4PSXA

Crystal structure of histone acetyltransferase complex
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
313
structure length
313
Chain Sequence
KPETWTSSANEALRVSIVGENAVQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDSVTFKPYVNVKYSAKLGDDNIVDVEKKLLSFLPKDDVIVRDEAKWVDCFAEERKTHNLSDVFEKVSEYSLNGEEFVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLLNKKTKELIGFVTTYKYWHYLGAKSFDEDIDKKFRAKISQFLIFPPYQNKGHGSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKLGYDAVFQKHSDLSDEFLESSRKSLKLEERQFNRLVEMLLLLNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hat2p recognizes the histone H3 tail to specify the acetylation of the newly synthesized H3/H4 heterodimer by the Hat1p/Hat2p complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Histone/transferase
molecule keywords Histone acetyltransferase type B catalytic subunit
total genus 98
structure length 313
sequence length 313
chains with identical sequence D
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2014-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4psxA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4psxA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 4psxA01
5F47A 1YR0A 4U9YA 4AVBA 1KUXA 3D3SA 3VWDA 3FYNA 2QIRA 1P0HA 4CRZB 2QMLA 2NMTA 3DSBA 3V8IA 1XF8A 1YGHA 3EO4A 4J3GA 4KLWA 4QUSA 3QB8A 3R96A 1FY7A 3DDDA 3E0KA 3TT2A 3S6KA 1YLEA 2VEZA 3N7ZA 1XMTA 1KZFA 3SXNA 4HNXB 1S7FA 5IV0A 2ZW5A 4EVYA 3R9EA 3TO6A 4NF1A 4JXRA 4HKFA 2FSRA 2B58A 1IIDA 1S7KA 4I49A 4L89A 1M44A 2H5MA 4KOVA 3R95A 2P6EA 2F5IA 2FIAA 4JD6A 2FL4A 4KOUA 4XPDB 2OH1A 4KVOE 2ZXVA 4KZTA 2R1IA 2VXKA 2P6GA 2EVNA 4FD6A 2WPWA 4KOSA 2VQYA 2JLMA 2OZHA 3PZJA 4AG9A 2ZW7A 1S7LA 5IB0A 4NSQA 2C27A 4L8AA 5JPHA 2B3UA 3G3SA 3B8GA 2Q4YA 2VBQA 3GYAA 4JLYA 2B4DB 1Q2DA 1S5KA 4Y49C 3S6FA 2J8NA 3TFYA 1RO5A 1V0CA 1QSOA 5H84A 2PDOA 5J8CA 1YVKA 1LRZA 5KTCA 3TTHA 2Z11A 1CM0A 5JQ4A 1YVOA 3TCVA 4PSWA 4UWIA 2Q0YA 2ARHA 3DNSA 2REEA 3FBUA 5KTDA 3R9FA 4B5OA 3WR7A 5KTAA 4F0YA 3ZZIA 3ZJ0A 1RXTA 4U5YA 3JVNA 2BUEA 2CY2A 1S7NA 1IYKA 4AVAA 3LODA 2JDDA 3GY9A 2G3AA 4KUAA 2HUZA 3FNCA 4XPLA 1BO4A 1UFHA 4R3KA 4QBJA 1I12A 1PUAA 1Y9WA 2EUIA 5C88A 1YK3A 4MJ8A 4AB7A 4E0AA 3D2PA 1IB1E 3TO9A 1XE4A 4B5PB 4FD7A 5DWNA 2GE3A 3F5BA 4LX9A 4KVXA 1XEBA 3OWCA 4E2AA 5I0CA 1IICA 5EC4A 1MK4A 4CAVA 2KCWA 4II9A 4CAWA 3G8WA 1CJWA 4ZBGA 3F0AA 2FT0A 4NXYA 2FIWA 1WK4A 2B4BA 1KUVA 2JDCA 1SQHA 2K5TA 3UY5A 5J8FA 2BL1A 3D2MA 1Q2YA 4PV6A 2HV2A 2G0BA 4RI1A 4IF5A 4CAXA 3BJ7A 1WWZA 4NEXA 1Z4RA 3TOAA 1QSMA 3DR6A 3I3GA 5F48A 5H86A 1Y7RA 1QSNA 3P2FA 3IGRA 1PU9A 5F46A 2Q4VA 4MHDA 1L0CA 4R9MA 2D4OA 2ZPAA 2REFA 2IL4A 3H4QA 2Q44A 2AJ6A 3FB3A 2CNTA 2ZW4A 3W91A 4PSXA 4OAEA 1QSTA 2OB0A 3VWEA 3S6GA 2B5GB 1M4IA 5HH1A 3S6HA 4KUBA 2D4PA 4GS4A 2VZZA 4AG7A 2BSWA 1MJ9A 4XNHB 1Y9KA 2PR8A 1B87A 3R1KA 2HQYA 2J8MA 4LUAA 4AVCA 2I00A 3SHPA 4XPKA 5E96A 1QSRA 4KOYA 4R57A 2ZW6A 5GCNA 4NCZA 3D8PA 1U6MA 4YFJA 4RS2A 2A4NA 1Z4EA 1YX0A 4U9ZA 1MJAA 4YRHA 3FIXA 3PGPA 4X5KA 3PP9A 2WPXA 4QB9A 4M3SA 4PK2A 3GKRA 1XIXA 2PRBA 3CXSA 5DWMA 3JUWA 3F8KA 5F49A 2FCKA 2DXQA 1J4JA 2OZUA 2PC1A 4PK3A 5FVJA 4MBUA 3QAHA 3TOBA 2Q04A 3T9YA 2P6FA 4JJXA 3P2HA 4UWJA 4IUSA 4JWPA 1GHEA 4ORFA 1K4JA 1NE9A 2FE7A 2R7HA 2P0WA 2Z0ZA 3W6SA 4KOWA 4H89A 5EBVA 4R3LA 2GIVA 3TE4A 4K30A 2OZGA 2Y0MA 3K9UA 5CNPA 2G3TA 3BLNA 4UA3A 2J8RA 4ONUA 4YGOA 2QECA 2Z10A 2B5GA 4B5PA 1I21A 1S3ZA 1M4DA 4KVME 3MGDA 3I9SA 2FXFA 3RYOA 4M85A 1NSLA 3R9GA 2R98A 1ON0A 2RC4A 4JXQA 4QC6A 2Q7BA 4MI4A 4BMHA 4UBRA 2FS5A 4MY0A 3LD2A 4H6UA 1I1DA 2BEIA 3T90A 3EFAA 1M4GA 4KOXA 2PQ8A 2GANA 1MJBA 4R87A 4OADA 1M1DA 1NMTA 4DNCA 1OZPA 1BOBA 4KLVA 1R57A 3FXTA 1P4NA 5HMNA 4XPDC 2R8VA 5ISVA 4XNHC 3C26A 2B4DA 2PSWA 4CRYB 3W6XA 4F6AA 1Z9UA 2I79A 2VZYA 2X7BA 2JEVA 1N71A 1IYLA 3BJ8A 3KKWA 2OU2A 3CXQA 5IX3A 4HNYB 3SXOA 4H6ZA 3TO7A 4CS0B 1KUYA 2B3VA 2CNSA 2CNMA 4MY3A 2ATRA 4KORA 4OLLA 3IWGA 4E8OA 4KOTA 1S60A 5C82A 1VKCA 4Y49B 3FRMA 3EY5A 2O28A 4FD4A 3EC4A 2PR1A 1VHSA 4FD5A 2VI7A 4HNWB 1TIQA 3DR8A 3EXNA 3NE7A 1YREA 1B6BA 2AE6A 4QVTA 3CXPA 1Q2CA
chains in the Genus database with same CATH superfamily
2JA7J 3JW4A 4LJZF 3V4GA 4G6QA 4GRIA 2LDUA 2WADA 3DPTA 1BI3A 4P4FA 1KUXA 3PNVA 3O8GA 1IJWC 3N05A 4EGZA 4QWQA 4FTHA 4Z65A 1KZHA 1JXSA 3FYNA 1QZEA 4CCOA 4HOBA 1JWQA 2ZBKA 1JHHA 2EV6A 1FBQA 2J5PA 2HDDA 2CFOA 4UHTA 4BXFA 5J1RA 4NQWB 1K4TA 4MGRA 4D5FA 3ZP5A 3J7YJ 1SVLA 2EA4A 1O57A 5FKNA 1GV2A 4JBAA 3JR9A 3BR3A 1XF8A 4ENKA 5BOXA 4IQJA 4ABZA 1MBFA 2PJ8A 4ZGYB 2V6EA 2BVLA 3R96A 2BGCA 4NUBA 5K5RA 3K4CA 4LQGA 2K9LA 3ZQHA 1SFEA 1N75A 2V79A 4NQWA 4I98B 4C2YA 2K27A 4YWYA 1XJOA 3PQJA 1XMTA 5D4RA 3HGGA 1B9NA 2HU9A 1RR8C 3DEUA 4XORA 5I4MA 2GM4A 2WB1N 5IV0A 3K6GA 1SC7A 1LPQA 5F0CA 2XEIA 1N25A 3MZHA 3HJEA 4PFPA 3TO6A 3CCEI 1A2ZA 4NF1A 1Y0RA 2JBJA 5LBQA 5J40A 4KN7X 2NRAC 3PFYA 1HSTA 2FSRA 1SAUA 5GTIC 4I49A 4L89A 5G1ZA 1VQMI 1J59A 2ZJRF 4I02A 7CPAA 2LR8A 3WC5A 5FKOA 2G9WA 5F08A 4BHPA 3NA6A 5IOYA 2MA3A 2KZVA 2F5IA 4HPSA 5BWAB 3JTKA 2WZNA 4Q5SF 2KHMA 1TWGJ 4IL6C 2IS2A 4KOUA 2DJIA 1K79A 1JTYA 5B5EC 1QQIA 2BZTA 1JI8A 4IAVA 5JGFA 1JQGA 1A6IA 2R1IA 3H8EA 3DBHB 4CCKA 2EVNA 1LJ9A 2EILH 1J0RA 2OCCH 2COBA 2JLMA 4EVIA 1LQ1A 4ZZLA 2XAHA 2KRHA 3QU6A 2QSGX 5C4XJ 3I3LA 4AG9A 2ZW7A 4EM1A 4X8IA 1J75A 3BQYA 5LLQA 2Z5UA 3IWEA 1CF7B 3C2BA 3FDYA 3P9CA 3D7FA 4NSQA 3H9QA 4A95A 4XLHA 1BIBA 4IRHA 4MQ9F 4JQFA 3K4MA 5L3DA 4U9YA 4U0VA 4FETA 2B9SA 2L5QA 1Q2DA 1S5KA 1R23A 3CZXA 3S6FA 2J8NA 3A03A 2XAGA 4XLEA 2W85A 1RO5A 3CMMA 3L09A 5B1BH 5BPIA 2RQQA 4HF2A 2DN0A 3KASA 2RNJA 3IH3A 5FJ8J 5KTCA 2B63J 1MMSA 3IRQA 2GU2A 3TTHA 2AFXA 2VT3A 3CUQB 2PJRA 3E5QA 2OA4A 2K9QA 1IN8A 1NHAA 3KP2A 2F6CA 3FXRA 4L5IA 1I50J 2ESHA 1YE9A 4DW6A 2ARHA 2Z1DA 4H0EA 3KP7A 3M3YJ 1TNTA 5KTAA 5KTDA 3OWTA 5F1JA 1FEXA 2P5LC 3ZPLA 4P6YA 4DYRA 5DM7F 5F27A 2CXAA 3RJPA 4A6EA 5AG7A 3L9FA 4ZTJA 3FISA 1FBUA 2E1MB 3WGGA 1B4AA 3GTJJ 4HDVA 1YI2I 1IYKA 4R87A 1OBRA 1X4OA 4E7JA 4AVAA 4EMSA 3GLLA 1CG2A 1P9QC 3SFIA 4DIQA 2LG4A 4AYBA 4PZJA 2XB5A 1VQOI 4I01A 5E1ZB 2K85A 3ZXSA 2NVTJ 3BI1A 4BS9A 1X1PA 2ZEFA 2R7ZJ 3LOCA 2KL4A 4IRIA 2V7FA 4RLFA 4ON0A 3I64A 4CA0A 1XG1A 1UFHA 4R3KA 2C6PA 1VIXA 1Z7UA 4JX4A 1PUAA 5D6FA 4A38A 4XRSA 2RNGA 1MGTA 1U0JA 4KSFA 5C88A 4LLLA 2NNYA 1HQCA 2DOFA 1YW8A 3KGQA 4AB7A 4A3LJ 1E2XA 3IH4A 5E3LA 4GDFA 4A3GJ 1EA3A 1GVDA 5IT9Z 1R5ID 2X4HA 1FOKA 3WGIA 1IDYA 5DWNA 1ENHA 3ZN1A 4D9JA 3P5JA 3I58A 1MW7A 2BE5F 4I6ZA 3D7GA 4X2TA 2LBFA 2DPDA 2NOJB 4EQQA 1TQMA 5JHFA 2GXAA 2YX7A 3CPAA 3OWCA 4ASNA 2KZGA 2F2EA 3M9AA 5DUKA 4RB1A 3PO2J 1VZ0A 4FE7A 4OAZA 4CAVA 1SEUA 1FTTA 3G8WA 3IL2A 3KE2A 1F9NA 2FT0A 4NXYA 2EB7A 2XPVA 1WK4A 1HCRA 4MFDA 2B4BA 2FIWA 2ZEHA 4C2ZA 2STWA 2XEJA 3KIOA 4I99C 2WY7Q 4E7HA 1A31A 3BY6A 3F23A 1W5CC 1WWXA 4ZYGA 1IC8A 5CVIA 2E36A 3I55I 1WJEA 1D3YA 4XOTA 4IHWA 1ON2A 2IS4A 2FUG2 4OC5A 3NARA 1N78A 1K6OA 3D66A 4CXFA 3CC7I 4IF5A 3AKZA 1HOMA 3S8PA 2O8KA 3IU1A 3VB2A 3TOAA 4XK4A 1YJ9I 1QSMA 3IP4B 1V4RA 4RAZA 2BO9A 3I3GA 5F48A 3BJOA 2VKVA 1DGWY 1P4AA 4ZJZA 3M07A 1BN5A 1FNOA 3P2FA 4PXEA 4HA8A 2PLYA 1MNDA 2LOOA 1TKHA 1XOVA 4AIJA 1IO2A 1GXQA 1RPWA 1X2NA 1SFXA 1S72I 1SANA 3FKJA 3FF3A 3R0AA 3E0JB 1ODDA 4CPAA 2X0LA 5D8KB 1T6SA 3H1CA 4B6ZA 4C7HA 3A0BC 3QPLA 1RKTA 1ZG8A 2TCTA 1G3YA 5D5VB 4UVBA 1SVOA 5HLIA 3FB3A 4RS8A 4Q38A 2CNTA 3WHBA 3LSIA 4B43A 1H9TA 1E0EA 3ZRGA 1ZGWA 4R7MA 1J09A 3SHFA 1MNMC 3RZOJ 4PSXA 4PPZA 4U7BA 4WWVA 1EJ9A 2W57A 2LREA 4WF2A 3S6GA 2YNEA 2A68F 4C30A 2B5GB 4Y17A 2VI6A 2R7SA 1M4IA 1Z8XA 2FX0A 4IRGA 4DZPA 4A39A 4KUBA 3NEUA 2D4PA 1HDPA 4PJNA 4GS4A 3I4PA 5EF6A 1CBXA 2DA6A 2BSWA 4XKWA 4HV5A 1S7EA 1BC7C 1P4WA 4XNHB 1D1CA 2BOLA 2XPWA 3IH2A 3BG9A 2VIXA 2J9AA 1B87A 4K2EA 3R1KA 3CCYA 2PRQA 1PUEE 2J8MA 3FH4A 3MEXA 1YX5A 4LUAA 2CQ7A 1B8IB 2EK8A 1LDKB 1R49A 5E96A 1QSRA 4XQFA 1XRYA 3IV5A 5K8MA 2FBIA 1QZZA 4HYEA 3PEIA 1OR7A 3HIFA 4NCZA 1ZRCA 3OR1C 1D0ZA 4YFJA 1LAPA 2ZMEA 2A4NA 4II3A 2EZKA 4U9ZA 4F52A 5GPCA 4YRHA 1BR4A 3WABA 3HHHA 4LB6B 4HAMA 3LQQA 1IG7A 2BBYA 4M72A 4M3SA 1FTZA 4CGMA 1TWHJ 4IOCF 3LA3A 1WSUA 3CXSA 1Z0XA 5DWMA 2KIFA 3WT4A 3MKWB 5DTDA 2RFHA 3F8KA 2F5VA 2NNNA 2OZUA 3NE8A 3ECOA 2PC1A 1U8BA 2NYXA 4OMEA 2BW3A 3FXMA 3TOBA 3FXQA 2P6FA 4KSAA 4PUSA 3P2HA 3E1SA 5K7FA 4IUSA 1GT0C 4PXDA 4JWPA 2R7DA 5KK1A 5JHUA 4L0YB 4AWXB 5M3MJ 1K4JA 4NGQA 2KP6A 3CLOA 1DGRM 1S3JA 2Y48A 3W6SA 2YPRA 1XTAA 4AVPA 3KYLA 2PCUA 2NVYJ 2P81A 2VOPA 4YU9A 3VODA 3H3VK 2M4KA 3DTIA 5HVGA 2ISYA 3V8JA 4KYWA 4HF0A 4MEYF 9ANTA 4CHUA 2EIMH 5FKMA 4A0ZA 3ZQGA 3TE4A 4PXCA 1S7AA 3M1CA 1S9HA 1AOYA 2CFXA 2P5KA 3DWLE 3SZTA 4UEZA 2EH3A 1WJBA 2OZGA 4MFPA 3KFWX 3OYFA 1NTCA 1XBUA 3GZ6A 4UIAA 3CCSI 2LSOA 5GAGJ 2EV0A 3I54A 3IJ3A 3F21A 2Z3KA 3IIBA 1VQ5I 5LYIA 2QA4I 1HLVA 5FB2A 2E60A 3CCVI 3SJEA 4A37A 4DYCA 2J8RA 1QPIA 4YGOA 5E17F 1M4LA 4MCRA 2DCEA 2CG4A 4CZZA 2CW7A 3SXYA 4S04A 1SVMA 3C18A 1JUSA 1T08B 4KIGA 4KITB 3HBLA 1O7FA 1T39A 1D5YA 1I21A 1MMGA 2LF8A 4GCVA 1S3ZA 1BIAA 4IHYA 3OS0A 1FSEA 5B3SH 1IOIA 4W97A 3TW6A 1RI7A 3EUHA 2JK3A 5THWA 2AQFA 2LBFB 4N9HA 3L2NA 4LD5A 2ELJA 4ZZDA 1WKMA 5IP9J 3H36A 1BLLE 2DT6A 2JUGA 1ON0A 1TT0A 2H1LA 5EG0A 2MYSA 3OYCA 1HDQA 3F3XA 2X6OA 4JXQA 2LKXA 1ERDA 3BC8A 4BMHA 1I27A 3ZMVA 4B1RA 1CQTA 1VHOA 4H6UA 5CYVA 1TZLA 3RPUD 3EFAA 4LK1F 3S1QJ 2XKOA 2IPQX 4NC7A 2OR4A 1VQPI 2E1MC 2PQ8A 1SMYF 2P5VA 3ZQIA 1B59A 4EEFG 2XSDC 2E2IJ 3WU2C 3D0SA 1M1DA 4DNCA 1NMTA 2VQCA 3VOEA 3ML6A 3K1MA 1P7IA 3QP5A 4LQ6A 3BHXA 1JGGA 4UV9A 1R57A 3DKYA 3K4LA 1OJLA 3FXTA 1TXRA 1RUOA 4J01A 1P4NA 3HHGA 1ZG5A 3PIOF 3CUOA 4JX6A 3JRDA 4B14A 4Q47A 2L9SA 1ZLJA 1XMKA 1T95A 2JVHA 3VYTB 1D1BA 3DLAA 3HOSA 5DD4A 2ELHA 2BEOA 3B6CA 2KISA 3K1NA 3S15J 5D29A 2XAQA 4M3FA 1T56A 3CO7C 3K69A 1Z9CA 5E20A 3MN8A 4F6AA 4RBOA 4P44A 4Z2YA 1XSXA 1JHFA 2JRMA 1BJAA 2QWWA 3HLPA 1FYLA 2QCOA 2VBZA 4FCYA 1LOKA 1FT7A 5CVRA 1Q7LA 1OCRH 2QJ8A 3J7AO 1KONA 3BCBA 4IHSA 3HOVJ 5E3MA 3KKWA 1IRZA 3C2HA 1EE3P 3CXQA 3ZMZA 4G7OF 3IAM2 4GM5A 4H6ZA 2W00A 2DA7A 3TO7A 3OSGA 2K3FA 2E71A 2M0MA 1IRGA 2PE3A 3LSPA 4B4CA 1WJDA 2OTLI 1CPSA 2QQ8A 2WV0A 2UWMA 2B3VA 4M73A 2VONA 2VL8A 3JTHA 4XN3A 3S32A 4DYOA 2DBBA 3CTAA 5A27A 2XROA 1UZCA 4N9IA 3L2UA 1XS9A 1JJ6C 4E8OA 4YRVA 3TKYA 1G3TA 2NYQA 4O5VA 1TQIA 4CH7A 4KFCA 4NGTA 2CUFA 2R3SA 2O28A 4OC3A 3KL9A 3NWSA 3GEZA 3HKZN 4FD4A 3GLXA 1IRFA 2EWNA 3WC7A 2VXDA 2GXBA 3KLOA 1KU2A 3BI0A 2I10A 1QO0D 1YQAA 3QRFF 1TF8A 4UUSB 1IV6A 2Y9YA 3FMQA 4H4KC 2OBPA 4CYCB 3G4SI 1FSHA 2F7VA 3FZVA 2F4IA 4BXUA 3DFGA 1J7KA 3TL4X 1VQ6I 1ETVA 2EO8A 3I4NJ 1MMDA 1IV8A 4F55A 4OU0A 1AMPA 4L9JA 4BNCA 2VI7A 1WH7A 1QU3A 3H3ZA 3BR0A 2PBIA 4G12A 1B6BA 1YREA 1RUNA 2LK2A 4DZJA 3S16J 1FC3A 1O3SA 2M5WA 3KPHA 4E7LA 2QSFX 1H8LA 2ID3A 2DU9A 1AKHA 1ETKA 3G2BA 1UG0A 3C7JA 3HSEA 3BJAA 3OYIA 4GFBA 1IY7A 2Z2SB 1TF9A 3WTZA 2HVQA 3FK6A 3I4MJ 3RPUA 1UELB 3D3SA 5LYLA 3H0DA 1MSFC 3CUQA 3T1BA 2QIRA 1YTYA 1P0HA 2XGEA 2QYOA 3IC1A 2CTBA 4P10A 3MN2A 2GBYA 3E6CC 1ZYRF 3G3ZA 4PGHA 1USSA 1VI0A 4CRZB 1GHCA 3EYYA 3CCRI 1XGOA 2QQ9A 1ZRDA 1USTA 2IVMA 5BNGA 5J4VA 1YGHA 3V8IA 1ZGJA 3S2WA 3HRTA 3GF2A 3EO4A 6CPAA 4KLWA 3HPHA 4NGSA 1G3SA 2FA5A 4HLXA 3LNQA 1FY7A 3CDLA 4A30A 4MO7A 1B9MA 3NFZA 3TT2A 5E1WA 1VQKI 1YLEA 1ARLA 2VEZA 3N7ZA 2QVPA 4JOMA 2EPFA 1KZFA 1ETXA 2L3DA 4C3HJ 5DM6F 3JRAA 2CV1A 3R9EA 2LC2A 1NK3P 2RKHA 2Z3YA 4V2GA 3GZ5A 2BVMA 3FF5A 1MSEC 4UY8I 4JXRA 4G1PA 5H6RA 2XB0X 1IN5A 2DFHA 3VYUB 1FBSA 3ZGKA 2JSCA 3DP7A 5J4YA 3CMYA 1S7KA 2B58A 4AXVA 5K1YA 1SFOJ 3TQNA 1VQ7I 6PAXA 4NJQA 3MKLA 4NGRA 1WRJA 3OSFA 2H5MA 2DQRA 1F2OA 3GYHX 1X3UA 2P6EA 2BY0A 3DU6A 2DMTA 1EH7A 2DA5A 4A6DA 3DQVC 2IXSA 3HRMA 1WJAA 2HOTA 2H8WA 2RGVA 4KMUX 3OIOA 1LAMA 3CF2A 4FWUA 2ZXVA 4A2UA 1S29A 4KZTA 3GW2A 3H5AA 2P6GA 3DTKA 5K7HA 1A35A 5CVJA 3RKYA 3FIWA 2R5ZB 2VJ4A 3L7WA 2HPMA 2OZHA 1KA8A 1G3WA 5H2FC 3HM5A 3PZJA 4KT6A 5ICEA 5CPAA 4RAFA 4BXXJ 2P6SA 3CC4I 3BDDA 3CLQA 1ZREA 4UCPA 5JM6A 4L8AA 3B3SA 3FXKA 3HC7A 4P1WA 5F6FA 5KAIC 2HI3A 4BAYA 3K70D 3GYAA 2PMZN 4Y49C 1MBHA 3ZQFA 4A3MJ 3WG7H 2TRTA 2HC9A 2HGCA 3TFYA 3VYRB 5EEAA 1QSOA 3MD2A 1LB2A 1U5TB 1BL0A 1RR7A 4U87A 2JWTA 5J8CA 4AU7A 1TT5B 1LRZA 3PB7X 1ETQA 2GOXB 1Y1WJ 3TCVA 4ZY0A 2BXZA 1BI2A 2MC4A 4KT5C 3QPTA 1IUYA 2Q0YA 3IEHA 3HOTA 1BI0A 1RTQA 1OR7C 3D5RC 5IT3A 5KHDA 2W1OA 4BYYA 3IUOA 5IP6A 3RNZA 5D5XB 3R9FA 3HOYJ 1WPKA 3CJQB 1X10A 1HDDC 1RXTA 2PJ3A 4C2UA 2VKDA 5FKKA 2CY2A 5K5OA 4DBQA 4YG2F 1V5EA 1Y0UA 2D5VA 4HQEA 2R7VA 2DMUA 4MFEA 2R7OA 5HLTA 3KR4A 3LODA 4UCNA 1ZRFA 2QQBA 4KUAA 2DODA 2HUZA 2OF7A 4XPLA 3QYFA 2LP0A 4EJVA 3L00A 3KYDB 2C6CA 3FMSA 3TEDA 4QBJA 1IN4A 2ZEOA 1WJ5A 4MIMA 4EMEA 1I6XA 4E6KG 1Z67A 1XD7A 3CPXA 3ELKA 5GAHJ 3BZKA 2E1CA 2M87A 4ENNA 5DDGA 1IB1E 3AG2H 5CQGA 2ZEEA 5J1QA 2HQ5A 1R00A 5C44J 4RAYA 2JN6A 2POKA 4XICA 4B5PB 1X3WB 2NS0A 4FD7A 3TP0A 4G94A 3FM3A 2GE3A 3HGYA 3S3NA 1QMUA 2CUJA 2VT2A 5GPAA 3ZMUA 4A3FJ 3M4OJ 3ZQ7A 1WQ2A 2R7QA 3IU2A 3BG6A 3BT9A 5I0CA 1R5GA 3VEPA 5EC4A 4AIKA 2W25A 1MK4A 2KCWA 2V1DA 8CPAA 2KJCA 4CYOA 3OL4A 3NAUA 2IGOA 5AG6A 3LSMA 2XSJC 3BP8A 3J7AY 3FMCA 2Z16A 3UY5A 4W9YA 2RREA 5J8FA 1UCRA 2LRDA 2A5WA 3DKXA 1QQ9A 4HQMA 2O03A 5AIQA 4XLFA 2CMPA 3IC7A 4FBEA 4AUXA 4L5JA 3FBIB 4B44A 1KU3A 3GMEA 3F22A 2G0BA 3C1DA 5DS9A 4CAXA 3BJ7A 3AAFA 4ZH4F 1X1AA 2AS5F 3E97A 2Z3PA 2EV5A 4A33A 1UG2A 2E35A 2A61A 1W0TA 3CJNA 2MG4A 1L3LA 5H86A 2BW3B 4II2A 3LFUA 3GTOJ 4XONA 2QENA 2DA1A 3DCFA 2KIUA 2RV8A 4HX7A 2D1HA 2MGQA 1LDDA 2IJLA 4BE1A 4YFKF 2PG4A 2WAQN 2RB7A 4D1QA 3QOPA 3ULQB 4R9MA 3KP6A 3BXMA 2D4OA 1DU6A 2REFA 4A3CJ 4ENMA 2K7LA 3IFEA 3O6BB 2IL4A 2B0LA 3Q0WA 4HX8A 4EV0A 4CDGA 1XSDA 3H4QA 2AJ6A 2M2EA 3ASOH 2ZXIA 3H9JA 2CW0F 5ICFA 4C2XA 2ZW4A 2YSRA 2WYRA 1QPMA 4AC0A 4RMNA 3LMSA 4IVNA 2XGCA 2HXIA 2MBFA 3LWFA 4OAEA 1QSTA 4OIRF 2ZXHA 3MZYA 5CLSA 4BY1J 2DDAA 4IZZA 1VFCA 1Z3XA 2HOAA 3FBNB 5H6QA 5EGOB 1VGYA 5HXDA 5CVVA 4P4JA 4MHZA 1R1VA 1D0YA 5DD8A 5HH1A 1Z5RA 3M8FA 3S6HA 1TBXA 4B12A 5LYDA 3K10A 3ZMDA 1ZHFA 1Z77A 1HEEA 4F8ZA 2VZZA 2LMDA 4AG7A 3LFKA 3F6VA 1XGNA 2AFWA 4FT8A 2ZJ2A 4PGGA 4UB8C 5IY5H 3H5NA 3EDPA 5EGOA 4UEEA 3KEQA 3LMMA 5E8GA 3D4UA 4B11A 4CGPA 2IGKA 5M3FJ 4C2TA 4D0PA 4M6YA 2HKXA 2JA5J 4OWRB 1YW4A 2K9MA 2Q1ZB 2HQYA 2KIMA 4R79A 4XKVA 5ICCA 4UXNA 1LE8A 2IT0A 1LANA 3SHPA 2H6BA 2VBXA 2GANA 3SDBA 3OYJA 1AU7A 5E18F 3OS1A 4ZDLA 5ILVA 5GTHC 2YNCC 4R57A 4C9YA 3BROA 4Q36A 4I0BA 1Z91A 5LEJA 3WGHA 2Y75A 3D8PA 3E6MA 4CGOA 4FHTA 1F1ZA 2XPUA 1Z4EA 5JLXA 3PIPF 1YX3A 3RQIA 2XEFA 3TX8A 3FIXA 1EF4A 3PP9A 2WPXA 1BW5A 3ISPA 4WWCA 1IGBA 3ABTA 1JKPC 1OYIA 2RQPA 4UVCA 4A69C 3JRIA 2R7TA 1G8XA 5ELYA 5F49A 2Y2ZA 3ONQA 3F8FA 4XMYA 2H6CA 5FVJA 2MSYA 4MBUA 4EATA 3QAHA 1XC5A 4F91B 2L9NA 1RIOH 2VXZA 2ZOGA 3L2QA 3ASNH 3HRUA 4O6JA 3GVAA 3W2VA 5HNFA 5BQTA 2Q4ZA 4DJLA 4BBRJ 2Y69H 4G9YA 2HR3A 1K61A 1XDSA 2H94A 4RAGA 4QSHA 4KNYA 2Z0ZA 4NFRA 3PFIA 2R7HA 3JTGA 3U2RA 3MKZA 1KQ9A 1BR1A 3FWEA 2QGUA 4KOWA 3BZCA 4H89A 1ZLHA 2VN2A 4P4IA 4XKCA 2XC7A 2PJBA 4HPQA 1NG7A 4DJAA 1O3RA 3TP3A 2TDXA 2GIVA 3F8BA 2JQ7A 3HUVA 3ZMTA 5CPRB 1ZN2A 4XBFA 5IYDJ 4ZYHA 5HVQC 3PJRA 4D7MA 4G7ZF 3K9UA 2XGDA 3VH9A 4BKXA 4RB3C 3CMAI 1R22A 3S3MA 2QF7A 4LLNA 4YELA 3RZAA 2QZ8A 3BLNA 1ZO0A 2W82A 2XHKA 2KPMA 1R36A 2PJ7A 5FLXZ 1W5TA 1B8IA 2QECA 5ICGA 2WWYA 3RYPA 2QKMB 2Z10A 1E17A 3UKGA 4OC0A 3E6DA 1TC3C 1IF1A 4IEJA 2CYYA 3K2AA 4KN4X 3B02A 2UXXA 4KVME 5B66C 2R92J 3SI1A 4XM3A 2DPSA 3RPQA 5LFAA 2PJ9A 3I9SA 2HZTA 2LD5A 3PB4X 4A3KJ 2FXFA 2V4JC 3I53A 4IO9F 1NSLA 1POGA 5LGUA 1K83J 5M5YJ 2K4JA 2H27A 1BAVA 5G22A 4M3EA 1MKMA 1UHMA 2VL1A 1ETWA 5A2QK 4PK4A 1ZG3A 1SMTA 1DTDA 5LHIA 4FISA 4NC6A 3K4NA 2ZC2A 4MI4A 3GTPJ 1FLIA 2Q0OA 1Z1DA 4XNFA 2AO9A 3ABLH 1JT6A 1OPCA 4HG2A 4QPOA 1HF0A 1I1DA 4MY0A 1FIAA 1Z6RA 4HDUA 2GFQA 4D5CA 4I2OA 4IKFA 1LDJA 3FEEA 4JJXA 3NRVA 1GLNA 2HDCA 3GTGJ 3ABMH 3GTQJ 2IQ6A 4MHGA 1ZLIA 1G2HA 2FEZA 3BTCA 3ERED 4CYPA 1BOBA 4CZCA 4KLVA 3K2KA 1SD5A 3EPZA 1QRYA 5F1RA 2JVGA 4CO8A 3OYBA 4Y4RA 2KDOA 1IRXA 2GLFA 2R8VA 2JPCA 3IKVA 3ZMSA 4C3JJ 5JLWA 2DTZA 2OB0A 2ZCWA 2HVSA 1XX5A 4XNHC 1ORKA 3CCLI 3W2WA 1F4KA 3C26A 2P6TA 2L0KA 1FJLA 4M3BA 3WTUC 3W6XA 3LAJA 1I1GA 5F0HA 2I79A 3ERMA 3FECA 2ADUA 1LCPA 2EZHA 3O3KA 1N71A 2V8VA 2VASA 3ROUA 3D7HA 2DPTA 2G9DA 3T8TA 2PJ5A 2DXIA 5L3BA 2M1BA 2VE8A 4BU2A 3ZQLA 1FYMA 1PCAA 2ZB9A 1ZLKA 3SXOA 4CS0B 2L02A 2YUSA 5IYBJ 4BH9A 2VBWA 2W7NA 3K70C 2EFQA 2HYGD 5LHGA 1FOXA 1W36C 1UWYA 4RN7A 3TGNA 2O5RA 2ZSIB 1DQUA 2CNMA 2IBDA 2BY2A 5DV5A 3RQ4A 1R71A 2ATRA 2FOKA 3OV8A 1WJFA 3IWGA 5DCMB 4NHJA 3M8EA 1EH8A 4MTEA 1S60A 4LB5A 2IMOA 3VPRA 4DQ2A 3FEDA 3SZGA 1WVRA 3B7IA 1HC8A 1R7JA 5AONA 2I3CA 2K02A 1HW5A 4MFLA 1QGPA 4A3DJ 3EC4A 2K9NA 1ON1A 4PJLA 3GTKJ 2CIJA 4RM2A 1X4PA 2DW4A 1DUXC 1W1WE 5DCMA 1UHSA 1ZQ3P 2R5ZA 4ZX8A 4E70A 4BE2A 4F9UA 1A5JA 3RI4A 5LEKA 3BG7A 5E3OA 3SJFA 2HQNA 1VHSA 3WU0A 1TWCJ 1V5FA 1Z8LA 4HNWB 3S3OA 3DR8A 3DPLC 4K3NA 4QVTA 3G1OA 3FXUA 2ZNZA 1Z2LA 3CXPA 4R6TA 3SJXA 2ZSHB 4UF4A 1D8KA 4I76A 3SEZA 1K7AA 4DUKA 3N5FA 1AHDP 3LAPA 5F04A 4LK0F 1JT0A 4A12A 3A02A 4RGUA 3OYAA 4EM2A 2JUCA 2JA2A 4DBRA 1WZ2A 4XLPF 2DMPA 4LGWA 3VWDA 2EA2A 3E3VA 3JCUC 2ID6A 3I56I 4C7IA 3DKWA 3MCZA 4UNOA 3DEWA 1W7PD 5J1YA 2FD5A 1T8IA 3BCAA 2AFOA 5JH9A 3WTSC 2NMTA 1TWFJ 2F4OB 4C2MJ 2L7ZA 5FGMA 3RIRA 1D8JA 3JRUA 2KIQA 2YGWA 2F5CA 4JYKA 3WC6A 2X9DA 2QVOA 3DTEA 4OMYA 5K8NA 2ZOFA 4MCPA 2DT7B 4GXOA 4WK8F 3V42A 2OQRA 1REPC 4J3GA 5FFZA 3GFIA 2N8GA 3R6SA 1YHQI 2F5EA 3E7LA 4UV8A 1I1SA 3CCUI 5FD6A 4BE0A 1X1CA 4KJZA 1HDUA 5K7ZA 3DDDA 1HKSA 1I5ZA 2V6CA 5EJCA 2ZENA 1R3NA 4IXAA 2CQKA 2LLKA 1OCCH 2LNBA 3VFZA 3MWMA 2R7XA 1SD7A 4KUMA 2VB6A 2O6GE 1H9GA 1YS7A 1Z7LA 3L2RA 2JZYA 5DUIA 2HFHA 3WE3A 3SXNA 5LYFA 2DPUA 2STTA 1BA5A 4LFUA 3B3TA 2ZW5A 4LIVA 5AGEA 5LGNA 1JKOC 1HXDA 1W36D 4EVYA 1S5LC 4I0AA 2HOEA 4MMOA 5J6XA 5E8IA 2ABZA 4UFXA 1YO5C 1AYEA 3CP8A 4F92B 2IA1A 1DU0A 3F6OA 4Z6YA 4G8XA 4HKFA 4ETSA 5D8NA 1R58A 1NH3A 1IIDA 4F9VA 2DDBA 3C3WA 3I5UA 2Z9OA 3D2PA 4MCSA 1L0OC 2BY3A 4UVAA 2L7MP 1SFUA 3GTLJ 4HBLA 4OMZA 3KEYA 5HODA 4BEHB 3WODF 3A01A 2PI0A 1DE4C 1M44A 3ZQQA 1Q1VA 4R8HA 5K5QA 3R95A 3HUGA 2FIAA 1YS6A 3KHXA 2MLKA 3CJRB 3AG4H 1RKWA 3FHNA 2M8GX 3T5XA 2RDPA 3HOXJ 1VQLI 4ZDOA 4XPDB 2OH1A 4HLYA 4ZYAA 4FAIA 4AVZA 1MMAA 2AFSA 2VXKA 5GP9A 4CCMA 2NXNB 2FBKA 4FD6A 4EJWA 3MAJA 2ZEGA 2W24A 4KOSA 4J19A 2MC3A 3W6VA 1YMEA 1XGMA 4QTRA 4IPAA 4DGWB 3CCJI 1QHHD 2LY9A 4AIDA 4A94A 3OL3A 2HVRA 2C27A 2B3UA 2R5YA 3HOWJ 4A2ZA 2Q4YA 3CCQI 1FZPB 4F3QA 4IHTA 1R1UA 2QQAA 2VQGA 3R4KA 2B4DB 4JLYA 1SD4A 2C6GA 4R1HA 1E3OC 2X1CA 1K78B 3W3CA 2XEGA 3I71A 1U6GA 2XASA 2FRHA 2IGNA 1DPRA 1LE8B 1V0CA 3I9V2 3JSPA 1PDNC 1DPUA 2KT0A 3GB0A 5H84A 1QVTA 2PDOA 3VWBA 1KU9A 2IAIA 1YJNI 3Q3SA 1CM0A 5JQ4A 4PSWA 1K78A 3L1PA 5ED4A 4F93B 5HS8A 1W7PA 3SJMA 2REEA 2XF5A 5L3GA 1G59A 1U78A 5HLGA 4U0WA 2QSHX 3H3UA 3WR7A 4F0YA 1ZKGA 3DXJF 2NVQJ 2CU7A 3ZJ0A 2VPLA 2RN7A 3EUHC 1X3ZB 2YNDA 3JVNA 1F2PA 2BUEA 4X3RA 1S7NA 4OP4A 2MD5A 1O7LA 5LRKA 2FMYA 2V1XA 3WTVC 4XL9A 3REOA 3BG3A 5JVGF 1DDNA 3PL8A 2RVCA 3LSJA 2JDDA 1Y7EA 3DLJA 5DEQA 3OYGA 3D1NI 3KZYA 1IOFA 4JZ0A 3GFJA 1ETOA 2OAZA 4NGNA 1ZAOA 1Y9WA 1TTYA 3TW7A 2P7CB 2D2WA 5CKTA 4ZTFA 2EUIA 2CS3A 2OQGA 2HKOA 3LSHA 2I8DA 3VARA 4N4NB 2O7OA 4TV7A 2FVGA 2OTJI 3TO9A 4EGYA 3NH5A 3HEFA 4OIOF 1GXPA 4Y52J 3KCCA 1OCZH 4YIFA 2O4HA 1JTXA 4ITVA 3QQAA 2ZEMA 3F5BA 1ACIA 2V9PA 3QOEA 3JREA 3U9GA 4KVXA 1GVJA 3M8JA 1XEBA 1Y8RB 4E2AA 1TKJA 3WTXC 1UFMA 1WJCA 5KAFC 1OCTC 2UXNA 3CUQC 3TDZC 4CCJA 4CYCA 1HA8A 1IICA 2PJ0A 5F09A 4CAWA 4II9A 2EK5A 2CGPA 1CJWA 4ZBGA 3F0AA 2WAFA 1Z3YA 3SZPA 1TNSA 3KQZA 2L7KA 3ABUA 3TMOA 1KUVA 1SQHA 2K5TA 2ICWG 4IHVA 1U5TA 1JUMA 2CQNA 2FSWA 4KIBA 5CQEA 1LFPA 1XDUA 4JP0A 3LQRA 2HNHA 3GCMA 4B48A 4M71A 4AD9A 3IO1A 1Q2YA 2CTCA 1X58A 2E2JJ 4R8FA 4PV6A 4UIBA 2QM3A 1R4MB 2LFBA 3Q0VA 4RI1A 4G6DA 2ZNYA 1BR2A 1YIOA 5FRNA 1PP7U 1I3QJ 5A2QZ 1Z4RA 4NEXA 2EIJH 3NH4A 3PFEA 5IP7J 4RDUA 2OCEA 2ETHA 3RKQA 3DR6A 4UEFA 1Y7RA 1IU8A 5EZGA 2BXYA 2O0YA 3DU5A 4A31A 2DEAA 3BWGA 4MNUA 4XIDA 1PU9A 3R0JA 5F46A 4BHBA 3DGVA 2Q4VA 5HVFA 5HNHA 1PP8F 4O23A 3X2QH 5H20A 1IUFA 1L0CA 3GTMJ 1K6YA 4OAYA 2PEXA 5D8LB 1PYTB 2BY1A 4ZX9A 4IQ4A 2ACJA 1C0WA 3HTUA 2ZPAA 1TQPA 3HKZA 1LKXA 4E7SA 3JRBA 1CPXA 4B3AA 2WSAA 2DA2A 1TWAJ 1ZARA 1BOAA 3W91A 1XPXA 3F9KA 4UCMA 4WX9A 2OUMA 1APLC 5AG4A 2G0EA 3KEOA 3DF8A 1QZYA 2MH2A 2PN6A 1OLTA 1MDMA 1LFBA 3OR2C 3VWEA 2LVSA 4WXDA 4L18B 1NK2P 4M9ZA 2KQRA 1DP7P 4LIUA 3FHZA 2ZJQF 4KDPA 1PVEA 3PB9X 4A0XA 2P7VB 4LMYA 2PMHA 4PFOA 3CMEI 4FX4A 3A1YA 4BQNA 1U8RA 4PJMA 3TBIA 4ZC3A 1T98A 2BCOA 5HS7A 3V38A 4A5MA 1D1AA 4W1UA 1MJ9A 1Y56A 4NC8A 5HLHA 4DYQA 4FUUA 2O9LA 2DFFA 1R43A 1Y9KA 2KKOA 4BEHA 2K40A 3A01B 2IS6A 4HNTA 2XF7A 3BZ6A 3S1MJ 3EUAA 2GZWA 2PR8A 3U21A 5B1AH 3WHCA 5C4JJ 3S2HJ 3TC8A 2PX9A 1BBYA 2GLJA 4GO1A 2L4AA 4WJBA 2W4SA 2PJ6A 2B7EA 2HS5A 2PJ1A 2E19A 2FQ3A 2WB1A 2XDVA 1MBKA 2AHQA 4XPKA 2MD0A 1TW3A 2JRTA 1LFUP 2WAEA 5HOOA 4M9SA 5HDGA 5GCNA 4RM3A 4YEJA 2WV1A 3QNVA 4P9UA 4CCLA 4MHNA 4YFNF 3HXLA 5HDNA 1U6MA 2V9KA 3HRSA 4MEXF 2HB6A 1BPNA 2R5YB 1CX8A 2JA6J 4ENJA 1JUPA 1KQ0A 2EZIA 3H5RA 5FRMA 2V8HA 2NOGA 4X5KA 2MLGA 4P45A 2DOEA 3CO6C 3RKXA 2XV4S 4PK2A 3GKRA 4KSIA 2Y0SA 5K8PA 4J00A 3QAYA 3JUWA 4HEA2 2VUMJ 4HX4A 3QYBA 2FCKA 2AFZA 4PK3A 2H8RA 2Z3LA 5KVRA 2HEOA 2Q04A 3T9YA 3CC2I 2ANPA 2X85A 4PQAA 2KFDA 5GADJ 1GHEA 4MRIA 4P9FA 1H0MA 2FE7A 3B3WA 4BQQA 3F8NA 2OPTA 2Y31A 1PJRA 4P4EA 2UV1A 4U0YA 4BBHA 4EFDA 2EFOA 4G7HF 4B10A 5C3EJ 1XMXA 1I39A 2BHZA 2HTJA 3DEEA 3WTWC 5BS6A 4CCNA 2DA3A 3Q5FA 3OY9A 2GXGA 1IZ1A 3KZZA 5A28A 4GGGA 2XF6A 1J5YA 3NH8A 1IW7F 2XVCA 5TGTA 1KYWA 3PBBA 2YU3A 2A05A 3K4JA 4L5EA 4PDKA 4QPQA 3OOUA 5EZHA 3B6AA 5CNPA 3S93A 4NGMA 2XUBA 2G3TA 4F0XA 4M3DA 4BL0B 1Y39A 3RO0A 3HTSB 3DBLB 2D45A 4L9TA 2NVUB 1V55H 2L4MA 2NS8A 3BG5A 2VPRA 2ISZA 1F57A 1XSVA 4ONUA 2AFUA 2B5GA 3JAMZ 3V7CA 1KYZA 4B5PA 2M7AA 4E0AA 2DK5A 4CICA 3EETA 2EINH 2G7UA 4FASD 4XLCA 4IHMA 1M4DA 3MGDA 1YRNA 4OC2A 2XRNA 3O2PE 3CZ6A 2AXTC 2C6YA 3SYTA 2Z3NA 4M85A 1BW6A 3R9GA 4PJ0C 3BTJA 2R98A 4CGNA 4M74A 2JBKA 2X51A 3AL0B 2ECCA 5D4SA 1PUFA 2RC4A 3CP2A 4QC6A 2Q7BA 5HVHA 2CH0A 3WG9A 5KNLA 2BYVE 5CVUA 3D7DA 2FS5A 4Y13A 3LD2A 1UJ8A 2Q2EB 4PJJA 1JKQC 2BEIA 1OQYA 2H1KA 2VKHA 4CAFA 4HSTA 3RYRA 1HW1A 2HTSA 2EFWA 1MJBA 2MFZA 1YQEA 4V19K 4AIHA 2Y9ZA 2PIYA 4U88A 5JR3A 3FVLA 2BHYA 2J5OA 2PMUA 4BGDA 1OZPA 2F4MB 1WI3A 2H09A 3AFHA 3HYIA 3H9GA 1XGSA 2KMUA 5HMNA 2UUZA 4FE4A 2E5NA 5JI6A 3COAC 2LY1A 3WTTC 2ELKA 3M1EA 3RDIA 5CJ9A 3OS2A 5ISVA 1X2MA 1QBJA 2M7BA 4PCQA 2PJPA 3H35A 1XB4A 2B4DA 1KWMA 2PSWA 4CRYB 5LRSA 2V9VA 3OMYA 1KGSA 3JRCA 4I7HA 1Z9UA 4FX0A 3D68A 3PB8X 3S9LA 4TNUA 2IJZA 4XN0A 3PM1A 2Q51A 1WI9A 3PNTA 4X0GA 2JEVA 4NGPA 3UNGC 4MCQA 1U5TC 1IYLA 3BJ8A 2FF4A 3W2AA 2O3FA 1YITI 4UB6C 2NSMA 1VTNC 3V7RA 2ZXJA 4RGRA 5FKLA 2XRLA 2EQRA 4OIWA 1SAXA 2PJ4A 3HDDA 1FX7A 3LACA 2EFPA 4B13A 3W6KB 3ABKH 1O3TA 2A07F 3HG9A 2CNSA 3PFOA 2ZEPA 4MY3A 3AL0C 1U9OA 2E1NA 1ARMA 3MQ0A 4MHYA 1QVUA 4XKBA 2OZ6A 2NAZA 2PJ2A 4OLLA 2L9RA 4KOTA 3F8MA 2COMA 2DTRA 2V8DA 5C82A 3G1MA 3QP6A 1EH6A 2QLZA 4CSWA 3EY5A 4XSXF 2M0CA 2QKLB 2YX4A 5GAEJ 2FXAA 2CW8A 5FO5A 1Z8WA 4XRFA 4BDZA 1TW2A 1YW6A 1U9NA 2PIZA 3FXLA 1J9IA 3S9MA 5EDNA 2K86A 1YLFA 2PR1A 1R1TA 4IHXA 2GIZA 3OYDA 3E5XA 1XMAA 2VJJA 1X1BA 2HZDA 4S05A 1H88C 4RB2C 4LLGF 3S17J 1CP7A 4GYGA 4XRMA 4FD5A 3B3CA 1S8NA 2AFMA 4M6HA 1T2KA 4ZDPA 3JAMK 3EXNA 1MIJA 3NE7A 2O61A 3PSIA 3K4BA 3F8CA 3BJ6A 3FXOA 4IJAA 5TISC 3IRRA 3CCMI 1D5VA 2KLOA 1M1EB 1IDZA 2X6XA 4C68A 3KZIC 3PQKA 5EG0B 1TKFA 1YR0A 3BLYA 1CGPA 2CRGA 2F48A 2LYCA 3RTRA 4ZY2A 4ANJA 3N97A 1G4DA 4BUPA 3DV8A 3A2KA 3S14J 2DMQA 1EV7A 4BQOA 2X48A 2A6HF 1R5HA 1CF7A 4NB5A 2DYSH 3PRTA 4EJTA 1IXCA 2ZFWA 3M7GA 1AUGA 3CF5F 3A9LA 3JRHA 1GYTA 3RBUA 2QMLA 3H5ZA 4MLOA 2HDWA 3DSBA 1FMVA 1GV5A 2OD5A 2P8TA 2JTVA 1ZELA 3OYNA 3SJGA 1JGSA 1UAAA 3Q0UA 3GUDA 3HB9A 1WH5A 5EEGA 1OMIA 3CT9A 3JRFA 1MBGA 4QUSA 3QB8A 4ZYDA 2YS9A 1VF9A 2HPIA 2WA0A 1D0XA 4M6XA 5KCMA 3KZWA 3FX3A 3QWLA 5ERIA 2Z3MA 5L3EA 3V7SA 1FPQA 3E0KA 4N0BA 1X1DA 4E7ZA 3S6KA 2JJ7A 5G21A 3P9IA 2EWBA 1MH4A 4ESJA 2Q8KA 1R6RA 5D5WB 4HV6A 1F43A 1STZA 1TL8A 1VHEA 4HNXB 2HWVA 1S7FA 2FQ4A 2LKSA 1Z05A 1MBJA 3BR2A 2X1EA 2ZEDA 5K8OA 4MFQA 4JK1X 3VDXA 2ESNA 1OYYA 2LY2A 4M9XA 4ZY1A 4M3GA 1V54H 5LRRA 4HF1A 4BY7J 4XR6A 2VJ5A 4HRIA 4WXHA 3KYCB 4UUVA 4AYBN 1LEBA 2FBHA 4WXCA 3OYMA 1HBXG 2GAUA 4EM0B 4KOVA 2HQRA 4CYDA 3PUFA 2JSPA 1RRJA 3ZQCA 4IF4A 2EJRA 4JD6A 2FL4A 1VQNI 4UUTA 3U1DA 4WCGA 3OYEA 1RC9A 3IHUA 3GWZA 2M30A 3CQZJ 3QPHA 3SQNA 4KVOE 4MHPA 5J1UA 1VQ4I 3OOPA 2CO5A 3CESA 3B3VA 2WPWA 2P4WA 1FOYA 1WCMJ 1ONVA 1RNLA 2W84A 2R7RA 1F5TA 4F7ZA 2VQYA 3B2YA 2VKEA 4RGXA 4RLQA 1S7LA 3E6BA 4L9NA 5IB0A 5E1XA 3SEQA 2ODFA 2VODA 1RESA 1S6LA 3CDHA 1FWZA 1PUFB 1ELMP 5JPHA 3G3SA 3B8GA 4Q7AA 2VBQA 4OIPF 4E7IA 2V8GA 3H8GA 2GOMA 2MABA 1E3HA 4Y33A 1MMNA 2FJ1A 3FM5A 4X1EA 2CJJA 3ECHA 2CSOA 1U2WA 3DLLF 1NSAA 2VC1A 2QUFA 2I5UA 2L01A 3C2GA 2WC2A 3G71I 4FQGA 1YVKA 1Z8TA 3H0GJ 3FMRA 3KI9A 1B72B 2Z11A 5E3NA 3HPGA 1YVOA 2CUEA 1V3FA 2YU9J 2MH9A 2R7FA 3A0HC 2KDZA 4UWIA 2BV6A 3LSKA 2IP2A 2EIKH 5HDKA 4IX7A 2VLAA 1JKRC 4CGLA 3AG3H 1MZBA 3DNSA 3FBUA 3BTIA 1O4XA 3J81Z 3BR5A 4B5OA 5G20A 2ECBA 2WY8Q 3G73A 4GYIA 4LG3A 2DA4A 3KETA 4OIQF 3ZZIA 5TJJA 4U5YA 3R61A 2E2HJ 4MFJA 5F0FA 5L3CA 3KP4A 1W7PB 2BOAA 2WAQA 3OIPA 3BOQA 1OYWA 2DMNA 3KR5A 1ULYA 3VSKA 2OJED 5BPDA 3KHZA 4Y3OA 3I0TA 1WFXA 2WTEA 3OYKA 2Y0SN 1P4XA 3JRGA 1I6HJ 1MDMB 3GY9A 5F64A 1OCPA 1QHGA 3VYSB 2G3AA 4R76A 2XGXA 1Z6TA 4B47A 1FIPA 3OYLA 3FNCA 4NJRA 2DQLA 1BC8C 1XMBA 4A3IJ 2XAUA 2F5DA 1BO4A 2Q43A 1I12A 4PXBA 4OKOA 4MFKA 2DO7A 2DFEA 1FP2A 2QEXI 1A36A 2D1VA 2L7FP 1YK3A 4MJ8A 4LITA 2CV0A 2DFIA 2M3AA 4M6IA 3LA7A 2DJNA 2ME6A 3D5LA 1ITYA 1R9TJ 2MW8A 4A5NA 2UZKA 3RSNA 4AM3A 2V1UA 2DLLA 1Z21A 5BMZA 4NBQA 1XE4A 4KIFA 1YG2A 1MBEA 1LEAA 1YYVA 2DI3A 4LX9A 2FU4A 4BJTA 2XKPA 4YFXF 5EMIA 3D67A 1SD6A 4NNJA 3N4MA 2IEKA 5IB9A 1BI1A 3K1PA 4A3EJ 1ZG1A 3FJUA 2CF4A 4NDLA 1HW2A 2R93J 2CWEA 1YJWI 3K2ZA 1W4MA 3ESWB 1A04A 3J80K 2PJAA 1FOWA 4IOAF 1WHUA 2DT5A 2JDCA 2PMZA 2Z33A 3PSFA 5D5UB 4RGSA 3KQXA 5JVTA 5AG5A 2Z99A 3G1LA 1IGNA 2BL1A 2VQHA 3D2MA 3DBRB 4A0YA 3MKYB 4D7NA 1T38A 1FP1D 2HXOA 2GA2A 2HQAA 4UFWA 4RUHA 2HV2A 5JFRA 1KQ8A 4GXHA 1RETA 3OIQA 1T0FA 4LOCA 1WWZA 2CUZA 1H8AC 3V7ZA 1BM9A 2QBYB 3OYHA 1IXSB 3LSGA 2YR2A 3GO5A 3KP5A 4X6AJ 2XAFA 3CJTB 3ZOBA 1B6AA 4JYWA 3ZN0A 4JX5A 4ZI6A 1QSNA 4BBSJ 3IGRA 1EKEA 2AQEA 5IPAA 1IAWA 5F47A 4CYQA 2R7WA 2ZMEB 3RCOA 1UMQA 4P4BA 2LTPA 4N4OB 5E79C 2EZLA 4LG0A 4MHDA 4ONWA 4BHCA 1YIJI 1TP4A 4V2FA 1E3PA 1UB9A 4HW0A 2YNCA 2PFBA 3GX4X 1PYVA 1ZK8A 1MNEA 4E4HA 3S2DJ 3QYEA 1P7JA 2RAEA 2Q44A 2DF5A 1Y1VJ 4Y7NJ 3GZNB 4P96A 2HYFA 3PO3J 2Q7SA 1NG6A 1FT9A 4LG0B 2Z3OA 2ME0A 2VE9A 2W48A 5LHHA 4Q48A 1R4NB 2E34A 1P2FA 4Y15A 4RB0A 2O8XA 4A3JJ 2G7HA 3NWTA 2XAJA 1S7OA 3J81K 4E7KA 2GWRA 3LSTA 3V8KA 3MRUA 4XRSG 1AA7A 5FFXA 1N77A 3HZJA 3HL2A 5FLMJ 4OIDA 1H89C 2L54A 2EK9A 3FX6A 2K9SA 3ISZA 1V5GA 2FMLA 3BR6A 3T0YA 1YOVB 2R0QC 2Y30A 3VATA 4BACA 1J2XA 3HOUJ 1RZ4A 3LA2A 5FD5A 3R60A 5LRJA 3H8FA 1Y0NA 2L9VA 4QLCU 4BD9A 4BJ5C 4XOPA 1SFKA 2K4BA 3FXJA 3K0LA 2HOSA 3S1NJ 2PVVA 3I59A 4H2KA 4KISA 3WTYC 1IN6A 3EQLF 4AVCA 2I00A 4HNUA 4B8XA 1P6RA 4KOYA 4Q4ZF 2M9HA 2A5YB 2K3PA 1O3QA 2ZW6A 2WBMA 1T33A 3IAS2 4KICA 5DCFA 3BR1A 3EUKL 2XIGA 3WU1B 4CYNA 1QNTA 2ZELA 2OC6A 5FROA 4A32A 2JA8J 1IXRC 1AKHB 1B1BA 4RS2A 4OC1A 3T8WA 3P9KA 1MD0A 3U1KA 4L9VA 1YX0A 1MJAA 2KRCA 3RZDJ 2F8HA 2F5FA 2X1DA 4C3IJ 3JSOA 1DP3A 3PGPA 4IK2A 2K5CA 3H92A 1ZTRA 2GQQA 3MZ8A 4HSRA 2VJIA 4P5OA 5ILSA 5LGTA 1JE8A 4DOZA 1Y0YA 3IWZA 2IW5A 4QB9A 1XIXA 1BJZA 2GA1A 3PNYA 1OKRA 3UR3C 4EJUA 5J47A 2PRBA 1W0UA 3CDXA 4EJOA 3QPSA 2IA0A 3J7ZI 3G6EI 2A3SA 2JMWA 1J4JA 2DXQA 4UFVA 3GFLA 2V77A 3B73A 3CDIA 1XN7A 4OOIA 1IN7A 5HS9A 2CQQA 1TLHB 1OFCX 1P92A 4UWJA 3KP3A 5M5XJ 1X12A 3SDGA 2DK8A 2M4GA 3FKIJ 2JT1A 4B09A 5L3FA 5DS0A 2V26A 1KU7A 1W5SA 4O3MA 1NE9A 4ORFA 2P0WA 1YW9A 3HSFA 4YIIA 4HZFA 4BJ6C 2NVXJ 2A6EF 2ZO4A 5EBVA 3GIUA 2LH9A 1ZR2A 4KS9A 4R3LA 4ESFA 3BPVA 4AVBA 3RAMA 4BINA 3LWUA 3F0CA 3GLJA 2JEWA 3WE2A 4K30A 4P4DA 5EEHA 3L2VA 2M8EA 4MFZA 5J3LA 2M34A 4KMFA 2Y0MA 2JPBA 1YSJA 1HKTA 4OINF 2VOOA 2FNAA 4OC4A 2L2OA 1LNWA 2LKPA 4MQVA 1VNDA 2IRFG 4UA3A 3O8HA 3Q9VA 2EBIA 1QA6A 5FLXK 5M5WJ 1FYKA 1LVKA 1YW7A 2O53A 2WUUA 1ZR4A 4XLAA 5IOZA 5TRDA 3K7AJ 1UHWA 3RYOA 3Q9SA 3W6JB 1FNNA 1U3EM 3PBEA 2IA2A 4P55A 4BDYA 1G6NA 3VSLA 1XCBA 3FK7A 1GDTA 3PUBA 1XCVA 1LVAA 1Y8QB 5AIPA 5ILUA 3L2CA 1JJ8C 4UBRA 4S0HB 2ZJPF 4TWEA 3T90A 4UUSA 2LF7A 1M4GA 2HYJA 4KOXA 3BQZA 3E5UA 1X19A 3DPUA 3KX2A 2OV7A 2QYVA 4I09A 2E7WA 4OADA 1AWCA 5CBMA 3J80Z 3SI2A 1OCOH 1ZG7A 2Q2EA 3PB6X 2PJRB 3MFKA 1ZH5A 1FMWA 4A93J 1Y6IA 3QODA 3F72A 1WGXA 2QBYA 2EBJA 1F36A 1ZG9A 2A6TA 1K4SA 4XPDC 3AG1H 3RKWA 4ESBA 4G6TB 3KLNA 2PJCA 3A4CA 2GREA 4M6GA 2NS7A 3S9NA 4L0ZB 3GBGA 3HOZJ 3TDUC 2M45A 2GLOA 4EWTA 4HNVA 1XFOA 3K4KA 4M6VA 3V8LA 2VZYA 3IKTA 3D5SC 2X7BA 4CGZA 1LFWA 1Q1HA 2E1OA 2OOTA 2OU2A 1YLOA 1B72A 2CV2A 2ZKZA 3GFMA 4RA2A 2A69F 2E7XA 5D6EA 2DOAA 3HSRA 4BQAA 2C1CA 4HNYB 5IX3A 2EFNA 4XLNF 3ZCOA 5IT9K 2VBYA 3MMYB 1KUYA 1VQ9I 1T0FC 3QU3A 2DYRH 2ZXWH 1LUJB 2IGMA 4CUGA 1BPMA 3HUGB 4KORA 1ZGAA 1YRNB 1MH3A 2V1NA 3GXOA 3P7NA 3IWWA 2FNPA 5DYMA 1VKCA 1GUUA 1ETYA 4ZYEA 3FRMA 1A6QA 3GUXA 3NQOA 1HKQA 2R4GA 4MTDA 4Y49B 5LRGA 4ZYQA 5EYRA 4MXUA 3MVPA 4YIRX 3CD6I 3ZR8X 4KA4A 1ELLP 3L2WA 4XSZF 4A3BJ 2IS1A 2PVWA 1OISA 2ZMEC 5IYCJ 3B35A 3I1UA 1CP6A 3BPXA 4CAEA 2KRFA 1VQ8I 4QIWN 2FE3A 3ISXA 2DAOA 2E5ZA 3LL7A 3K9TA 2X6YA 2FOWA 3T8RA 2CQXA 4U7DA 3SFZA 3BTLA 3I59B 1YFHA 5FLVA 2AXLA 5LD2C 2X6WA 3S1RJ 2ZFUA 3LSRA 1TIQA 2KJBA 4B3XA 2R7UA 3IWFA 2VQLA 2AE6A 1HSJA 1I3AA 3EYIA 1Q2CA 3SI0A 2VC0A
chains in the Genus database with same CATH topology
2X6XA 4C68A 4GRIA 4H6UA 3G2BA 2WADA 1UG0A 3DPTA 3OYIA 3BLYA 1YR0A 4U9YA 5F47A 2Z2SB 4AVBA 2HVQA 2LYCA 3PNVA 3OYAA 1KUXA 3RTRA 1UELB 4ANJA 2JA2A 4DBRA 4BUPA 3A2KA 3D3SA 3N05A 3VWDA 4BQOA 3H0DA 3FYNA 4CCOA 2QIRA 4C7IA 1P0HA 3A9LA 2CFOA 4CRZB 4BXFA 4MBUA 2QMLA 3BCAA 3H5ZA 4MLOA 2NMTA 2HDWA 4NQWB 3DSBA 1FMVA 2YGWA 3OYNA 1ZELA 3V8IA 3DTEA 1UAAA 1XF8A 1YGHA 4IQJA 2DT7B 3EO4A 3V42A 4J3GA 4KLWA 3HPHA 4QUSA 4ZGYB 3QB8A 2V6EA 2BVLA 3R96A 2HPIA 2WA0A 4NUBA 1D0XA 5KCMA 1FY7A 3K4CA 4BE0A 2Z3MA 4A30A 1X1CA 2K9LA 4KJZA 3DDDA 3E0KA 3TT2A 1N75A 1X1DA 4E7ZA 3S6KA 4C2YA 1YLEA 2VEZA 3N7ZA 5G21A 1XMTA 2R7XA 4JOMA 2HU9A 2VB6A 3L2RA 1R6RA 1Z7LA 4XORA 1KZFA 3SXNA 4HNXB 1S7FA 5IV0A 3K6GA 2CV1A 2ZW5A 4LIVA 5AGEA 4EVYA 3R9EA 2LC2A 1W36D 2X1EA 4MFQA 4PFPA 2BVMA 3TO6A 4UFXA 3VDXA 4NF1A 2LY2A 3CP8A 4F92B 4JXRA 3VYUB 4HKFA 3ZGKA 3PFYA 4XR6A 2VJ5A 4HRIA 2B58A 1IIDA 1S7KA 2FSRA 1SAUA 4I49A 4L89A 5G1ZA 3OYMA 3KEYA 4BEHB 1M44A 2H5MA 4KOVA 3ZQQA 2JSPA 3R95A 2P6EA 2KZVA 2F5IA 2FIAA 5BWAB 3DU6A 3CJRB 3JTKA 4JD6A 2FL4A 3FHNA 2KHMA 2IXSA 3DQVC 1WJAA 3OYEA 2IS2A 4KOUA 2DJIA 4ZDOA 4XPDB 3CF2A 2OH1A 4KVOE 4ZYAA 1JI8A 2ZXVA 4AVZA 1MMAA 4KZTA 2R1IA 2VXKA 3CESA 3H5AA 4CCMA 2P6GA 4CCKA 2EVNA 3DTKA 4FD6A 2WPWA 4KOSA 2VQYA 2R7RA 2JLMA 2VJ4A 2HPMA 2OZHA 3PZJA 2KRHA 4KT6A 3I3LA 4AG9A 2ZW7A 4RLQA 4DGWB 1S7LA 3IWEA 1QHHD 5IB0A 3SEQA 3FDYA 4NSQA 3OL3A 4UCPA 3H9QA 2HVRA 4XLHA 2C27A 4L8AA 4A95A 5JPHA 2B3UA 4A2ZA 3G3SA 3HC7A 3K4MA 4JQFA 4P1WA 3K70D 4FETA 4F3QA 2Q4YA 2VBQA 2VQGA 4E7IA 3GYAA 2L5QA 2B4DB 4JLYA 2GOMA 2MABA 1Q2DA 1S5KA 4Y49C 2X1CA 4Y33A 3W3CA 3S6FA 1MMNA 2J8NA 3TFYA 2IGNA 4XLEA 1RO5A 3CMMA 3VYRB 3I9V2 1QSOA 3MD2A 1V0CA 3B8GA 2RQQA 5H84A 4U87A 2PDOA 4AU7A 3VWBA 1LRZA 3C2GA 1YVKA 5J8CA 5KTCA 3TTHA 2Z11A 1CM0A 2PJRA 5JQ4A 3HPGA 1YVOA 2GOXB 3TCVA 2F6CA 2MC4A 3LSKA 4PSWA 2Q0YA 4UWIA 3HOTA 4IX7A 2VLAA 4F93B 1OR7C 1YE9A 3D5RC 2ARHA 4CGLA 5KHDA 2REEA 2W1OA 2XF5A 3IUOA 2Z1DA 1G59A 3DNSA 3FBUA 5KTDA 3R9FA 4B5OA 3WR7A 3OWTA 5G20A 2WY8Q 3ZZIA 3CJQB 4LG3A 4F0YA 3TOBA 3ZJ0A 2VPLA 1RXTA 3EUHC 4U5YA 2CXAA 4C2UA 2YNDA 3JVNA 4MFJA 2BUEA 2VKDA 4ZTJA 5AG7A 2CY2A 2E1MB 1S7NA 4DBQA 1IYKA 4KUAA 2WAQA 3OIPA 1V5EA 1X4OA 4E7JA 4AVAA 3VSKA 1P9QC 4XL9A 4Y3OA 2R7VA 4DIQA 1WFXA 2LG4A 2R7OA 4AYBA 5HLTA 3OYKA 3PL8A 3LODA 2JDDA 4UCNA 3GY9A 3ZXSA 1QHGA 3VYSB 4BS9A 3OYGA 2G3AA 4B47A 2HUZA 2KL4A 3OYLA 3FNCA 2V7FA 3QYFA 4RLFA 4XPLA 4CA0A 2XAUA 1BO4A 1UFHA 4R3KA 4QBJA 1I12A 1WJ5A 1PUAA 1Y9WA 4MFKA 4E6KG 5CKTA 4ZTFA 2RNGA 2EUIA 2CS3A 1U0JA 4KSFA 5C88A 1YK3A 3LSHA 4MJ8A 2I8DA 4LITA 4N4NB 2CV0A 2M3AA 4AB7A 4E0AA 3D2PA 3D5LA 1IB1E 5CQGA 3RSNA 3TO9A 1EA3A 1Z21A 1XE4A 4B5PB 4FD7A 5DWNA 2GE3A 4ITVA 4D9JA 3S3NA 2CUJA 1MW7A 3F5BA 4LX9A 4BJTA 4KVXA 2LBFA 3QOEA 2NOJB 3M8JA 4NNJA 1XEBA 5JHFA 3OWCA 2R7QA 3IU2A 3BG6A 4E2AA 5I0CA 1WJCA 1IICA 1VZ0A 4OAZA 4CCJA 1MK4A 1HA8A 5EC4A 2KCWA 4CAVA 4II9A 4CAWA 3G8WA 4CYOA 1CJWA 4ZBGA 3OL4A 3F0AA 2WAFA 1Z3YA 2FT0A 2FIWA 1WK4A 2B4BA 4NXYA 2IGOA 5AG6A 4C2ZA 2L7KA 1KUVA 3TMOA 3LSMA 2XSJC 1SQHA 2JDCA 2PMZA 3J7AY 2K5TA 2Z16A 3PSFA 3UY5A 2RREA 2WY7Q 3DKXA 2LRDA 1LFPA 2A5WA 5CQEA 4E7HA 2BL1A 5AG5A 2VQHA 3D2MA 4XLFA 2CMPA 2HNHA 4B48A 3MKYB 1WJEA 1Q2YA 3FBIB 4B44A 4XOTA 2HQAA 2IS4A 4PV6A 2FUG2 4UFWA 2HV2A 1N78A 2G0BA 4RI1A 1BR2A 5FRNA 4IF5A 4CAXA 3AKZA 3BJ7A 3OIQA 1WWZA 3S8PA 4NEXA 1X1AA 2CUZA 1Z4RA 3IU1A 2Z3PA 3OYHA 3TOAA 3LSGA 1QSMA 4A33A 3IP4B 3DR6A 3I3GA 5F48A 5H86A 1Y7RA 2BW3B 1DGWY 4ZJZA 1QSNA 3P2FA 5KTAA 3IGRA 2AQEA 4II2A 3LFUA 4XONA 3DU5A 4A31A 4CYQA 2R7WA 1MNDA 2LOOA 3RCOA 1PU9A 4N4OB 5F46A 4BE1A 2Q4VA 5HNHA 4MHDA 1L0CA 1K6YA 3FKJA 4OAYA 4D1QA 3E0JB 2YNCA 4R9MA 4IQ4A 1PYVA 2D4OA 1MNEA 4E4HA 2REFA 2ZPAA 3HKZA 1LKXA 4E7SA 4C7HA 3QYEA 2IL4A 3H4QA 4Q38A 2Q44A 2WSAA 2AJ6A 3FB3A 2CNTA 1E0EA 3LSIA 4B43A 1NG6A 2ZXIA 3H9JA 4C2XA 2ZW4A 3W91A 3ZRGA 2Z3OA 1J09A 3F9KA 4UCMA 4RMNA 2OUMA 4PSXA 5AG4A 4OAEA 1QSTA 3NWTA 1OLTA 2ZXHA 4E7KA 2OB0A 3OR2C 4U7BA 4IZZA 1Z3XA 3VWEA 2LREA 3FBNB 3S6GA 2YNEA 1AA7A 4C30A 2B5GB 2KQRA 4LIUA 1N77A 1D0YA 3HL2A 2R7SA 1M4IA 5HH1A 3S6HA 4PFOA 4KUBA 4B12A 2D4PA 3K10A 3A1YA 4PJNA 4BQNA 4GS4A 1V5GA 4PJMA 3TBIA 4ZC3A 4BACA 2VZZA 1D1AA 4AG7A 2BSWA 4XKWA 1Y56A 4NC8A 1MJ9A 4XNHB 1Y9KA 4BJ5C 1D1CA 4XOPA 4BEHA 2BOLA 3H5NA 4HNTA 2XF7A 2IS6A 4CGPA 3LMMA 2PR8A 3EUAA 4B11A 2VIXA 1SFKA 3U21A 2IGKA 4C2TA 1B87A 4OWRB 3R1KA 4KISA 2W4SA 2K9MA 2Q1ZB 2HQYA 4R79A 4XKVA 2WB1A 2XDVA 2J8MA 1YX5A 2I00A 4LUAA 3SHPA 4XPKA 4HNUA 4AVCA 1LDKB 3SDBA 2MD0A 3OYJA 5E96A 1QSRA 4XQFA 3OS1A 4KOYA 4ZDLA 2K3PA 4R57A 2YNCC 2WAEA 2WBMA 5HOOA 4C9YA 2ZW6A 5GCNA 3IAS2 4RM3A 4Q36A 4YEJA 3EUKL 4CCLA 4NCZA 4CYNA 3HXLA 3OR1C 3D8PA 1D0ZA 2OC6A 1U6MA 5FROA 4A32A 4YFJA 2V9KA 4CGOA 4RS2A 2A4NA 4II3A 1Z4EA 1YX0A 4U9ZA 1YX3A 2KRCA 4F52A 1MJAA 4YRHA 1BR4A 5J8FA 3FIXA 2X1DA 5FRMA 3H5RA 1DP3A 3PGPA 4X5KA 2K5CA 3PP9A 2WPXA 4HSRA 4P5OA 2VJIA 4QB9A 4DOZA 4M3SA 4PK2A 3GKRA 4CGMA 1XIXA 2Y0SA 3PNYA 4J00A 3UR3C 2PRBA 3CXSA 2R7TA 5DWMA 1G8XA 3JUWA 4HEA2 3MKWB 3F8KA 3QYBA 2F5VA 5F49A 2FCKA 2DXQA 3ONQA 4XMYA 1J4JA 2OZUA 2PC1A 4PK3A 4UFVA 5FVJA 2BW3A 4EATA 4F91B 2Z3LA 3QAHA 2L9NA 2Q04A 2VXZA 2P6FA 3L2QA 5HNFA 4JJXA 4KSAA 3T9YA 3W2VA 2X85A 4PUSA 3P2HA 3E1SA 4UWJA 4IUSA 4JWPA 2M4GA 2V26A 1GHEA 1K4JA 1NE9A 2Z0ZA 2FE7A 2R7HA 2P0WA 4ORFA 2KP6A 4BQQA 1DGRM 3MKZA 1BR1A 4BJ6C 3W6SA 3KYLA 1PJRA 4KOWA 2UV1A 4BBHA 4B10A 4H89A 3DEEA 5EBVA 2LH9A 4XKCA 4KS9A 2M4KA 3DTIA 2XC7A 4R3LA 4HPQA 1NG7A 4DJAA 4CCNA 3OY9A 2GIVA 5A28A 3TE4A 3M1CA 1S9HA 5CPRB 2XF6A 3DWLE 4K30A 4MFZA 3L2VA 2OZGA 1WJBA 5TGTA 5HVQC 4MFPA 3OYFA 2Y0MA 3K4JA 3PJRA 3K9UA 4QPQA 3OOUA 2L2OA 5CNPA 3S93A 3S3MA 2G3TA 4F0XA 2Z3KA 4YELA 4BL0B 3BLNA 1ZO0A 2W82A 2KPMA 4UA3A 2E60A 2J8RA 4ONUA 4YGOA 2QECA 2Z10A 2B5GA 2QKMB 2DCEA 4B5PA 2CW7A 2M7AA 4FASD 4KITB 1I21A 1S3ZA 4XLCA 1MMGA 1LVKA 1M4DA 4KVME 3MGDA 4XM3A 3OS0A 2WUUA 2DPSA 4XLAA 5LFAA 3I9SA 3CZ6A 2FXFA 2AQFA 2V4JC 2LBFB 3SYTA 2Z3NA 4M85A 3RYOA 1NSLA 4BDYA 2ELJA 3R9GA 5G22A 2R98A 3VSLA 2DT6A 4CGNA 2JUGA 4PK4A 1ON0A 1TT0A 2X51A 2MYSA 3PUBA 3OYCA 3AL0B 3K4NA 2RC4A 3CP2A 1ERDA 4JXQA 4MI4A 3BC8A 2CH0A 4QC6A 5KNLA 4UBRA 2Q7BA 4BMHA 4XNFA 2FS5A 4MY0A 4QPOA 3LD2A 1TZLA 4HG2A 3RPUD 2Q2EB 4PJJA 1I1DA 2BEIA 3EFAA 3T90A 2VKHA 4IKFA 1M4GA 4HSTA 4KOXA 4CAFA 1X19A 1GLNA 3DPUA 2OV7A 3KX2A 2E1MC 4NC7A 2GANA 2PQ8A 1MJBA 2MFZA 4R87A 4OADA 1M1DA 1NMTA 4DNCA 2VQCA 4BGDA 1BOBA 4CZCA 1OZPA 4KLVA 1R57A 3DKYA 3K4LA 3FXTA 2PJRB 3AFHA 1FMWA 3EPZA 1Y6IA 3QODA 4J01A 1P4NA 2JVGA 3H9GA 2KMUA 5HMNA 4B14A 2A6TA 2UUZA 2KDOA 1IRXA 4Y4RA 3OYBA 2E5NA 2L9SA 2R8VA 4XPDC 2LY1A 2JVHA 1T95A 4G6TB 3VYTB 1D1BA 3DLAA 3OS2A 3HOSA 2HVSA 5ISVA 4XNHC 2M7BA 3A4CA 3W2WA 3H35A 3C26A 2B4DA 3GBGA 2PSWA 4CRYB 3OMYA 3W6XA 4F6AA 1Z9UA 2I79A 4XN0A 3K4KA 2VZYA 3D5SC 2X7BA 3PNTA 4X0GA 2JEVA 1N71A 3UNGC 2VASA 1IYLA 3BJ8A 2DPTA 1KONA 3BCBA 3W2AA 2OU2A 3KKWA 2CV2A 3C2HA 2DXIA 3CXQA 2DOAA 5IX3A 4HNYB 3IAM2 4BU2A 4H6ZA 2W00A 3SXOA 3TO7A 2M0MA 3ZCOA 4CS0B 3K70C 2W7NA 1WJDA 4B13A 3MMYB 1W36C 1KUYA 2UWMA 4CYPA 2O5RA 2B3VA 3HG9A 2ZSIB 2CNSA 1DQUA 1T0FC 2VL8A 4XN3A 3RQ4A 3S32A 3AL0C 2CNMA 4MY3A 2IGMA 4CUGA 2ATRA 3HUGB 3L2UA 4KORA 5A27A 1WJFA 4XKBA 3IWGA 4OLLA 2V1NA 4E8OA 4YRVA 4KOTA 1S60A 5C82A 1VKCA 4CH7A 3FRMA 4Y49B 4CSWA 2R4GA 3SZGA 3EY5A 2QKLB 2O28A 3ZR8X 2CW8A 3NWSA 3L2WA 4BDZA 2IS1A 4FD4A 4MFLA 3EC4A 4PJLA 2VXDA 4RM2A 1X4PA 4CAEA 2PR1A 3OYDA 2E5ZA 3LL7A 4H4KC 4BE2A 2VJJA 1X1BA 2X6YA 2F4IA 2HZDA 3TL4X 3BG7A 1MMDA 4F55A 5LD2C 2X6WA 1VHSA 4FD5A 2ZFUA 1V5FA 2VI7A 4HNWB 3S3OA 1TIQA 1QU3A 4B3XA 4ZDPA 2R7UA 3DR8A 3EXNA 3NE7A 3DPLC 1YREA 1B6BA 3PSIA 2VQLA 3K4BA 2AE6A 3CXPA 4QVTA 1Q2CA 2ZSHB 4E7LA 2KLOA 3SEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F47 A;  1YR0 A;  4U9Y A;  4AVB A;  1KUX A;  3D3S A;  3VWD A;  3FYN A;  2QIR A;  1P0H A;  4CRZ B;  2QML A;  2NMT A;  3DSB A;  3V8I A;  1XF8 A;  1YGH A;  3EO4 A;  4J3G A;  4KLW A;  4QUS A;  3QB8 A;  3R96 A;  1FY7 A;  3DDD A;  3E0K A;  3TT2 A;  3S6K A;  1YLE A;  2VEZ A;  3N7Z A;  1XMT A;  1KZF A;  3SXN A;  4HNX B;  1S7F A;  5IV0 A;  2ZW5 A;  4EVY A;  3R9E A;  3TO6 A;  4NF1 A;  4JXR A;  4HKF A;  2FSR A;  2B58 A;  1IID A;  1S7K A;  4I49 A;  4L89 A;  1M44 A;  2H5M A;  4KOV A;  3R95 A;  2P6E A;  2F5I A;  2FIA A;  4JD6 A;  2FL4 A;  4KOU A;  4XPD B;  2OH1 A;  4KVO E;  2ZXV A;  4KZT A;  2R1I A;  2VXK A;  2P6G A;  2EVN A;  4FD6 A;  2WPW A;  4KOS A;  2VQY A;  2JLM A;  2OZH A;  3PZJ A;  4AG9 A;  2ZW7 A;  1S7L A;  5IB0 A;  4NSQ A;  2C27 A;  4L8A A;  5JPH A;  2B3U A;  3G3S A;  3B8G A;  2Q4Y A;  2VBQ A;  3GYA A;  4JLY A;  2B4D B;  1Q2D A;  1S5K A;  4Y49 C;  3S6F A;  2J8N A;  3TFY A;  1RO5 A;  1V0C A;  1QSO A;  5H84 A;  2PDO A;  5J8C A;  1YVK A;  1LRZ A;  5KTC A;  3TTH A;  2Z11 A;  1CM0 A;  5JQ4 A;  1YVO A;  3TCV A;  4PSW A;  4UWI A;  2Q0Y A;  2ARH A;  3DNS A;  2REE A;  3FBU A;  5KTD A;  3R9F A;  4B5O A;  3WR7 A;  5KTA A;  4F0Y A;  3ZZI A;  3ZJ0 A;  1RXT A;  4U5Y A;  3JVN A;  2BUE A;  2CY2 A;  1S7N A;  1IYK A;  4AVA A;  3LOD A;  2JDD A;  3GY9 A;  2G3A A;  4KUA A;  2HUZ A;  3FNC A;  4XPL A;  1BO4 A;  1UFH A;  4R3K A;  4QBJ A;  1I12 A;  1PUA A;  1Y9W A;  2EUI A;  5C88 A;  1YK3 A;  4MJ8 A;  4AB7 A;  4E0A A;  3D2P A;  1IB1 E;  3TO9 A;  1XE4 A;  4B5P B;  4FD7 A;  5DWN A;  2GE3 A;  3F5B A;  4LX9 A;  4KVX A;  1XEB A;  3OWC A;  4E2A A;  5I0C A;  1IIC A;  5EC4 A;  1MK4 A;  4CAV A;  2KCW A;  4II9 A;  4CAW A;  3G8W A;  1CJW A;  4ZBG A;  3F0A A;  2FT0 A;  4NXY A;  2FIW A;  1WK4 A;  2B4B A;  1KUV A;  2JDC A;  1SQH A;  2K5T A;  3UY5 A;  5J8F A;  2BL1 A;  3D2M A;  1Q2Y A;  4PV6 A;  2HV2 A;  2G0B A;  4RI1 A;  4IF5 A;  4CAX A;  3BJ7 A;  1WWZ A;  4NEX A;  1Z4R A;  3TOA A;  1QSM A;  3DR6 A;  3I3G A;  5F48 A;  5H86 A;  1Y7R A;  1QSN A;  3P2F A;  3IGR A;  1PU9 A;  5F46 A;  2Q4V A;  4MHD A;  1L0C A;  4R9M A;  2D4O A;  2ZPA A;  2REF A;  2IL4 A;  3H4Q A;  2Q44 A;  2AJ6 A;  3FB3 A;  2CNT A;  2ZW4 A;  3W91 A;  4PSX A;  4OAE A;  1QST A;  2OB0 A;  3VWE A;  3S6G A;  2B5G B;  1M4I A;  5HH1 A;  3S6H A;  4KUB A;  2D4P A;  4GS4 A;  2VZZ A;  4AG7 A;  2BSW A;  1MJ9 A;  4XNH B;  1Y9K A;  2PR8 A;  1B87 A;  3R1K A;  2HQY A;  2J8M A;  4LUA A;  4AVC A;  2I00 A;  3SHP A;  4XPK A;  5E96 A;  1QSR A;  4KOY A;  4R57 A;  2ZW6 A;  5GCN A;  4NCZ A;  3D8P A;  1U6M A;  4YFJ A;  4RS2 A;  2A4N A;  1Z4E A;  1YX0 A;  4U9Z A;  1MJA A;  4YRH A;  3FIX A;  3PGP A;  4X5K A;  3PP9 A;  2WPX A;  4QB9 A;  4M3S A;  4PK2 A;  3GKR A;  1XIX A;  2PRB A;  3CXS A;  5DWM A;  3JUW A;  3F8K A;  5F49 A;  2FCK A;  2DXQ A;  1J4J A;  2OZU A;  2PC1 A;  4PK3 A;  5FVJ A;  4MBU A;  3QAH A;  3TOB A;  2Q04 A;  3T9Y A;  2P6F A;  4JJX A;  3P2H A;  4UWJ A;  4IUS A;  4JWP A;  1GHE A;  4ORF A;  1K4J A;  1NE9 A;  2FE7 A;  2R7H A;  2P0W A;  2Z0Z A;  3W6S A;  4KOW A;  4H89 A;  5EBV A;  4R3L A;  2GIV A;  3TE4 A;  4K30 A;  2OZG A;  2Y0M A;  3K9U A;  5CNP A;  2G3T A;  3BLN A;  4UA3 A;  2J8R A;  4ONU A;  4YGO A;  2QEC A;  2Z10 A;  2B5G A;  4B5P A;  1I21 A;  1S3Z A;  1M4D A;  4KVM E;  3MGD A;  3I9S A;  2FXF A;  3RYO A;  4M85 A;  1NSL A;  3R9G A;  2R98 A;  1ON0 A;  2RC4 A;  4JXQ A;  4QC6 A;  2Q7B A;  4MI4 A;  4BMH A;  4UBR A;  2FS5 A;  4MY0 A;  3LD2 A;  4H6U A;  1I1D A;  2BEI A;  3T90 A;  3EFA A;  1M4G A;  4KOX A;  2PQ8 A;  2GAN A;  1MJB A;  4R87 A;  4OAD A;  1M1D A;  1NMT A;  4DNC A;  1OZP A;  1BOB A;  4KLV A;  1R57 A;  3FXT A;  1P4N A;  5HMN A;  4XPD C;  2R8V A;  5ISV A;  4XNH C;  3C26 A;  2B4D A;  2PSW A;  4CRY B;  3W6X A;  4F6A A;  1Z9U A;  2I79 A;  2VZY A;  2X7B A;  2JEV A;  1N71 A;  1IYL A;  3BJ8 A;  3KKW A;  2OU2 A;  3CXQ A;  5IX3 A;  4HNY B;  3SXO A;  4H6Z A;  3TO7 A;  4CS0 B;  1KUY A;  2B3V A;  2CNS A;  2CNM A;  4MY3 A;  2ATR A;  4KOR A;  4OLL A;  3IWG A;  4E8O A;  4KOT A;  1S60 A;  5C82 A;  1VKC A;  4Y49 B;  3FRM A;  3EY5 A;  2O28 A;  4FD4 A;  3EC4 A;  2PR1 A;  1VHS A;  4FD5 A;  2VI7 A;  4HNW B;  1TIQ A;  3DR8 A;  3EXN A;  3NE7 A;  1YRE A;  1B6B A;  2AE6 A;  4QVT A;  3CXP A;  1Q2C A; 
#chains in the Genus database with same CATH topology
 2JA7 J;  3JW4 A;  4LJZ F;  3V4G A;  4G6Q A;  4GRI A;  2LDU A;  2WAD A;  3DPT A;  1BI3 A;  4P4F A;  1KUX A;  3PNV A;  3O8G A;  1IJW C;  3N05 A;  4EGZ A;  4QWQ A;  4FTH A;  4Z65 A;  1KZH A;  1JXS A;  3FYN A;  1QZE A;  4CCO A;  4HOB A;  1JWQ A;  2ZBK A;  1JHH A;  2EV6 A;  1FBQ A;  2J5P A;  2HDD A;  2CFO A;  4UHT A;  4BXF A;  5J1R A;  4NQW B;  1K4T A;  4MGR A;  4D5F A;  3ZP5 A;  3J7Y J;  1SVL A;  2EA4 A;  1O57 A;  5FKN A;  1GV2 A;  4JBA A;  3JR9 A;  3BR3 A;  1XF8 A;  4ENK A;  5BOX A;  4IQJ A;  4ABZ A;  1MBF A;  2PJ8 A;  4ZGY B;  2V6E A;  2BVL A;  3R96 A;  2BGC A;  4NUB A;  5K5R A;  3K4C A;  4LQG A;  2K9L A;  3ZQH A;  1SFE A;  1N75 A;  2V79 A;  4NQW A;  4I98 B;  4C2Y A;  2K27 A;  4YWY A;  1XJO A;  3PQJ A;  1XMT A;  5D4R A;  3HGG A;  1B9N A;  2HU9 A;  1RR8 C;  3DEU A;  4XOR A;  5I4M A;  2GM4 A;  2WB1 N;  5IV0 A;  3K6G A;  1SC7 A;  1LPQ A;  5F0C A;  2XEI A;  1N25 A;  3MZH A;  3HJE A;  4PFP A;  3TO6 A;  3CCE I;  1A2Z A;  4NF1 A;  1Y0R A;  2JBJ A;  5LBQ A;  5J40 A;  4KN7 X;  2NRA C;  3PFY A;  1HST A;  2FSR A;  1SAU A;  5GTI C;  4I49 A;  4L89 A;  5G1Z A;  1VQM I;  1J59 A;  2ZJR F;  4I02 A;  7CPA A;  2LR8 A;  3WC5 A;  5FKO A;  2G9W A;  5F08 A;  4BHP A;  3NA6 A;  5IOY A;  2MA3 A;  2KZV A;  2F5I A;  4HPS A;  5BWA B;  3JTK A;  2WZN A;  4Q5S F;  2KHM A;  1TWG J;  4IL6 C;  2IS2 A;  4KOU A;  2DJI A;  1K79 A;  1JTY A;  5B5E C;  1QQI A;  2BZT A;  1JI8 A;  4IAV A;  5JGF A;  1JQG A;  1A6I A;  2R1I A;  3H8E A;  3DBH B;  4CCK A;  2EVN A;  1LJ9 A;  2EIL H;  1J0R A;  2OCC H;  2COB A;  2JLM A;  4EVI A;  1LQ1 A;  4ZZL A;  2XAH A;  2KRH A;  3QU6 A;  2QSG X;  5C4X J;  3I3L A;  4AG9 A;  2ZW7 A;  4EM1 A;  4X8I A;  1J75 A;  3BQY A;  5LLQ A;  2Z5U A;  3IWE A;  1CF7 B;  3C2B A;  3FDY A;  3P9C A;  3D7F A;  4NSQ A;  3H9Q A;  4A95 A;  4XLH A;  1BIB A;  4IRH A;  4MQ9 F;  4JQF A;  3K4M A;  5L3D A;  4U9Y A;  4U0V A;  4FET A;  2B9S A;  2L5Q A;  1Q2D A;  1S5K A;  1R23 A;  3CZX A;  3S6F A;  2J8N A;  3A03 A;  2XAG A;  4XLE A;  2W85 A;  1RO5 A;  3CMM A;  3L09 A;  5B1B H;  5BPI A;  2RQQ A;  4HF2 A;  2DN0 A;  3KAS A;  2RNJ A;  3IH3 A;  5FJ8 J;  5KTC A;  2B63 J;  1MMS A;  3IRQ A;  2GU2 A;  3TTH A;  2AFX A;  2VT3 A;  3CUQ B;  2PJR A;  3E5Q A;  2OA4 A;  2K9Q A;  1IN8 A;  1NHA A;  3KP2 A;  2F6C A;  3FXR A;  4L5I A;  1I50 J;  2ESH A;  1YE9 A;  4DW6 A;  2ARH A;  2Z1D A;  4H0E A;  3KP7 A;  3M3Y J;  1TNT A;  5KTA A;  5KTD A;  3OWT A;  5F1J A;  1FEX A;  2P5L C;  3ZPL A;  4P6Y A;  4DYR A;  5DM7 F;  5F27 A;  2CXA A;  3RJP A;  4A6E A;  5AG7 A;  3L9F A;  4ZTJ A;  3FIS A;  1FBU A;  2E1M B;  3WGG A;  1B4A A;  3GTJ J;  4HDV A;  1YI2 I;  1IYK A;  4R87 A;  1OBR A;  1X4O A;  4E7J A;  4AVA A;  4EMS A;  3GLL A;  1CG2 A;  1P9Q C;  3SFI A;  4DIQ A;  2LG4 A;  4AYB A;  4PZJ A;  2XB5 A;  1VQO I;  4I01 A;  5E1Z B;  2K85 A;  3ZXS A;  2NVT J;  3BI1 A;  4BS9 A;  1X1P A;  2ZEF A;  2R7Z J;  3LOC A;  2KL4 A;  4IRI A;  2V7F A;  4RLF A;  4ON0 A;  3I64 A;  4CA0 A;  1XG1 A;  1UFH A;  4R3K A;  2C6P A;  1VIX A;  1Z7U A;  4JX4 A;  1PUA A;  5D6F A;  4A38 A;  4XRS A;  2RNG A;  1MGT A;  1U0J A;  4KSF A;  5C88 A;  4LLL A;  2NNY A;  1HQC A;  2DOF A;  1YW8 A;  3KGQ A;  4AB7 A;  4A3L J;  1E2X A;  3IH4 A;  5E3L A;  4GDF A;  4A3G J;  1EA3 A;  1GVD A;  5IT9 Z;  1R5I D;  2X4H A;  1FOK A;  3WGI A;  1IDY A;  5DWN A;  1ENH A;  3ZN1 A;  4D9J A;  3P5J A;  3I58 A;  1MW7 A;  2BE5 F;  4I6Z A;  3D7G A;  4X2T A;  2LBF A;  2DPD A;  2NOJ B;  4EQQ A;  1TQM A;  5JHF A;  2GXA A;  2YX7 A;  3CPA A;  3OWC A;  4ASN A;  2KZG A;  2F2E A;  3M9A A;  5DUK A;  4RB1 A;  3PO2 J;  1VZ0 A;  4FE7 A;  4OAZ A;  4CAV A;  1SEU A;  1FTT A;  3G8W A;  3IL2 A;  3KE2 A;  1F9N A;  2FT0 A;  4NXY A;  2EB7 A;  2XPV A;  1WK4 A;  1HCR A;  4MFD A;  2B4B A;  2FIW A;  2ZEH A;  4C2Z A;  2STW A;  2XEJ A;  3KIO A;  4I99 C;  2WY7 Q;  4E7H A;  1A31 A;  3BY6 A;  3F23 A;  1W5C C;  1WWX A;  4ZYG A;  1IC8 A;  5CVI A;  2E36 A;  3I55 I;  1WJE A;  1D3Y A;  4XOT A;  4IHW A;  1ON2 A;  2IS4 A;  2FUG 2;  4OC5 A;  3NAR A;  1N78 A;  1K6O A;  3D66 A;  4CXF A;  3CC7 I;  4IF5 A;  3AKZ A;  1HOM A;  3S8P A;  2O8K A;  3IU1 A;  3VB2 A;  3TOA A;  4XK4 A;  1YJ9 I;  1QSM A;  3IP4 B;  1V4R A;  4RAZ A;  2BO9 A;  3I3G A;  5F48 A;  3BJO A;  2VKV A;  1DGW Y;  1P4A A;  4ZJZ A;  3M07 A;  1BN5 A;  1FNO A;  3P2F A;  4PXE A;  4HA8 A;  2PLY A;  1MND A;  2LOO A;  1TKH A;  1XOV A;  4AIJ A;  1IO2 A;  1GXQ A;  1RPW A;  1X2N A;  1SFX A;  1S72 I;  1SAN A;  3FKJ A;  3FF3 A;  3R0A A;  3E0J B;  1ODD A;  4CPA A;  2X0L A;  5D8K B;  1T6S A;  3H1C A;  4B6Z A;  4C7H A;  3A0B C;  3QPL A;  1RKT A;  1ZG8 A;  2TCT A;  1G3Y A;  5D5V B;  4UVB A;  1SVO A;  5HLI A;  3FB3 A;  4RS8 A;  4Q38 A;  2CNT A;  3WHB A;  3LSI A;  4B43 A;  1H9T A;  1E0E A;  3ZRG A;  1ZGW A;  4R7M A;  1J09 A;  3SHF A;  1MNM C;  3RZO J;  4PSX A;  4PPZ A;  4U7B A;  4WWV A;  1EJ9 A;  2W57 A;  2LRE A;  4WF2 A;  3S6G A;  2YNE A;  2A68 F;  4C30 A;  2B5G B;  4Y17 A;  2VI6 A;  2R7S A;  1M4I A;  1Z8X A;  2FX0 A;  4IRG A;  4DZP A;  4A39 A;  4KUB A;  3NEU A;  2D4P A;  1HDP A;  4PJN A;  4GS4 A;  3I4P A;  5EF6 A;  1CBX A;  2DA6 A;  2BSW A;  4XKW A;  4HV5 A;  1S7E A;  1BC7 C;  1P4W A;  4XNH B;  1D1C A;  2BOL A;  2XPW A;  3IH2 A;  3BG9 A;  2VIX A;  2J9A A;  1B87 A;  4K2E A;  3R1K A;  3CCY A;  2PRQ A;  1PUE E;  2J8M A;  3FH4 A;  3MEX A;  1YX5 A;  4LUA A;  2CQ7 A;  1B8I B;  2EK8 A;  1LDK B;  1R49 A;  5E96 A;  1QSR A;  4XQF A;  1XRY A;  3IV5 A;  5K8M A;  2FBI A;  1QZZ A;  4HYE A;  3PEI A;  1OR7 A;  3HIF A;  4NCZ A;  1ZRC A;  3OR1 C;  1D0Z A;  4YFJ A;  1LAP A;  2ZME A;  2A4N A;  4II3 A;  2EZK A;  4U9Z A;  4F52 A;  5GPC A;  4YRH A;  1BR4 A;  3WAB A;  3HHH A;  4LB6 B;  4HAM A;  3LQQ A;  1IG7 A;  2BBY A;  4M72 A;  4M3S A;  1FTZ A;  4CGM A;  1TWH J;  4IOC F;  3LA3 A;  1WSU A;  3CXS A;  1Z0X A;  5DWM A;  2KIF A;  3WT4 A;  3MKW B;  5DTD A;  2RFH A;  3F8K A;  2F5V A;  2NNN A;  2OZU A;  3NE8 A;  3ECO A;  2PC1 A;  1U8B A;  2NYX A;  4OME A;  2BW3 A;  3FXM A;  3TOB A;  3FXQ A;  2P6F A;  4KSA A;  4PUS A;  3P2H A;  3E1S A;  5K7F A;  4IUS A;  1GT0 C;  4PXD A;  4JWP A;  2R7D A;  5KK1 A;  5JHU A;  4L0Y B;  4AWX B;  5M3M J;  1K4J A;  4NGQ A;  2KP6 A;  3CLO A;  1DGR M;  1S3J A;  2Y48 A;  3W6S A;  2YPR A;  1XTA A;  4AVP A;  3KYL A;  2PCU A;  2NVY J;  2P81 A;  2VOP A;  4YU9 A;  3VOD A;  3H3V K;  2M4K A;  3DTI A;  5HVG A;  2ISY A;  3V8J A;  4KYW A;  4HF0 A;  4MEY F;  9ANT A;  4CHU A;  2EIM H;  5FKM A;  4A0Z A;  3ZQG A;  3TE4 A;  4PXC A;  1S7A A;  3M1C A;  1S9H A;  1AOY A;  2CFX A;  2P5K A;  3DWL E;  3SZT A;  4UEZ A;  2EH3 A;  1WJB A;  2OZG A;  4MFP A;  3KFW X;  3OYF A;  1NTC A;  1XBU A;  3GZ6 A;  4UIA A;  3CCS I;  2LSO A;  5GAG J;  2EV0 A;  3I54 A;  3IJ3 A;  3F21 A;  2Z3K A;  3IIB A;  1VQ5 I;  5LYI A;  2QA4 I;  1HLV A;  5FB2 A;  2E60 A;  3CCV I;  3SJE A;  4A37 A;  4DYC A;  2J8R A;  1QPI A;  4YGO A;  5E17 F;  1M4L A;  4MCR A;  2DCE A;  2CG4 A;  4CZZ A;  2CW7 A;  3SXY A;  4S04 A;  1SVM A;  3C18 A;  1JUS A;  1T08 B;  4KIG A;  4KIT B;  3HBL A;  1O7F A;  1T39 A;  1D5Y A;  1I21 A;  1MMG A;  2LF8 A;  4GCV A;  1S3Z A;  1BIA A;  4IHY A;  3OS0 A;  1FSE A;  5B3S H;  1IOI A;  4W97 A;  3TW6 A;  1RI7 A;  3EUH A;  2JK3 A;  5THW A;  2AQF A;  2LBF B;  4N9H A;  3L2N A;  4LD5 A;  2ELJ A;  4ZZD A;  1WKM A;  5IP9 J;  3H36 A;  1BLL E;  2DT6 A;  2JUG A;  1ON0 A;  1TT0 A;  2H1L A;  5EG0 A;  2MYS A;  3OYC A;  1HDQ A;  3F3X A;  2X6O A;  4JXQ A;  2LKX A;  1ERD A;  3BC8 A;  4BMH A;  1I27 A;  3ZMV A;  4B1R A;  1CQT A;  1VHO A;  4H6U A;  5CYV A;  1TZL A;  3RPU D;  3EFA A;  4LK1 F;  3S1Q J;  2XKO A;  2IPQ X;  4NC7 A;  2OR4 A;  1VQP I;  2E1M C;  2PQ8 A;  1SMY F;  2P5V A;  3ZQI A;  1B59 A;  4EEF G;  2XSD C;  2E2I J;  3WU2 C;  3D0S A;  1M1D A;  4DNC A;  1NMT A;  2VQC A;  3VOE A;  3ML6 A;  3K1M A;  1P7I A;  3QP5 A;  4LQ6 A;  3BHX A;  1JGG A;  4UV9 A;  1R57 A;  3DKY A;  3K4L A;  1OJL A;  3FXT A;  1TXR A;  1RUO A;  4J01 A;  1P4N A;  3HHG A;  1ZG5 A;  3PIO F;  3CUO A;  4JX6 A;  3JRD A;  4B14 A;  4Q47 A;  2L9S A;  1ZLJ A;  1XMK A;  1T95 A;  2JVH A;  3VYT B;  1D1B A;  3DLA A;  3HOS A;  5DD4 A;  2ELH A;  2BEO A;  3B6C A;  2KIS A;  3K1N A;  3S15 J;  5D29 A;  2XAQ A;  4M3F A;  1T56 A;  3CO7 C;  3K69 A;  1Z9C A;  5E20 A;  3MN8 A;  4F6A A;  4RBO A;  4P44 A;  4Z2Y A;  1XSX A;  1JHF A;  2JRM A;  1BJA A;  2QWW A;  3HLP A;  1FYL A;  2QCO A;  2VBZ A;  4FCY A;  1LOK A;  1FT7 A;  5CVR A;  1Q7L A;  1OCR H;  2QJ8 A;  3J7A O;  1KON A;  3BCB A;  4IHS A;  3HOV J;  5E3M A;  3KKW A;  1IRZ A;  3C2H A;  1EE3 P;  3CXQ A;  3ZMZ A;  4G7O F;  3IAM 2;  4GM5 A;  4H6Z A;  2W00 A;  2DA7 A;  3TO7 A;  3OSG A;  2K3F A;  2E71 A;  2M0M A;  1IRG A;  2PE3 A;  3LSP A;  4B4C A;  1WJD A;  2OTL I;  1CPS A;  2QQ8 A;  2WV0 A;  2UWM A;  2B3V A;  4M73 A;  2VON A;  2VL8 A;  3JTH A;  4XN3 A;  3S32 A;  4DYO A;  2DBB A;  3CTA A;  5A27 A;  2XRO A;  1UZC A;  4N9I A;  3L2U A;  1XS9 A;  1JJ6 C;  4E8O A;  4YRV A;  3TKY A;  1G3T A;  2NYQ A;  4O5V A;  1TQI A;  4CH7 A;  4KFC A;  4NGT A;  2CUF A;  2R3S A;  2O28 A;  4OC3 A;  3KL9 A;  3NWS A;  3GEZ A;  3HKZ N;  4FD4 A;  3GLX A;  1IRF A;  2EWN A;  3WC7 A;  2VXD A;  2GXB A;  3KLO A;  1KU2 A;  3BI0 A;  2I10 A;  1QO0 D;  1YQA A;  3QRF F;  1TF8 A;  4UUS B;  1IV6 A;  2Y9Y A;  3FMQ A;  4H4K C;  2OBP A;  4CYC B;  3G4S I;  1FSH A;  2F7V A;  3FZV A;  2F4I A;  4BXU A;  3DFG A;  1J7K A;  3TL4 X;  1VQ6 I;  1ETV A;  2EO8 A;  3I4N J;  1MMD A;  1IV8 A;  4F55 A;  4OU0 A;  1AMP A;  4L9J A;  4BNC A;  2VI7 A;  1WH7 A;  1QU3 A;  3H3Z A;  3BR0 A;  2PBI A;  4G12 A;  1B6B A;  1YRE A;  1RUN A;  2LK2 A;  4DZJ A;  3S16 J;  1FC3 A;  1O3S A;  2M5W A;  3KPH A;  4E7L A;  2QSF X;  1H8L A;  2ID3 A;  2DU9 A;  1AKH A;  1ETK A;  3G2B A;  1UG0 A;  3C7J A;  3HSE A;  3BJA A;  3OYI A;  4GFB A;  1IY7 A;  2Z2S B;  1TF9 A;  3WTZ A;  2HVQ A;  3FK6 A;  3I4M J;  3RPU A;  1UEL B;  3D3S A;  5LYL A;  3H0D A;  1MSF C;  3CUQ A;  3T1B A;  2QIR A;  1YTY A;  1P0H A;  2XGE A;  2QYO A;  3IC1 A;  2CTB A;  4P10 A;  3MN2 A;  2GBY A;  3E6C C;  1ZYR F;  3G3Z A;  4PGH A;  1USS A;  1VI0 A;  4CRZ B;  1GHC A;  3EYY A;  3CCR I;  1XGO A;  2QQ9 A;  1ZRD A;  1UST A;  2IVM A;  5BNG A;  5J4V A;  1YGH A;  3V8I A;  1ZGJ A;  3S2W A;  3HRT A;  3GF2 A;  3EO4 A;  6CPA A;  4KLW A;  3HPH A;  4NGS A;  1G3S A;  2FA5 A;  4HLX A;  3LNQ A;  1FY7 A;  3CDL A;  4A30 A;  4MO7 A;  1B9M A;  3NFZ A;  3TT2 A;  5E1W A;  1VQK I;  1YLE A;  1ARL A;  2VEZ A;  3N7Z A;  2QVP A;  4JOM A;  2EPF A;  1KZF A;  1ETX A;  2L3D A;  4C3H J;  5DM6 F;  3JRA A;  2CV1 A;  3R9E A;  2LC2 A;  1NK3 P;  2RKH A;  2Z3Y A;  4V2G A;  3GZ5 A;  2BVM A;  3FF5 A;  1MSE C;  4UY8 I;  4JXR A;  4G1P A;  5H6R A;  2XB0 X;  1IN5 A;  2DFH A;  3VYU B;  1FBS A;  3ZGK A;  2JSC A;  3DP7 A;  5J4Y A;  3CMY A;  1S7K A;  2B58 A;  4AXV A;  5K1Y A;  1SFO J;  3TQN A;  1VQ7 I;  6PAX A;  4NJQ A;  3MKL A;  4NGR A;  1WRJ A;  3OSF A;  2H5M A;  2DQR A;  1F2O A;  3GYH X;  1X3U A;  2P6E A;  2BY0 A;  3DU6 A;  2DMT A;  1EH7 A;  2DA5 A;  4A6D A;  3DQV C;  2IXS A;  3HRM A;  1WJA A;  2HOT A;  2H8W A;  2RGV A;  4KMU X;  3OIO A;  1LAM A;  3CF2 A;  4FWU A;  2ZXV A;  4A2U A;  1S29 A;  4KZT A;  3GW2 A;  3H5A A;  2P6G A;  3DTK A;  5K7H A;  1A35 A;  5CVJ A;  3RKY A;  3FIW A;  2R5Z B;  2VJ4 A;  3L7W A;  2HPM A;  2OZH A;  1KA8 A;  1G3W A;  5H2F C;  3HM5 A;  3PZJ A;  4KT6 A;  5ICE A;  5CPA A;  4RAF A;  4BXX J;  2P6S A;  3CC4 I;  3BDD A;  3CLQ A;  1ZRE A;  4UCP A;  5JM6 A;  4L8A A;  3B3S A;  3FXK A;  3HC7 A;  4P1W A;  5F6F A;  5KAI C;  2HI3 A;  4BAY A;  3K70 D;  3GYA A;  2PMZ N;  4Y49 C;  1MBH A;  3ZQF A;  4A3M J;  3WG7 H;  2TRT A;  2HC9 A;  2HGC A;  3TFY A;  3VYR B;  5EEA A;  1QSO A;  3MD2 A;  1LB2 A;  1U5T B;  1BL0 A;  1RR7 A;  4U87 A;  2JWT A;  5J8C A;  4AU7 A;  1TT5 B;  1LRZ A;  3PB7 X;  1ETQ A;  2GOX B;  1Y1W J;  3TCV A;  4ZY0 A;  2BXZ A;  1BI2 A;  2MC4 A;  4KT5 C;  3QPT A;  1IUY A;  2Q0Y A;  3IEH A;  3HOT A;  1BI0 A;  1RTQ A;  1OR7 C;  3D5R C;  5IT3 A;  5KHD A;  2W1O A;  4BYY A;  3IUO A;  5IP6 A;  3RNZ A;  5D5X B;  3R9F A;  3HOY J;  1WPK A;  3CJQ B;  1X10 A;  1HDD C;  1RXT A;  2PJ3 A;  4C2U A;  2VKD A;  5FKK A;  2CY2 A;  5K5O A;  4DBQ A;  4YG2 F;  1V5E A;  1Y0U A;  2D5V A;  4HQE A;  2R7V A;  2DMU A;  4MFE A;  2R7O A;  5HLT A;  3KR4 A;  3LOD A;  4UCN A;  1ZRF A;  2QQB A;  4KUA A;  2DOD A;  2HUZ A;  2OF7 A;  4XPL A;  3QYF A;  2LP0 A;  4EJV A;  3L00 A;  3KYD B;  2C6C A;  3FMS A;  3TED A;  4QBJ A;  1IN4 A;  2ZEO A;  1WJ5 A;  4MIM A;  4EME A;  1I6X A;  4E6K G;  1Z67 A;  1XD7 A;  3CPX A;  3ELK A;  5GAH J;  3BZK A;  2E1C A;  2M87 A;  4ENN A;  5DDG A;  1IB1 E;  3AG2 H;  5CQG A;  2ZEE A;  5J1Q A;  2HQ5 A;  1R00 A;  5C44 J;  4RAY A;  2JN6 A;  2POK A;  4XIC A;  4B5P B;  1X3W B;  2NS0 A;  4FD7 A;  3TP0 A;  4G94 A;  3FM3 A;  2GE3 A;  3HGY A;  3S3N A;  1QMU A;  2CUJ A;  2VT2 A;  5GPA A;  3ZMU A;  4A3F J;  3M4O J;  3ZQ7 A;  1WQ2 A;  2R7Q A;  3IU2 A;  3BG6 A;  3BT9 A;  5I0C A;  1R5G A;  3VEP A;  5EC4 A;  4AIK A;  2W25 A;  1MK4 A;  2KCW A;  2V1D A;  8CPA A;  2KJC A;  4CYO A;  3OL4 A;  3NAU A;  2IGO A;  5AG6 A;  3LSM A;  2XSJ C;  3BP8 A;  3J7A Y;  3FMC A;  2Z16 A;  3UY5 A;  4W9Y A;  2RRE A;  5J8F A;  1UCR A;  2LRD A;  2A5W A;  3DKX A;  1QQ9 A;  4HQM A;  2O03 A;  5AIQ A;  4XLF A;  2CMP A;  3IC7 A;  4FBE A;  4AUX A;  4L5J A;  3FBI B;  4B44 A;  1KU3 A;  3GME A;  3F22 A;  2G0B A;  3C1D A;  5DS9 A;  4CAX A;  3BJ7 A;  3AAF A;  4ZH4 F;  1X1A A;  2AS5 F;  3E97 A;  2Z3P A;  2EV5 A;  4A33 A;  1UG2 A;  2E35 A;  2A61 A;  1W0T A;  3CJN A;  2MG4 A;  1L3L A;  5H86 A;  2BW3 B;  4II2 A;  3LFU A;  3GTO J;  4XON A;  2QEN A;  2DA1 A;  3DCF A;  2KIU A;  2RV8 A;  4HX7 A;  2D1H A;  2MGQ A;  1LDD A;  2IJL A;  4BE1 A;  4YFK F;  2PG4 A;  2WAQ N;  2RB7 A;  4D1Q A;  3QOP A;  3ULQ B;  4R9M A;  3KP6 A;  3BXM A;  2D4O A;  1DU6 A;  2REF A;  4A3C J;  4ENM A;  2K7L A;  3IFE A;  3O6B B;  2IL4 A;  2B0L A;  3Q0W A;  4HX8 A;  4EV0 A;  4CDG A;  1XSD A;  3H4Q A;  2AJ6 A;  2M2E A;  3ASO H;  2ZXI A;  3H9J A;  2CW0 F;  5ICF A;  4C2X A;  2ZW4 A;  2YSR A;  2WYR A;  1QPM A;  4AC0 A;  4RMN A;  3LMS A;  4IVN A;  2XGC A;  2HXI A;  2MBF A;  3LWF A;  4OAE A;  1QST A;  4OIR F;  2ZXH A;  3MZY A;  5CLS A;  4BY1 J;  2DDA A;  4IZZ A;  1VFC A;  1Z3X A;  2HOA A;  3FBN B;  5H6Q A;  5EGO B;  1VGY A;  5HXD A;  5CVV A;  4P4J A;  4MHZ A;  1R1V A;  1D0Y A;  5DD8 A;  5HH1 A;  1Z5R A;  3M8F A;  3S6H A;  1TBX A;  4B12 A;  5LYD A;  3K10 A;  3ZMD A;  1ZHF A;  1Z77 A;  1HEE A;  4F8Z A;  2VZZ A;  2LMD A;  4AG7 A;  3LFK A;  3F6V A;  1XGN A;  2AFW A;  4FT8 A;  2ZJ2 A;  4PGG A;  4UB8 C;  5IY5 H;  3H5N A;  3EDP A;  5EGO A;  4UEE A;  3KEQ A;  3LMM A;  5E8G A;  3D4U A;  4B11 A;  4CGP A;  2IGK A;  5M3F J;  4C2T A;  4D0P A;  4M6Y A;  2HKX A;  2JA5 J;  4OWR B;  1YW4 A;  2K9M A;  2Q1Z B;  2HQY A;  2KIM A;  4R79 A;  4XKV A;  5ICC A;  4UXN A;  1LE8 A;  2IT0 A;  1LAN A;  3SHP A;  2H6B A;  2VBX A;  2GAN A;  3SDB A;  3OYJ A;  1AU7 A;  5E18 F;  3OS1 A;  4ZDL A;  5ILV A;  5GTH C;  2YNC C;  4R57 A;  4C9Y A;  3BRO A;  4Q36 A;  4I0B A;  1Z91 A;  5LEJ A;  3WGH A;  2Y75 A;  3D8P A;  3E6M A;  4CGO A;  4FHT A;  1F1Z A;  2XPU A;  1Z4E A;  5JLX A;  3PIP F;  1YX3 A;  3RQI A;  2XEF A;  3TX8 A;  3FIX A;  1EF4 A;  3PP9 A;  2WPX A;  1BW5 A;  3ISP A;  4WWC A;  1IGB A;  3ABT A;  1JKP C;  1OYI A;  2RQP A;  4UVC A;  4A69 C;  3JRI A;  2R7T A;  1G8X A;  5ELY A;  5F49 A;  2Y2Z A;  3ONQ A;  3F8F A;  4XMY A;  2H6C A;  5FVJ A;  2MSY A;  4MBU A;  4EAT A;  3QAH A;  1XC5 A;  4F91 B;  2L9N A;  1RIO H;  2VXZ A;  2ZOG A;  3L2Q A;  3ASN H;  3HRU A;  4O6J A;  3GVA A;  3W2V A;  5HNF A;  5BQT A;  2Q4Z A;  4DJL A;  4BBR J;  2Y69 H;  4G9Y A;  2HR3 A;  1K61 A;  1XDS A;  2H94 A;  4RAG A;  4QSH A;  4KNY A;  2Z0Z A;  4NFR A;  3PFI A;  2R7H A;  3JTG A;  3U2R A;  3MKZ A;  1KQ9 A;  1BR1 A;  3FWE A;  2QGU A;  4KOW A;  3BZC A;  4H89 A;  1ZLH A;  2VN2 A;  4P4I A;  4XKC A;  2XC7 A;  2PJB A;  4HPQ A;  1NG7 A;  4DJA A;  1O3R A;  3TP3 A;  2TDX A;  2GIV A;  3F8B A;  2JQ7 A;  3HUV A;  3ZMT A;  5CPR B;  1ZN2 A;  4XBF A;  5IYD J;  4ZYH A;  5HVQ C;  3PJR A;  4D7M A;  4G7Z F;  3K9U A;  2XGD A;  3VH9 A;  4BKX A;  4RB3 C;  3CMA I;  1R22 A;  3S3M A;  2QF7 A;  4LLN A;  4YEL A;  3RZA A;  2QZ8 A;  3BLN A;  1ZO0 A;  2W82 A;  2XHK A;  2KPM A;  1R36 A;  2PJ7 A;  5FLX Z;  1W5T A;  1B8I A;  2QEC A;  5ICG A;  2WWY A;  3RYP A;  2QKM B;  2Z10 A;  1E17 A;  3UKG A;  4OC0 A;  3E6D A;  1TC3 C;  1IF1 A;  4IEJ A;  2CYY A;  3K2A A;  4KN4 X;  3B02 A;  2UXX A;  4KVM E;  5B66 C;  2R92 J;  3SI1 A;  4XM3 A;  2DPS A;  3RPQ A;  5LFA A;  2PJ9 A;  3I9S A;  2HZT A;  2LD5 A;  3PB4 X;  4A3K J;  2FXF A;  2V4J C;  3I53 A;  4IO9 F;  1NSL A;  1POG A;  5LGU A;  1K83 J;  5M5Y J;  2K4J A;  2H27 A;  1BAV A;  5G22 A;  4M3E A;  1MKM A;  1UHM A;  2VL1 A;  1ETW A;  5A2Q K;  4PK4 A;  1ZG3 A;  1SMT A;  1DTD A;  5LHI A;  4FIS A;  4NC6 A;  3K4N A;  2ZC2 A;  4MI4 A;  3GTP J;  1FLI A;  2Q0O A;  1Z1D A;  4XNF A;  2AO9 A;  3ABL H;  1JT6 A;  1OPC A;  4HG2 A;  4QPO A;  1HF0 A;  1I1D A;  4MY0 A;  1FIA A;  1Z6R A;  4HDU A;  2GFQ A;  4D5C A;  4I2O A;  4IKF A;  1LDJ A;  3FEE A;  4JJX A;  3NRV A;  1GLN A;  2HDC A;  3GTG J;  3ABM H;  3GTQ J;  2IQ6 A;  4MHG A;  1ZLI A;  1G2H A;  2FEZ A;  3BTC A;  3ERE D;  4CYP A;  1BOB A;  4CZC A;  4KLV A;  3K2K A;  1SD5 A;  3EPZ A;  1QRY A;  5F1R A;  2JVG A;  4CO8 A;  3OYB A;  4Y4R A;  2KDO A;  1IRX A;  2GLF A;  2R8V A;  2JPC A;  3IKV A;  3ZMS A;  4C3J J;  5JLW A;  2DTZ A;  2OB0 A;  2ZCW A;  2HVS A;  1XX5 A;  4XNH C;  1ORK A;  3CCL I;  3W2W A;  1F4K A;  3C26 A;  2P6T A;  2L0K A;  1FJL A;  4M3B A;  3WTU C;  3W6X A;  3LAJ A;  1I1G A;  5F0H A;  2I79 A;  3ERM A;  3FEC A;  2ADU A;  1LCP A;  2EZH A;  3O3K A;  1N71 A;  2V8V A;  2VAS A;  3ROU A;  3D7H A;  2DPT A;  2G9D A;  3T8T A;  2PJ5 A;  2DXI A;  5L3B A;  2M1B A;  2VE8 A;  4BU2 A;  3ZQL A;  1FYM A;  1PCA A;  2ZB9 A;  1ZLK A;  3SXO A;  4CS0 B;  2L02 A;  2YUS A;  5IYB J;  4BH9 A;  2VBW A;  2W7N A;  3K70 C;  2EFQ A;  2HYG D;  5LHG A;  1FOX A;  1W36 C;  1UWY A;  4RN7 A;  3TGN A;  2O5R A;  2ZSI B;  1DQU A;  2CNM A;  2IBD A;  2BY2 A;  5DV5 A;  3RQ4 A;  1R71 A;  2ATR A;  2FOK A;  3OV8 A;  1WJF A;  3IWG A;  5DCM B;  4NHJ A;  3M8E A;  1EH8 A;  4MTE A;  1S60 A;  4LB5 A;  2IMO A;  3VPR A;  4DQ2 A;  3FED A;  3SZG A;  1WVR A;  3B7I A;  1HC8 A;  1R7J A;  5AON A;  2I3C A;  2K02 A;  1HW5 A;  4MFL A;  1QGP A;  4A3D J;  3EC4 A;  2K9N A;  1ON1 A;  4PJL A;  3GTK J;  2CIJ A;  4RM2 A;  1X4P A;  2DW4 A;  1DUX C;  1W1W E;  5DCM A;  1UHS A;  1ZQ3 P;  2R5Z A;  4ZX8 A;  4E70 A;  4BE2 A;  4F9U A;  1A5J A;  3RI4 A;  5LEK A;  3BG7 A;  5E3O A;  3SJF A;  2HQN A;  1VHS A;  3WU0 A;  1TWC J;  1V5F A;  1Z8L A;  4HNW B;  3S3O A;  3DR8 A;  3DPL C;  4K3N A;  4QVT A;  3G1O A;  3FXU A;  2ZNZ A;  1Z2L A;  3CXP A;  4R6T A;  3SJX A;  2ZSH B;  4UF4 A;  1D8K A;  4I76 A;  3SEZ A;  1K7A A;  4DUK A;  3N5F A;  1AHD P;  3LAP A;  5F04 A;  4LK0 F;  1JT0 A;  4A12 A;  3A02 A;  4RGU A;  3OYA A;  4EM2 A;  2JUC A;  2JA2 A;  4DBR A;  1WZ2 A;  4XLP F;  2DMP A;  4LGW A;  3VWD A;  2EA2 A;  3E3V A;  3JCU C;  2ID6 A;  3I56 I;  4C7I A;  3DKW A;  3MCZ A;  4UNO A;  3DEW A;  1W7P D;  5J1Y A;  2FD5 A;  1T8I A;  3BCA A;  2AFO A;  5JH9 A;  3WTS C;  2NMT A;  1TWF J;  2F4O B;  4C2M J;  2L7Z A;  5FGM A;  3RIR A;  1D8J A;  3JRU A;  2KIQ A;  2YGW A;  2F5C A;  4JYK A;  3WC6 A;  2X9D A;  2QVO A;  3DTE A;  4OMY A;  5K8N A;  2ZOF A;  4MCP A;  2DT7 B;  4GXO A;  4WK8 F;  3V42 A;  2OQR A;  1REP C;  4J3G A;  5FFZ A;  3GFI A;  2N8G A;  3R6S A;  1YHQ I;  2F5E A;  3E7L A;  4UV8 A;  1I1S A;  3CCU I;  5FD6 A;  4BE0 A;  1X1C A;  4KJZ A;  1HDU A;  5K7Z A;  3DDD A;  1HKS A;  1I5Z A;  2V6C A;  5EJC A;  2ZEN A;  1R3N A;  4IXA A;  2CQK A;  2LLK A;  1OCC H;  2LNB A;  3VFZ A;  3MWM A;  2R7X A;  1SD7 A;  4KUM A;  2VB6 A;  2O6G E;  1H9G A;  1YS7 A;  1Z7L A;  3L2R A;  2JZY A;  5DUI A;  2HFH A;  3WE3 A;  3SXN A;  5LYF A;  2DPU A;  2STT A;  1BA5 A;  4LFU A;  3B3T A;  2ZW5 A;  4LIV A;  5AGE A;  5LGN A;  1JKO C;  1HXD A;  1W36 D;  4EVY A;  1S5L C;  4I0A A;  2HOE A;  4MMO A;  5J6X A;  5E8I A;  2ABZ A;  4UFX A;  1YO5 C;  1AYE A;  3CP8 A;  4F92 B;  2IA1 A;  1DU0 A;  3F6O A;  4Z6Y A;  4G8X A;  4HKF A;  4ETS A;  5D8N A;  1R58 A;  1NH3 A;  1IID A;  4F9V A;  2DDB A;  3C3W A;  3I5U A;  2Z9O A;  3D2P A;  4MCS A;  1L0O C;  2BY3 A;  4UVA A;  2L7M P;  1SFU A;  3GTL J;  4HBL A;  4OMZ A;  3KEY A;  5HOD A;  4BEH B;  3WOD F;  3A01 A;  2PI0 A;  1DE4 C;  1M44 A;  3ZQQ A;  1Q1V A;  4R8H A;  5K5Q A;  3R95 A;  3HUG A;  2FIA A;  1YS6 A;  3KHX A;  2MLK A;  3CJR B;  3AG4 H;  1RKW A;  3FHN A;  2M8G X;  3T5X A;  2RDP A;  3HOX J;  1VQL I;  4ZDO A;  4XPD B;  2OH1 A;  4HLY A;  4ZYA A;  4FAI A;  4AVZ A;  1MMA A;  2AFS A;  2VXK A;  5GP9 A;  4CCM A;  2NXN B;  2FBK A;  4FD6 A;  4EJW A;  3MAJ A;  2ZEG A;  2W24 A;  4KOS A;  4J19 A;  2MC3 A;  3W6V A;  1YME A;  1XGM A;  4QTR A;  4IPA A;  4DGW B;  3CCJ I;  1QHH D;  2LY9 A;  4AID A;  4A94 A;  3OL3 A;  2HVR A;  2C27 A;  2B3U A;  2R5Y A;  3HOW J;  4A2Z A;  2Q4Y A;  3CCQ I;  1FZP B;  4F3Q A;  4IHT A;  1R1U A;  2QQA A;  2VQG A;  3R4K A;  2B4D B;  4JLY A;  1SD4 A;  2C6G A;  4R1H A;  1E3O C;  2X1C A;  1K78 B;  3W3C A;  2XEG A;  3I71 A;  1U6G A;  2XAS A;  2FRH A;  2IGN A;  1DPR A;  1LE8 B;  1V0C A;  3I9V 2;  3JSP A;  1PDN C;  1DPU A;  2KT0 A;  3GB0 A;  5H84 A;  1QVT A;  2PDO A;  3VWB A;  1KU9 A;  2IAI A;  1YJN I;  3Q3S A;  1CM0 A;  5JQ4 A;  4PSW A;  1K78 A;  3L1P A;  5ED4 A;  4F93 B;  5HS8 A;  1W7P A;  3SJM A;  2REE A;  2XF5 A;  5L3G A;  1G59 A;  1U78 A;  5HLG A;  4U0W A;  2QSH X;  3H3U A;  3WR7 A;  4F0Y A;  1ZKG A;  3DXJ F;  2NVQ J;  2CU7 A;  3ZJ0 A;  2VPL A;  2RN7 A;  3EUH C;  1X3Z B;  2YND A;  3JVN A;  1F2P A;  2BUE A;  4X3R A;  1S7N A;  4OP4 A;  2MD5 A;  1O7L A;  5LRK A;  2FMY A;  2V1X A;  3WTV C;  4XL9 A;  3REO A;  3BG3 A;  5JVG F;  1DDN A;  3PL8 A;  2RVC A;  3LSJ A;  2JDD A;  1Y7E A;  3DLJ A;  5DEQ A;  3OYG A;  3D1N I;  3KZY A;  1IOF A;  4JZ0 A;  3GFJ A;  1ETO A;  2OAZ A;  4NGN A;  1ZAO A;  1Y9W A;  1TTY A;  3TW7 A;  2P7C B;  2D2W A;  5CKT A;  4ZTF A;  2EUI A;  2CS3 A;  2OQG A;  2HKO A;  3LSH A;  2I8D A;  3VAR A;  4N4N B;  2O7O A;  4TV7 A;  2FVG A;  2OTJ I;  3TO9 A;  4EGY A;  3NH5 A;  3HEF A;  4OIO F;  1GXP A;  4Y52 J;  3KCC A;  1OCZ H;  4YIF A;  2O4H A;  1JTX A;  4ITV A;  3QQA A;  2ZEM A;  3F5B A;  1ACI A;  2V9P A;  3QOE A;  3JRE A;  3U9G A;  4KVX A;  1GVJ A;  3M8J A;  1XEB A;  1Y8R B;  4E2A A;  1TKJ A;  3WTX C;  1UFM A;  1WJC A;  5KAF C;  1OCT C;  2UXN A;  3CUQ C;  3TDZ C;  4CCJ A;  4CYC A;  1HA8 A;  1IIC A;  2PJ0 A;  5F09 A;  4CAW A;  4II9 A;  2EK5 A;  2CGP A;  1CJW A;  4ZBG A;  3F0A A;  2WAF A;  1Z3Y A;  3SZP A;  1TNS A;  3KQZ A;  2L7K A;  3ABU A;  3TMO A;  1KUV A;  1SQH A;  2K5T A;  2ICW G;  4IHV A;  1U5T A;  1JUM A;  2CQN A;  2FSW A;  4KIB A;  5CQE A;  1LFP A;  1XDU A;  4JP0 A;  3LQR A;  2HNH A;  3GCM A;  4B48 A;  4M71 A;  4AD9 A;  3IO1 A;  1Q2Y A;  2CTC A;  1X58 A;  2E2J J;  4R8F A;  4PV6 A;  4UIB A;  2QM3 A;  1R4M B;  2LFB A;  3Q0V A;  4RI1 A;  4G6D A;  2ZNY A;  1BR2 A;  1YIO A;  5FRN A;  1PP7 U;  1I3Q J;  5A2Q Z;  1Z4R A;  4NEX A;  2EIJ H;  3NH4 A;  3PFE A;  5IP7 J;  4RDU A;  2OCE A;  2ETH A;  3RKQ A;  3DR6 A;  4UEF A;  1Y7R A;  1IU8 A;  5EZG A;  2BXY A;  2O0Y A;  3DU5 A;  4A31 A;  2DEA A;  3BWG A;  4MNU A;  4XID A;  1PU9 A;  3R0J A;  5F46 A;  4BHB A;  3DGV A;  2Q4V A;  5HVF A;  5HNH A;  1PP8 F;  4O23 A;  3X2Q H;  5H20 A;  1IUF A;  1L0C A;  3GTM J;  1K6Y A;  4OAY A;  2PEX A;  5D8L B;  1PYT B;  2BY1 A;  4ZX9 A;  4IQ4 A;  2ACJ A;  1C0W A;  3HTU A;  2ZPA A;  1TQP A;  3HKZ A;  1LKX A;  4E7S A;  3JRB A;  1CPX A;  4B3A A;  2WSA A;  2DA2 A;  1TWA J;  1ZAR A;  1BOA A;  3W91 A;  1XPX A;  3F9K A;  4UCM A;  4WX9 A;  2OUM A;  1APL C;  5AG4 A;  2G0E A;  3KEO A;  3DF8 A;  1QZY A;  2MH2 A;  2PN6 A;  1OLT A;  1MDM A;  1LFB A;  3OR2 C;  3VWE A;  2LVS A;  4WXD A;  4L18 B;  1NK2 P;  4M9Z A;  2KQR A;  1DP7 P;  4LIU A;  3FHZ A;  2ZJQ F;  4KDP A;  1PVE A;  3PB9 X;  4A0X A;  2P7V B;  4LMY A;  2PMH A;  4PFO A;  3CME I;  4FX4 A;  3A1Y A;  4BQN A;  1U8R A;  4PJM A;  3TBI A;  4ZC3 A;  1T98 A;  2BCO A;  5HS7 A;  3V38 A;  4A5M A;  1D1A A;  4W1U A;  1MJ9 A;  1Y56 A;  4NC8 A;  5HLH A;  4DYQ A;  4FUU A;  2O9L A;  2DFF A;  1R43 A;  1Y9K A;  2KKO A;  4BEH A;  2K40 A;  3A01 B;  2IS6 A;  4HNT A;  2XF7 A;  3BZ6 A;  3S1M J;  3EUA A;  2GZW A;  2PR8 A;  3U21 A;  5B1A H;  3WHC A;  5C4J J;  3S2H J;  3TC8 A;  2PX9 A;  1BBY A;  2GLJ A;  4GO1 A;  2L4A A;  4WJB A;  2W4S A;  2PJ6 A;  2B7E A;  2HS5 A;  2PJ1 A;  2E19 A;  2FQ3 A;  2WB1 A;  2XDV A;  1MBK A;  2AHQ A;  4XPK A;  2MD0 A;  1TW3 A;  2JRT A;  1LFU P;  2WAE A;  5HOO A;  4M9S A;  5HDG A;  5GCN A;  4RM3 A;  4YEJ A;  2WV1 A;  3QNV A;  4P9U A;  4CCL A;  4MHN A;  4YFN F;  3HXL A;  5HDN A;  1U6M A;  2V9K A;  3HRS A;  4MEX F;  2HB6 A;  1BPN A;  2R5Y B;  1CX8 A;  2JA6 J;  4ENJ A;  1JUP A;  1KQ0 A;  2EZI A;  3H5R A;  5FRM A;  2V8H A;  2NOG A;  4X5K A;  2MLG A;  4P45 A;  2DOE A;  3CO6 C;  3RKX A;  2XV4 S;  4PK2 A;  3GKR A;  4KSI A;  2Y0S A;  5K8P A;  4J00 A;  3QAY A;  3JUW A;  4HEA 2;  2VUM J;  4HX4 A;  3QYB A;  2FCK A;  2AFZ A;  4PK3 A;  2H8R A;  2Z3L A;  5KVR A;  2HEO A;  2Q04 A;  3T9Y A;  3CC2 I;  2ANP A;  2X85 A;  4PQA A;  2KFD A;  5GAD J;  1GHE A;  4MRI A;  4P9F A;  1H0M A;  2FE7 A;  3B3W A;  4BQQ A;  3F8N A;  2OPT A;  2Y31 A;  1PJR A;  4P4E A;  2UV1 A;  4U0Y A;  4BBH A;  4EFD A;  2EFO A;  4G7H F;  4B10 A;  5C3E J;  1XMX A;  1I39 A;  2BHZ A;  2HTJ A;  3DEE A;  3WTW C;  5BS6 A;  4CCN A;  2DA3 A;  3Q5F A;  3OY9 A;  2GXG A;  1IZ1 A;  3KZZ A;  5A28 A;  4GGG A;  2XF6 A;  1J5Y A;  3NH8 A;  1IW7 F;  2XVC A;  5TGT A;  1KYW A;  3PBB A;  2YU3 A;  2A05 A;  3K4J A;  4L5E A;  4PDK A;  4QPQ A;  3OOU A;  5EZH A;  3B6A A;  5CNP A;  3S93 A;  4NGM A;  2XUB A;  2G3T A;  4F0X A;  4M3D A;  4BL0 B;  1Y39 A;  3RO0 A;  3HTS B;  3DBL B;  2D45 A;  4L9T A;  2NVU B;  1V55 H;  2L4M A;  2NS8 A;  3BG5 A;  2VPR A;  2ISZ A;  1F57 A;  1XSV A;  4ONU A;  2AFU A;  2B5G A;  3JAM Z;  3V7C A;  1KYZ A;  4B5P A;  2M7A A;  4E0A A;  2DK5 A;  4CIC A;  3EET A;  2EIN H;  2G7U A;  4FAS D;  4XLC A;  4IHM A;  1M4D A;  3MGD A;  1YRN A;  4OC2 A;  2XRN A;  3O2P E;  3CZ6 A;  2AXT C;  2C6Y A;  3SYT A;  2Z3N A;  4M85 A;  1BW6 A;  3R9G A;  4PJ0 C;  3BTJ A;  2R98 A;  4CGN A;  4M74 A;  2JBK A;  2X51 A;  3AL0 B;  2ECC A;  5D4S A;  1PUF A;  2RC4 A;  3CP2 A;  4QC6 A;  2Q7B A;  5HVH A;  2CH0 A;  3WG9 A;  5KNL A;  2BYV E;  5CVU A;  3D7D A;  2FS5 A;  4Y13 A;  3LD2 A;  1UJ8 A;  2Q2E B;  4PJJ A;  1JKQ C;  2BEI A;  1OQY A;  2H1K A;  2VKH A;  4CAF A;  4HST A;  3RYR A;  1HW1 A;  2HTS A;  2EFW A;  1MJB A;  2MFZ A;  1YQE A;  4V19 K;  4AIH A;  2Y9Z A;  2PIY A;  4U88 A;  5JR3 A;  3FVL A;  2BHY A;  2J5O A;  2PMU A;  4BGD A;  1OZP A;  2F4M B;  1WI3 A;  2H09 A;  3AFH A;  3HYI A;  3H9G A;  1XGS A;  2KMU A;  5HMN A;  2UUZ A;  4FE4 A;  2E5N A;  5JI6 A;  3COA C;  2LY1 A;  3WTT C;  2ELK A;  3M1E A;  3RDI A;  5CJ9 A;  3OS2 A;  5ISV A;  1X2M A;  1QBJ A;  2M7B A;  4PCQ A;  2PJP A;  3H35 A;  1XB4 A;  2B4D A;  1KWM A;  2PSW A;  4CRY B;  5LRS A;  2V9V A;  3OMY A;  1KGS A;  3JRC A;  4I7H A;  1Z9U A;  4FX0 A;  3D68 A;  3PB8 X;  3S9L A;  4TNU A;  2IJZ A;  4XN0 A;  3PM1 A;  2Q51 A;  1WI9 A;  3PNT A;  4X0G A;  2JEV A;  4NGP A;  3UNG C;  4MCQ A;  1U5T C;  1IYL A;  3BJ8 A;  2FF4 A;  3W2A A;  2O3F A;  1YIT I;  4UB6 C;  2NSM A;  1VTN C;  3V7R A;  2ZXJ A;  4RGR A;  5FKL A;  2XRL A;  2EQR A;  4OIW A;  1SAX A;  2PJ4 A;  3HDD A;  1FX7 A;  3LAC A;  2EFP A;  4B13 A;  3W6K B;  3ABK H;  1O3T A;  2A07 F;  3HG9 A;  2CNS A;  3PFO A;  2ZEP A;  4MY3 A;  3AL0 C;  1U9O A;  2E1N A;  1ARM A;  3MQ0 A;  4MHY A;  1QVU A;  4XKB A;  2OZ6 A;  2NAZ A;  2PJ2 A;  4OLL A;  2L9R A;  4KOT A;  3F8M A;  2COM A;  2DTR A;  2V8D A;  5C82 A;  3G1M A;  3QP6 A;  1EH6 A;  2QLZ A;  4CSW A;  3EY5 A;  4XSX F;  2M0C A;  2QKL B;  2YX4 A;  5GAE J;  2FXA A;  2CW8 A;  5FO5 A;  1Z8W A;  4XRF A;  4BDZ A;  1TW2 A;  1YW6 A;  1U9N A;  2PIZ A;  3FXL A;  1J9I A;  3S9M A;  5EDN A;  2K86 A;  1YLF A;  2PR1 A;  1R1T A;  4IHX A;  2GIZ A;  3OYD A;  3E5X A;  1XMA A;  2VJJ A;  1X1B A;  2HZD A;  4S05 A;  1H88 C;  4RB2 C;  4LLG F;  3S17 J;  1CP7 A;  4GYG A;  4XRM A;  4FD5 A;  3B3C A;  1S8N A;  2AFM A;  4M6H A;  1T2K A;  4ZDP A;  3JAM K;  3EXN A;  1MIJ A;  3NE7 A;  2O61 A;  3PSI A;  3K4B A;  3F8C A;  3BJ6 A;  3FXO A;  4IJA A;  5TIS C;  3IRR A;  3CCM I;  1D5V A;  2KLO A;  1M1E B;  1IDZ A;  2X6X A;  4C68 A;  3KZI C;  3PQK A;  5EG0 B;  1TKF A;  1YR0 A;  3BLY A;  1CGP A;  2CRG A;  2F48 A;  2LYC A;  3RTR A;  4ZY2 A;  4ANJ A;  3N97 A;  1G4D A;  4BUP A;  3DV8 A;  3A2K A;  3S14 J;  2DMQ A;  1EV7 A;  4BQO A;  2X48 A;  2A6H F;  1R5H A;  1CF7 A;  4NB5 A;  2DYS H;  3PRT A;  4EJT A;  1IXC A;  2ZFW A;  3M7G A;  1AUG A;  3CF5 F;  3A9L A;  3JRH A;  1GYT A;  3RBU A;  2QML A;  3H5Z A;  4MLO A;  2HDW A;  3DSB A;  1FMV A;  1GV5 A;  2OD5 A;  2P8T A;  2JTV A;  1ZEL A;  3OYN A;  3SJG A;  1JGS A;  1UAA A;  3Q0U A;  3GUD A;  3HB9 A;  1WH5 A;  5EEG A;  1OMI A;  3CT9 A;  3JRF A;  1MBG A;  4QUS A;  3QB8 A;  4ZYD A;  2YS9 A;  1VF9 A;  2HPI A;  2WA0 A;  1D0X A;  4M6X A;  5KCM A;  3KZW A;  3FX3 A;  3QWL A;  5ERI A;  2Z3M A;  5L3E A;  3V7S A;  1FPQ A;  3E0K A;  4N0B A;  1X1D A;  4E7Z A;  3S6K A;  2JJ7 A;  5G21 A;  3P9I A;  2EWB A;  1MH4 A;  4ESJ A;  2Q8K A;  1R6R A;  5D5W B;  4HV6 A;  1F43 A;  1STZ A;  1TL8 A;  1VHE A;  4HNX B;  2HWV A;  1S7F A;  2FQ4 A;  2LKS A;  1Z05 A;  1MBJ A;  3BR2 A;  2X1E A;  2ZED A;  5K8O A;  4MFQ A;  4JK1 X;  3VDX A;  2ESN A;  1OYY A;  2LY2 A;  4M9X A;  4ZY1 A;  4M3G A;  1V54 H;  5LRR A;  4HF1 A;  4BY7 J;  4XR6 A;  2VJ5 A;  4HRI A;  4WXH A;  3KYC B;  4UUV A;  4AYB N;  1LEB A;  2FBH A;  4WXC A;  3OYM A;  1HBX G;  2GAU A;  4EM0 B;  4KOV A;  2HQR A;  4CYD A;  3PUF A;  2JSP A;  1RRJ A;  3ZQC A;  4IF4 A;  2EJR A;  4JD6 A;  2FL4 A;  1VQN I;  4UUT A;  3U1D A;  4WCG A;  3OYE A;  1RC9 A;  3IHU A;  3GWZ A;  2M30 A;  3CQZ J;  3QPH A;  3SQN A;  4KVO E;  4MHP A;  5J1U A;  1VQ4 I;  3OOP A;  2CO5 A;  3CES A;  3B3V A;  2WPW A;  2P4W A;  1FOY A;  1WCM J;  1ONV A;  1RNL A;  2W84 A;  2R7R A;  1F5T A;  4F7Z A;  2VQY A;  3B2Y A;  2VKE A;  4RGX A;  4RLQ A;  1S7L A;  3E6B A;  4L9N A;  5IB0 A;  5E1X A;  3SEQ A;  2ODF A;  2VOD A;  1RES A;  1S6L A;  3CDH A;  1FWZ A;  1PUF B;  1ELM P;  5JPH A;  3G3S A;  3B8G A;  4Q7A A;  2VBQ A;  4OIP F;  4E7I A;  2V8G A;  3H8G A;  2GOM A;  2MAB A;  1E3H A;  4Y33 A;  1MMN A;  2FJ1 A;  3FM5 A;  4X1E A;  2CJJ A;  3ECH A;  2CSO A;  1U2W A;  3DLL F;  1NSA A;  2VC1 A;  2QUF A;  2I5U A;  2L01 A;  3C2G A;  2WC2 A;  3G71 I;  4FQG A;  1YVK A;  1Z8T A;  3H0G J;  3FMR A;  3KI9 A;  1B72 B;  2Z11 A;  5E3N A;  3HPG A;  1YVO A;  2CUE A;  1V3F A;  2YU9 J;  2MH9 A;  2R7F A;  3A0H C;  2KDZ A;  4UWI A;  2BV6 A;  3LSK A;  2IP2 A;  2EIK H;  5HDK A;  4IX7 A;  2VLA A;  1JKR C;  4CGL A;  3AG3 H;  1MZB A;  3DNS A;  3FBU A;  3BTI A;  1O4X A;  3J81 Z;  3BR5 A;  4B5O A;  5G20 A;  2ECB A;  2WY8 Q;  3G73 A;  4GYI A;  4LG3 A;  2DA4 A;  3KET A;  4OIQ F;  3ZZI A;  5TJJ A;  4U5Y A;  3R61 A;  2E2H J;  4MFJ A;  5F0F A;  5L3C A;  3KP4 A;  1W7P B;  2BOA A;  2WAQ A;  3OIP A;  3BOQ A;  1OYW A;  2DMN A;  3KR5 A;  1ULY A;  3VSK A;  2OJE D;  5BPD A;  3KHZ A;  4Y3O A;  3I0T A;  1WFX A;  2WTE A;  3OYK A;  2Y0S N;  1P4X A;  3JRG A;  1I6H J;  1MDM B;  3GY9 A;  5F64 A;  1OCP A;  1QHG A;  3VYS B;  2G3A A;  4R76 A;  2XGX A;  1Z6T A;  4B47 A;  1FIP A;  3OYL A;  3FNC A;  4NJR A;  2DQL A;  1BC8 C;  1XMB A;  4A3I J;  2XAU A;  2F5D A;  1BO4 A;  2Q43 A;  1I12 A;  4PXB A;  4OKO A;  4MFK A;  2DO7 A;  2DFE A;  1FP2 A;  2QEX I;  1A36 A;  2D1V A;  2L7F P;  1YK3 A;  4MJ8 A;  4LIT A;  2CV0 A;  2DFI A;  2M3A A;  4M6I A;  3LA7 A;  2DJN A;  2ME6 A;  3D5L A;  1ITY A;  1R9T J;  2MW8 A;  4A5N A;  2UZK A;  3RSN A;  4AM3 A;  2V1U A;  2DLL A;  1Z21 A;  5BMZ A;  4NBQ A;  1XE4 A;  4KIF A;  1YG2 A;  1MBE A;  1LEA A;  1YYV A;  2DI3 A;  4LX9 A;  2FU4 A;  4BJT A;  2XKP A;  4YFX F;  5EMI A;  3D67 A;  1SD6 A;  4NNJ A;  3N4M A;  2IEK A;  5IB9 A;  1BI1 A;  3K1P A;  4A3E J;  1ZG1 A;  3FJU A;  2CF4 A;  4NDL A;  1HW2 A;  2R93 J;  2CWE A;  1YJW I;  3K2Z A;  1W4M A;  3ESW B;  1A04 A;  3J80 K;  2PJA A;  1FOW A;  4IOA F;  1WHU A;  2DT5 A;  2JDC A;  2PMZ A;  2Z33 A;  3PSF A;  5D5U B;  4RGS A;  3KQX A;  5JVT A;  5AG5 A;  2Z99 A;  3G1L A;  1IGN A;  2BL1 A;  2VQH A;  3D2M A;  3DBR B;  4A0Y A;  3MKY B;  4D7N A;  1T38 A;  1FP1 D;  2HXO A;  2GA2 A;  2HQA A;  4UFW A;  4RUH A;  2HV2 A;  5JFR A;  1KQ8 A;  4GXH A;  1RET A;  3OIQ A;  1T0F A;  4LOC A;  1WWZ A;  2CUZ A;  1H8A C;  3V7Z A;  1BM9 A;  2QBY B;  3OYH A;  1IXS B;  3LSG A;  2YR2 A;  3GO5 A;  3KP5 A;  4X6A J;  2XAF A;  3CJT B;  3ZOB A;  1B6A A;  4JYW A;  3ZN0 A;  4JX5 A;  4ZI6 A;  1QSN A;  4BBS J;  3IGR A;  1EKE A;  2AQE A;  5IPA A;  1IAW A;  5F47 A;  4CYQ A;  2R7W A;  2ZME B;  3RCO A;  1UMQ A;  4P4B A;  2LTP A;  4N4O B;  5E79 C;  2EZL A;  4LG0 A;  4MHD A;  4ONW A;  4BHC A;  1YIJ I;  1TP4 A;  4V2F A;  1E3P A;  1UB9 A;  4HW0 A;  2YNC A;  2PFB A;  3GX4 X;  1PYV A;  1ZK8 A;  1MNE A;  4E4H A;  3S2D J;  3QYE A;  1P7J A;  2RAE A;  2Q44 A;  2DF5 A;  1Y1V J;  4Y7N J;  3GZN B;  4P96 A;  2HYF A;  3PO3 J;  2Q7S A;  1NG6 A;  1FT9 A;  4LG0 B;  2Z3O A;  2ME0 A;  2VE9 A;  2W48 A;  5LHH A;  4Q48 A;  1R4N B;  2E34 A;  1P2F A;  4Y15 A;  4RB0 A;  2O8X A;  4A3J J;  2G7H A;  3NWT A;  2XAJ A;  1S7O A;  3J81 K;  4E7K A;  2GWR A;  3LST A;  3V8K A;  3MRU A;  4XRS G;  1AA7 A;  5FFX A;  1N77 A;  3HZJ A;  3HL2 A;  5FLM J;  4OID A;  1H89 C;  2L54 A;  2EK9 A;  3FX6 A;  2K9S A;  3ISZ A;  1V5G A;  2FML A;  3BR6 A;  3T0Y A;  1YOV B;  2R0Q C;  2Y30 A;  3VAT A;  4BAC A;  1J2X A;  3HOU J;  1RZ4 A;  3LA2 A;  5FD5 A;  3R60 A;  5LRJ A;  3H8F A;  1Y0N A;  2L9V A;  4QLC U;  4BD9 A;  4BJ5 C;  4XOP A;  1SFK A;  2K4B A;  3FXJ A;  3K0L A;  2HOS A;  3S1N J;  2PVV A;  3I59 A;  4H2K A;  4KIS A;  3WTY C;  1IN6 A;  3EQL F;  4AVC A;  2I00 A;  4HNU A;  4B8X A;  1P6R A;  4KOY A;  4Q4Z F;  2M9H A;  2A5Y B;  2K3P A;  1O3Q A;  2ZW6 A;  2WBM A;  1T33 A;  3IAS 2;  4KIC A;  5DCF A;  3BR1 A;  3EUK L;  2XIG A;  3WU1 B;  4CYN A;  1QNT A;  2ZEL A;  2OC6 A;  5FRO A;  4A32 A;  2JA8 J;  1IXR C;  1AKH B;  1B1B A;  4RS2 A;  4OC1 A;  3T8W A;  3P9K A;  1MD0 A;  3U1K A;  4L9V A;  1YX0 A;  1MJA A;  2KRC A;  3RZD J;  2F8H A;  2F5F A;  2X1D A;  4C3I J;  3JSO A;  1DP3 A;  3PGP A;  4IK2 A;  2K5C A;  3H92 A;  1ZTR A;  2GQQ A;  3MZ8 A;  4HSR A;  2VJI A;  4P5O A;  5ILS A;  5LGT A;  1JE8 A;  4DOZ A;  1Y0Y A;  3IWZ A;  2IW5 A;  4QB9 A;  1XIX A;  1BJZ A;  2GA1 A;  3PNY A;  1OKR A;  3UR3 C;  4EJU A;  5J47 A;  2PRB A;  1W0U A;  3CDX A;  4EJO A;  3QPS A;  2IA0 A;  3J7Z I;  3G6E I;  2A3S A;  2JMW A;  1J4J A;  2DXQ A;  4UFV A;  3GFL A;  2V77 A;  3B73 A;  3CDI A;  1XN7 A;  4OOI A;  1IN7 A;  5HS9 A;  2CQQ A;  1TLH B;  1OFC X;  1P92 A;  4UWJ A;  3KP3 A;  5M5X J;  1X12 A;  3SDG A;  2DK8 A;  2M4G A;  3FKI J;  2JT1 A;  4B09 A;  5L3F A;  5DS0 A;  2V26 A;  1KU7 A;  1W5S A;  4O3M A;  1NE9 A;  4ORF A;  2P0W A;  1YW9 A;  3HSF A;  4YII A;  4HZF A;  4BJ6 C;  2NVX J;  2A6E F;  2ZO4 A;  5EBV A;  3GIU A;  2LH9 A;  1ZR2 A;  4KS9 A;  4R3L A;  4ESF A;  3BPV A;  4AVB A;  3RAM A;  4BIN A;  3LWU A;  3F0C A;  3GLJ A;  2JEW A;  3WE2 A;  4K30 A;  4P4D A;  5EEH A;  3L2V A;  2M8E A;  4MFZ A;  5J3L A;  2M34 A;  4KMF A;  2Y0M A;  2JPB A;  1YSJ A;  1HKT A;  4OIN F;  2VOO A;  2FNA A;  4OC4 A;  2L2O A;  1LNW A;  2LKP A;  4MQV A;  1VND A;  2IRF G;  4UA3 A;  3O8H A;  3Q9V A;  2EBI A;  1QA6 A;  5FLX K;  5M5W J;  1FYK A;  1LVK A;  1YW7 A;  2O53 A;  2WUU A;  1ZR4 A;  4XLA A;  5IOZ A;  5TRD A;  3K7A J;  1UHW A;  3RYO A;  3Q9S A;  3W6J B;  1FNN A;  1U3E M;  3PBE A;  2IA2 A;  4P55 A;  4BDY A;  1G6N A;  3VSL A;  1XCB A;  3FK7 A;  1GDT A;  3PUB A;  1XCV A;  1LVA A;  1Y8Q B;  5AIP A;  5ILU A;  3L2C A;  1JJ8 C;  4UBR A;  4S0H B;  2ZJP F;  4TWE A;  3T90 A;  4UUS A;  2LF7 A;  1M4G A;  2HYJ A;  4KOX A;  3BQZ A;  3E5U A;  1X19 A;  3DPU A;  3KX2 A;  2OV7 A;  2QYV A;  4I09 A;  2E7W A;  4OAD A;  1AWC A;  5CBM A;  3J80 Z;  3SI2 A;  1OCO H;  1ZG7 A;  2Q2E A;  3PB6 X;  2PJR B;  3MFK A;  1ZH5 A;  1FMW A;  4A93 J;  1Y6I A;  3QOD A;  3F72 A;  1WGX A;  2QBY A;  2EBJ A;  1F36 A;  1ZG9 A;  2A6T A;  1K4S A;  4XPD C;  3AG1 H;  3RKW A;  4ESB A;  4G6T B;  3KLN A;  2PJC A;  3A4C A;  2GRE A;  4M6G A;  2NS7 A;  3S9N A;  4L0Z B;  3GBG A;  3HOZ J;  3TDU C;  2M45 A;  2GLO A;  4EWT A;  4HNV A;  1XFO A;  3K4K A;  4M6V A;  3V8L A;  2VZY A;  3IKT A;  3D5S C;  2X7B A;  4CGZ A;  1LFW A;  1Q1H A;  2E1O A;  2OOT A;  2OU2 A;  1YLO A;  1B72 A;  2CV2 A;  2ZKZ A;  3GFM A;  4RA2 A;  2A69 F;  2E7X A;  5D6E A;  2DOA A;  3HSR A;  4BQA A;  2C1C A;  4HNY B;  5IX3 A;  2EFN A;  4XLN F;  3ZCO A;  5IT9 K;  2VBY A;  3MMY B;  1KUY A;  1VQ9 I;  1T0F C;  3QU3 A;  2DYR H;  2ZXW H;  1LUJ B;  2IGM A;  4CUG A;  1BPM A;  3HUG B;  4KOR A;  1ZGA A;  1YRN B;  1MH3 A;  2V1N A;  3GXO A;  3P7N A;  3IWW A;  2FNP A;  5DYM A;  1VKC A;  1GUU A;  1ETY A;  4ZYE A;  3FRM A;  1A6Q A;  3GUX A;  3NQO A;  1HKQ A;  2R4G A;  4MTD A;  4Y49 B;  5LRG A;  4ZYQ A;  5EYR A;  4MXU A;  3MVP A;  4YIR X;  3CD6 I;  3ZR8 X;  4KA4 A;  1ELL P;  3L2W A;  4XSZ F;  4A3B J;  2IS1 A;  2PVW A;  1OIS A;  2ZME C;  5IYC J;  3B35 A;  3I1U A;  1CP6 A;  3BPX A;  4CAE A;  2KRF A;  1VQ8 I;  4QIW N;  2FE3 A;  3ISX A;  2DAO A;  2E5Z A;  3LL7 A;  3K9T A;  2X6Y A;  2FOW A;  3T8R A;  2CQX A;  4U7D A;  3SFZ A;  3BTL A;  3I59 B;  1YFH A;  5FLV A;  2AXL A;  5LD2 C;  2X6W A;  3S1R J;  2ZFU A;  3LSR A;  1TIQ A;  2KJB A;  4B3X A;  2R7U A;  3IWF A;  2VQL A;  2AE6 A;  1HSJ A;  1I3A A;  3EYI A;  1Q2C A;  3SI0 A;  2VC0 A; 
#chains in the Genus database with same CATH homology
 2X6X A;  4C68 A;  4GRI A;  4H6U A;  3G2B A;  2WAD A;  1UG0 A;  3DPT A;  3OYI A;  3BLY A;  1YR0 A;  4U9Y A;  5F47 A;  2Z2S B;  4AVB A;  2HVQ A;  2LYC A;  3PNV A;  3OYA A;  1KUX A;  3RTR A;  1UEL B;  4ANJ A;  2JA2 A;  4DBR A;  4BUP A;  3A2K A;  3D3S A;  3N05 A;  3VWD A;  4BQO A;  3H0D A;  3FYN A;  4CCO A;  2QIR A;  4C7I A;  1P0H A;  3A9L A;  2CFO A;  4CRZ B;  4BXF A;  4MBU A;  2QML A;  3BCA A;  3H5Z A;  4MLO A;  2NMT A;  2HDW A;  4NQW B;  3DSB A;  1FMV A;  2YGW A;  3OYN A;  1ZEL A;  3V8I A;  3DTE A;  1UAA A;  1XF8 A;  1YGH A;  4IQJ A;  2DT7 B;  3EO4 A;  3V42 A;  4J3G A;  4KLW A;  3HPH A;  4QUS A;  4ZGY B;  3QB8 A;  2V6E A;  2BVL A;  3R96 A;  2HPI A;  2WA0 A;  4NUB A;  1D0X A;  5KCM A;  1FY7 A;  3K4C A;  4BE0 A;  2Z3M A;  4A30 A;  1X1C A;  2K9L A;  4KJZ A;  3DDD A;  3E0K A;  3TT2 A;  1N75 A;  1X1D A;  4E7Z A;  3S6K A;  4C2Y A;  1YLE A;  2VEZ A;  3N7Z A;  5G21 A;  1XMT A;  2R7X A;  4JOM A;  2HU9 A;  2VB6 A;  3L2R A;  1R6R A;  1Z7L A;  4XOR A;  1KZF A;  3SXN A;  4HNX B;  1S7F A;  5IV0 A;  3K6G A;  2CV1 A;  2ZW5 A;  4LIV A;  5AGE A;  4EVY A;  3R9E A;  2LC2 A;  1W36 D;  2X1E A;  4MFQ A;  4PFP A;  2BVM A;  3TO6 A;  4UFX A;  3VDX A;  4NF1 A;  2LY2 A;  3CP8 A;  4F92 B;  4JXR A;  3VYU B;  4HKF A;  3ZGK A;  3PFY A;  4XR6 A;  2VJ5 A;  4HRI A;  2B58 A;  1IID A;  1S7K A;  2FSR A;  1SAU A;  4I49 A;  4L89 A;  5G1Z A;  3OYM A;  3KEY A;  4BEH B;  1M44 A;  2H5M A;  4KOV A;  3ZQQ A;  2JSP A;  3R95 A;  2P6E A;  2KZV A;  2F5I A;  2FIA A;  5BWA B;  3DU6 A;  3CJR B;  3JTK A;  4JD6 A;  2FL4 A;  3FHN A;  2KHM A;  2IXS A;  3DQV C;  1WJA A;  3OYE A;  2IS2 A;  4KOU A;  2DJI A;  4ZDO A;  4XPD B;  3CF2 A;  2OH1 A;  4KVO E;  4ZYA A;  1JI8 A;  2ZXV A;  4AVZ A;  1MMA A;  4KZT A;  2R1I A;  2VXK A;  3CES A;  3H5A A;  4CCM A;  2P6G A;  4CCK A;  2EVN A;  3DTK A;  4FD6 A;  2WPW A;  4KOS A;  2VQY A;  2R7R A;  2JLM A;  2VJ4 A;  2HPM A;  2OZH A;  3PZJ A;  2KRH A;  4KT6 A;  3I3L A;  4AG9 A;  2ZW7 A;  4RLQ A;  4DGW B;  1S7L A;  3IWE A;  1QHH D;  5IB0 A;  3SEQ A;  3FDY A;  4NSQ A;  3OL3 A;  4UCP A;  3H9Q A;  2HVR A;  4XLH A;  2C27 A;  4L8A A;  4A95 A;  5JPH A;  2B3U A;  4A2Z A;  3G3S A;  3HC7 A;  3K4M A;  4JQF A;  4P1W A;  3K70 D;  4FET A;  4F3Q A;  2Q4Y A;  2VBQ A;  2VQG A;  4E7I A;  3GYA A;  2L5Q A;  2B4D B;  4JLY A;  2GOM A;  2MAB A;  1Q2D A;  1S5K A;  4Y49 C;  2X1C A;  4Y33 A;  3W3C A;  3S6F A;  1MMN A;  2J8N A;  3TFY A;  2IGN A;  4XLE A;  1RO5 A;  3CMM A;  3VYR B;  3I9V 2;  1QSO A;  3MD2 A;  1V0C A;  3B8G A;  2RQQ A;  5H84 A;  4U87 A;  2PDO A;  4AU7 A;  3VWB A;  1LRZ A;  3C2G A;  1YVK A;  5J8C A;  5KTC A;  3TTH A;  2Z11 A;  1CM0 A;  2PJR A;  5JQ4 A;  3HPG A;  1YVO A;  2GOX B;  3TCV A;  2F6C A;  2MC4 A;  3LSK A;  4PSW A;  2Q0Y A;  4UWI A;  3HOT A;  4IX7 A;  2VLA A;  4F93 B;  1OR7 C;  1YE9 A;  3D5R C;  2ARH A;  4CGL A;  5KHD A;  2REE A;  2W1O A;  2XF5 A;  3IUO A;  2Z1D A;  1G59 A;  3DNS A;  3FBU A;  5KTD A;  3R9F A;  4B5O A;  3WR7 A;  3OWT A;  5G20 A;  2WY8 Q;  3ZZI A;  3CJQ B;  4LG3 A;  4F0Y A;  3TOB A;  3ZJ0 A;  2VPL A;  1RXT A;  3EUH C;  4U5Y A;  2CXA A;  4C2U A;  2YND A;  3JVN A;  4MFJ A;  2BUE A;  2VKD A;  4ZTJ A;  5AG7 A;  2CY2 A;  2E1M B;  1S7N A;  4DBQ A;  1IYK A;  4KUA A;  2WAQ A;  3OIP A;  1V5E A;  1X4O A;  4E7J A;  4AVA A;  3VSK A;  1P9Q C;  4XL9 A;  4Y3O A;  2R7V A;  4DIQ A;  1WFX A;  2LG4 A;  2R7O A;  4AYB A;  5HLT A;  3OYK A;  3PL8 A;  3LOD A;  2JDD A;  4UCN A;  3GY9 A;  3ZXS A;  1QHG A;  3VYS B;  4BS9 A;  3OYG A;  2G3A A;  4B47 A;  2HUZ A;  2KL4 A;  3OYL A;  3FNC A;  2V7F A;  3QYF A;  4RLF A;  4XPL A;  4CA0 A;  2XAU A;  1BO4 A;  1UFH A;  4R3K A;  4QBJ A;  1I12 A;  1WJ5 A;  1PUA A;  1Y9W A;  4MFK A;  4E6K G;  5CKT A;  4ZTF A;  2RNG A;  2EUI A;  2CS3 A;  1U0J A;  4KSF A;  5C88 A;  1YK3 A;  3LSH A;  4MJ8 A;  2I8D A;  4LIT A;  4N4N B;  2CV0 A;  2M3A A;  4AB7 A;  4E0A A;  3D2P A;  3D5L A;  1IB1 E;  5CQG A;  3RSN A;  3TO9 A;  1EA3 A;  1Z21 A;  1XE4 A;  4B5P B;  4FD7 A;  5DWN A;  2GE3 A;  4ITV A;  4D9J A;  3S3N A;  2CUJ A;  1MW7 A;  3F5B A;  4LX9 A;  4BJT A;  4KVX A;  2LBF A;  3QOE A;  2NOJ B;  3M8J A;  4NNJ A;  1XEB A;  5JHF A;  3OWC A;  2R7Q A;  3IU2 A;  3BG6 A;  4E2A A;  5I0C A;  1WJC A;  1IIC A;  1VZ0 A;  4OAZ A;  4CCJ A;  1MK4 A;  1HA8 A;  5EC4 A;  2KCW A;  4CAV A;  4II9 A;  4CAW A;  3G8W A;  4CYO A;  1CJW A;  4ZBG A;  3OL4 A;  3F0A A;  2WAF A;  1Z3Y A;  2FT0 A;  2FIW A;  1WK4 A;  2B4B A;  4NXY A;  2IGO A;  5AG6 A;  4C2Z A;  2L7K A;  1KUV A;  3TMO A;  3LSM A;  2XSJ C;  1SQH A;  2JDC A;  2PMZ A;  3J7A Y;  2K5T A;  2Z16 A;  3PSF A;  3UY5 A;  2RRE A;  2WY7 Q;  3DKX A;  2LRD A;  1LFP A;  2A5W A;  5CQE A;  4E7H A;  2BL1 A;  5AG5 A;  2VQH A;  3D2M A;  4XLF A;  2CMP A;  2HNH A;  4B48 A;  3MKY B;  1WJE A;  1Q2Y A;  3FBI B;  4B44 A;  4XOT A;  2HQA A;  2IS4 A;  4PV6 A;  2FUG 2;  4UFW A;  2HV2 A;  1N78 A;  2G0B A;  4RI1 A;  1BR2 A;  5FRN A;  4IF5 A;  4CAX A;  3AKZ A;  3BJ7 A;  3OIQ A;  1WWZ A;  3S8P A;  4NEX A;  1X1A A;  2CUZ A;  1Z4R A;  3IU1 A;  2Z3P A;  3OYH A;  3TOA A;  3LSG A;  1QSM A;  4A33 A;  3IP4 B;  3DR6 A;  3I3G A;  5F48 A;  5H86 A;  1Y7R A;  2BW3 B;  1DGW Y;  4ZJZ A;  1QSN A;  3P2F A;  5KTA A;  3IGR A;  2AQE A;  4II2 A;  3LFU A;  4XON A;  3DU5 A;  4A31 A;  4CYQ A;  2R7W A;  1MND A;  2LOO A;  3RCO A;  1PU9 A;  4N4O B;  5F46 A;  4BE1 A;  2Q4V A;  5HNH A;  4MHD A;  1L0C A;  1K6Y A;  3FKJ A;  4OAY A;  4D1Q A;  3E0J B;  2YNC A;  4R9M A;  4IQ4 A;  1PYV A;  2D4O A;  1MNE A;  4E4H A;  2REF A;  2ZPA A;  3HKZ A;  1LKX A;  4E7S A;  4C7H A;  3QYE A;  2IL4 A;  3H4Q A;  4Q38 A;  2Q44 A;  2WSA A;  2AJ6 A;  3FB3 A;  2CNT A;  1E0E A;  3LSI A;  4B43 A;  1NG6 A;  2ZXI A;  3H9J A;  4C2X A;  2ZW4 A;  3W91 A;  3ZRG A;  2Z3O A;  1J09 A;  3F9K A;  4UCM A;  4RMN A;  2OUM A;  4PSX A;  5AG4 A;  4OAE A;  1QST A;  3NWT A;  1OLT A;  2ZXH A;  4E7K A;  2OB0 A;  3OR2 C;  4U7B A;  4IZZ A;  1Z3X A;  3VWE A;  2LRE A;  3FBN B;  3S6G A;  2YNE A;  1AA7 A;  4C30 A;  2B5G B;  2KQR A;  4LIU A;  1N77 A;  1D0Y A;  3HL2 A;  2R7S A;  1M4I A;  5HH1 A;  3S6H A;  4PFO A;  4KUB A;  4B12 A;  2D4P A;  3K10 A;  3A1Y A;  4PJN A;  4BQN A;  4GS4 A;  1V5G A;  4PJM A;  3TBI A;  4ZC3 A;  4BAC A;  2VZZ A;  1D1A A;  4AG7 A;  2BSW A;  4XKW A;  1Y56 A;  4NC8 A;  1MJ9 A;  4XNH B;  1Y9K A;  4BJ5 C;  1D1C A;  4XOP A;  4BEH A;  2BOL A;  3H5N A;  4HNT A;  2XF7 A;  2IS6 A;  4CGP A;  3LMM A;  2PR8 A;  3EUA A;  4B11 A;  2VIX A;  1SFK A;  3U21 A;  2IGK A;  4C2T A;  1B87 A;  4OWR B;  3R1K A;  4KIS A;  2W4S A;  2K9M A;  2Q1Z B;  2HQY A;  4R79 A;  4XKV A;  2WB1 A;  2XDV A;  2J8M A;  1YX5 A;  2I00 A;  4LUA A;  3SHP A;  4XPK A;  4HNU A;  4AVC A;  1LDK B;  3SDB A;  2MD0 A;  3OYJ A;  5E96 A;  1QSR A;  4XQF A;  3OS1 A;  4KOY A;  4ZDL A;  2K3P A;  4R57 A;  2YNC C;  2WAE A;  2WBM A;  5HOO A;  4C9Y A;  2ZW6 A;  5GCN A;  3IAS 2;  4RM3 A;  4Q36 A;  4YEJ A;  3EUK L;  4CCL A;  4NCZ A;  4CYN A;  3HXL A;  3OR1 C;  3D8P A;  1D0Z A;  2OC6 A;  1U6M A;  5FRO A;  4A32 A;  4YFJ A;  2V9K A;  4CGO A;  4RS2 A;  2A4N A;  4II3 A;  1Z4E A;  1YX0 A;  4U9Z A;  1YX3 A;  2KRC A;  4F52 A;  1MJA A;  4YRH A;  1BR4 A;  5J8F A;  3FIX A;  2X1D A;  5FRM A;  3H5R A;  1DP3 A;  3PGP A;  4X5K A;  2K5C A;  3PP9 A;  2WPX A;  4HSR A;  4P5O A;  2VJI A;  4QB9 A;  4DOZ A;  4M3S A;  4PK2 A;  3GKR A;  4CGM A;  1XIX A;  2Y0S A;  3PNY A;  4J00 A;  3UR3 C;  2PRB A;  3CXS A;  2R7T A;  5DWM A;  1G8X A;  3JUW A;  4HEA 2;  3MKW B;  3F8K A;  3QYB A;  2F5V A;  5F49 A;  2FCK A;  2DXQ A;  3ONQ A;  4XMY A;  1J4J A;  2OZU A;  2PC1 A;  4PK3 A;  4UFV A;  5FVJ A;  2BW3 A;  4EAT A;  4F91 B;  2Z3L A;  3QAH A;  2L9N A;  2Q04 A;  2VXZ A;  2P6F A;  3L2Q A;  5HNF A;  4JJX A;  4KSA A;  3T9Y A;  3W2V A;  2X85 A;  4PUS A;  3P2H A;  3E1S A;  4UWJ A;  4IUS A;  4JWP A;  2M4G A;  2V26 A;  1GHE A;  1K4J A;  1NE9 A;  2Z0Z A;  2FE7 A;  2R7H A;  2P0W A;  4ORF A;  2KP6 A;  4BQQ A;  1DGR M;  3MKZ A;  1BR1 A;  4BJ6 C;  3W6S A;  3KYL A;  1PJR A;  4KOW A;  2UV1 A;  4BBH A;  4B10 A;  4H89 A;  3DEE A;  5EBV A;  2LH9 A;  4XKC A;  4KS9 A;  2M4K A;  3DTI A;  2XC7 A;  4R3L A;  4HPQ A;  1NG7 A;  4DJA A;  4CCN A;  3OY9 A;  2GIV A;  5A28 A;  3TE4 A;  3M1C A;  1S9H A;  5CPR B;  2XF6 A;  3DWL E;  4K30 A;  4MFZ A;  3L2V A;  2OZG A;  1WJB A;  5TGT A;  5HVQ C;  4MFP A;  3OYF A;  2Y0M A;  3K4J A;  3PJR A;  3K9U A;  4QPQ A;  3OOU A;  2L2O A;  5CNP A;  3S93 A;  3S3M A;  2G3T A;  4F0X A;  2Z3K A;  4YEL A;  4BL0 B;  3BLN A;  1ZO0 A;  2W82 A;  2KPM A;  4UA3 A;  2E60 A;  2J8R A;  4ONU A;  4YGO A;  2QEC A;  2Z10 A;  2B5G A;  2QKM B;  2DCE A;  4B5P A;  2CW7 A;  2M7A A;  4FAS D;  4KIT B;  1I21 A;  1S3Z A;  4XLC A;  1MMG A;  1LVK A;  1M4D A;  4KVM E;  3MGD A;  4XM3 A;  3OS0 A;  2WUU A;  2DPS A;  4XLA A;  5LFA A;  3I9S A;  3CZ6 A;  2FXF A;  2AQF A;  2V4J C;  2LBF B;  3SYT A;  2Z3N A;  4M85 A;  3RYO A;  1NSL A;  4BDY A;  2ELJ A;  3R9G A;  5G22 A;  2R98 A;  3VSL A;  2DT6 A;  4CGN A;  2JUG A;  4PK4 A;  1ON0 A;  1TT0 A;  2X51 A;  2MYS A;  3PUB A;  3OYC A;  3AL0 B;  3K4N A;  2RC4 A;  3CP2 A;  1ERD A;  4JXQ A;  4MI4 A;  3BC8 A;  2CH0 A;  4QC6 A;  5KNL A;  4UBR A;  2Q7B A;  4BMH A;  4XNF A;  2FS5 A;  4MY0 A;  4QPO A;  3LD2 A;  1TZL A;  4HG2 A;  3RPU D;  2Q2E B;  4PJJ A;  1I1D A;  2BEI A;  3EFA A;  3T90 A;  2VKH A;  4IKF A;  1M4G A;  4HST A;  4KOX A;  4CAF A;  1X19 A;  1GLN A;  3DPU A;  2OV7 A;  3KX2 A;  2E1M C;  4NC7 A;  2GAN A;  2PQ8 A;  1MJB A;  2MFZ A;  4R87 A;  4OAD A;  1M1D A;  1NMT A;  4DNC A;  2VQC A;  4BGD A;  1BOB A;  4CZC A;  1OZP A;  4KLV A;  1R57 A;  3DKY A;  3K4L A;  3FXT A;  2PJR B;  3AFH A;  1FMW A;  3EPZ A;  1Y6I A;  3QOD A;  4J01 A;  1P4N A;  2JVG A;  3H9G A;  2KMU A;  5HMN A;  4B14 A;  2A6T A;  2UUZ A;  2KDO A;  1IRX A;  4Y4R A;  3OYB A;  2E5N A;  2L9S A;  2R8V A;  4XPD C;  2LY1 A;  2JVH A;  1T95 A;  4G6T B;  3VYT B;  1D1B A;  3DLA A;  3OS2 A;  3HOS A;  2HVS A;  5ISV A;  4XNH C;  2M7B A;  3A4C A;  3W2W A;  3H35 A;  3C26 A;  2B4D A;  3GBG A;  2PSW A;  4CRY B;  3OMY A;  3W6X A;  4F6A A;  1Z9U A;  2I79 A;  4XN0 A;  3K4K A;  2VZY A;  3D5S C;  2X7B A;  3PNT A;  4X0G A;  2JEV A;  1N71 A;  3UNG C;  2VAS A;  1IYL A;  3BJ8 A;  2DPT A;  1KON A;  3BCB A;  3W2A A;  2OU2 A;  3KKW A;  2CV2 A;  3C2H A;  2DXI A;  3CXQ A;  2DOA A;  5IX3 A;  4HNY B;  3IAM 2;  4BU2 A;  4H6Z A;  2W00 A;  3SXO A;  3TO7 A;  2M0M A;  3ZCO A;  4CS0 B;  3K70 C;  2W7N A;  1WJD A;  4B13 A;  3MMY B;  1W36 C;  1KUY A;  2UWM A;  4CYP A;  2O5R A;  2B3V A;  3HG9 A;  2ZSI B;  2CNS A;  1DQU A;  1T0F C;  2VL8 A;  4XN3 A;  3RQ4 A;  3S32 A;  3AL0 C;  2CNM A;  4MY3 A;  2IGM A;  4CUG A;  2ATR A;  3HUG B;  3L2U A;  4KOR A;  5A27 A;  1WJF A;  4XKB A;  3IWG A;  4OLL A;  2V1N A;  4E8O A;  4YRV A;  4KOT A;  1S60 A;  5C82 A;  1VKC A;  4CH7 A;  3FRM A;  4Y49 B;  4CSW A;  2R4G A;  3SZG A;  3EY5 A;  2QKL B;  2O28 A;  3ZR8 X;  2CW8 A;  3NWS A;  3L2W A;  4BDZ A;  2IS1 A;  4FD4 A;  4MFL A;  3EC4 A;  4PJL A;  2VXD A;  4RM2 A;  1X4P A;  4CAE A;  2PR1 A;  3OYD A;  2E5Z A;  3LL7 A;  4H4K C;  4BE2 A;  2VJJ A;  1X1B A;  2X6Y A;  2F4I A;  2HZD A;  3TL4 X;  3BG7 A;  1MMD A;  4F55 A;  5LD2 C;  2X6W A;  1VHS A;  4FD5 A;  2ZFU A;  1V5F A;  2VI7 A;  4HNW B;  3S3O A;  1TIQ A;  1QU3 A;  4B3X A;  4ZDP A;  2R7U A;  3DR8 A;  3EXN A;  3NE7 A;  3DPL C;  1YRE A;  1B6B A;  3PSI A;  2VQL A;  3K4B A;  2AE6 A;  3CXP A;  4QVT A;  1Q2C A;  2ZSH B;  4E7L A;  2KLO A;  3SEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...