ZA 3RJPA 3GYAA 2DFHA 1UAAA 3D5RC 2GQQA 5F0FA 4UCNA 1KONA 1OCPA 2BV6A 1EF4A 3DTIA 3F9KA 2XV4S 3PBBA 2VBXA 1IXCA 1RR8C 4TNUA 3H5ZA 3B35A 1IXRC 1J59A 1I1DA 4KUBA 4EMEA 4KOSA 4RS2A 4MHDA 1AMPA 1IN8A 1R57A 3KHZA 2OZGA 1F43A 2KIUA 2XDVA 4A2UA 1ETOA 4ZDPA 3NAUA 4AVZA 5LBQA 3MKWB 4KJZA 1Y1WJ 2QCOA 1FBSA 2TCTA 2CXAA 2D4OA 3NFZA 1KYWA 2BW3A 2Z5UA 5D5WB 1FOKA 3K9TA 3L09A 3PB4X 1P4WA 1Y8RB 4IHYA 3I59B 1KGSA 2RKHA 3SJGA 4CDGA 2CS3A 1E3HA 2XAUA 1MMNA 2NMTA 4EVYA 3ZQGA 4G7HF 4KSIA 1AOYA 2ZPAA 2R7UA 4HA8A 3MZYA 1XMBA 1P4AA 4XORA 5KTCA 5D29A 3V7CA 2EVNA 3IAM2 3I4MJ 1JJ6C 5LGTA 4AM3A 4H4KC 3KEQA 3BCAA 1BI2A 1XEBA 2CTCA 5ISVA 2MSYA 4DOZA 1IB1E 3LSRA 3FIXA 3Q5FA 5L3EA 5EDNA 3OYAA 4FAIA 4V2FA 4ABZA 2PFBA 1USSA 3OYMA 1RRJA 1VQ4I 2VXKA 3PB8X 4OWRB 2BE5F 3P9CA 3RZAA 4C2YA 4P4DA 2VXZA 2E5NA 3CDIA 4IRIA 2BHZA 3VYSB 1QSMA 3KCCA 2Y48A 4N9IA 5M5WJ 1VNDA 2X1CA 1WI3A 2CUJA 1G3SA 2L01A 2WB1A 3D5LA 3R95A 1YYVA 3KYLA 3BTJA 2HWVA 3IWEA 3ZMTA 5LGNA 4KS9A 2JSPA 2B9SA 4NCZA 2CU7A 1F2PA 2L2OA 4IVNA 1LFBA 2BOAA 3HOWJ 1OKRA 3V8LA 3DFGA 3JRIA 3CC4I 2DXQA 3H4QA 1CPXA 2DYSH 4M72A 2YX4A 3GBGA 3SJFA 3EQLF 2QLZA 2BHYA 2I79A 3S1MJ 1IRGA 1UCRA 1LNWA 5AG5A 1ONVA 2EQRA 2JPBA 5HMNA 3HG9A 2FMYA 4BAYA 4GCVA 3BY6A 1TW2A 4GO1A 5JH9A 2NAZA 5HLHA 4XLHA 3DU5A 4HDUA 4BEHB 4AG7A 4DJLA 1LDJA 2HOAA 3CO7C 4X6AJ 1P4NA 3EFAA 3SEQA 2BVLA 2V1UA 4JXRA 4A94A 2NYXA 2ID3A 2GLFA 2JWTA 2MD0A 5FD6A 1S3JA 4S0HB 5EF6A 1X1DA 4S05A 3ISXA 2NS8A 3JRCA 1XE4A 4ZTFA 3EO4A 1V5FA 1XF8A 2GOMA 3QU3A 3BLNA 3VARA 5J1QA 1PYVA 2M30A 2L54A 3S9LA 2O9LA 2UXNA 2GXGA 3FMQA 4PUSA 2PJ9A 4NGSA 4BYYA 3GY9A 2JDCA 3OL4A 5LGUA 3GFJA 2XB5A 1UJ8A 1VQOI 1IDZA 3CUQA 3D66A 1JT6A 4B8XA 1H89C 4PJ0C 3M8JA 4IQ4A 4B12A 3BG5A 1Z7LA 1KUYA 1YW6A 2EILH 1V3FA 2TRTA 5G22A 2O8KA 1FT9A 1S7AA 4XPDC 4C2XA 2FE3A 5E1WA 3QRFF 2PDOA 2XEJA 4NNJA 1FOXA 4EGYA 3HOSA 4A93J 1OISA 1E0EA 2Y75A 4KMUX 3A01B 2STWA 1Q2CA 4C2ZA 3JUWA 1PUAA 4BUPA 3B2YA 3LQRA 2ISZA 2H27A 3ZMVA 1IO2A 4PFPA 5B3SH 3U1KA 1XD7A 2JMWA 2DPUA 4ENJA 4B14A 2A6EF 2VASA 3IC7A 3D8PA 2KZVA 1ZAOA 3G3SA 3EETA 5D5XB 3OYGA 1K4SA 2OAZA 5F6FA 2HDCA 2Z3MA 3MN8A 1ETQA 3BOQA 3O8HA 5D4SA 4FE7A 2DLLA 2OCEA 4K2EA 2FL4A 3A9LA 1O57A 1Z6TA 2LBFB 4PXCA 5THWA 3KEOA 3QP5A 4G94A 5KHDA 3CC2I 1SVLA 1UG2A 3OS1A 3OWCA 4NGTA 1PJRA 1E3PA 1JHHA 4MTEA 4EM1A 5LRSA 2MLGA 2LR8A 3K69A 2OD5A 3PZJA 3S2HJ 1YRNA 2W4SA 3VSKA 2G0BA 1A2ZA 2G3AA 3E7LA 1XCVA 3A0BC 1MDMB 2DOEA 1I3AA 2EV6A 2H6BA 5FKKA 3PQJA 3GTLJ 3S3OA 2DXIA 3FNCA 2OPTA 2YNDA 4ENNA 3R4KA 4ESFA 3MN2A 5LD2C 3CTAA 4C7HA 2DFIA 4UF4A 4ITVA 2PMUA 2DCEA 5D4RA 1GV2A 4NC8A 3S6GA 2Y0SN 3MKZA 3SXNA 3AFHA 3TCVA 1TW3A 4IJAA 1R5ID 3BXMA 3DLLF 2KT0A 4KT5C 4KVOE 2DPDA 4XL9A 4P9FA 1PU9A 4QBJA 2F2EA 3GEZA 4ZZDA 2A6HF 2V8VA 2BEOA 1YX5A 2ZC2A 1D5YA 4KOVA 2OJED 4GRIA 4MNUA 3LL7A 4HNXB 4FBEA 3ABUA 1O3QA 3HIFA 1V5GA 4CYQA 4M6VA 4QLCU 1VQ8I 3S8PA 4UUSB 3SEZA 4P4BA 2AHQA 4CCMA 3HOVJ 5HVHA 1QZEA 4HAMA 3P5JA 5FJ8J 5K8OA 1X1AA 3F8NA 3OIQA 4A3GJ 3V7SA 1KA8A 3K2AA 3LFUA 2V6CA 2P6EA 5GAHJ 5HLTA 4A37A 5C82A 1A36A 2E2HJ 4NDLA 1CM0A 6PAXA 2K9QA 1Y9WA 1D1AA 4UFWA 1DDNA 3ZJ0A 2JJ7A 1ZLKA 1QU3A 4LITA 4IOAF 2FD5A 4A30A 2HV2A 4R7MA 1S5LC 2ZMEA 2X1DA 3C3WA 1YHQI 3E5UA 2FU4A 3ASNH 3I9V2 2Z10A 1HSJA 3DU6A 3EC4A 1UG0A 4A12A 3F6OA 4WK8F 3WTYC 4KSFA 3OIPA 4FETA 1QSTA 3MVPA 3SHPA 2QVOA 2KRFA 1Z9UA 4R79A 4MO7A 2QIRA 3ZMZA 5LHIA 3L2WA 4RLFA 2P0WA 1AKHA 1I21A 2ELKA 3K1NA 4DNCA 3VWBA 4HEA2 2A4NA 3BZKA 1FZPB 4O3MA 4EJTA 4OMYA 4U9ZA 5F47A 1DU6A 1H9GA 2DA1A 5DYMA 1XOVA 1ZG7A 1A6QA 2K7LA 1LKXA 1EV7A 2BCOA 4I01A 1Z21A 3BR0A 4G9YA 3UR3C 1DP7P 3TO6A 2IS6A 1X1BA 2NOGA 1IRZA 3DV8A 3TDZC 3I1UA 1Y8QB 1IRXA 3HYIA 5IB9A 3BI0A 2I8DA 4KISA 3BHXA 1MNDA 3S1QJ 4Y49B 2IGNA 3R61A 2PSWA 4E7SA 3ERED 1IRFA 3I55I 4B10A 4BGDA 3V38A 4XMYA 4IUSA 1OPCA 1G59A 1F57A 4I02A 4L9NA 4OMZA 3SQNA 1Y1VJ 4HNTA 4XKBA 3FBIB 4QPQA 4D1QA 3M1EA 2K85A 1RZ4A 5J6XA 1ZGWA 1HDDC 1ZK8A 4NQWB 2KPMA 4BQQA 2PEXA 2K5CA 1IN5A 4WF2A 5AIPA 2IL4A 4XPDB 3C7JA 2L0KA 3L2QA 2FQ3A 5CQEA 3IH3A 4DYOA 5JHUA 2P5VA 3ZQCA 4R87A 1IICA 2K9MA 4I0BA 5TGTA 2YUSA 2RVCA 1PDNC 4BHCA 3LFKA 1RETA 3REOA 1U5TC 2Z11A 4I7HA 2VUMJ 3S9NA 1MMGA 2LBFA 1U5TA 4KN7X 3LSJA 1K4TA 3ZPLA 4FTHA 3CDXA 3CCLI 2M7BA 1TT0A 3ZCOA 3LD2A 2UXXA 3FXOA 1RXTA 3DKXA 2HYJA 4EWTA 4ZYDA 3CXQA 4XSXF 2VQLA 2VJJA 2X0LA 3ZMSA 4ZZLA 1R71A 2ARHA 1T95A 2YSRA 5GCNA 4E8OA 2CGPA 1U0JA 3BLYA 1TWHJ 2PJRA 4YFNF 2B3UA 2VBWA 2E36A 4XK4A 5FKNA 3FMCA 3O8GA 4CAFA 1Y6IA 1I3QJ 3LA7A 3WHBA 1UHWA 2DDAA 2HFHA 4OAZA 2ZEDA 1YG2A 3K9UA 2XRNA 3QNVA 3BR1A 4LUAA 1VQKI 1LRZA 3FXMA 2JZYA 2MA3A 2BY3A 1TL8A 2KRCA 2EWBA 4U5YA 1HKQA 3S93A 1S7LA 1Z8TA 3KGQA 5F09A 3I5UA 4HZFA 3G1OA 2HPIA 4AVPA 2YPRA 1OMIA 3D2MA 2LYCA 4A3LJ 3N05A 1X4PA 1IY7A 1J5YA 2M0CA 3CMYA 1YITI 2MYSA 5GTHC 1OZPA 3GLLA 4A3IJ 3R60A 1EH7A 3S2DJ 3KQZA 4BDZA 1JKRC 1WPKA 2LY1A 2WAQA 3OYIA 2DA3A 2R7VA 1FSHA 2F6CA 1CF7B 5IP9J 4M9XA 2A6TA 2B0LA 2JBKA 4UCPA 1TQMA 2EFNA 2LLKA 3F21A 3HEFA 3I9SA 4RN7A 1IF1A 3WG7H 1BI3A 3W6KB 4R3LA 3FECA 3GXOA 2MBFA 2GWRA 2VQYA 1MBHA 1S72I 4UV8A 2E2JJ 2V9VA 3RYPA 1QSNA 3FXTA 4HLXA 3RYOA 2KDZA 1LDKB 4LG0A 4EJVA 4X8IA 1QVUA 1UZCA 4FX0A 2KIMA 4EJOA 3Q9SA 3TP3A 5K5RA 1SFKA 1N75A 1F5TA 4ORFA 1GDTA 1MK4A 4CGLA 4CXFA 4MEXF 3HBLA 3PRTA 4IEJA 4YEJA 1RIOH 3GF2A 3GZ5A 1IJWC 3CCQI 3GW2A 1JKQC 4KITB 4BJTA 3CMEI 2ISYA 2W00A 4UB8C 3VOEA 4AIHA 4Z2YA 2QA4I 2VPLA 2Q44A 2IPQX 2IA0A 4F9VA 4JP0A 3L2NA 2P6GA 3FXRA 1QO0D 1ULYA 1ZG1A 2XPVA 2DTRA 2KIQA 4HPQA 2P8TA 1IDYA 3BJ6A 4RI1A 4BE0A 3H0DA 5J3LA 3FX3A 4NFRA 4A3MJ 4U0VA 3LAPA 1KU9A 3ABMH 1DTDA 4A39A 4WWCA 4KA4A 3BTLA 3HUGB 3S3MA 4XIDA 2GXBA 3PNTA 2BW3B 2G9DA 2PJ0A 5KVRA 1S60A 2KZGA 2QMLA 2K9LA 4G7OF 1BA5A 2CNSA 3GVAA 1AWCA 4R57A 1DE4C 2MGQA 1BL0A 1M4GA 2Q2EA 5D6EA 3ZR8X 3ECOA 1YS6A 4RA2A 3OYKA 1LCPA 4AVBA 3BJ7A 3LWFA 5DTDA 4BJ6C 1VQMI 4DBRA 2PJ6A 3JSPA 5D5UB 2HGCA 4TV7A 4B11A 3JRFA 4YIFA 4HLYA 5IB0A 2MW8A 5HLGA 2R0QC 2VKHA 5GAGJ 4A3EJ 1Y0YA 2IAIA 2IP2A 4FD6A 1I5ZA 2GXAA 3SHFA 4IL6C 3M07A 3K4LA 3C2GA 4XRFA 3HOTA 2EFWA 2BO9A 2JDDA 5D5VB 3GIUA 3KL9A 4CCKA 3SFIA 3AL0C 3LSMA 3VB2A 4CO8A 1T0FC 5JQ4A 2VOOA 1MSEC 4AIKA 2IGKA 5HVGA 3FXJA 3JTHA 1X3ZB 1RKWA 5BQTA 4YWYA 2R4GA 2P5LC 4E7HA 2Q51A 1PP8F 4OC4A 1FPQA 2VXDA 3AKZA 1BOAA 3M9AA 1TT5B 1YO5C 1R49A 1MNEA 4FX4A 4KYWA 3OS2A 2R7WA 3DDDA 3NARA 1LAMA 2HXOA 5EC4A 2ZEHA 4B1RA 2GAUA 3FK6A 2GOXB 3LMMA 1UWYA 2J8RA 3VH9A 3OIOA 2IA1A 1XCBA 2OV7A 3TDUC 3IP4B 3T8RA 1XGMA 4AWXB 5LFAA 4RB2C 1Z5RA 5K5QA 3GTKJ 2ZBKA 4HOBA 1XMTA 4NB5A 3RQ4A 3G73A 3S14J 1S7KA 3OYEA 3FYNA 5IOYA 1OCOH 4ZDLA 4F3QA 3FBNB 2Y31A 2PJRB 4CGOA 4EFDA 5DUKA 3LSHA 1UB9A 3IAS2 2ZW6A 4YRVA 1YIJI 3T0YA 1VQNI 1M4IA 1Z7UA 2CF4A 1O3TA 4PV6A 4J00A 5HVFA 1FNOA 3L00A 3UNGC 4F91B 4I99C 1XX5A 3B3CA 1XMXA 2VOPA 4CHUA 4W9YA 2QQAA 2R7XA 3G1LA 2IMOA 4XLEA 2K86A 2C6CA 3CPAA 3J7YJ 2O4HA 1R1UA 2VJ5A 3SI2A 2V9PA 2Y0MA 5CPRB 3CJNA 1KQ0A 3NEUA 4FWUA 1CBXA 4NGQA 2Y0SA 2K9NA 1KU3A 4RGXA 3LA3A 2CUEA 1ZARA 4XLFA 3WC5A 4M6HA 1FTTA 1KUXA 2DDBA 2GZWA 4P4FA 3HRSA 2R7OA 4M3BA 3V8KA 3E5XA 1R4MB 4LG3A 2G0EA 2ZOFA 4JOMA 4FD7A 3HM5A 1ZO0A 5AG6A 4QB9A 3GKRA 1IV8A 2DT6A 2V1DA 3B6CA 4GYGA 3K4KA 3ISZA 2HDDA 1X10A 4BE2A 2Q1ZB 4II2A 4YRHA 2QBYA 1R43A 2J8MA 4ASNA 5ILUA 5DM6F 1HKSA 1MJ9A 2XC7A 3K0LA 3F23A 2F5IA 4WXDA 4PJNA 2AFWA 2PBIA 1LJ9A 3FM3A 3TQNA 1RR7A 3KLOA 3H92A 1DGWY 3HOYJ 3F0AA 4CGNA 5FLXK 5C44J 4B3XA 2C27A 3PSIA 2EK9A 1U6MA 2DPSA 4PK2A 1OYWA 5LYLA 2R5ZA 2EZKA 2HVSA 1B8IA 4R8HA 3B3WA 3PFEA 4M3EA 4KZTA 5E3OA 5FRMA 4UWIA 5H6RA 4ZTJA 1R00A 2BOLA 2B5GB 2VPRA 3IKVA 3LSTA 4X3RA 4HYEA 1Y7EA 2OUMA 2PJAA 2LK2A 3PFIA 4C3IJ 2XGXA 3B6AA 3I53A 5CYVA 3VODA 4AYBA 4EMSA 1W36C 4E6KG 3FJUA 2XF6A 4BQNA 1XSXA 2CUZA 4KT6A 4Y33A 5H20A 1OCRH 2HOSA 2M2EA 4XRMA 3G8WA 2XAJA 1LFUP 2RV8A 3WR7A 3OYDA 2ELHA 4DBQA 1S7NA 2ZW4A 2LSOA 5BOXA 3A4CA 3I4NJ 3PGPA 5JHFA 1FSEA 2XGEA 4YELA 4EM2A 4JZ0A 2RQPA 4OAYA 2HVRA 2PJ3A 1TQPA 4G7ZF 3JR9A 5DS9A 1ZREA 4LGWA 4GYIA 1X4OA 2CY2A 1AU7A 1K4JA 2XUBA 2DU9A 2Z3OA 1YLFA 1YJWI 3ABLH 1TNTA 4D0PA 1VI0A 2HNHA 3D7FA 1TBXA 4YFKF 1WH7A 5DCMA 4M6IA 3JRUA 5H6QA 1LQ1A 1FOWA 3AG1H 2LY9A 1QVTA 2O0YA 4M9ZA 1FTZA 2ZCWA 1S9HA 1X2NA 1MMDA 3TC8A 2OA4A 3RPUA 2JTVA 2FBIA 3CJQB 1LVAA 1YLEA 3CESA 4FCYA 2EBJA 5EEGA 2L9RA 4I98B 4H6ZA 4B09A 3SJXA 2JRTA 4ETSA 2EINH 2AXTC 2E1OA 2V79A 4KSAA 4UBRA 4X2TA 4PGHA 3ERMA 1B1BA 5L3BA 3GMEA 1ETWA 2ZNZA 4ANJA 1W0UA 1XRYA 2XGCA 2PJ1A 1FMVA 2L7MP 3K2KA 4MQVA 2R7FA
chains in the Genus database with same CATH topology
2LBFB 2R98A 2ATRA 4A31A 5J8CA 5F46A 5KHDA 3BG7A 3A2KA 5C88A 3OS1A 3OWCA 1Z3YA 3DTKA 1PJRA 1OLTA 2JEVA 3PL8A 3OYJA 4XR6A 3VYRB 4MJ8A 1WJAA 1Z3XA 2HDWA 4IQJA 3EUHC 2Q4YA 3F5BA 2KRHA 5EBVA 3K70C 3OL3A 3PZJA 2Z3NA 2Z0ZA 4CRYB 4FASD 2W4SA 4JLYA 2YNDA 3VSKA 3VWEA 3VSLA 2Z3LA 2G0BA 4HNWB 3K6GA 4N4OB 1B87A 2G3AA 2E1MB 2VZZA 3DTEA 4H6UA 3R96A 3ZZIA 1NG6A 4C2TA 1D1BA 3VYUB 4IX7A 2RC4A 3KEYA 2VBQA 3C2HA 2K3PA 5FROA 4J01A 3S3OA 2DXIA 3FNCA 2KMUA 4LIVA 4G6TB 2AE6A 4L89A 5LD2C 4C7HA 2B58A 1QHHD 4ITVA 2DCEA 3S6GA 1V5EA 4II3A 4NC8A 4Y3OA 4HNUA 3MKZA 4ZDOA 3SXNA 3AFHA 1IYKA 4A33A 4E7KA 3TCVA 3LSIA 4NC7A 3HC7A 1WFXA 1WJEA 3QYEA 4BDYA 4KVOE 2FUG2 2M4GA 3BC8A 4XL9A 2FIAA 4KOXA 4XKWA 1PU9A 3IWGA 4DGWB 4QBJA 4CCNA 2PR1A 3OR2C 2JLMA 3W6XA 3OOUA 1BR2A 1YX5A 5HNFA 4KOVA 3QYBA 4GRIA 4RM3A 4HNXB 3LL7A 3R9GA 2WAFA 3EUKL 3D2PA 4I49A 4UFXA 3R1KA 3PFYA 2WBMA 5F48A 5IV0A 4CCLA 2RQQA 1V5GA 3V8IA 4CYQA 3DLAA 2UV1A 3ONQA 3S8PA 4U7BA 2KP6A 3SEZA 4CCMA 2W1OA 2ZFUA 3S3NA 3TE4A 1GLNA 1MW7A 1MJBA 2B3VA 5G20A 4C7IA 4P1WA 1X1AA 5CQGA 3LODA 3OIQA 4PSWA 2CH0A 5HOOA 3TO9A 4HSTA 3LFUA 2P6EA 2L5QA 1AA7A 5HLTA 1LVKA 2BSWA 3I3LA 1Z4RA 2V26A 2Q04A 5E96A 1YX3A 2KDOA 3BG6A 3E1SA 2M4KA 1CM0A 1YE9A 1S7FA 1Y9WA 1D1AA 3DR8A 4UFWA 4XNFA 3TOBA 3ZJ0A 1MJAA 1QU3A 4LITA 2R7HA 1Q2YA 2REFA 3EY5A 4Q36A 3S6FA 4A30A 2DOAA 2V7FA 2Q0YA 2HV2A 4C68A 3TFYA 3SZGA 1M1DA 4OADA 3CMMA 2RREA 1I12A 3MKYB 1KUVA 2X1DA 4XLCA 4U9YA 1TZLA 5AGEA 1WJ5A 3I9V2 2Z10A 3ZRGA 4JQFA 4CGMA 3DU6A 3HPGA 2BEIA 3EC4A 1UG0A 4CUGA 2CNTA 5FRNA 4KSFA 3SXOA 3OIPA 2E1MC 4FETA 1QSTA 4UCMA 3SHPA 4F0XA 5KTDA 1Z9UA 1D0ZA 4MFJA 4HSRA 4R79A 2IS4A 4BXFA 4NUBA 3L2WA 2QIRA 3W6SA 4RLFA 2P0WA 1I21A 1J09A 2VZYA 4DNCA 2V6EA 3VWBA 4HEA2 2A4NA 3OYHA 2ZW7A 1NG7A 2DJIA 2UWMA 3S6KA 4MFZA 2VKDA 1BOBA 2M3AA 4B43A 4U9ZA 5F47A 4MY0A 2H5MA 3TOAA 2CNMA 3K10A 4CCJA 2YNEA 2R7QA 1LKXA 3CP8A 2ZSIB 2CW7A 3IGRA 1Z21A 4BJ5C 1J4JA 3UR3C 3OYNA 2LOOA 2OB0A 4HKFA 2IS6A 4YGOA 1X1BA 3G2BA 4D9JA 4XNHB 3TO6A 4A95A 4RMNA 4B13A 4CRZB 2JA2A 2WADA 4QVTA 3OYFA 1IRXA 1Y7RA 1P0HA 2I8DA 2O28A 3TO7A 4KISA 4B5PA 1MNDA 4Y49B 2GE3A 1WK4A 5G21A 2IGNA 4QC6A 2PSWA 3T9YA 4E7SA 3K4JA 4CAVA 4B10A 4MFPA 2R8VA 2WPWA 4CAXA 3CP2A 4BGDA 4XMYA 4IUSA 1X1CA 1G59A 3L2VA 2DT7B 3H5RA 3VWDA 2FE7A 5FVJA 5AG4A 1UELB 4HNTA 4XKBA 3FBIB 4QPQA 4D1QA 3RPUD 2VLAA 4KOYA 4R3KA 4AB7A 4A32A 4A2ZA 4PJJA 4NQWB 2KPMA 3FB3A 2JVGA 3H5AA 4BQQA 4XM3A 5DWMA 2L7KA 1W36D 2PMZA 2K5CA 3H9QA 4PK4A 1QSOA 4XKCA 2G3TA 2IL4A 2WUUA 2B5GA 4XPDB 3L2QA 3EUAA 3FDYA 3J7AY 3W2AA 5CQEA 2X6WA 2X85A 2D4PA 2J8NA 2R1IA 4R87A 1IICA 2K9MA 5TGTA 4E7LA 2REEA 3K4BA 2Z2SB 3RTRA 2V9KA 2Z11A 5HNHA 1BO4A 1MMGA 2LBFA 4BS9A 3HPHA 2VQHA 2YNCA 4NEXA 1NE9A 3TBIA 5HVQC 2LY2A 2LC2A 5KCMA 2M7BA 4M85A 1MMAA 1YX0A 3NWSA 4XPKA 1TT0A 3ZCOA 3LD2A 1YVKA 4E7IA 1RXTA 4B48A 3DKXA 4KORA 3CXQA 2VQLA 2VJJA 4E8OA 3S32A 5GCNA 2ARHA 1T95A 4AVAA 3EPZA 4IZZA 4MY3A 1U0JA 3BLYA 3H9GA 1WWZA 2PJRA 4ZJZA 5H84A 2XSJC 2B3UA 4B47A 4JJXA 2WSAA 1M44A 4UFVA 1RO5A 2IGMA 2X6YA 4ZC3A 4CAFA 1Y6IA 2WAEA 1ZELA 4OAZA 2AQEA 2CV0A 1DQUA 3K9UA 4KOTA 4XN0A 2B4DB 3CJRB 4EATA 4LUAA 3K70D 1LRZA 4CZCA 3P2HA 2LRDA 2Q7BA 4U5YA 2KRCA 3K4NA 4E7JA 3QYFA 3S93A 1S7LA 2PQ8A 2R7TA 3R9FA 4CCOA 3HXLA 2HPIA 2M0MA 3DWLE 3MMYB 2FXFA 4U87A 4KLWA 2XF7A 2YNCC 3D2MA 4XPLA 4X0GA 4CS0B 2LYCA 2OC6A 3N05A 1X4PA 2W82A 4PFOA 3SDBA 4XONA 2PC1A 2Q2EB 4E4HA 4ZYAA 4NF1A 2MYSA 3PJRA 1OZPA 1G8XA 2XF5A 3LSGA 4PJLA 4CYOA 4AVCA 2KHMA 4BL0B 4BDZA 2BUEA 2Z3PA 4RM2A 3PSFA 3W2WA 2LY1A 4F92B 2WAQA 3K4MA 3OYIA 2R7VA 1OR7C 3R9EA 2F6CA 4DIQA 4MFKA 2NOJB 2A6TA 4UCPA 3I9SA 1FY7A 1VHSA 3IUOA 1V0CA 4R3LA 2LG4A 5A28A 3OY9A 2X7BA 2LH9A 4P5OA 3ZGKA 3TL4X 3L2UA 2FT0A 2Q4VA 5HH1A 4XLAA 3ZQQA 3LSKA 3FBUA 2VQYA 2RNGA 3PNYA 3QODA 3OYBA 3OWTA 3FXTA 3RYOA 1QSNA 1Z4EA 4CAWA 3W91A 1LDKB 4CH7A 4KUAA 1SFKA 1N75A 2V1NA 3KKWA 1NSLA 4AG9A 1MK4A 4NXYA 3QB8A 4UA3A 4CGLA 2X1EA 4YEJA 4DJAA 4MBUA 4H89A 2WPXA 1WJBA 3D5SC 2GIVA 5BWAB 3BJ8A 4BE1A 2A5WA 3HKZA 4BJTA 4KITB 4CYPA 5CKTA 3CXSA 2W00A 1JI8A 2Z3KA 2KCWA 2OZHA 1FMWA 4BMHA 2E60A 2EUIA 2VPLA 2Q44A 4XN3A 2JUGA 4F0YA 1S3ZA 2AQFA 1Y9KA 3PUBA 2L9SA 2P6GA 4C9YA 1XIXA 3DQVC 4KVME 4HPQA 4RI1A 4R9MA 2ZSHB 4BE0A 3OYLA 2LREA 3H0DA 2HUZA 2KQRA 4AU7A 2M7AA 2OH1A 1Q2DA 1YR0A 3KX2A 4B44A 2E5ZA 2ELJA 1DGRM 2YGWA 3A1YA 3S3MA 3HUGB 2CV2A 4JD6A 3PNTA 2BW3B 2IS1A 1BR1A 1S60A 4KLVA 4YFJA 2QMLA 4KOWA 2BVMA 2K9LA 3D3SA 2MABA 3JVNA 4KOUA 2CNSA 4R57A 3C26A 2B4BA 1M4GA 1ON0A 3U21A 3ZR8X 5KNLA 2PR8A 3DSBA 1P9QC 2FSRA 3OYKA 4AVBA 1SAUA 4FD4A 3BJ7A 4BJ6C 3S6HA 1EA3A 4DBRA 2R7RA 2ZW5A 3B8GA 3EXNA 2X51A 4BQOA 4B11A 5I0CA 1L0CA 2HZDA 5IB0A 2VKHA 1GHEA 4FD6A 4QUSA 2QKMB 4NSQA 2UUZA 2V4JC 1KZFA 3QAHA 3K4LA 3C2GA 3V42A 3VYTB 3HOTA 2JDDA 4L8AA 3BCBA 2WY8Q 4CCKA 4CSWA 1WJDA 3LSMA 2ZXHA 3AL0C 2HQYA 2OZUA 1T0FC 3IU2A 5JQ4A 4MFQA 2O5RA 2IGKA 4Q38A 3WR7A 3OMYA 3H5NA 1R6RA 3W3CA 1D0XA 2R4GA 2VJIA 4E7HA 3GYAA 2VXDA 3D5RC 3AKZA 1UAAA 2GANA 4ONUA 1KONA 4UCNA 4XKVA 1MNEA 3DTIA 3F9KA 1N77A 3OS2A 4Y4RA 2R7WA 1VKCA 1YVOA 2VEZA 3DDDA 3QOEA 5EC4A 2KLOA 3H5ZA 3P2FA 4HNYB 1I1DA 2AJ6A 4KUBA 2GOXB 3ZXSA 4KOSA 3M1CA 4RS2A 3LMMA 2J8RA 3H9JA 4MHDA 2OV7A 1Y56A 2L9NA 3IP4B 1R57A 2OZGA 5LFAA 4AVZA 2XDVA 1IYLA 4ZDPA 4IF5A 3MKWB 3OYCA 2CXAA 4KJZA 4N4NB 2FIWA 1XMTA 2D4OA 5DWNA 3RQ4A 2BW3A 1S7KA 3OYEA 2OU2A 3FYNA 1ERDA 4ZDLA 4F3QA 2R7SA 3DR6A 3FBNB 3OS0A 2PJRB 4CGOA 3LSHA 3IAS2 2ZW6A 2CS3A 4YRVA 4EVYA 2XAUA 1MMNA 1M4IA 2NMTA 2HVQA 3OR1C 4PV6A 5IX3A 1LFPA 4J00A 2WA0A 4XOPA 2Z1DA 3L2RA 2R7UA 1SQHA 2ZPAA 3UNGC 4F55A 4F91B 4II9A 4CA0A 3CXPA 5KTCA 4XORA 4BU2A 2MFZA 4HRIA 2R7XA 2EVNA 4X5KA 3IAM2 4XLEA 3PP9A 4CGPA 4H4KC 3NWTA 4ZGYB 1X19A 3BCAA 4BBHA 2VJ5A 4F52A 1YREA 1XEBA 2HU9A 5CPRB 1M4DA 2Y0MA 4ZBGA 2F5VA 2PRBA 5ISVA 4DOZA 1IB1E 3CF2A 3FIXA 2Y0SA 3OYAA 2QECA 4XLFA 5F49A 3OYMA 2F4IA 2VXKA 1UFHA 4OWRB 1KUXA 4C2UA 1CJWA 3N7ZA 4C2YA 2IS2A 2R7OA 2VXZA 2E5NA 4LG3A 3VYSB 3DPLC 4JOMA 1QSMA 4FD7A 2ZXVA 1ZO0A 5AG6A 4QB9A 2B4DA 4PJMA 3GKRA 2X1CA 3R95A 2CUJA 3D5LA 2WB1A 3UY5A 3KYLA 2CW8A 2DT6A 3IWEA 3K4KA 2K5TA 4KS9A 4XQFA 3PNVA 2JSPA 3SYTA 4BE2A 4IKFA 2Q1ZB 4NCZA 3MD2A 4MI4A 2L2OA 2JVHA 4II2A 2CV1A 2BL1A 4YRHA 3TTHA 2J8MA 4E7ZA 2Z16A 3H4QA 3W2VA 2DXQA 3FRMA 3FHNA 3DPTA 1MJ9A 3TMOA 2XC7A 2HPMA 3NE7A 3TT2A 3E0JB 3GBGA 2F5IA 4CAEA 4PJNA 2VB6A 2I79A 3IU1A 3JTKA 2WY7Q 5AG5A 4J3GA 4JXQA 5HMNA 3HG9A 3K4CA 1DP3A 1DGWY 1QHGA 2FCKA 3DKYA 3F0AA 4CGNA 1VZ0A 3A9LA 4JWPA 4B3XA 4XLHA 1QSRA 2C27A 3DU5A 3PSIA 4BEHB 4RLQA 4AG7A 1U6MA 2I00A 4JXRA 3AL0B 1P4NA 3SEQA 2BVLA 2DPSA 3EFAA 4PK2A 2HVSA 4LIUA 2VIXA 4BACA 4KZTA 3RSNA 2MD0A 5FRMA 4UWIA 2MC4A 1HA8A 5J8FA 2CMPA 4ZTJA 2BOLA 3H35A 1X1DA 2B5GB 1K6YA 4K30A 2P6FA 1XE4A 2OUMA 4ZTFA 3VDXA 3MGDA 4OLLA 1B6BA 1W36C 4AYBA 4MLOA 1NMTA 5H86A 1BR4A 2IXSA 3EO4A 4E6KG 1V5FA 2XF6A 2GOMA 4BQNA 1XF8A 3BLNA 4OAEA 1WJCA 1PYVA 2CUZA 3CZ6A 4CYNA 4KT6A 1YGHA 2QKLB 4Y33A 4E2AA 4FD5A 3F8KA 4PUSA 5AG7A 3G8WA 1YK3A 5C82A 3GY9A 3OYDA 1S5KA 4DBQA 3HL2A 1D1CA 1S7NA 1D0YA 3OL4A 2VJ4A 2JDCA 2ZW4A 4UWJA 3DPUA 3A4CA 3FKJA 3PGPA 5JHFA 4YELA 1TIQA 5CNPA 3DEEA 3T90A 2HVRA 4OAYA 2HQAA 5JPHA 3M8JA 4IQ4A 4BEHA 1IIDA 4B5PB 4LX9A 3E0KA 2CY2A 1X4OA 1Z7LA 1KUYA 1K4JA 4B12A 4B5OA 4F6AA 4HG2A 2ZXIA 2FS5A 5G22A 2Z3OA 4XOTA 1N71A 4MFLA 4XPDC 4C2XA 2HNHA 2PDOA 2VQGA 4NNJA 1WJFA 3HOSA 4PK3A 1E0EA 4PSXA 4C2ZA 1Q2CA 4QPOA 1PUAA 3JUWA 1S9HA 1MMDA 4BUPA 2CFOA 3CJQB 5A27A 4E0AA 4C30A 1YLEA 4PFPA 4KVXA 3CESA 2X6XA 5KTAA 2IGOA 4H6ZA 4B14A 3RCOA 2W7NA 4F93B 2VASA 3D8PA 4Y49C 2KZVA 2KL4A 3DNSA 3G3SA 3OYGA 4KSAA 4UBRA 4M3SA 2Z3MA 1N78A 2DPTA 4GS4A 3I3GA 2VQCA 5G1ZA 4ANJA 2VI7A 2VL8A 1FMVA 4XNHC 2FL4A 4ORFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R98 A;  5J8C A;  2ATR A;  5F46 A;  5C88 A;  3OWC A;  2JEV A;  4MJ8 A;  2Q4Y A;  3F5B A;  5EBV A;  3PZJ A;  2Z0Z A;  4CRY B;  4JLY A;  3VWE A;  2G0B A;  4HNW B;  2G3A A;  4H6U A;  1B87 A;  2VZZ A;  3ZZI A;  3R96 A;  2RC4 A;  2VBQ A;  3FNC A;  4L89 A;  2AE6 A;  2B58 A;  3S6G A;  3SXN A;  1IYK A;  3TCV A;  4KVO E;  4KOX A;  2FIA A;  1PU9 A;  3IWG A;  4QBJ A;  2PR1 A;  2JLM A;  3W6X A;  4KOV A;  4HNX B;  3R9G A;  3D2P A;  4I49 A;  3R1K A;  5F48 A;  5IV0 A;  3V8I A;  3TE4 A;  1MJB A;  2B3V A;  3LOD A;  4PSW A;  3TO9 A;  2P6E A;  2Q04 A;  5C82 A;  3SXO A;  2BSW A;  1Z4R A;  5E96 A;  1S7F A;  1Y9W A;  1CM0 A;  3DR8 A;  3TOB A;  3ZJ0 A;  1MJA A;  2R7H A;  2REF A;  1Q2Y A;  3EY5 A;  3S6F A;  2Q0Y A;  2HV2 A;  3TFY A;  1M1D A;  4OAD A;  1I12 A;  1KUV A;  4U9Y A;  2Z10 A;  2BEI A;  3EC4 A;  2CNT A;  3SHP A;  1QST A;  5KTD A;  1Z9U A;  2QIR A;  3W6S A;  2P0W A;  1I21 A;  2VZY A;  4DNC A;  2A4N A;  2ZW7 A;  3S6K A;  4U9Z A;  1BOB A;  5F47 A;  4MY0 A;  2H5M A;  3TOA A;  2CNM A;  3IGR A;  1J4J A;  4YGO A;  2OB0 A;  4HKF A;  3TO6 A;  4XNH B;  4CRZ B;  4QVT A;  1Y7R A;  1P0H A;  2O28 A;  3TO7 A;  4B5P A;  4Y49 B;  2GE3 A;  1WK4 A;  4QC6 A;  2PSW A;  3T9Y A;  4CAV A;  2R8V A;  2WPW A;  4CAX A;  4IUS A;  3VWD A;  2FE7 A;  5FVJ A;  4AB7 A;  4R3K A;  4KOY A;  3FB3 A;  5DWM A;  2IL4 A;  1QSO A;  2G3T A;  2B5G A;  4XPD B;  2D4P A;  2J8N A;  2R1I A;  4R87 A;  1IIC A;  2REE A;  2Z11 A;  1BO4 A;  4NEX A;  1NE9 A;  4M85 A;  1YX0 A;  4XPK A;  3LD2 A;  1YVK A;  1RXT A;  4KOR A;  3CXQ A;  4E8O A;  5GCN A;  2ARH A;  4AVA A;  4MY3 A;  1WWZ A;  5H84 A;  2B3U A;  4JJX A;  1M44 A;  1RO5 A;  3K9U A;  4KOT A;  2B4D B;  4LUA A;  1LRZ A;  2Q7B A;  3P2H A;  4U5Y A;  2PQ8 A;  1S7L A;  3R9F A;  2FXF A;  4KLW A;  4CS0 B;  3D2M A;  4XPL A;  2PC1 A;  4NF1 A;  1OZP A;  4AVC A;  2BUE A;  3R9E A;  3I9S A;  1FY7 A;  1VHS A;  1V0C A;  4R3L A;  2X7B A;  5HH1 A;  2FT0 A;  2Q4V A;  3FBU A;  2VQY A;  3FXT A;  3RYO A;  1QSN A;  1Z4E A;  4CAW A;  3W91 A;  4KUA A;  1NSL A;  3KKW A;  4AG9 A;  1MK4 A;  4NXY A;  3QB8 A;  4UA3 A;  4MBU A;  4H89 A;  2WPX A;  2GIV A;  3BJ8 A;  3CXS A;  2KCW A;  2OZH A;  4BMH A;  2EUI A;  2Q44 A;  4F0Y A;  1S3Z A;  1Y9K A;  2P6G A;  1XIX A;  4KVM E;  4RI1 A;  4R9M A;  2HUZ A;  2OH1 A;  1Q2D A;  1YR0 A;  4JD6 A;  4KLV A;  1S60 A;  4YFJ A;  2QML A;  4KOW A;  3D3S A;  3JVN A;  4KOU A;  2CNS A;  4R57 A;  3C26 A;  2B4B A;  1M4G A;  1ON0 A;  2PR8 A;  3DSB A;  2FSR A;  4AVB A;  4FD4 A;  3BJ7 A;  3S6H A;  5I0C A;  2ZW5 A;  3B8G A;  3EXN A;  1L0C A;  5IB0 A;  1GHE A;  4FD6 A;  4QUS A;  4NSQ A;  1KZF A;  3QAH A;  2JDD A;  4L8A A;  2HQY A;  2OZU A;  5JQ4 A;  3GYA A;  4ONU A;  2GAN A;  1VKC A;  1YVO A;  2VEZ A;  3DDD A;  5EC4 A;  3P2F A;  4HNY B;  1I1D A;  2AJ6 A;  4KUB A;  4KOS A;  4RS2 A;  2J8R A;  4MHD A;  1R57 A;  2OZG A;  1IYL A;  4IF5 A;  2FIW A;  1XMT A;  2D4O A;  5DWN A;  1S7K A;  2OU2 A;  3FYN A;  3DR6 A;  2ZW6 A;  4EVY A;  1M4I A;  2NMT A;  4PV6 A;  5IX3 A;  2ZPA A;  1SQH A;  4II9 A;  3CXP A;  5KTC A;  4X5K A;  2EVN A;  3PP9 A;  1YRE A;  1XEB A;  1M4D A;  2Y0M A;  4ZBG A;  2PRB A;  5ISV A;  1IB1 E;  3FIX A;  2QEC A;  5F49 A;  2VXK A;  1UFH A;  1KUX A;  1CJW A;  3N7Z A;  1QSM A;  4FD7 A;  2ZXV A;  4QB9 A;  2B4D A;  3GKR A;  3R95 A;  3UY5 A;  2K5T A;  4NCZ A;  4MI4 A;  2BL1 A;  4YRH A;  3TTH A;  2J8M A;  3H4Q A;  2DXQ A;  3FRM A;  1MJ9 A;  3TT2 A;  3NE7 A;  2F5I A;  2I79 A;  4J3G A;  4JXQ A;  5HMN A;  2FCK A;  3F0A A;  4JWP A;  2C27 A;  1QSR A;  4AG7 A;  1U6M A;  2I00 A;  4JXR A;  1P4N A;  3EFA A;  4KZT A;  5J8F A;  4UWI A;  2B5G B;  4K30 A;  2P6F A;  4OLL A;  1XE4 A;  3MGD A;  1B6B A;  1NMT A;  5H86 A;  3EO4 A;  1XF8 A;  3BLN A;  4OAE A;  1YGH A;  4E2A A;  4FD5 A;  3F8K A;  3G8W A;  1YK3 A;  3GY9 A;  1S5K A;  1S7N A;  2JDC A;  2ZW4 A;  3WR7 A;  4UWJ A;  3PGP A;  1TIQ A;  5CNP A;  3T90 A;  5JPH A;  1IID A;  4B5P B;  4LX9 A;  3E0K A;  2CY2 A;  1KUY A;  1K4J A;  4B5O A;  4F6A A;  2FS5 A;  1N71 A;  4XPD C;  2PDO A;  4PK3 A;  4PSX A;  1Q2C A;  3JUW A;  1PUA A;  4E0A A;  1YLE A;  4KVX A;  5KTA A;  4H6Z A;  3D8P A;  4Y49 C;  3DNS A;  3G3S A;  4UBR A;  4M3S A;  4GS4 A;  3I3G A;  2VI7 A;  4PK2 A;  4XNH C;  2FL4 A;  4ORF A; 
#chains in the Genus database with same CATH topology
 5J8C A;  4CYC B;  2ATR A;  2R98 A;  4A31 A;  5F46 A;  3BG7 A;  5C88 A;  2YX7 A;  1T33 A;  1ZRD A;  4UVC A;  2JEV A;  1OLT A;  2Q7S A;  3TW6 A;  5IT9 Z;  1P92 A;  1W5C C;  1WJA A;  4L5J A;  2KRH A;  1GUU A;  3OL3 A;  1K78 A;  3CF5 F;  3KP3 A;  1Z9C A;  2Z0Z A;  4IOC F;  2AFS A;  4MFE A;  2MC3 A;  5J1U A;  2ME0 A;  2W84 A;  5AIQ A;  2K40 A;  4N9H A;  3VSL A;  3V8J A;  5GAE J;  3CMA I;  1HKT A;  3K6G A;  4HNW B;  3BG9 A;  3ZZI A;  3SDG A;  2IBD A;  1NG6 A;  4H0E A;  4C3J J;  2G9W A;  2RC4 A;  3KEY A;  1XBU A;  2RB7 A;  2K3P A;  4J01 A;  4BBH A;  2KMU A;  2AE6 A;  2ZEN A;  3RKW A;  1TC3 C;  2HB6 A;  4NGM A;  1QHH D;  3JRB A;  5M3F J;  1JQG A;  2ZEE A;  1V5E A;  3FWE A;  4Y3O A;  4ZDO A;  1SD6 A;  3LNQ A;  2F4M B;  2GRE A;  3CUQ C;  1FC3 A;  3LSI A;  4EEF G;  3RNZ A;  2EA4 A;  1IC8 A;  1EH8 A;  4NC7 A;  2ZME C;  3HC7 A;  2HOE A;  3QYE A;  2JQ7 A;  3NE8 A;  2FUG 2;  2M4G A;  1I50 J;  3J7A O;  2FIA A;  2Y30 A;  2ECC A;  2PR1 A;  3OR2 C;  2LF8 A;  3N4M A;  3CCV I;  1WZ2 A;  3BJA A;  1BR2 A;  2J5P A;  2X9D A;  4RGR A;  4RM3 A;  4S04 A;  3CCJ I;  4MCP A;  2WAF A;  3EUK L;  2Y9Z A;  5J4Y A;  3R1K A;  2E1C A;  4CCL A;  3V8I A;  2CQX A;  2FX0 A;  3DLA A;  4BD9 A;  3FIW A;  2UV1 A;  3ONQ A;  4DZJ A;  3SJE A;  4CPA A;  4O6J A;  4EVI A;  2W1O A;  1TWC J;  4LK1 F;  2ZFU A;  2IQ6 A;  2OR4 A;  4L0Y B;  1MW7 A;  1SD7 A;  2GA2 A;  1R36 A;  4P1W A;  3HHG A;  3TO9 A;  3GZ6 A;  4HST A;  4MCS A;  4NQW A;  1VHE A;  2L5Q A;  2Q04 A;  3SXO A;  2A61 A;  1Z4R A;  1W7P D;  1R23 A;  2V26 A;  1YX3 A;  2H1L A;  3BG6 A;  3P9I A;  1KU7 A;  4I09 A;  2I3C A;  3DR8 A;  2JA8 J;  4AXV A;  1K6O A;  1FX7 A;  4M6Y A;  2ZME B;  5CVU A;  2DOA A;  4C68 A;  5K7H A;  2Q0Y A;  4G12 A;  3SZG A;  3MKY B;  2P6S A;  3BR6 A;  1T56 A;  1T0F A;  2FML A;  3ZRG A;  5F1R A;  5GPC A;  5FD5 A;  3GTG J;  1SVM A;  3HTU A;  1YOV B;  4W1U A;  2ESH A;  4HBL A;  4RS8 A;  4IK2 A;  2E1M C;  4UCM A;  4LLN A;  3WC7 A;  2XKO A;  4PXE A;  1D0Z A;  3PIO F;  2IS4 A;  5ERI A;  4BXF A;  1TWG J;  9ANT A;  2CSO A;  2BZT A;  4DW6 A;  5J4V A;  2XSD C;  1VQL I;  3D67 A;  5DDG A;  3V7Z A;  2AFZ A;  2ZW7 A;  2DJI A;  4MFZ A;  1RUN A;  2BXY A;  3A01 A;  2CNM A;  4B6Z A;  4CCJ A;  2XAH A;  2IRF G;  1YFH A;  3CP8 A;  1MD0 A;  2ZSI B;  2EA2 A;  3VPR A;  2QF7 A;  3KYC B;  4I0A A;  1J4J A;  3SZT A;  3L2C A;  2JEW A;  2OB0 A;  5L3D A;  1H8L A;  5HS7 A;  5FFZ A;  1B6A A;  2JA2 A;  3F3X A;  2ODF A;  2BYV E;  1EH6 A;  2NS0 A;  2WAD A;  1RUO A;  4CRZ B;  4OC2 A;  2PMH A;  1FIA A;  1P0H A;  6CPA A;  4B5P A;  2HXI A;  5K7F A;  3WOD F;  1ZG5 A;  2GE3 A;  4LMY A;  3BR3 A;  2QJ8 A;  5CVI A;  4MFP A;  1U6G A;  4JBA A;  2EZL A;  2NYQ A;  2WPW A;  3QPS A;  1T38 A;  1X1C A;  3FK7 A;  3M4O J;  3VWD A;  1U9N A;  5AG4 A;  2FE7 A;  1TQI A;  1ZRC A;  5L3C A;  2VLA A;  2ANP A;  2A3S A;  4XBF A;  4A2Z A;  1P2F A;  5DWM A;  1Z05 A;  2PMZ A;  3BZ6 A;  5CVV A;  3G71 I;  3HUG A;  4PK4 A;  3WTT C;  2Y69 H;  2HEO A;  1NTC A;  3AAF A;  1HDP A;  3EUA A;  2X6W A;  2X85 A;  5DUI A;  2J8N A;  3TX8 A;  1EKE A;  3PFO A;  2M5W A;  2EO8 A;  1R1V A;  4BY7 J;  4M73 A;  2FBK A;  4L18 B;  5K8N A;  2Z2S B;  4PXB A;  3RTR A;  2V77 A;  2V9K A;  1QQ9 A;  1MBG A;  1BO4 A;  4BS9 A;  3KFW X;  2VQH A;  1NE9 A;  3TBI A;  4WWV A;  5KK1 A;  2R3S A;  3NWS A;  2BXZ A;  1SFX A;  1HCR A;  3ISP A;  4IF4 A;  4KUM A;  2AXL A;  5LRR A;  1SAX A;  3T5X A;  3OSF A;  2NVU B;  2CQK A;  1SD5 A;  3EPZ A;  3R0J A;  4RGS A;  1WWZ A;  1ZN2 A;  3MKL A;  2DYR H;  4ZJZ A;  2H8W A;  2XSJ C;  3JRH A;  4KIB A;  4UFV A;  2VE8 A;  3BG3 A;  2L7Z A;  4JX6 A;  3GTQ J;  1RO5 A;  2HC9 A;  2ZEP A;  2X6Y A;  4ZC3 A;  3ZMU A;  2WAE A;  5TIS C;  4A0Z A;  4EJW A;  1ZEL A;  3C2B A;  1YJN I;  2CV0 A;  1ACI A;  1B4A A;  4XN0 A;  1G3T A;  3F0C A;  4EAT A;  3K70 D;  1FLI A;  1RI7 A;  2Q7B A;  2D45 A;  4QWQ A;  3JW4 A;  2GM4 A;  3K4N A;  4E7J A;  3R9F A;  5E18 F;  4CCO A;  1BC8 C;  3HXL A;  1EJ9 A;  1P4X A;  3KZZ A;  2M0M A;  2AS5 F;  3MMY B;  2ME6 A;  4U87 A;  4BH9 A;  4KLW A;  3DEW A;  4CS0 B;  1YW7 A;  3KP4 A;  3BP8 A;  1Z8L A;  4WXC A;  4A3K J;  2ZOG A;  2OC6 A;  2W82 A;  3SDB A;  4PFO A;  4XON A;  4P55 A;  1APL C;  4E4H A;  1LUJ B;  3WTX C;  4NF1 A;  2VN2 A;  1G8X A;  5CVR A;  3CO6 C;  3MAJ A;  2VT2 A;  2KHM A;  4RB1 A;  2NNY A;  2R5Y A;  1ELL P;  5F04 A;  5FLX Z;  3W2W A;  3PSF A;  1J9I A;  3K4M A;  3R9E A;  1FNN A;  2CRG A;  4AD9 A;  4DIQ A;  3IV5 A;  4MFK A;  2QGU A;  3CD6 I;  2QWW A;  3LA2 A;  2GFQ A;  3IUO A;  4Z6Y A;  1IGB A;  5BS6 A;  4JK1 X;  3RKQ A;  2X7B A;  2WB1 N;  4MCR A;  1P7J A;  4R76 A;  3ZQQ A;  2FF4 A;  1Y39 A;  2JA5 J;  1ON2 A;  2DA5 A;  5ICF A;  1B72 A;  3OYB A;  3OWT A;  3ZQF A;  4CAW A;  1Z4E A;  1IZ1 A;  1ODD A;  4BBR J;  4M6G A;  4MRI A;  3DP7 A;  5J40 A;  4A6D A;  3KKW A;  2WV1 A;  1UHM A;  1TNS A;  1FOY A;  2ZO4 A;  3QB8 A;  2VE9 A;  3QOP A;  4UVA A;  3ZMD A;  2ZFW A;  1J0R A;  4UEE A;  2QUF A;  1TF8 A;  1WJB A;  2GIV A;  4BBS J;  2QQB A;  2W85 A;  3A02 A;  2W24 A;  3UKG A;  3DCF A;  3BJ8 A;  3KP7 A;  4G1P A;  1W1W E;  1XJO A;  2DF5 A;  4CYP A;  5CKT A;  4P9U A;  1O3S A;  4BMH A;  2PE3 A;  2E60 A;  2DK8 A;  1VGY A;  1W5S A;  2A07 F;  2ZXJ A;  4XN3 A;  3BJO A;  2M1B A;  4QTR A;  3PUB A;  1S3Z A;  1Y9K A;  3DGV A;  2HR3 A;  2L9S A;  3DF8 A;  4MXU A;  1U8R A;  4A69 C;  1JXS A;  5JFR A;  3PO3 J;  5ED4 A;  1S7O A;  2DMU A;  4AU7 A;  2OH1 A;  3BZC A;  3S16 J;  2ELJ A;  4GDF A;  4M3D A;  5IYB J;  1NK3 P;  1AUG A;  2XAG A;  4CGZ A;  3KET A;  2W25 A;  2D5V A;  1OFC X;  2IS1 A;  1V4R A;  3BRO A;  5K5O A;  4WCG A;  3FMS A;  3I64 A;  3HLP A;  4MMO A;  4NGR A;  1ON0 A;  2PI0 A;  1RC9 A;  2HI3 A;  3DSB A;  5JM6 A;  3LSP A;  2FSR A;  1HST A;  3ABT A;  5HDK A;  1ENH A;  2R7R A;  2ZW5 A;  3B8G A;  2GIZ A;  3S6H A;  5I0C A;  4H2K A;  2DW4 A;  1MKM A;  3BR2 A;  4L0Z B;  1SD4 A;  1L0C A;  2HQR A;  2NVX J;  1VIX A;  4QUS A;  2V4J C;  3RO0 A;  5DCM B;  4X1E A;  1Y0R A;  3WTZ A;  3KPH A;  3D68 A;  4GGG A;  5JVT A;  3IEH A;  3N5F A;  2YR2 A;  1IYL A;  5HS8 A;  2VL1 A;  1SVO A;  1IUY A;  4Q38 A;  3WTU C;  1MBJ A;  3JTG A;  5K7Z A;  5EG0 B;  3DKW A;  5LRK A;  3M8E A;  3EUH A;  1T2K A;  2H8R A;  3FED A;  3KP6 A;  4A3F J;  2AFM A;  3NH8 A;  4UIB A;  3HOU J;  5DS0 A;  1N77 A;  2D2W A;  5BPD A;  5C4J J;  2O8X A;  3QPH A;  4Q48 A;  2B7E A;  4Y4R A;  1VKC A;  1XDS A;  3E3V A;  3QOE A;  4IXA A;  4IAV A;  3I58 A;  1YIO A;  1DU0 A;  2AJ6 A;  2EIK H;  2CUF A;  4OOI A;  1Y56 A;  2L9N A;  1SAN A;  3WTW C;  3DEU A;  4OC1 A;  2PX9 A;  3OYC A;  1UFM A;  5DWN A;  5DM7 F;  3K1P A;  2P81 A;  3H1C A;  4E70 A;  1PCA A;  2OF7 A;  2OU2 A;  2EZH A;  3CUO A;  3RIR A;  2R7S A;  3CCE I;  2DA2 A;  4ZH4 F;  2HVQ A;  3OR1 C;  4ZI6 A;  5IX3 A;  3ZQH A;  2WA0 A;  4XOP A;  1KZH A;  1GVJ A;  2H09 A;  5IT3 A;  2Y9Y A;  4II9 A;  4CA0 A;  3CXP A;  3WTS C;  2MFZ A;  4GXO A;  3KAS A;  4XRS G;  2XIG A;  5BPI A;  2HQ5 A;  4JX5 A;  1W0T A;  4ZGY B;  1RNL A;  1YRE A;  3PUF A;  2HU9 A;  3IRQ A;  4BKX A;  2EZI A;  4ZBG A;  1STZ A;  1R4N B;  4P6Y A;  4L9J A;  3SJM A;  1R1T A;  2LKS A;  4LFU A;  4C3H J;  1MSF C;  5F0H A;  3N7Z A;  2XHK A;  4GS4 A;  2DMP A;  2DK5 A;  2V1X A;  4L5E A;  3HOX J;  1PUF A;  3DPL C;  3S2W A;  2HKX A;  1QBJ A;  2B4D A;  1E3O C;  3MEX A;  4PXD A;  3RZO J;  5FB2 A;  4WJB A;  1Y0N A;  2CW8 A;  4A5M A;  5EEA A;  1K79 A;  1LOK A;  2CYY A;  5E79 C;  1T8I A;  2K5T A;  4D5C A;  1O7F A;  4XQF A;  2V8H A;  3SYT A;  5HOD A;  2JT1 A;  4MI4 A;  3D7G A;  2JVH A;  3TTH A;  2CV1 A;  2NNN A;  1HW2 A;  3FRM A;  4GXH A;  3FHN A;  3DPT A;  3TT2 A;  2QSG X;  3NE7 A;  2F5F A;  1ZKG A;  2K3F A;  4BQA A;  3IU1 A;  2EJR A;  2HTS A;  1CPS A;  2M87 A;  2EK8 A;  3JTK A;  3SZP A;  3DBL B;  4J3G A;  4JXQ A;  1DP3 A;  1CG2 A;  3FXL A;  1QHG A;  2O6G E;  1MBF A;  3DKY A;  2FCK A;  1VZ0 A;  2V8D A;  3GLJ A;  3IIB A;  4JWP A;  3J81 K;  2TDX A;  4EJU A;  4RLQ A;  2EB7 A;  2I00 A;  2YU3 A;  1U8B A;  2ZEL A;  4OC0 A;  2ZEO A;  4LIU A;  4UHT A;  4IHX A;  2PJ7 A;  2MC4 A;  3CQZ J;  3CLO A;  3H35 A;  1K6Y A;  4ZY0 A;  2P6F A;  4OLL A;  3VDX A;  1B6B A;  1ELM P;  5H86 A;  2L4A A;  3S15 J;  1BR4 A;  2IXS A;  5K8M A;  4OAE A;  4BNC A;  1WJC A;  2FRH A;  3CZ6 A;  2FOK A;  2DMT A;  1JUM A;  1YGH A;  1S7E A;  3RQI A;  1FT7 A;  5AG7 A;  2F5E A;  1YK3 A;  3N97 A;  4OID A;  5JR3 A;  3HL2 A;  2VJ4 A;  4YII A;  1FYK A;  3L9F A;  3J80 Z;  2FOW A;  3VAT A;  2O3F A;  3KZI C;  3DEE A;  2NSM A;  5JPH A;  5LEK A;  2HQA A;  2C1C A;  2ZEF A;  2E19 A;  4JX4 A;  1IID A;  3NH5 A;  3QWL A;  4B5P B;  4LX9 A;  1R22 A;  2DA4 A;  1LAN A;  3E0K A;  2C6G A;  3TKY A;  4B5O A;  4HG2 A;  4F6A A;  2FS5 A;  2E7X A;  4KFC A;  2JA6 J;  3HUV A;  3KP5 A;  2AO9 A;  2ECB A;  5C3E J;  3BQY A;  1MBK A;  2VQG A;  1IG7 A;  1WJF A;  3GUX A;  5M5X J;  1N25 A;  4PK3 A;  3AG2 H;  1FP2 A;  1X1P A;  3FMR A;  4QPO A;  2IW5 A;  4LQG A;  3E6M A;  2CFO A;  2M8E A;  1I6X A;  3BWG A;  3IWW A;  3HRU A;  3ML6 A;  4E0A A;  4C30 A;  4KVX A;  5F1J A;  1FYM A;  2X6X A;  3GTM J;  2IGO A;  4D7N A;  4TWE A;  1JT0 A;  2W7N A;  1IAW A;  5E3N A;  3FF5 A;  2MH2 A;  3GWZ A;  3HSR A;  2KL4 A;  4G6Q A;  4UEZ A;  4Y49 C;  3KZY A;  3I0T A;  4MHP A;  1T08 B;  4XLP F;  4NJQ A;  2VI7 A;  1TTY A;  1XSV A;  2O03 A;  4XNH C;  4UUV A;  2KJB A;  1Z3Y A;  3DTK A;  4HF2 A;  3ZQL A;  4OIQ F;  3GFL A;  3PL8 A;  4XR6 A;  3ZN1 A;  3HDD A;  1Z3X A;  4IQJ A;  1J2X A;  2HDW A;  3EUH C;  4BXU A;  2ZJP F;  3R6S A;  1OCT C;  1BJZ A;  2Q4Y A;  3F5B A;  1FIP A;  1ZR2 A;  1AKH B;  3K70 C;  3FEE A;  5EBV A;  3PM1 A;  3KLN A;  5EGO B;  4OP4 A;  2Z3N A;  4CRY B;  4FAS D;  4JLY A;  4M71 A;  3VWE A;  1OCZ H;  4EV0 A;  3H3V K;  4DUK A;  1B87 A;  2PJ2 A;  3R96 A;  2QVP A;  3CCU I;  2YS9 A;  1LEA A;  4B4C A;  4ZYE A;  1CX8 A;  1D1B A;  3BQZ A;  3C2H A;  5FRO A;  3ECH A;  4LIV A;  3F8C A;  4G6T B;  3CPX A;  1GT0 C;  3U2R A;  4W97 A;  2B58 A;  3GB0 A;  2E2I J;  2K4B A;  2E35 A;  4II3 A;  4HNU A;  1F4K A;  2NVQ J;  4E7K A;  3RZD J;  4A3D J;  2KFD A;  4BDY A;  1WFX A;  1WJE A;  2PLY A;  4F8Z A;  4D7M A;  3BC8 A;  4UY8 I;  1QQI A;  1BI1 A;  4HX8 A;  2A68 F;  3I54 A;  5CJ9 A;  5FKL A;  4DGW B;  4CCN A;  4UIA A;  2MD5 A;  1YS7 A;  1ZLJ A;  3W6X A;  4A5N A;  4U0W A;  1LEB A;  5HNF A;  3QYB A;  3IWF A;  2OTL I;  1RKT A;  2E71 A;  2FQ4 A;  3B7I A;  4I49 A;  3BI1 A;  3PB7 X;  3F8M A;  2WBM A;  3CCR I;  2RQQ A;  4D5F A;  2DMN A;  3WT4 A;  3Q3S A;  5E8I A;  2KP6 A;  4YU9 A;  4UXN A;  1U3E M;  4NGP A;  3J81 Z;  3S3N A;  5EJC A;  1GLN A;  3NQO A;  1MJB A;  2B3V A;  2XRL A;  5G20 A;  3PO2 J;  4C7I A;  2QYV A;  1V54 H;  2DQL A;  3WAB A;  4PSW A;  5HOO A;  1JTX A;  2CH0 A;  2ZJR F;  1CGP A;  4IHW A;  4NHJ A;  1AA7 A;  1LVK A;  2BSW A;  3I3L A;  3BPV A;  2H1K A;  5EGO A;  1TKF A;  2CTB A;  2KDO A;  5E96 A;  3E1S A;  1K78 B;  2M4K A;  3E6B A;  1YE9 A;  2JK3 A;  1S7F A;  1IUF A;  1ZGA A;  4XNF A;  3TOB A;  1PUF B;  2M8G X;  1W4M A;  3LWU A;  3RBU A;  4Q36 A;  2CIJ A;  1Q2Y A;  2REF A;  2PG4 A;  3I59 A;  2V7F A;  1WWX A;  1Z6R A;  3HJE A;  4GM5 A;  4ZY2 A;  3TFY A;  4OAD A;  3CMM A;  1I12 A;  1KUV A;  4UUT A;  1YSJ A;  1JGG A;  1YW8 A;  4XLC A;  3MWM A;  1TZL A;  2OOT A;  2L3D A;  5JI6 A;  5E3L A;  4AUX A;  4LQ6 A;  4JQF A;  3HPG A;  2BEI A;  5F0C A;  2OZ6 A;  1KQ8 A;  5FRN A;  3WGG A;  5BNG A;  5L3F A;  3S1R J;  2EIJ H;  4PDK A;  5KTD A;  1YRN B;  4HSR A;  3W6S A;  5E8G A;  2V6E A;  1TWF J;  1V55 H;  5A2Q Z;  3OYH A;  4DYR A;  3FXQ A;  1VFC A;  2XEI A;  2UWM A;  3S6K A;  2L4M A;  2M3A A;  4B43 A;  5E20 A;  4MY0 A;  2CQN A;  2YNE A;  1MDM A;  1JUS A;  3QU6 A;  3IGR A;  4BJ5 C;  3OYN A;  1I1G A;  2CG4 A;  2LOO A;  2NVT J;  1ORK A;  1BPN A;  4YGO A;  4XNH B;  1H9T A;  4A95 A;  5DCF A;  4MEY F;  3JRA A;  1IV6 A;  2JPC A;  5F64 A;  4LLL A;  1Y7R A;  3O3K A;  2VKE A;  1LAP A;  2O28 A;  3FHZ A;  3BT9 A;  3TO7 A;  3RAM A;  5I4M A;  2A69 F;  1WGX A;  1WK4 A;  2ESN A;  1ZYR F;  3MZ8 A;  3KP2 A;  3T9Y A;  3K4J A;  3ZQ7 A;  4CAV A;  2POK A;  2E34 A;  3IRR A;  1JKP C;  2PRQ A;  3U9G A;  2R8V A;  2BBY A;  3B3S A;  4CAX A;  2AFU A;  4K3N A;  1I39 A;  3LAC A;  3KIO A;  2DT7 B;  1MMS A;  5IPA A;  3GFI A;  4GFB A;  5FVJ A;  4AC0 A;  1UEL B;  1G4D A;  5EZG A;  2ICW G;  1QMU A;  4A32 A;  3CCS I;  2NS7 A;  3H5A A;  4EGZ A;  4HX4 A;  4XM3 A;  2ZB9 A;  1W36 D;  2WYR A;  1BIA A;  4IHT A;  1QSO A;  2WUU A;  2IJL A;  2KIS A;  2LMD A;  3FDY A;  1HW5 A;  3J7A Y;  1H8A C;  2IEK A;  4G6D A;  5JLW A;  4ENM A;  2QM3 A;  4R8F A;  4PCQ A;  4E7L A;  8CPA A;  3K4B A;  2CFX A;  5CPA A;  4M74 A;  1B9M A;  1IW7 F;  1QGP A;  3WU0 A;  1P6R A;  3HPH A;  2E1N A;  2LY2 A;  3BR5 A;  4M85 A;  4Q5S F;  4XPK A;  1G3W A;  1YVK A;  1OQY A;  4G8X A;  4E7I A;  1XGS A;  2QSF X;  1O4X A;  4FE4 A;  4B48 A;  2PJC A;  4XLN F;  2WAQ N;  2VON A;  4JYW A;  3ZQI A;  4AVA A;  3GTO J;  4KIC A;  4IZZ A;  4MY3 A;  2K02 A;  3H9G A;  2H6C A;  4OIO F;  4MQ9 F;  3H3U A;  4PZJ A;  5EG0 A;  4JJX A;  4B47 A;  4BIN A;  1M44 A;  2ZXW H;  3FH4 A;  4LLG F;  1MGT A;  2RDP A;  4OIN F;  3G6E I;  1S8N A;  3BDD A;  1X3W B;  4RBO A;  3S1N J;  2AQE A;  4KOT A;  2B4D B;  2L02 A;  4M3F A;  4UEF A;  3P2H A;  3WGH A;  1WRJ A;  2LRD A;  2LDU A;  4OIR F;  4Q4Z F;  2DMQ A;  1TLH B;  4BHB A;  1HDU A;  2R7T A;  1XGO A;  1SMT A;  1QZY A;  3CUQ B;  2M9H A;  4AYB N;  2FXF A;  1MH3 A;  2GLJ A;  2XF7 A;  2YNC C;  3H8F A;  4X0G A;  2X48 A;  2NXN B;  2L7F P;  2Q2E B;  2QYO A;  4ZYA A;  3FX6 A;  3PJR A;  1QA6 A;  5K8P A;  2KJC A;  3LSG A;  2P6T A;  4PJL A;  4B3A A;  1IGN A;  4AVC A;  5LRJ A;  4A3J J;  4BL0 B;  2BUE A;  2VT3 A;  2Z3P A;  4RM2 A;  1B72 B;  1ZR4 A;  2XKP A;  4F92 B;  2F48 A;  3A0H C;  1OR7 C;  5B5E C;  1HDQ A;  3D4U A;  4PQA A;  2NOJ B;  2O7O A;  1AYE A;  3DBH B;  1F2O A;  4M9S A;  1GV5 A;  1W7P B;  1TP4 A;  2LG4 A;  4OU0 A;  1YW4 A;  3OY9 A;  3IO1 A;  2LH9 A;  4P5O A;  2J5O A;  3TL4 X;  5KAF C;  5HH1 A;  4XLA A;  3FBU A;  3LSK A;  4HV6 A;  1ZTR A;  5CLS A;  2R93 J;  3QOD A;  3D7H A;  3KI9 A;  2RAE A;  3G3Z A;  3GLX A;  5GTI C;  1SEU A;  3W91 A;  4CH7 A;  2LNB A;  3O2P E;  3K2Z A;  1NHA A;  3KR4 A;  2V1N A;  1NSL A;  4AG9 A;  3HSE A;  5DD8 A;  4UA3 A;  3COA C;  1WHU A;  1Z8X A;  4DJA A;  2Z33 A;  5DV5 A;  2OTJ I;  4MBU A;  3GX4 X;  4U7D A;  1ZRF A;  1TWA J;  1XMA A;  2GU2 A;  5D8N A;  2OQR A;  1LPQ A;  4RB0 A;  5E17 F;  2A5W A;  1U2W A;  2NRA C;  2QQ8 A;  4A3B J;  3CXS A;  3TED A;  2Z3K A;  2ETH A;  4I76 A;  1FMW A;  2EUI A;  3F8B A;  1UST A;  2F8H A;  2JUG A;  1SC7 A;  1U78 A;  4F0Y A;  3JRG A;  2LKX A;  2PVV A;  1QPM A;  2ZJQ F;  2WV0 A;  2XEG A;  3PIP F;  1XIX A;  1XSD A;  2Q4Z A;  4UB6 C;  3WTV C;  2ZSH B;  4A6E A;  2LRE A;  3OYL A;  4MGR A;  2HUZ A;  1SFE A;  5FLM J;  3HKZ N;  1XS9 A;  1YR0 A;  3KX2 A;  4B44 A;  4FQG A;  2E5Z A;  1YJ9 I;  4HF0 A;  5KAI C;  4OC5 A;  2FJ1 A;  2YGW A;  2VBY A;  3I4P A;  3WC6 A;  1QPI A;  3H3Z A;  2GLO A;  4YFJ A;  5LRG A;  2HTJ A;  3D3S A;  2MAB A;  3JVN A;  5TRD A;  3IH2 A;  2B4B A;  3R0A A;  4P96 A;  5HDG A;  2ADU A;  3DLJ A;  3FXK A;  1RES A;  5FO5 A;  3FKI J;  2COM A;  1EA3 A;  5EYR A;  1BPM A;  1VQP I;  4FUU A;  4I6Z A;  4A0X A;  1G6N A;  1HW1 A;  4RAG A;  1G3Y A;  2EBI A;  2R7D A;  1LE8 B;  2QEN A;  1Z67 A;  2HYG D;  3B02 A;  4IHM A;  3F22 A;  4NSQ A;  1L0O C;  1YQE A;  2FNA A;  3GTP J;  4L8A A;  3JSO A;  1WI9 A;  2EIM H;  1CF7 A;  5FKO A;  3BCB A;  3RKY A;  4ZYQ A;  2XGD A;  2P7V B;  4CSW A;  2DT5 A;  2ZXH A;  2OZU A;  4KN4 X;  3IU2 A;  2DTZ A;  3HZJ A;  4MFQ A;  3A03 A;  1BAV A;  2DOF A;  4ZX8 A;  3HRM A;  3OMY A;  2WC2 A;  1R6R A;  3W3C A;  2QZ8 A;  4ENK A;  1A5J A;  1D0X A;  1A31 A;  1REP C;  2VJI A;  2AFX A;  1ETX A;  1JTY A;  4UUS A;  4ONU A;  1D5V A;  2GAN A;  2EPF A;  5F08 A;  4XKV A;  5TJJ A;  1VTN C;  2QSH X;  1JUP A;  3PB6 X;  3V4G A;  1YVO A;  2VEZ A;  3HB9 A;  5IT9 K;  2KLO A;  3P2F A;  4HNY B;  3ZXS A;  2IVM A;  3M1C A;  3I71 A;  5HLI A;  5ICE A;  4RDU A;  5LHG A;  3F6V A;  3H9J A;  3IL2 A;  2PN6 A;  5ICG A;  3PB9 X;  3RKX A;  1K61 A;  4LG0 B;  2DA6 A;  1HEE A;  4A0Y A;  4N4N B;  1D8J A;  2FIW A;  1VQ7 I;  1YME A;  3RPQ A;  5FGM A;  2P7C B;  3JCU C;  1ERD A;  1WQ2 A;  3DR6 A;  3S9M A;  3OS0 A;  5C4X J;  3JRD A;  2ZEM A;  1LFP A;  2Z1D A;  3DXJ F;  3L2R A;  1SQH A;  4EQQ A;  4F55 A;  4P4E A;  4BU2 A;  4X5K A;  3G1M A;  4HRI A;  1ZH5 A;  3PP9 A;  5DEQ A;  5EEH A;  4HPS A;  3NWT A;  1Z8W A;  1X19 A;  1UHS A;  1BN5 A;  4F52 A;  4HQE A;  1M4D A;  2X4H A;  3FF3 A;  2F5V A;  2PRB A;  3HSF A;  1ZHF A;  3CF2 A;  4RGU A;  2QEC A;  1M4L A;  1XN7 A;  2VC0 A;  3QPL A;  5F49 A;  2DFF A;  4MFD A;  1XDU A;  2F4I A;  3CT9 A;  1UFH A;  3IKT A;  1BLL E;  2XB0 X;  3ABK H;  4C2U A;  1CJW A;  4QSH A;  4ZX9 A;  2IS2 A;  2RNJ A;  2STT A;  4MTD A;  4IHV A;  1R58 A;  2ZKZ A;  1R7J A;  3F72 A;  3GYH X;  2XPW A;  2ZXV A;  3CLQ A;  4PJM A;  1ZG9 A;  3UY5 A;  2XAQ A;  3SI0 A;  1U5T B;  3CDL A;  2O61 A;  1YTY A;  4P44 A;  4IPA A;  5E3M A;  3PNV A;  3P9K A;  2W57 A;  4IKF A;  3MD2 A;  7CPA A;  5CVJ A;  2BL1 A;  2D1V A;  4KIF A;  4E7Z A;  2Z16 A;  1BJA A;  3W2V A;  1DPU A;  3BPX A;  3TMO A;  1VQ6 I;  2HPM A;  3E0J B;  1VQ5 I;  2BGC A;  2F7V A;  2N8G A;  2J9A A;  3B3V A;  2VB6 A;  3P7N A;  4CAE A;  2XVC A;  2Z3Y A;  2UZK A;  4F9U A;  4MHG A;  4MIM A;  2WY7 Q;  1GHC A;  1Z0X A;  5IY5 H;  1I6H J;  3NH4 A;  3K4C A;  1R9T J;  2QQ9 A;  1ZGJ A;  1GVD A;  3HGY A;  3PQK A;  1M1E B;  3CZX A;  3M3Y J;  1QSR A;  3ZN0 A;  2K9S A;  3ZP5 A;  2EFQ A;  2JRM A;  3AL0 B;  5F27 A;  1S6L A;  4P10 A;  3I56 I;  3EDP A;  2VIX A;  1F36 A;  4OC3 A;  4BAC A;  1B59 A;  2WZN A;  1EE3 P;  1T6S A;  3RSN A;  4N0B A;  5J8F A;  1HA8 A;  4AID A;  3L7W A;  1ITY A;  2CMP A;  1BW6 A;  1B9N A;  3H0G J;  3B3T A;  5GPA A;  2PIY A;  4K30 A;  1Z91 A;  3TW7 A;  3MGD A;  2RN7 A;  3FIS A;  1NMT A;  4MLO A;  1E17 A;  2X6O A;  1HQC A;  2ZEG A;  4LD5 A;  3QPT A;  4CYN A;  1QZZ A;  4RAY A;  1BC7 C;  2QKL B;  1WKM A;  4E2A A;  4FD5 A;  2DOD A;  1MH4 A;  3F8K A;  2R92 J;  1JJ8 C;  1RTQ A;  1S5K A;  1JHF A;  1D1C A;  2I10 A;  1D0Y A;  5DD4 A;  3X2Q H;  5FLV A;  4UWJ A;  3DPU A;  3FKJ A;  2FEZ A;  1TIQ A;  5CNP A;  3T90 A;  4M3G A;  3CDH A;  3C1D A;  4BEH A;  5ELY A;  3T8W A;  4MHZ A;  5L3G A;  4YIR X;  1R3N A;  4BY1 J;  2ZXI A;  2JA7 J;  2XRO A;  2LKP A;  4XOT A;  3E6C C;  4I2O A;  1BW5 A;  1IU8 A;  1N71 A;  4MFL A;  2A5Y B;  4P4J A;  1HF0 A;  3VFZ A;  4PSX A;  1XB4 A;  2L9V A;  4KNY A;  2O53 A;  2EV5 A;  2GBY A;  2E7W A;  4NGN A;  1XC5 A;  3ULQ B;  2LF7 A;  3M8F A;  5A27 A;  4OIW A;  4Q47 A;  4V19 K;  3GZN B;  1A6I A;  5KTA A;  1KYZ A;  2HS5 A;  5K1Y A;  3CJT B;  4WXH A;  4LB5 A;  3RCO A;  4F93 B;  3HGG A;  3DNS A;  1Z77 A;  2JSC A;  2PJP A;  2BY1 A;  4WX9 A;  4M3S A;  5BMZ A;  1K7A A;  2JN6 A;  1SMY F;  1N78 A;  2DPT A;  3PBE A;  2EFP A;  2VQC A;  4R1H A;  4FIS A;  3I3G A;  2EH3 A;  2HYF A;  4YFX F;  2C6Y A;  2VL8 A;  5GAD J;  2IJZ A;  1JGS A;  1YW9 A;  1XGN A;  2KKO A;  2R5Z B;  2Y2Z A;  3A2K A;  1ETY A;  4LJZ F;  4U88 A;  3WGI A;  5LEJ A;  2DA7 A;  1HBX G;  1VF9 A;  4L5I A;  1NSA A;  2DO7 A;  3RYR A;  3ROU A;  2XAF A;  3VYR B;  3OYJ A;  4MJ8 A;  2EK5 A;  1H0M A;  1HXD A;  1BI0 A;  1Y0U A;  2LFB A;  4LB6 B;  2DEA A;  1ZG3 A;  2WTE A;  5ILV A;  3GCM A;  4IO9 F;  5JLX A;  1E2X A;  2P4W A;  1FEX A;  2Z3L A;  3MQ0 A;  1PVE A;  4H6U A;  4N4O B;  1YQA A;  5IYC J;  2E1M B;  5FFX A;  3DTE A;  4XIC A;  1YLO A;  3G4S I;  2VZZ A;  3NA6 A;  4C2T A;  3VYU B;  3MCZ A;  4IX7 A;  2VBQ A;  3J80 K;  4L89 A;  4Z65 A;  2VKV A;  2K27 A;  1L3L A;  4RUH A;  4Y15 A;  4HV5 A;  1TKJ A;  1CP7 A;  1IYK A;  1SFO J;  4A33 A;  3CCY A;  3H8G A;  5CBM A;  4HNV A;  3IC1 A;  4OME A;  2EV0 A;  2VOD A;  4KOX A;  4MHY A;  4XKW A;  1D8K A;  3C18 A;  2PJ4 A;  3IWG A;  4CIC A;  2PVW A;  2JLM A;  3Q0V A;  3OOU A;  3MFK A;  4ZY1 A;  1J75 A;  3AG4 H;  1DUX C;  3R9G A;  3FM5 A;  1FP1 D;  1Q1V A;  4Y17 A;  3D2P A;  4P45 A;  2COB A;  1OJL A;  4UFX A;  3PFY A;  1FYL A;  2ID6 A;  2XAS A;  1ON1 A;  5F48 A;  5IV0 A;  2PJ5 A;  4HX7 A;  3ESW B;  2HQN A;  1D3Y A;  4KIG A;  4U7B A;  1GYT A;  4ZYG A;  4UVB A;  4FT8 A;  3TE4 A;  3WG9 A;  2Q0O A;  3WE2 A;  1TXR A;  2D1H A;  5CQG A;  3LOD A;  3LQQ A;  3TGN A;  1JE8 A;  2FXA A;  3GO5 A;  1XG1 A;  3KYD B;  3CC7 I;  2CJJ A;  4U0Y A;  1IXS B;  5FKM A;  1MBE A;  1IN4 A;  5J1R A;  1OYY A;  1PUE E;  1MJA A;  2KIF A;  2R7H A;  4DQ2 A;  3EY5 A;  3U1D A;  4EM0 B;  3S6F A;  1FBQ A;  1M1D A;  1W5T A;  2GA1 A;  2RRE A;  3M7G A;  5D8L B;  1FBU A;  4U9Y A;  5AGE A;  1WJ5 A;  3WE3 A;  4CGM A;  4HDV A;  3ZOB A;  2LD5 A;  3ASO H;  4CUG A;  1WSU A;  2CNT A;  5ICC A;  4HQM A;  4A38 A;  5J47 A;  4F0X A;  5JGF A;  2HOT A;  2JUC A;  4J19 A;  3GFM A;  3KR5 A;  4MFJ A;  4DYC A;  5LHH A;  2LTP A;  3GTJ J;  4NUB A;  1XFO A;  1Z2L A;  2RFH A;  1J09 A;  2VZY A;  4P4I A;  2HKO A;  1NG7 A;  2F4O B;  2B63 J;  2VKD A;  1BOB A;  2PIZ A;  5M3M J;  1CP6 A;  2A05 A;  2H5M A;  3TOA A;  1BM9 A;  3K10 A;  4V2G A;  1A35 A;  2R7Q A;  1K83 J;  2CW7 A;  3Q0U A;  4CYC A;  2PMZ N;  5LYD A;  1NH3 A;  4HKF A;  3K7A J;  2DBB A;  3G2B A;  2Q8K A;  4D9J A;  4B13 A;  4RMN A;  5E1X A;  4QVT A;  3OYF A;  3J7Z I;  1PP7 U;  1ARL A;  3HTS B;  2QEX I;  4IHS A;  3D1N I;  2BY2 A;  3RDI A;  5LYF A;  5G21 A;  4IRG A;  4QC6 A;  3LOC A;  4O5V A;  1OBR A;  1AHD P;  2OBP A;  2ABZ A;  3WU2 C;  5IP7 J;  3T8T A;  1F9N A;  3CP2 A;  1C0W A;  4BHP A;  3NRV A;  2DAO A;  2AFO A;  2XEF A;  2P5K A;  3L2V A;  1ARM A;  3H5R A;  2PCU A;  5G1Z A;  1KU2 A;  4AB7 A;  4CGP A;  4R3K A;  3RPU D;  4KOY A;  3FXU A;  5IYD J;  1JWQ A;  4PJJ A;  4Y52 J;  3FB3 A;  2JVG A;  1X3U A;  3BTC A;  2L7K A;  2CQQ A;  5H2F C;  2IA2 A;  3WHC A;  1PYT B;  3H9Q A;  1IN6 A;  1F1Z A;  4XKC A;  5JVG F;  2G3T A;  3KHX A;  2B5G A;  3W2A A;  2D4P A;  2MLK A;  1TKH A;  2R1I A;  1QRY A;  3Q9V A;  3JAM K;  1B8I B;  2EFO A;  1LFW A;  2REE A;  3IJ3 A;  4UNO A;  1MNM C;  2CQ7 A;  4UV9 A;  3E6D A;  4RAF A;  5HNH A;  1XTA A;  3DBR B;  2YNC A;  2ZJ2 A;  4NEX A;  5HVQ C;  5HXD A;  4CYD A;  2LC2 A;  2CWE A;  5KCM A;  3HOZ J;  4O23 A;  1MMA A;  1JKO C;  1YX0 A;  2DFE A;  2VI6 A;  2FSW A;  4ESB A;  3RI4 A;  3O6B B;  1OCC H;  3QP6 A;  1ZQ3 P;  4KOR A;  2RGV A;  2H94 A;  3B73 A;  4JYK A;  3S32 A;  2MH9 A;  1OR7 A;  1KQ9 A;  3IHU A;  2IT0 A;  4OIP F;  1IN7 A;  3OOP A;  4LK0 F;  5HS9 A;  4Y13 A;  5B66 C;  4Y7N J;  3EYY A;  1OYI A;  5H84 A;  1S29 A;  2HZT A;  4QIW N;  3JAM Z;  2WSA A;  5EZH A;  1FWZ A;  3MRU A;  1ZLH A;  2IGM A;  4C2M J;  3L1P A;  4IF5 A;  4XRS A;  1HC8 A;  2ZNY A;  1DQU A;  2K4J A;  1ZG8 A;  5M5Y J;  3CJR B;  2M34 A;  3H36 A;  3Q0W A;  4CZC A;  1CQT A;  2DI3 A;  1P7I A;  2BY0 A;  1X58 A;  2PQ8 A;  3QYF A;  2F5D A;  2W48 A;  3CCM I;  2VC1 A;  3DWL E;  5GP9 A;  1R5H A;  4KMF A;  4R6T A;  4XPL A;  4MHN A;  1KWM A;  4PGG A;  1ZLI A;  4AIJ A;  1T39 A;  2PC1 A;  1I27 A;  3BTI A;  2OQG A;  2XF5 A;  4XSZ F;  5IOZ A;  1VQ9 I;  1IOF A;  4RB3 C;  4CYO A;  1FJL A;  1POG A;  1TF9 A;  4HF1 A;  2F5C A;  1ETK A;  5LYI A;  5D6F A;  3KZW A;  4DZP A;  2R7Z J;  4Q7A A;  5A2Q K;  3D7D A;  1H88 C;  1XPX A;  4MCQ A;  3KE2 A;  3SFZ A;  1FY7 A;  1VHS A;  1W7P A;  1XMK A;  1RPW A;  3MZH A;  2YU9 J;  1V0C A;  4NJR A;  2QBY B;  5A28 A;  1Z1D A;  4HW0 A;  1DPR A;  1WCM J;  4FHT A;  3ZGK A;  3L2U A;  1G2H A;  1I1S A;  1HOM A;  2FT0 A;  2FVG A;  2Q4V A;  2V8G A;  3SXY A;  1MIJ A;  2RNG A;  3PNY A;  2Z99 A;  3GUD A;  3IWZ A;  1YI2 I;  1IOI A;  5EMI A;  3JRE A;  1WVR A;  4KUA A;  1ETV A;  2CO5 A;  3OV8 A;  3FVL A;  2PJ8 A;  4NXY A;  4KDP A;  2X1E A;  2FA5 A;  2ACJ A;  1NK2 P;  4IRH A;  1VHO A;  2DN0 A;  1BBY A;  5B1B H;  4H89 A;  4OKO A;  2WPX A;  5D8K B;  3PEI A;  1X2M A;  1QNT A;  3D5S C;  3K1M A;  5BWA B;  2G7U A;  2NVY J;  3E97 A;  4DYQ A;  1MZB A;  4BE1 A;  3SI1 A;  3EYI A;  3HKZ A;  1SFU A;  5AON A;  5ILS A;  3QAY A;  3S17 J;  1HLV A;  1JI8 A;  2KCW A;  2OZH A;  4M6X A;  1O7L A;  2AQF A;  2OCC H;  1J7K A;  2I5U A;  5LLQ A;  2XPU A;  3QQA A;  4C9Y A;  2FBH A;  3VEP A;  1BIB A;  1WH5 A;  3DQV C;  2PJB A;  4KVM E;  1GXQ A;  4R9M A;  1Q7L A;  2C6P A;  3WU1 B;  3IFE A;  1X12 A;  1U9O A;  2CW0 F;  2KQR A;  2LVS A;  1A04 A;  2M7A A;  2JBJ A;  1Q2D A;  3LMS A;  3E5Q A;  3F8F A;  4NC6 A;  4CZZ A;  2Q43 A;  3H8E A;  1Q1H A;  1DGR M;  5HDN A;  4LOC A;  2Z9O A;  3A1Y A;  2CV2 A;  1LDD A;  4JD6 A;  4PPZ A;  4YG2 F;  1BR1 A;  3HHH A;  4KLV A;  3HRT A;  4ONW A;  2FNP A;  2BVM A;  4KOW A;  4NBQ A;  3W6V A;  1R5G A;  2DJN A;  4KOU A;  3C26 A;  4ZYH A;  1O3R A;  1GXP A;  3U21 A;  5KNL A;  5J1Y A;  2PR8 A;  5E1Z B;  3ELK A;  3TP0 A;  5IP6 A;  1P9Q C;  3T1B A;  1SAU A;  2VBZ A;  4FD4 A;  2G7H A;  2M45 A;  1T98 A;  4ON0 A;  2DQR A;  2X51 A;  4L9V A;  4BQO A;  3EXN A;  3LAJ A;  2HZD A;  4RAZ A;  1LE8 A;  4L9T A;  3V7R A;  1GHE A;  2MG4 A;  2QKM B;  1LB2 A;  2EWN A;  2UUZ A;  4A3C J;  3OSG A;  1KZF A;  3QAH A;  3V42 A;  3VYT B;  3IH4 A;  3KQX A;  2WY8 Q;  1WJD A;  4ESJ A;  2HQY A;  3FZV A;  2R5Y B;  2O5R A;  5B1A H;  2LP0 A;  3W6J B;  1UMQ A;  3H5N A;  2WWY A;  3D0S A;  3AG3 H;  4BXX J;  4F7Z A;  3RJP A;  3GYA A;  2DFH A;  1UAA A;  3D5R C;  2GQQ A;  5F0F A;  4UCN A;  1KON A;  1OCP A;  2BV6 A;  1EF4 A;  3DTI A;  3F9K A;  2XV4 S;  3PBB A;  2VBX A;  1IXC A;  1RR8 C;  4TNU A;  3H5Z A;  3B35 A;  1IXR C;  1J59 A;  1I1D A;  4KUB A;  4EME A;  4KOS A;  4RS2 A;  4MHD A;  1AMP A;  1IN8 A;  1R57 A;  3KHZ A;  2OZG A;  1F43 A;  2KIU A;  2XDV A;  4A2U A;  1ETO A;  4ZDP A;  3NAU A;  4AVZ A;  5LBQ A;  3MKW B;  4KJZ A;  1Y1W J;  2QCO A;  1FBS A;  2TCT A;  2CXA A;  2D4O A;  3NFZ A;  1KYW A;  2BW3 A;  2Z5U A;  5D5W B;  1FOK A;  3K9T A;  3L09 A;  3PB4 X;  1P4W A;  1Y8R B;  4IHY A;  3I59 B;  1KGS A;  2RKH A;  3SJG A;  4CDG A;  2CS3 A;  1E3H A;  2XAU A;  1MMN A;  2NMT A;  4EVY A;  3ZQG A;  4G7H F;  4KSI A;  1AOY A;  2ZPA A;  2R7U A;  4HA8 A;  3MZY A;  1XMB A;  1P4A A;  4XOR A;  5KTC A;  5D29 A;  3V7C A;  2EVN A;  3IAM 2;  3I4M J;  1JJ6 C;  5LGT A;  4AM3 A;  4H4K C;  3KEQ A;  3BCA A;  1BI2 A;  1XEB A;  2CTC A;  5ISV A;  2MSY A;  4DOZ A;  1IB1 E;  3LSR A;  3FIX A;  3Q5F A;  5L3E A;  5EDN A;  3OYA A;  4FAI A;  4V2F A;  4ABZ A;  2PFB A;  1USS A;  3OYM A;  1RRJ A;  1VQ4 I;  2VXK A;  3PB8 X;  4OWR B;  2BE5 F;  3P9C A;  3RZA A;  4C2Y A;  4P4D A;  2VXZ A;  2E5N A;  3CDI A;  4IRI A;  2BHZ A;  3VYS B;  1QSM A;  3KCC A;  2Y48 A;  4N9I A;  5M5W J;  1VND A;  2X1C A;  1WI3 A;  2CUJ A;  1G3S A;  2L01 A;  2WB1 A;  3D5L A;  3R95 A;  1YYV A;  3KYL A;  3BTJ A;  2HWV A;  3IWE A;  3ZMT A;  5LGN A;  4KS9 A;  2JSP A;  2B9S A;  4NCZ A;  2CU7 A;  1F2P A;  2L2O A;  4IVN A;  1LFB A;  2BOA A;  3HOW J;  1OKR A;  3V8L A;  3DFG A;  3JRI A;  3CC4 I;  2DXQ A;  3H4Q A;  1CPX A;  2DYS H;  4M72 A;  2YX4 A;  3GBG A;  3SJF A;  3EQL F;  2QLZ A;  2BHY A;  2I79 A;  3S1M J;  1IRG A;  1UCR A;  1LNW A;  5AG5 A;  1ONV A;  2EQR A;  2JPB A;  5HMN A;  3HG9 A;  2FMY A;  4BAY A;  4GCV A;  3BY6 A;  1TW2 A;  4GO1 A;  5JH9 A;  2NAZ A;  5HLH A;  4XLH A;  3DU5 A;  4HDU A;  4BEH B;  4AG7 A;  4DJL A;  1LDJ A;  2HOA A;  3CO7 C;  4X6A J;  1P4N A;  3EFA A;  3SEQ A;  2BVL A;  2V1U A;  4JXR A;  4A94 A;  2NYX A;  2ID3 A;  2GLF A;  2JWT A;  2MD0 A;  5FD6 A;  1S3J A;  4S0H B;  5EF6 A;  1X1D A;  4S05 A;  3ISX A;  2NS8 A;  3JRC A;  1XE4 A;  4ZTF A;  3EO4 A;  1V5F A;  1XF8 A;  2GOM A;  3QU3 A;  3BLN A;  3VAR A;  5J1Q A;  1PYV A;  2M30 A;  2L54 A;  3S9L A;  2O9L A;  2UXN A;  2GXG A;  3FMQ A;  4PUS A;  2PJ9 A;  4NGS A;  4BYY A;  3GY9 A;  2JDC A;  3OL4 A;  5LGU A;  3GFJ A;  2XB5 A;  1UJ8 A;  1VQO I;  1IDZ A;  3CUQ A;  3D66 A;  1JT6 A;  4B8X A;  1H89 C;  4PJ0 C;  3M8J A;  4IQ4 A;  4B12 A;  3BG5 A;  1Z7L A;  1KUY A;  1YW6 A;  2EIL H;  1V3F A;  2TRT A;  5G22 A;  2O8K A;  1FT9 A;  1S7A A;  4XPD C;  4C2X A;  2FE3 A;  5E1W A;  3QRF F;  2PDO A;  2XEJ A;  4NNJ A;  1FOX A;  4EGY A;  3HOS A;  4A93 J;  1OIS A;  1E0E A;  2Y75 A;  4KMU X;  3A01 B;  2STW A;  1Q2C A;  4C2Z A;  3JUW A;  1PUA A;  4BUP A;  3B2Y A;  3LQR A;  2ISZ A;  2H27 A;  3ZMV A;  1IO2 A;  4PFP A;  5B3S H;  3U1K A;  1XD7 A;  2JMW A;  2DPU A;  4ENJ A;  4B14 A;  2A6E F;  2VAS A;  3IC7 A;  3D8P A;  2KZV A;  1ZAO A;  3G3S A;  3EET A;  5D5X B;  3OYG A;  1K4S A;  2OAZ A;  5F6F A;  2HDC A;  2Z3M A;  3MN8 A;  1ETQ A;  3BOQ A;  3O8H A;  5D4S A;  4FE7 A;  2DLL A;  2OCE A;  4K2E A;  2FL4 A;  3A9L A;  1O57 A;  1Z6T A;  2LBF B;  4PXC A;  5THW A;  3KEO A;  3QP5 A;  4G94 A;  5KHD A;  3CC2 I;  1SVL A;  1UG2 A;  3OS1 A;  3OWC A;  4NGT A;  1PJR A;  1E3P A;  1JHH A;  4MTE A;  4EM1 A;  5LRS A;  2MLG A;  2LR8 A;  3K69 A;  2OD5 A;  3PZJ A;  3S2H J;  1YRN A;  2W4S A;  3VSK A;  2G0B A;  1A2Z A;  2G3A A;  3E7L A;  1XCV A;  3A0B C;  1MDM B;  2DOE A;  1I3A A;  2EV6 A;  2H6B A;  5FKK A;  3PQJ A;  3GTL J;  3S3O A;  2DXI A;  3FNC A;  2OPT A;  2YND A;  4ENN A;  3R4K A;  4ESF A;  3MN2 A;  5LD2 C;  3CTA A;  4C7H A;  2DFI A;  4UF4 A;  4ITV A;  2PMU A;  2DCE A;  5D4R A;  1GV2 A;  4NC8 A;  3S6G A;  2Y0S N;  3MKZ A;  3SXN A;  3AFH A;  3TCV A;  1TW3 A;  4IJA A;  1R5I D;  3BXM A;  3DLL F;  2KT0 A;  4KT5 C;  4KVO E;  2DPD A;  4XL9 A;  4P9F A;  1PU9 A;  4QBJ A;  2F2E A;  3GEZ A;  4ZZD A;  2A6H F;  2V8V A;  2BEO A;  1YX5 A;  2ZC2 A;  1D5Y A;  4KOV A;  2OJE D;  4GRI A;  4MNU A;  3LL7 A;  4HNX B;  4FBE A;  3ABU A;  1O3Q A;  3HIF A;  1V5G A;  4CYQ A;  4M6V A;  4QLC U;  1VQ8 I;  3S8P A;  4UUS B;  3SEZ A;  4P4B A;  2AHQ A;  4CCM A;  3HOV J;  5HVH A;  1QZE A;  4HAM A;  3P5J A;  5FJ8 J;  5K8O A;  1X1A A;  3F8N A;  3OIQ A;  4A3G J;  3V7S A;  1KA8 A;  3K2A A;  3LFU A;  2V6C A;  2P6E A;  5GAH J;  5HLT A;  4A37 A;  5C82 A;  1A36 A;  2E2H J;  4NDL A;  1CM0 A;  6PAX A;  2K9Q A;  1Y9W A;  1D1A A;  4UFW A;  1DDN A;  3ZJ0 A;  2JJ7 A;  1ZLK A;  1QU3 A;  4LIT A;  4IOA F;  2FD5 A;  4A30 A;  2HV2 A;  4R7M A;  1S5L C;  2ZME A;  2X1D A;  3C3W A;  1YHQ I;  3E5U A;  2FU4 A;  3ASN H;  3I9V 2;  2Z10 A;  1HSJ A;  3DU6 A;  3EC4 A;  1UG0 A;  4A12 A;  3F6O A;  4WK8 F;  3WTY C;  4KSF A;  3OIP A;  4FET A;  1QST A;  3MVP A;  3SHP A;  2QVO A;  2KRF A;  1Z9U A;  4R79 A;  4MO7 A;  2QIR A;  3ZMZ A;  5LHI A;  3L2W A;  4RLF A;  2P0W A;  1AKH A;  1I21 A;  2ELK A;  3K1N A;  4DNC A;  3VWB A;  4HEA 2;  2A4N A;  3BZK A;  1FZP B;  4O3M A;  4EJT A;  4OMY A;  4U9Z A;  5F47 A;  1DU6 A;  1H9G A;  2DA1 A;  5DYM A;  1XOV A;  1ZG7 A;  1A6Q A;  2K7L A;  1LKX A;  1EV7 A;  2BCO A;  4I01 A;  1Z21 A;  3BR0 A;  4G9Y A;  3UR3 C;  1DP7 P;  3TO6 A;  2IS6 A;  1X1B A;  2NOG A;  1IRZ A;  3DV8 A;  3TDZ C;  3I1U A;  1Y8Q B;  1IRX A;  3HYI A;  5IB9 A;  3BI0 A;  2I8D A;  4KIS A;  3BHX A;  1MND A;  3S1Q J;  4Y49 B;  2IGN A;  3R61 A;  2PSW A;  4E7S A;  3ERE D;  1IRF A;  3I55 I;  4B10 A;  4BGD A;  3V38 A;  4XMY A;  4IUS A;  1OPC A;  1G59 A;  1F57 A;  4I02 A;  4L9N A;  4OMZ A;  3SQN A;  1Y1V J;  4HNT A;  4XKB A;  3FBI B;  4QPQ A;  4D1Q A;  3M1E A;  2K85 A;  1RZ4 A;  5J6X A;  1ZGW A;  1HDD C;  1ZK8 A;  4NQW B;  2KPM A;  4BQQ A;  2PEX A;  2K5C A;  1IN5 A;  4WF2 A;  5AIP A;  2IL4 A;  4XPD B;  3C7J A;  2L0K A;  3L2Q A;  2FQ3 A;  5CQE A;  3IH3 A;  4DYO A;  5JHU A;  2P5V A;  3ZQC A;  4R87 A;  1IIC A;  2K9M A;  4I0B A;  5TGT A;  2YUS A;  2RVC A;  1PDN C;  4BHC A;  3LFK A;  1RET A;  3REO A;  1U5T C;  2Z11 A;  4I7H A;  2VUM J;  3S9N A;  1MMG A;  2LBF A;  1U5T A;  4KN7 X;  3LSJ A;  1K4T A;  3ZPL A;  4FTH A;  3CDX A;  3CCL I;  2M7B A;  1TT0 A;  3ZCO A;  3LD2 A;  2UXX A;  3FXO A;  1RXT A;  3DKX A;  2HYJ A;  4EWT A;  4ZYD A;  3CXQ A;  4XSX F;  2VQL A;  2VJJ A;  2X0L A;  3ZMS A;  4ZZL A;  1R71 A;  2ARH A;  1T95 A;  2YSR A;  5GCN A;  4E8O A;  2CGP A;  1U0J A;  3BLY A;  1TWH J;  2PJR A;  4YFN F;  2B3U A;  2VBW A;  2E36 A;  4XK4 A;  5FKN A;  3FMC A;  3O8G A;  4CAF A;  1Y6I A;  1I3Q J;  3LA7 A;  3WHB A;  1UHW A;  2DDA A;  2HFH A;  4OAZ A;  2ZED A;  1YG2 A;  3K9U A;  2XRN A;  3QNV A;  3BR1 A;  4LUA A;  1VQK I;  1LRZ A;  3FXM A;  2JZY A;  2MA3 A;  2BY3 A;  1TL8 A;  2KRC A;  2EWB A;  4U5Y A;  1HKQ A;  3S93 A;  1S7L A;  1Z8T A;  3KGQ A;  5F09 A;  3I5U A;  4HZF A;  3G1O A;  2HPI A;  4AVP A;  2YPR A;  1OMI A;  3D2M A;  2LYC A;  4A3L J;  3N05 A;  1X4P A;  1IY7 A;  1J5Y A;  2M0C A;  3CMY A;  1YIT I;  2MYS A;  5GTH C;  1OZP A;  3GLL A;  4A3I J;  3R60 A;  1EH7 A;  3S2D J;  3KQZ A;  4BDZ A;  1JKR C;  1WPK A;  2LY1 A;  2WAQ A;  3OYI A;  2DA3 A;  2R7V A;  1FSH A;  2F6C A;  1CF7 B;  5IP9 J;  4M9X A;  2A6T A;  2B0L A;  2JBK A;  4UCP A;  1TQM A;  2EFN A;  2LLK A;  3F21 A;  3HEF A;  3I9S A;  4RN7 A;  1IF1 A;  3WG7 H;  1BI3 A;  3W6K B;  4R3L A;  3FEC A;  3GXO A;  2MBF A;  2GWR A;  2VQY A;  1MBH A;  1S72 I;  4UV8 A;  2E2J J;  2V9V A;  3RYP A;  1QSN A;  3FXT A;  4HLX A;  3RYO A;  2KDZ A;  1LDK B;  4LG0 A;  4EJV A;  4X8I A;  1QVU A;  1UZC A;  4FX0 A;  2KIM A;  4EJO A;  3Q9S A;  3TP3 A;  5K5R A;  1SFK A;  1N75 A;  1F5T A;  4ORF A;  1GDT A;  1MK4 A;  4CGL A;  4CXF A;  4MEX F;  3HBL A;  3PRT A;  4IEJ A;  4YEJ A;  1RIO H;  3GF2 A;  3GZ5 A;  1IJW C;  3CCQ I;  3GW2 A;  1JKQ C;  4KIT B;  4BJT A;  3CME I;  2ISY A;  2W00 A;  4UB8 C;  3VOE A;  4AIH A;  4Z2Y A;  2QA4 I;  2VPL A;  2Q44 A;  2IPQ X;  2IA0 A;  4F9V A;  4JP0 A;  3L2N A;  2P6G A;  3FXR A;  1QO0 D;  1ULY A;  1ZG1 A;  2XPV A;  2DTR A;  2KIQ A;  4HPQ A;  2P8T A;  1IDY A;  3BJ6 A;  4RI1 A;  4BE0 A;  3H0D A;  5J3L A;  3FX3 A;  4NFR A;  4A3M J;  4U0V A;  3LAP A;  1KU9 A;  3ABM H;  1DTD A;  4A39 A;  4WWC A;  4KA4 A;  3BTL A;  3HUG B;  3S3M A;  4XID A;  2GXB A;  3PNT A;  2BW3 B;  2G9D A;  2PJ0 A;  5KVR A;  1S60 A;  2KZG A;  2QML A;  2K9L A;  4G7O F;  1BA5 A;  2CNS A;  3GVA A;  1AWC A;  4R57 A;  1DE4 C;  2MGQ A;  1BL0 A;  1M4G A;  2Q2E A;  5D6E A;  3ZR8 X;  3ECO A;  1YS6 A;  4RA2 A;  3OYK A;  1LCP A;  4AVB A;  3BJ7 A;  3LWF A;  5DTD A;  4BJ6 C;  1VQM I;  4DBR A;  2PJ6 A;  3JSP A;  5D5U B;  2HGC A;  4TV7 A;  4B11 A;  3JRF A;  4YIF A;  4HLY A;  5IB0 A;  2MW8 A;  5HLG A;  2R0Q C;  2VKH A;  5GAG J;  4A3E J;  1Y0Y A;  2IAI A;  2IP2 A;  4FD6 A;  1I5Z A;  2GXA A;  3SHF A;  4IL6 C;  3M07 A;  3K4L A;  3C2G A;  4XRF A;  3HOT A;  2EFW A;  2BO9 A;  2JDD A;  5D5V B;  3GIU A;  3KL9 A;  4CCK A;  3SFI A;  3AL0 C;  3LSM A;  3VB2 A;  4CO8 A;  1T0F C;  5JQ4 A;  2VOO A;  1MSE C;  4AIK A;  2IGK A;  5HVG A;  3FXJ A;  3JTH A;  1X3Z B;  1RKW A;  5BQT A;  4YWY A;  2R4G A;  2P5L C;  4E7H A;  2Q51 A;  1PP8 F;  4OC4 A;  1FPQ A;  2VXD A;  3AKZ A;  1BOA A;  3M9A A;  1TT5 B;  1YO5 C;  1R49 A;  1MNE A;  4FX4 A;  4KYW A;  3OS2 A;  2R7W A;  3DDD A;  3NAR A;  1LAM A;  2HXO A;  5EC4 A;  2ZEH A;  4B1R A;  2GAU A;  3FK6 A;  2GOX B;  3LMM A;  1UWY A;  2J8R A;  3VH9 A;  3OIO A;  2IA1 A;  1XCB A;  2OV7 A;  3TDU C;  3IP4 B;  3T8R A;  1XGM A;  4AWX B;  5LFA A;  4RB2 C;  1Z5R A;  5K5Q A;  3GTK J;  2ZBK A;  4HOB A;  1XMT A;  4NB5 A;  3RQ4 A;  3G73 A;  3S14 J;  1S7K A;  3OYE A;  3FYN A;  5IOY A;  1OCO H;  4ZDL A;  4F3Q A;  3FBN B;  2Y31 A;  2PJR B;  4CGO A;  4EFD A;  5DUK A;  3LSH A;  1UB9 A;  3IAS 2;  2ZW6 A;  4YRV A;  1YIJ I;  3T0Y A;  1VQN I;  1M4I A;  1Z7U A;  2CF4 A;  1O3T A;  4PV6 A;  4J00 A;  5HVF A;  1FNO A;  3L00 A;  3UNG C;  4F91 B;  4I99 C;  1XX5 A;  3B3C A;  1XMX A;  2VOP A;  4CHU A;  4W9Y A;  2QQA A;  2R7X A;  3G1L A;  2IMO A;  4XLE A;  2K86 A;  2C6C A;  3CPA A;  3J7Y J;  2O4H A;  1R1U A;  2VJ5 A;  3SI2 A;  2V9P A;  2Y0M A;  5CPR B;  3CJN A;  1KQ0 A;  3NEU A;  4FWU A;  1CBX A;  4NGQ A;  2Y0S A;  2K9N A;  1KU3 A;  4RGX A;  3LA3 A;  2CUE A;  1ZAR A;  4XLF A;  3WC5 A;  4M6H A;  1FTT A;  1KUX A;  2DDB A;  2GZW A;  4P4F A;  3HRS A;  2R7O A;  4M3B A;  3V8K A;  3E5X A;  1R4M B;  4LG3 A;  2G0E A;  2ZOF A;  4JOM A;  4FD7 A;  3HM5 A;  1ZO0 A;  5AG6 A;  4QB9 A;  3GKR A;  1IV8 A;  2DT6 A;  2V1D A;  3B6C A;  4GYG A;  3K4K A;  3ISZ A;  2HDD A;  1X10 A;  4BE2 A;  2Q1Z B;  4II2 A;  4YRH A;  2QBY A;  1R43 A;  2J8M A;  4ASN A;  5ILU A;  5DM6 F;  1HKS A;  1MJ9 A;  2XC7 A;  3K0L A;  3F23 A;  2F5I A;  4WXD A;  4PJN A;  2AFW A;  2PBI A;  1LJ9 A;  3FM3 A;  3TQN A;  1RR7 A;  3KLO A;  3H92 A;  1DGW Y;  3HOY J;  3F0A A;  4CGN A;  5FLX K;  5C44 J;  4B3X A;  2C27 A;  3PSI A;  2EK9 A;  1U6M A;  2DPS A;  4PK2 A;  1OYW A;  5LYL A;  2R5Z A;  2EZK A;  2HVS A;  1B8I A;  4R8H A;  3B3W A;  3PFE A;  4M3E A;  4KZT A;  5E3O A;  5FRM A;  4UWI A;  5H6R A;  4ZTJ A;  1R00 A;  2BOL A;  2B5G B;  2VPR A;  3IKV A;  3LST A;  4X3R A;  4HYE A;  1Y7E A;  2OUM A;  2PJA A;  2LK2 A;  3PFI A;  4C3I J;  2XGX A;  3B6A A;  3I53 A;  5CYV A;  3VOD A;  4AYB A;  4EMS A;  1W36 C;  4E6K G;  3FJU A;  2XF6 A;  4BQN A;  1XSX A;  2CUZ A;  4KT6 A;  4Y33 A;  5H20 A;  1OCR H;  2HOS A;  2M2E A;  4XRM A;  3G8W A;  2XAJ A;  1LFU P;  2RV8 A;  3WR7 A;  3OYD A;  2ELH A;  4DBQ A;  1S7N A;  2ZW4 A;  2LSO A;  5BOX A;  3A4C A;  3I4N J;  3PGP A;  5JHF A;  1FSE A;  2XGE A;  4YEL A;  4EM2 A;  4JZ0 A;  2RQP A;  4OAY A;  2HVR A;  2PJ3 A;  1TQP A;  4G7Z F;  3JR9 A;  5DS9 A;  1ZRE A;  4LGW A;  4GYI A;  1X4O A;  2CY2 A;  1AU7 A;  1K4J A;  2XUB A;  2DU9 A;  2Z3O A;  1YLF A;  1YJW I;  3ABL H;  1TNT A;  4D0P A;  1VI0 A;  2HNH A;  3D7F A;  1TBX A;  4YFK F;  1WH7 A;  5DCM A;  4M6I A;  3JRU A;  5H6Q A;  1LQ1 A;  1FOW A;  3AG1 H;  2LY9 A;  1QVT A;  2O0Y A;  4M9Z A;  1FTZ A;  2ZCW A;  1S9H A;  1X2N A;  1MMD A;  3TC8 A;  2OA4 A;  3RPU A;  2JTV A;  2FBI A;  3CJQ B;  1LVA A;  1YLE A;  3CES A;  4FCY A;  2EBJ A;  5EEG A;  2L9R A;  4I98 B;  4H6Z A;  4B09 A;  3SJX A;  2JRT A;  4ETS A;  2EIN H;  2AXT C;  2E1O A;  2V79 A;  4KSA A;  4UBR A;  4X2T A;  4PGH A;  3ERM A;  1B1B A;  5L3B A;  3GME A;  1ETW A;  2ZNZ A;  4ANJ A;  1W0U A;  1XRY A;  2XGC A;  2PJ1 A;  1FMV A;  2L7M P;  3K2K A;  4MQV A;  2R7F A; 
#chains in the Genus database with same CATH homology
 2LBF B;  2R98 A;  2ATR A;  4A31 A;  5J8C A;  5F46 A;  5KHD A;  3BG7 A;  3A2K A;  5C88 A;  3OS1 A;  3OWC A;  1Z3Y A;  3DTK A;  1PJR A;  1OLT A;  2JEV A;  3PL8 A;  3OYJ A;  4XR6 A;  3VYR B;  4MJ8 A;  1WJA A;  1Z3X A;  2HDW A;  4IQJ A;  3EUH C;  2Q4Y A;  3F5B A;  2KRH A;  5EBV A;  3K70 C;  3OL3 A;  3PZJ A;  2Z3N A;  2Z0Z A;  4CRY B;  4FAS D;  2W4S A;  4JLY A;  2YND A;  3VSK A;  3VWE A;  3VSL A;  2Z3L A;  2G0B A;  4HNW B;  3K6G A;  4N4O B;  1B87 A;  2G3A A;  2E1M B;  2VZZ A;  3DTE A;  4H6U A;  3R96 A;  3ZZI A;  1NG6 A;  4C2T A;  1D1B A;  3VYU B;  4IX7 A;  2RC4 A;  3KEY A;  2VBQ A;  3C2H A;  2K3P A;  5FRO A;  4J01 A;  3S3O A;  2DXI A;  3FNC A;  2KMU A;  4LIV A;  4G6T B;  2AE6 A;  4L89 A;  5LD2 C;  4C7H A;  2B58 A;  1QHH D;  4ITV A;  2DCE A;  3S6G A;  1V5E A;  4II3 A;  4NC8 A;  4Y3O A;  4HNU A;  3MKZ A;  4ZDO A;  3SXN A;  3AFH A;  1IYK A;  4A33 A;  4E7K A;  3TCV A;  3LSI A;  4NC7 A;  3HC7 A;  1WFX A;  1WJE A;  3QYE A;  4BDY A;  4KVO E;  2FUG 2;  2M4G A;  3BC8 A;  4XL9 A;  2FIA A;  4KOX A;  4XKW A;  1PU9 A;  3IWG A;  4DGW B;  4QBJ A;  4CCN A;  2PR1 A;  3OR2 C;  2JLM A;  3W6X A;  3OOU A;  1BR2 A;  1YX5 A;  5HNF A;  4KOV A;  3QYB A;  4GRI A;  4RM3 A;  4HNX B;  3LL7 A;  3R9G A;  2WAF A;  3EUK L;  3D2P A;  4I49 A;  4UFX A;  3R1K A;  3PFY A;  2WBM A;  5F48 A;  5IV0 A;  4CCL A;  2RQQ A;  1V5G A;  3V8I A;  4CYQ A;  3DLA A;  2UV1 A;  3ONQ A;  3S8P A;  4U7B A;  2KP6 A;  3SEZ A;  4CCM A;  2W1O A;  2ZFU A;  3S3N A;  3TE4 A;  1GLN A;  1MW7 A;  1MJB A;  2B3V A;  5G20 A;  4C7I A;  4P1W A;  1X1A A;  5CQG A;  3LOD A;  3OIQ A;  4PSW A;  2CH0 A;  5HOO A;  3TO9 A;  4HST A;  3LFU A;  2P6E A;  2L5Q A;  1AA7 A;  5HLT A;  1LVK A;  2BSW A;  3I3L A;  1Z4R A;  2V26 A;  2Q04 A;  5E96 A;  1YX3 A;  2KDO A;  3BG6 A;  3E1S A;  2M4K A;  1CM0 A;  1YE9 A;  1S7F A;  1Y9W A;  1D1A A;  3DR8 A;  4UFW A;  4XNF A;  3TOB A;  3ZJ0 A;  1MJA A;  1QU3 A;  4LIT A;  2R7H A;  1Q2Y A;  2REF A;  3EY5 A;  4Q36 A;  3S6F A;  4A30 A;  2DOA A;  2V7F A;  2Q0Y A;  2HV2 A;  4C68 A;  3TFY A;  3SZG A;  1M1D A;  4OAD A;  3CMM A;  2RRE A;  1I12 A;  3MKY B;  1KUV A;  2X1D A;  4XLC A;  4U9Y A;  1TZL A;  5AGE A;  1WJ5 A;  3I9V 2;  2Z10 A;  3ZRG A;  4JQF A;  4CGM A;  3DU6 A;  3HPG A;  2BEI A;  3EC4 A;  1UG0 A;  4CUG A;  2CNT A;  5FRN A;  4KSF A;  3SXO A;  3OIP A;  2E1M C;  4FET A;  1QST A;  4UCM A;  3SHP A;  4F0X A;  5KTD A;  1Z9U A;  1D0Z A;  4MFJ A;  4HSR A;  4R79 A;  2IS4 A;  4BXF A;  4NUB A;  3L2W A;  2QIR A;  3W6S A;  4RLF A;  2P0W A;  1I21 A;  1J09 A;  2VZY A;  4DNC A;  2V6E A;  3VWB A;  4HEA 2;  2A4N A;  3OYH A;  2ZW7 A;  1NG7 A;  2DJI A;  2UWM A;  3S6K A;  4MFZ A;  2VKD A;  1BOB A;  2M3A A;  4B43 A;  4U9Z A;  5F47 A;  4MY0 A;  2H5M A;  3TOA A;  2CNM A;  3K10 A;  4CCJ A;  2YNE A;  2R7Q A;  1LKX A;  3CP8 A;  2ZSI B;  2CW7 A;  3IGR A;  1Z21 A;  4BJ5 C;  1J4J A;  3UR3 C;  3OYN A;  2LOO A;  2OB0 A;  4HKF A;  2IS6 A;  4YGO A;  1X1B A;  3G2B A;  4D9J A;  4XNH B;  3TO6 A;  4A95 A;  4RMN A;  4B13 A;  4CRZ B;  2JA2 A;  2WAD A;  4QVT A;  3OYF A;  1IRX A;  1Y7R A;  1P0H A;  2I8D A;  2O28 A;  3TO7 A;  4KIS A;  4B5P A;  1MND A;  4Y49 B;  2GE3 A;  1WK4 A;  5G21 A;  2IGN A;  4QC6 A;  2PSW A;  3T9Y A;  4E7S A;  3K4J A;  4CAV A;  4B10 A;  4MFP A;  2R8V A;  2WPW A;  4CAX A;  3CP2 A;  4BGD A;  4XMY A;  4IUS A;  1X1C A;  1G59 A;  3L2V A;  2DT7 B;  3H5R A;  3VWD A;  2FE7 A;  5FVJ A;  5AG4 A;  1UEL B;  4HNT A;  4XKB A;  3FBI B;  4QPQ A;  4D1Q A;  3RPU D;  2VLA A;  4KOY A;  4R3K A;  4AB7 A;  4A32 A;  4A2Z A;  4PJJ A;  4NQW B;  2KPM A;  3FB3 A;  2JVG A;  3H5A A;  4BQQ A;  4XM3 A;  5DWM A;  2L7K A;  1W36 D;  2PMZ A;  2K5C A;  3H9Q A;  4PK4 A;  1QSO A;  4XKC A;  2G3T A;  2IL4 A;  2WUU A;  2B5G A;  4XPD B;  3L2Q A;  3EUA A;  3FDY A;  3J7A Y;  3W2A A;  5CQE A;  2X6W A;  2X85 A;  2D4P A;  2J8N A;  2R1I A;  4R87 A;  1IIC A;  2K9M A;  5TGT A;  4E7L A;  2REE A;  3K4B A;  2Z2S B;  3RTR A;  2V9K A;  2Z11 A;  5HNH A;  1BO4 A;  1MMG A;  2LBF A;  4BS9 A;  3HPH A;  2VQH A;  2YNC A;  4NEX A;  1NE9 A;  3TBI A;  5HVQ C;  2LY2 A;  2LC2 A;  5KCM A;  2M7B A;  4M85 A;  1MMA A;  1YX0 A;  3NWS A;  4XPK A;  1TT0 A;  3ZCO A;  3LD2 A;  1YVK A;  4E7I A;  1RXT A;  4B48 A;  3DKX A;  4KOR A;  3CXQ A;  2VQL A;  2VJJ A;  4E8O A;  3S32 A;  5GCN A;  2ARH A;  1T95 A;  4AVA A;  3EPZ A;  4IZZ A;  4MY3 A;  1U0J A;  3BLY A;  3H9G A;  1WWZ A;  2PJR A;  4ZJZ A;  5H84 A;  2XSJ C;  2B3U A;  4B47 A;  4JJX A;  2WSA A;  1M44 A;  4UFV A;  1RO5 A;  2IGM A;  2X6Y A;  4ZC3 A;  4CAF A;  1Y6I A;  2WAE A;  1ZEL A;  4OAZ A;  2AQE A;  2CV0 A;  1DQU A;  3K9U A;  4KOT A;  4XN0 A;  2B4D B;  3CJR B;  4EAT A;  4LUA A;  3K70 D;  1LRZ A;  4CZC A;  3P2H A;  2LRD A;  2Q7B A;  4U5Y A;  2KRC A;  3K4N A;  4E7J A;  3QYF A;  3S93 A;  1S7L A;  2PQ8 A;  2R7T A;  3R9F A;  4CCO A;  3HXL A;  2HPI A;  2M0M A;  3DWL E;  3MMY B;  2FXF A;  4U87 A;  4KLW A;  2XF7 A;  2YNC C;  3D2M A;  4XPL A;  4X0G A;  4CS0 B;  2LYC A;  2OC6 A;  3N05 A;  1X4P A;  2W82 A;  4PFO A;  3SDB A;  4XON A;  2PC1 A;  2Q2E B;  4E4H A;  4ZYA A;  4NF1 A;  2MYS A;  3PJR A;  1OZP A;  1G8X A;  2XF5 A;  3LSG A;  4PJL A;  4CYO A;  4AVC A;  2KHM A;  4BL0 B;  4BDZ A;  2BUE A;  2Z3P A;  4RM2 A;  3PSF A;  3W2W A;  2LY1 A;  4F92 B;  2WAQ A;  3K4M A;  3OYI A;  2R7V A;  1OR7 C;  3R9E A;  2F6C A;  4DIQ A;  4MFK A;  2NOJ B;  2A6T A;  4UCP A;  3I9S A;  1FY7 A;  1VHS A;  3IUO A;  1V0C A;  4R3L A;  2LG4 A;  5A28 A;  3OY9 A;  2X7B A;  2LH9 A;  4P5O A;  3ZGK A;  3TL4 X;  3L2U A;  2FT0 A;  2Q4V A;  5HH1 A;  4XLA A;  3ZQQ A;  3LSK A;  3FBU A;  2VQY A;  2RNG A;  3PNY A;  3QOD A;  3OYB A;  3OWT A;  3FXT A;  3RYO A;  1QSN A;  1Z4E A;  4CAW A;  3W91 A;  1LDK B;  4CH7 A;  4KUA A;  1SFK A;  1N75 A;  2V1N A;  3KKW A;  1NSL A;  4AG9 A;  1MK4 A;  4NXY A;  3QB8 A;  4UA3 A;  4CGL A;  2X1E A;  4YEJ A;  4DJA A;  4MBU A;  4H89 A;  2WPX A;  1WJB A;  3D5S C;  2GIV A;  5BWA B;  3BJ8 A;  4BE1 A;  2A5W A;  3HKZ A;  4BJT A;  4KIT B;  4CYP A;  5CKT A;  3CXS A;  2W00 A;  1JI8 A;  2Z3K A;  2KCW A;  2OZH A;  1FMW A;  4BMH A;  2E60 A;  2EUI A;  2VPL A;  2Q44 A;  4XN3 A;  2JUG A;  4F0Y A;  1S3Z A;  2AQF A;  1Y9K A;  3PUB A;  2L9S A;  2P6G A;  4C9Y A;  1XIX A;  3DQV C;  4KVM E;  4HPQ A;  4RI1 A;  4R9M A;  2ZSH B;  4BE0 A;  3OYL A;  2LRE A;  3H0D A;  2HUZ A;  2KQR A;  4AU7 A;  2M7A A;  2OH1 A;  1Q2D A;  1YR0 A;  3KX2 A;  4B44 A;  2E5Z A;  2ELJ A;  1DGR M;  2YGW A;  3A1Y A;  3S3M A;  3HUG B;  2CV2 A;  4JD6 A;  3PNT A;  2BW3 B;  2IS1 A;  1BR1 A;  1S60 A;  4KLV A;  4YFJ A;  2QML A;  4KOW A;  2BVM A;  2K9L A;  3D3S A;  2MAB A;  3JVN A;  4KOU A;  2CNS A;  4R57 A;  3C26 A;  2B4B A;  1M4G A;  1ON0 A;  3U21 A;  3ZR8 X;  5KNL A;  2PR8 A;  3DSB A;  1P9Q C;  2FSR A;  3OYK A;  4AVB A;  1SAU A;  4FD4 A;  3BJ7 A;  4BJ6 C;  3S6H A;  1EA3 A;  4DBR A;  2R7R A;  2ZW5 A;  3B8G A;  3EXN A;  2X51 A;  4BQO A;  4B11 A;  5I0C A;  1L0C A;  2HZD A;  5IB0 A;  2VKH A;  1GHE A;  4FD6 A;  4QUS A;  2QKM B;  4NSQ A;  2UUZ A;  2V4J C;  1KZF A;  3QAH A;  3K4L A;  3C2G A;  3V42 A;  3VYT B;  3HOT A;  2JDD A;  4L8A A;  3BCB A;  2WY8 Q;  4CCK A;  4CSW A;  1WJD A;  3LSM A;  2ZXH A;  3AL0 C;  2HQY A;  2OZU A;  1T0F C;  3IU2 A;  5JQ4 A;  4MFQ A;  2O5R A;  2IGK A;  4Q38 A;  3WR7 A;  3OMY A;  3H5N A;  1R6R A;  3W3C A;  1D0X A;  2R4G A;  2VJI A;  4E7H A;  3GYA A;  2VXD A;  3D5R C;  3AKZ A;  1UAA A;  2GAN A;  4ONU A;  1KON A;  4UCN A;  4XKV A;  1MNE A;  3DTI A;  3F9K A;  1N77 A;  3OS2 A;  4Y4R A;  2R7W A;  1VKC A;  1YVO A;  2VEZ A;  3DDD A;  3QOE A;  5EC4 A;  2KLO A;  3H5Z A;  3P2F A;  4HNY B;  1I1D A;  2AJ6 A;  4KUB A;  2GOX B;  3ZXS A;  4KOS A;  3M1C A;  4RS2 A;  3LMM A;  2J8R A;  3H9J A;  4MHD A;  2OV7 A;  1Y56 A;  2L9N A;  3IP4 B;  1R57 A;  2OZG A;  5LFA A;  4AVZ A;  2XDV A;  1IYL A;  4ZDP A;  4IF5 A;  3MKW B;  3OYC A;  2CXA A;  4KJZ A;  4N4N B;  2FIW A;  1XMT A;  2D4O A;  5DWN A;  3RQ4 A;  2BW3 A;  1S7K A;  3OYE A;  2OU2 A;  3FYN A;  1ERD A;  4ZDL A;  4F3Q A;  2R7S A;  3DR6 A;  3FBN B;  3OS0 A;  2PJR B;  4CGO A;  3LSH A;  3IAS 2;  2ZW6 A;  2CS3 A;  4YRV A;  4EVY A;  2XAU A;  1MMN A;  1M4I A;  2NMT A;  2HVQ A;  3OR1 C;  4PV6 A;  5IX3 A;  1LFP A;  4J00 A;  2WA0 A;  4XOP A;  2Z1D A;  3L2R A;  2R7U A;  1SQH A;  2ZPA A;  3UNG C;  4F55 A;  4F91 B;  4II9 A;  4CA0 A;  3CXP A;  5KTC A;  4XOR A;  4BU2 A;  2MFZ A;  4HRI A;  2R7X A;  2EVN A;  4X5K A;  3IAM 2;  4XLE A;  3PP9 A;  4CGP A;  4H4K C;  3NWT A;  4ZGY B;  1X19 A;  3BCA A;  4BBH A;  2VJ5 A;  4F52 A;  1YRE A;  1XEB A;  2HU9 A;  5CPR B;  1M4D A;  2Y0M A;  4ZBG A;  2F5V A;  2PRB A;  5ISV A;  4DOZ A;  1IB1 E;  3CF2 A;  3FIX A;  2Y0S A;  3OYA A;  2QEC A;  4XLF A;  5F49 A;  3OYM A;  2F4I A;  2VXK A;  1UFH A;  4OWR B;  1KUX A;  4C2U A;  1CJW A;  3N7Z A;  4C2Y A;  2IS2 A;  2R7O A;  2VXZ A;  2E5N A;  4LG3 A;  3VYS B;  3DPL C;  4JOM A;  1QSM A;  4FD7 A;  2ZXV A;  1ZO0 A;  5AG6 A;  4QB9 A;  2B4D A;  4PJM A;  3GKR A;  2X1C A;  3R95 A;  2CUJ A;  3D5L A;  2WB1 A;  3UY5 A;  3KYL A;  2CW8 A;  2DT6 A;  3IWE A;  3K4K A;  2K5T A;  4KS9 A;  4XQF A;  3PNV A;  2JSP A;  3SYT A;  4BE2 A;  4IKF A;  2Q1Z B;  4NCZ A;  3MD2 A;  4MI4 A;  2L2O A;  2JVH A;  4II2 A;  2CV1 A;  2BL1 A;  4YRH A;  3TTH A;  2J8M A;  4E7Z A;  2Z16 A;  3H4Q A;  3W2V A;  2DXQ A;  3FRM A;  3FHN A;  3DPT A;  1MJ9 A;  3TMO A;  2XC7 A;  2HPM A;  3NE7 A;  3TT2 A;  3E0J B;  3GBG A;  2F5I A;  4CAE A;  4PJN A;  2VB6 A;  2I79 A;  3IU1 A;  3JTK A;  2WY7 Q;  5AG5 A;  4J3G A;  4JXQ A;  5HMN A;  3HG9 A;  3K4C A;  1DP3 A;  1DGW Y;  1QHG A;  2FCK A;  3DKY A;  3F0A A;  4CGN A;  1VZ0 A;  3A9L A;  4JWP A;  4B3X A;  4XLH A;  1QSR A;  2C27 A;  3DU5 A;  3PSI A;  4BEH B;  4RLQ A;  4AG7 A;  1U6M A;  2I00 A;  4JXR A;  3AL0 B;  1P4N A;  3SEQ A;  2BVL A;  2DPS A;  3EFA A;  4PK2 A;  2HVS A;  4LIU A;  2VIX A;  4BAC A;  4KZT A;  3RSN A;  2MD0 A;  5FRM A;  4UWI A;  2MC4 A;  1HA8 A;  5J8F A;  2CMP A;  4ZTJ A;  2BOL A;  3H35 A;  1X1D A;  2B5G B;  1K6Y A;  4K30 A;  2P6F A;  1XE4 A;  2OUM A;  4ZTF A;  3VDX A;  3MGD A;  4OLL A;  1B6B A;  1W36 C;  4AYB A;  4MLO A;  1NMT A;  5H86 A;  1BR4 A;  2IXS A;  3EO4 A;  4E6K G;  1V5F A;  2XF6 A;  2GOM A;  4BQN A;  1XF8 A;  3BLN A;  4OAE A;  1WJC A;  1PYV A;  2CUZ A;  3CZ6 A;  4CYN A;  4KT6 A;  1YGH A;  2QKL B;  4Y33 A;  4E2A A;  4FD5 A;  3F8K A;  4PUS A;  5AG7 A;  3G8W A;  1YK3 A;  5C82 A;  3GY9 A;  3OYD A;  1S5K A;  4DBQ A;  3HL2 A;  1D1C A;  1S7N A;  1D0Y A;  3OL4 A;  2VJ4 A;  2JDC A;  2ZW4 A;  4UWJ A;  3DPU A;  3A4C A;  3FKJ A;  3PGP A;  5JHF A;  4YEL A;  1TIQ A;  5CNP A;  3DEE A;  3T90 A;  2HVR A;  4OAY A;  2HQA A;  5JPH A;  3M8J A;  4IQ4 A;  4BEH A;  1IID A;  4B5P B;  4LX9 A;  3E0K A;  2CY2 A;  1X4O A;  1Z7L A;  1KUY A;  1K4J A;  4B12 A;  4B5O A;  4F6A A;  4HG2 A;  2ZXI A;  2FS5 A;  5G22 A;  2Z3O A;  4XOT A;  1N71 A;  4MFL A;  4XPD C;  4C2X A;  2HNH A;  2PDO A;  2VQG A;  4NNJ A;  1WJF A;  3HOS A;  4PK3 A;  1E0E A;  4PSX A;  4C2Z A;  1Q2C A;  4QPO A;  1PUA A;  3JUW A;  1S9H A;  1MMD A;  4BUP A;  2CFO A;  3CJQ B;  5A27 A;  4E0A A;  4C30 A;  1YLE A;  4PFP A;  4KVX A;  3CES A;  2X6X A;  5KTA A;  2IGO A;  4H6Z A;  4B14 A;  3RCO A;  2W7N A;  4F93 B;  2VAS A;  3D8P A;  4Y49 C;  2KZV A;  2KL4 A;  3DNS A;  3G3S A;  3OYG A;  4KSA A;  4UBR A;  4M3S A;  2Z3M A;  1N78 A;  2DPT A;  4GS4 A;  3I3G A;  2VQC A;  5G1Z A;  4ANJ A;  2VI7 A;  2VL8 A;  1FMV A;  4XNH C;  2FL4 A;  4ORF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...