4PSXA

Crystal structure of histone acetyltransferase complex
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
313
structure length
313
Chain Sequence
KPETWTSSANEALRVSIVGENAVQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDSVTFKPYVNVKYSAKLGDDNIVDVEKKLLSFLPKDDVIVRDEAKWVDCFAEERKTHNLSDVFEKVSEYSLNGEEFVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLLNKKTKELIGFVTTYKYWHYLGAKSFDEDIDKKFRAKISQFLIFPPYQNKGHGSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKLGYDAVFQKHSDLSDEFLESSRKSLKLEERQFNRLVEMLLLLNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Histone/transferase
molecule keywords Histone acetyltransferase type B catalytic subunit
publication title Hat2p recognizes the histone H3 tail to specify the acetylation of the newly synthesized H3/H4 heterodimer by the Hat1p/Hat2p complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 98
structure length 313
sequence length 313
chains with identical sequence D
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2014-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4psxA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4psxA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 4psxA01
1U6MA 5EC4A 3F8KA 1M44A 4AVAA 2PRBA 4QUSA 2ZW6A 2JDCA 2FT0A 2J8RA 3DSBA 2BL1A 4YFJA 2OZHA 4R87A 2FSRA 3TCVA 4EVYA 2J8MA 4NCZA 5IB0A 1S7LA 3JVNA 1BOBA 1PU9A 1S7NA 2EUIA 3PP9A 4Y49B 2ZXVA 3DR8A 4UWJA 3IGRA 2AJ6A 2VZZA 5H86A 4H6ZA 4PSXA 3TFYA 3D2PA 5F49A 3C26A 3S6GA 4JWPA 2FL4A 4HNXB 4MJ8A 4KOUA 3R96A 1IIDA 3EXNA 3F5BA 1ON0A 3GYAA 4AVBA 5DWNA 3QB8A 2BUEA 1Z9UA 3IWGA 4CAWA 5IV0A 2Q0YA 3TOAA 5ISVA 3FB3A 4II9A 1I1DA 2ZW5A 4YRHA 3F0AA 4U9ZA 4UWIA 2FIWA 5KTDA 4KOSA 4KOYA 2JDDA 1WWZA 3LD2A 4M85A 1Z4RA 1Y9KA 4QC6A 4MY0A 3R9EA 1S7KA 2O28A 3TO7A 2Q4YA 1B6BA 1NSLA 3BLNA 1Z4EA 2D4OA 4XPDB 2VQYA 1TIQA 2OZGA 3DNSA 2WPXA 1MJAA 1IYKA 4AG9A 1Y7RA 4FD7A 2B4BA 3QAHA 2Z10A 3TO6A 2BSWA 1IB1E 3K9UA 4HNWB 3SXOA 1YVOA 4JD6A 5KTAA 3BJ7A 2JLMA 5HMNA 4FD5A 5C82A 5JQ4A 1WK4A 2HUZA 1GHEA 3S6FA 1XF8A 2VI7A 1Q2DA 4E2AA 2G0BA 1YREA 1S7FA 3G8WA 1MJ9A 4KUAA 1QSNA 5F48A 5E96A 2QMLA 4M3SA 2K5TA 4U9YA 3LODA 3TTHA 3R9FA 4KORA 3H4QA 4QBJA 2ATRA 3VWDA 2HQYA 2B5GB 4HNYB 3W6XA 3FYNA 4HKFA 2G3AA 4KLWA 1M4IA 3N7ZA 2ZW7A 4PK3A 4B5PA 1P4NA 1NMTA 4LUAA 4NXYA 4E8OA 3GY9A 4L8AA 1S60A 1S5KA 4OLLA 2B3VA 3W91A 3V8IA 1Q2YA 3JUWA 2PR8A 4R9MA 1R57A 3T90A 4XNHC 2FCKA 5HH1A 2B3UA 4PK2A 2FS5A 1BO4A 4FD6A 1QSOA 2Q04A 1IICA 3FXTA 4MHDA 2ARHA 1M1DA 4IF5A 3DDDA 4R57A 2I79A 2CY2A 2RC4A 4GS4A 1QSTA 2IL4A 5GCNA 2ZW4A 4MI4A 2R1IA 2VXKA 2P6GA 1B87A 1YVKA 4JXQA 3CXSA 3R95A 4I49A 2PC1A 2PDOA 4CRZB 2R8VA 3GKRA 1SQHA 3TT2A 5J8FA 4QVTA 4J3GA 4PV6A 1PUAA 2QECA 5JPHA 3P2FA 3PZJA 1MK4A 3T9YA 3I9SA 4B5OA 5IX3A 2CNSA 4PSWA 3S6KA 2Q44A 4AG7A 3EFAA 1LRZA 3PGPA 3EY5A 3NE7A 3DR6A 2FE7A 4MY3A 1YLEA 3W6SA 3SHPA 4H89A 4XPKA 2B4DA 3B8GA 5F47A 2P6EA 1Q2CA 4KVOE 2B58A 1M4DA 1KUYA 1S3ZA 4KVXA 3CXQA 5DWMA 1I21A 5H84A 4R3LA 1IYLA 1CJWA 1QSMA 1YK3A 4ORFA 1YR0A 1I12A 4FD4A 3MGDA 4KLVA 4KUBA 3UY5A 2H5MA 4L89A 4JJXA 2GANA 2REEA 4IUSA 3TO9A 2OH1A 2OZUA 2WPWA 3SXNA 3FRMA 4KOTA 1YX0A 5I0CA 4YGOA 2Z11A 4U5YA 2I00A 3R1KA 4JXRA 3FBUA 1XIXA 2B5GA 2OU2A 1RXTA 4OADA 2EVNA 3D3SA 4KOVA 4CS0B 4Y49C 3CXPA 4UA3A 4R3KA 2DXQA 4CAXA 3OWCA 4KZTA 4XNHB 1N71A 1VHSA 2HV2A 5KTCA 2AE6A 2FIAA 3TE4A 2JEVA 2R98A 4E0AA 2VBQA 1Y9WA 2VEZA 1J4JA 2REFA 2ZPAA 5CNPA 1YGHA 5F46A 2GIVA 5EBVA 1M4GA 2PSWA 2NMTA 1FY7A 2G3TA 3S6HA 1KUVA 2FXFA 4UBRA 1VKCA 3I3GA 3BJ8A 4K30A 2D4PA 1UFHA 2A4NA 4X5KA 4ZBGA 1XEBA 5C88A 1K4JA 3KKWA 1QSRA 3FIXA 3TOBA 4CAVA 3P2HA 1V0CA 1XE4A 3EO4A 4XPDC 3RYOA 3ZJ0A 4MBUA 2Q7BA 1CM0A 3D2MA 4QB9A 1OZPA 2BEIA 4DNCA 2CNMA 3WR7A 3E0KA 2KCWA 4NF1A 1MJBA 5FVJA 3FNCA 1RO5A 2Q4VA 4H6UA 2CNTA 3G3SA 2B4DB 4KOXA 4NSQA 4BMHA 2VZYA 2Z0ZA 4F0YA 1P0HA 2OB0A 2GE3A 2X7BA 1KUXA 4XPLA 2R7HA 3ZZIA 1L0CA 1NE9A 2F5IA 4RI1A 3R9GA 2P0WA 4JLYA 3VWEA 3EC4A 2PR1A 1XMTA 2C27A 2J8NA 2P6FA 4KVME 4KOWA 4LX9A 4F6AA 4NEXA 3D8PA 4AB7A 4CRYB 4OAEA 4B5PB 4RS2A 4ONUA 2PQ8A 4AVCA 5J8CA 2QIRA 2Y0MA 1KZFA
chains in the Genus database with same CATH superfamily
2CWEA 4LG0B 1BPMA 3S14J 1U6MA 3F8KA 4B44A 1AWCA 2VQGA 2XUBA 1M44A 2AFUA 4XRSG 1A5JA 1R6RA 2CQQA 2JRTA 5HS9A 2CQ7A 3BG3A 3JTHA 3WHBA 4ABZA 2JDCA 1KQ9A 3GF2A 3HKZN 4ZYEA 3SJFA 3GEZA 2J8RA 1R9TJ 2KRHA 3IL2A 4W97A 4CZZA 4JZ0A 3L00A 3DTIA 4ZX9A 1J09A 2QM3A 3LQQA 3CCMI 4EGZA 3ISZA 3ECHA 5GTIC 3PB7X 3TCVA 2MA3A 4UFVA 2DFHA 2G7UA 3DFGA 3JRCA 4NCZA 5ED4A 1HF0A 1ETQA 2KDZA 1HLVA 3WTXC 3SI0A 2M4GA 3QP6A 3PP9A 2EIMH 4LLLA 1A2ZA 2V1UA 2ZXVA 3VB2A 1ARMA 5HXDA 3DR8A 4OIRF 2COBA 2ZXJA 4M3GA 1UHMA 3CZXA 5J1RA 5GAHJ 3HTUA 1U0JA 3UKGA 1ZLHA 1VQ5I 1IXSB 2FUG2 3PB8X 2VKDA 3G1MA 4DBRA 1POGA 2Y31A 3F8FA 3E6BA 1R36A 2W4SA 4BBHA 3CZ6A 4M9ZA 3KZIC 2ECCA 2HZDA 3QYFA 4M71A 2FL4A 2IT0A 2K9QA 2CTCA 1AOYA 3OSGA 4JP0A 3A4CA 1IV8A 3H5RA 4GO1A 1OYYA 5DWNA 1SAUA 4AIDA 3JAMZ 5JI6A 3QB8A 2PE3A 3KP7A 2HVQA 2A07F 4CAWA 2Q0YA 2F5DA 1U5TC 2ID6A 2VQLA 2EA4A 4IHVA 4A3MJ 2ZCWA 1OQYA 1HW1A 2XASA 2ADUA 4RGSA 4YRHA 1K7AA 3F22A 4PQAA 2V6CA 4BD9A 3CDLA 3S1RJ 2FIWA 4OAYA 1ZKGA 4OMZA 3H5NA 4AWXB 1WJEA 1WI3A 5JLWA 4WWCA 1Y8RB 4BE1A 3C2HA 4Y4RA 1CPXA 2M8EA 1YGHA 2HQAA 3Q5FA 4A2ZA 1DP3A 4B10A 2LH9A 2HS5A 4HSRA 1XSDA 1F2OA 2ZSHB 2CUFA 5THWA 4CGOA 4L5EA 2Q4YA 2QYVA 2EWNA 1NSLA 3I56I 2D4OA 1FBQA 3KHXA 3LSTA 2EZLA 5D5WB 2NXNB 2QSFX 3QWLA 3HOUJ 2Z3KA 1VNDA 2R7FA 3ZRGA 2JN6A 2PX9A 2L3DA 2CYYA 3H5AA 4HX7A 3GFJA 3SDBA 2XROA 4P4JA 4EJUA 2KRFA 1QHHD 4AG9A 1BM9A 4E70A 3GTGJ 4HX8A 5JH9A 3H3VK 1TT0A 2H1KA 2H94A 2O9LA 3FX6A 1TNTA 3MKLA 5IP7J 6CPAA 3PO2J 5E79C 2WA0A 1YW8A 2KIQA 2KISA 2PJRB 4MHZA 4WJBA 1OKRA 4E7KA 2XKPA 2JA8J 2PMZN 1K61A 3CTAA 2XAHA 5C82A 3ML6A 1WK4A 2Y0SA 4B6ZA 1OR7A 3PM1A 3S2DJ 1BR2A 2VI7A 2O7OA 1XTAA 2LFBA 3NH4A 1KQ8A 4ZDPA 1MJ9A 3RI4A 2V77A 3WU1B 2ZEGA 3JSOA 2VJIA 4KUAA 4RB1A 4JYWA 2OTLI 4XOTA 4IHXA 3HOXJ 4DGWB 5E96A 4MHGA 2QMLA 3R0JA 3OS0A 3DV8A 4ONWA 2K5TA 2ME0A 3AG3H 5K8OA 4KN4X 3LODA 4CGNA 3R9FA 2D1VA 1UWYA 3FKJA 2HXIA 3VWDA 4WX9A 2AS5F 4U88A 1FSEA 4ZC3A 1MH4A 4BQOA 4ZYHA 2C6YA 2HQYA 3L2NA 4KIGA 2W57A 2B5GB 5IT9K 2EK8A 3L2QA 2W1OA 4PXEA 2QSHX 3V7CA 1IUFA 2DT5A 2TCTA 1PDNC 1V5GA 5JR3A 6PAXA 3HUGB 4HKFA 3H1CA 4NJRA 2M34A 1G8XA 2J5PA 1M4IA 1E17A 4BUPA 1YW4A 2PJ4A 1XGMA 4B5PA 1P4NA 3ULQB 1MIJA 3OYFA 1IV6A 1EE3P 4NXYA 3DKWA 1S60A 1DE4C 4OLLA 4PJLA 5HLTA 1ARLA 2JSCA 1MDMA 5LYLA 3W6KB 3L1PA 1P4WA 3OIOA 2BW3B 4R9MA 2C6CA 2DTRA 5L3BA 4CXFA 2LP0A 5GAEJ 1BPNA 4MHYA 5HH1A 2HQNA 3IRQA 1FIAA 4XQFA 3A0HC 4MNUA 2FOWA 2VBYA 2GZWA 1BO4A 2UUZA 3HHGA 4S0HB 2HYJA 2CO5A 2V1NA 2ARHA 4RM3A 3OYDA 2CXAA 3DDDA 2XVCA 3CDHA 4XM3A 4QLCU 3CMYA 4CYOA 2EPFA 1BR4A 2I79A 1ETXA 2L0KA 2PJ6A 2W00A 1U8BA 2LG4A 4QWQA 5TRDA 3I59A 2IL4A 2K4JA 1Z0XA 2F48A 3HGGA 1FSHA 2R1IA 4H2KA 2CQNA 3BR5A 4NC6A 1B87A 4R7MA 2M3AA 3V7RA 2O8XA 4HNUA 1D8JA 3PIPF 1FC3A 4L9VA 3REOA 4BHPA 2JQ7A 1IN5A 4OC1A 2HB6A 4DIQA 2WBMA 3NH5A 4UFWA 4D1QA 2PDOA 3JTKA 4K3NA 3CC4I 2R8VA 1JJ8C 1K78A 3GKRA 3VPRA 1YX5A 1UHSA 1XOVA 4YWYA 3EUHC 3GVAA 4MFDA 1YIOA 2V7FA 2A69F 3FF5A 4JOMA 2IS6A 1FBSA 3GLXA 4OMEA 4A93J 1HW5A 1QZYA 4IX7A 4AU7A 3PNTA 2DA3A 5K8NA 3BCBA 2DMUA 4EMSA 3KCCA 4ZY2A 2VKEA 2CG4A 4L5IA 4G7HF 1PP7U 1DU6A 5JPHA 4Y33A 1KZHA 1UB9A 5F6FA 2RV8A 5KAFC 3I9SA 3SZTA 1HDQA 4B8XA 4ZYAA 3MZHA 3DP7A 1JGSA 1WRJA 1IJWC 4A95A 1KU9A 2CNSA 3S6KA 1LEBA 4NJQA 3GZ5A 1LEAA 2NOJB 1LRZA 3J80Z 2COMA 1Q1HA 4HX4A 4BS9A 3D4UA 3PO3J 3F8MA 5DDGA 1RESA 4LB5A 3DR6A 3NE7A 1OR7C 4A0ZA 1U8RA 4G6QA 3IAS2 2YGWA 1F9NA 1JUMA 5CBMA 1KWMA 2FMLA 4XORA 4MY3A 1Z3YA 2H8WA 2VOOA 4V2FA 1A6QA 2DBBA 1Z8LA 3PNVA 4KT5C 3W6SA 3IKVA 1XGSA 3KEOA 1IF1A 3PFOA 4C7HA 3GTJJ 3R0AA 1XDUA 4A3GJ 1VQPI 2GXBA 1X12A 5FRMA 2ESHA 1XN7A 5LEJA 5E3LA 5BMZA 3QYEA 1KUYA 2VBZA 2ZNZA 4CICA 1RETA 1X58A 4N4OB 4I02A 2VE8A 4XONA 3V7SA 1ELLP 4XMYA 2LC2A 4XICA 2BY0A 1TQMA 1I21A 5EZHA 2X51A 1HQCA 4Q48A 3G1OA 1VZ0A 3TP0A 3G73A 4H0EA 1IYLA 1QSMA 2Y30A 1Q7LA 3A01A 1T08B 3OYLA 4P1WA 1ZGAA 3GFLA 1W7PA 3E97A 2ZJRF 2KJCA 3CCVI 3W2AA 3RQ4A 2PJ0A 1I12A 2V26A 3I3LA 3KLOA 4DYQA 1T6SA 3CUQA 2ZOFA 4KLVA 4WXCA 4BGDA 2RB7A 2XIGA 2CFOA 2P7CB 2F6CA 3I64A 2RN7A 1IW7F 3D5RC 1FOYA 3LFKA 2REEA 2WV1A 1ETKA 3TO9A 2DW4A 3DBLB 5FKOA 1LNWA 3ZMUA 3NEUA 4XN3A 4AD9A 3GFIA 1YE9A 2DA1A 4A3LJ 4CAEA 1TLHB 1D5YA 2OA4A 4A3DJ 3MKYB 5F08A 1B59A 2JUGA 3P7NA 4A3JJ 1U3EM 3ABMH 4HZFA 2WUUA 1PUFB 3PJRA 1VF9A 3BZKA 3CDIA 3G2BA 2O3FA 4L9JA 5D8LB 4XBFA 4PFPA 2V8HA 2EWBA 2QZ8A 3VODA 1QGPA 2HGCA 3VEPA 5EGOB 1R49A 4NGNA 1DQUA 4YGOA 3NFZA 4GGGA 4MTEA 3I55I 2L9SA 2KKOA 4JXRA 1F2PA 3FBUA 1XIXA 5EG0A 4YIIA 1RXTA 2AFWA 3H5ZA 2I5UA 1G59A 4OADA 2Z3OA 5FLXZ 5KNLA 3SXYA 1REPC 4CS0B 3QPTA 2KZVA 1QU3A 3OOPA 3PFIA 3WABA 4UA3A 4UEEA 5FJ8J 3K4NA 1HOMA 2RDPA 5LHIA 1YHQI 1VHEA 2CUJA 1D1AA 3OWCA 4A94A 2L7MP 5H6QA 4ZZLA 1DU0A 1H88C 3D7HA 1N71A 5FO5A 3GUXA 1VHSA 4EQQA 1T33A 1WKMA 4PJNA 3L2VA 3ZQFA 2PLYA 1MMDA 2FIAA 4LIVA 3DBRB 1O57A 2FX0A 1ZGWA 1Z7UA 2R7ZJ 5G22A 2E5ZA 3WU0A 2MH2A 3A1YA 3BI0A 1Y9WA 4MFJA 1WQ2A 2JEWA 5EDNA 5EBVA 1XSVA 3W6JB 5LGTA 4BE2A 4RLFA 3GTKJ 1FY7A 2ABZA 3VWBA 2VPRA 1OBRA 1E3PA 2G3TA 2VB6A 4A5MA 1P7IA 1GDTA 1B9NA 2W48A 1ON2A 4HV5A 2BZTA 5J4YA 2MG4A 3A9LA 4MO7A 4P4IA 2QQ8A 2O8KA 2XV4S 4MXUA 4K30A 1FZPB 3S3OA 1UFHA 1V55H 2ISZA 2EB7A 1MZBA 2TDXA 3K69A 3NARA 2GLOA 1S9HA 2K27A 3ZQ7A 4ZGYB 2DODA 2HTJA 5EJCA 1MMAA 2O53A 5FKLA 3SZPA 1ZREA 5HVFA 2Z16A 4EVIA 2DDAA 4BHBA 3H8GA 3MAJA 3JRDA 3KX2A 4UB6C 1XCVA 4QIWN 3J80K 3RPUD 4ENKA 1YQEA 5CVIA 1XE4A 2CV1A 2HDCA 3EO4A 2BHYA 1I3AA 3O8GA 4XPDC 3ZJ0A 3BC8A 4MBUA 1CM0A 3IAM2 4NGMA 3D2MA 2FXAA 4F91B 4A5NA 2VC0A 3KI9A 3RKXA 4QB9A 2QENA 1IG7A 3G4SI 3GIUA 1HXDA 4BDYA 2BEIA 5HLGA 4LJZF 2PMUA 2RAEA 4C3IJ 3IJ3A 3WR7A 2Z3PA 1O3QA 3KR4A 3CCLI 4IRGA 1YTYA 3FXLA 4F55A 1S3JA 3SEQA 1F43A 1YSJA 4XL9A 2QUFA 3FNCA 1RO5A 2YSRA 1EH6A 3HYIA 1Z8TA 3LACA 2LVSA 2CNTA 2DJIA 4KISA 2O03A 1O3TA 1YLOA 4ZY1A 3OYIA 3WTVC 2PEXA 4BU2A 2Z0ZA 2VJ5A 4C2XA 2O0YA 5KK1A 5EEAA 1SMYF 1QO0D 1HA8A 2R7DA 3X2QH 1P0HA 2GLJA 4C3JJ 2H1LA 3MKZA 4BACA 1K79A 2NRAC 4HF1A 2YNCA 4G1PA 4AYBA 3BY6A 4PXDA 4UIAA 4XN0A 2RQPA 2A68F 5D8KB 4ZDOA 1MBJA 2F5IA 3C1DA 1OFCX 5HDNA 3OYKA 5DCMA 1ODDA 1E0EA 2NS7A 3QQAA 4JLYA 3VWEA 1QQIA 3KE2A 2E1OA 4CYCA 3PEIA 4M6HA 4A3EJ 1X1BA 3K2AA 4LQ6A 3RZOJ 2K9MA 2C27A 3VDXA 2P6FA 3HOVJ 4MLOA 4CHUA 1YRNB 2HZTA 2M9HA 4KICA 1QRYA 4LX9A 4N0BA 1KONA 3KYCB 4OIDA 3JCUC 5DEQA 3RQIA 3D8PA 4NEXA 4CAFA 3TW6A 1LE8B 4CRYB 2AFOA 3ESWB 4C9YA 3ABUA 2Y9YA 1WGXA 3HPGA 3JSPA 1JXSA 4ONUA 3BXMA 2XEGA 2ZOGA 2IA1A 3J7YJ 4AVCA 3K7AJ 3LSKA 4I6ZA 5FLXK 3WGGA 3VATA 2HU9A 1LQ1A 3WTWC 1WVRA 5KHDA 4BY1J 2Q51A 4MCPA 3CJNA 1QZZA 5J1QA 2HYGD 1WWXA 4AVAA 4B09A 3HKZA 3HDDA 3PB4X 1JTYA 1Y6IA 5K7ZA 2WZNA 2FT0A 4CCMA 1ZLIA 4C30A 3EYYA 1ZELA 2E60A 2OUMA 4PGHA 4YFJA 1EH7A 4P96A 3D66A 1OYIA 3RYRA 3FF3A 1J75A 3S17J 4PJJA 4PXBA 2CTBA 2V4JC 4MFKA 1NG6A 1TWGJ 3DLLF 2MBFA 2EUIA 1R7JA 3CCYA 1S7AA 1P92A 3QU6A 3AG1H 3FXOA 3ABKH 4B3AA 1R43A 1GXQA 1Y0UA 4A2UA 4DQ2A 3VYTB 2K3PA 2DFEA 1W0TA 3D7GA 3IGRA 3HSEA 3ZGKA 2AJ6A 5F0HA 1Y0YA 5DS0A 2WWYA 5IB9A 3N5FA 4H6ZA 3TFYA 3D2PA 4A6DA 3TEDA 3S6GA 1SD7A 3S93A 4MHNA 2DT6A 2JT1A 1IDZA 1FYMA 4I09A 1CP7A 2LBFA 4IVNA 4JWPA 1OCTC 4MJ8A 4P4EA 1W5SA 1FT9A 1ETYA 5J4VA 4OC3A 1V5FA 3EXNA 1ON0A 1FNNA 2NNYA 3LWFA 2XGXA 3F23A 2POKA 1O7LA 3H92A 5CVRA 1X3WB 1Z9UA 5B1AH 1VI0A 3COAC 1HEEA 1X1PA 4C2MJ 4EJWA 2R7SA 5IV0A 5ISVA 4GM5A 2R7WA 4II2A 3FB3A 2QQBA 5HVHA 1VIXA 2JA2A 1XMBA 4Y15A 2CMPA 3GLLA 1ZAOA 2ZJPF 2EBJA 4NC8A 5E1ZB 4U9ZA 3BJ6A 4UVAA 1WSUA 4KOSA 5KTDA 1M1EB 2A3SA 5CJ9A 3AL0B 2JDDA 2XGEA 1F4KA 5H20A 2UZKA 1WWZA 3N97A 3TBIA 1EF4A 4M85A 1I6XA 5B1BH 1FPQA 1BL0A 2BY1A 2WTEA 1Y9KA 4P5OA 3CCRI 4M3DA 1X19A 2KIMA 4MY0A 1SD4A 1USTA 2O28A 2ZEHA 2M87A 3HZJA 3MWMA 2QCOA 5F0FA 1DTDA 3BLNA 3FMCA 1MBKA 2V8DA 1Z4EA 3SEZA 2YNCC 4C7IA 2K40A 5TJJA 2DN0A 2PN6A 1XS9A 2ETHA 4ON0A 5CQGA 4M3FA 1JJ6C 2NVUB 1IU8A 2ZSIB 3CMEI 2M30A 2KDOA 1O3SA 2XF5A 1LPQA 3ABTA 3E1SA 2GBYA 2IS1A 3DNSA 2WPXA 2EV5A 2K9LA 3PUBA 3OY9A 1LDJA 4IAVA 1MJAA 1MSFC 1ZYRF 1IYKA 4A31A 3I58A 1SEUA 2HVRA 4FE7A 1HSJA 3BOQA 4Z6YA 2BSWA 2ZC2A 5KCMA 1ON1A 1OCZH 3IWZA 5DV5A 4HNWB 5GTHC 3KQZA 4PFOA 2JK3A 3CF2A 4XLHA 3HOTA 4JD6A 3OYJA 2DPTA 2D1HA 1IRZA 2OAZA 4HV6A 4RGUA 3G6EI 2TRTA 1VQOI 5E1XA 2JLMA 3Q0VA 3HOSA 1CF7A 1VQMI 5JQ4A 3KQXA 3BQYA 2HUZA 4I0BA 3HRTA 1YOVB 3L7WA 3S6FA 1Q2DA 3FEEA 4KJZA 4RB3C 3FKIJ 2G0BA 1S7FA 3H0DA 2XPWA 4GXHA 4XRMA 4BEHA 4B4CA 2IBDA 1NSAA 1QBJA 3PIOF 1GVDA 2JSPA 4LLNA 1QSNA 2F2EA 3I5UA 3PB6X 5F48A 4RMNA 2FMYA 2X1CA 2IXSA 1HW2A 2VN2A 3TTHA 3F8NA 4B3XA 1QPIA 3H4QA 2BVMA 2ATRA 2RKHA 4BDZA 3D1NI 4DYOA 2BOLA 4L9TA 3SFZA 5HVGA 3NWSA 1VQLI 2R7OA 3CCJI 4HNYB 1WHUA 2X85A 1VGYA 3ZMTA 4RGRA 4UEZA 3W6XA 3OSFA 3ELKA 4XSZF 3FYNA 3WT4A 1LANA 1BR1A 3JRBA 2ZW7A 4L0YB 1XDSA 2H8RA 4BJ5C 1H0MA 1NMTA 3K2KA 4LUAA 4MMOA 3OIQA 1FP1D 4E8OA 3J7AO 5C3EJ 5J6XA 4ZDLA 3JR9A 2B3VA 3W91A 1SVOA 2CU7A 5LYDA 1MBGA 3G3ZA 4YFXF 4HQMA 1X4OA 3JUWA 2PR8A 1DPRA 3EETA 2FQ4A 3J81K 2QEXI 4XNHC 2VODA 3DTEA 1BJAA 4PK2A 2ZENA 2P8TA 2EK5A 1QVTA 1YQAA 1QSOA 1IICA 3PFEA 2ZJ2A 4MHDA 3M3YJ 3EDPA 3TDZC 5FKKA 2X6OA 1M1DA 4ZYQA 1RR8C 4BKXA 4RB2C 3K70D 2WB1N 3W6VA 1BJZA 4NFRA 4ENJA 4M6YA 2RREA 1I1GA 3A0BC 1IXRC 3TDUC 2ZO4A 1TQIA 3RYPA 4BBSJ 4P6YA 4P4BA 1YS6A 4GS4A 3TP3A 2F4IA 2VT2A 3BG7A 2NOGA 3K1MA 2NAZA 2FU4A 2W85A 2V6EA 2ZW4A 5AG4A 5CVUA 5E3OA 1XG1A 3FISA 3CPAA 3VYRB 3JTGA 4A3BJ 5ERIA 1QQ9A 2LYCA 2C6GA 3T8WA 4B47A 2PC1A 2DOAA 3D5LA 4UVBA 1YG2A 4RUHA 2W84A 2XGDA 1P2FA 1SQHA 3TT2A 3OYHA 4FX0A 1D0ZA 2JJ7A 5J8FA 2O5RA 5K5OA 4Q4ZF 2G0EA 3K10A 1GV5A 3B6AA 3BR2A 3BTLA 1L3LA 2JBKA 3CLOA 4J3GA 2Q8KA 4F9VA 3PQKA 1YS7A 2F4MB 2DXIA 1IO2A 5CLSA 2DMNA 3KEYA 3DPUA 1VQ7I 2ZMEB 5JHFA 3AL0C 5B3SH 1YI2I 2I3CA 2BXZA 4P4FA 4M6VA 4NC7A 3BQZA 3W2VA 5CQEA 3B2YA 3PZJA 1MK4A 2IGKA 3EUHA 3B3SA 1FOWA 3GZNB 3ZP5A 3U9GA 3C18A 5C4XJ 2EFPA 3FHZA 4HOBA 5LGNA 1J2XA 1GLNA 3IP4B 1PP8F 2DPUA 4XNFA 2R92J 1ZG3A 2IW5A 1JUPA 4MFLA 3PGPA 2CIJA 3LOCA 2G9WA 1ETOA 3EUAA 3ASNH 4XK4A 4UY8I 5ICEA 3VYUB 5DS9A 2FBKA 2L4MA 3FWEA 4GRIA 2MH9A 4LG3A 1UHWA 3CCSI 4R8FA 1Y7EA 3LFUA 1TTYA 4NGTA 4D5CA 2B4DA 1ZG5A 3B8GA 2RNGA 1GUUA 2P6EA 5F47A 2Z1DA 1QHGA 1E3HA 1TF9A 2YR2A 3IO1A 2QKMB 3RJPA 3B35A 2X1EA 4A12A 2PJ7A 2GOXB 3E6MA 4ZYDA 1Z2LA 1YO5C 2DK5A 4MCQA 3S32A 5J40A 4HLYA 4U0YA 2M0CA 3S9MA 3BLYA 4X0GA 2R7QA 1CJWA 2F7VA 2OCEA 5D5XB 3C2BA 3E5XA 5A2QK 1YITI 3BR0A 1YFHA 1W4MA 1XGOA 3S2WA 3BCAA 2CQKA 3MEXA 5IT3A 1YR0A 3IU1A 2A5YB 2YX7A 3I4PA 2VXDA 4KUBA 1IRGA 5ICGA 2JUCA 4HPQA 3IH3A 2DLLA 2LF8A 2Q1ZB 3DF8A 5FFXA 2E2HJ 3S16J 3H0GJ 5JLXA 3T1BA 2XRLA 3BG5A 4ZTFA 2AQFA 1LFPA 3CD6I 3DU6A 1EV7A 4II3A 4HQEA 1JKQC 3RKQA 4KSIA 3K9TA 5D4SA 3FXKA 1BI1A 2OZUA 1SD5A 2WV0A 2DA2A 3KP2A 3QODA 4MGRA 4BH9A 2Z5UA 3OR2C 3CUOA 2H6CA 2CH0A 3OWTA 3BTIA 1EJ9A 2HOAA 2PJ9A 3SXNA 2ICWG 3HRUA 2B7EA 3IKTA 3WC7A 1TXRA 2K85A 3HC7A 1TWCJ 5HNFA 1MDMB 2I00A 2VBXA 5AGEA 1B72B 3SJMA 4F8ZA 4O23A 4FHTA 2H27A 4FUUA 1GVJA 5LD2C 3NQOA 3S1MJ 1WFXA 2OCCH 2OU2A 1FOKA 2B5GA 3B3CA 1IOFA 3DWLE 2EVNA 4CYQA 3LQRA 3D3SA 3KHZA 4KOVA 1Z1DA 2ELKA 4MEXF 3PUFA 2ESNA 3LNQA 2IPQX 1EKEA 2NYXA 5FKMA 3VOEA 2EFWA 4BNCA 1LFWA 3JAMK 3I4NJ 2BOAA 4CAXA 2AFXA 2QVPA 3B3WA 4OKOA 2R7XA 3LAPA 4KZTA 4ZI6A 3HIFA 3IIBA 3BP8A 2OTJI 3N05A 4U87A 1Z8WA 1DP7P 3S15J 5KTCA 3V7ZA 3I59B 1L0OC 1W5CC 4L5JA 1R58A 3CC7I 2E1MB 1FWZA 3GCMA 4HA8A 5BPDA 2Z3YA 5M5XJ 1UFMA 4HF2A 1J4JA 1T98A 1YYVA 2FQ3A 2REFA 5CNPA 2F8HA 3GXOA 4FETA 2KRCA 2V9PA 5GAGJ 2EQRA 1S8NA 1X2MA 3GFMA 1I5ZA 4DOZA 5K1YA 2IGMA 3OYBA 2HVSA 5LEKA 1JI8A 4OC2A 2FD5A 2E34A 1R23A 1K78B 2LSOA 4JQFA 5CKTA 3S6HA 4F7ZA 4MQ9F 4ZJZA 3I3GA 1DGWY 3CP8A 1WJDA 2R0QC 2XRNA 2V9VA 3ZQGA 2P6TA 4LK0F 2HKOA 5LLQA 2EZHA 4GYIA 4X5KA 5A28A 4ZBGA 2DDBA 1SC7A 4RN7A 4EGYA 1RI7A 1K4SA 1XEBA 4WCGA 5C88A 3KKWA 2HDWA 2RNJA 2VBWA 1HSTA 3H35A 4X2TA 3TOBA 2EBIA 2IGOA 4P9UA 1CGPA 3FECA 3BR1A 1R71A 2H09A 2WSAA 1BAVA 1OCCH 5TISC 3ZCOA 1HDUA 3KYLA 3BPXA 4ITVA 4GDFA 3KIOA 2ANPA 1ZQ3P 2RQQA 3DEUA 1T0FA 4LMYA 2KL4A 4IPAA 1T38A 3KP6A 2ZEDA 4R79A 1KU7A 2UXXA 1W5TA 4ESJA 3S3NA 3WGIA 1EH8A 4J00A 3FMRA 4UCNA 2V79A 3FVLA 2QBYB 2KIFA 1CPSA 4CCJA 2DTZA 2IA2A 1G3TA 4NF1A 1JKOC 1OISA 2V1XA 5FVJA 3KASA 3E3VA 3AFHA 3RPQA 5DUIA 2M8GX 2V8GA 1MBHA 5EZGA 3I9V2 1ZARA 2XPVA 2ME6A 4IRIA 5HLIA 1Y1VJ 2NS8A 4NBQA 1B6AA 3FMSA 2OB0A 5DCFA 2GE3A 2OV7A 2LOOA 1KUXA 1AU7A 4XPLA 2DYSH 2DA7A 3NH8A 2VE9A 4OIOF 3LA7A 3A01B 3HOZJ 3RZDJ 1CQTA 2DCEA 2PCUA 1R4NB 3ECOA 1L0CA 1W7PB 4I99C 3BT9A 3K4LA 2KZGA 4XKWA 4XSXF 3GMEA 4OIPF 3H36A 3VSLA 4RI1A 4XOPA 1RRJA 1HC8A 2PIYA 1OJLA 3WU2C 3Q0WA 1P6RA 2KFDA 2V8VA 2LK2A 3FZVA 1RKWA 3ASOH 3JRGA 1T56A 4AC0A 2HEOA 4OC5A 2CV0A 3OS1A 4YIRX 3LA2A 2PJ2A 4A33A 2VPLA 2LY9A 3F9KA 2Z3NA 5IYBJ 1ULYA 1GXPA 3CPXA 3V38A 1VFCA 3M8EA 4OAEA 1XBUA 3HJEA 4RS2A 1STZA 2IGNA 4LITA 4PCQA 1YW6A 2DEAA 5L3CA 2JPCA 4IO9F 1S7EA 2F5VA 3WC5A 3L2CA 3S3MA 5BWAB 3HGYA 2ELHA 1KU3A 4OU0A 3HSRA 3MN2A 3WTSC 5EC4A 4PGGA 1VQ6I 5EG0B 1VQNI 3M8FA 4IRHA 2W7NA 4FAIA 2ZW6A 2GXGA 2B0LA 3RKWA 4EJOA 2XAJA 2PVWA 3Q9VA 2VQCA 5FLMJ 1XRYA 3GX4X 2BL1A 2OZHA 3L9FA 2Z2SB 4R87A 4RM2A 2GU2A 2FSRA 4P10A 1IN7A 4EVYA 5L3FA 3HEFA 2LD5A 3DTKA 4Q47A 2NVQJ 3LAJA 1S7LA 2JMWA 3VSKA 1S7NA 2X6WA 3E5QA 1MKMA 5FFZA 5LHHA 5GADJ 4Y49B 1TWAJ 4AIJA 1ZG8A 1UMQA 2LKSA 1LCPA 3WTUC 2A05A 2EV0A 4M6IA 1PUEE 4NQWB 2DA5A 2M45A 4FWUA 1MMGA 3I54A 3DU5A 2Q7SA 3HB9A 2ZNYA 5K5QA 1Z7LA 3D0SA 3R60A 5DM7F 2O6GE 4PZJA 3KP5A 5GPCA 4E7IA 2DU9A 4CGLA 4Q38A 3IH2A 1S72I 2VC1A 5J1UA 2LMDA 2GXAA 5E8IA 1TZLA 3GYHX 4IOAF 5AG5A 3JREA 1LAMA 4UUSB 3D68A 1TNSA 4DYRA 4KOUA 1IIDA 3R96A 3F5BA 3K70C 1OMIA 2X4HA 4A37A 2R7UA 2XF6A 4Y3OA 5IOYA 2E71A 2VOPA 1K6YA 1WCMJ 1T0FC 2NS0A 3IWGA 2BGCA 2PVVA 4WK8F 2MYSA 3CDXA 5F09A 3PQJA 4DJAA 1GYTA 3WE2A 3FXQA 3M4OJ 5JVGF 4II9A 1BC8C 1I1DA 1N75A 5HLHA 4HG2A 2X0LA 3CC2I 4KOYA 2R5YA 2XAFA 2GA1A 4UFXA 5IYDJ 5H2FC 2P5LC 1MBEA 3LD2A 1Z4RA 3H9JA 2HNHA 3P9IA 1R5HA 4UUTA 1NH3A 1ERDA 3QPLA 4QC6A 1S7KA 3TO7A 4R8HA 3CCQI 4M3EA 1YMEA 4Y13A 3TW7A 5DYMA 4XLCA 3SZGA 4FX4A 3GUDA 3FXJA 4JX6A 3ZQQA 2O61A 2KIUA 1DPUA 5DD4A 4IK2A 2DMPA 2JVHA 2KPMA 3EPZA 3FXMA 4BBRJ 2VASA 4BQAA 2GWRA 5JVTA 2VQYA 5I4MA 1XMKA 1TIQA 3FXUA 2OZGA 2XPUA 2EA2A 4CUGA 2FE3A 3O2PE 4HDVA 2LY1A 3SI2A 3D5SC 5AG7A 1Y7RA 2M7AA 1AA7A 2B4BA 3QAHA 4KDPA 4KNYA 2Z10A 5IOZA 2L9NA 3QNVA 4IF4A 1F5TA 3GTLJ 4NGQA 3K9UA 4XLAA 1IRXA 3OYAA 2QA4I 5DCMB 2XSJC 4Z2YA 4EM2A 5JM6A 5KTAA 3FBIB 4HEA2 3BJ7A 4CYCB 1E3OC 2G7HA 1MMSA 3QAYA 2CFXA 3H3UA 3M9AA 5HMNA 2MFZA 4FD5A 4MHPA 1AMPA 4MFEA 2P7VB 5LRJA 2CGPA 4E2AA 5TGTA 1XF8A 3H3ZA 2DO7A 4U0WA 4KN7X 1VQ8I 2EO8A 4A39A 5E3MA 1BN5A 4LLGF 2EJRA 3E7LA 3LSMA 3JRHA 3HRSA 3ZQCA 2V9KA 3T5XA 4RS8A 2IS2A 3BROA 4KS9A 4X1EA 5FROA 5HS8A 3KZZA 3PFYA 3PNYA 2DQRA 1A04A 1ZRCA 4KORA 1NK2P 2RVCA 4QBJA 3IC1A 5FB2A 3F8CA 3CCUI 3O6BB 2OD5A 4RGXA 4C2TA 1B9MA 4LOCA 2HPMA 1IUYA 4D5FA 4NHJA 5HS7A 2ZXHA 1Y0NA 2QVOA 2FF4A 4UEFA 4FT8A 2WC2A 1WJAA 2FEZA 5B5EC 2G3AA 1IRFA 4UCMA 4PK3A 4C2YA 3LL7A 1KYWA 2HDDA 1B4AA 3GY9A 3KPHA 3N4MA 4A3IJ 4AVZA 1S5KA 5KVRA 4NGRA 4HSTA 1IGNA 3F72A 3ONQA 3IWEA 1Q2YA 3V8IA 3K4JA 2EIKH 1ZG1A 3H8EA 3E0JB 3FM3A 4A0YA 3L2RA 1G4DA 1GHCA 2Q2EB 3S1NJ 2H6BA 3HBLA 2E1NA 3MFKA 1HBXG 3FEDA 1KYZA 3QPHA 4E4HA 3IHUA 2ZJQF 4X8IA 5FD6A 3DCFA 1USSA 2C1CA 4UIBA 4UV9A 4OINF 2FS5A 4BY7J 3D7FA 2R93J 4FD6A 3NRVA 2XDVA 2DAOA 1U9NA 4D9JA 3PL8A 4G7OF 3GTMJ 4IF5A 3OOUA 2PFBA 2RFHA 5HDGA 1TKJA 1D1CA 4R57A 5IP9J 2VONA 5ILVA 3HXLA 3BZ6A 2OPTA 3OIPA 4RAFA 2LBFB 4MEYF 2QKLB 1Z3XA 4AUXA 3HOWJ 3IWWA 1S5LC 3ISXA 1BIBA 1DUXC 3KETA 5A27A 3RTRA 1YLFA 3DKYA 1G3YA 5GCNA 1I1SA 4MI4A 4ZZDA 3RDIA 1ZLKA 2VXKA 4UCPA 5IP6A 4CH7A 5F1RA 2XHKA 2YNDA 3Q0UA 3MZ8A 2L02A 1B8IA 3V8LA 1LFUP 4E7SA 4RA2A 3BPVA 1S7OA 3FDYA 4I49A 4Y7NJ 2ZELA 3P9KA 2DOEA 5DM6F 2GA2A 2A5WA 4B12A 5D6EA 4OWRB 1NHAA 2L5QA 4EJTA 4CCNA 3DLAA 1U5TB 1JWQA 1YIJI 1LVKA 4N9HA 1PUAA 3VYSB 4MTDA 3MRUA 4XLNF 2Z99A 2KP6A 1I6HJ 2QECA 3BHXA 4DJLA 4JYKA 3P2FA 4ETSA 3B7IA 3BR6A 3IWFA 3QU3A 4KUMA 2DK8A 4RAYA 1S29A 2DJNA 1O7FA 4PSWA 1UG2A 3OYEA 4KSAA 1E2XA 2VXZA 4BHCA 4OIQF 3EFAA 2PJPA 2X48A 5IPAA 3NAUA 2Q0OA 4M74A 4ANJA 4IQJA 1D1BA 1TBXA 2HOSA 2EK9A 2JTVA 4MFQA 2PJ8A 4B1RA 2FE7A 3CJTB 1R1VA 3DEWA 3WTYC 3Q9SA 3F21A 1BI2A 4WXDA 3RPUA 1W1WE 2PMZA 4FQGA 4XLEA 4DYCA 4ASNA 2M5WA 3Q3SA 1SVLA 4XPKA 1Z8XA 5FGMA 2HXOA 1CF7B 3ZMVA 3FK6A 1DGRM 1GV2A 3BTJA 2Q43A 4P44A 4B13A 1LDDA 2K9SA 3FBNB 2R5ZB 3R61A 5HNHA 4X3RA 4B11A 4KVXA 2LNBA 1OCRH 3ZOBA 1H9GA 2XB5A 5DWMA 1NG7A 5H84A 4R3LA 3DEEA 4CCLA 1AKHB 1RNLA 4FISA 4JK1X 1X2NA 2EFOA 5F1JA 4OIWA 3I71A 4EM0B 4YRVA 1JKPC 4IHSA 2VKVA 5G20A 2V1DA 4HBLA 5LHGA 4IZZA 4Q36A 1ZR2A 1YX3A 4UNOA 4NNJA 4FD4A 5G1ZA 3QOPA 1R22A 3MGDA 1ITYA 4KYWA 3UY5A 4CGPA 3DKXA 2GAUA 3J7AY 5B66C 1LFBA 4HW0A 1MW7A 4G6DA 1WJCA 5CVVA 3CP2A 2PMHA 2E19A 1ETVA 3CLQA 2OH1A 2YPRA 4UB8C 3KFWX 3BI1A 4C3HJ 1G3WA 4BYYA 2GQQA 3DPTA 3I4MJ 3LSRA 2GIZA 2WPWA 5E20A 3ZMZA 2DF5A 5AG6A 1O4XA 3FMQA 2OC6A 4L18B 1D5VA 4ZX8A 3V8KA 1YJWI 1RUOA 4AVPA 1KGSA 2QF7A 3K1PA 5H6RA 5I0CA 1T95A 4JX5A 4XKBA 4KA4A 1SAXA 1ZG9A 5J47A 1MH3A 3R1KA 5D29A 3OYCA 3HLPA 3M7GA 5L3DA 4A38A 1XB4A 2D2WA 4Z65A 3NWTA 1WJ5A 4LG0A 5EF6A 1T39A 1BIAA 5HDKA 3JRAA 2LTPA 3S2HJ 1LKXA 2FA5A 2BY3A 3GZ6A 1PYTB 4YFNF 3GLJA 2R4GA 2AXLA 3IC7A 2M2EA 3KP4A 1XJOA 3H8FA 4C68A 2E7XA 4F3QA 3CXPA 3RIRA 2AXTC 3BTCA 1C0WA 4P9FA 2CW0F 1CG2A 4ESFA 1TC3C 2I8DA 3F6OA 5C44J 4Q5SF 5IT9Z 3KL9A 1A6IA 3PB9X 1MBFA 4KFCA 4NDLA 1RIOH 5ICFA 1Y56A 4Q7AA 4GXOA 2B9SA 2KQRA 2HV2A 4X6AJ 2AE6A 4CSWA 3ISPA 3LMMA 1TF8A 4UF4A 3E5UA 3CMMA 2BV6A 3HTSB 4E0AA 2BXYA 3TGNA 4A0XA 2VEZA 5EYRA 1R00A 3DBHB 5JFRA 4JBAA 4MRIA 1R3NA 2HC9A 3DGVA 5F46A 1M4GA 4RDUA 5LRGA 3M1EA 4A6EA 2NMTA 3RO0A 1TWFJ 4M9SA 1QPMA 3SHFA 4D0PA 3KZYA 1D0XA 3B6CA 4ESBA 5ELYA 1V54H 3WG9A 3AKZA 2VT3A 3OV8A 2VL1A 2HFHA 2OJED 2DA6A 4UBRA 1VKCA 3GWZA 4E7LA 1ZRFA 3LSGA 1XX5A 1A31A 2D4PA 1HCRA 2A4NA 5ICCA 3A2KA 2WY7Q 4XIDA 2D5VA 4CA0A 4M6XA 1N25A 2KHMA 3M07A 1K4JA 2ID3A 2ISYA 1OPCA 1ORKA 3FIXA 2XAGA 5JGFA 3MZYA 3WG7H 3VARA 4A69C 2VLAA 5F64A 4CAVA 3P2HA 4RLQA 2F4OB 1V0CA 3HRMA 3L09A 4FE4A 4GFBA 2IA0A 2E2IJ 1V3FA 1ZG7A 4O6JA 2I10A 4R1HA 2IP2A 4I76A 1P4AA 1JT6A 2L9RA 1QA6A 1SFEA 2IEKA 4O3MA 4IHYA 2CRGA 3OR1C 3OMYA 1HKSA 4IHWA 1OZPA 3E6CC 5E3NA 5HVQC 2FRHA 4DNCA 3WTZA 1JQGA 2E7WA 2BEOA 3KZWA 4U7BA 4QPOA 2ZMEA 5AIQA 4G7ZF 5LGUA 1SFKA 2KCWA 2LY2A 4BJTA 1ZO0A 5K7FA 1SMTA 1W7PD 4H6UA 1PCAA 2IRFG 4E6KG 1FMVA 2AQEA 1H8AC 2L7KA 3UR3C 2B4DB 1OCPA 1ZHFA 5JHUA 4HF0A 3CCEI 5M3FJ 4KOXA 1A36A 2FNPA 4L0ZB 4MFZA 4NSQA 1PJRA 2ZBKA 2VZYA 3HSFA 2IJZA 4AM3A 2OR4A 4F0YA 5K8PA 4HAMA 2PRQA 1J5YA 2LR8A 3OL3A 2R7RA 1ZR4A 3GB0A 1TL8A 3TKYA 2JA5J 4GCVA 3IRRA 1W0UA 3ZZIA 3FJUA 2IS4A 1WH5A 1ZTRA 3K6GA 4IKFA 3KR5A 1NE9A 3FIWA 2X6XA 2L54A 1WPKA 2MD0A 4WF2A 4PK4A 1WZ2A 3R9GA 2P0WA 4I01A 2PJRA 3IU2A 2DPSA 2E36A 2DOFA 1QMUA 1TT5B 4NB5A 4D7NA 3EC4A 4OC4A 2PR1A 2J8NA 4KVME 2WAQN 2AFZA 2ZEEA 2L01A 4KOWA 1OYWA 4R76A 2JZYA 4F6AA 3IH4A 2LKPA 2F5FA 4FASD 2PJ1A 5LRSA 2EFNA 1JKRC 4EJVA 4AB7A 2RGVA 3VFZA 4I7HA 1MNMC 4F0XA 4B5PB 1Z05A 2PIZA 2KLOA 4J01A 1W36D 3NE8A 5DTDA 4OC0A 2F5EA 3C2GA 2PQ8A 2Z3LA 1XGNA 3JW4A 2Y0MA 4DZJA 1KZFA 2Z3MA 5FD5A 1K83J 1Z6RA 1V4RA 3K2ZA 2ZFUA 2JWTA 4UV8A 1APLC 4ZY0A 3S1QJ 4RAGA 3CMAI 2OQGA 5E18F 2PJBA 2PRBA 1Z6TA 2A6TA 2K5CA 4QUSA 3MVPA 5AIPA 3HUGA 3CJQB 1UJ8A 3IEHA 2DFFA 3GTOJ 3K0LA 3DSBA 4I2OA 5BQTA 4RAZA 5HOOA 3F0CA 4P45A 1SFUA 2XF7A 4OMYA 5IYCJ 2BHZA 4ZH4F 1MSEC 3B3VA 2MC3A 2X9DA 3F6VA 4CGZA 2BY2A 4YIFA 3W2WA 2J8MA 4LGWA 5IB0A 2JBJA 3P5JA 3I1UA 3ROUA 3JVNA 1BOBA 1H9TA 2MABA 1B72A 1PYVA 2CS3A 1PU9A 2BW3A 3WGHA 1CBXA 2BCOA 3K4KA 3NA6A 4UWJA 2HQ5A 4DBQA 4WWVA 2VZZA 2HPIA 3BZCA 2NVXJ 5H86A 2Z9OA 4U0VA 2ZEOA 2PBIA 2VJ4A 2HYFA 4PSXA 5D5VB 3C26A 5F49A 1TKHA 5E1WA 2WYRA 1RTQA 2GLFA 3I0TA 4YG2F 1Y0RA 2CJJA 3M8JA 1BBYA 2R7VA 4HNXB 3SI1A 3FHNA 4M72A 2IMOA 2DI3A 5ILSA 2HOTA 1H89C 1K4TA 3GYAA 1Z5RA 4AVBA 2O4HA 3ZQHA 3AG4H 2BUEA 2DA4A 3MQ0A 2VL8A 3FXRA 3GBGA 4XKVA 5EEHA 4MCSA 3RSNA 4XR6A 2VUMJ 4ZTJA 4P4DA 4MCRA 3TOAA 4FBEA 2OZ6A 1U6GA 1IGBA 1XMAA 2DMTA 1SD6A 1XSXA 4KITB 1KA8A 3D67A 2BYVE 2W24A 4IHTA 2BE5F 2N8GA 2EZKA 2ZB9A 2ZMEC 2ZW5A 3F0AA 1XPXA 1SFOJ 1FLIA 4A32A 1ZK8A 4UWIA 2BVLA 2LLKA 2MC4A 4ZYGA 1Z9CA 3ZXSA 2HI3A 4LD5A 4G94A 4EEFG 1FJLA 2P81A 5D5UB 2M0MA 2OF7A 1UZCA 4MQVA 3EQLF 2NSMA 1FTZA 4DZPA 2EFQA 4F52A 2XEFA 1ZGJA 2ZFWA 3R9EA 3SJGA 4IOCF 1KQ0A 2MLKA 4QTRA 4MFPA 1B6BA 4R6TA 2ZXWH 2GREA 2QGUA 3LSPA 2VQHA 3T8RA 4XPDB 2R3SA 5BPIA 2STTA 4KSFA 5CVJA 3OYMA 1FYLA 3HL2A 5ILUA 3ZQLA 1EA3A 3LSIA 1I39A 3B02A 4IQ4A 3W3CA 2PJAA 1V5EA 5F04A 3WE3A 1SFXA 1X3ZB 5M3MJ 1YW9A 2L4AA 2DFIA 2Y69H 2QJ8A 1FBUA 4XRFA 4FD7A 2Y2ZA 3BDDA 3GW2A 3TO6A 1LAPA 4K2EA 3SYTA 1LOKA 2ZXIA 2D45A 2QBYA 4CDGA 1IB1E 2MLGA 3PSIA 3SXOA 4D7MA 3LA3A 5IY5H 3DQVC 1VTNC 1BW5A 1YVOA 2W82A 2Z33A 2FVGA 4TNUA 2W25A 3CUQB 3S8PA 4G9YA 3VH9A 1VHOA 4LFUA 1F36A 2XEJA 4A3FJ 3TL4X 4UXNA 1Z21A 2ZEPA 2QWWA 1AYEA 3CESA 1XFOA 2AHQA 4NGPA 2LRDA 1S6LA 1P9QC 2A6HF 2LREA 4A3KJ 3JRUA 1P4XA 1RPWA 4N9IA 2YU9J 2CF4A 1GHEA 2YS9A 3PRTA 2L9VA 1BA5A 1G2HA 2Y0SN 4S05A 1YREA 2M7BA 3ERMA 1WJBA 3F8BA 3G8WA 3CF5F 5LBQA 2J9AA 2CW8A 1IZ1A 4TV7A 1YJ9I 2Q4ZA 2PI0A 4F92B 4CYNA 4Y52J 2CV2A 4RB0A 4EMEA 1TW2A 1X1DA 5CPRB 1HKTA 4CO8A 4M3SA 4U9YA 1LVAA 1R1UA 4PDKA 3E6DA 4HNVA 3ZPLA 3LSHA 2HOEA 1BOAA 1R1TA 4EV0A 5D4RA 1RUNA 4V19K 2E1CA 4KT6A 2QQAA 2JVGA 1I27A 2DYRH 1UAAA 5D6FA 5J1YA 2GM4A 2EH3A 2XGCA 3G1LA 3OS2A 1TKFA 2NVYJ 1NTCA 4KLWA 2JRMA 1MNEA 3N7ZA 4UVCA 2AFSA 1Y8QB 3GTQJ 4I0AA 4M73A 3SDGA 2QYOA 1PUFA 3HM5A 4A3CJ 2C6PA 4L8AA 1TW3A 4C2ZA 1VQ9I 5EGOA 3AG2H 1AHDP 3BG6A 1SANA 3MKWB 4IXAA 2MD5A 5E8GA 2NVTJ 1R57A 3T90A 2LF7A 4CGMA 2HQRA 2R7TA 2FCKA 2ACJA 2B3UA 3K4CA 3RKYA 1DDNA 1BI0A 3D7DA 5K7HA 2B63J 2FSWA 2XAUA 3IUOA 2KT0A 2P5KA 2Q04A 1X1AA 3FXTA 4UHTA 2CUEA 2E1MC 3HOYJ 5L3EA 3SJEA 2PJ3A 3SFIA 1T8IA 1GT0C 5M5WJ 4W9YA 2K9NA 4BJ6C 3HUVA 1HDPA 2YNEA 3ZN1A 3DXJF 2CY2A 1J0RA 1FEXA 2K7LA 2RC4A 1TWHJ 4OOIA 5EMIA 2Y48A 3A03A 3OL4A 2YUSA 1QSTA 1FTTA 3FH4A 4CPAA 5LYFA 4KIBA 5F27A 2EZIA 2P6GA 4WXHA 4CYPA 4I98B 5K5RA 3L2WA 2QLZA 4E7ZA 4NQWA 1YVKA 4JXQA 5FRNA 3CXSA 1HDDC 1WH7A 4IEJA 2HWVA 1FIPA 3WHCA 3R95A 1IDYA 3ZMDA 4BXXJ 3ZN0A 4CRZB 2OBPA 4N4NB 3LWUA 2FBHA 3JRIA 2R5YB 4AXVA 2XKOA 2K02A 2JPBA 1X3UA 2QQ9A 4UUSA 2CSOA 4QVTA 3TX8A 4BQQA 1JHFA 1RKTA 4BL0B 5GP9A 4B48A 2EILH 3V42A 4KMFA 4AIHA 4LK1F 4YU9A 1OCOH 4PV6A 3J7ZI 1FT7A 1QZEA 4ENMA 8CPAA 4XKCA 1LDKB 2EINH 3T9YA 3MMYB 4OP4A 3TQNA 1QNTA 2P6SA 4B5OA 4RBOA 4NGSA 4DW6A 5IX3A 2P5VA 1KU2A 4BE0A 2G9DA 2XSDC 3FM5A 2Q44A 4AG7A 3MCZA 4P55A 1PVEA 5EEGA 2XEIA 5FKNA 3BR3A 2AFMA 4PPZA 5BS6A 4ENNA 3V4GA 4IJAA 1Y39A 3EY5A 1R5GA 4GYGA 5C4JJ 3C7JA 1FX7A 4HDUA 1VQ4I 2P4WA 3P9CA 3BWGA 4G12A 4JX4A 1YLEA 4LIUA 2BBYA 2FJ1A 3KEQA 5KAIC 2STWA 3SHPA 3QP5A 4H89A 2GOMA 2X1DA 2NYQA 3U1DA 4XRSA 5GPAA 2GFQA 3S9LA 5E17F 1Q2CA 7CPAA 2UV1A 2ODFA 2B58A 4KVOE 3CUQC 1JE8A 4A30A 1M4DA 3HG9A 1FMWA 3I53A 4G6TB 5M5YJ 1S3ZA 5G21A 1XC5A 3PSFA 1IY7A 2VKHA 2FNAA 3CXQA 1I50J 2ZKZA 4TWEA 1FYKA 2L7ZA 1MMNA 1D3YA 2MSYA 4M3BA 3AAFA 2MW8A 3TMOA 3ZQIA 1YK3A 4ORFA 1YW7A 3RAMA 2DMQA 3B3TA 1UG0A 4XLFA 3PBEA 2KMUA 3DPLC 5J3LA 2UXNA 4J19A 3BG9A 2H5MA 3LSJA 4PJ0C 4V2GA 5AONA 1JGGA 2IVMA 1D0YA 4PUSA 4G8XA 4YELA 3ZMSA 3G71I 3CJRB 1H8LA 2BO9A 2GANA 4JJXA 4B14A 1IN8A 4DUKA 4IUSA 1YRNA 1JTXA 1XD7A 1U78A 2Y9ZA 4Y17A 1LB2A 1JHHA 2K86A 3T8TA 4BINA 2DQLA 3KP3A 5BOXA 9ANTA 1IAWA 1X4PA 1LE8A 3WODF 3BJAA 2MGQA 3KYDB 2WAFA 1M4LA 1Z77A 3V8JA 4E7HA 2XC7A 4EATA 3FRMA 4KOTA 4F93B 1YX0A 3GO5A 2Z11A 1FP2A 4U5YA 1W36C 1G3SA 4L9NA 3B73A 1IXCA 4BXUA 1ZH5A 1XMXA 1Z91A 2YX4A 4HYEA 4C2UA 3A02A 5F0CA 5D8NA 4AIKA 1RC9A 3HHHA 3RZAA 3R6SA 1T2KA 2WAEA 3O8HA 5HODA 4M6GA 1FOXA 3CQZJ 1N78A 1Q1VA 4Y49C 1RZ4A 2LKXA 2ECBA 1QVUA 2OQRA 2XAQA 5DUKA 2WB1A 4R3KA 4CCKA 2DXQA 3BJOA 1ZRDA 4CCOA 4EWTA 2X6YA 3OYNA 4UUVA 1I3QJ 1BW6A 3PBBA 4XNHB 4YEJA 1F57A 1N77A 1UCRA 3K4BA 2Q2EA 3U2RA 4E7JA 3K4MA 3TE4A 1ENHA 3O3KA 3QOEA 5BNGA 2JEVA 2R98A 3ERED 2E35A 2VBQA 4QPQA 4B43A 4BXFA 4CZCA 2ZPAA 4OAZA 1HKQA 2E5NA 2YU3A 3FX3A 4NUBA 1B8IB 4HRIA 2GIVA 2UWMA 2K4BA 2XB0X 1IC8A 1D8KA 4EM1A 2JA7J 4W1UA 2PJCA 2PSWA 3IFEA 3SJXA 2DT7B 2K3FA 3J81Z 1ACIA 2VIXA 1BC7C 1KUVA 2FXFA 1UELB 2HR3A 3R4KA 3BJ8A 3H9QA 1G6NA 3SQNA 5FLVA 1SVMA 1R5ID 4EFDA 3WC6A 2M4KA 1FNOA 4O5VA 5LRRA 2PJ5A 1QSRA 3CO6C 3RCOA 1X10A 3EYIA 2J5OA 3HPHA 3C3WA 2ZEMA 4F9UA 5CPAA 1ZLJA 1O3RA 1ELMP 2FOKA 4FTHA 1TQPA 3TC8A 1ZN2A 3RYOA 2ELJA 2Q7BA 3LMSA 1U2WA 1AUGA 2IAIA 2WADA 2PG4A 3JRFA 4QSHA 1U5TA 3WTTC 2HTSA 1IOIA 1MNDA 2CNMA 2KJBA 1LUJB 3U1KA 3RBUA 1J59A 2FBIA 3L2UA 3CT9A 3E0KA 1R4MB 2AO9A 1CX8A 4HLXA 3ZR8X 1XCBA 1MJBA 4KMUX 4YFKF 3DLJA 2Q4VA 1IN4A 2CUZA 4L89A 2F5CA 2IJLA 2VJJA 2M1BA 3UNGC 3G3SA 3GTPJ 1OLTA 4LB6B 2L2OA 3K1NA 4BMHA 5K8MA 1B1BA 1P7JA 3M1CA 2QSGX 4BQNA 1CP6A 4KIFA 2HKXA 4PJMA 2WY8Q 2X7BA 3ABLH 2CW7A 3QRFF 2R7HA 2VI6A 4BEHB 4BAYA 1TP4A 4AYBN 4XLPF 2ZEFA 2CQXA 2NNNA 1LJ9A 1Y1WJ 1BLLE 1J9IA 3RNZA 2A6EF 1X1CA 1NK3P 1RR7A 4HPSA 1MD0A 2L7FP 3QYBA 2WAQA 1K6OA 3F3XA 4S04A 3CO7C 1XMTA 5L3GA 2EV6A 4MIMA 1MGTA 1IN6A 5LRKA 1J7KA 3S9NA 4IL6C 2R5ZA 1VQKI 2JA6J 1F1ZA 3KGQA 1JUSA 4CYDA 4HNTA 3MD2A 2LDUA 1YJNI 1ONVA 4M9XA 4IHMA 1WI9A 1Z67A 1JT0A 2IQ6A 1AKHA 4U7DA 3U21A 3H9GA 2DPDA 4FCYA 4PXCA 3QPSA 3EUKL 2A61A 4H4KC 1A35A 3FK7A 5LFAA 2E2JJ 3IV5A 1U9OA 2EIJH 1WJFA 3OYGA 1ETWA 3T0YA 1BI3A 3MN8A 2Y75A 5J8CA 5CYVA 5A2QZ 2QIRA 5LYIA 2OOTA 3KLNA 4LQGA 5DD8A
chains in the Genus database with same CATH topology
2ZFUA 5KHDA 1U6MA 5EC4A 3F8KA 4B44A 2VQGA 1M44A 4AVAA 3HKZA 2PRBA 1R6RA 1Y6IA 2A6TA 2K5CA 2W7NA 2ZW6A 2JDCA 4Q36A 3CJQB 4QUSA 2FT0A 4CCMA 4C30A 2J8RA 1ZELA 2E60A 2OUMA 2VQCA 2KRHA 2BL1A 3DSBA 4YFJA 2OZHA 2Z2SB 3DTIA 5HOOA 4RM2A 4R87A 1J09A 2XF7A 2FSRA 3TCVA 4EVYA 4UFVA 3W2WA 3DTKA 4PJJA 2J8MA 4NCZA 5IB0A 2V4JC 1S7LA 4MFKA 1NG6A 3JVNA 1BOBA 2M4GA 2MABA 3VSKA 1PYVA 2CS3A 1PU9A 1S7NA 2EUIA 2X6WA 2BW3A 3PP9A 4Y49B 3K4KA 2ZXVA 3DR8A 4UWJA 3VYTB 2K3PA 4NQWB 3IGRA 1MMGA 4DBQA 3DU5A 3ZGKA 2AJ6A 2VZZA 1U0JA 2HPIA 5H86A 1Z7LA 2FUG2 4H6ZA 2VJ4A 2VKDA 4PSXA 4DBRA 4E7IA 3C26A 3D2PA 5F49A 3S6GA 4Q38A 4CGLA 3S93A 2DT6A 2W4SA 4BBHA 3CZ6A 1TZLA 2LBFA 3QYFA 2HZDA 3M8JA 2R7VA 4JWPA 2FL4A 4HNXB 4MJ8A 3FHNA 5AG5A 4KOUA 3R96A 1IIDA 1V5FA 3EXNA 3A4CA 3H5RA 3F5BA 3K70C 1ON0A 3GYAA 4AVBA 5DWNA 1SAUA 3QB8A 2R7UA 4B13A 2BUEA 2XF6A 4Y3OA 4XKVA 1Z9UA 2VL8A 3GBGA 1K6YA 1T0FC 2HVQA 3RSNA 4XR6A 3IWGA 2MYSA 4ZTJA 4CAWA 5IV0A 4DJAA 2Q0YA 2R7SA 3TOAA 5ISVA 2R7WA 4II2A 2VQLA 4KITB 3FB3A 4II9A 2JA2A 1I1DA 2CMPA 2ZW5A 4YRHA 3F0AA 4NC8A 1N75A 4HG2A 4U9ZA 4A32A 4UWIA 2BVLA 2FIWA 4OAYA 2MC4A 5KTDA 4KOSA 4KOYA 2JDDA 3H5NA 3ZXSA 1WJEA 3AL0B 4UFXA 5H84A 4BE1A 3C2HA 4Y4RA 1WWZA 3TBIA 3LD2A 2HQAA 2M0MA 4M85A 1DP3A 1Z4RA 3H9JA 2HNHA 4A2ZA 4B10A 2LH9A 1Y9KA 4HSRA 4P5OA 4F52A 4QC6A 1X19A 1ERDA 2ZSHB 4MY0A 3R9EA 1S7KA 2O28A 3TO7A 4CGOA 2Q4YA 1B6BA 4MFPA 3BLNA 1NSLA 1Z4EA 2VQHA 3SEZA 2D4OA 2YNCC 4XPDB 4XLCA 4C7IA 3SZGA 4KSFA 3OYMA 3ZQQA 5CQGA 3HL2A 2Z3KA 3ZRGA 2KPMA 2JVHA 3EPZA 2ZSIB 2VQYA 2VASA 2KDOA 1EA3A 2XF5A 3LSIA 3H5AA 1TIQA 3E1SA 4IQ4A 3W3CA 1V5EA 2IS1A 2OZGA 3SDBA 4CUGA 2WPXA 3DNSA 3PUBA 2K9LA 2LY1A 3OY9A 1MJAA 3D5SC 1QHHD 1IYKA 4AG9A 5AG7A 1Y7RA 2M7AA 1AA7A 2B4BA 3QAHA 4FD7A 2Z10A 3TO6A 4A31A 2HVRA 2L9NA 3SYTA 1TT0A 2ZXIA 2BSWA 5KCMA 1IB1E 3K9UA 3PSIA 4XLAA 4HNWB 1IRXA 3SXOA 3DQVC 4PFOA 3CF2A 4XLHA 3HOTA 2W82A 3OYJA 3OYAA 1YVOA 2DPTA 4JD6A 2XSJC 3S8PA 2WA0A 5KTAA 3FBIB 2PJRB 4HEA2 3BJ7A 3TL4X 4E7KA 2JLMA 5HMNA 1Z21A 2MFZA 3HOSA 4FD5A 3CESA 5C82A 5JQ4A 2LRDA 1WK4A 1P9QC 2LREA 2Y0SA 2HUZA 1BR2A 1GHEA 3S6FA 5TGTA 1XF8A 1Q2DA 2VI7A 4E2AA 4KJZA 2G0BA 1YREA 2M7BA 1S7FA 3H0DA 1WJBA 3G8WA 4ZDPA 4BEHA 1MJ9A 2CW8A 3LSMA 4KUAA 2JSPA 2VJIA 2V9KA 4F92B 1QSNA 4XOTA 4CYNA 5F48A 2CV2A 4RMNA 4DGWB 2IS2A 4KS9A 5E96A 2QMLA 2X1CA 1X1DA 5CPRB 3OS0A 4M3SA 2K5TA 2IXSA 5FROA 4U9YA 3PFYA 3PNYA 3LODA 3TTHA 4B3XA 4KORA 3R9FA 3H4QA 2BVMA 3LSHA 4CGNA 3FKJA 2ATRA 4QBJA 4BDZA 3VWDA 2BOLA 2HQYA 4ZC3A 4KT6A 4BQOA 4C2TA 2JVGA 2HPMA 1UAAA 3NWSA 2B5GB 4HNYB 2R7OA 2W1OA 3L2QA 2X85A 2ZXHA 3W6XA 3OS2A 1V5GA 3FYNA 3HUGB 4HKFA 1WJAA 2G3AA 4KLWA 1BR1A 1G8XA 1M4IA 1MNEA 3N7ZA 4UCMA 4BUPA 2ZW7A 4PK3A 4B5PA 1P4NA 1NMTA 4BJ5C 4C2YA 3LL7A 4LUAA 3OIQA 3OYFA 4NXYA 4E8OA 3GY9A 4L8AA 1S60A 4AVZA 1S5KA 4OLLA 4C2ZA 4HSTA 4PJLA 4ZDLA 3ONQA 5HLTA 1Q2YA 2B3VA 3K4JA 3BG6A 3IWEA 3V8IA 3E0JB 3L2RA 3MKWB 2Q2EB 1X4OA 3JUWA 2PR8A 2BW3B 4R9MA 1R57A 3T90A 4CGMA 4XNHC 4E4HA 2R7TA 2FCKA 5HH1A 2B3UA 3K4CA 3DTEA 4XQFA 4PK2A 2FS5A 1BO4A 2XAUA 3IUOA 4FD6A 2XDVA 2UUZA 1QSOA 2Q04A 1X1AA 1IICA 3FXTA 2E1MC 4MHDA 4D9JA 3PL8A 2V1NA 1M1DA 2ARHA 4IF5A 3OOUA 4RM3A 3OYDA 2CXAA 3DDDA 1D1CA 4R57A 4BJ6C 3HXLA 4XM3A 2YNEA 3OIPA 3K70D 2LBFB 2QKLB 1Z3XA 4CYOA 1BR4A 2I79A 2RREA 2CY2A 5A27A 2W00A 3RTRA 2LG4A 2RC4A 3DKYA 3OL4A 4GS4A 1QSTA 2F4IA 2IL4A 3BG7A 5GCNA 2ZW4A 4MI4A 2V6EA 2R1IA 2VXKA 5AG4A 4UCPA 2P6GA 4CYPA 1B87A 4CH7A 3L2WA 4E7ZA 2YNDA 1YVKA 4JXQA 5FRNA 3CXSA 2M3AA 3VYRB 4HNUA 4E7SA 3R95A 2LYCA 4I49A 3FDYA 4DIQA 2WBMA 4UFWA 4B47A 4D1QA 2PC1A 2PDOA 3JTKA 2DOAA 3D5LA 4CRZB 2R8VA 4N4NB 3GKRA 1SQHA 3TT2A 2A5WA 1YX5A 3OYHA 1D0ZA 4B12A 5J8FA 2O5RA 3EUHC 4OWRB 4QVTA 2L5QA 3K10A 4BQQA 4CCNA 3DLAA 2V7FA 4B48A 4BL0B 4JOMA 2IS6A 3V42A 4J3GA 2DXIA 1LVKA 4PV6A 4IX7A 3KEYA 3AL0C 3DPUA 3PNTA 4AU7A 5JHFA 3VYSB 1PUAA 3BCBA 4XKCA 1LDKB 2KP6A 4NC7A 2QECA 3W2VA 5CQEA 5JPHA 3P2FA 3PZJA 3MMYB 4Y33A 2IGKA 1MK4A 3T9YA 3I9SA 4B5OA 4ZYAA 5IX3A 4BE0A 4A95A 1GLNA 3IP4B 4PSWA 2CNSA 2Q44A 3OYEA 3S6KA 4AG7A 4KSAA 2VXZA 4XNFA 3EFAA 1LRZA 2NOJB 4BS9A 4ANJA 4IQJA 1D1BA 4MFLA 3PGPA 3EY5A 3NE7A 3DR6A 3EUAA 4MFQA 1OR7C 2YGWA 3IAS2 3VYUB 2FE7A 4LG3A 4GRIA 4XORA 4MY3A 1Z3YA 3PNVA 2PMZA 4LIUA 4XLEA 1YLEA 3LFUA 3SHPA 3W6SA 4H89A 4XPKA 2GOMA 2B4DA 4C7HA 2X1DA 3B8GA 2RNGA 2P6EA 5F47A 2Z1DA 1QHGA 5FRMA 2QKMB 1Q2CA 1DGRM 2UV1A 3QYEA 2B58A 4KVOE 2X1EA 4A30A 1M4DA 2GOXB 3FBNB 3HG9A 1FMWA 5HNHA 4G6TB 4N4OB 4XONA 1KUYA 3PSFA 1S3ZA 4KVXA 5G21A 4XMYA 2LC2A 3S32A 2VKHA 3CXQA 1NG7A 1I21A 4R3LA 5DWMA 2X51A 3BLYA 3DEEA 2R7QA 4CCLA 1VZ0A 4X0GA 1IYLA 1CJWA 1MMNA 1QSMA 3OYLA 4P1WA 4YRVA 3TMOA 1YK3A 3W2AA 5G20A 4ORFA 3BCAA 3RQ4A 1YR0A 1I12A 3IU1A 5G1ZA 4IZZA 2V26A 3I3LA 1YX3A 1UG0A 2VXDA 4NNJA 4XLFA 2KMUA 3MGDA 3DPLC 4FD4A 4KLVA 4HPQA 4KUBA 2Q1ZB 4BGDA 2CFOA 3UY5A 2F6CA 4CGPA 2H5MA 3DKXA 4L89A 3J7AY 3D5RC 4PUSA 1D0YA 4YELA 1MW7A 3CJRB 4ZTFA 2AQFA 2GANA 4JJXA 1WJCA 2REEA 4B14A 3CP2A 1LFPA 4IUSA 3TO9A 3DU6A 4XN3A 1YE9A 4CAEA 4II3A 2OH1A 3MKYB 1X4PA 3QODA 2JUGA 2OZUA 3DPTA 2WAFA 2WUUA 3OR2C 3PJRA 2WPWA 3G2BA 5AG6A 4E7HA 2CH0A 2OC6A 3OWTA 4PFPA 3SXNA 2XC7A 4EATA 3FRMA 4KOTA 4F93B 1YX0A 5I0CA 4YGOA 2Z11A 1T95A 1DQUA 3HC7A 4XKBA 5HNFA 1W36C 2I00A 3R1KA 4U5YA 5AGEA 3OYCA 4C2UA 2L9SA 3NWTA 1WJ5A 4JXRA 3FBUA 5LD2C 1XIXA 2B5GA 1WFXA 1LKXA 2OU2A 1RXTA 4OADA 3H5ZA 1G59A 4CYQA 2WAEA 3DWLE 2R4GA 5KNLA 2EVNA 2Z3OA 3D3SA 4KOVA 2KZVA 1QU3A 4C68A 4CS0B 3TFYA 1N78A 4Y49C 4F3QA 3CXPA 4UA3A 3K4NA 2WB1A 4R3KA 4CCKA 2DXQA 4CAXA 2I8DA 2CUJA 4CCOA 1D1AA 2X6YA 3OYNA 2R7XA 3OWCA 4KZTA 4XNHB 4YEJA 1Y56A 1N71A 1N77A 3N05A 2KQRA 4U87A 1VHSA 2HV2A 3K4BA 4PJNA 3L2VA 5KTCA 1MMDA 2AE6A 2FIAA 4CSWA 3LMMA 4LIVA 4E7JA 3K4MA 3TE4A 2E1MB 3QOEA 2E5ZA 3CMMA 2JEVA 2R98A 5G22A 4E0AA 3A1YA 2VBQA 1Y9WA 2VEZA 4MFJA 1J4JA 4QPQA 4B43A 4BXFA 4CZCA 2REFA 2ZPAA 4OAZA 2E5NA 3A9LA 5CNPA 4NUBA 4HRIA 4FETA 2KRCA 2UWMA 1YGHA 2GIVA 5EBVA 1M4GA 5F46A 4BE2A 2PSWA 4RLFA 3OYBA 2HVSA 4DOZA 2NMTA 2IGMA 1FY7A 3VWBA 2DT7B 1JI8A 1D0XA 2G3TA 2VB6A 3AKZA 4JQFA 2VIXA 5CKTA 3S6HA 1KUVA 2FXFA 1UELB 1VKCA 4UBRA 4ZJZA 4E7LA 3I3GA 1DGWY 3LSGA 3BJ8A 3CP8A 4K30A 1WJDA 3S3OA 2D4PA 3H9QA 1UFHA 2A4NA 4X5KA 5A28A 3A2KA 2WY7Q 4ZBGA 4CA0A 1XEBA 2KHMA 2M4KA 5C88A 1S9HA 1K4JA 3KKWA 1QSRA 3FIXA 4ZGYB 1MMAA 3RCOA 2HDWA 3HPHA 2VLAA 2Z16A 3H35A 3TOBA 4CAVA 3P2HA 3KX2A 2IGOA 3RPUD 4RLQA 2WSAA 1V0CA 1XE4A 2CV1A 3ZCOA 3EO4A 3KYLA 4XPDC 4ITVA 3RYOA 3ZJ0A 3BC8A 2ELJA 4MBUA 1CM0A 2Q7BA 2RQQA 3IAM2 3D2MA 4F91B 4QB9A 3OR1C 1OZPA 2WADA 3OMYA 2KL4A 5HVQC 4R79A 4BDYA 2BEIA 1MNDA 2CNMA 4DNCA 3S3NA 3WR7A 4J00A 2Z3PA 4U7BA 4QPOA 3L2UA 4UCNA 3E0KA 1SFKA 2KCWA 2LY2A 4BJTA 3SEQA 3ZR8X 4CCJA 4F55A 1MJBA 1ZO0A 4NF1A 4XL9A 5FVJA 3FNCA 1RO5A 2Q4VA 4H6UA 2CUZA 3AFHA 1FMVA 2AQEA 4E6KG 2DJIA 2VJJA 4KISA 2CNTA 2L7KA 3UR3C 3UNGC 3G3SA 2B4DB 4KOXA 1OLTA 2L2OA 3OYIA 4MFZA 3I9V2 4NSQA 1PJRA 4BU2A 2VZYA 2VJ5A 2Z0ZA 4BMHA 4B11A 4C2XA 4F0YA 3M1CA 1HA8A 1P0HA 4BQNA 2OB0A 4BACA 4PJMA 3MKZA 2GE3A 2WY8Q 3OL3A 2X7BA 2R7RA 2OV7A 2LOOA 1KUXA 2YNCA 2CW7A 4AYBA 4XPLA 2R7HA 4XN0A 4BEHB 3ZZIA 2DCEA 2IS4A 4IKFA 3K6GA 4ZDOA 1L0CA 3K4LA 4XKWA 1NE9A 2X6XA 2F5IA 3VSLA 4RI1A 4XOPA 2MD0A 1X1CA 3OYKA 1E0EA 4PK4A 3R9GA 2P0WA 2PJRA 3IU2A 3QYBA 4JLYA 3VWEA 2WAQA 2DPSA 3EC4A 1X1BA 2PR1A 2K9MA 1XMTA 3VDXA 2C27A 2J8NA 2P6FA 2CV0A 4KVME 3OS1A 4MLOA 4A33A 4KOWA 4LX9A 2VPLA 4HNTA 3F9KA 3MD2A 1KONA 2Z3NA 4F6AA 4FASD 4NEXA 3D8PA 4CAFA 4F0XA 3U21A 3H9GA 3W91A 4AB7A 4CRYB 4OAEA 4B5PB 3EUKL 4RS2A 4C9YA 4H4KC 2KLOA 4J01A 1W36D 2IGNA 4LITA 5LFAA 3HPGA 3C2GA 4ONUA 2PQ8A 1WJFA 3OYGA 2F5VA 2Z3LA 4AVCA 3LSKA 5J8CA 2QIRA 3S3MA 2Y0MA 1KZFA 5BWAB 2HU9A 2Z3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U6M A;  5EC4 A;  3F8K A;  1M44 A;  4AVA A;  2PRB A;  4QUS A;  2ZW6 A;  2JDC A;  2FT0 A;  2J8R A;  3DSB A;  2BL1 A;  4YFJ A;  2OZH A;  4R87 A;  2FSR A;  3TCV A;  4EVY A;  2J8M A;  4NCZ A;  5IB0 A;  1S7L A;  3JVN A;  1BOB A;  1PU9 A;  1S7N A;  2EUI A;  3PP9 A;  4Y49 B;  2ZXV A;  3DR8 A;  4UWJ A;  3IGR A;  2AJ6 A;  2VZZ A;  5H86 A;  4H6Z A;  4PSX A;  3TFY A;  3D2P A;  5F49 A;  3C26 A;  3S6G A;  4JWP A;  2FL4 A;  4HNX B;  4MJ8 A;  4KOU A;  3R96 A;  1IID A;  3EXN A;  3F5B A;  1ON0 A;  3GYA A;  4AVB A;  5DWN A;  3QB8 A;  2BUE A;  1Z9U A;  3IWG A;  4CAW A;  5IV0 A;  2Q0Y A;  3TOA A;  5ISV A;  3FB3 A;  4II9 A;  1I1D A;  2ZW5 A;  4YRH A;  3F0A A;  4U9Z A;  4UWI A;  2FIW A;  5KTD A;  4KOS A;  4KOY A;  2JDD A;  1WWZ A;  3LD2 A;  4M85 A;  1Z4R A;  1Y9K A;  4QC6 A;  4MY0 A;  3R9E A;  1S7K A;  2O28 A;  3TO7 A;  2Q4Y A;  1B6B A;  1NSL A;  3BLN A;  1Z4E A;  2D4O A;  4XPD B;  2VQY A;  1TIQ A;  2OZG A;  3DNS A;  2WPX A;  1MJA A;  1IYK A;  4AG9 A;  1Y7R A;  4FD7 A;  2B4B A;  3QAH A;  2Z10 A;  3TO6 A;  2BSW A;  1IB1 E;  3K9U A;  4HNW B;  3SXO A;  1YVO A;  4JD6 A;  5KTA A;  3BJ7 A;  2JLM A;  5HMN A;  4FD5 A;  5C82 A;  5JQ4 A;  1WK4 A;  2HUZ A;  1GHE A;  3S6F A;  1XF8 A;  2VI7 A;  1Q2D A;  4E2A A;  2G0B A;  1YRE A;  1S7F A;  3G8W A;  1MJ9 A;  4KUA A;  1QSN A;  5F48 A;  5E96 A;  2QML A;  4M3S A;  2K5T A;  4U9Y A;  3LOD A;  3TTH A;  3R9F A;  4KOR A;  3H4Q A;  4QBJ A;  2ATR A;  3VWD A;  2HQY A;  2B5G B;  4HNY B;  3W6X A;  3FYN A;  4HKF A;  2G3A A;  4KLW A;  1M4I A;  3N7Z A;  2ZW7 A;  4PK3 A;  4B5P A;  1P4N A;  1NMT A;  4LUA A;  4NXY A;  4E8O A;  3GY9 A;  4L8A A;  1S60 A;  1S5K A;  4OLL A;  2B3V A;  3W91 A;  3V8I A;  1Q2Y A;  3JUW A;  2PR8 A;  4R9M A;  1R57 A;  3T90 A;  4XNH C;  2FCK A;  5HH1 A;  2B3U A;  4PK2 A;  2FS5 A;  1BO4 A;  4FD6 A;  1QSO A;  2Q04 A;  1IIC A;  3FXT A;  4MHD A;  2ARH A;  1M1D A;  4IF5 A;  3DDD A;  4R57 A;  2I79 A;  2CY2 A;  2RC4 A;  4GS4 A;  1QST A;  2IL4 A;  5GCN A;  2ZW4 A;  4MI4 A;  2R1I A;  2VXK A;  2P6G A;  1B87 A;  1YVK A;  4JXQ A;  3CXS A;  3R95 A;  4I49 A;  2PC1 A;  2PDO A;  4CRZ B;  2R8V A;  3GKR A;  1SQH A;  3TT2 A;  5J8F A;  4QVT A;  4J3G A;  4PV6 A;  1PUA A;  2QEC A;  5JPH A;  3P2F A;  3PZJ A;  1MK4 A;  3T9Y A;  3I9S A;  4B5O A;  5IX3 A;  2CNS A;  4PSW A;  3S6K A;  2Q44 A;  4AG7 A;  3EFA A;  1LRZ A;  3PGP A;  3EY5 A;  3NE7 A;  3DR6 A;  2FE7 A;  4MY3 A;  1YLE A;  3W6S A;  3SHP A;  4H89 A;  4XPK A;  2B4D A;  3B8G A;  5F47 A;  2P6E A;  1Q2C A;  4KVO E;  2B58 A;  1M4D A;  1KUY A;  1S3Z A;  4KVX A;  3CXQ A;  5DWM A;  1I21 A;  5H84 A;  4R3L A;  1IYL A;  1CJW A;  1QSM A;  1YK3 A;  4ORF A;  1YR0 A;  1I12 A;  4FD4 A;  3MGD A;  4KLV A;  4KUB A;  3UY5 A;  2H5M A;  4L89 A;  4JJX A;  2GAN A;  2REE A;  4IUS A;  3TO9 A;  2OH1 A;  2OZU A;  2WPW A;  3SXN A;  3FRM A;  4KOT A;  1YX0 A;  5I0C A;  4YGO A;  2Z11 A;  4U5Y A;  2I00 A;  3R1K A;  4JXR A;  3FBU A;  1XIX A;  2B5G A;  2OU2 A;  1RXT A;  4OAD A;  2EVN A;  3D3S A;  4KOV A;  4CS0 B;  4Y49 C;  3CXP A;  4UA3 A;  4R3K A;  2DXQ A;  4CAX A;  3OWC A;  4KZT A;  4XNH B;  1N71 A;  1VHS A;  2HV2 A;  5KTC A;  2AE6 A;  2FIA A;  3TE4 A;  2JEV A;  2R98 A;  4E0A A;  2VBQ A;  1Y9W A;  2VEZ A;  1J4J A;  2REF A;  2ZPA A;  5CNP A;  1YGH A;  5F46 A;  2GIV A;  5EBV A;  1M4G A;  2PSW A;  2NMT A;  1FY7 A;  2G3T A;  3S6H A;  1KUV A;  2FXF A;  4UBR A;  1VKC A;  3I3G A;  3BJ8 A;  4K30 A;  2D4P A;  1UFH A;  2A4N A;  4X5K A;  4ZBG A;  1XEB A;  5C88 A;  1K4J A;  3KKW A;  1QSR A;  3FIX A;  3TOB A;  4CAV A;  3P2H A;  1V0C A;  1XE4 A;  3EO4 A;  4XPD C;  3RYO A;  3ZJ0 A;  4MBU A;  2Q7B A;  1CM0 A;  3D2M A;  4QB9 A;  1OZP A;  2BEI A;  4DNC A;  2CNM A;  3WR7 A;  3E0K A;  2KCW A;  4NF1 A;  1MJB A;  5FVJ A;  3FNC A;  1RO5 A;  2Q4V A;  4H6U A;  2CNT A;  3G3S A;  2B4D B;  4KOX A;  4NSQ A;  4BMH A;  2VZY A;  2Z0Z A;  4F0Y A;  1P0H A;  2OB0 A;  2GE3 A;  2X7B A;  1KUX A;  4XPL A;  2R7H A;  3ZZI A;  1L0C A;  1NE9 A;  2F5I A;  4RI1 A;  3R9G A;  2P0W A;  4JLY A;  3VWE A;  3EC4 A;  2PR1 A;  1XMT A;  2C27 A;  2J8N A;  2P6F A;  4KVM E;  4KOW A;  4LX9 A;  4F6A A;  4NEX A;  3D8P A;  4AB7 A;  4CRY B;  4OAE A;  4B5P B;  4RS2 A;  4ONU A;  2PQ8 A;  4AVC A;  5J8C A;  2QIR A;  2Y0M A;  1KZF A; 
#chains in the Genus database with same CATH topology
 2CWE A;  4LG0 B;  1BPM A;  3S14 J;  1U6M A;  3F8K A;  4B44 A;  1AWC A;  2VQG A;  2XUB A;  1M44 A;  2AFU A;  4XRS G;  1A5J A;  1R6R A;  2CQQ A;  2JRT A;  5HS9 A;  2CQ7 A;  3BG3 A;  3JTH A;  3WHB A;  4ABZ A;  2JDC A;  1KQ9 A;  3GF2 A;  3HKZ N;  4ZYE A;  3SJF A;  3GEZ A;  2J8R A;  1R9T J;  2KRH A;  3IL2 A;  4W97 A;  4CZZ A;  4JZ0 A;  3L00 A;  3DTI A;  4ZX9 A;  1J09 A;  2QM3 A;  3LQQ A;  3CCM I;  4EGZ A;  3ISZ A;  3ECH A;  5GTI C;  3PB7 X;  3TCV A;  2MA3 A;  4UFV A;  2DFH A;  2G7U A;  3DFG A;  3JRC A;  4NCZ A;  5ED4 A;  1HF0 A;  1ETQ A;  2KDZ A;  1HLV A;  3WTX C;  3SI0 A;  2M4G A;  3QP6 A;  3PP9 A;  2EIM H;  4LLL A;  1A2Z A;  2V1U A;  2ZXV A;  3VB2 A;  1ARM A;  5HXD A;  3DR8 A;  4OIR F;  2COB A;  2ZXJ A;  4M3G A;  1UHM A;  3CZX A;  5J1R A;  5GAH J;  3HTU A;  1U0J A;  3UKG A;  1ZLH A;  1VQ5 I;  1IXS B;  2FUG 2;  3PB8 X;  2VKD A;  3G1M A;  4DBR A;  1POG A;  2Y31 A;  3F8F A;  3E6B A;  1R36 A;  2W4S A;  4BBH A;  3CZ6 A;  4M9Z A;  3KZI C;  2ECC A;  2HZD A;  3QYF A;  4M71 A;  2FL4 A;  2IT0 A;  2K9Q A;  2CTC A;  1AOY A;  3OSG A;  4JP0 A;  3A4C A;  1IV8 A;  3H5R A;  4GO1 A;  1OYY A;  5DWN A;  1SAU A;  4AID A;  3JAM Z;  5JI6 A;  3QB8 A;  2PE3 A;  3KP7 A;  2HVQ A;  2A07 F;  4CAW A;  2Q0Y A;  2F5D A;  1U5T C;  2ID6 A;  2VQL A;  2EA4 A;  4IHV A;  4A3M J;  2ZCW A;  1OQY A;  1HW1 A;  2XAS A;  2ADU A;  4RGS A;  4YRH A;  1K7A A;  3F22 A;  4PQA A;  2V6C A;  4BD9 A;  3CDL A;  3S1R J;  2FIW A;  4OAY A;  1ZKG A;  4OMZ A;  3H5N A;  4AWX B;  1WJE A;  1WI3 A;  5JLW A;  4WWC A;  1Y8R B;  4BE1 A;  3C2H A;  4Y4R A;  1CPX A;  2M8E A;  1YGH A;  2HQA A;  3Q5F A;  4A2Z A;  1DP3 A;  4B10 A;  2LH9 A;  2HS5 A;  4HSR A;  1XSD A;  1F2O A;  2ZSH B;  2CUF A;  5THW A;  4CGO A;  4L5E A;  2Q4Y A;  2QYV A;  2EWN A;  1NSL A;  3I56 I;  2D4O A;  1FBQ A;  3KHX A;  3LST A;  2EZL A;  5D5W B;  2NXN B;  2QSF X;  3QWL A;  3HOU J;  2Z3K A;  1VND A;  2R7F A;  3ZRG A;  2JN6 A;  2PX9 A;  2L3D A;  2CYY A;  3H5A A;  4HX7 A;  3GFJ A;  3SDB A;  2XRO A;  4P4J A;  4EJU A;  2KRF A;  1QHH D;  4AG9 A;  1BM9 A;  4E70 A;  3GTG J;  4HX8 A;  5JH9 A;  3H3V K;  1TT0 A;  2H1K A;  2H94 A;  2O9L A;  3FX6 A;  1TNT A;  3MKL A;  5IP7 J;  6CPA A;  3PO2 J;  5E79 C;  2WA0 A;  1YW8 A;  2KIQ A;  2KIS A;  2PJR B;  4MHZ A;  4WJB A;  1OKR A;  4E7K A;  2XKP A;  2JA8 J;  2PMZ N;  1K61 A;  3CTA A;  2XAH A;  5C82 A;  3ML6 A;  1WK4 A;  2Y0S A;  4B6Z A;  1OR7 A;  3PM1 A;  3S2D J;  1BR2 A;  2VI7 A;  2O7O A;  1XTA A;  2LFB A;  3NH4 A;  1KQ8 A;  4ZDP A;  1MJ9 A;  3RI4 A;  2V77 A;  3WU1 B;  2ZEG A;  3JSO A;  2VJI A;  4KUA A;  4RB1 A;  4JYW A;  2OTL I;  4XOT A;  4IHX A;  3HOX J;  4DGW B;  5E96 A;  4MHG A;  2QML A;  3R0J A;  3OS0 A;  3DV8 A;  4ONW A;  2K5T A;  2ME0 A;  3AG3 H;  5K8O A;  4KN4 X;  3LOD A;  4CGN A;  3R9F A;  2D1V A;  1UWY A;  3FKJ A;  2HXI A;  3VWD A;  4WX9 A;  2AS5 F;  4U88 A;  1FSE A;  4ZC3 A;  1MH4 A;  4BQO A;  4ZYH A;  2C6Y A;  2HQY A;  3L2N A;  4KIG A;  2W57 A;  2B5G B;  5IT9 K;  2EK8 A;  3L2Q A;  2W1O A;  4PXE A;  2QSH X;  3V7C A;  1IUF A;  2DT5 A;  2TCT A;  1PDN C;  1V5G A;  5JR3 A;  6PAX A;  3HUG B;  4HKF A;  3H1C A;  4NJR A;  2M34 A;  1G8X A;  2J5P A;  1M4I A;  1E17 A;  4BUP A;  1YW4 A;  2PJ4 A;  1XGM A;  4B5P A;  1P4N A;  3ULQ B;  1MIJ A;  3OYF A;  1IV6 A;  1EE3 P;  4NXY A;  3DKW A;  1S60 A;  1DE4 C;  4OLL A;  4PJL A;  5HLT A;  1ARL A;  2JSC A;  1MDM A;  5LYL A;  3W6K B;  3L1P A;  1P4W A;  3OIO A;  2BW3 B;  4R9M A;  2C6C A;  2DTR A;  5L3B A;  4CXF A;  2LP0 A;  5GAE J;  1BPN A;  4MHY A;  5HH1 A;  2HQN A;  3IRQ A;  1FIA A;  4XQF A;  3A0H C;  4MNU A;  2FOW A;  2VBY A;  2GZW A;  1BO4 A;  2UUZ A;  3HHG A;  4S0H B;  2HYJ A;  2CO5 A;  2V1N A;  2ARH A;  4RM3 A;  3OYD A;  2CXA A;  3DDD A;  2XVC A;  3CDH A;  4XM3 A;  4QLC U;  3CMY A;  4CYO A;  2EPF A;  1BR4 A;  2I79 A;  1ETX A;  2L0K A;  2PJ6 A;  2W00 A;  1U8B A;  2LG4 A;  4QWQ A;  5TRD A;  3I59 A;  2IL4 A;  2K4J A;  1Z0X A;  2F48 A;  3HGG A;  1FSH A;  2R1I A;  4H2K A;  2CQN A;  3BR5 A;  4NC6 A;  1B87 A;  4R7M A;  2M3A A;  3V7R A;  2O8X A;  4HNU A;  1D8J A;  3PIP F;  1FC3 A;  4L9V A;  3REO A;  4BHP A;  2JQ7 A;  1IN5 A;  4OC1 A;  2HB6 A;  4DIQ A;  2WBM A;  3NH5 A;  4UFW A;  4D1Q A;  2PDO A;  3JTK A;  4K3N A;  3CC4 I;  2R8V A;  1JJ8 C;  1K78 A;  3GKR A;  3VPR A;  1YX5 A;  1UHS A;  1XOV A;  4YWY A;  3EUH C;  3GVA A;  4MFD A;  1YIO A;  2V7F A;  2A69 F;  3FF5 A;  4JOM A;  2IS6 A;  1FBS A;  3GLX A;  4OME A;  4A93 J;  1HW5 A;  1QZY A;  4IX7 A;  4AU7 A;  3PNT A;  2DA3 A;  5K8N A;  3BCB A;  2DMU A;  4EMS A;  3KCC A;  4ZY2 A;  2VKE A;  2CG4 A;  4L5I A;  4G7H F;  1PP7 U;  1DU6 A;  5JPH A;  4Y33 A;  1KZH A;  1UB9 A;  5F6F A;  2RV8 A;  5KAF C;  3I9S A;  3SZT A;  1HDQ A;  4B8X A;  4ZYA A;  3MZH A;  3DP7 A;  1JGS A;  1WRJ A;  1IJW C;  4A95 A;  1KU9 A;  2CNS A;  3S6K A;  1LEB A;  4NJQ A;  3GZ5 A;  1LEA A;  2NOJ B;  1LRZ A;  3J80 Z;  2COM A;  1Q1H A;  4HX4 A;  4BS9 A;  3D4U A;  3PO3 J;  3F8M A;  5DDG A;  1RES A;  4LB5 A;  3DR6 A;  3NE7 A;  1OR7 C;  4A0Z A;  1U8R A;  4G6Q A;  3IAS 2;  2YGW A;  1F9N A;  1JUM A;  5CBM A;  1KWM A;  2FML A;  4XOR A;  4MY3 A;  1Z3Y A;  2H8W A;  2VOO A;  4V2F A;  1A6Q A;  2DBB A;  1Z8L A;  3PNV A;  4KT5 C;  3W6S A;  3IKV A;  1XGS A;  3KEO A;  1IF1 A;  3PFO A;  4C7H A;  3GTJ J;  3R0A A;  1XDU A;  4A3G J;  1VQP I;  2GXB A;  1X12 A;  5FRM A;  2ESH A;  1XN7 A;  5LEJ A;  5E3L A;  5BMZ A;  3QYE A;  1KUY A;  2VBZ A;  2ZNZ A;  4CIC A;  1RET A;  1X58 A;  4N4O B;  4I02 A;  2VE8 A;  4XON A;  3V7S A;  1ELL P;  4XMY A;  2LC2 A;  4XIC A;  2BY0 A;  1TQM A;  1I21 A;  5EZH A;  2X51 A;  1HQC A;  4Q48 A;  3G1O A;  1VZ0 A;  3TP0 A;  3G73 A;  4H0E A;  1IYL A;  1QSM A;  2Y30 A;  1Q7L A;  3A01 A;  1T08 B;  3OYL A;  4P1W A;  1ZGA A;  3GFL A;  1W7P A;  3E97 A;  2ZJR F;  2KJC A;  3CCV I;  3W2A A;  3RQ4 A;  2PJ0 A;  1I12 A;  2V26 A;  3I3L A;  3KLO A;  4DYQ A;  1T6S A;  3CUQ A;  2ZOF A;  4KLV A;  4WXC A;  4BGD A;  2RB7 A;  2XIG A;  2CFO A;  2P7C B;  2F6C A;  3I64 A;  2RN7 A;  1IW7 F;  3D5R C;  1FOY A;  3LFK A;  2REE A;  2WV1 A;  1ETK A;  3TO9 A;  2DW4 A;  3DBL B;  5FKO A;  1LNW A;  3ZMU A;  3NEU A;  4XN3 A;  4AD9 A;  3GFI A;  1YE9 A;  2DA1 A;  4A3L J;  4CAE A;  1TLH B;  1D5Y A;  2OA4 A;  4A3D J;  3MKY B;  5F08 A;  1B59 A;  2JUG A;  3P7N A;  4A3J J;  1U3E M;  3ABM H;  4HZF A;  2WUU A;  1PUF B;  3PJR A;  1VF9 A;  3BZK A;  3CDI A;  3G2B A;  2O3F A;  4L9J A;  5D8L B;  4XBF A;  4PFP A;  2V8H A;  2EWB A;  2QZ8 A;  3VOD A;  1QGP A;  2HGC A;  3VEP A;  5EGO B;  1R49 A;  4NGN A;  1DQU A;  4YGO A;  3NFZ A;  4GGG A;  4MTE A;  3I55 I;  2L9S A;  2KKO A;  4JXR A;  1F2P A;  3FBU A;  1XIX A;  5EG0 A;  4YII A;  1RXT A;  2AFW A;  3H5Z A;  2I5U A;  1G59 A;  4OAD A;  2Z3O A;  5FLX Z;  5KNL A;  3SXY A;  1REP C;  4CS0 B;  3QPT A;  2KZV A;  1QU3 A;  3OOP A;  3PFI A;  3WAB A;  4UA3 A;  4UEE A;  5FJ8 J;  3K4N A;  1HOM A;  2RDP A;  5LHI A;  1YHQ I;  1VHE A;  2CUJ A;  1D1A A;  3OWC A;  4A94 A;  2L7M P;  5H6Q A;  4ZZL A;  1DU0 A;  1H88 C;  3D7H A;  1N71 A;  5FO5 A;  3GUX A;  1VHS A;  4EQQ A;  1T33 A;  1WKM A;  4PJN A;  3L2V A;  3ZQF A;  2PLY A;  1MMD A;  2FIA A;  4LIV A;  3DBR B;  1O57 A;  2FX0 A;  1ZGW A;  1Z7U A;  2R7Z J;  5G22 A;  2E5Z A;  3WU0 A;  2MH2 A;  3A1Y A;  3BI0 A;  1Y9W A;  4MFJ A;  1WQ2 A;  2JEW A;  5EDN A;  5EBV A;  1XSV A;  3W6J B;  5LGT A;  4BE2 A;  4RLF A;  3GTK J;  1FY7 A;  2ABZ A;  3VWB A;  2VPR A;  1OBR A;  1E3P A;  2G3T A;  2VB6 A;  4A5M A;  1P7I A;  1GDT A;  1B9N A;  2W48 A;  1ON2 A;  4HV5 A;  2BZT A;  5J4Y A;  2MG4 A;  3A9L A;  4MO7 A;  4P4I A;  2QQ8 A;  2O8K A;  2XV4 S;  4MXU A;  4K30 A;  1FZP B;  3S3O A;  1UFH A;  1V55 H;  2ISZ A;  2EB7 A;  1MZB A;  2TDX A;  3K69 A;  3NAR A;  2GLO A;  1S9H A;  2K27 A;  3ZQ7 A;  4ZGY B;  2DOD A;  2HTJ A;  5EJC A;  1MMA A;  2O53 A;  5FKL A;  3SZP A;  1ZRE A;  5HVF A;  2Z16 A;  4EVI A;  2DDA A;  4BHB A;  3H8G A;  3MAJ A;  3JRD A;  3KX2 A;  4UB6 C;  1XCV A;  4QIW N;  3J80 K;  3RPU D;  4ENK A;  1YQE A;  5CVI A;  1XE4 A;  2CV1 A;  2HDC A;  3EO4 A;  2BHY A;  1I3A A;  3O8G A;  4XPD C;  3ZJ0 A;  3BC8 A;  4MBU A;  1CM0 A;  3IAM 2;  4NGM A;  3D2M A;  2FXA A;  4F91 B;  4A5N A;  2VC0 A;  3KI9 A;  3RKX A;  4QB9 A;  2QEN A;  1IG7 A;  3G4S I;  3GIU A;  1HXD A;  4BDY A;  2BEI A;  5HLG A;  4LJZ F;  2PMU A;  2RAE A;  4C3I J;  3IJ3 A;  3WR7 A;  2Z3P A;  1O3Q A;  3KR4 A;  3CCL I;  4IRG A;  1YTY A;  3FXL A;  4F55 A;  1S3J A;  3SEQ A;  1F43 A;  1YSJ A;  4XL9 A;  2QUF A;  3FNC A;  1RO5 A;  2YSR A;  1EH6 A;  3HYI A;  1Z8T A;  3LAC A;  2LVS A;  2CNT A;  2DJI A;  4KIS A;  2O03 A;  1O3T A;  1YLO A;  4ZY1 A;  3OYI A;  3WTV C;  2PEX A;  4BU2 A;  2Z0Z A;  2VJ5 A;  4C2X A;  2O0Y A;  5KK1 A;  5EEA A;  1SMY F;  1QO0 D;  1HA8 A;  2R7D A;  3X2Q H;  1P0H A;  2GLJ A;  4C3J J;  2H1L A;  3MKZ A;  4BAC A;  1K79 A;  2NRA C;  4HF1 A;  2YNC A;  4G1P A;  4AYB A;  3BY6 A;  4PXD A;  4UIA A;  4XN0 A;  2RQP A;  2A68 F;  5D8K B;  4ZDO A;  1MBJ A;  2F5I A;  3C1D A;  1OFC X;  5HDN A;  3OYK A;  5DCM A;  1ODD A;  1E0E A;  2NS7 A;  3QQA A;  4JLY A;  3VWE A;  1QQI A;  3KE2 A;  2E1O A;  4CYC A;  3PEI A;  4M6H A;  4A3E J;  1X1B A;  3K2A A;  4LQ6 A;  3RZO J;  2K9M A;  2C27 A;  3VDX A;  2P6F A;  3HOV J;  4MLO A;  4CHU A;  1YRN B;  2HZT A;  2M9H A;  4KIC A;  1QRY A;  4LX9 A;  4N0B A;  1KON A;  3KYC B;  4OID A;  3JCU C;  5DEQ A;  3RQI A;  3D8P A;  4NEX A;  4CAF A;  3TW6 A;  1LE8 B;  4CRY B;  2AFO A;  3ESW B;  4C9Y A;  3ABU A;  2Y9Y A;  1WGX A;  3HPG A;  3JSP A;  1JXS A;  4ONU A;  3BXM A;  2XEG A;  2ZOG A;  2IA1 A;  3J7Y J;  4AVC A;  3K7A J;  3LSK A;  4I6Z A;  5FLX K;  3WGG A;  3VAT A;  2HU9 A;  1LQ1 A;  3WTW C;  1WVR A;  5KHD A;  4BY1 J;  2Q51 A;  4MCP A;  3CJN A;  1QZZ A;  5J1Q A;  2HYG D;  1WWX A;  4AVA A;  4B09 A;  3HKZ A;  3HDD A;  3PB4 X;  1JTY A;  1Y6I A;  5K7Z A;  2WZN A;  2FT0 A;  4CCM A;  1ZLI A;  4C30 A;  3EYY A;  1ZEL A;  2E60 A;  2OUM A;  4PGH A;  4YFJ A;  1EH7 A;  4P96 A;  3D66 A;  1OYI A;  3RYR A;  3FF3 A;  1J75 A;  3S17 J;  4PJJ A;  4PXB A;  2CTB A;  2V4J C;  4MFK A;  1NG6 A;  1TWG J;  3DLL F;  2MBF A;  2EUI A;  1R7J A;  3CCY A;  1S7A A;  1P92 A;  3QU6 A;  3AG1 H;  3FXO A;  3ABK H;  4B3A A;  1R43 A;  1GXQ A;  1Y0U A;  4A2U A;  4DQ2 A;  3VYT B;  2K3P A;  2DFE A;  1W0T A;  3D7G A;  3IGR A;  3HSE A;  3ZGK A;  2AJ6 A;  5F0H A;  1Y0Y A;  5DS0 A;  2WWY A;  5IB9 A;  3N5F A;  4H6Z A;  3TFY A;  3D2P A;  4A6D A;  3TED A;  3S6G A;  1SD7 A;  3S93 A;  4MHN A;  2DT6 A;  2JT1 A;  1IDZ A;  1FYM A;  4I09 A;  1CP7 A;  2LBF A;  4IVN A;  4JWP A;  1OCT C;  4MJ8 A;  4P4E A;  1W5S A;  1FT9 A;  1ETY A;  5J4V A;  4OC3 A;  1V5F A;  3EXN A;  1ON0 A;  1FNN A;  2NNY A;  3LWF A;  2XGX A;  3F23 A;  2POK A;  1O7L A;  3H92 A;  5CVR A;  1X3W B;  1Z9U A;  5B1A H;  1VI0 A;  3COA C;  1HEE A;  1X1P A;  4C2M J;  4EJW A;  2R7S A;  5IV0 A;  5ISV A;  4GM5 A;  2R7W A;  4II2 A;  3FB3 A;  2QQB A;  5HVH A;  1VIX A;  2JA2 A;  1XMB A;  4Y15 A;  2CMP A;  3GLL A;  1ZAO A;  2ZJP F;  2EBJ A;  4NC8 A;  5E1Z B;  4U9Z A;  3BJ6 A;  4UVA A;  1WSU A;  4KOS A;  5KTD A;  1M1E B;  2A3S A;  5CJ9 A;  3AL0 B;  2JDD A;  2XGE A;  1F4K A;  5H20 A;  2UZK A;  1WWZ A;  3N97 A;  3TBI A;  1EF4 A;  4M85 A;  1I6X A;  5B1B H;  1FPQ A;  1BL0 A;  2BY1 A;  2WTE A;  1Y9K A;  4P5O A;  3CCR I;  4M3D A;  1X19 A;  2KIM A;  4MY0 A;  1SD4 A;  1UST A;  2O28 A;  2ZEH A;  2M87 A;  3HZJ A;  3MWM A;  2QCO A;  5F0F A;  1DTD A;  3BLN A;  3FMC A;  1MBK A;  2V8D A;  1Z4E A;  3SEZ A;  2YNC C;  4C7I A;  2K40 A;  5TJJ A;  2DN0 A;  2PN6 A;  1XS9 A;  2ETH A;  4ON0 A;  5CQG A;  4M3F A;  1JJ6 C;  2NVU B;  1IU8 A;  2ZSI B;  3CME I;  2M30 A;  2KDO A;  1O3S A;  2XF5 A;  1LPQ A;  3ABT A;  3E1S A;  2GBY A;  2IS1 A;  3DNS A;  2WPX A;  2EV5 A;  2K9L A;  3PUB A;  3OY9 A;  1LDJ A;  4IAV A;  1MJA A;  1MSF C;  1ZYR F;  1IYK A;  4A31 A;  3I58 A;  1SEU A;  2HVR A;  4FE7 A;  1HSJ A;  3BOQ A;  4Z6Y A;  2BSW A;  2ZC2 A;  5KCM A;  1ON1 A;  1OCZ H;  3IWZ A;  5DV5 A;  4HNW B;  5GTH C;  3KQZ A;  4PFO A;  2JK3 A;  3CF2 A;  4XLH A;  3HOT A;  4JD6 A;  3OYJ A;  2DPT A;  2D1H A;  1IRZ A;  2OAZ A;  4HV6 A;  4RGU A;  3G6E I;  2TRT A;  1VQO I;  5E1X A;  2JLM A;  3Q0V A;  3HOS A;  1CF7 A;  1VQM I;  5JQ4 A;  3KQX A;  3BQY A;  2HUZ A;  4I0B A;  3HRT A;  1YOV B;  3L7W A;  3S6F A;  1Q2D A;  3FEE A;  4KJZ A;  4RB3 C;  3FKI J;  2G0B A;  1S7F A;  3H0D A;  2XPW A;  4GXH A;  4XRM A;  4BEH A;  4B4C A;  2IBD A;  1NSA A;  1QBJ A;  3PIO F;  1GVD A;  2JSP A;  4LLN A;  1QSN A;  2F2E A;  3I5U A;  3PB6 X;  5F48 A;  4RMN A;  2FMY A;  2X1C A;  2IXS A;  1HW2 A;  2VN2 A;  3TTH A;  3F8N A;  4B3X A;  1QPI A;  3H4Q A;  2BVM A;  2ATR A;  2RKH A;  4BDZ A;  3D1N I;  4DYO A;  2BOL A;  4L9T A;  3SFZ A;  5HVG A;  3NWS A;  1VQL I;  2R7O A;  3CCJ I;  4HNY B;  1WHU A;  2X85 A;  1VGY A;  3ZMT A;  4RGR A;  4UEZ A;  3W6X A;  3OSF A;  3ELK A;  4XSZ F;  3FYN A;  3WT4 A;  1LAN A;  1BR1 A;  3JRB A;  2ZW7 A;  4L0Y B;  1XDS A;  2H8R A;  4BJ5 C;  1H0M A;  1NMT A;  3K2K A;  4LUA A;  4MMO A;  3OIQ A;  1FP1 D;  4E8O A;  3J7A O;  5C3E J;  5J6X A;  4ZDL A;  3JR9 A;  2B3V A;  3W91 A;  1SVO A;  2CU7 A;  5LYD A;  1MBG A;  3G3Z A;  4YFX F;  4HQM A;  1X4O A;  3JUW A;  2PR8 A;  1DPR A;  3EET A;  2FQ4 A;  3J81 K;  2QEX I;  4XNH C;  2VOD A;  3DTE A;  1BJA A;  4PK2 A;  2ZEN A;  2P8T A;  2EK5 A;  1QVT A;  1YQA A;  1QSO A;  1IIC A;  3PFE A;  2ZJ2 A;  4MHD A;  3M3Y J;  3EDP A;  3TDZ C;  5FKK A;  2X6O A;  1M1D A;  4ZYQ A;  1RR8 C;  4BKX A;  4RB2 C;  3K70 D;  2WB1 N;  3W6V A;  1BJZ A;  4NFR A;  4ENJ A;  4M6Y A;  2RRE A;  1I1G A;  3A0B C;  1IXR C;  3TDU C;  2ZO4 A;  1TQI A;  3RYP A;  4BBS J;  4P6Y A;  4P4B A;  1YS6 A;  4GS4 A;  3TP3 A;  2F4I A;  2VT2 A;  3BG7 A;  2NOG A;  3K1M A;  2NAZ A;  2FU4 A;  2W85 A;  2V6E A;  2ZW4 A;  5AG4 A;  5CVU A;  5E3O A;  1XG1 A;  3FIS A;  3CPA A;  3VYR B;  3JTG A;  4A3B J;  5ERI A;  1QQ9 A;  2LYC A;  2C6G A;  3T8W A;  4B47 A;  2PC1 A;  2DOA A;  3D5L A;  4UVB A;  1YG2 A;  4RUH A;  2W84 A;  2XGD A;  1P2F A;  1SQH A;  3TT2 A;  3OYH A;  4FX0 A;  1D0Z A;  2JJ7 A;  5J8F A;  2O5R A;  5K5O A;  4Q4Z F;  2G0E A;  3K10 A;  1GV5 A;  3B6A A;  3BR2 A;  3BTL A;  1L3L A;  2JBK A;  3CLO A;  4J3G A;  2Q8K A;  4F9V A;  3PQK A;  1YS7 A;  2F4M B;  2DXI A;  1IO2 A;  5CLS A;  2DMN A;  3KEY A;  3DPU A;  1VQ7 I;  2ZME B;  5JHF A;  3AL0 C;  5B3S H;  1YI2 I;  2I3C A;  2BXZ A;  4P4F A;  4M6V A;  4NC7 A;  3BQZ A;  3W2V A;  5CQE A;  3B2Y A;  3PZJ A;  1MK4 A;  2IGK A;  3EUH A;  3B3S A;  1FOW A;  3GZN B;  3ZP5 A;  3U9G A;  3C18 A;  5C4X J;  2EFP A;  3FHZ A;  4HOB A;  5LGN A;  1J2X A;  1GLN A;  3IP4 B;  1PP8 F;  2DPU A;  4XNF A;  2R92 J;  1ZG3 A;  2IW5 A;  1JUP A;  4MFL A;  3PGP A;  2CIJ A;  3LOC A;  2G9W A;  1ETO A;  3EUA A;  3ASN H;  4XK4 A;  4UY8 I;  5ICE A;  3VYU B;  5DS9 A;  2FBK A;  2L4M A;  3FWE A;  4GRI A;  2MH9 A;  4LG3 A;  1UHW A;  3CCS I;  4R8F A;  1Y7E A;  3LFU A;  1TTY A;  4NGT A;  4D5C A;  2B4D A;  1ZG5 A;  3B8G A;  2RNG A;  1GUU A;  2P6E A;  5F47 A;  2Z1D A;  1QHG A;  1E3H A;  1TF9 A;  2YR2 A;  3IO1 A;  2QKM B;  3RJP A;  3B35 A;  2X1E A;  4A12 A;  2PJ7 A;  2GOX B;  3E6M A;  4ZYD A;  1Z2L A;  1YO5 C;  2DK5 A;  4MCQ A;  3S32 A;  5J40 A;  4HLY A;  4U0Y A;  2M0C A;  3S9M A;  3BLY A;  4X0G A;  2R7Q A;  1CJW A;  2F7V A;  2OCE A;  5D5X B;  3C2B A;  3E5X A;  5A2Q K;  1YIT I;  3BR0 A;  1YFH A;  1W4M A;  1XGO A;  3S2W A;  3BCA A;  2CQK A;  3MEX A;  5IT3 A;  1YR0 A;  3IU1 A;  2A5Y B;  2YX7 A;  3I4P A;  2VXD A;  4KUB A;  1IRG A;  5ICG A;  2JUC A;  4HPQ A;  3IH3 A;  2DLL A;  2LF8 A;  2Q1Z B;  3DF8 A;  5FFX A;  2E2H J;  3S16 J;  3H0G J;  5JLX A;  3T1B A;  2XRL A;  3BG5 A;  4ZTF A;  2AQF A;  1LFP A;  3CD6 I;  3DU6 A;  1EV7 A;  4II3 A;  4HQE A;  1JKQ C;  3RKQ A;  4KSI A;  3K9T A;  5D4S A;  3FXK A;  1BI1 A;  2OZU A;  1SD5 A;  2WV0 A;  2DA2 A;  3KP2 A;  3QOD A;  4MGR A;  4BH9 A;  2Z5U A;  3OR2 C;  3CUO A;  2H6C A;  2CH0 A;  3OWT A;  3BTI A;  1EJ9 A;  2HOA A;  2PJ9 A;  3SXN A;  2ICW G;  3HRU A;  2B7E A;  3IKT A;  3WC7 A;  1TXR A;  2K85 A;  3HC7 A;  1TWC J;  5HNF A;  1MDM B;  2I00 A;  2VBX A;  5AGE A;  1B72 B;  3SJM A;  4F8Z A;  4O23 A;  4FHT A;  2H27 A;  4FUU A;  1GVJ A;  5LD2 C;  3NQO A;  3S1M J;  1WFX A;  2OCC H;  2OU2 A;  1FOK A;  2B5G A;  3B3C A;  1IOF A;  3DWL E;  2EVN A;  4CYQ A;  3LQR A;  3D3S A;  3KHZ A;  4KOV A;  1Z1D A;  2ELK A;  4MEX F;  3PUF A;  2ESN A;  3LNQ A;  2IPQ X;  1EKE A;  2NYX A;  5FKM A;  3VOE A;  2EFW A;  4BNC A;  1LFW A;  3JAM K;  3I4N J;  2BOA A;  4CAX A;  2AFX A;  2QVP A;  3B3W A;  4OKO A;  2R7X A;  3LAP A;  4KZT A;  4ZI6 A;  3HIF A;  3IIB A;  3BP8 A;  2OTJ I;  3N05 A;  4U87 A;  1Z8W A;  1DP7 P;  3S15 J;  5KTC A;  3V7Z A;  3I59 B;  1L0O C;  1W5C C;  4L5J A;  1R58 A;  3CC7 I;  2E1M B;  1FWZ A;  3GCM A;  4HA8 A;  5BPD A;  2Z3Y A;  5M5X J;  1UFM A;  4HF2 A;  1J4J A;  1T98 A;  1YYV A;  2FQ3 A;  2REF A;  5CNP A;  2F8H A;  3GXO A;  4FET A;  2KRC A;  2V9P A;  5GAG J;  2EQR A;  1S8N A;  1X2M A;  3GFM A;  1I5Z A;  4DOZ A;  5K1Y A;  2IGM A;  3OYB A;  2HVS A;  5LEK A;  1JI8 A;  4OC2 A;  2FD5 A;  2E34 A;  1R23 A;  1K78 B;  2LSO A;  4JQF A;  5CKT A;  3S6H A;  4F7Z A;  4MQ9 F;  4ZJZ A;  3I3G A;  1DGW Y;  3CP8 A;  1WJD A;  2R0Q C;  2XRN A;  2V9V A;  3ZQG A;  2P6T A;  4LK0 F;  2HKO A;  5LLQ A;  2EZH A;  4GYI A;  4X5K A;  5A28 A;  4ZBG A;  2DDB A;  1SC7 A;  4RN7 A;  4EGY A;  1RI7 A;  1K4S A;  1XEB A;  4WCG A;  5C88 A;  3KKW A;  2HDW A;  2RNJ A;  2VBW A;  1HST A;  3H35 A;  4X2T A;  3TOB A;  2EBI A;  2IGO A;  4P9U A;  1CGP A;  3FEC A;  3BR1 A;  1R71 A;  2H09 A;  2WSA A;  1BAV A;  1OCC H;  5TIS C;  3ZCO A;  1HDU A;  3KYL A;  3BPX A;  4ITV A;  4GDF A;  3KIO A;  2ANP A;  1ZQ3 P;  2RQQ A;  3DEU A;  1T0F A;  4LMY A;  2KL4 A;  4IPA A;  1T38 A;  3KP6 A;  2ZED A;  4R79 A;  1KU7 A;  2UXX A;  1W5T A;  4ESJ A;  3S3N A;  3WGI A;  1EH8 A;  4J00 A;  3FMR A;  4UCN A;  2V79 A;  3FVL A;  2QBY B;  2KIF A;  1CPS A;  4CCJ A;  2DTZ A;  2IA2 A;  1G3T A;  4NF1 A;  1JKO C;  1OIS A;  2V1X A;  5FVJ A;  3KAS A;  3E3V A;  3AFH A;  3RPQ A;  5DUI A;  2M8G X;  2V8G A;  1MBH A;  5EZG A;  3I9V 2;  1ZAR A;  2XPV A;  2ME6 A;  4IRI A;  5HLI A;  1Y1V J;  2NS8 A;  4NBQ A;  1B6A A;  3FMS A;  2OB0 A;  5DCF A;  2GE3 A;  2OV7 A;  2LOO A;  1KUX A;  1AU7 A;  4XPL A;  2DYS H;  2DA7 A;  3NH8 A;  2VE9 A;  4OIO F;  3LA7 A;  3A01 B;  3HOZ J;  3RZD J;  1CQT A;  2DCE A;  2PCU A;  1R4N B;  3ECO A;  1L0C A;  1W7P B;  4I99 C;  3BT9 A;  3K4L A;  2KZG A;  4XKW A;  4XSX F;  3GME A;  4OIP F;  3H36 A;  3VSL A;  4RI1 A;  4XOP A;  1RRJ A;  1HC8 A;  2PIY A;  1OJL A;  3WU2 C;  3Q0W A;  1P6R A;  2KFD A;  2V8V A;  2LK2 A;  3FZV A;  1RKW A;  3ASO H;  3JRG A;  1T56 A;  4AC0 A;  2HEO A;  4OC5 A;  2CV0 A;  3OS1 A;  4YIR X;  3LA2 A;  2PJ2 A;  4A33 A;  2VPL A;  2LY9 A;  3F9K A;  2Z3N A;  5IYB J;  1ULY A;  1GXP A;  3CPX A;  3V38 A;  1VFC A;  3M8E A;  4OAE A;  1XBU A;  3HJE A;  4RS2 A;  1STZ A;  2IGN A;  4LIT A;  4PCQ A;  1YW6 A;  2DEA A;  5L3C A;  2JPC A;  4IO9 F;  1S7E A;  2F5V A;  3WC5 A;  3L2C A;  3S3M A;  5BWA B;  3HGY A;  2ELH A;  1KU3 A;  4OU0 A;  3HSR A;  3MN2 A;  3WTS C;  5EC4 A;  4PGG A;  1VQ6 I;  5EG0 B;  1VQN I;  3M8F A;  4IRH A;  2W7N A;  4FAI A;  2ZW6 A;  2GXG A;  2B0L A;  3RKW A;  4EJO A;  2XAJ A;  2PVW A;  3Q9V A;  2VQC A;  5FLM J;  1XRY A;  3GX4 X;  2BL1 A;  2OZH A;  3L9F A;  2Z2S B;  4R87 A;  4RM2 A;  2GU2 A;  2FSR A;  4P10 A;  1IN7 A;  4EVY A;  5L3F A;  3HEF A;  2LD5 A;  3DTK A;  4Q47 A;  2NVQ J;  3LAJ A;  1S7L A;  2JMW A;  3VSK A;  1S7N A;  2X6W A;  3E5Q A;  1MKM A;  5FFZ A;  5LHH A;  5GAD J;  4Y49 B;  1TWA J;  4AIJ A;  1ZG8 A;  1UMQ A;  2LKS A;  1LCP A;  3WTU C;  2A05 A;  2EV0 A;  4M6I A;  1PUE E;  4NQW B;  2DA5 A;  2M45 A;  4FWU A;  1MMG A;  3I54 A;  3DU5 A;  2Q7S A;  3HB9 A;  2ZNY A;  5K5Q A;  1Z7L A;  3D0S A;  3R60 A;  5DM7 F;  2O6G E;  4PZJ A;  3KP5 A;  5GPC A;  4E7I A;  2DU9 A;  4CGL A;  4Q38 A;  3IH2 A;  1S72 I;  2VC1 A;  5J1U A;  2LMD A;  2GXA A;  5E8I A;  1TZL A;  3GYH X;  4IOA F;  5AG5 A;  3JRE A;  1LAM A;  4UUS B;  3D68 A;  1TNS A;  4DYR A;  4KOU A;  1IID A;  3R96 A;  3F5B A;  3K70 C;  1OMI A;  2X4H A;  4A37 A;  2R7U A;  2XF6 A;  4Y3O A;  5IOY A;  2E71 A;  2VOP A;  1K6Y A;  1WCM J;  1T0F C;  2NS0 A;  3IWG A;  2BGC A;  2PVV A;  4WK8 F;  2MYS A;  3CDX A;  5F09 A;  3PQJ A;  4DJA A;  1GYT A;  3WE2 A;  3FXQ A;  3M4O J;  5JVG F;  4II9 A;  1BC8 C;  1I1D A;  1N75 A;  5HLH A;  4HG2 A;  2X0L A;  3CC2 I;  4KOY A;  2R5Y A;  2XAF A;  2GA1 A;  4UFX A;  5IYD J;  5H2F C;  2P5L C;  1MBE A;  3LD2 A;  1Z4R A;  3H9J A;  2HNH A;  3P9I A;  1R5H A;  4UUT A;  1NH3 A;  1ERD A;  3QPL A;  4QC6 A;  1S7K A;  3TO7 A;  4R8H A;  3CCQ I;  4M3E A;  1YME A;  4Y13 A;  3TW7 A;  5DYM A;  4XLC A;  3SZG A;  4FX4 A;  3GUD A;  3FXJ A;  4JX6 A;  3ZQQ A;  2O61 A;  2KIU A;  1DPU A;  5DD4 A;  4IK2 A;  2DMP A;  2JVH A;  2KPM A;  3EPZ A;  3FXM A;  4BBR J;  2VAS A;  4BQA A;  2GWR A;  5JVT A;  2VQY A;  5I4M A;  1XMK A;  1TIQ A;  3FXU A;  2OZG A;  2XPU A;  2EA2 A;  4CUG A;  2FE3 A;  3O2P E;  4HDV A;  2LY1 A;  3SI2 A;  3D5S C;  5AG7 A;  1Y7R A;  2M7A A;  1AA7 A;  2B4B A;  3QAH A;  4KDP A;  4KNY A;  2Z10 A;  5IOZ A;  2L9N A;  3QNV A;  4IF4 A;  1F5T A;  3GTL J;  4NGQ A;  3K9U A;  4XLA A;  1IRX A;  3OYA A;  2QA4 I;  5DCM B;  2XSJ C;  4Z2Y A;  4EM2 A;  5JM6 A;  5KTA A;  3FBI B;  4HEA 2;  3BJ7 A;  4CYC B;  1E3O C;  2G7H A;  1MMS A;  3QAY A;  2CFX A;  3H3U A;  3M9A A;  5HMN A;  2MFZ A;  4FD5 A;  4MHP A;  1AMP A;  4MFE A;  2P7V B;  5LRJ A;  2CGP A;  4E2A A;  5TGT A;  1XF8 A;  3H3Z A;  2DO7 A;  4U0W A;  4KN7 X;  1VQ8 I;  2EO8 A;  4A39 A;  5E3M A;  1BN5 A;  4LLG F;  2EJR A;  3E7L A;  3LSM A;  3JRH A;  3HRS A;  3ZQC A;  2V9K A;  3T5X A;  4RS8 A;  2IS2 A;  3BRO A;  4KS9 A;  4X1E A;  5FRO A;  5HS8 A;  3KZZ A;  3PFY A;  3PNY A;  2DQR A;  1A04 A;  1ZRC A;  4KOR A;  1NK2 P;  2RVC A;  4QBJ A;  3IC1 A;  5FB2 A;  3F8C A;  3CCU I;  3O6B B;  2OD5 A;  4RGX A;  4C2T A;  1B9M A;  4LOC A;  2HPM A;  1IUY A;  4D5F A;  4NHJ A;  5HS7 A;  2ZXH A;  1Y0N A;  2QVO A;  2FF4 A;  4UEF A;  4FT8 A;  2WC2 A;  1WJA A;  2FEZ A;  5B5E C;  2G3A A;  1IRF A;  4UCM A;  4PK3 A;  4C2Y A;  3LL7 A;  1KYW A;  2HDD A;  1B4A A;  3GY9 A;  3KPH A;  3N4M A;  4A3I J;  4AVZ A;  1S5K A;  5KVR A;  4NGR A;  4HST A;  1IGN A;  3F72 A;  3ONQ A;  3IWE A;  1Q2Y A;  3V8I A;  3K4J A;  2EIK H;  1ZG1 A;  3H8E A;  3E0J B;  3FM3 A;  4A0Y A;  3L2R A;  1G4D A;  1GHC A;  2Q2E B;  3S1N J;  2H6B A;  3HBL A;  2E1N A;  3MFK A;  1HBX G;  3FED A;  1KYZ A;  3QPH A;  4E4H A;  3IHU A;  2ZJQ F;  4X8I A;  5FD6 A;  3DCF A;  1USS A;  2C1C A;  4UIB A;  4UV9 A;  4OIN F;  2FS5 A;  4BY7 J;  3D7F A;  2R93 J;  4FD6 A;  3NRV A;  2XDV A;  2DAO A;  1U9N A;  4D9J A;  3PL8 A;  4G7O F;  3GTM J;  4IF5 A;  3OOU A;  2PFB A;  2RFH A;  5HDG A;  1TKJ A;  1D1C A;  4R57 A;  5IP9 J;  2VON A;  5ILV A;  3HXL A;  3BZ6 A;  2OPT A;  3OIP A;  4RAF A;  2LBF B;  4MEY F;  2QKL B;  1Z3X A;  4AUX A;  3HOW J;  3IWW A;  1S5L C;  3ISX A;  1BIB A;  1DUX C;  3KET A;  5A27 A;  3RTR A;  1YLF A;  3DKY A;  1G3Y A;  5GCN A;  1I1S A;  4MI4 A;  4ZZD A;  3RDI A;  1ZLK A;  2VXK A;  4UCP A;  5IP6 A;  4CH7 A;  5F1R A;  2XHK A;  2YND A;  3Q0U A;  3MZ8 A;  2L02 A;  1B8I A;  3V8L A;  1LFU P;  4E7S A;  4RA2 A;  3BPV A;  1S7O A;  3FDY A;  4I49 A;  4Y7N J;  2ZEL A;  3P9K A;  2DOE A;  5DM6 F;  2GA2 A;  2A5W A;  4B12 A;  5D6E A;  4OWR B;  1NHA A;  2L5Q A;  4EJT A;  4CCN A;  3DLA A;  1U5T B;  1JWQ A;  1YIJ I;  1LVK A;  4N9H A;  1PUA A;  3VYS B;  4MTD A;  3MRU A;  4XLN F;  2Z99 A;  2KP6 A;  1I6H J;  2QEC A;  3BHX A;  4DJL A;  4JYK A;  3P2F A;  4ETS A;  3B7I A;  3BR6 A;  3IWF A;  3QU3 A;  4KUM A;  2DK8 A;  4RAY A;  1S29 A;  2DJN A;  1O7F A;  4PSW A;  1UG2 A;  3OYE A;  4KSA A;  1E2X A;  2VXZ A;  4BHC A;  4OIQ F;  3EFA A;  2PJP A;  2X48 A;  5IPA A;  3NAU A;  2Q0O A;  4M74 A;  4ANJ A;  4IQJ A;  1D1B A;  1TBX A;  2HOS A;  2EK9 A;  2JTV A;  4MFQ A;  2PJ8 A;  4B1R A;  2FE7 A;  3CJT B;  1R1V A;  3DEW A;  3WTY C;  3Q9S A;  3F21 A;  1BI2 A;  4WXD A;  3RPU A;  1W1W E;  2PMZ A;  4FQG A;  4XLE A;  4DYC A;  4ASN A;  2M5W A;  3Q3S A;  1SVL A;  4XPK A;  1Z8X A;  5FGM A;  2HXO A;  1CF7 B;  3ZMV A;  3FK6 A;  1DGR M;  1GV2 A;  3BTJ A;  2Q43 A;  4P44 A;  4B13 A;  1LDD A;  2K9S A;  3FBN B;  2R5Z B;  3R61 A;  5HNH A;  4X3R A;  4B11 A;  4KVX A;  2LNB A;  1OCR H;  3ZOB A;  1H9G A;  2XB5 A;  5DWM A;  1NG7 A;  5H84 A;  4R3L A;  3DEE A;  4CCL A;  1AKH B;  1RNL A;  4FIS A;  4JK1 X;  1X2N A;  2EFO A;  5F1J A;  4OIW A;  3I71 A;  4EM0 B;  4YRV A;  1JKP C;  4IHS A;  2VKV A;  5G20 A;  2V1D A;  4HBL A;  5LHG A;  4IZZ A;  4Q36 A;  1ZR2 A;  1YX3 A;  4UNO A;  4NNJ A;  4FD4 A;  5G1Z A;  3QOP A;  1R22 A;  3MGD A;  1ITY A;  4KYW A;  3UY5 A;  4CGP A;  3DKX A;  2GAU A;  3J7A Y;  5B66 C;  1LFB A;  4HW0 A;  1MW7 A;  4G6D A;  1WJC A;  5CVV A;  3CP2 A;  2PMH A;  2E19 A;  1ETV A;  3CLQ A;  2OH1 A;  2YPR A;  4UB8 C;  3KFW X;  3BI1 A;  4C3H J;  1G3W A;  4BYY A;  2GQQ A;  3DPT A;  3I4M J;  3LSR A;  2GIZ A;  2WPW A;  5E20 A;  3ZMZ A;  2DF5 A;  5AG6 A;  1O4X A;  3FMQ A;  2OC6 A;  4L18 B;  1D5V A;  4ZX8 A;  3V8K A;  1YJW I;  1RUO A;  4AVP A;  1KGS A;  2QF7 A;  3K1P A;  5H6R A;  5I0C A;  1T95 A;  4JX5 A;  4XKB A;  4KA4 A;  1SAX A;  1ZG9 A;  5J47 A;  1MH3 A;  3R1K A;  5D29 A;  3OYC A;  3HLP A;  3M7G A;  5L3D A;  4A38 A;  1XB4 A;  2D2W A;  4Z65 A;  3NWT A;  1WJ5 A;  4LG0 A;  5EF6 A;  1T39 A;  1BIA A;  5HDK A;  3JRA A;  2LTP A;  3S2H J;  1LKX A;  2FA5 A;  2BY3 A;  3GZ6 A;  1PYT B;  4YFN F;  3GLJ A;  2R4G A;  2AXL A;  3IC7 A;  2M2E A;  3KP4 A;  1XJO A;  3H8F A;  4C68 A;  2E7X A;  4F3Q A;  3CXP A;  3RIR A;  2AXT C;  3BTC A;  1C0W A;  4P9F A;  2CW0 F;  1CG2 A;  4ESF A;  1TC3 C;  2I8D A;  3F6O A;  5C44 J;  4Q5S F;  5IT9 Z;  3KL9 A;  1A6I A;  3PB9 X;  1MBF A;  4KFC A;  4NDL A;  1RIO H;  5ICF A;  1Y56 A;  4Q7A A;  4GXO A;  2B9S A;  2KQR A;  2HV2 A;  4X6A J;  2AE6 A;  4CSW A;  3ISP A;  3LMM A;  1TF8 A;  4UF4 A;  3E5U A;  3CMM A;  2BV6 A;  3HTS B;  4E0A A;  2BXY A;  3TGN A;  4A0X A;  2VEZ A;  5EYR A;  1R00 A;  3DBH B;  5JFR A;  4JBA A;  4MRI A;  1R3N A;  2HC9 A;  3DGV A;  5F46 A;  1M4G A;  4RDU A;  5LRG A;  3M1E A;  4A6E A;  2NMT A;  3RO0 A;  1TWF J;  4M9S A;  1QPM A;  3SHF A;  4D0P A;  3KZY A;  1D0X A;  3B6C A;  4ESB A;  5ELY A;  1V54 H;  3WG9 A;  3AKZ A;  2VT3 A;  3OV8 A;  2VL1 A;  2HFH A;  2OJE D;  2DA6 A;  4UBR A;  1VKC A;  3GWZ A;  4E7L A;  1ZRF A;  3LSG A;  1XX5 A;  1A31 A;  2D4P A;  1HCR A;  2A4N A;  5ICC A;  3A2K A;  2WY7 Q;  4XID A;  2D5V A;  4CA0 A;  4M6X A;  1N25 A;  2KHM A;  3M07 A;  1K4J A;  2ID3 A;  2ISY A;  1OPC A;  1ORK A;  3FIX A;  2XAG A;  5JGF A;  3MZY A;  3WG7 H;  3VAR A;  4A69 C;  2VLA A;  5F64 A;  4CAV A;  3P2H A;  4RLQ A;  2F4O B;  1V0C A;  3HRM A;  3L09 A;  4FE4 A;  4GFB A;  2IA0 A;  2E2I J;  1V3F A;  1ZG7 A;  4O6J A;  2I10 A;  4R1H A;  2IP2 A;  4I76 A;  1P4A A;  1JT6 A;  2L9R A;  1QA6 A;  1SFE A;  2IEK A;  4O3M A;  4IHY A;  2CRG A;  3OR1 C;  3OMY A;  1HKS A;  4IHW A;  1OZP A;  3E6C C;  5E3N A;  5HVQ C;  2FRH A;  4DNC A;  3WTZ A;  1JQG A;  2E7W A;  2BEO A;  3KZW A;  4U7B A;  4QPO A;  2ZME A;  5AIQ A;  4G7Z F;  5LGU A;  1SFK A;  2KCW A;  2LY2 A;  4BJT A;  1ZO0 A;  5K7F A;  1SMT A;  1W7P D;  4H6U A;  1PCA A;  2IRF G;  4E6K G;  1FMV A;  2AQE A;  1H8A C;  2L7K A;  3UR3 C;  2B4D B;  1OCP A;  1ZHF A;  5JHU A;  4HF0 A;  3CCE I;  5M3F J;  4KOX A;  1A36 A;  2FNP A;  4L0Z B;  4MFZ A;  4NSQ A;  1PJR A;  2ZBK A;  2VZY A;  3HSF A;  2IJZ A;  4AM3 A;  2OR4 A;  4F0Y A;  5K8P A;  4HAM A;  2PRQ A;  1J5Y A;  2LR8 A;  3OL3 A;  2R7R A;  1ZR4 A;  3GB0 A;  1TL8 A;  3TKY A;  2JA5 J;  4GCV A;  3IRR A;  1W0U A;  3ZZI A;  3FJU A;  2IS4 A;  1WH5 A;  1ZTR A;  3K6G A;  4IKF A;  3KR5 A;  1NE9 A;  3FIW A;  2X6X A;  2L54 A;  1WPK A;  2MD0 A;  4WF2 A;  4PK4 A;  1WZ2 A;  3R9G A;  2P0W A;  4I01 A;  2PJR A;  3IU2 A;  2DPS A;  2E36 A;  2DOF A;  1QMU A;  1TT5 B;  4NB5 A;  4D7N A;  3EC4 A;  4OC4 A;  2PR1 A;  2J8N A;  4KVM E;  2WAQ N;  2AFZ A;  2ZEE A;  2L01 A;  4KOW A;  1OYW A;  4R76 A;  2JZY A;  4F6A A;  3IH4 A;  2LKP A;  2F5F A;  4FAS D;  2PJ1 A;  5LRS A;  2EFN A;  1JKR C;  4EJV A;  4AB7 A;  2RGV A;  3VFZ A;  4I7H A;  1MNM C;  4F0X A;  4B5P B;  1Z05 A;  2PIZ A;  2KLO A;  4J01 A;  1W36 D;  3NE8 A;  5DTD A;  4OC0 A;  2F5E A;  3C2G A;  2PQ8 A;  2Z3L A;  1XGN A;  3JW4 A;  2Y0M A;  4DZJ A;  1KZF A;  2Z3M A;  5FD5 A;  1K83 J;  1Z6R A;  1V4R A;  3K2Z A;  2ZFU A;  2JWT A;  4UV8 A;  1APL C;  4ZY0 A;  3S1Q J;  4RAG A;  3CMA I;  2OQG A;  5E18 F;  2PJB A;  2PRB A;  1Z6T A;  2A6T A;  2K5C A;  4QUS A;  3MVP A;  5AIP A;  3HUG A;  3CJQ B;  1UJ8 A;  3IEH A;  2DFF A;  3GTO J;  3K0L A;  3DSB A;  4I2O A;  5BQT A;  4RAZ A;  5HOO A;  3F0C A;  4P45 A;  1SFU A;  2XF7 A;  4OMY A;  5IYC J;  2BHZ A;  4ZH4 F;  1MSE C;  3B3V A;  2MC3 A;  2X9D A;  3F6V A;  4CGZ A;  2BY2 A;  4YIF A;  3W2W A;  2J8M A;  4LGW A;  5IB0 A;  2JBJ A;  3P5J A;  3I1U A;  3ROU A;  3JVN A;  1BOB A;  1H9T A;  2MAB A;  1B72 A;  1PYV A;  2CS3 A;  1PU9 A;  2BW3 A;  3WGH A;  1CBX A;  2BCO A;  3K4K A;  3NA6 A;  4UWJ A;  2HQ5 A;  4DBQ A;  4WWV A;  2VZZ A;  2HPI A;  3BZC A;  2NVX J;  5H86 A;  2Z9O A;  4U0V A;  2ZEO A;  2PBI A;  2VJ4 A;  2HYF A;  4PSX A;  5D5V B;  3C26 A;  5F49 A;  1TKH A;  5E1W A;  2WYR A;  1RTQ A;  2GLF A;  3I0T A;  4YG2 F;  1Y0R A;  2CJJ A;  3M8J A;  1BBY A;  2R7V A;  4HNX B;  3SI1 A;  3FHN A;  4M72 A;  2IMO A;  2DI3 A;  5ILS A;  2HOT A;  1H89 C;  1K4T A;  3GYA A;  1Z5R A;  4AVB A;  2O4H A;  3ZQH A;  3AG4 H;  2BUE A;  2DA4 A;  3MQ0 A;  2VL8 A;  3FXR A;  3GBG A;  4XKV A;  5EEH A;  4MCS A;  3RSN A;  4XR6 A;  2VUM J;  4ZTJ A;  4P4D A;  4MCR A;  3TOA A;  4FBE A;  2OZ6 A;  1U6G A;  1IGB A;  1XMA A;  2DMT A;  1SD6 A;  1XSX A;  4KIT B;  1KA8 A;  3D67 A;  2BYV E;  2W24 A;  4IHT A;  2BE5 F;  2N8G A;  2EZK A;  2ZB9 A;  2ZME C;  2ZW5 A;  3F0A A;  1XPX A;  1SFO J;  1FLI A;  4A32 A;  1ZK8 A;  4UWI A;  2BVL A;  2LLK A;  2MC4 A;  4ZYG A;  1Z9C A;  3ZXS A;  2HI3 A;  4LD5 A;  4G94 A;  4EEF G;  1FJL A;  2P81 A;  5D5U B;  2M0M A;  2OF7 A;  1UZC A;  4MQV A;  3EQL F;  2NSM A;  1FTZ A;  4DZP A;  2EFQ A;  4F52 A;  2XEF A;  1ZGJ A;  2ZFW A;  3R9E A;  3SJG A;  4IOC F;  1KQ0 A;  2MLK A;  4QTR A;  4MFP A;  1B6B A;  4R6T A;  2ZXW H;  2GRE A;  2QGU A;  3LSP A;  2VQH A;  3T8R A;  4XPD B;  2R3S A;  5BPI A;  2STT A;  4KSF A;  5CVJ A;  3OYM A;  1FYL A;  3HL2 A;  5ILU A;  3ZQL A;  1EA3 A;  3LSI A;  1I39 A;  3B02 A;  4IQ4 A;  3W3C A;  2PJA A;  1V5E A;  5F04 A;  3WE3 A;  1SFX A;  1X3Z B;  5M3M J;  1YW9 A;  2L4A A;  2DFI A;  2Y69 H;  2QJ8 A;  1FBU A;  4XRF A;  4FD7 A;  2Y2Z A;  3BDD A;  3GW2 A;  3TO6 A;  1LAP A;  4K2E A;  3SYT A;  1LOK A;  2ZXI A;  2D45 A;  2QBY A;  4CDG A;  1IB1 E;  2MLG A;  3PSI A;  3SXO A;  4D7M A;  3LA3 A;  5IY5 H;  3DQV C;  1VTN C;  1BW5 A;  1YVO A;  2W82 A;  2Z33 A;  2FVG A;  4TNU A;  2W25 A;  3CUQ B;  3S8P A;  4G9Y A;  3VH9 A;  1VHO A;  4LFU A;  1F36 A;  2XEJ A;  4A3F J;  3TL4 X;  4UXN A;  1Z21 A;  2ZEP A;  2QWW A;  1AYE A;  3CES A;  1XFO A;  2AHQ A;  4NGP A;  2LRD A;  1S6L A;  1P9Q C;  2A6H F;  2LRE A;  4A3K J;  3JRU A;  1P4X A;  1RPW A;  4N9I A;  2YU9 J;  2CF4 A;  1GHE A;  2YS9 A;  3PRT A;  2L9V A;  1BA5 A;  1G2H A;  2Y0S N;  4S05 A;  1YRE A;  2M7B A;  3ERM A;  1WJB A;  3F8B A;  3G8W A;  3CF5 F;  5LBQ A;  2J9A A;  2CW8 A;  1IZ1 A;  4TV7 A;  1YJ9 I;  2Q4Z A;  2PI0 A;  4F92 B;  4CYN A;  4Y52 J;  2CV2 A;  4RB0 A;  4EME A;  1TW2 A;  1X1D A;  5CPR B;  1HKT A;  4CO8 A;  4M3S A;  4U9Y A;  1LVA A;  1R1U A;  4PDK A;  3E6D A;  4HNV A;  3ZPL A;  3LSH A;  2HOE A;  1BOA A;  1R1T A;  4EV0 A;  5D4R A;  1RUN A;  4V19 K;  2E1C A;  4KT6 A;  2QQA A;  2JVG A;  1I27 A;  2DYR H;  1UAA A;  5D6F A;  5J1Y A;  2GM4 A;  2EH3 A;  2XGC A;  3G1L A;  3OS2 A;  1TKF A;  2NVY J;  1NTC A;  4KLW A;  2JRM A;  1MNE A;  3N7Z A;  4UVC A;  2AFS A;  1Y8Q B;  3GTQ J;  4I0A A;  4M73 A;  3SDG A;  2QYO A;  1PUF A;  3HM5 A;  4A3C J;  2C6P A;  4L8A A;  1TW3 A;  4C2Z A;  1VQ9 I;  5EGO A;  3AG2 H;  1AHD P;  3BG6 A;  1SAN A;  3MKW B;  4IXA A;  2MD5 A;  5E8G A;  2NVT J;  1R57 A;  3T90 A;  2LF7 A;  4CGM A;  2HQR A;  2R7T A;  2FCK A;  2ACJ A;  2B3U A;  3K4C A;  3RKY A;  1DDN A;  1BI0 A;  3D7D A;  5K7H A;  2B63 J;  2FSW A;  2XAU A;  3IUO A;  2KT0 A;  2P5K A;  2Q04 A;  1X1A A;  3FXT A;  4UHT A;  2CUE A;  2E1M C;  3HOY J;  5L3E A;  3SJE A;  2PJ3 A;  3SFI A;  1T8I A;  1GT0 C;  5M5W J;  4W9Y A;  2K9N A;  4BJ6 C;  3HUV A;  1HDP A;  2YNE A;  3ZN1 A;  3DXJ F;  2CY2 A;  1J0R A;  1FEX A;  2K7L A;  2RC4 A;  1TWH J;  4OOI A;  5EMI A;  2Y48 A;  3A03 A;  3OL4 A;  2YUS A;  1QST A;  1FTT A;  3FH4 A;  4CPA A;  5LYF A;  4KIB A;  5F27 A;  2EZI A;  2P6G A;  4WXH A;  4CYP A;  4I98 B;  5K5R A;  3L2W A;  2QLZ A;  4E7Z A;  4NQW A;  1YVK A;  4JXQ A;  5FRN A;  3CXS A;  1HDD C;  1WH7 A;  4IEJ A;  2HWV A;  1FIP A;  3WHC A;  3R95 A;  1IDY A;  3ZMD A;  4BXX J;  3ZN0 A;  4CRZ B;  2OBP A;  4N4N B;  3LWU A;  2FBH A;  3JRI A;  2R5Y B;  4AXV A;  2XKO A;  2K02 A;  2JPB A;  1X3U A;  2QQ9 A;  4UUS A;  2CSO A;  4QVT A;  3TX8 A;  4BQQ A;  1JHF A;  1RKT A;  4BL0 B;  5GP9 A;  4B48 A;  2EIL H;  3V42 A;  4KMF A;  4AIH A;  4LK1 F;  4YU9 A;  1OCO H;  4PV6 A;  3J7Z I;  1FT7 A;  1QZE A;  4ENM A;  8CPA A;  4XKC A;  1LDK B;  2EIN H;  3T9Y A;  3MMY B;  4OP4 A;  3TQN A;  1QNT A;  2P6S A;  4B5O A;  4RBO A;  4NGS A;  4DW6 A;  5IX3 A;  2P5V A;  1KU2 A;  4BE0 A;  2G9D A;  2XSD C;  3FM5 A;  2Q44 A;  4AG7 A;  3MCZ A;  4P55 A;  1PVE A;  5EEG A;  2XEI A;  5FKN A;  3BR3 A;  2AFM A;  4PPZ A;  5BS6 A;  4ENN A;  3V4G A;  4IJA A;  1Y39 A;  3EY5 A;  1R5G A;  4GYG A;  5C4J J;  3C7J A;  1FX7 A;  4HDU A;  1VQ4 I;  2P4W A;  3P9C A;  3BWG A;  4G12 A;  4JX4 A;  1YLE A;  4LIU A;  2BBY A;  2FJ1 A;  3KEQ A;  5KAI C;  2STW A;  3SHP A;  3QP5 A;  4H89 A;  2GOM A;  2X1D A;  2NYQ A;  3U1D A;  4XRS A;  5GPA A;  2GFQ A;  3S9L A;  5E17 F;  1Q2C A;  7CPA A;  2UV1 A;  2ODF A;  2B58 A;  4KVO E;  3CUQ C;  1JE8 A;  4A30 A;  1M4D A;  3HG9 A;  1FMW A;  3I53 A;  4G6T B;  5M5Y J;  1S3Z A;  5G21 A;  1XC5 A;  3PSF A;  1IY7 A;  2VKH A;  2FNA A;  3CXQ A;  1I50 J;  2ZKZ A;  4TWE A;  1FYK A;  2L7Z A;  1MMN A;  1D3Y A;  2MSY A;  4M3B A;  3AAF A;  2MW8 A;  3TMO A;  3ZQI A;  1YK3 A;  4ORF A;  1YW7 A;  3RAM A;  2DMQ A;  3B3T A;  1UG0 A;  4XLF A;  3PBE A;  2KMU A;  3DPL C;  5J3L A;  2UXN A;  4J19 A;  3BG9 A;  2H5M A;  3LSJ A;  4PJ0 C;  4V2G A;  5AON A;  1JGG A;  2IVM A;  1D0Y A;  4PUS A;  4G8X A;  4YEL A;  3ZMS A;  3G71 I;  3CJR B;  1H8L A;  2BO9 A;  2GAN A;  4JJX A;  4B14 A;  1IN8 A;  4DUK A;  4IUS A;  1YRN A;  1JTX A;  1XD7 A;  1U78 A;  2Y9Z A;  4Y17 A;  1LB2 A;  1JHH A;  2K86 A;  3T8T A;  4BIN A;  2DQL A;  3KP3 A;  5BOX A;  9ANT A;  1IAW A;  1X4P A;  1LE8 A;  3WOD F;  3BJA A;  2MGQ A;  3KYD B;  2WAF A;  1M4L A;  1Z77 A;  3V8J A;  4E7H A;  2XC7 A;  4EAT A;  3FRM A;  4KOT A;  4F93 B;  1YX0 A;  3GO5 A;  2Z11 A;  1FP2 A;  4U5Y A;  1W36 C;  1G3S A;  4L9N A;  3B73 A;  1IXC A;  4BXU A;  1ZH5 A;  1XMX A;  1Z91 A;  2YX4 A;  4HYE A;  4C2U A;  3A02 A;  5F0C A;  5D8N A;  4AIK A;  1RC9 A;  3HHH A;  3RZA A;  3R6S A;  1T2K A;  2WAE A;  3O8H A;  5HOD A;  4M6G A;  1FOX A;  3CQZ J;  1N78 A;  1Q1V A;  4Y49 C;  1RZ4 A;  2LKX A;  2ECB A;  1QVU A;  2OQR A;  2XAQ A;  5DUK A;  2WB1 A;  4R3K A;  4CCK A;  2DXQ A;  3BJO A;  1ZRD A;  4CCO A;  4EWT A;  2X6Y A;  3OYN A;  4UUV A;  1I3Q J;  1BW6 A;  3PBB A;  4XNH B;  4YEJ A;  1F57 A;  1N77 A;  1UCR A;  3K4B A;  2Q2E A;  3U2R A;  4E7J A;  3K4M A;  3TE4 A;  1ENH A;  3O3K A;  3QOE A;  5BNG A;  2JEV A;  2R98 A;  3ERE D;  2E35 A;  2VBQ A;  4QPQ A;  4B43 A;  4BXF A;  4CZC A;  2ZPA A;  4OAZ A;  1HKQ A;  2E5N A;  2YU3 A;  3FX3 A;  4NUB A;  1B8I B;  4HRI A;  2GIV A;  2UWM A;  2K4B A;  2XB0 X;  1IC8 A;  1D8K A;  4EM1 A;  2JA7 J;  4W1U A;  2PJC A;  2PSW A;  3IFE A;  3SJX A;  2DT7 B;  2K3F A;  3J81 Z;  1ACI A;  2VIX A;  1BC7 C;  1KUV A;  2FXF A;  1UEL B;  2HR3 A;  3R4K A;  3BJ8 A;  3H9Q A;  1G6N A;  3SQN A;  5FLV A;  1SVM A;  1R5I D;  4EFD A;  3WC6 A;  2M4K A;  1FNO A;  4O5V A;  5LRR A;  2PJ5 A;  1QSR A;  3CO6 C;  3RCO A;  1X10 A;  3EYI A;  2J5O A;  3HPH A;  3C3W A;  2ZEM A;  4F9U A;  5CPA A;  1ZLJ A;  1O3R A;  1ELM P;  2FOK A;  4FTH A;  1TQP A;  3TC8 A;  1ZN2 A;  3RYO A;  2ELJ A;  2Q7B A;  3LMS A;  1U2W A;  1AUG A;  2IAI A;  2WAD A;  2PG4 A;  3JRF A;  4QSH A;  1U5T A;  3WTT C;  2HTS A;  1IOI A;  1MND A;  2CNM A;  2KJB A;  1LUJ B;  3U1K A;  3RBU A;  1J59 A;  2FBI A;  3L2U A;  3CT9 A;  3E0K A;  1R4M B;  2AO9 A;  1CX8 A;  4HLX A;  3ZR8 X;  1XCB A;  1MJB A;  4KMU X;  4YFK F;  3DLJ A;  2Q4V A;  1IN4 A;  2CUZ A;  4L89 A;  2F5C A;  2IJL A;  2VJJ A;  2M1B A;  3UNG C;  3G3S A;  3GTP J;  1OLT A;  4LB6 B;  2L2O A;  3K1N A;  4BMH A;  5K8M A;  1B1B A;  1P7J A;  3M1C A;  2QSG X;  4BQN A;  1CP6 A;  4KIF A;  2HKX A;  4PJM A;  2WY8 Q;  2X7B A;  3ABL H;  2CW7 A;  3QRF F;  2R7H A;  2VI6 A;  4BEH B;  4BAY A;  1TP4 A;  4AYB N;  4XLP F;  2ZEF A;  2CQX A;  2NNN A;  1LJ9 A;  1Y1W J;  1BLL E;  1J9I A;  3RNZ A;  2A6E F;  1X1C A;  1NK3 P;  1RR7 A;  4HPS A;  1MD0 A;  2L7F P;  3QYB A;  2WAQ A;  1K6O A;  3F3X A;  4S04 A;  3CO7 C;  1XMT A;  5L3G A;  2EV6 A;  4MIM A;  1MGT A;  1IN6 A;  5LRK A;  1J7K A;  3S9N A;  4IL6 C;  2R5Z A;  1VQK I;  2JA6 J;  1F1Z A;  3KGQ A;  1JUS A;  4CYD A;  4HNT A;  3MD2 A;  2LDU A;  1YJN I;  1ONV A;  4M9X A;  4IHM A;  1WI9 A;  1Z67 A;  1JT0 A;  2IQ6 A;  1AKH A;  4U7D A;  3U21 A;  3H9G A;  2DPD A;  4FCY A;  4PXC A;  3QPS A;  3EUK L;  2A61 A;  4H4K C;  1A35 A;  3FK7 A;  5LFA A;  2E2J J;  3IV5 A;  1U9O A;  2EIJ H;  1WJF A;  3OYG A;  1ETW A;  3T0Y A;  1BI3 A;  3MN8 A;  2Y75 A;  5J8C A;  5CYV A;  5A2Q Z;  2QIR A;  5LYI A;  2OOT A;  3KLN A;  4LQG A;  5DD8 A; 
#chains in the Genus database with same CATH homology
 2ZFU A;  5KHD A;  1U6M A;  5EC4 A;  3F8K A;  4B44 A;  2VQG A;  1M44 A;  4AVA A;  3HKZ A;  2PRB A;  1R6R A;  1Y6I A;  2A6T A;  2K5C A;  2W7N A;  2ZW6 A;  2JDC A;  4Q36 A;  3CJQ B;  4QUS A;  2FT0 A;  4CCM A;  4C30 A;  2J8R A;  1ZEL A;  2E60 A;  2OUM A;  2VQC A;  2KRH A;  2BL1 A;  3DSB A;  4YFJ A;  2OZH A;  2Z2S B;  3DTI A;  5HOO A;  4RM2 A;  4R87 A;  1J09 A;  2XF7 A;  2FSR A;  3TCV A;  4EVY A;  4UFV A;  3W2W A;  3DTK A;  4PJJ A;  2J8M A;  4NCZ A;  5IB0 A;  2V4J C;  1S7L A;  4MFK A;  1NG6 A;  3JVN A;  1BOB A;  2M4G A;  2MAB A;  3VSK A;  1PYV A;  2CS3 A;  1PU9 A;  1S7N A;  2EUI A;  2X6W A;  2BW3 A;  3PP9 A;  4Y49 B;  3K4K A;  2ZXV A;  3DR8 A;  4UWJ A;  3VYT B;  2K3P A;  4NQW B;  3IGR A;  1MMG A;  4DBQ A;  3DU5 A;  3ZGK A;  2AJ6 A;  2VZZ A;  1U0J A;  2HPI A;  5H86 A;  1Z7L A;  2FUG 2;  4H6Z A;  2VJ4 A;  2VKD A;  4PSX A;  4DBR A;  4E7I A;  3C26 A;  3D2P A;  5F49 A;  3S6G A;  4Q38 A;  4CGL A;  3S93 A;  2DT6 A;  2W4S A;  4BBH A;  3CZ6 A;  1TZL A;  2LBF A;  3QYF A;  2HZD A;  3M8J A;  2R7V A;  4JWP A;  2FL4 A;  4HNX B;  4MJ8 A;  3FHN A;  5AG5 A;  4KOU A;  3R96 A;  1IID A;  1V5F A;  3EXN A;  3A4C A;  3H5R A;  3F5B A;  3K70 C;  1ON0 A;  3GYA A;  4AVB A;  5DWN A;  1SAU A;  3QB8 A;  2R7U A;  4B13 A;  2BUE A;  2XF6 A;  4Y3O A;  4XKV A;  1Z9U A;  2VL8 A;  3GBG A;  1K6Y A;  1T0F C;  2HVQ A;  3RSN A;  4XR6 A;  3IWG A;  2MYS A;  4ZTJ A;  4CAW A;  5IV0 A;  4DJA A;  2Q0Y A;  2R7S A;  3TOA A;  5ISV A;  2R7W A;  4II2 A;  2VQL A;  4KIT B;  3FB3 A;  4II9 A;  2JA2 A;  1I1D A;  2CMP A;  2ZW5 A;  4YRH A;  3F0A A;  4NC8 A;  1N75 A;  4HG2 A;  4U9Z A;  4A32 A;  4UWI A;  2BVL A;  2FIW A;  4OAY A;  2MC4 A;  5KTD A;  4KOS A;  4KOY A;  2JDD A;  3H5N A;  3ZXS A;  1WJE A;  3AL0 B;  4UFX A;  5H84 A;  4BE1 A;  3C2H A;  4Y4R A;  1WWZ A;  3TBI A;  3LD2 A;  2HQA A;  2M0M A;  4M85 A;  1DP3 A;  1Z4R A;  3H9J A;  2HNH A;  4A2Z A;  4B10 A;  2LH9 A;  1Y9K A;  4HSR A;  4P5O A;  4F52 A;  4QC6 A;  1X19 A;  1ERD A;  2ZSH B;  4MY0 A;  3R9E A;  1S7K A;  2O28 A;  3TO7 A;  4CGO A;  2Q4Y A;  1B6B A;  4MFP A;  3BLN A;  1NSL A;  1Z4E A;  2VQH A;  3SEZ A;  2D4O A;  2YNC C;  4XPD B;  4XLC A;  4C7I A;  3SZG A;  4KSF A;  3OYM A;  3ZQQ A;  5CQG A;  3HL2 A;  2Z3K A;  3ZRG A;  2KPM A;  2JVH A;  3EPZ A;  2ZSI B;  2VQY A;  2VAS A;  2KDO A;  1EA3 A;  2XF5 A;  3LSI A;  3H5A A;  1TIQ A;  3E1S A;  4IQ4 A;  3W3C A;  1V5E A;  2IS1 A;  2OZG A;  3SDB A;  4CUG A;  2WPX A;  3DNS A;  3PUB A;  2K9L A;  2LY1 A;  3OY9 A;  1MJA A;  3D5S C;  1QHH D;  1IYK A;  4AG9 A;  5AG7 A;  1Y7R A;  2M7A A;  1AA7 A;  2B4B A;  3QAH A;  4FD7 A;  2Z10 A;  3TO6 A;  4A31 A;  2HVR A;  2L9N A;  3SYT A;  1TT0 A;  2ZXI A;  2BSW A;  5KCM A;  1IB1 E;  3K9U A;  3PSI A;  4XLA A;  4HNW B;  1IRX A;  3SXO A;  3DQV C;  4PFO A;  3CF2 A;  4XLH A;  3HOT A;  2W82 A;  3OYJ A;  3OYA A;  1YVO A;  2DPT A;  4JD6 A;  2XSJ C;  3S8P A;  2WA0 A;  5KTA A;  3FBI B;  2PJR B;  4HEA 2;  3BJ7 A;  3TL4 X;  4E7K A;  2JLM A;  5HMN A;  1Z21 A;  2MFZ A;  3HOS A;  4FD5 A;  3CES A;  5C82 A;  5JQ4 A;  2LRD A;  1WK4 A;  1P9Q C;  2LRE A;  2Y0S A;  2HUZ A;  1BR2 A;  1GHE A;  3S6F A;  5TGT A;  1XF8 A;  1Q2D A;  2VI7 A;  4E2A A;  4KJZ A;  2G0B A;  1YRE A;  2M7B A;  1S7F A;  3H0D A;  1WJB A;  3G8W A;  4ZDP A;  4BEH A;  1MJ9 A;  2CW8 A;  3LSM A;  4KUA A;  2JSP A;  2VJI A;  2V9K A;  4F92 B;  1QSN A;  4XOT A;  4CYN A;  5F48 A;  2CV2 A;  4RMN A;  4DGW B;  2IS2 A;  4KS9 A;  5E96 A;  2QML A;  2X1C A;  1X1D A;  5CPR B;  3OS0 A;  4M3S A;  2K5T A;  2IXS A;  5FRO A;  4U9Y A;  3PFY A;  3PNY A;  3LOD A;  3TTH A;  4B3X A;  4KOR A;  3R9F A;  3H4Q A;  2BVM A;  3LSH A;  4CGN A;  3FKJ A;  2ATR A;  4QBJ A;  4BDZ A;  3VWD A;  2BOL A;  2HQY A;  4ZC3 A;  4KT6 A;  4BQO A;  4C2T A;  2JVG A;  2HPM A;  1UAA A;  3NWS A;  2B5G B;  4HNY B;  2R7O A;  2W1O A;  3L2Q A;  2X85 A;  2ZXH A;  3W6X A;  3OS2 A;  1V5G A;  3FYN A;  3HUG B;  4HKF A;  1WJA A;  2G3A A;  4KLW A;  1BR1 A;  1G8X A;  1M4I A;  1MNE A;  3N7Z A;  4UCM A;  4BUP A;  2ZW7 A;  4PK3 A;  4B5P A;  1P4N A;  1NMT A;  4BJ5 C;  4C2Y A;  3LL7 A;  4LUA A;  3OIQ A;  3OYF A;  4NXY A;  4E8O A;  3GY9 A;  4L8A A;  1S60 A;  4AVZ A;  1S5K A;  4OLL A;  4C2Z A;  4HST A;  4PJL A;  4ZDL A;  3ONQ A;  5HLT A;  1Q2Y A;  2B3V A;  3K4J A;  3BG6 A;  3IWE A;  3V8I A;  3E0J B;  3L2R A;  3MKW B;  2Q2E B;  1X4O A;  3JUW A;  2PR8 A;  2BW3 B;  4R9M A;  1R57 A;  3T90 A;  4CGM A;  4XNH C;  4E4H A;  2R7T A;  2FCK A;  5HH1 A;  2B3U A;  3K4C A;  3DTE A;  4XQF A;  4PK2 A;  2FS5 A;  1BO4 A;  2XAU A;  3IUO A;  4FD6 A;  2XDV A;  2UUZ A;  1QSO A;  2Q04 A;  1X1A A;  1IIC A;  3FXT A;  2E1M C;  4MHD A;  4D9J A;  3PL8 A;  2V1N A;  1M1D A;  2ARH A;  4IF5 A;  3OOU A;  4RM3 A;  3OYD A;  2CXA A;  3DDD A;  1D1C A;  4R57 A;  4BJ6 C;  3HXL A;  4XM3 A;  2YNE A;  3OIP A;  3K70 D;  2LBF B;  2QKL B;  1Z3X A;  4CYO A;  1BR4 A;  2I79 A;  2RRE A;  2CY2 A;  5A27 A;  2W00 A;  3RTR A;  2LG4 A;  2RC4 A;  3DKY A;  3OL4 A;  4GS4 A;  1QST A;  2F4I A;  2IL4 A;  3BG7 A;  5GCN A;  2ZW4 A;  4MI4 A;  2V6E A;  2R1I A;  2VXK A;  5AG4 A;  4UCP A;  2P6G A;  4CYP A;  1B87 A;  4CH7 A;  3L2W A;  4E7Z A;  2YND A;  1YVK A;  4JXQ A;  5FRN A;  3CXS A;  2M3A A;  3VYR B;  4HNU A;  4E7S A;  3R95 A;  2LYC A;  4I49 A;  3FDY A;  4DIQ A;  2WBM A;  4UFW A;  4B47 A;  4D1Q A;  2PC1 A;  2PDO A;  3JTK A;  2DOA A;  3D5L A;  4CRZ B;  2R8V A;  4N4N B;  3GKR A;  1SQH A;  3TT2 A;  2A5W A;  1YX5 A;  3OYH A;  1D0Z A;  4B12 A;  5J8F A;  2O5R A;  3EUH C;  4OWR B;  4QVT A;  2L5Q A;  3K10 A;  4BQQ A;  4CCN A;  3DLA A;  2V7F A;  4B48 A;  4BL0 B;  4JOM A;  2IS6 A;  3V42 A;  4J3G A;  2DXI A;  1LVK A;  4PV6 A;  4IX7 A;  3KEY A;  3AL0 C;  3DPU A;  3PNT A;  4AU7 A;  5JHF A;  3VYS B;  1PUA A;  3BCB A;  4XKC A;  1LDK B;  2KP6 A;  4NC7 A;  2QEC A;  3W2V A;  5CQE A;  5JPH A;  3P2F A;  3PZJ A;  3MMY B;  4Y33 A;  2IGK A;  1MK4 A;  3T9Y A;  3I9S A;  4B5O A;  4ZYA A;  5IX3 A;  4BE0 A;  4A95 A;  1GLN A;  3IP4 B;  4PSW A;  2CNS A;  2Q44 A;  3OYE A;  3S6K A;  4AG7 A;  4KSA A;  2VXZ A;  4XNF A;  3EFA A;  1LRZ A;  2NOJ B;  4BS9 A;  4ANJ A;  4IQJ A;  1D1B A;  4MFL A;  3PGP A;  3EY5 A;  3NE7 A;  3DR6 A;  3EUA A;  4MFQ A;  1OR7 C;  2YGW A;  3IAS 2;  3VYU B;  2FE7 A;  4LG3 A;  4GRI A;  4XOR A;  4MY3 A;  1Z3Y A;  3PNV A;  2PMZ A;  4LIU A;  4XLE A;  1YLE A;  3LFU A;  3SHP A;  3W6S A;  4H89 A;  4XPK A;  2GOM A;  2B4D A;  4C7H A;  2X1D A;  3B8G A;  2RNG A;  2P6E A;  5F47 A;  2Z1D A;  1QHG A;  5FRM A;  2QKM B;  1Q2C A;  1DGR M;  2UV1 A;  3QYE A;  2B58 A;  4KVO E;  2X1E A;  4A30 A;  1M4D A;  2GOX B;  3FBN B;  3HG9 A;  1FMW A;  5HNH A;  4G6T B;  4N4O B;  4XON A;  1KUY A;  3PSF A;  1S3Z A;  4KVX A;  5G21 A;  4XMY A;  2LC2 A;  3S32 A;  2VKH A;  3CXQ A;  1NG7 A;  1I21 A;  4R3L A;  5DWM A;  2X51 A;  3BLY A;  3DEE A;  2R7Q A;  4CCL A;  1VZ0 A;  4X0G A;  1IYL A;  1CJW A;  1MMN A;  1QSM A;  3OYL A;  4P1W A;  4YRV A;  3TMO A;  1YK3 A;  3W2A A;  5G20 A;  4ORF A;  3BCA A;  3RQ4 A;  1YR0 A;  1I12 A;  3IU1 A;  5G1Z A;  4IZZ A;  2V26 A;  3I3L A;  1YX3 A;  1UG0 A;  2VXD A;  4NNJ A;  4XLF A;  2KMU A;  3MGD A;  3DPL C;  4FD4 A;  4KLV A;  4HPQ A;  4KUB A;  2Q1Z B;  4BGD A;  2CFO A;  3UY5 A;  2F6C A;  4CGP A;  2H5M A;  3DKX A;  4L89 A;  3J7A Y;  3D5R C;  4PUS A;  1D0Y A;  4YEL A;  1MW7 A;  3CJR B;  4ZTF A;  2AQF A;  2GAN A;  4JJX A;  1WJC A;  2REE A;  4B14 A;  3CP2 A;  1LFP A;  4IUS A;  3TO9 A;  3DU6 A;  4XN3 A;  1YE9 A;  4CAE A;  4II3 A;  2OH1 A;  3MKY B;  1X4P A;  3QOD A;  2JUG A;  2OZU A;  3DPT A;  2WAF A;  2WUU A;  3OR2 C;  3PJR A;  2WPW A;  3G2B A;  5AG6 A;  4E7H A;  2CH0 A;  2OC6 A;  3OWT A;  4PFP A;  3SXN A;  2XC7 A;  4EAT A;  3FRM A;  4KOT A;  4F93 B;  1YX0 A;  5I0C A;  4YGO A;  2Z11 A;  1T95 A;  1DQU A;  3HC7 A;  4XKB A;  5HNF A;  1W36 C;  2I00 A;  3R1K A;  4U5Y A;  5AGE A;  3OYC A;  4C2U A;  2L9S A;  3NWT A;  1WJ5 A;  4JXR A;  3FBU A;  5LD2 C;  1XIX A;  2B5G A;  1WFX A;  1LKX A;  2OU2 A;  1RXT A;  4OAD A;  3H5Z A;  1G59 A;  4CYQ A;  2WAE A;  3DWL E;  2R4G A;  5KNL A;  2EVN A;  2Z3O A;  3D3S A;  4KOV A;  2KZV A;  1QU3 A;  4C68 A;  4CS0 B;  3TFY A;  1N78 A;  4Y49 C;  4F3Q A;  3CXP A;  4UA3 A;  3K4N A;  2WB1 A;  4R3K A;  4CCK A;  2DXQ A;  4CAX A;  2I8D A;  2CUJ A;  4CCO A;  1D1A A;  2X6Y A;  3OYN A;  2R7X A;  3OWC A;  4KZT A;  4XNH B;  4YEJ A;  1Y56 A;  1N71 A;  1N77 A;  3N05 A;  2KQR A;  4U87 A;  1VHS A;  2HV2 A;  3K4B A;  4PJN A;  3L2V A;  5KTC A;  1MMD A;  2AE6 A;  2FIA A;  4CSW A;  3LMM A;  4LIV A;  4E7J A;  3K4M A;  3TE4 A;  2E1M B;  3QOE A;  2E5Z A;  3CMM A;  2JEV A;  2R98 A;  5G22 A;  4E0A A;  3A1Y A;  2VBQ A;  1Y9W A;  2VEZ A;  4MFJ A;  1J4J A;  4QPQ A;  4B43 A;  4BXF A;  4CZC A;  2REF A;  2ZPA A;  4OAZ A;  2E5N A;  3A9L A;  5CNP A;  4NUB A;  4HRI A;  4FET A;  2KRC A;  2UWM A;  1YGH A;  2GIV A;  5EBV A;  1M4G A;  5F46 A;  4BE2 A;  2PSW A;  4RLF A;  3OYB A;  2HVS A;  4DOZ A;  2NMT A;  2IGM A;  1FY7 A;  3VWB A;  2DT7 B;  1JI8 A;  1D0X A;  2G3T A;  2VB6 A;  3AKZ A;  4JQF A;  2VIX A;  5CKT A;  3S6H A;  1KUV A;  2FXF A;  1UEL B;  1VKC A;  4UBR A;  4ZJZ A;  4E7L A;  3I3G A;  1DGW Y;  3LSG A;  3BJ8 A;  3CP8 A;  4K30 A;  1WJD A;  3S3O A;  2D4P A;  3H9Q A;  1UFH A;  2A4N A;  4X5K A;  5A28 A;  3A2K A;  2WY7 Q;  4ZBG A;  4CA0 A;  1XEB A;  2KHM A;  2M4K A;  5C88 A;  1S9H A;  1K4J A;  3KKW A;  1QSR A;  3FIX A;  4ZGY B;  1MMA A;  3RCO A;  2HDW A;  3HPH A;  2VLA A;  2Z16 A;  3H35 A;  3TOB A;  4CAV A;  3P2H A;  3KX2 A;  2IGO A;  3RPU D;  4RLQ A;  2WSA A;  1V0C A;  1XE4 A;  2CV1 A;  3ZCO A;  3EO4 A;  3KYL A;  4XPD C;  4ITV A;  3RYO A;  3ZJ0 A;  3BC8 A;  2ELJ A;  4MBU A;  1CM0 A;  2Q7B A;  2RQQ A;  3IAM 2;  3D2M A;  4F91 B;  4QB9 A;  3OR1 C;  1OZP A;  2WAD A;  3OMY A;  2KL4 A;  5HVQ C;  4R79 A;  4BDY A;  2BEI A;  1MND A;  2CNM A;  4DNC A;  3S3N A;  3WR7 A;  4J00 A;  2Z3P A;  4U7B A;  4QPO A;  3L2U A;  4UCN A;  3E0K A;  1SFK A;  2KCW A;  2LY2 A;  4BJT A;  3SEQ A;  3ZR8 X;  4CCJ A;  4F55 A;  1MJB A;  1ZO0 A;  4NF1 A;  4XL9 A;  5FVJ A;  3FNC A;  1RO5 A;  2Q4V A;  4H6U A;  2CUZ A;  3AFH A;  1FMV A;  2AQE A;  4E6K G;  2DJI A;  2VJJ A;  4KIS A;  2CNT A;  2L7K A;  3UR3 C;  3UNG C;  3G3S A;  2B4D B;  4KOX A;  1OLT A;  2L2O A;  3OYI A;  4MFZ A;  3I9V 2;  4NSQ A;  1PJR A;  4BU2 A;  2VZY A;  2VJ5 A;  2Z0Z A;  4BMH A;  4B11 A;  4C2X A;  4F0Y A;  3M1C A;  1HA8 A;  1P0H A;  4BQN A;  2OB0 A;  4BAC A;  4PJM A;  3MKZ A;  2GE3 A;  2WY8 Q;  3OL3 A;  2X7B A;  2R7R A;  2OV7 A;  2LOO A;  1KUX A;  2YNC A;  2CW7 A;  4AYB A;  4XPL A;  2R7H A;  4XN0 A;  4BEH B;  3ZZI A;  2DCE A;  2IS4 A;  4IKF A;  3K6G A;  4ZDO A;  1L0C A;  3K4L A;  4XKW A;  1NE9 A;  2X6X A;  2F5I A;  3VSL A;  4RI1 A;  4XOP A;  2MD0 A;  1X1C A;  3OYK A;  1E0E A;  4PK4 A;  3R9G A;  2P0W A;  2PJR A;  3IU2 A;  3QYB A;  4JLY A;  3VWE A;  2WAQ A;  2DPS A;  3EC4 A;  1X1B A;  2PR1 A;  2K9M A;  1XMT A;  3VDX A;  2C27 A;  2J8N A;  2P6F A;  2CV0 A;  4KVM E;  3OS1 A;  4MLO A;  4A33 A;  4KOW A;  4LX9 A;  2VPL A;  4HNT A;  3F9K A;  3MD2 A;  1KON A;  2Z3N A;  4F6A A;  4FAS D;  4NEX A;  3D8P A;  4CAF A;  4F0X A;  3U21 A;  3H9G A;  3W91 A;  4AB7 A;  4CRY B;  4OAE A;  4B5P B;  3EUK L;  4RS2 A;  4C9Y A;  4H4K C;  2KLO A;  4J01 A;  1W36 D;  2IGN A;  4LIT A;  5LFA A;  3HPG A;  3C2G A;  4ONU A;  2PQ8 A;  1WJF A;  3OYG A;  2F5V A;  2Z3L A;  4AVC A;  3LSK A;  5J8C A;  2QIR A;  3S3M A;  2Y0M A;  1KZF A;  5BWA B;  2HU9 A;  2Z3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...