4PSXA

Crystal structure of histone acetyltransferase complex
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
313
structure length
313
Chain Sequence
KPETWTSSANEALRVSIVGENAVQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDSVTFKPYVNVKYSAKLGDDNIVDVEKKLLSFLPKDDVIVRDEAKWVDCFAEERKTHNLSDVFEKVSEYSLNGEEFVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLLNKKTKELIGFVTTYKYWHYLGAKSFDEDIDKKFRAKISQFLIFPPYQNKGHGSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKLGYDAVFQKHSDLSDEFLESSRKSLKLEERQFNRLVEMLLLLNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hat2p recognizes the histone H3 tail to specify the acetylation of the newly synthesized H3/H4 heterodimer by the Hat1p/Hat2p complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Histone/transferase
molecule keywords Histone acetyltransferase type B catalytic subunit
total genus 98
structure length 313
sequence length 313
chains with identical sequence D
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2014-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4psxA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4psxA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 4psxA01
1M4GA 2B4DA 4I49A 3ZZIA 2GIVA 1KUXA 2IL4A 3IWGA 3D2MA 5J8CA 1CM0A 2P6EA 3QAHA 4KOUA 2OU2A 1QSTA 4FD4A 5EC4A 4R57A 2B5GB 2CNTA 4Y49B 4KLWA 3R95A 4HNYB 2FXFA 1S3ZA 1TIQA 3CXQA 2NMTA 4XPKA 2P6FA 2RC4A 3S6KA 1MJBA 2VXKA 2Z11A 4KVME 3LODA 2QMLA 4CAXA 4KOYA 2J8RA 1Q2CA 4AG9A 1FY7A 5H86A 4FD7A 3S6FA 2BEIA 1IB1E 4CAWA 4AG7A 4R87A 4KUBA 1V0CA 4BMHA 4AVBA 1YREA 4L89A 1IICA 3VWEA 3E0KA 2Q7BA 3BJ7A 2VEZA 2AE6A 4J3GA 5JQ4A 3JVNA 3TOAA 3I9SA 3OWCA 2GANA 3F0AA 2FSRA 1L0CA 4YFJA 1M1DA 1NE9A 3FB3A 3W91A 3CXSA 4FD6A 4LUAA 1PU9A 4K30A 2PQ8A 2G3TA 5E96A 4U9ZA 4MBUA 2FIAA 4MHDA 1QSRA 2PRBA 1NSLA 4JD6A 2Q0YA 5IX3A 1R57A 4ORFA 2B58A 3S6GA 4HNWB 1VHSA 3F5BA 3G3SA 2FCKA 5F46A 5IB0A 1BOBA 2B4BA 4KOTA 2OH1A 2B4DB 4PK3A 2VI7A 5JPHA 4MY0A 4JXQA 4OLLA 1U6MA 3QB8A 1NMTA 4XPDC 4MJ8A 4KLVA 3B8GA 1MK4A 1P0HA 4PSXA 1VKCA 1M44A 2VBQA 2J8MA 1J4JA 2OZUA 3GY9A 1I12A 2FT0A 2OZGA 5KTAA 3P2HA 3F8KA 2P6GA 2R7HA 2F5IA 4H6UA 3C26A 2HV2A 4KUAA 4XPDB 1B6BA 2Z10A 4B5OA 4RS2A 4MI4A 2EUIA 5DWNA 3R9GA 3TOBA 1Z4EA 2JDDA 5HMNA 4NCZA 4B5PA 4KOWA 2VZZA 3FBUA 1Y9KA 4KVOE 4R9MA 3TO9A 1S7KA 4JXRA 3GKRA 3VWDA 1S60A 3R1KA 2GE3A 4KORA 1RO5A 4JWPA 4B5PB 1QSNA 1YLEA 2Y0MA 4KVXA 4PK2A 3R96A 4KZTA 4PSWA 4CAVA 2BUEA 3DDDA 2BL1A 2EVNA 4F6AA 4AB7A 4XNHC 3EXNA 5DWMA 2Z0ZA 1QSMA 1S7LA 3SXNA 3TTHA 2KCWA 3DR8A 1MJ9A 3NE7A 4DNCA 2PC1A 1Q2YA 4QB9A 5C88A 2J8NA 2Q4YA 3JUWA 1Y7RA 3DSBA 2I79A 3TCVA 5F49A 3PGPA 3RYOA 1OZPA 4YGOA 3KKWA 5I0CA 2B3UA 5EBVA 2D4OA 1M4DA 2FL4A 1Z4RA 4IF5A 4CRZB 2ZW7A 2R98A 4E8OA 2B3VA 2PR1A 4HNXB 1XE4A 3ZJ0A 2Q44A 2PSWA 3SXOA 2G0BA 2X7BA 4M3SA 1ON0A 3LD2A 4OAEA 2REEA 4H89A 5H84A 2JLMA 3DR6A 4FD5A 5CNPA 4II9A 1YVOA 2VQYA 4M85A 5ISVA 1IIDA 4OADA 2PDOA 1K4JA 3D8PA 2FIWA 1YK3A 3R9FA 4NF1A 1S7FA 2ARHA 3EO4A 1KUYA 3SHPA 4KOXA 4LX9A 4ONUA 3T90A 4Y49C 4RI1A 3D3SA 4NXYA 5KTCA 2JDCA 1IYLA 3EFAA 4CS0B 4NEXA 3TO7A 3IGRA 1YR0A 1IYKA 1Z9UA 4GS4A 5HH1A 1MJAA 1N71A 4KOVA 4UWJA 1PUAA 3PZJA 1B87A 3FYNA 4JLYA 2G3AA 2WPWA 3TFYA 3MGDA 2Q4VA 3R9EA 3FIXA 3UY5A 5FVJA 3TT2A 1WWZA 2CNMA 3EY5A 2AJ6A 3FRMA 1S7NA 3S6HA 3WR7A 3TO6A 1P4NA 4CRYB 2I00A 2REFA 3V8IA 2ZW6A 2JEVA 4PV6A 2ATRA 4AVAA 2WPXA 4QUSA 5GCNA 4X5KA 3W6SA 2R1IA 3K9UA 1XF8A 2P0WA 2C27A 5IV0A 1XIXA 1I21A 4UBRA 2O28A 2CNSA 3DNSA 3BLNA 2K5TA 3EC4A 2ZW4A 3W6XA 2ZW5A 3CXPA 5J8FA 4JJXA 2OB0A 2QECA 1S5KA 2VZYA 4QBJA 2HQYA 1CJWA 1I1DA 5F47A 4U5YA 4UWIA 1KZFA 3G8WA 1RXTA 2HUZA 3P2FA 2B5GA 4IUSA 3N7ZA 4QVTA 2ZPAA 1YVKA 2ZXVA 1Q2DA 2H5MA 5F48A 3PP9A 1GHEA 3I3GA 1YX0A 4L8AA 4EVYA 3FXTA 2Q04A 2CY2A 5C82A 1LRZA 4XNHB 3D2PA 3GYAA 4NSQA 4E2AA 3TE4A 2FS5A 1BO4A 4ZBGA 1QSOA 1UFHA 3H4QA 2PR8A 4XPLA 4UA3A 2BSWA 1XEBA 2R8VA 4QC6A 3BJ8A 3FNCA 4HKFA 2A4NA 5KTDA 1SQHA 1Y9WA 4H6ZA 4F0YA 2FE7A 4KOSA 4U9YA 4E0AA 2QIRA 1M4IA 2D4PA 4YRHA 2OZHA 1YGHA 2DXQA 1WK4A 1XMTA 4R3LA 4AVCA 4R3KA 3T9YA 1KUVA 4MY3A
chains in the Genus database with same CATH superfamily
2KP6A 3IRRA 2MC4A 2WADA 3G1MA 3WE3A 2GIVA 3I4NJ 1KQ0A 3IO1A 3ZZIA 4M6YA 5KAFC 1FLIA 5J8CA 2HQ5A 1CM0A 1FSEA 2MH2A 3I59B 2VJJA 1TW3A 2JVGA 4RGRA 1FJLA 4V19K 2PJ0A 2BXZA 4BU2A 3LSHA 3WT4A 1OMIA 3LWFA 3SDBA 1FOYA 2N8GA 2XEJA 1YG2A 2JTVA 4N9IA 4C3JJ 2P81A 2VL8A 4TV7A 1SVLA 2QA4I 2B5GB 2Z33A 3GTQJ 1XN7A 4HNYB 1TXRA 3KYLA 4EM0B 4L9VA 4UXNA 1YFHA 1QBJA 4GGGA 5F1RA 1VQ7I 2P6FA 1TWAJ 2H1KA 2PIZA 2OZ6A 2RC4A 2HVRA 1KU3A 2D1HA 4BE0A 3IRQA 3DP7A 3PIPF 2Z11A 1DGWY 2DFEA 2XPWA 4CDGA 1OQYA 3KQZA 1NTCA 4JYKA 3LODA 2NOGA 2QMLA 2L3DA 2KRFA 4DYQA 4CYCA 2J8RA 5AONA 2DT5A 1R23A 5H86A 2QWWA 2QUFA 3OIOA 1YJNI 1ZLKA 3S6FA 2BEIA 1XGOA 2QBYA 2VKVA 1Y1VJ 4AG7A 4F93B 3NQOA 2E71A 4M71A 2E1NA 3F72A 3FX6A 4KUBA 1J2XA 2FOKA 4IOAF 1V0CA 4M6HA 1O7FA 2L7ZA 3CCSI 1PCAA 4MCSA 2QVPA 5EF6A 2RB7A 4UEZA 3FHZA 3ULQB 1FSHA 1YIOA 1LE8A 1LJ9A 2BZTA 3EETA 3RKYA 2LVSA 4ZDPA 3K4JA 1FIAA 1WI9A 3JVNA 3SZPA 3OWCA 4X6AJ 1UJ8A 2ESNA 2MW8A 4G7HF 3RZOJ 2GFQA 4DYCA 5LRKA 1BL0A 5H6RA 2E36A 2JUGA 4P4EA 2EQRA 5LRJA 2HTSA 3FIWA 2HKXA 4MEXF 1MMGA 2CJJA 4XRMA 3LL7A 3CP2A 4IHTA 4I0BA 3VWBA 2FBHA 2YPRA 1SD5A 3TQNA 3F8BA 5FKNA 3FX3A 1YRNB 3CXSA 2RAEA 1I3AA 3DPLC 2HPMA 2JA5J 4C3IJ 1S7OA 2LMDA 3D5RC 2EZLA 3VDXA 4FETA 2L0KA 4B1RA 4MFLA 2D1VA 2KQRA 2LDUA 2VJ4A 3H0GJ 2VPLA 3GO5A 2DOAA 2FU4A 3TL4X 2M4GA 1F2OA 2O0YA 4MHDA 3AAFA 3C1DA 4LK1F 1BLLE 4ENNA 3AL0C 1NSLA 5HLTA 3GXOA 4FUUA 4KSAA 2UV1A 5IX3A 1JWQA 4DW6A 5L3BA 3BLYA 4UFVA 2DK8A 2M7BA 1JKOC 3LSPA 3I3LA 4MCQA 2QSHX 2BOAA 5IOYA 2IBDA 2WUUA 4ESFA 4EATA 1NK2P 3BR3A 3F5BA 4EJVA 1OKRA 4DBRA 2IT0A 2FCKA 1XFOA 1WWXA 2VN2A 3GTKJ 3E5QA 1BOBA 4AYBN 2DQLA 2V8VA 4KOTA 3F8MA 4BEHB 2PJBA 3C18A 3TP3A 5G20A 1T0FC 3A01A 1S3JA 2JMWA 3SEZA 1D5VA 2STTA 1GT0C 1MBGA 3OL4A 4OLLA 4FE7A 1NMTA 3BR0A 3GBGA 1RR7A 3BTJA 4KLVA 1R22A 2Y0SN 3S3OA 5HNFA 1YLFA 1VKCA 5JH9A 3RNZA 2Q1ZB 1IV8A 4XMYA 1DE4C 1WJCA 1I12A 3L9FA 4E7IA 4A2ZA 2FT0A 3HOUJ 2XUBA 1R5GA 4HLXA 2HZTA 1IRXA 2P6GA 1JGSA 3KZYA 3JW4A 4HYEA 2YNDA 2CV1A 4PJ0C 3CCQI 4FCYA 1Z21A 3CC4I 2V26A 2ACJA 2R7OA 2L7MP 2R7RA 2WAFA 4S0HB 1M4LA 1EH6A 3GLJA 3NRVA 1SVOA 1O4XA 1G6NA 3FBNB 1B6BA 4XPDB 4I6ZA 5EYRA 4RS2A 1UG0A 1B6AA 3HGGA 2A6HF 4MI4A 2LK2A 4PXDA 5L3GA 3F6OA 4JK1X 3OMYA 5DWNA 3R9GA 4U7BA 4E7HA 5IPAA 5LHGA 2STWA 1ZR2A 4NCZA 2EZIA 1XC5A 2ZMEC 3GCMA 4UUSB 2ZXWH 1FYLA 4B5PA 2BVLA 1R00A 3F23A 1Y9KA 1J75A 4KVOE 3DTEA 3KFWX 2X85A 3D5SC 3KE2A 4L5EA 5HLIA 3CDXA 1S7KA 4HNVA 3GKRA 3FMRA 4C68A 2UXNA 1VQ9I 1Y8RB 4AUXA 5B1AH 2CU7A 1HDUA 2GBYA 2GE3A 4BNCA 1BI3A 3FKJA 1RO5A 4LFUA 3ISZA 3CLOA 4UUSA 4JX6A 4KVXA 4GM5A 4B5PB 4CAFA 3HTSB 1TZLA 1WCMJ 4PSWA 2BW3B 4CAVA 1R7JA 4R76A 3OYJA 3DDDA 4F6AA 1Y6IA 2PMZN 3QU6A 4ZYHA 3EYIA 2ZEFA 3F8NA 3SJXA 1Z6RA 4AB7A 4UVAA 4UB8C 3CCEI 2LRDA 3V8JA 3V38A 2QLZA 3G6EI 1R4MB 2O8XA 4IHYA 2DA6A 4A69C 3EXNA 4X3RA 2LKPA 4ZZDA 3L00A 1RIOH 1LUJB 1ELLP 4RDUA 4Y15A 5G21A 2DCEA 2DMQA 2VQHA 4XOPA 3J81K 2DLLA 1QQIA 2PVWA 1P7IA 3SXNA 4NB5A 2ZEPA 4AIKA 3K4MA 3AG4H 2Y48A 5DM7F 1D0YA 5C44J 1RETA 3IWZA 3ZMDA 5DDGA 4DNCA 4UFWA 2NS7A 3M8FA 5IYBJ 3RI4A 1Q2YA 1HCRA 4P55A 4XRSG 2O6GE 1IXRC 2AFSA 2Q4YA 2V8DA 1DU0A 1P4XA 4HX4A 5JI6A 4OIQF 1IO2A 5F08A 2I79A 4JYWA 4IHMA 1JKPC 3GYHX 3TCVA 1QPIA 3RYOA 5K7FA 4ZGYB 2ZEMA 1TQPA 2IA2A 4LLNA 1CP7A 2IVMA 1QNTA 2XPVA 4ZZLA 2DYSH 5EBVA 2XEIA 3IH4A 4G12A 4CCJA 2P6SA 1UHMA 2R98A 2JN6A 3D7GA 4BH9A 1IN5A 3CDIA 4V2GA 4G8XA 4ZX8A 2ZXHA 2BY2A 2DDAA 1HDQA 2R7QA 4MCPA 1OCOH 3S15J 2EO8A 3S8PA 4M3SA 1VZ0A 1VGYA 2YS9A 1ON0A 3LD2A 4X2TA 2L9SA 1ENHA 3WC7A 1I1GA 3BWGA 2VKEA 3J7YJ 3JCUC 2XROA 3DR6A 5CNPA 5DCFA 1TC3C 3BJAA 3DLJA 3ELKA 4JOMA 1MNDA 4RGUA 2HB6A 4D7MA 3E0JB 2QJ8A 2PJRA 3J80K 4UV8A 4NF1A 2ARHA 3EO4A 2GXGA 3FXRA 3P9CA 5B66C 3SHPA 2IJLA 1F43A 2E5NA 2HS5A 1FP2A 3G2BA 2V1UA 1JTXA 5J1UA 2GXBA 4YWYA 4I2OA 5E3MA 3HOSA 1ZARA 3GTJJ 4CHUA 3HC7A 3WTYC 1K7AA 2OJED 2F8HA 1HSJA 1YX5A 4CYNA 3H1CA 1SD6A 4AIHA 2R7DA 3EFAA 3NE8A 5A27A 2QKMB 3OYIA 4OIDA 3IKTA 4G1PA 4CXFA 3B2YA 4N9HA 4HNTA 4A39A 1JI8A 3ZQ7A 3MVPA 5F0HA 1BN5A 3CJRB 3BR5A 3WTTC 1KQ9A 3H9QA 3PQJA 4LG0B 3AL0B 3WABA 3NARA 1TQIA 1P2FA 2DI3A 5EEGA 1R1TA 4UWJA 1PUAA 1SVMA 2CQKA 2V1DA 3T5XA 3UKGA 3M3YJ 3CCYA 3F21A 1HQCA 4YRVA 1F2PA 1CPXA 2WPWA 5HVGA 1KWMA 5AIPA 4Q38A 4EFDA 2V9PA 1FPQA 2XPUA 4KICA 4XKWA 4WF2A 3FIXA 1RESA 4FBEA 3R4KA 1WWZA 5JVTA 3OYMA 2GM4A 1N78A 3MKWB 4EGZA 4XLCA 4EEFG 2YGWA 3EY5A 2GLFA 3DU5A 2BHYA 3FRMA 2WTEA 2V9VA 3TO6A 2NRAC 5FFXA 2DPDA 1DUXC 4G7OF 1P4WA 2EIKH 2IP2A 3V8IA 3BZKA 4G94A 4L0ZB 1LOKA 3ZQGA 5JGFA 2M1BA 4DJAA 2ATRA 2HDWA 3BI1A 3H9GA 4KITB 2CV2A 3CC7I 1ZLIA 2EFNA 3I5UA 4B11A 1MMAA 3QYBA 2E7WA 5A28A 3NAUA 3G1LA 4AIJA 4U88A 4A6DA 2P5VA 2VJ5A 3LFUA 1HKTA 2GLOA 4HW0A 1Y0NA 3WTUC 1BOAA 3VYTB 3H3ZA 2B9SA 4A3LJ 4HG2A 1MH4A 3H5AA 3DKXA 3W6SA 3ZGKA 2V6CA 1A6QA 1QHGA 1W36D 1ZRCA 4CICA 4DIQA 4IHXA 4MHYA 1WPKA 4WWVA 5K5QA 1XIXA 4C7IA 1BW5A 3HOYJ 4UBRA 2M34A 3S2DJ 2O28A 2LC2A 2NYXA 4LQGA 4OC2A 2E2HJ 3EC4A 2ZW4A 1R6RA 2LG4A 1FMVA 4KJZA 4BAYA 2PCUA 2BGCA 3CXPA 3OYBA 4JJXA 1ETOA 5G22A 1I6XA 2CSOA 3HL2A 4UIBA 2VZYA 2GOXB 3PB4X 2L54A 1I5ZA 4DOZA 3CPAA 4RMNA 3D7DA 3VOEA 2FMLA 1I1DA 2KIUA 1WJDA 2Z3MA 3E1SA 4FISA 5F47A 1U0JA 1JQGA 1WRJA 2O7OA 5D5XB 2LTPA 4C3HJ 2QQBA 4A3JJ 1LPQA 4XLPF 3IU2A 2EV6A 1V5GA 4BHBA 4A12A 3TDZC 2EFWA 2C6PA 3FISA 1ZK8A 4CGPA 2RGVA 1N75A 1V3FA 2M7AA 3P2FA 4MEYF 1EV7A 3FZVA 2EPFA 5JFRA 3HDDA 2PJ2A 3HPHA 2ZEOA 3FEDA 5C3EJ 1HF0A 2ZXVA 3HXLA 4ZY0A 2HXIA 2QYOA 4BDYA 2HQAA 2FXAA 4YIRX 2M5WA 2E1MB 2JEWA 3OS0A 5F48A 1ZG8A 1JJ8C 3GIUA 2I8DA 2VBWA 2IA1A 3CZXA 4FX0A 3F0CA 2K86A 5E3LA 3CCRI 1LFWA 2CY2A 1LRZA 3WC5A 3NWSA 3V8LA 2IA0A 2HYFA 2LYCA 4LIUA 3TGNA 3F22A 3D2PA 4NSQA 4ZY2A 4E2AA 4X8IA 3K4CA 1BO4A 1X2NA 3RPUA 4ZBGA 4IHWA 5HVQC 3OYAA 2Q7SA 2YNCA 2LFBA 1MBFA 2PMHA 4E7ZA 4ZYQA 4FQGA 2CWEA 4F0XA 5LHIA 4P10A 3K7AJ 1REPC 4P4DA 4G6QA 4FX4A 2ZXIA 3E7LA 1WZ2A 4QC6A 4HF1A 2GZWA 1VQ8I 3K4LA 4ZTJA 4F52A 2VOOA 3FNCA 1H8AC 4B12A 1USTA 1YQEA 4HQMA 4E7LA 3CJQB 3QOEA 2MYSA 2PG4A 2KL4A 2PJ4A 2L4MA 2DT7B 5TRDA 3RQ4A 3LNQA 4GYIA 2D4PA 5K8NA 2VQLA 1OCTC 2ISZA 2V8HA 1T0FA 2XGXA 1YTYA 1YITI 4W97A 4XICA 3QNVA 1X1CA 1R9TJ 4A3EJ 3B6AA 2W24A 3MKZA 4BE2A 4MMOA 1XMTA 2A5YB 1Y8QB 3B3CA 4CGNA 1LFPA 5F09A 2NS0A 1D0ZA 5HNHA 3P9IA 3H5NA 1QZZA 3LMSA 4YGOA 1FOKA 3SDGA 2E2JJ 3KLOA 1HKSA 2ZJRF 4MY3A 4I49A 4G6TB 2HOTA 2WY8Q 2PJ3A 4OINF 5E1ZB 1X1AA 2H8WA 2FNAA 4BXFA 3JRUA 2EH3A 3OOPA 5M5YJ 5FLVA 3U21A 2BY1A 2B7EA 1TWCJ 4BY1J 5IB9A 1IGBA 1Y7EA 3RKQA 2F6CA 2LY9A 3K6GA 4II3A 2R7FA 3M9AA 4B14A 1OJLA 3BTIA 2AQEA 4CSWA 2C6GA 4K3NA 2X6OA 4KLWA 3V4GA 2FXFA 1S3ZA 4I99C 4OAZA 5JHFA 5A2QK 3SFIA 2KRHA 5BPDA 1W0UA 1XGMA 3DFGA 4RS8A 3L1PA 4XPKA 1Q1VA 3DKWA 1AUGA 2WZNA 4AXVA 4B10A 4IXAA 3I9V2 3FXOA 4I01A 5FROA 3BDDA 3KP2A 3MWMA 2Z2SB 4O6JA 2DPUA 1Q2CA 2IGNA 5JLXA 5E8GA 5M5XJ 1F36A 1XMXA 1NSAA 2EK8A 3ZQCA 4NGMA 1MMDA 2M3AA 2V1NA 2A6TA 4XONA 2F4MB 1PDNC 2M8EA 2H09A 3IP4B 1ERDA 3MRUA 4HNUA 3T8RA 2NNNA 4L5JA 1EF4A 2UUZA 1YREA 5HS9A 3S1RJ 4IQ4A 5AIQA 2VONA 2OQGA 1NHAA 4EJOA 1IICA 3HKZN 3BQYA 3I4PA 2K3FA 2DMNA 3AG1H 2Q7BA 5DD8A 5DYMA 2Y75A 5C4JJ 3ABUA 3M07A 3BJ7A 5KCMA 2AE6A 2DPSA 5J1YA 2VQGA 3JREA 2X1DA 3Q9SA 2GANA 1YX3A 3O3KA 1B4AA 3EUKL 1IUFA 5GP9A 4ZDLA 2YU9J 1QZYA 3D66A 2FSRA 4GXOA 1IDZA 4OOIA 1W5SA 1P6RA 2P5KA 4KIGA 3WODF 4BBHA 2K40A 2OC6A 2A07F 3Q0WA 1FIPA 2IS2A 2ABZA 3FK7A 1OYIA 2R7WA 3HHHA 1IN8A 1KONA 1MGTA 3W6KB 1LDDA 2GLJA 1Z1DA 1B72A 2FE3A 3KEOA 5IY5H 2VBYA 1XMAA 2JWTA 4A0XA 2RN7A 1PU9A 4K30A 2PQ8A 3H0DA 2LR8A 4B8XA 2DEAA 1E3HA 1JHFA 3S9NA 3EUAA 3JRCA 2VC0A 3PFEA 4MBUA 5HVHA 1QSRA 1ZG7A 2PRBA 6PAXA 3C2HA 1J5YA 1VQKI 3FHNA 3ZR8X 3OYHA 4A37A 3GUXA 3ZMTA 4PUSA 1J09A 2Z99A 1J59A 1R57A 2BOLA 2YX4A 5FB2A 2DJIA 1Z2LA 3DXJF 3GB0A 1VQ5I 1R5ID 1G4DA 3JTGA 4A38A 4OC3A 2ESHA 1TKHA 2PMUA 4KDPA 3MZHA 1IDYA 4Y17A 1Y0YA 2BW3A 2XDVA 2XAGA 4CCOA 4YG2F 2A69F 3W3CA 1KU7A 3GTGJ 4MRIA 3G3SA 5F46A 4CA0A 3JRAA 2HWVA 2WC2A 1JT6A 2JPBA 3RPQA 3BG6A 4AVPA 3GMEA 1ARLA 4A30A 4BE1A 2OH1A 1ETQA 2VI7A 5JPHA 1YW9A 3MZ8A 1E3OC 2EA4A 4MY0A 2KZGA 4NQWB 4EMEA 1U5TB 2YNEA 4UCPA 4XL9A 4JXQA 3R61A 4OP4A 4D5FA 1EH7A 1K78A 3ASNH 5D29A 4IJAA 2IJZA 3B8GA 1OCRH 4R8HA 3G4SI 1FYKA 1MK4A 4PSXA 3NH8A 2G7UA 4ON0A 1W7PD 3HUVA 1V5EA 2J8MA 2DT6A 3ERMA 1MDMA 1IN6A 2ZBKA 3HB9A 3QPHA 4A5MA 5HLGA 4HF2A 3GY9A 2MH9A 1MBHA 4XORA 2F5EA 3S93A 3S1NJ 3OS1A 4RB2C 5KTAA 4UEFA 3E97A 2WB1N 1FWZA 5DCMB 4H6UA 4A3MJ 5K7ZA 3BR1A 2EV5A 1JT0A 1D8KA 2F4IA 2VKHA 4P4JA 5AG6A 2R7SA 3E6BA 4KUAA 2XRNA 3MMYB 4B5OA 2HU9A 2EA2A 4LLLA 2CW8A 4A6EA 4L18B 3T0YA 1EKEA 2FBKA 2DTRA 3RIRA 5ELYA 4MNUA 1ORKA 4LGWA 2LY2A 3PFOA 1SD4A 2AS5F 3ZQLA 3B3SA 2LBFA 1WH5A 3X2QH 3VFZA 3GTOJ 2V79A 4AYBA 1ARMA 4KOWA 1U6GA 3GLLA 4U0WA 3IAM2 3FBUA 2DXIA 3QU3A 5LYDA 4R9MA 1M1EB 3A01B 1YS7A 4UB6C 5CVUA 3TO9A 5D5WB 4WCGA 4A93J 1ZELA 3BHXA 3RKWA 5JVGF 1W5CC 2K02A 3HJEA 1SEUA 2K85A 3VWDA 1NK3P 3R1KA 5ED4A 3UR3C 2W7NA 2KDOA 1MBJA 5EGOB 5EG0B 1KA8A 2Y0MA 1QSNA 2LP0A 2XB0X 2Z3NA 2PVVA 1FYMA 2BUEA 4NQWA 3EUHC 1ULYA 1PUFA 4OWRB 2HOAA 3KR5A 3J80Z 4I02A 4AIDA 2G9WA 3HGYA 4BEHA 3K70D 2X9DA 4KSIA 2JA6J 1XTAA 3QODA 4XLEA 1EH8A 3KASA 4NNJA 2BY3A 4PK4A 2LREA 4CGLA 2XIGA 4NHJA 4MTEA 2Z0ZA 1YW8A 4QLCU 1QSMA 4BKXA 1ZAOA 4KN7X 3FH4A 3PB6X 1OR7C 3ZP5A 2MSYA 4LG3A 3K70C 3DR8A 1T8IA 4XRFA 3HKZA 2KLOA 3K4BA 1UAAA 4QB9A 4NGTA 1Y7RA 3OS2A 3LFKA 2PEXA 2Z3YA 3BP8A 2PLYA 1TKJA 3Q3SA 2D5VA 1DU6A 1CQTA 5AGEA 1U5TA 2A05A 4AM3A 3KKWA 4XKBA 1OYYA 3PEIA 3S3NA 4ZH4F 3GFIA 1ZREA 4EJWA 2KJBA 2B3UA 2HDDA 2D4OA 4KN4X 2HQRA 1VQNI 1M4DA 1LQ1A 1Z4RA 3QYEA 2C1CA 2IQ6A 3IAS2 1RUNA 2B3VA 2EFPA 4IRIA 2ZSHB 2PR1A 1LDJA 2W00A 3REOA 1APLC 2ZCWA 3CCMI 2IGKA 3LAJA 2JBJA 2Q44A 4M74A 1Z6TA 1P92A 3SXOA 1Z8XA 3ZQQA 2X7BA 2HGCA 3BG5A 2ELJA 1ZG1A 2O61A 5AG4A 1UB9A 4OAEA 4D0PA 5GPCA 3PUFA 2Q2EA 3CCJI 5HDNA 2WWYA 1UFMA 2YSRA 1T95A 4II9A 2VASA 2GOMA 1PYVA 4XLHA 2ID3A 4RAFA 4QTRA 5IYCJ 4OADA 1LKXA 2PDOA 1BIBA 3R9FA 3QP6A 4D5CA 2A6EF 3E5UA 4BGDA 4BXUA 4B6ZA 3CQZJ 4IQJA 3WGGA 4CGZA 4I98B 2XGCA 2VE9A 2EK9A 1RRJA 4Z2YA 2VUMJ 4LX9A 5FD6A 3SFZA 1R71A 2RV8A 2HR3A 3HTUA 1OFCX 3D7FA 2COBA 3ESWB 1ZG5A 2KZVA 4MLOA 5FLMJ 3FJUA 3CLQA 5TGTA 3QP5A 4N4NB 5KTCA 1SMTA 1WFXA 2EIMH 2HKOA 1G59A 2ZFWA 4CS0B 4ZYAA 3F6VA 4XLNF 4LQ6A 1AA7A 4ESJA 3TO7A 1TT5B 4XKVA 1E2XA 3MEXA 2FUG2 3DQVC 1PP8F 5IT3A 1OCCH 1YR0A 1YQAA 1UHSA 2ETHA 1K4TA 1KYWA 1LCPA 4AU7A 4BJTA 1AOYA 3I4MJ 5L3FA 3LSMA 4U0VA 3JAMZ 1B87A 1VNDA 1BJZA 4QSHA 2G3AA 3H5ZA 1QO0D 5CVRA 3R9EA 2AFMA 2V77A 5BPIA 1FMWA 4I76A 5CVJA 1DP7P 4DJLA 3K10A 3OWTA 3TT2A 3TX8A 1TW2A 2R7ZJ 3W6VA 2CFOA 3I59A 3W2VA 3H8FA 2F2EA 2AFOA 3S6HA 5KHDA 5IOZA 2GXAA 2R93J 2AFUA 4CCKA 4CRYB 3GFLA 3ABMH 4Z6YA 2OTLI 4GDFA 3WG7H 2NXNB 3W6JB 1BR4A 1TBXA 4CGOA 1RR8C 3N05A 4PQAA 2MGQA 2Y30A 4MFZA 5ILSA 1JJ6C 5FKKA 2WPXA 3VB2A 1IXSB 4P6YA 4UUTA 1RKTA 4F3QA 4QUSA 3OY9A 2QZ8A 3MN2A 1ZRFA 2O03A 2FQ3A 2ZFUA 3PJRA 3K9UA 1R1UA 3JSOA 1XF8A 5LHHA 2PE3A 2C27A 3L2NA 5IV0A 1WI3A 1GXQA 3HRTA 3I64A 2A68F 3IL2A 2OOTA 4BJ5C 2CW7A 2VODA 1IN7A 1MH3A 2LLKA 5BMZA 3DPTA 3CCLI 2EWNA 3CO6C 1AMPA 3W6XA 3EDPA 1HXDA 2OUMA 4AWXB 4WXDA 4HRIA 1IC8A 2QECA 4NC6A 3OSFA 4N4OB 4W9YA 2HQYA 2CTBA 2HI3A 2XAUA 5I4MA 5JM6A 1X1PA 1VHOA 1JUPA 2H1LA 3FWEA 3FXKA 4XR6A 4KT6A 2Q51A 4XN3A 1G3TA 2GIZA 1R43A 1YYVA 2GREA 3ZN0A 3G8WA 5LYFA 2QSGX 5AG7A 2IS6A 3BZ6A 5J1QA 3GX4X 3HSFA 3VSLA 4IUSA 4XLFA 3SEQA 3VSKA 2XAFA 5HLHA 1W7PB 5HOOA 4KYWA 2ZPAA 1HDPA 2MABA 4FWUA 1WGXA 1XGSA 2VIXA 1HBXG 2CIJA 3S2HJ 5HDKA 5BWAB 1GHEA 4ZYDA 3I3GA 3OV8A 2RFHA 3P9KA 2ZOGA 3K1MA 1E3PA 4WX9A 1XS9A 1IRZA 3FXTA 4HPSA 4L8AA 3FXMA 1I50J 4M3BA 3HPGA 4ZI6A 3M1CA 2XKPA 8CPAA 2NAZA 4GCVA 3DV8A 3U1DA 3I58A 4RLFA 5F0CA 4BACA 1LB2A 2JQ7A 1BPMA 4OIWA 2DA7A 1XB4A 2PX9A 4LD5A 4RM3A 2FQ4A 4FHTA 1LAPA 3G3ZA 3S9MA 4A95A 3GFMA 1R58A 1OLTA 5LGNA 4ZTFA 1XRYA 1XMKA 2LNBA 4CYQA 2NS8A 2VPRA 4P4BA 4P45A 2R8VA 4O23A 4BQAA 3HUGB 3DGVA 2K4JA 3JTHA 3MQ0A 3BJ8A 2ZXJA 5TISC 4UY8I 1V4RA 4HKFA 1HDDC 3QPLA 3Q5FA 5KTDA 2DK5A 1XSVA 2FE7A 3TKYA 2MLKA 2XHKA 3DWLE 3VYRB 5BS6A 3H36A 2B63J 3L09A 4Z65A 4I09A 4E0AA 4B3XA 2QIRA 4P44A 2PIYA 4HQEA 4M9SA 4YRHA 3HOVJ 5EZGA 1BC7C 2OQRA 1Z91A 4M9XA 2COMA 4Q7AA 4HV6A 1YGHA 4XBFA 4BY7J 4FT8A 4P1WA 4IL6C 5ICGA 1RTQA 4M3FA 1YOVB 3GW2A 4R3LA 1VF9A 3FXQA 4KT5C 3B35A 2DW4A 3AKZA 4OKOA 1M4GA 3A0BC 2B4DA 3ABTA 2BXYA 4L5IA 3ZXSA 3KEYA 1TF9A 3PB7X 3D2MA 2HXOA 5EEHA 2KFDA 2X6WA 5J4VA 4C2ZA 3WGIA 2GAUA 3SI0A 3ONQA 3BQZA 2OU2A 1J9IA 1QSTA 1G3WA 3C3WA 3TMOA 4A3IJ 3S16J 4NGSA 4YFKF 1CX8A 3DF8A 1S7AA 1XDUA 3K4KA 5EC4A 1SC7A 2EK5A 1HKQA 3NWTA 1CGPA 1H9TA 2CV0A 5DS0A 5J47A 4R57A 2E7XA 3LSKA 2XVCA 3IJ3A 2ICWG 4Y49B 1IY7A 3HG9A 4KFCA 5F04A 3W2AA 1TIQA 1BAVA 2NMTA 5HDGA 5HVFA 3T1BA 2ME6A 1W4MA 1ONVA 2IW5A 2W57A 3FMSA 3KLNA 3S6KA 1MJBA 3SQNA 4U0YA 4MIMA 2Q2EB 2HZDA 4KVME 2FNPA 1S9HA 1GV2A 2MC3A 4CAXA 4KOYA 1DTDA 2ZMEA 1QMUA 5ILUA 4IHSA 4AG9A 1XSXA 1FOWA 3CMAI 1FY7A 2XSJC 3GVAA 4M72A 5M5WJ 3N97A 3BG7A 4FD7A 1F1ZA 5CJ9A 4LK0F 1IB1E 1ETKA 5FGMA 4B09A 4CAWA 3GFJA 3R0JA 3HEFA 4R87A 5KK1A 4HDUA 4OC5A 3GTPJ 2CXAA 4F92B 3GUDA 3FEEA 4XSZF 3JSPA 1IOIA 3PNVA 1UZCA 4L89A 3PB9X 1Z5RA 1FT7A 1E0EA 2O5RA 4U87A 3GWZA 5K8OA 5J40A 2ADUA 4YU9A 3E0KA 3VWEA 3E5XA 4JBAA 3MKLA 2FVGA 2X48A 3FF3A 4J3GA 1RI7A 3KPHA 1JE8A 1ACIA 1AKHB 3MAJA 3RJPA 5H6QA 3SZGA 2KKOA 3I9SA 1RC9A 2CUJA 4EGYA 5E18F 2IS1A 4B48A 5L3CA 1N25A 1Z7LA 4F91B 3PFYA 2VXZA 3JRDA 1G2HA 2JBKA 3F0AA 2WA0A 2O3FA 3SI1A 2GQQA 5B1BH 2YUSA 1T08B 2GWRA 3RDIA 4J01A 2LF7A 1L0CA 4NFRA 2CQQA 2I5UA 2CFXA 5J4YA 1NE9A 3FB3A 2EINH 1ZG9A 4UF4A 1LFBA 3FM5A 1YJ9I 4J19A 3W91A 1JKRC 1QZEA 5D6EA 1JGGA 3HLPA 4GYGA 1O3RA 3BPVA 3A9LA 3CDHA 3CD6I 1D1BA 3HHGA 3MKYB 4BBRJ 4LUAA 1YE9A 2BE5F 3H8EA 1YW7A 2P8TA 1MDMB 4YFNF 4E4HA 2DMUA 4PDKA 3DEEA 1UG2A 3TW6A 2FIAA 2DFIA 4WXCA 1IXCA 2CYYA 4HA8A 4L9TA 1A36A 3WHBA 4JD6A 1GXPA 5FO5A 2A3SA 2Q0YA 4D9JA 4BUPA 3CP8A 4BQNA 3OYLA 1U8RA 1KGSA 2KRCA 2KPMA 2B58A 2Q43A 2G0EA 4GRIA 1QHHD 3DBRB 4MTDA 2PI0A 2K5CA 4BQQA 5E1XA 4HNWB 4JX4A 1H88C 2AFWA 1IW7F 1VHSA 3ISXA 3DKYA 1S5LC 5FLXZ 3Q9VA 4XKCA 3K2ZA 1IAWA 4NGQA 3EUHA 1LVKA 5DS9A 4A3CJ 2OCCH 3BCBA 2B4BA 2ZJ2A 1Q1HA 1YS6A 2X6YA 3A1YA 2VXDA 1MD0A 4FASD 2B4DB 4PK3A 3WC6A 1ZH5A 2X1EA 3K2AA 3P7NA 4RB3C 1XG1A 4Y52J 3S32A 1B1BA 2LY1A 2DTZA 3P5JA 4PJJA 2PJRB 2W85A 4S04A 3HOZJ 1MW7A 1TLHB 4DZJA 3QB8A 2R5YB 4O3MA 3IUOA 3OL3A 1P0HA 4DBQA 1A6IA 1FTZA 2VB6A 2VBQA 3VARA 5DM6F 2E1OA 1R36A 1E17A 4OC0A 1X58A 3IKVA 2IAIA 2K9NA 1IU8A 5K1YA 2R7XA 1ETYA 2M45A 3WTWC 2OZGA 1Y39A 3KZWA 4OMEA 2L01A 3ECOA 4Y13A 5K7HA 1K61A 3LSTA 4CYOA 2ZC2A 4IRGA 5HODA 1DDNA 2R7HA 3FECA 1Z3XA 4P4FA 1Z7UA 3WTSC 4PJNA 3EYYA 4UV9A 4C2TA 5K8PA 2FA5A 2DQRA 2X51A 2W25A 3JRFA 3VH9A 3M7GA 4FE4A 5E20A 1WHUA 5GAGJ 1W36C 1POGA 2VL1A 2ZMEB 1X3UA 3BTCA 4E70A 4MQVA 1F5TA 1FC3A 4HOBA 3BXMA 1AKHA 1ZGJA 1MBKA 4A32A 3KEQA 3PSFA 5LEKA 3NA6A 3SYTA 4ESBA 2E1CA 1SANA 1Z8TA 1Z4EA 4JQFA 4IKFA 3KZIC 5FRMA 3I71A 3PL8A 3B6CA 2G7HA 2QVOA 3I56I 3HSEA 1SFOJ 1B8IA 2HVSA 3KHZA 3HIFA 4RGXA 4A0YA 5LRRA 2UZKA 3M1EA 4JXRA 4F9UA 1GYTA 5LD2C 1OPCA 2POKA 2IRFG 4UVCA 3D1NI 4CPAA 2F5VA 1T39A 1MZBA 2CF4A 2DODA 4O5VA 3O6BB 2CRGA 4MO7A 4CUGA 5LEJA 2Z3PA 4FAIA 4JWPA 1R5HA 2M4KA 1YLEA 1KU9A 4PK2A 4ASNA 4UCNA 4M6XA 4GO1A 4PJMA 4KZTA 4BJ6C 1WVRA 1U2WA 2BL1A 1PUFB 1WSUA 1C0WA 4UNOA 3FXJA 2QQ8A 1IZ1A 1YO5C 1SMYF 3DU6A 4PZJA 4I7HA 4AVZA 3WU2C 4MHNA 4RAGA 4ZYEA 4NGPA 1O3QA 3K1PA 2WV1A 3S1QJ 1R3NA 3BR2A 5DWMA 2VQCA 3SZTA 3CJNA 2R0QC 5GPAA 2YNCC 2W84A 3PBBA 2JK3A 3CJTB 2GU2A 1JUSA 5D5UB 1GVJA 4HEA2 1MIJA 2Z5UA 3FKIJ 1YW4A 3FMQA 3TTHA 5IT9K 2L9VA 1SFKA 2Z9OA 1K4SA 3NE7A 3AG2H 3OYEA 2I3CA 4F55A 2PJ7A 2ID6A 2BHZA 7CPAA 2PBIA 3GEZA 3IWFA 1K6YA 2M2EA 2LBFB 1Z0XA 4PJLA 3QRFF 1X3ZB 3H35A 2D45A 3A03A 2IMOA 1K79A 1OZPA 1TP4A 1TTYA 3H8GA 4PXEA 4PGHA 2O9LA 3WTVC 1V5FA 5CQEA 1O57A 1IN4A 1B59A 3RSNA 4G7ZF 2FL4A 2EBJA 4IF5A 4L0YB 3L2WA 2ZW7A 4EV0A 3MCZA 2KT0A 5FLXK 5JR3A 3CTAA 3WU0A 4HNXB 1XE4A 4XN0A 5GAEJ 3MD2A 3IWEA 2EB7A 5K5RA 1VTNC 3ZJ0A 1MMSA 1ZTRA 5KAIC 1YI2I 1FNNA 2G0BA 3L2UA 2AHQA 1Y56A 1QVTA 2YU3A 4C9YA 1A35A 2EZHA 2JSCA 4BDZA 1XDSA 1B9MA 2REEA 1X12A 2QF7A 5E3NA 3VODA 3D68A 4H89A 2YX7A 1TQMA 3BPXA 5IT9Z 2JLMA 3K2KA 4WJBA 3JAMK 2X6XA 1CPSA 5H84A 1SAUA 5JLWA 4F8ZA 2ZNYA 1HOMA 4M85A 4C2UA 2XF5A 3KR4A 5ISVA 3IH3A 4UCMA 1IIDA 3D8PA 3QPTA 1QPMA 1K4JA 2FIWA 1IV6A 1JXSA 1YK3A 3TP0A 4M6VA 3RZDJ 1Z05A 2HFHA 1IOFA 2OF7A 3N5FA 5F0FA 2PFBA 3HZJA 2CUEA 1I39A 2IGOA 3BCAA 4KOXA 4PPZA 3TW7A 3WE2A 4GXHA 3GF2A 3PIOF 2XKOA 4B4CA 4RI1A 5K8MA 2MFZA 2BY0A 2WBMA 3ZRGA 2CW0F 2DA4A 5J3LA 1IYLA 1ZGWA 4NEXA 5DCMA 1WKMA 4M73A 1LEBA 1BPNA 3IGRA 3BT9A 2EJRA 1HW5A 4B44A 1PJRA 4R8FA 1G8XA 4GS4A 4LIVA 5CQGA 1UCRA 5E79C 1AHDP 1ITYA 1P4AA 2E1MC 1X10A 1UELB 1N71A 4XRSA 1NG7A 1QGPA 4KOVA 1JTYA 3IC7A 3T8TA 3IIBA 3FYNA 6CPAA 2RDPA 3LA2A 4TNUA 2M9HA 2JUCA 2TDXA 3MGDA 2P7VB 4B3AA 2AO9A 2O4HA 1W1WE 3IHUA 2W48A 4Q48A 3RQIA 1OYWA 1W0TA 2L02A 1BC8C 2IS4A 1D8JA 4RN7A 3UY5A 1MSFC 1MMNA 2W1OA 1UWYA 3DTIA 3PNYA 2V9KA 2CNMA 3LQRA 4Y4RA 3LAPA 2AJ6A 4Q36A 1S7NA 3WR7A 4ANJA 5J1RA 3KYDB 4UIAA 2HEOA 2NNYA 1FZPB 1P4NA 3CCVI 2XAHA 4H4KC 4R1HA 2Y9ZA 1WJFA 1V54H 4J00A 3H3VK 5E3OA 1FEXA 1LAMA 2XASA 2JEVA 3CUQC 2M0MA 2QM3A 3M8JA 1O3SA 3MN8A 2KHMA 3CMMA 3NH5A 2M30A 1H0MA 4QWQA 3FXLA 2OBPA 5HS8A 2DBBA 2R5YA 4ONWA 2W4SA 3R0AA 1I1SA 4A3GJ 3IV5A 4OIPF 5FKMA 1VQ6I 3WTXC 2R1IA 1QRYA 1H89C 4UVBA 3K9TA 3BZCA 4IRHA 3RTRA 2DPTA 3S17J 4N0BA 3FXUA 5ICFA 4EM1A 4LB5A 4E7SA 2QQ9A 3DNSA 3BLNA 2QBYB 3FMCA 2ZJPF 1U3EM 4XOTA 5K5OA 1CP6A 5CYVA 2ZW5A 4AD9A 5J8FA 4RAZA 4WK8F 1U8BA 2CS3A 2PRQA 1S5KA 4QBJA 4XK4A 1CJWA 2DA5A 2P4WA 2Y2ZA 2Z1DA 1HC8A 1GVDA 4II2A 2XC7A 1K6OA 2ZO4A 1R49A 4UEEA 1ZLHA 2BBYA 2ELKA 4MFPA 3LSJA 3CF5F 2LKSA 1OCPA 4RB1A 2CGPA 2AQFA 4RUHA 1RXTA 4KMUX 1BI1A 2ZNZA 2VOPA 4G9YA 4P4IA 2B5GA 3U9GA 3KL9A 3N7ZA 2QQAA 5KVRA 2R5ZB 4MGRA 1O7LA 2NVUB 3D7HA 3ZMVA 3LSGA 1Q2DA 1Z3YA 2M87A 2NYQA 3E6MA 2AXLA 1G3YA 2NVYJ 3BROA 3HBLA 3I0TA 5E96A 5D8KB 4EVYA 5E17F 4HSRA 3S14J 2DA2A 2HPIA 2XEGA 2EV0A 5EJCA 1AWCA 4PFOA 4P96A 4CCNA 4JP0A 3BOQA 4AC0A 3OYKA 4OC1A 3GYAA 1S29A 3F8FA 2XSDC 2P6TA 5IYDJ 3TE4A 4MFJA 1IJWC 2VJIA 4ENMA 2LF8A 3CUOA 1S72I 1TWGJ 2K27A 1BI2A 3DBHB 4M3GA 4DQ2A 1AYEA 1QSOA 2Z3LA 2PR8A 5IP7J 1WH7A 4Q47A 1GDTA 4QPQA 5DUIA 1Z77A 4XPLA 4R6TA 4UA3A 2A61A 1J0RA 3DBLB 9ANTA 3I54A 4ZX9A 5EG0A 2DU9A 5EGOA 3SJEA 1X1BA 2JVHA 4C2YA 4NUBA 4CZZA 5KNLA 2CQ7A 3RBUA 3C2GA 1ON2A 3I53A 4KISA 2A4NA 1SQHA 1I27A 1Y9WA 3G71I 1XPXA 2E34A 3KI9A 3CUQB 3JRBA 4F0YA 2P7CB 3SJFA 4U9YA 4RA2A 1EJ9A 4A0ZA 4E6KG 1CF7B 1U5TC 1XCBA 1RZ4A 3DLAA 1M4IA 2OZHA 3JRIA 3QPSA 3IWWA 5C4XJ 4R79A 1Z9CA 1CG2A 1HW2A 4MFDA 4NC8A 2DXQA 1WK4A 5D6FA 3BG9A 4YIFA 4A5NA 1OR7A 2W82A 1KZHA 2DA1A 3RPUD 4R3KA 1BIAA 2WY7Q 4G6DA 1GHCA 4D7NA 1FBQA 2DYRH 2ECCA 3ABLH 1KUXA 2IL4A 4JX5A 3IWGA 3HM5A 1ZLJA 5CPRB 2CUZA 3QAHA 3OIPA 1T33A 2YR2A 2P6EA 4KOUA 3KP5A 1IRFA 5CLSA 4D1QA 4FD4A 2BO9A 2HVQA 1HW1A 1GLNA 3SHFA 5FJ8J 3IEHA 4XIDA 2HYGD 1U9NA 2B0LA 1J7KA 2KDZA 2XF6A 1RPWA 4X1EA 1JKQC 4PGGA 3LMMA 2QSFX 5GTIC 2PJPA 2CNTA 1VI0A 2QYVA 3R95A 1U9OA 4PFPA 2DN0A 1DPUA 3HRUA 3CXQA 2ZSIB 1H9GA 3B7IA 4HSTA 2M0CA 5DUKA 1BI0A 3PBEA 2VXKA 5DD4A 3BTLA 3O8GA 3OYFA 4A3BJ 3K4NA 4NJRA 1NG6A 5TJJA 4L9NA 3PB8X 2PMZA 4PXBA 4ETSA 1TT0A 2MG4A 2VBZA 3EPZA 4HAMA 1G3SA 1X1DA 3J7AY 3LA3A 1L0OC 3ZOBA 3HOWJ 3S9LA 1QA6A 3CO7C 4A33A 4KUMA 4EQQA 2IEKA 3RZAA 3UNGC 2R7TA 3J7ZI 3BJOA 3CCUI 5L3DA 1S6LA 4BMHA 4AVBA 2OV7A 2ZENA 4ZDOA 3PQKA 3WGHA 5E8IA 3CC2I 1FNOA 1WJBA 2Q4ZA 4BL0B 4Q4ZF 1DGRM 3KIOA 2JRTA 3OYDA 3J7AO 2H8RA 2VEZA 4U7DA 2JSPA 2EFQA 4HX7A 4P5OA 4UFXA 1CBXA 5EZHA 5D5VB 5BQTA 5JQ4A 3ISPA 3TOAA 3OR1C 3RYPA 2VE8A 1I3QJ 5H20A 2JA8J 1YSJA 2G9DA 5B5EC 2Y9YA 4LITA 4IZZA 4LB6B 2FF4A 1Q7LA 2WYRA 1TKFA 3I1UA 2PJ9A 4IOCF 2F5FA 5FRNA 5ERIA 4F7ZA 5G1ZA 1BM9A 2JZYA 2RNGA 1X3WB 4BHPA 1M1DA 4YFJA 2FRHA 3OR2C 2R7VA 2CTCA 4KSFA 2K7LA 5F1JA 1A04A 4X0GA 1YRNA 4V2FA 3JRHA 3CZ6A 3COAC 2HOEA 2OD5A 2L7FP 2VT2A 3V7ZA 1TNTA 1VHEA 3L2VA 4FD6A 1XMBA 2XGEA 4OIOF 1DQUA 2G3TA 4M6GA 2NOJB 4EVIA 2TRTA 3ERED 2V4JC 4NDLA 3U2RA 3RKXA 4U9ZA 1IG7A 2J5PA 1B9NA 2EIJH 5M3FJ 3SJMA 3S1MJ 1IUYA 1TWFJ 2MD5A 4L9JA 4XQFA 1F4KA 1GUUA 2OCEA 3SXYA 3DLLF 1ZRDA 2RQQA 4ORFA 2H6BA 4BS9A 1HLVA 2ZELA 3D0SA 2E5ZA 2O53A 1R1VA 2L9RA 4YEJA 5ICCA 3S6GA 4I0AA 4BHCA 1SAXA 2DAOA 3LOCA 1GV5A 4CGMA 3FVLA 5L3EA 2Z3KA 2EFOA 3TC8A 1SFXA 3IH2A 2QCOA 2ODFA 1Y0UA 3A0HC 4A31A 3R60A 5IB0A 2FSWA 4A3FJ 4MHPA 2F5CA 1F57A 3ZMUA 5E1WA 2PJ8A 2DA3A 3BR6A 3V8KA 1XSDA 4MFKA 2ZJQF 4MHGA 3T8WA 2K9LA 2GA2A 2PJCA 1P9QC 1ZGAA 2E60A 4OMZA 3V7RA 4IK2A 3GZ6A 1T38A 1B8IB 3RAMA 1PUEE 2CH0A 3O8HA 5GADJ 1ZO0A 2OAZA 2JJ7A 3CUQA 3WTZA 1D5YA 1XCVA 2Q8KA 1STZA 4C30A 1X19A 3QYFA 3CMEI 1U6MA 5LYLA 2VBXA 4ZYGA 4MCRA 2WV0A 1WJAA 4NGRA 4XPDC 4MJ8A 2BEOA 3D5LA 1K83J 1M44A 2PJ5A 1X4PA 4DUKA 2C6CA 3FM3A 1J4JA 2OZUA 4DYRA 2V8GA 5CVVA 3DEWA 4OC4A 3WG9A 2XEFA 5LYIA 2Z3OA 4WWCA 4M3DA 4H0EA 2EWBA 3LWUA 2VI6A 3H5RA 3P2HA 1RNLA 3F8KA 1TNSA 1WJ5A 5LGUA 1A2ZA 3FDYA 2F5IA 2FMYA 3HRSA 3G1OA 1LFUP 3VYSB 3C26A 2HV2A 5M3MJ 3BJ6A 3K69A 5F27A 2GA1A 4MFEA 4A3DJ 4WXHA 3S3MA 4R7MA 2RVCA 5J6XA 2Z10A 3QAYA 1KYZA 4HLYA 4E7JA 1VQMI 1FTTA 4IVNA 2PJ6A 2MD0A 2EUIA 3PRTA 5LGTA 1MBEA 2CMPA 1QU3A 2NVTJ 5FD5A 4QPOA 2UXXA 4C7HA 3TOBA 2HYJA 2IXSA 1D1AA 3FF5A 2JDDA 1I6HJ 4RBOA 5HMNA 2R4GA 1BR1A 2WAQA 4W1UA 1YHQI 1A5JA 1FT9A 3C2BA 1FX7A 3LSRA 2VZZA 1Z8LA 2WAEA 4CAEA 2H94A 2RREA 2RNJA 4M9ZA 4YIIA 3VEPA 2DDBA 3ZMSA 1XD7A 4Y7NJ 4OU0A 2ISYA 1VIXA 2Y0SA 3V7CA 4BD9A 1BA5A 2L9NA 1O3TA 4C2XA 2XRLA 1LDKB 5D4SA 3HRMA 1S60A 2AFXA 3NH4A 2V7FA 2L7KA 2Z16A 4RB0A 4UUVA 3LQQA 2HQNA 4KORA 2Y69H 3GTLJ 3ZN1A 2DFFA 3MZYA 3TEDA 4IO9F 3R96A 5CVIA 2LH9A 2FOWA 4PCQA 4JZ0A 1VQLI 4GFBA 2OTJI 3DEUA 1FBSA 1WQ2A 2J5OA 4LOCA 2V6EA 2EVNA 2VKDA 4H2KA 1U78A 4HV5A 1FBUA 4HBLA 1DPRA 3OYCA 4ZY1A 4HX8A 4XNHC 1DP3A 2X4HA 3VYUB 1LNWA 4P9FA 2IGMA 4Y3OA 2Y31A 2MLGA 3ZQIA 4C2MJ 3HYIA 4RM2A 4NJQA 4LMYA 4LG0A 2HC9A 1R4NB 1JHHA 2X1CA 2PJ1A 1ETWA 4LLGF 4IAVA 4KS9A 1SFUA 3DPUA 1S7LA 4F9VA 1W5TA 4ZC3A 2KCWA 1MJ9A 2O8KA 2R7UA 2PC1A 4NGNA 3ABKH 4BQOA 5GTHC 5C88A 5CBMA 2ELHA 2J8NA 3KZZA 3JUWA 5LRSA 2F4OB 4KIFA 3CDLA 4RAYA 1ELMP 2BCOA 2LKXA 1ON1A 3W2WA 1VFCA 3D4UA 3LSIA 3DSBA 1KU2A 1BW6A 3SJGA 2EZKA 4BXXJ 3PGPA 4BYYA 5F49A 2DJNA 2KJCA 1OCZH 4P9UA 1PP7U 5H2FC 5I0CA 3KX2A 5FKLA 2JT1A 4BBSJ 4PXCA 4HZFA 1PVEA 4M3EA 2X0LA 3ZMZA 4MXUA 5EDNA 4CRZB 4E8OA 4A3KJ 1YMEA 3L7WA 3ML6A 3KHXA 1Y0RA 3TBIA 4Q5SF 3KP6A 3PSIA 1LANA 3B3VA 3H92A 5ICEA 2FEZA 2JPCA 3KYCB 2PSWA 4M6IA 3PUBA 2L5QA 1Z67A 4RGSA 1ZKGA 1QVUA 2XAQA 4MQ9F 2FJ1A 2QENA 2ECBA 2JA7J 3U1KA 5ILVA 1YLOA 3B3TA 3BY6A 2UWMA 4MHZA 2DFHA 2P5LC 3MFKA 3OSGA 1T2KA 4NBQA 1VQ4I 2OA4A 1W7PA 2K9MA 5EEAA 1YVOA 2VQYA 4FD5A 2Q0OA 3NEUA 4HF0A 2K4BA 4B13A 2ZEEA 2C6YA 3KP3A 3VATA 2I10A 2XF7A 3TDUC 3CF2A 1S7FA 3OYNA 4RLQA 3A2KA 3CMYA 3K0LA 1ETXA 4XNFA 2LOOA 1KUYA 2WSAA 5HS7A 3RO0A 4YELA 1D3YA 2KISA 1D1CA 3JRGA 3L2CA 2J9AA 4ONUA 2DO7A 2ANPA 3T90A 1RUOA 2WAQN 4Y49C 4BINA 2RQPA 1EE3P 1USSA 3V7SA 3D3SA 2K3PA 1NH3A 2LD5A 4NXYA 1ZQ3P 3H9JA 2JDCA 3PM1A 3WHCA 3NFZA 3CPXA 3KQXA 5DTDA 4ENJA 3B02A 1CF7A 2HTJA 1IYKA 1Z9UA 5HH1A 1T6SA 5BNGA 3JR9A 2V1XA 1MJAA 2XGDA 1Y1WJ 4KIBA 5F64A 3ZCOA 3B3WA 4HDVA 2OPTA 2XAJA 2KIMA 5D8LB 1SD7A 4KNYA 1OISA 3F3XA 3F8CA 1XOVA 3LACA 4DYOA 2RKHA 2QKLB 1S7EA 3K1NA 3PZJA 2PN6A 1MKMA 5F6FA 1ODDA 4EMSA 1A31A 1Z8WA 3Q0VA 2ZOFA 4JLYA 4S05A 3TFYA 2NVXJ 3FBIB 2Q4VA 2E35A 3G73A 5THWA 2XB5A 2H27A 1S8NA 3F9KA 4ZJZA 3HSRA 2HNHA 5FVJA 3BC8A 2KIQA 1QQ9A 3O2PE 5LLQA 3KCCA 3SI2A 2MA3A 1EA3A 3KP7A 2IPQX 5CKTA 2L2OA 3ASOH 2HOSA 2BV6A 2D2WA 2I00A 2ZEHA 1IF1A 1N77A 4EM2A 2REFA 2ZW6A 2BVMA 3IC1A 3M4OJ 4PV6A 4UHTA 3Q0UA 5LFAA 1UHWA 4EJUA 1JUMA 3C7JA 4CZCA 3OOUA 1ZR4A 1IRGA 4AVAA 3V42A 2FBIA 1IGNA 1KQ8A 3QQAA 2JA2A 4TWEA 3A02A 1K78B 3BG3A 3PO2J 2AFZA 5GCNA 1LEAA 2TCTA 4X5KA 3ZQFA 4IEJA 2VC1A 4KA4A 3A4CA 4XSXF 1ZYRF 3H3UA 2L4AA 3ZQHA 4EJTA 2NSMA 2F48A 4IPAA 2P0WA 2H6CA 1RKWA 3E6DA 2FX0A 5IP6A 3ROUA 2QGUA 2VLAA 1I21A 2E19A 5DEQA 1X2MA 4B47A 3J81Z 1HA8A 1XJOA 2CO5A 3JTKA 4ENKA 2CNSA 3GTMJ 1XBUA 2KIFA 3IFEA 2K5TA 5EMIA 1V55H 2DF5A 3KP4A 3FK6A 3GZNB 4CCMA 1XGNA 2MBFA 1ETVA 1ZG3A 1PYTB 2OB0A 1H8LA 1T56A 5JHUA 4CYCB 1P7JA 2OR4A 4ABZA 3L2QA 3VPRA 3HOTA 3ECHA 1D0XA 3S2WA 2DMPA 2WB1A 4U5YA 4E7KA 4UWIA 2ZKZA 3AFHA 2BYVE 1YIJI 2VT3A 2ZEDA 1X4OA 1KZFA 4Y33A 1MNMC 3IU1A 4A94A 3PNTA 1BJAA 2R92J 2A5WA 3HOXJ 2FD5A 3QWLA 5A2QZ 2HUZA 5HXDA 4EWTA 1YW6A 4IX7A 1LE8B 3QOPA 1VQOI 4QIWN 3BI0A 4QVTA 2R5ZA 3GZ5A 5FFZA 2HDCA 1WJEA 2AXTC 1YVKA 5DV5A 2K9QA 4NC7A 2CUFA 4CYPA 2EBIA 1T98A 2H5MA 2KMUA 2F7VA 1B72B 3PP9A 1YX0A 5FKOA 2Q04A 5C82A 4K2EA 4XM3A 1TWHJ 2ZB9A 4XNHB 1TF8A 1AU7A 2ME0A 3HUGA 5BOXA 4MFQA 3PFIA 2E2IJ 2FS5A 4IF4A 2PJAA 5LRGA 3DCFA 3M8EA 2ZEGA 1SFEA 2R3SA 4B43A 1FP1D 3RYRA 5D4RA 1UFHA 3H4QA 1YJWI 5CPAA 3RCOA 2JRMA 4CYDA 3OYGA 1XX5A 3PO3J 4KMFA 4FTHA 2K9SA 1ZHFA 1XEBA 3CESA 4ITVA 4XLAA 1FOXA 2BSWA 1L3LA 3R6SA 1UMQA 2DMTA 3OIQA 3L2RA 2QEXI 3D67A 4YFXF 4DGWB 3B73A 5IP9J 1F9NA 2F5DA 4H6ZA 1LVAA 2CQNA 3LA7A 1VQPI 4KOSA 4CH7A 3AG3H 3KETA 1MSEC 1BBYA 2CG4A 3ZPLA 1BR2A 2DOFA 4IHVA 1HSTA 3KGQA 5LBQA 4HPQA 2DOEA 1HEEA 1ZN2A 4OMYA 4CO8A 3E3VA 3CT9A 4A2UA 4OAYA 1MNEA 3DTKA 3I55I 4LJZF 1OBRA 5AG5A 2EILH 2XV4S 4OIRF 2LSOA 1TL8A 3GLXA 5B3SH 5D8NA 2CQXA 3EQLF 2NVQJ 4CCLA 3WU1B 2M8GX 3E6CC 4AVCA 5GAHJ 3T9YA 4DZPA 1KUVA 3N4MA
chains in the Genus database with same CATH topology
1M4GA 2KP6A 2B4DA 4I49A 2MC4A 2WADA 3ZZIA 2GIVA 1KUXA 4G6TB 2WY8Q 3ZXSA 3KEYA 2IL4A 3IWGA 3D2MA 1X1AA 5J8CA 4BXFA 2X6WA 5CPRB 4C2ZA 2CUZA 1CM0A 3OIPA 2P6EA 3QAHA 4KOUA 3U21A 3ONQA 2VJJA 2JVGA 2OU2A 4D1QA 1QSTA 4FD4A 2HVQA 3TMOA 4BU2A 1GLNA 3LSHA 2F6CA 3K6GA 4II3A 3K4KA 5EC4A 3NWTA 3SDBA 4C2YA 2XF6A 4B14A 2CV0A 4R57A 2AQEA 2B5GB 2VL8A 3LMMA 4CSWA 3LSKA 2CNTA 4NF1A 4Y49B 4KLWA 3R95A 3HG9A 4PFPA 2FXFA 1S3ZA 2YGWA 4OAZA 5JHFA 3W2AA 3KYLA 1TIQA 3CXQA 2KRHA 2ZSIB 2NMTA 4XPKA 4HSTA 2P6FA 2HVRA 2RC4A 3S6KA 4B10A 1MJBA 4BE0A 2VXKA 2Q2EB 2HZDA 2Z11A 4KVME 1DGWY 3I9V2 3OYFA 3K4NA 5FROA 1NG6A 1S9HA 2QMLA 3LODA 4CAXA 2Z2SB 2PMZA 2J8RA 4KOYA 1Q2CA 2IGNA 4AG9A 2XSJC 1TT0A 1FY7A 5H86A 3EPZA 3BG7A 4FD7A 1MMDA 1X1DA 2M3AA 2A6TA 2V1NA 4XONA 3J7AY 1IB1E 2BEIA 3S6FA 1ERDA 3IP4B 4CAWA 4AG7A 4F93B 4R87A 4A33A 4HNUA 2CXAA 4KUBA 3UNGC 4F92B 2R7TA 1V0CA 4DNCA 4BMHA 4AVBA 3PNVA 2UUZA 1YREA 4L89A 4IQ4A 2OV7A 1IICA 4ZDOA 1E0EA 2O5RA 4U87A 1WJBA 3VWEA 3E0KA 4BL0B 2Q7BA 1DGRM 4ZDPA 3BJ7A 3OYDA 5KCMA 3K4JA 2JSPA 4P5OA 2AE6A 2DPSA 2VEZA 4J3GA 4UFXA 2VQGA 2X1DA 5JQ4A 3JVNA 3TOAA 3OR1C 3SZGA 3I9SA 3OWCA 2GANA 1YX3A 2CUJA 3EUKL 4ZDLA 2IS1A 4B48A 1Z7LA 4F91B 3PFYA 2VXZA 4LITA 2FSRA 3F0AA 4IZZA 2WA0A 2JUGA 1L0CA 4J01A 2OC6A 5FRNA 5G1ZA 1MMGA 2IS2A 2RNGA 1M1DA 4YFJA 3LL7A 3CP2A 3OR2C 1NE9A 2R7VA 2R7WA 3FB3A 4KSFA 1KONA 3VWBA 3W91A 4X0GA 3CXSA 3CZ6A 3A9LA 3DPLC 2HPMA 1D1BA 3MKYB 3L2VA 4FD6A 1PU9A 4LUAA 1YE9A 4K30A 3H0DA 2PQ8A 2G3TA 1DQUA 3D5RC 3VDXA 4FETA 2NOJB 4MFLA 5E96A 2KQRA 2VJ4A 2VPLA 4E4HA 2V4JC 2DOAA 3EUAA 4U9ZA 3TL4X 3DEEA 4MBUA 2M4GA 2FIAA 4MHDA 1QSRA 2PRBA 3C2HA 4XQFA 3FHNA 3ZR8X 3OYHA 3AL0C 1NSLA 4JD6A 5HLTA 4KSAA 4PUSA 1J09A 2RQQA 2UV1A 3CP8A 2BOLA 4BQNA 4BUPA 2DJIA 4BS9A 4D9JA 3OYLA 1R57A 4ORFA 2KRCA 2E5ZA 2KPMA 2B58A 4GRIA 4YEJA 3BLYA 4UFVA 3S6GA 2M7BA 1QHHD 3I3LA 2XDVA 2BW3A 2K5CA 4BQQA 4CCOA 3W3CA 2WUUA 4HNWB 4EATA 1VHSA 2Z3KA 3F5BA 3DKYA 4A31A 3G3SA 4DBRA 2FCKA 4XKCA 5F46A 5IB0A 4CA0A 1LVKA 1BOBA 3BCBA 3BG6A 2B4BA 4A30A 4KOTA 4BEHB 4MFKA 2X6YA 3A1YA 4FASD 4BE1A 2VXDA 2K9LA 2B4DB 2OH1A 2VI7A 4PK3A 5JPHA 2X1EA 1P9QC 2E60A 5G20A 1T0FC 2CH0A 4MY0A 1ZO0A 4NQWB 3SEZA 3S32A 5IX3A 2LY1A 4PJJA 2YNEA 4UCPA 3OL4A 4XL9A 1X19A 3QYFA 4C30A 1MW7A 2PJRB 1U6MA 3QB8A 1NMTA 4JXQA 4OLLA 1WJAA 3GBGA 4XPDC 4MJ8A 3IUOA 3OL3A 4KLVA 3B8GA 3S3OA 1MK4A 5HNFA 3D5LA 4PSXA 1P0HA 1M44A 4DBQA 1VKCA 1X4PA 2VB6A 2VBQA 1V5EA 2J8MA 2DT6A 1J4JA 2Q1ZB 4CGMA 2OZUA 4XMYA 3GY9A 5CNPA 2Z3OA 1WJCA 1I12A 4XORA 2R7XA 4E7IA 4A2ZA 3S93A 2FT0A 2OZGA 3OS1A 5KTAA 3H5RA 3P2HA 3F8KA 4CYOA 1IRXA 1WJ5A 2P6GA 2R7HA 2F5IA 3FDYA 1Z3XA 2YNDA 2CV1A 4H6UA 1Z21A 3VYSB 4PJNA 2V26A 2HV2A 2VKHA 2F4IA 2R7OA 4C2TA 3C26A 2Q0YA 5AG6A 2X51A 2WAFA 2R7RA 3S3MA 2R7SA 4KUAA 4XPDB 3FBNB 1B6BA 1W36C 2Z10A 3MMYB 4RS2A 4UFWA 4B5OA 4E7JA 2HU9A 1UG0A 2CW8A 2MD0A 2EUIA 4MI4A 2CMPA 1QU3A 4A32A 3OMYA 3PSFA 4QPOA 5DWNA 3R9GA 3SYTA 3TOBA 4C7HA 2IXSA 2LY2A 1D1AA 4U7BA 4E7HA 1Z4EA 2JDDA 4JQFA 5HMNA 4IKFA 4NCZA 2R4GA 2LBFA 5FRMA 4B5PA 1BR1A 2WAQA 3PL8A 2VZZA 2BVLA 4AYBA 4KOWA 4CAEA 3FBUA 2WAEA 3IAM2 2DXIA 2RREA 1Y9KA 4KVOE 4R9MA 2HVSA 3DTEA 2X85A 3D5SC 3TO9A 1S7KA 1ZELA 4JXRA 3GKRA 2Y0SA 5LD2C 2L9NA 3VWDA 4C2XA 4C68A 1LDKB 1S60A 2F5VA 2V7FA 2L7KA 2Z16A 3R1KA 4CUGA 2Z3PA 2W7NA 3UR3C 2GE3A 1RO5A 2KDOA 3FKJA 4KORA 4JWPA 4B5PB 1QSNA 2M4KA 1YLEA 2Y0MA 4KVXA 2LH9A 4PK2A 4PJMA 2Z3NA 4UCNA 4CAFA 4KZTA 1TZLA 4PSWA 4BJ6C 2BW3B 4CAVA 2BUEA 3EUHC 3OYJA 2V6EA 2BL1A 1Y6IA 2EVNA 3DDDA 4F6AA 2VKDA 4OWRB 4AB7A 2LRDA 3DU6A 3OYCA 4AVZA 4XNHC 1DP3A 3EXNA 3VYUB 4BEHA 3K70D 2IGMA 3QODA 4XLEA 4Y3OA 5DWMA 2VQCA 4NNJA 4PK4A 4RM2A 2LREA 2YNCC 5G21A 4CGLA 2DCEA 2VQHA 2X1CA 4XOPA 2Z0ZA 1QSMA 4HEA2 4KS9A 3DPUA 1S7LA 3SXNA 3TTHA 3K4MA 1D0YA 1OR7C 1SFKA 4LG3A 4ZC3A 3K70C 1MJ9A 2KCWA 3DR8A 3NE7A 2R7UA 1Q2YA 3OYEA 3HKZA 2PC1A 4BQOA 4F55A 3K4BA 2KLOA 1UAAA 4QB9A 2J8NA 2Q4YA 5C88A 3JUWA 1Y7RA 3DSBA 3W2WA 3OS2A 1K6YA 3LSIA 2LBFB 4PJLA 2I79A 3H35A 3TCVA 5AGEA 5F49A 3PGPA 3RYOA 1OZPA 4YGOA 3KKWA 4ZGYB 4XKBA 3S3NA 1V5FA 5CQEA 5I0CA 2B3UA 5EBVA 2D4OA 3RSNA 3KX2A 1M4DA 2FL4A 1Z4RA 3QYEA 4IF5A 4CRZB 3IAS2 4CCJA 3L2WA 2ZW7A 2R98A 4E8OA 2B3VA 2ZSHB 2PR1A 2W00A 3TBIA 4HNXB 2ZXHA 1XE4A 4XN0A 3PSIA 2IGKA 3MD2A 3IWEA 3ZJ0A 2Q44A 2R7QA 2PSWA 3SXOA 3ZQQA 2G0BA 3PUBA 3L2UA 2X7BA 4M3SA 1Y56A 2ELJA 2L5QA 3S8PA 1VZ0A 4C9YA 5AG4A 1ON0A 3LD2A 4BDZA 2L9SA 4OAEA 2REEA 4H89A 2UWMA 5H84A 1T95A 2JLMA 5A28A 3DR6A 4FD5A 2X6XA 2VASA 1YVOA 1SAUA 2GOMA 2K9MA 1PYVA 4XLHA 2VQYA 4II9A 4M85A 4C2UA 2XF5A 5ISVA 4UCMA 1IIDA 4JOMA 4B13A 4OADA 1LKXA 1MNDA 1K4JA 2FIWA 2PDOA 3D8PA 1YK3A 3E0JB 3R9FA 2XF7A 4BGDA 3CF2A 2PJRA 1S7FA 3OYNA 4RLQA 4IQJA 3A2KA 1KUYA 2ARHA 4XNFA 2LOOA 2WSAA 3EO4A 3SHPA 2E5NA 4KOXA 2IGOA 3G2BA 3BCAA 4LX9A 4YELA 1D1CA 4ONUA 3T90A 3HOSA 4Y49C 4RI1A 3HC7A 2MFZA 2WBMA 3D3SA 2KZVA 4MLOA 3ZRGA 2K3PA 5TGTA 1YX5A 4N4NB 4NXYA 4CYNA 5KTCA 3H9JA 1IYLA 2JDCA 1WFXA 1G59A 3EFAA 4CS0B 4NEXA 4ZYAA 5A27A 2QKMB 3OYIA 1AA7A 3TO7A 3IGRA 4XKVA 4HNTA 4B44A 1JI8A 1PJRA 2FUG2 1G8XA 3DQVC 1YR0A 1IYKA 3CJRB 4LIVA 5CQGA 1Z9UA 4GS4A 5HH1A 1MJAA 3H9QA 2E1MC 3ZCOA 1UELB 3AL0B 1N71A 1NG7A 4QBJA 4AU7A 4BJTA 4KOVA 4UWJA 2QKLB 1PUAA 3LSMA 3PZJA 1B87A 3FYNA 4JLYA 2G3AA 4YRVA 2WPWA 3TFYA 3H5ZA 3FBIB 2Q4VA 3MGDA 4Q38A 3R9EA 4XKWA 2IS4A 1FMWA 3FIXA 3UY5A 3F9KA 4ZJZA 5FVJA 2HNHA 3K10A 3OWTA 1WWZA 3TT2A 1MMNA 2W1OA 3OYMA 1N78A 3BC8A 3DTIA 2CFOA 2V9KA 3PNYA 4XLCA 3W2VA 3MKWB 2CNMA 3DU5A 3EY5A 4Y4RA 2AJ6A 3FRMA 4Q36A 1EA3A 1S7NA 3S6HA 4ANJA 3WR7A 5CKTA 5KHDA 2L2OA 4CCKA 3TO6A 1P4NA 4CRYB 2I00A 1N77A 4H4KC 2REFA 3V8IA 2ZW6A 1WJFA 4J00A 2BVMA 2JEVA 1BR4A 4PV6A 4CGOA 2M0MA 5LFAA 4DJAA 2ATRA 2HDWA 3M8JA 3H9GA 3N05A 4KITB 2CV2A 2KHMA 3CMMA 4CZCA 1MMAA 3OOUA 3QYBA 4MFZA 4AVAA 3V42A 4B11A 2WPXA 2VJ5A 3LFUA 2JA2A 4F3QA 2W4SA 3OY9A 4QUSA 5GCNA 4X5KA 3R96A 3VYTB 4HG2A 3H5AA 3W6SA 3DKXA 2ZFUA 3A4CA 3PJRA 2R1IA 3K9UA 3ZGKA 1QHGA 2P0WA 1W36D 4DIQA 1XF8A 2C27A 4BBHA 5IV0A 2VLAA 4C7IA 1XIXA 1I21A 3RTRA 2DPTA 4B47A 2CW7A 4BJ5C 4UBRA 2O28A 4HNYB 1HA8A 2LC2A 3JTKA 2CNSA 4E7SA 3DNSA 3BLNA 3DPTA 2K5TA 4XOTA 2ZW4A 3EC4A 1R6RA 2LG4A 2ZW5A 1FMVA 4KJZA 3W6XA 4CCMA 2OUMA 3CXPA 5J8FA 3OYBA 4JJXA 4HRIA 2CS3A 2OB0A 2QECA 5G22A 1S5KA 3HL2A 4N4OB 2VZYA 2GOXB 3L2QA 1CJWA 3HOTA 4DOZA 2HQYA 2XAUA 4RMNA 1D0XA 1I1DA 1WJDA 2Z1DA 3E1SA 2Z3MA 5F47A 1U0JA 4XR6A 2WB1A 4KT6A 4E7KA 4U5YA 4UWIA 3AFHA 4II2A 2XC7A 3IU2A 1V5GA 1X4OA 4XN3A 1KZFA 4Y33A 4MFPA 3IU1A 3PNTA 2AQFA 2A5WA 3G8WA 4CGPA 1RXTA 2HUZA 5AG7A 1N75A 2IS6A 2M7AA 3P2FA 2B5GA 4IX7A 3VSLA 4IUSA 3N7ZA 4XLFA 3SEQA 3VSKA 4QVTA 5HOOA 3HPHA 2MABA 1WJEA 2ZPAA 1YVKA 2ZXVA 3HXLA 4BDYA 2HQAA 2VIXA 4NC7A 4CYPA 2E1MB 3LSGA 1Q2DA 1Z3YA 2KMUA 3OS0A 2H5MA 3PP9A 1GHEA 3I3GA 2I8DA 1YX0A 5F48A 5BWAB 4L8AA 4EVYA 3FXTA 4HSRA 2Q04A 2CY2A 5C82A 2HPIA 1LRZA 3HPGA 4XM3A 3NWSA 3M1CA 4LIUA 2LYCA 4PFOA 4CCNA 3OYKA 4XNHB 3D2PA 3GYAA 4MFQA 4NSQA 4E2AA 3TE4A 2FS5A 3K4CA 4RLFA 4BACA 1BO4A 4MFJA 4ZBGA 2VJIA 4B43A 4RM3A 5HVQC 1QSOA 2Z3LA 3OYAA 1UFHA 3H4QA 2PR8A 2YNCA 4A95A 4E7ZA 4QPQA 3RCOA 4ZTFA 1OLTA 3OYGA 4UA3A 4XPLA 4F0XA 2BSWA 4CYQA 1XEBA 3CESA 4ITVA 4XLAA 2R8VA 2ZXIA 4QC6A 3HUGB 1X1BA 2JVHA 3OIQA 4NUBA 3K4LA 5KNLA 3L2RA 4ZTJA 3BJ8A 4F52A 3C2GA 3FNCA 4KISA 4HKFA 2A4NA 4DGWB 4B12A 1SQHA 5KTDA 1Y9WA 4H6ZA 4F0YA 2FE7A 3VYRB 3CJQB 3DWLE 3QOEA 2MYSA 4E7LA 4KOSA 4CH7A 4U9YA 4E0AA 4E6KG 2KL4A 4B3XA 1BR2A 2DT7B 2QIRA 3RQ4A 3DLAA 1M4IA 2D4PA 4HPQA 4YRHA 2OZHA 2VQLA 4R79A 1X1CA 4OAYA 1MNEA 3DTKA 3MKZA 4NC8A 1YGHA 2DXQA 5AG5A 4P1WA 4BE2A 1WK4A 1XMTA 4CGNA 1LFPA 2W82A 1D0ZA 4CCLA 4R3LA 5HNHA 4AVCA 3H5NA 3RPUD 4R3KA 3T9YA 3AKZA 1KUVA 2WY7Q 4MY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M4G A;  2B4D A;  4I49 A;  3ZZI A;  2GIV A;  1KUX A;  2IL4 A;  3IWG A;  3D2M A;  5J8C A;  1CM0 A;  2P6E A;  3QAH A;  4KOU A;  2OU2 A;  1QST A;  4FD4 A;  5EC4 A;  4R57 A;  2B5G B;  2CNT A;  4Y49 B;  4KLW A;  3R95 A;  4HNY B;  2FXF A;  1S3Z A;  1TIQ A;  3CXQ A;  2NMT A;  4XPK A;  2P6F A;  2RC4 A;  3S6K A;  1MJB A;  2VXK A;  2Z11 A;  4KVM E;  3LOD A;  2QML A;  4CAX A;  4KOY A;  2J8R A;  1Q2C A;  4AG9 A;  1FY7 A;  5H86 A;  4FD7 A;  3S6F A;  2BEI A;  1IB1 E;  4CAW A;  4AG7 A;  4R87 A;  4KUB A;  1V0C A;  4BMH A;  4AVB A;  1YRE A;  4L89 A;  1IIC A;  3VWE A;  3E0K A;  2Q7B A;  3BJ7 A;  2VEZ A;  2AE6 A;  4J3G A;  5JQ4 A;  3JVN A;  3TOA A;  3I9S A;  3OWC A;  2GAN A;  3F0A A;  2FSR A;  1L0C A;  4YFJ A;  1M1D A;  1NE9 A;  3FB3 A;  3W91 A;  3CXS A;  4FD6 A;  4LUA A;  1PU9 A;  4K30 A;  2PQ8 A;  2G3T A;  5E96 A;  4U9Z A;  4MBU A;  2FIA A;  4MHD A;  1QSR A;  2PRB A;  1NSL A;  4JD6 A;  2Q0Y A;  5IX3 A;  1R57 A;  4ORF A;  2B58 A;  3S6G A;  4HNW B;  1VHS A;  3F5B A;  3G3S A;  2FCK A;  5F46 A;  5IB0 A;  1BOB A;  2B4B A;  4KOT A;  2OH1 A;  2B4D B;  4PK3 A;  2VI7 A;  5JPH A;  4MY0 A;  4JXQ A;  4OLL A;  1U6M A;  3QB8 A;  1NMT A;  4XPD C;  4MJ8 A;  4KLV A;  3B8G A;  1MK4 A;  1P0H A;  4PSX A;  1VKC A;  1M44 A;  2VBQ A;  2J8M A;  1J4J A;  2OZU A;  3GY9 A;  1I12 A;  2FT0 A;  2OZG A;  5KTA A;  3P2H A;  3F8K A;  2P6G A;  2R7H A;  2F5I A;  4H6U A;  3C26 A;  2HV2 A;  4KUA A;  4XPD B;  1B6B A;  2Z10 A;  4B5O A;  4RS2 A;  4MI4 A;  2EUI A;  5DWN A;  3R9G A;  3TOB A;  1Z4E A;  2JDD A;  5HMN A;  4NCZ A;  4B5P A;  4KOW A;  2VZZ A;  3FBU A;  1Y9K A;  4KVO E;  4R9M A;  3TO9 A;  1S7K A;  4JXR A;  3GKR A;  3VWD A;  1S60 A;  3R1K A;  2GE3 A;  4KOR A;  1RO5 A;  4JWP A;  4B5P B;  1QSN A;  1YLE A;  2Y0M A;  4KVX A;  4PK2 A;  3R96 A;  4KZT A;  4PSW A;  4CAV A;  2BUE A;  3DDD A;  2BL1 A;  2EVN A;  4F6A A;  4AB7 A;  4XNH C;  3EXN A;  5DWM A;  2Z0Z A;  1QSM A;  1S7L A;  3SXN A;  3TTH A;  2KCW A;  3DR8 A;  1MJ9 A;  3NE7 A;  4DNC A;  2PC1 A;  1Q2Y A;  4QB9 A;  5C88 A;  2J8N A;  2Q4Y A;  3JUW A;  1Y7R A;  3DSB A;  2I79 A;  3TCV A;  5F49 A;  3PGP A;  3RYO A;  1OZP A;  4YGO A;  3KKW A;  5I0C A;  2B3U A;  5EBV A;  2D4O A;  1M4D A;  2FL4 A;  1Z4R A;  4IF5 A;  4CRZ B;  2ZW7 A;  2R98 A;  4E8O A;  2B3V A;  2PR1 A;  4HNX B;  1XE4 A;  3ZJ0 A;  2Q44 A;  2PSW A;  3SXO A;  2G0B A;  2X7B A;  4M3S A;  1ON0 A;  3LD2 A;  4OAE A;  2REE A;  4H89 A;  5H84 A;  2JLM A;  3DR6 A;  4FD5 A;  5CNP A;  4II9 A;  1YVO A;  2VQY A;  4M85 A;  5ISV A;  1IID A;  4OAD A;  2PDO A;  1K4J A;  3D8P A;  2FIW A;  1YK3 A;  3R9F A;  4NF1 A;  1S7F A;  2ARH A;  3EO4 A;  1KUY A;  3SHP A;  4KOX A;  4LX9 A;  4ONU A;  3T90 A;  4Y49 C;  4RI1 A;  3D3S A;  4NXY A;  5KTC A;  2JDC A;  1IYL A;  3EFA A;  4CS0 B;  4NEX A;  3TO7 A;  3IGR A;  1YR0 A;  1IYK A;  1Z9U A;  4GS4 A;  5HH1 A;  1MJA A;  1N71 A;  4KOV A;  4UWJ A;  1PUA A;  3PZJ A;  1B87 A;  3FYN A;  4JLY A;  2G3A A;  2WPW A;  3TFY A;  3MGD A;  2Q4V A;  3R9E A;  3FIX A;  3UY5 A;  5FVJ A;  3TT2 A;  1WWZ A;  2CNM A;  3EY5 A;  2AJ6 A;  3FRM A;  1S7N A;  3S6H A;  3WR7 A;  3TO6 A;  1P4N A;  4CRY B;  2I00 A;  2REF A;  3V8I A;  2ZW6 A;  2JEV A;  4PV6 A;  2ATR A;  4AVA A;  2WPX A;  4QUS A;  5GCN A;  4X5K A;  3W6S A;  2R1I A;  3K9U A;  1XF8 A;  2P0W A;  2C27 A;  5IV0 A;  1XIX A;  1I21 A;  4UBR A;  2O28 A;  2CNS A;  3DNS A;  3BLN A;  2K5T A;  3EC4 A;  2ZW4 A;  3W6X A;  2ZW5 A;  3CXP A;  5J8F A;  4JJX A;  2OB0 A;  2QEC A;  1S5K A;  2VZY A;  4QBJ A;  2HQY A;  1CJW A;  1I1D A;  5F47 A;  4U5Y A;  4UWI A;  1KZF A;  3G8W A;  1RXT A;  2HUZ A;  3P2F A;  2B5G A;  4IUS A;  3N7Z A;  4QVT A;  2ZPA A;  1YVK A;  2ZXV A;  1Q2D A;  2H5M A;  5F48 A;  3PP9 A;  1GHE A;  3I3G A;  1YX0 A;  4L8A A;  4EVY A;  3FXT A;  2Q04 A;  2CY2 A;  5C82 A;  1LRZ A;  4XNH B;  3D2P A;  3GYA A;  4NSQ A;  4E2A A;  3TE4 A;  2FS5 A;  1BO4 A;  4ZBG A;  1QSO A;  1UFH A;  3H4Q A;  2PR8 A;  4XPL A;  4UA3 A;  2BSW A;  1XEB A;  2R8V A;  4QC6 A;  3BJ8 A;  3FNC A;  4HKF A;  2A4N A;  5KTD A;  1SQH A;  1Y9W A;  4H6Z A;  4F0Y A;  2FE7 A;  4KOS A;  4U9Y A;  4E0A A;  2QIR A;  1M4I A;  2D4P A;  4YRH A;  2OZH A;  1YGH A;  2DXQ A;  1WK4 A;  1XMT A;  4R3L A;  4AVC A;  4R3K A;  3T9Y A;  1KUV A;  4MY3 A; 
#chains in the Genus database with same CATH topology
 2KP6 A;  3IRR A;  2MC4 A;  2WAD A;  3G1M A;  3WE3 A;  2GIV A;  3I4N J;  1KQ0 A;  3IO1 A;  3ZZI A;  4M6Y A;  5KAF C;  1FLI A;  5J8C A;  2HQ5 A;  1CM0 A;  1FSE A;  2MH2 A;  3I59 B;  2VJJ A;  1TW3 A;  2JVG A;  4RGR A;  1FJL A;  4V19 K;  2PJ0 A;  2BXZ A;  4BU2 A;  3LSH A;  3WT4 A;  1OMI A;  3LWF A;  3SDB A;  1FOY A;  2N8G A;  2XEJ A;  1YG2 A;  2JTV A;  4N9I A;  4C3J J;  2P81 A;  2VL8 A;  4TV7 A;  1SVL A;  2QA4 I;  2B5G B;  2Z33 A;  3GTQ J;  1XN7 A;  4HNY B;  1TXR A;  3KYL A;  4EM0 B;  4L9V A;  4UXN A;  1YFH A;  1QBJ A;  4GGG A;  5F1R A;  1VQ7 I;  2P6F A;  1TWA J;  2H1K A;  2PIZ A;  2OZ6 A;  2RC4 A;  2HVR A;  1KU3 A;  2D1H A;  4BE0 A;  3IRQ A;  3DP7 A;  3PIP F;  2Z11 A;  1DGW Y;  2DFE A;  2XPW A;  4CDG A;  1OQY A;  3KQZ A;  1NTC A;  4JYK A;  3LOD A;  2NOG A;  2QML A;  2L3D A;  2KRF A;  4DYQ A;  4CYC A;  2J8R A;  5AON A;  2DT5 A;  1R23 A;  5H86 A;  2QWW A;  2QUF A;  3OIO A;  1YJN I;  1ZLK A;  3S6F A;  2BEI A;  1XGO A;  2QBY A;  2VKV A;  1Y1V J;  4AG7 A;  4F93 B;  3NQO A;  2E71 A;  4M71 A;  2E1N A;  3F72 A;  3FX6 A;  4KUB A;  1J2X A;  2FOK A;  4IOA F;  1V0C A;  4M6H A;  1O7F A;  2L7Z A;  3CCS I;  1PCA A;  4MCS A;  2QVP A;  5EF6 A;  2RB7 A;  4UEZ A;  3FHZ A;  3ULQ B;  1FSH A;  1YIO A;  1LE8 A;  1LJ9 A;  2BZT A;  3EET A;  3RKY A;  2LVS A;  4ZDP A;  3K4J A;  1FIA A;  1WI9 A;  3JVN A;  3SZP A;  3OWC A;  4X6A J;  1UJ8 A;  2ESN A;  2MW8 A;  4G7H F;  3RZO J;  2GFQ A;  4DYC A;  5LRK A;  1BL0 A;  5H6R A;  2E36 A;  2JUG A;  4P4E A;  2EQR A;  5LRJ A;  2HTS A;  3FIW A;  2HKX A;  4MEX F;  1MMG A;  2CJJ A;  4XRM A;  3LL7 A;  3CP2 A;  4IHT A;  4I0B A;  3VWB A;  2FBH A;  2YPR A;  1SD5 A;  3TQN A;  3F8B A;  5FKN A;  3FX3 A;  1YRN B;  3CXS A;  2RAE A;  1I3A A;  3DPL C;  2HPM A;  2JA5 J;  4C3I J;  1S7O A;  2LMD A;  3D5R C;  2EZL A;  3VDX A;  4FET A;  2L0K A;  4B1R A;  4MFL A;  2D1V A;  2KQR A;  2LDU A;  2VJ4 A;  3H0G J;  2VPL A;  3GO5 A;  2DOA A;  2FU4 A;  3TL4 X;  2M4G A;  1F2O A;  2O0Y A;  4MHD A;  3AAF A;  3C1D A;  4LK1 F;  1BLL E;  4ENN A;  3AL0 C;  1NSL A;  5HLT A;  3GXO A;  4FUU A;  4KSA A;  2UV1 A;  5IX3 A;  1JWQ A;  4DW6 A;  5L3B A;  3BLY A;  4UFV A;  2DK8 A;  2M7B A;  1JKO C;  3LSP A;  3I3L A;  4MCQ A;  2QSH X;  2BOA A;  5IOY A;  2IBD A;  2WUU A;  4ESF A;  4EAT A;  1NK2 P;  3BR3 A;  3F5B A;  4EJV A;  1OKR A;  4DBR A;  2IT0 A;  2FCK A;  1XFO A;  1WWX A;  2VN2 A;  3GTK J;  3E5Q A;  1BOB A;  4AYB N;  2DQL A;  2V8V A;  4KOT A;  3F8M A;  4BEH B;  2PJB A;  3C18 A;  3TP3 A;  5G20 A;  1T0F C;  3A01 A;  1S3J A;  2JMW A;  3SEZ A;  1D5V A;  2STT A;  1GT0 C;  1MBG A;  3OL4 A;  4OLL A;  4FE7 A;  1NMT A;  3BR0 A;  3GBG A;  1RR7 A;  3BTJ A;  4KLV A;  1R22 A;  2Y0S N;  3S3O A;  5HNF A;  1YLF A;  1VKC A;  5JH9 A;  3RNZ A;  2Q1Z B;  1IV8 A;  4XMY A;  1DE4 C;  1WJC A;  1I12 A;  3L9F A;  4E7I A;  4A2Z A;  2FT0 A;  3HOU J;  2XUB A;  1R5G A;  4HLX A;  2HZT A;  1IRX A;  2P6G A;  1JGS A;  3KZY A;  3JW4 A;  4HYE A;  2YND A;  2CV1 A;  4PJ0 C;  3CCQ I;  4FCY A;  1Z21 A;  3CC4 I;  2V26 A;  2ACJ A;  2R7O A;  2L7M P;  2R7R A;  2WAF A;  4S0H B;  1M4L A;  1EH6 A;  3GLJ A;  3NRV A;  1SVO A;  1O4X A;  1G6N A;  3FBN B;  1B6B A;  4XPD B;  4I6Z A;  5EYR A;  4RS2 A;  1UG0 A;  1B6A A;  3HGG A;  2A6H F;  4MI4 A;  2LK2 A;  4PXD A;  5L3G A;  3F6O A;  4JK1 X;  3OMY A;  5DWN A;  3R9G A;  4U7B A;  4E7H A;  5IPA A;  5LHG A;  2STW A;  1ZR2 A;  4NCZ A;  2EZI A;  1XC5 A;  2ZME C;  3GCM A;  4UUS B;  2ZXW H;  1FYL A;  4B5P A;  2BVL A;  1R00 A;  3F23 A;  1Y9K A;  1J75 A;  4KVO E;  3DTE A;  3KFW X;  2X85 A;  3D5S C;  3KE2 A;  4L5E A;  5HLI A;  3CDX A;  1S7K A;  4HNV A;  3GKR A;  3FMR A;  4C68 A;  2UXN A;  1VQ9 I;  1Y8R B;  4AUX A;  5B1A H;  2CU7 A;  1HDU A;  2GBY A;  2GE3 A;  4BNC A;  1BI3 A;  3FKJ A;  1RO5 A;  4LFU A;  3ISZ A;  3CLO A;  4UUS A;  4JX6 A;  4KVX A;  4GM5 A;  4B5P B;  4CAF A;  3HTS B;  1TZL A;  1WCM J;  4PSW A;  2BW3 B;  4CAV A;  1R7J A;  4R76 A;  3OYJ A;  3DDD A;  4F6A A;  1Y6I A;  2PMZ N;  3QU6 A;  4ZYH A;  3EYI A;  2ZEF A;  3F8N A;  3SJX A;  1Z6R A;  4AB7 A;  4UVA A;  4UB8 C;  3CCE I;  2LRD A;  3V8J A;  3V38 A;  2QLZ A;  3G6E I;  1R4M B;  2O8X A;  4IHY A;  2DA6 A;  4A69 C;  3EXN A;  4X3R A;  2LKP A;  4ZZD A;  3L00 A;  1RIO H;  1LUJ B;  1ELL P;  4RDU A;  4Y15 A;  5G21 A;  2DCE A;  2DMQ A;  2VQH A;  4XOP A;  3J81 K;  2DLL A;  1QQI A;  2PVW A;  1P7I A;  3SXN A;  4NB5 A;  2ZEP A;  4AIK A;  3K4M A;  3AG4 H;  2Y48 A;  5DM7 F;  1D0Y A;  5C44 J;  1RET A;  3IWZ A;  3ZMD A;  5DDG A;  4DNC A;  4UFW A;  2NS7 A;  3M8F A;  5IYB J;  3RI4 A;  1Q2Y A;  1HCR A;  4P55 A;  4XRS G;  2O6G E;  1IXR C;  2AFS A;  2Q4Y A;  2V8D A;  1DU0 A;  1P4X A;  4HX4 A;  5JI6 A;  4OIQ F;  1IO2 A;  5F08 A;  2I79 A;  4JYW A;  4IHM A;  1JKP C;  3GYH X;  3TCV A;  1QPI A;  3RYO A;  5K7F A;  4ZGY B;  2ZEM A;  1TQP A;  2IA2 A;  4LLN A;  1CP7 A;  2IVM A;  1QNT A;  2XPV A;  4ZZL A;  2DYS H;  5EBV A;  2XEI A;  3IH4 A;  4G12 A;  4CCJ A;  2P6S A;  1UHM A;  2R98 A;  2JN6 A;  3D7G A;  4BH9 A;  1IN5 A;  3CDI A;  4V2G A;  4G8X A;  4ZX8 A;  2ZXH A;  2BY2 A;  2DDA A;  1HDQ A;  2R7Q A;  4MCP A;  1OCO H;  3S15 J;  2EO8 A;  3S8P A;  4M3S A;  1VZ0 A;  1VGY A;  2YS9 A;  1ON0 A;  3LD2 A;  4X2T A;  2L9S A;  1ENH A;  3WC7 A;  1I1G A;  3BWG A;  2VKE A;  3J7Y J;  3JCU C;  2XRO A;  3DR6 A;  5CNP A;  5DCF A;  1TC3 C;  3BJA A;  3DLJ A;  3ELK A;  4JOM A;  1MND A;  4RGU A;  2HB6 A;  4D7M A;  3E0J B;  2QJ8 A;  2PJR A;  3J80 K;  4UV8 A;  4NF1 A;  2ARH A;  3EO4 A;  2GXG A;  3FXR A;  3P9C A;  5B66 C;  3SHP A;  2IJL A;  1F43 A;  2E5N A;  2HS5 A;  1FP2 A;  3G2B A;  2V1U A;  1JTX A;  5J1U A;  2GXB A;  4YWY A;  4I2O A;  5E3M A;  3HOS A;  1ZAR A;  3GTJ J;  4CHU A;  3HC7 A;  3WTY C;  1K7A A;  2OJE D;  2F8H A;  1HSJ A;  1YX5 A;  4CYN A;  3H1C A;  1SD6 A;  4AIH A;  2R7D A;  3EFA A;  3NE8 A;  5A27 A;  2QKM B;  3OYI A;  4OID A;  3IKT A;  4G1P A;  4CXF A;  3B2Y A;  4N9H A;  4HNT A;  4A39 A;  1JI8 A;  3ZQ7 A;  3MVP A;  5F0H A;  1BN5 A;  3CJR B;  3BR5 A;  3WTT C;  1KQ9 A;  3H9Q A;  3PQJ A;  4LG0 B;  3AL0 B;  3WAB A;  3NAR A;  1TQI A;  1P2F A;  2DI3 A;  5EEG A;  1R1T A;  4UWJ A;  1PUA A;  1SVM A;  2CQK A;  2V1D A;  3T5X A;  3UKG A;  3M3Y J;  3CCY A;  3F21 A;  1HQC A;  4YRV A;  1F2P A;  1CPX A;  2WPW A;  5HVG A;  1KWM A;  5AIP A;  4Q38 A;  4EFD A;  2V9P A;  1FPQ A;  2XPU A;  4KIC A;  4XKW A;  4WF2 A;  3FIX A;  1RES A;  4FBE A;  3R4K A;  1WWZ A;  5JVT A;  3OYM A;  2GM4 A;  1N78 A;  3MKW B;  4EGZ A;  4XLC A;  4EEF G;  2YGW A;  3EY5 A;  2GLF A;  3DU5 A;  2BHY A;  3FRM A;  2WTE A;  2V9V A;  3TO6 A;  2NRA C;  5FFX A;  2DPD A;  1DUX C;  4G7O F;  1P4W A;  2EIK H;  2IP2 A;  3V8I A;  3BZK A;  4G94 A;  4L0Z B;  1LOK A;  3ZQG A;  5JGF A;  2M1B A;  4DJA A;  2ATR A;  2HDW A;  3BI1 A;  3H9G A;  4KIT B;  2CV2 A;  3CC7 I;  1ZLI A;  2EFN A;  3I5U A;  4B11 A;  1MMA A;  3QYB A;  2E7W A;  5A28 A;  3NAU A;  3G1L A;  4AIJ A;  4U88 A;  4A6D A;  2P5V A;  2VJ5 A;  3LFU A;  1HKT A;  2GLO A;  4HW0 A;  1Y0N A;  3WTU C;  1BOA A;  3VYT B;  3H3Z A;  2B9S A;  4A3L J;  4HG2 A;  1MH4 A;  3H5A A;  3DKX A;  3W6S A;  3ZGK A;  2V6C A;  1A6Q A;  1QHG A;  1W36 D;  1ZRC A;  4CIC A;  4DIQ A;  4IHX A;  4MHY A;  1WPK A;  4WWV A;  5K5Q A;  1XIX A;  4C7I A;  1BW5 A;  3HOY J;  4UBR A;  2M34 A;  3S2D J;  2O28 A;  2LC2 A;  2NYX A;  4LQG A;  4OC2 A;  2E2H J;  3EC4 A;  2ZW4 A;  1R6R A;  2LG4 A;  1FMV A;  4KJZ A;  4BAY A;  2PCU A;  2BGC A;  3CXP A;  3OYB A;  4JJX A;  1ETO A;  5G22 A;  1I6X A;  2CSO A;  3HL2 A;  4UIB A;  2VZY A;  2GOX B;  3PB4 X;  2L54 A;  1I5Z A;  4DOZ A;  3CPA A;  4RMN A;  3D7D A;  3VOE A;  2FML A;  1I1D A;  2KIU A;  1WJD A;  2Z3M A;  3E1S A;  4FIS A;  5F47 A;  1U0J A;  1JQG A;  1WRJ A;  2O7O A;  5D5X B;  2LTP A;  4C3H J;  2QQB A;  4A3J J;  1LPQ A;  4XLP F;  3IU2 A;  2EV6 A;  1V5G A;  4BHB A;  4A12 A;  3TDZ C;  2EFW A;  2C6P A;  3FIS A;  1ZK8 A;  4CGP A;  2RGV A;  1N75 A;  1V3F A;  2M7A A;  3P2F A;  4MEY F;  1EV7 A;  3FZV A;  2EPF A;  5JFR A;  3HDD A;  2PJ2 A;  3HPH A;  2ZEO A;  3FED A;  5C3E J;  1HF0 A;  2ZXV A;  3HXL A;  4ZY0 A;  2HXI A;  2QYO A;  4BDY A;  2HQA A;  2FXA A;  4YIR X;  2M5W A;  2E1M B;  2JEW A;  3OS0 A;  5F48 A;  1ZG8 A;  1JJ8 C;  3GIU A;  2I8D A;  2VBW A;  2IA1 A;  3CZX A;  4FX0 A;  3F0C A;  2K86 A;  5E3L A;  3CCR I;  1LFW A;  2CY2 A;  1LRZ A;  3WC5 A;  3NWS A;  3V8L A;  2IA0 A;  2HYF A;  2LYC A;  4LIU A;  3TGN A;  3F22 A;  3D2P A;  4NSQ A;  4ZY2 A;  4E2A A;  4X8I A;  3K4C A;  1BO4 A;  1X2N A;  3RPU A;  4ZBG A;  4IHW A;  5HVQ C;  3OYA A;  2Q7S A;  2YNC A;  2LFB A;  1MBF A;  2PMH A;  4E7Z A;  4ZYQ A;  4FQG A;  2CWE A;  4F0X A;  5LHI A;  4P10 A;  3K7A J;  1REP C;  4P4D A;  4G6Q A;  4FX4 A;  2ZXI A;  3E7L A;  1WZ2 A;  4QC6 A;  4HF1 A;  2GZW A;  1VQ8 I;  3K4L A;  4ZTJ A;  4F52 A;  2VOO A;  3FNC A;  1H8A C;  4B12 A;  1UST A;  1YQE A;  4HQM A;  4E7L A;  3CJQ B;  3QOE A;  2MYS A;  2PG4 A;  2KL4 A;  2PJ4 A;  2L4M A;  2DT7 B;  5TRD A;  3RQ4 A;  3LNQ A;  4GYI A;  2D4P A;  5K8N A;  2VQL A;  1OCT C;  2ISZ A;  2V8H A;  1T0F A;  2XGX A;  1YTY A;  1YIT I;  4W97 A;  4XIC A;  3QNV A;  1X1C A;  1R9T J;  4A3E J;  3B6A A;  2W24 A;  3MKZ A;  4BE2 A;  4MMO A;  1XMT A;  2A5Y B;  1Y8Q B;  3B3C A;  4CGN A;  1LFP A;  5F09 A;  2NS0 A;  1D0Z A;  5HNH A;  3P9I A;  3H5N A;  1QZZ A;  3LMS A;  4YGO A;  1FOK A;  3SDG A;  2E2J J;  3KLO A;  1HKS A;  2ZJR F;  4MY3 A;  4I49 A;  4G6T B;  2HOT A;  2WY8 Q;  2PJ3 A;  4OIN F;  5E1Z B;  1X1A A;  2H8W A;  2FNA A;  4BXF A;  3JRU A;  2EH3 A;  3OOP A;  5M5Y J;  5FLV A;  3U21 A;  2BY1 A;  2B7E A;  1TWC J;  4BY1 J;  5IB9 A;  1IGB A;  1Y7E A;  3RKQ A;  2F6C A;  2LY9 A;  3K6G A;  4II3 A;  2R7F A;  3M9A A;  4B14 A;  1OJL A;  3BTI A;  2AQE A;  4CSW A;  2C6G A;  4K3N A;  2X6O A;  4KLW A;  3V4G A;  2FXF A;  1S3Z A;  4I99 C;  4OAZ A;  5JHF A;  5A2Q K;  3SFI A;  2KRH A;  5BPD A;  1W0U A;  1XGM A;  3DFG A;  4RS8 A;  3L1P A;  4XPK A;  1Q1V A;  3DKW A;  1AUG A;  2WZN A;  4AXV A;  4B10 A;  4IXA A;  3I9V 2;  3FXO A;  4I01 A;  5FRO A;  3BDD A;  3KP2 A;  3MWM A;  2Z2S B;  4O6J A;  2DPU A;  1Q2C A;  2IGN A;  5JLX A;  5E8G A;  5M5X J;  1F36 A;  1XMX A;  1NSA A;  2EK8 A;  3ZQC A;  4NGM A;  1MMD A;  2M3A A;  2V1N A;  2A6T A;  4XON A;  2F4M B;  1PDN C;  2M8E A;  2H09 A;  3IP4 B;  1ERD A;  3MRU A;  4HNU A;  3T8R A;  2NNN A;  4L5J A;  1EF4 A;  2UUZ A;  1YRE A;  5HS9 A;  3S1R J;  4IQ4 A;  5AIQ A;  2VON A;  2OQG A;  1NHA A;  4EJO A;  1IIC A;  3HKZ N;  3BQY A;  3I4P A;  2K3F A;  2DMN A;  3AG1 H;  2Q7B A;  5DD8 A;  5DYM A;  2Y75 A;  5C4J J;  3ABU A;  3M07 A;  3BJ7 A;  5KCM A;  2AE6 A;  2DPS A;  5J1Y A;  2VQG A;  3JRE A;  2X1D A;  3Q9S A;  2GAN A;  1YX3 A;  3O3K A;  1B4A A;  3EUK L;  1IUF A;  5GP9 A;  4ZDL A;  2YU9 J;  1QZY A;  3D66 A;  2FSR A;  4GXO A;  1IDZ A;  4OOI A;  1W5S A;  1P6R A;  2P5K A;  4KIG A;  3WOD F;  4BBH A;  2K40 A;  2OC6 A;  2A07 F;  3Q0W A;  1FIP A;  2IS2 A;  2ABZ A;  3FK7 A;  1OYI A;  2R7W A;  3HHH A;  1IN8 A;  1KON A;  1MGT A;  3W6K B;  1LDD A;  2GLJ A;  1Z1D A;  1B72 A;  2FE3 A;  3KEO A;  5IY5 H;  2VBY A;  1XMA A;  2JWT A;  4A0X A;  2RN7 A;  1PU9 A;  4K30 A;  2PQ8 A;  3H0D A;  2LR8 A;  4B8X A;  2DEA A;  1E3H A;  1JHF A;  3S9N A;  3EUA A;  3JRC A;  2VC0 A;  3PFE A;  4MBU A;  5HVH A;  1QSR A;  1ZG7 A;  2PRB A;  6PAX A;  3C2H A;  1J5Y A;  1VQK I;  3FHN A;  3ZR8 X;  3OYH A;  4A37 A;  3GUX A;  3ZMT A;  4PUS A;  1J09 A;  2Z99 A;  1J59 A;  1R57 A;  2BOL A;  2YX4 A;  5FB2 A;  2DJI A;  1Z2L A;  3DXJ F;  3GB0 A;  1VQ5 I;  1R5I D;  1G4D A;  3JTG A;  4A38 A;  4OC3 A;  2ESH A;  1TKH A;  2PMU A;  4KDP A;  3MZH A;  1IDY A;  4Y17 A;  1Y0Y A;  2BW3 A;  2XDV A;  2XAG A;  4CCO A;  4YG2 F;  2A69 F;  3W3C A;  1KU7 A;  3GTG J;  4MRI A;  3G3S A;  5F46 A;  4CA0 A;  3JRA A;  2HWV A;  2WC2 A;  1JT6 A;  2JPB A;  3RPQ A;  3BG6 A;  4AVP A;  3GME A;  1ARL A;  4A30 A;  4BE1 A;  2OH1 A;  1ETQ A;  2VI7 A;  5JPH A;  1YW9 A;  3MZ8 A;  1E3O C;  2EA4 A;  4MY0 A;  2KZG A;  4NQW B;  4EME A;  1U5T B;  2YNE A;  4UCP A;  4XL9 A;  4JXQ A;  3R61 A;  4OP4 A;  4D5F A;  1EH7 A;  1K78 A;  3ASN H;  5D29 A;  4IJA A;  2IJZ A;  3B8G A;  1OCR H;  4R8H A;  3G4S I;  1FYK A;  1MK4 A;  4PSX A;  3NH8 A;  2G7U A;  4ON0 A;  1W7P D;  3HUV A;  1V5E A;  2J8M A;  2DT6 A;  3ERM A;  1MDM A;  1IN6 A;  2ZBK A;  3HB9 A;  3QPH A;  4A5M A;  5HLG A;  4HF2 A;  3GY9 A;  2MH9 A;  1MBH A;  4XOR A;  2F5E A;  3S93 A;  3S1N J;  3OS1 A;  4RB2 C;  5KTA A;  4UEF A;  3E97 A;  2WB1 N;  1FWZ A;  5DCM B;  4H6U A;  4A3M J;  5K7Z A;  3BR1 A;  2EV5 A;  1JT0 A;  1D8K A;  2F4I A;  2VKH A;  4P4J A;  5AG6 A;  2R7S A;  3E6B A;  4KUA A;  2XRN A;  3MMY B;  4B5O A;  2HU9 A;  2EA2 A;  4LLL A;  2CW8 A;  4A6E A;  4L18 B;  3T0Y A;  1EKE A;  2FBK A;  2DTR A;  3RIR A;  5ELY A;  4MNU A;  1ORK A;  4LGW A;  2LY2 A;  3PFO A;  1SD4 A;  2AS5 F;  3ZQL A;  3B3S A;  2LBF A;  1WH5 A;  3X2Q H;  3VFZ A;  3GTO J;  2V79 A;  4AYB A;  1ARM A;  4KOW A;  1U6G A;  3GLL A;  4U0W A;  3IAM 2;  3FBU A;  2DXI A;  3QU3 A;  5LYD A;  4R9M A;  1M1E B;  3A01 B;  1YS7 A;  4UB6 C;  5CVU A;  3TO9 A;  5D5W B;  4WCG A;  4A93 J;  1ZEL A;  3BHX A;  3RKW A;  5JVG F;  1W5C C;  2K02 A;  3HJE A;  1SEU A;  2K85 A;  3VWD A;  1NK3 P;  3R1K A;  5ED4 A;  3UR3 C;  2W7N A;  2KDO A;  1MBJ A;  5EGO B;  5EG0 B;  1KA8 A;  2Y0M A;  1QSN A;  2LP0 A;  2XB0 X;  2Z3N A;  2PVV A;  1FYM A;  2BUE A;  4NQW A;  3EUH C;  1ULY A;  1PUF A;  4OWR B;  2HOA A;  3KR5 A;  3J80 Z;  4I02 A;  4AID A;  2G9W A;  3HGY A;  4BEH A;  3K70 D;  2X9D A;  4KSI A;  2JA6 J;  1XTA A;  3QOD A;  4XLE A;  1EH8 A;  3KAS A;  4NNJ A;  2BY3 A;  4PK4 A;  2LRE A;  4CGL A;  2XIG A;  4NHJ A;  4MTE A;  2Z0Z A;  1YW8 A;  4QLC U;  1QSM A;  4BKX A;  1ZAO A;  4KN7 X;  3FH4 A;  3PB6 X;  1OR7 C;  3ZP5 A;  2MSY A;  4LG3 A;  3K70 C;  3DR8 A;  1T8I A;  4XRF A;  3HKZ A;  2KLO A;  3K4B A;  1UAA A;  4QB9 A;  4NGT A;  1Y7R A;  3OS2 A;  3LFK A;  2PEX A;  2Z3Y A;  3BP8 A;  2PLY A;  1TKJ A;  3Q3S A;  2D5V A;  1DU6 A;  1CQT A;  5AGE A;  1U5T A;  2A05 A;  4AM3 A;  3KKW A;  4XKB A;  1OYY A;  3PEI A;  3S3N A;  4ZH4 F;  3GFI A;  1ZRE A;  4EJW A;  2KJB A;  2B3U A;  2HDD A;  2D4O A;  4KN4 X;  2HQR A;  1VQN I;  1M4D A;  1LQ1 A;  1Z4R A;  3QYE A;  2C1C A;  2IQ6 A;  3IAS 2;  1RUN A;  2B3V A;  2EFP A;  4IRI A;  2ZSH B;  2PR1 A;  1LDJ A;  2W00 A;  3REO A;  1APL C;  2ZCW A;  3CCM I;  2IGK A;  3LAJ A;  2JBJ A;  2Q44 A;  4M74 A;  1Z6T A;  1P92 A;  3SXO A;  1Z8X A;  3ZQQ A;  2X7B A;  2HGC A;  3BG5 A;  2ELJ A;  1ZG1 A;  2O61 A;  5AG4 A;  1UB9 A;  4OAE A;  4D0P A;  5GPC A;  3PUF A;  2Q2E A;  3CCJ I;  5HDN A;  2WWY A;  1UFM A;  2YSR A;  1T95 A;  4II9 A;  2VAS A;  2GOM A;  1PYV A;  4XLH A;  2ID3 A;  4RAF A;  4QTR A;  5IYC J;  4OAD A;  1LKX A;  2PDO A;  1BIB A;  3R9F A;  3QP6 A;  4D5C A;  2A6E F;  3E5U A;  4BGD A;  4BXU A;  4B6Z A;  3CQZ J;  4IQJ A;  3WGG A;  4CGZ A;  4I98 B;  2XGC A;  2VE9 A;  2EK9 A;  1RRJ A;  4Z2Y A;  2VUM J;  4LX9 A;  5FD6 A;  3SFZ A;  1R71 A;  2RV8 A;  2HR3 A;  3HTU A;  1OFC X;  3D7F A;  2COB A;  3ESW B;  1ZG5 A;  2KZV A;  4MLO A;  5FLM J;  3FJU A;  3CLQ A;  5TGT A;  3QP5 A;  4N4N B;  5KTC A;  1SMT A;  1WFX A;  2EIM H;  2HKO A;  1G59 A;  2ZFW A;  4CS0 B;  4ZYA A;  3F6V A;  4XLN F;  4LQ6 A;  1AA7 A;  4ESJ A;  3TO7 A;  1TT5 B;  4XKV A;  1E2X A;  3MEX A;  2FUG 2;  3DQV C;  1PP8 F;  5IT3 A;  1OCC H;  1YR0 A;  1YQA A;  1UHS A;  2ETH A;  1K4T A;  1KYW A;  1LCP A;  4AU7 A;  4BJT A;  1AOY A;  3I4M J;  5L3F A;  3LSM A;  4U0V A;  3JAM Z;  1B87 A;  1VND A;  1BJZ A;  4QSH A;  2G3A A;  3H5Z A;  1QO0 D;  5CVR A;  3R9E A;  2AFM A;  2V77 A;  5BPI A;  1FMW A;  4I76 A;  5CVJ A;  1DP7 P;  4DJL A;  3K10 A;  3OWT A;  3TT2 A;  3TX8 A;  1TW2 A;  2R7Z J;  3W6V A;  2CFO A;  3I59 A;  3W2V A;  3H8F A;  2F2E A;  2AFO A;  3S6H A;  5KHD A;  5IOZ A;  2GXA A;  2R93 J;  2AFU A;  4CCK A;  4CRY B;  3GFL A;  3ABM H;  4Z6Y A;  2OTL I;  4GDF A;  3WG7 H;  2NXN B;  3W6J B;  1BR4 A;  1TBX A;  4CGO A;  1RR8 C;  3N05 A;  4PQA A;  2MGQ A;  2Y30 A;  4MFZ A;  5ILS A;  1JJ6 C;  5FKK A;  2WPX A;  3VB2 A;  1IXS B;  4P6Y A;  4UUT A;  1RKT A;  4F3Q A;  4QUS A;  3OY9 A;  2QZ8 A;  3MN2 A;  1ZRF A;  2O03 A;  2FQ3 A;  2ZFU A;  3PJR A;  3K9U A;  1R1U A;  3JSO A;  1XF8 A;  5LHH A;  2PE3 A;  2C27 A;  3L2N A;  5IV0 A;  1WI3 A;  1GXQ A;  3HRT A;  3I64 A;  2A68 F;  3IL2 A;  2OOT A;  4BJ5 C;  2CW7 A;  2VOD A;  1IN7 A;  1MH3 A;  2LLK A;  5BMZ A;  3DPT A;  3CCL I;  2EWN A;  3CO6 C;  1AMP A;  3W6X A;  3EDP A;  1HXD A;  2OUM A;  4AWX B;  4WXD A;  4HRI A;  1IC8 A;  2QEC A;  4NC6 A;  3OSF A;  4N4O B;  4W9Y A;  2HQY A;  2CTB A;  2HI3 A;  2XAU A;  5I4M A;  5JM6 A;  1X1P A;  1VHO A;  1JUP A;  2H1L A;  3FWE A;  3FXK A;  4XR6 A;  4KT6 A;  2Q51 A;  4XN3 A;  1G3T A;  2GIZ A;  1R43 A;  1YYV A;  2GRE A;  3ZN0 A;  3G8W A;  5LYF A;  2QSG X;  5AG7 A;  2IS6 A;  3BZ6 A;  5J1Q A;  3GX4 X;  3HSF A;  3VSL A;  4IUS A;  4XLF A;  3SEQ A;  3VSK A;  2XAF A;  5HLH A;  1W7P B;  5HOO A;  4KYW A;  2ZPA A;  1HDP A;  2MAB A;  4FWU A;  1WGX A;  1XGS A;  2VIX A;  1HBX G;  2CIJ A;  3S2H J;  5HDK A;  5BWA B;  1GHE A;  4ZYD A;  3I3G A;  3OV8 A;  2RFH A;  3P9K A;  2ZOG A;  3K1M A;  1E3P A;  4WX9 A;  1XS9 A;  1IRZ A;  3FXT A;  4HPS A;  4L8A A;  3FXM A;  1I50 J;  4M3B A;  3HPG A;  4ZI6 A;  3M1C A;  2XKP A;  8CPA A;  2NAZ A;  4GCV A;  3DV8 A;  3U1D A;  3I58 A;  4RLF A;  5F0C A;  4BAC A;  1LB2 A;  2JQ7 A;  1BPM A;  4OIW A;  2DA7 A;  1XB4 A;  2PX9 A;  4LD5 A;  4RM3 A;  2FQ4 A;  4FHT A;  1LAP A;  3G3Z A;  3S9M A;  4A95 A;  3GFM A;  1R58 A;  1OLT A;  5LGN A;  4ZTF A;  1XRY A;  1XMK A;  2LNB A;  4CYQ A;  2NS8 A;  2VPR A;  4P4B A;  4P45 A;  2R8V A;  4O23 A;  4BQA A;  3HUG B;  3DGV A;  2K4J A;  3JTH A;  3MQ0 A;  3BJ8 A;  2ZXJ A;  5TIS C;  4UY8 I;  1V4R A;  4HKF A;  1HDD C;  3QPL A;  3Q5F A;  5KTD A;  2DK5 A;  1XSV A;  2FE7 A;  3TKY A;  2MLK A;  2XHK A;  3DWL E;  3VYR B;  5BS6 A;  3H36 A;  2B63 J;  3L09 A;  4Z65 A;  4I09 A;  4E0A A;  4B3X A;  2QIR A;  4P44 A;  2PIY A;  4HQE A;  4M9S A;  4YRH A;  3HOV J;  5EZG A;  1BC7 C;  2OQR A;  1Z91 A;  4M9X A;  2COM A;  4Q7A A;  4HV6 A;  1YGH A;  4XBF A;  4BY7 J;  4FT8 A;  4P1W A;  4IL6 C;  5ICG A;  1RTQ A;  4M3F A;  1YOV B;  3GW2 A;  4R3L A;  1VF9 A;  3FXQ A;  4KT5 C;  3B35 A;  2DW4 A;  3AKZ A;  4OKO A;  1M4G A;  3A0B C;  2B4D A;  3ABT A;  2BXY A;  4L5I A;  3ZXS A;  3KEY A;  1TF9 A;  3PB7 X;  3D2M A;  2HXO A;  5EEH A;  2KFD A;  2X6W A;  5J4V A;  4C2Z A;  3WGI A;  2GAU A;  3SI0 A;  3ONQ A;  3BQZ A;  2OU2 A;  1J9I A;  1QST A;  1G3W A;  3C3W A;  3TMO A;  4A3I J;  3S16 J;  4NGS A;  4YFK F;  1CX8 A;  3DF8 A;  1S7A A;  1XDU A;  3K4K A;  5EC4 A;  1SC7 A;  2EK5 A;  1HKQ A;  3NWT A;  1CGP A;  1H9T A;  2CV0 A;  5DS0 A;  5J47 A;  4R57 A;  2E7X A;  3LSK A;  2XVC A;  3IJ3 A;  2ICW G;  4Y49 B;  1IY7 A;  3HG9 A;  4KFC A;  5F04 A;  3W2A A;  1TIQ A;  1BAV A;  2NMT A;  5HDG A;  5HVF A;  3T1B A;  2ME6 A;  1W4M A;  1ONV A;  2IW5 A;  2W57 A;  3FMS A;  3KLN A;  3S6K A;  1MJB A;  3SQN A;  4U0Y A;  4MIM A;  2Q2E B;  2HZD A;  4KVM E;  2FNP A;  1S9H A;  1GV2 A;  2MC3 A;  4CAX A;  4KOY A;  1DTD A;  2ZME A;  1QMU A;  5ILU A;  4IHS A;  4AG9 A;  1XSX A;  1FOW A;  3CMA I;  1FY7 A;  2XSJ C;  3GVA A;  4M72 A;  5M5W J;  3N97 A;  3BG7 A;  4FD7 A;  1F1Z A;  5CJ9 A;  4LK0 F;  1IB1 E;  1ETK A;  5FGM A;  4B09 A;  4CAW A;  3GFJ A;  3R0J A;  3HEF A;  4R87 A;  5KK1 A;  4HDU A;  4OC5 A;  3GTP J;  2CXA A;  4F92 B;  3GUD A;  3FEE A;  4XSZ F;  3JSP A;  1IOI A;  3PNV A;  1UZC A;  4L89 A;  3PB9 X;  1Z5R A;  1FT7 A;  1E0E A;  2O5R A;  4U87 A;  3GWZ A;  5K8O A;  5J40 A;  2ADU A;  4YU9 A;  3E0K A;  3VWE A;  3E5X A;  4JBA A;  3MKL A;  2FVG A;  2X48 A;  3FF3 A;  4J3G A;  1RI7 A;  3KPH A;  1JE8 A;  1ACI A;  1AKH B;  3MAJ A;  3RJP A;  5H6Q A;  3SZG A;  2KKO A;  3I9S A;  1RC9 A;  2CUJ A;  4EGY A;  5E18 F;  2IS1 A;  4B48 A;  5L3C A;  1N25 A;  1Z7L A;  4F91 B;  3PFY A;  2VXZ A;  3JRD A;  1G2H A;  2JBK A;  3F0A A;  2WA0 A;  2O3F A;  3SI1 A;  2GQQ A;  5B1B H;  2YUS A;  1T08 B;  2GWR A;  3RDI A;  4J01 A;  2LF7 A;  1L0C A;  4NFR A;  2CQQ A;  2I5U A;  2CFX A;  5J4Y A;  1NE9 A;  3FB3 A;  2EIN H;  1ZG9 A;  4UF4 A;  1LFB A;  3FM5 A;  1YJ9 I;  4J19 A;  3W91 A;  1JKR C;  1QZE A;  5D6E A;  1JGG A;  3HLP A;  4GYG A;  1O3R A;  3BPV A;  3A9L A;  3CDH A;  3CD6 I;  1D1B A;  3HHG A;  3MKY B;  4BBR J;  4LUA A;  1YE9 A;  2BE5 F;  3H8E A;  1YW7 A;  2P8T A;  1MDM B;  4YFN F;  4E4H A;  2DMU A;  4PDK A;  3DEE A;  1UG2 A;  3TW6 A;  2FIA A;  2DFI A;  4WXC A;  1IXC A;  2CYY A;  4HA8 A;  4L9T A;  1A36 A;  3WHB A;  4JD6 A;  1GXP A;  5FO5 A;  2A3S A;  2Q0Y A;  4D9J A;  4BUP A;  3CP8 A;  4BQN A;  3OYL A;  1U8R A;  1KGS A;  2KRC A;  2KPM A;  2B58 A;  2Q43 A;  2G0E A;  4GRI A;  1QHH D;  3DBR B;  4MTD A;  2PI0 A;  2K5C A;  4BQQ A;  5E1X A;  4HNW B;  4JX4 A;  1H88 C;  2AFW A;  1IW7 F;  1VHS A;  3ISX A;  3DKY A;  1S5L C;  5FLX Z;  3Q9V A;  4XKC A;  3K2Z A;  1IAW A;  4NGQ A;  3EUH A;  1LVK A;  5DS9 A;  4A3C J;  2OCC H;  3BCB A;  2B4B A;  2ZJ2 A;  1Q1H A;  1YS6 A;  2X6Y A;  3A1Y A;  2VXD A;  1MD0 A;  4FAS D;  2B4D B;  4PK3 A;  3WC6 A;  1ZH5 A;  2X1E A;  3K2A A;  3P7N A;  4RB3 C;  1XG1 A;  4Y52 J;  3S32 A;  1B1B A;  2LY1 A;  2DTZ A;  3P5J A;  4PJJ A;  2PJR B;  2W85 A;  4S04 A;  3HOZ J;  1MW7 A;  1TLH B;  4DZJ A;  3QB8 A;  2R5Y B;  4O3M A;  3IUO A;  3OL3 A;  1P0H A;  4DBQ A;  1A6I A;  1FTZ A;  2VB6 A;  2VBQ A;  3VAR A;  5DM6 F;  2E1O A;  1R36 A;  1E17 A;  4OC0 A;  1X58 A;  3IKV A;  2IAI A;  2K9N A;  1IU8 A;  5K1Y A;  2R7X A;  1ETY A;  2M45 A;  3WTW C;  2OZG A;  1Y39 A;  3KZW A;  4OME A;  2L01 A;  3ECO A;  4Y13 A;  5K7H A;  1K61 A;  3LST A;  4CYO A;  2ZC2 A;  4IRG A;  5HOD A;  1DDN A;  2R7H A;  3FEC A;  1Z3X A;  4P4F A;  1Z7U A;  3WTS C;  4PJN A;  3EYY A;  4UV9 A;  4C2T A;  5K8P A;  2FA5 A;  2DQR A;  2X51 A;  2W25 A;  3JRF A;  3VH9 A;  3M7G A;  4FE4 A;  5E20 A;  1WHU A;  5GAG J;  1W36 C;  1POG A;  2VL1 A;  2ZME B;  1X3U A;  3BTC A;  4E70 A;  4MQV A;  1F5T A;  1FC3 A;  4HOB A;  3BXM A;  1AKH A;  1ZGJ A;  1MBK A;  4A32 A;  3KEQ A;  3PSF A;  5LEK A;  3NA6 A;  3SYT A;  4ESB A;  2E1C A;  1SAN A;  1Z8T A;  1Z4E A;  4JQF A;  4IKF A;  3KZI C;  5FRM A;  3I71 A;  3PL8 A;  3B6C A;  2G7H A;  2QVO A;  3I56 I;  3HSE A;  1SFO J;  1B8I A;  2HVS A;  3KHZ A;  3HIF A;  4RGX A;  4A0Y A;  5LRR A;  2UZK A;  3M1E A;  4JXR A;  4F9U A;  1GYT A;  5LD2 C;  1OPC A;  2POK A;  2IRF G;  4UVC A;  3D1N I;  4CPA A;  2F5V A;  1T39 A;  1MZB A;  2CF4 A;  2DOD A;  4O5V A;  3O6B B;  2CRG A;  4MO7 A;  4CUG A;  5LEJ A;  2Z3P A;  4FAI A;  4JWP A;  1R5H A;  2M4K A;  1YLE A;  1KU9 A;  4PK2 A;  4ASN A;  4UCN A;  4M6X A;  4GO1 A;  4PJM A;  4KZT A;  4BJ6 C;  1WVR A;  1U2W A;  2BL1 A;  1PUF B;  1WSU A;  1C0W A;  4UNO A;  3FXJ A;  2QQ8 A;  1IZ1 A;  1YO5 C;  1SMY F;  3DU6 A;  4PZJ A;  4I7H A;  4AVZ A;  3WU2 C;  4MHN A;  4RAG A;  4ZYE A;  4NGP A;  1O3Q A;  3K1P A;  2WV1 A;  3S1Q J;  1R3N A;  3BR2 A;  5DWM A;  2VQC A;  3SZT A;  3CJN A;  2R0Q C;  5GPA A;  2YNC C;  2W84 A;  3PBB A;  2JK3 A;  3CJT B;  2GU2 A;  1JUS A;  5D5U B;  1GVJ A;  4HEA 2;  1MIJ A;  2Z5U A;  3FKI J;  1YW4 A;  3FMQ A;  3TTH A;  5IT9 K;  2L9V A;  1SFK A;  2Z9O A;  1K4S A;  3NE7 A;  3AG2 H;  3OYE A;  2I3C A;  4F55 A;  2PJ7 A;  2ID6 A;  2BHZ A;  7CPA A;  2PBI A;  3GEZ A;  3IWF A;  1K6Y A;  2M2E A;  2LBF B;  1Z0X A;  4PJL A;  3QRF F;  1X3Z B;  3H35 A;  2D45 A;  3A03 A;  2IMO A;  1K79 A;  1OZP A;  1TP4 A;  1TTY A;  3H8G A;  4PXE A;  4PGH A;  2O9L A;  3WTV C;  1V5F A;  5CQE A;  1O57 A;  1IN4 A;  1B59 A;  3RSN A;  4G7Z F;  2FL4 A;  2EBJ A;  4IF5 A;  4L0Y B;  3L2W A;  2ZW7 A;  4EV0 A;  3MCZ A;  2KT0 A;  5FLX K;  5JR3 A;  3CTA A;  3WU0 A;  4HNX B;  1XE4 A;  4XN0 A;  5GAE J;  3MD2 A;  3IWE A;  2EB7 A;  5K5R A;  1VTN C;  3ZJ0 A;  1MMS A;  1ZTR A;  5KAI C;  1YI2 I;  1FNN A;  2G0B A;  3L2U A;  2AHQ A;  1Y56 A;  1QVT A;  2YU3 A;  4C9Y A;  1A35 A;  2EZH A;  2JSC A;  4BDZ A;  1XDS A;  1B9M A;  2REE A;  1X12 A;  2QF7 A;  5E3N A;  3VOD A;  3D68 A;  4H89 A;  2YX7 A;  1TQM A;  3BPX A;  5IT9 Z;  2JLM A;  3K2K A;  4WJB A;  3JAM K;  2X6X A;  1CPS A;  5H84 A;  1SAU A;  5JLW A;  4F8Z A;  2ZNY A;  1HOM A;  4M85 A;  4C2U A;  2XF5 A;  3KR4 A;  5ISV A;  3IH3 A;  4UCM A;  1IID A;  3D8P A;  3QPT A;  1QPM A;  1K4J A;  2FIW A;  1IV6 A;  1JXS A;  1YK3 A;  3TP0 A;  4M6V A;  3RZD J;  1Z05 A;  2HFH A;  1IOF A;  2OF7 A;  3N5F A;  5F0F A;  2PFB A;  3HZJ A;  2CUE A;  1I39 A;  2IGO A;  3BCA A;  4KOX A;  4PPZ A;  3TW7 A;  3WE2 A;  4GXH A;  3GF2 A;  3PIO F;  2XKO A;  4B4C A;  4RI1 A;  5K8M A;  2MFZ A;  2BY0 A;  2WBM A;  3ZRG A;  2CW0 F;  2DA4 A;  5J3L A;  1IYL A;  1ZGW A;  4NEX A;  5DCM A;  1WKM A;  4M73 A;  1LEB A;  1BPN A;  3IGR A;  3BT9 A;  2EJR A;  1HW5 A;  4B44 A;  1PJR A;  4R8F A;  1G8X A;  4GS4 A;  4LIV A;  5CQG A;  1UCR A;  5E79 C;  1AHD P;  1ITY A;  1P4A A;  2E1M C;  1X10 A;  1UEL B;  1N71 A;  4XRS A;  1NG7 A;  1QGP A;  4KOV A;  1JTY A;  3IC7 A;  3T8T A;  3IIB A;  3FYN A;  6CPA A;  2RDP A;  3LA2 A;  4TNU A;  2M9H A;  2JUC A;  2TDX A;  3MGD A;  2P7V B;  4B3A A;  2AO9 A;  2O4H A;  1W1W E;  3IHU A;  2W48 A;  4Q48 A;  3RQI A;  1OYW A;  1W0T A;  2L02 A;  1BC8 C;  2IS4 A;  1D8J A;  4RN7 A;  3UY5 A;  1MSF C;  1MMN A;  2W1O A;  1UWY A;  3DTI A;  3PNY A;  2V9K A;  2CNM A;  3LQR A;  4Y4R A;  3LAP A;  2AJ6 A;  4Q36 A;  1S7N A;  3WR7 A;  4ANJ A;  5J1R A;  3KYD B;  4UIA A;  2HEO A;  2NNY A;  1FZP B;  1P4N A;  3CCV I;  2XAH A;  4H4K C;  4R1H A;  2Y9Z A;  1WJF A;  1V54 H;  4J00 A;  3H3V K;  5E3O A;  1FEX A;  1LAM A;  2XAS A;  2JEV A;  3CUQ C;  2M0M A;  2QM3 A;  3M8J A;  1O3S A;  3MN8 A;  2KHM A;  3CMM A;  3NH5 A;  2M30 A;  1H0M A;  4QWQ A;  3FXL A;  2OBP A;  5HS8 A;  2DBB A;  2R5Y A;  4ONW A;  2W4S A;  3R0A A;  1I1S A;  4A3G J;  3IV5 A;  4OIP F;  5FKM A;  1VQ6 I;  3WTX C;  2R1I A;  1QRY A;  1H89 C;  4UVB A;  3K9T A;  3BZC A;  4IRH A;  3RTR A;  2DPT A;  3S17 J;  4N0B A;  3FXU A;  5ICF A;  4EM1 A;  4LB5 A;  4E7S A;  2QQ9 A;  3DNS A;  3BLN A;  2QBY B;  3FMC A;  2ZJP F;  1U3E M;  4XOT A;  5K5O A;  1CP6 A;  5CYV A;  2ZW5 A;  4AD9 A;  5J8F A;  4RAZ A;  4WK8 F;  1U8B A;  2CS3 A;  2PRQ A;  1S5K A;  4QBJ A;  4XK4 A;  1CJW A;  2DA5 A;  2P4W A;  2Y2Z A;  2Z1D A;  1HC8 A;  1GVD A;  4II2 A;  2XC7 A;  1K6O A;  2ZO4 A;  1R49 A;  4UEE A;  1ZLH A;  2BBY A;  2ELK A;  4MFP A;  3LSJ A;  3CF5 F;  2LKS A;  1OCP A;  4RB1 A;  2CGP A;  2AQF A;  4RUH A;  1RXT A;  4KMU X;  1BI1 A;  2ZNZ A;  2VOP A;  4G9Y A;  4P4I A;  2B5G A;  3U9G A;  3KL9 A;  3N7Z A;  2QQA A;  5KVR A;  2R5Z B;  4MGR A;  1O7L A;  2NVU B;  3D7H A;  3ZMV A;  3LSG A;  1Q2D A;  1Z3Y A;  2M87 A;  2NYQ A;  3E6M A;  2AXL A;  1G3Y A;  2NVY J;  3BRO A;  3HBL A;  3I0T A;  5E96 A;  5D8K B;  4EVY A;  5E17 F;  4HSR A;  3S14 J;  2DA2 A;  2HPI A;  2XEG A;  2EV0 A;  5EJC A;  1AWC A;  4PFO A;  4P96 A;  4CCN A;  4JP0 A;  3BOQ A;  4AC0 A;  3OYK A;  4OC1 A;  3GYA A;  1S29 A;  3F8F A;  2XSD C;  2P6T A;  5IYD J;  3TE4 A;  4MFJ A;  1IJW C;  2VJI A;  4ENM A;  2LF8 A;  3CUO A;  1S72 I;  1TWG J;  2K27 A;  1BI2 A;  3DBH B;  4M3G A;  4DQ2 A;  1AYE A;  1QSO A;  2Z3L A;  2PR8 A;  5IP7 J;  1WH7 A;  4Q47 A;  1GDT A;  4QPQ A;  5DUI A;  1Z77 A;  4XPL A;  4R6T A;  4UA3 A;  2A61 A;  1J0R A;  3DBL B;  9ANT A;  3I54 A;  4ZX9 A;  5EG0 A;  2DU9 A;  5EGO A;  3SJE A;  1X1B A;  2JVH A;  4C2Y A;  4NUB A;  4CZZ A;  5KNL A;  2CQ7 A;  3RBU A;  3C2G A;  1ON2 A;  3I53 A;  4KIS A;  2A4N A;  1SQH A;  1I27 A;  1Y9W A;  3G71 I;  1XPX A;  2E34 A;  3KI9 A;  3CUQ B;  3JRB A;  4F0Y A;  2P7C B;  3SJF A;  4U9Y A;  4RA2 A;  1EJ9 A;  4A0Z A;  4E6K G;  1CF7 B;  1U5T C;  1XCB A;  1RZ4 A;  3DLA A;  1M4I A;  2OZH A;  3JRI A;  3QPS A;  3IWW A;  5C4X J;  4R79 A;  1Z9C A;  1CG2 A;  1HW2 A;  4MFD A;  4NC8 A;  2DXQ A;  1WK4 A;  5D6F A;  3BG9 A;  4YIF A;  4A5N A;  1OR7 A;  2W82 A;  1KZH A;  2DA1 A;  3RPU D;  4R3K A;  1BIA A;  2WY7 Q;  4G6D A;  1GHC A;  4D7N A;  1FBQ A;  2DYR H;  2ECC A;  3ABL H;  1KUX A;  2IL4 A;  4JX5 A;  3IWG A;  3HM5 A;  1ZLJ A;  5CPR B;  2CUZ A;  3QAH A;  3OIP A;  1T33 A;  2YR2 A;  2P6E A;  4KOU A;  3KP5 A;  1IRF A;  5CLS A;  4D1Q A;  4FD4 A;  2BO9 A;  2HVQ A;  1HW1 A;  1GLN A;  3SHF A;  5FJ8 J;  3IEH A;  4XID A;  2HYG D;  1U9N A;  2B0L A;  1J7K A;  2KDZ A;  2XF6 A;  1RPW A;  4X1E A;  1JKQ C;  4PGG A;  3LMM A;  2QSF X;  5GTI C;  2PJP A;  2CNT A;  1VI0 A;  2QYV A;  3R95 A;  1U9O A;  4PFP A;  2DN0 A;  1DPU A;  3HRU A;  3CXQ A;  2ZSI B;  1H9G A;  3B7I A;  4HST A;  2M0C A;  5DUK A;  1BI0 A;  3PBE A;  2VXK A;  5DD4 A;  3BTL A;  3O8G A;  3OYF A;  4A3B J;  3K4N A;  4NJR A;  1NG6 A;  5TJJ A;  4L9N A;  3PB8 X;  2PMZ A;  4PXB A;  4ETS A;  1TT0 A;  2MG4 A;  2VBZ A;  3EPZ A;  4HAM A;  1G3S A;  1X1D A;  3J7A Y;  3LA3 A;  1L0O C;  3ZOB A;  3HOW J;  3S9L A;  1QA6 A;  3CO7 C;  4A33 A;  4KUM A;  4EQQ A;  2IEK A;  3RZA A;  3UNG C;  2R7T A;  3J7Z I;  3BJO A;  3CCU I;  5L3D A;  1S6L A;  4BMH A;  4AVB A;  2OV7 A;  2ZEN A;  4ZDO A;  3PQK A;  3WGH A;  5E8I A;  3CC2 I;  1FNO A;  1WJB A;  2Q4Z A;  4BL0 B;  4Q4Z F;  1DGR M;  3KIO A;  2JRT A;  3OYD A;  3J7A O;  2H8R A;  2VEZ A;  4U7D A;  2JSP A;  2EFQ A;  4HX7 A;  4P5O A;  4UFX A;  1CBX A;  5EZH A;  5D5V B;  5BQT A;  5JQ4 A;  3ISP A;  3TOA A;  3OR1 C;  3RYP A;  2VE8 A;  1I3Q J;  5H20 A;  2JA8 J;  1YSJ A;  2G9D A;  5B5E C;  2Y9Y A;  4LIT A;  4IZZ A;  4LB6 B;  2FF4 A;  1Q7L A;  2WYR A;  1TKF A;  3I1U A;  2PJ9 A;  4IOC F;  2F5F A;  5FRN A;  5ERI A;  4F7Z A;  5G1Z A;  1BM9 A;  2JZY A;  2RNG A;  1X3W B;  4BHP A;  1M1D A;  4YFJ A;  2FRH A;  3OR2 C;  2R7V A;  2CTC A;  4KSF A;  2K7L A;  5F1J A;  1A04 A;  4X0G A;  1YRN A;  4V2F A;  3JRH A;  3CZ6 A;  3COA C;  2HOE A;  2OD5 A;  2L7F P;  2VT2 A;  3V7Z A;  1TNT A;  1VHE A;  3L2V A;  4FD6 A;  1XMB A;  2XGE A;  4OIO F;  1DQU A;  2G3T A;  4M6G A;  2NOJ B;  4EVI A;  2TRT A;  3ERE D;  2V4J C;  4NDL A;  3U2R A;  3RKX A;  4U9Z A;  1IG7 A;  2J5P A;  1B9N A;  2EIJ H;  5M3F J;  3SJM A;  3S1M J;  1IUY A;  1TWF J;  2MD5 A;  4L9J A;  4XQF A;  1F4K A;  1GUU A;  2OCE A;  3SXY A;  3DLL F;  1ZRD A;  2RQQ A;  4ORF A;  2H6B A;  4BS9 A;  1HLV A;  2ZEL A;  3D0S A;  2E5Z A;  2O53 A;  1R1V A;  2L9R A;  4YEJ A;  5ICC A;  3S6G A;  4I0A A;  4BHC A;  1SAX A;  2DAO A;  3LOC A;  1GV5 A;  4CGM A;  3FVL A;  5L3E A;  2Z3K A;  2EFO A;  3TC8 A;  1SFX A;  3IH2 A;  2QCO A;  2ODF A;  1Y0U A;  3A0H C;  4A31 A;  3R60 A;  5IB0 A;  2FSW A;  4A3F J;  4MHP A;  2F5C A;  1F57 A;  3ZMU A;  5E1W A;  2PJ8 A;  2DA3 A;  3BR6 A;  3V8K A;  1XSD A;  4MFK A;  2ZJQ F;  4MHG A;  3T8W A;  2K9L A;  2GA2 A;  2PJC A;  1P9Q C;  1ZGA A;  2E60 A;  4OMZ A;  3V7R A;  4IK2 A;  3GZ6 A;  1T38 A;  1B8I B;  3RAM A;  1PUE E;  2CH0 A;  3O8H A;  5GAD J;  1ZO0 A;  2OAZ A;  2JJ7 A;  3CUQ A;  3WTZ A;  1D5Y A;  1XCV A;  2Q8K A;  1STZ A;  4C30 A;  1X19 A;  3QYF A;  3CME I;  1U6M A;  5LYL A;  2VBX A;  4ZYG A;  4MCR A;  2WV0 A;  1WJA A;  4NGR A;  4XPD C;  4MJ8 A;  2BEO A;  3D5L A;  1K83 J;  1M44 A;  2PJ5 A;  1X4P A;  4DUK A;  2C6C A;  3FM3 A;  1J4J A;  2OZU A;  4DYR A;  2V8G A;  5CVV A;  3DEW A;  4OC4 A;  3WG9 A;  2XEF A;  5LYI A;  2Z3O A;  4WWC A;  4M3D A;  4H0E A;  2EWB A;  3LWU A;  2VI6 A;  3H5R A;  3P2H A;  1RNL A;  3F8K A;  1TNS A;  1WJ5 A;  5LGU A;  1A2Z A;  3FDY A;  2F5I A;  2FMY A;  3HRS A;  3G1O A;  1LFU P;  3VYS B;  3C26 A;  2HV2 A;  5M3M J;  3BJ6 A;  3K69 A;  5F27 A;  2GA1 A;  4MFE A;  4A3D J;  4WXH A;  3S3M A;  4R7M A;  2RVC A;  5J6X A;  2Z10 A;  3QAY A;  1KYZ A;  4HLY A;  4E7J A;  1VQM I;  1FTT A;  4IVN A;  2PJ6 A;  2MD0 A;  2EUI A;  3PRT A;  5LGT A;  1MBE A;  2CMP A;  1QU3 A;  2NVT J;  5FD5 A;  4QPO A;  2UXX A;  4C7H A;  3TOB A;  2HYJ A;  2IXS A;  1D1A A;  3FF5 A;  2JDD A;  1I6H J;  4RBO A;  5HMN A;  2R4G A;  1BR1 A;  2WAQ A;  4W1U A;  1YHQ I;  1A5J A;  1FT9 A;  3C2B A;  1FX7 A;  3LSR A;  2VZZ A;  1Z8L A;  2WAE A;  4CAE A;  2H94 A;  2RRE A;  2RNJ A;  4M9Z A;  4YII A;  3VEP A;  2DDB A;  3ZMS A;  1XD7 A;  4Y7N J;  4OU0 A;  2ISY A;  1VIX A;  2Y0S A;  3V7C A;  4BD9 A;  1BA5 A;  2L9N A;  1O3T A;  4C2X A;  2XRL A;  1LDK B;  5D4S A;  3HRM A;  1S60 A;  2AFX A;  3NH4 A;  2V7F A;  2L7K A;  2Z16 A;  4RB0 A;  4UUV A;  3LQQ A;  2HQN A;  4KOR A;  2Y69 H;  3GTL J;  3ZN1 A;  2DFF A;  3MZY A;  3TED A;  4IO9 F;  3R96 A;  5CVI A;  2LH9 A;  2FOW A;  4PCQ A;  4JZ0 A;  1VQL I;  4GFB A;  2OTJ I;  3DEU A;  1FBS A;  1WQ2 A;  2J5O A;  4LOC A;  2V6E A;  2EVN A;  2VKD A;  4H2K A;  1U78 A;  4HV5 A;  1FBU A;  4HBL A;  1DPR A;  3OYC A;  4ZY1 A;  4HX8 A;  4XNH C;  1DP3 A;  2X4H A;  3VYU B;  1LNW A;  4P9F A;  2IGM A;  4Y3O A;  2Y31 A;  2MLG A;  3ZQI A;  4C2M J;  3HYI A;  4RM2 A;  4NJQ A;  4LMY A;  4LG0 A;  2HC9 A;  1R4N B;  1JHH A;  2X1C A;  2PJ1 A;  1ETW A;  4LLG F;  4IAV A;  4KS9 A;  1SFU A;  3DPU A;  1S7L A;  4F9V A;  1W5T A;  4ZC3 A;  2KCW A;  1MJ9 A;  2O8K A;  2R7U A;  2PC1 A;  4NGN A;  3ABK H;  4BQO A;  5GTH C;  5C88 A;  5CBM A;  2ELH A;  2J8N A;  3KZZ A;  3JUW A;  5LRS A;  2F4O B;  4KIF A;  3CDL A;  4RAY A;  1ELM P;  2BCO A;  2LKX A;  1ON1 A;  3W2W A;  1VFC A;  3D4U A;  3LSI A;  3DSB A;  1KU2 A;  1BW6 A;  3SJG A;  2EZK A;  4BXX J;  3PGP A;  4BYY A;  5F49 A;  2DJN A;  2KJC A;  1OCZ H;  4P9U A;  1PP7 U;  5H2F C;  5I0C A;  3KX2 A;  5FKL A;  2JT1 A;  4BBS J;  4PXC A;  4HZF A;  1PVE A;  4M3E A;  2X0L A;  3ZMZ A;  4MXU A;  5EDN A;  4CRZ B;  4E8O A;  4A3K J;  1YME A;  3L7W A;  3ML6 A;  3KHX A;  1Y0R A;  3TBI A;  4Q5S F;  3KP6 A;  3PSI A;  1LAN A;  3B3V A;  3H92 A;  5ICE A;  2FEZ A;  2JPC A;  3KYC B;  2PSW A;  4M6I A;  3PUB A;  2L5Q A;  1Z67 A;  4RGS A;  1ZKG A;  1QVU A;  2XAQ A;  4MQ9 F;  2FJ1 A;  2QEN A;  2ECB A;  2JA7 J;  3U1K A;  5ILV A;  1YLO A;  3B3T A;  3BY6 A;  2UWM A;  4MHZ A;  2DFH A;  2P5L C;  3MFK A;  3OSG A;  1T2K A;  4NBQ A;  1VQ4 I;  2OA4 A;  1W7P A;  2K9M A;  5EEA A;  1YVO A;  2VQY A;  4FD5 A;  2Q0O A;  3NEU A;  4HF0 A;  2K4B A;  4B13 A;  2ZEE A;  2C6Y A;  3KP3 A;  3VAT A;  2I10 A;  2XF7 A;  3TDU C;  3CF2 A;  1S7F A;  3OYN A;  4RLQ A;  3A2K A;  3CMY A;  3K0L A;  1ETX A;  4XNF A;  2LOO A;  1KUY A;  2WSA A;  5HS7 A;  3RO0 A;  4YEL A;  1D3Y A;  2KIS A;  1D1C A;  3JRG A;  3L2C A;  2J9A A;  4ONU A;  2DO7 A;  2ANP A;  3T90 A;  1RUO A;  2WAQ N;  4Y49 C;  4BIN A;  2RQP A;  1EE3 P;  1USS A;  3V7S A;  3D3S A;  2K3P A;  1NH3 A;  2LD5 A;  4NXY A;  1ZQ3 P;  3H9J A;  2JDC A;  3PM1 A;  3WHC A;  3NFZ A;  3CPX A;  3KQX A;  5DTD A;  4ENJ A;  3B02 A;  1CF7 A;  2HTJ A;  1IYK A;  1Z9U A;  5HH1 A;  1T6S A;  5BNG A;  3JR9 A;  2V1X A;  1MJA A;  2XGD A;  1Y1W J;  4KIB A;  5F64 A;  3ZCO A;  3B3W A;  4HDV A;  2OPT A;  2XAJ A;  2KIM A;  5D8L B;  1SD7 A;  4KNY A;  1OIS A;  3F3X A;  3F8C A;  1XOV A;  3LAC A;  4DYO A;  2RKH A;  2QKL B;  1S7E A;  3K1N A;  3PZJ A;  2PN6 A;  1MKM A;  5F6F A;  1ODD A;  4EMS A;  1A31 A;  1Z8W A;  3Q0V A;  2ZOF A;  4JLY A;  4S05 A;  3TFY A;  2NVX J;  3FBI B;  2Q4V A;  2E35 A;  3G73 A;  5THW A;  2XB5 A;  2H27 A;  1S8N A;  3F9K A;  4ZJZ A;  3HSR A;  2HNH A;  5FVJ A;  3BC8 A;  2KIQ A;  1QQ9 A;  3O2P E;  5LLQ A;  3KCC A;  3SI2 A;  2MA3 A;  1EA3 A;  3KP7 A;  2IPQ X;  5CKT A;  2L2O A;  3ASO H;  2HOS A;  2BV6 A;  2D2W A;  2I00 A;  2ZEH A;  1IF1 A;  1N77 A;  4EM2 A;  2REF A;  2ZW6 A;  2BVM A;  3IC1 A;  3M4O J;  4PV6 A;  4UHT A;  3Q0U A;  5LFA A;  1UHW A;  4EJU A;  1JUM A;  3C7J A;  4CZC A;  3OOU A;  1ZR4 A;  1IRG A;  4AVA A;  3V42 A;  2FBI A;  1IGN A;  1KQ8 A;  3QQA A;  2JA2 A;  4TWE A;  3A02 A;  1K78 B;  3BG3 A;  3PO2 J;  2AFZ A;  5GCN A;  1LEA A;  2TCT A;  4X5K A;  3ZQF A;  4IEJ A;  2VC1 A;  4KA4 A;  3A4C A;  4XSX F;  1ZYR F;  3H3U A;  2L4A A;  3ZQH A;  4EJT A;  2NSM A;  2F48 A;  4IPA A;  2P0W A;  2H6C A;  1RKW A;  3E6D A;  2FX0 A;  5IP6 A;  3ROU A;  2QGU A;  2VLA A;  1I21 A;  2E19 A;  5DEQ A;  1X2M A;  4B47 A;  3J81 Z;  1HA8 A;  1XJO A;  2CO5 A;  3JTK A;  4ENK A;  2CNS A;  3GTM J;  1XBU A;  2KIF A;  3IFE A;  2K5T A;  5EMI A;  1V55 H;  2DF5 A;  3KP4 A;  3FK6 A;  3GZN B;  4CCM A;  1XGN A;  2MBF A;  1ETV A;  1ZG3 A;  1PYT B;  2OB0 A;  1H8L A;  1T56 A;  5JHU A;  4CYC B;  1P7J A;  2OR4 A;  4ABZ A;  3L2Q A;  3VPR A;  3HOT A;  3ECH A;  1D0X A;  3S2W A;  2DMP A;  2WB1 A;  4U5Y A;  4E7K A;  4UWI A;  2ZKZ A;  3AFH A;  2BYV E;  1YIJ I;  2VT3 A;  2ZED A;  1X4O A;  1KZF A;  4Y33 A;  1MNM C;  3IU1 A;  4A94 A;  3PNT A;  1BJA A;  2R92 J;  2A5W A;  3HOX J;  2FD5 A;  3QWL A;  5A2Q Z;  2HUZ A;  5HXD A;  4EWT A;  1YW6 A;  4IX7 A;  1LE8 B;  3QOP A;  1VQO I;  4QIW N;  3BI0 A;  4QVT A;  2R5Z A;  3GZ5 A;  5FFZ A;  2HDC A;  1WJE A;  2AXT C;  1YVK A;  5DV5 A;  2K9Q A;  4NC7 A;  2CUF A;  4CYP A;  2EBI A;  1T98 A;  2H5M A;  2KMU A;  2F7V A;  1B72 B;  3PP9 A;  1YX0 A;  5FKO A;  2Q04 A;  5C82 A;  4K2E A;  4XM3 A;  1TWH J;  2ZB9 A;  4XNH B;  1TF8 A;  1AU7 A;  2ME0 A;  3HUG A;  5BOX A;  4MFQ A;  3PFI A;  2E2I J;  2FS5 A;  4IF4 A;  2PJA A;  5LRG A;  3DCF A;  3M8E A;  2ZEG A;  1SFE A;  2R3S A;  4B43 A;  1FP1 D;  3RYR A;  5D4R A;  1UFH A;  3H4Q A;  1YJW I;  5CPA A;  3RCO A;  2JRM A;  4CYD A;  3OYG A;  1XX5 A;  3PO3 J;  4KMF A;  4FTH A;  2K9S A;  1ZHF A;  1XEB A;  3CES A;  4ITV A;  4XLA A;  1FOX A;  2BSW A;  1L3L A;  3R6S A;  1UMQ A;  2DMT A;  3OIQ A;  3L2R A;  2QEX I;  3D67 A;  4YFX F;  4DGW B;  3B73 A;  5IP9 J;  1F9N A;  2F5D A;  4H6Z A;  1LVA A;  2CQN A;  3LA7 A;  1VQP I;  4KOS A;  4CH7 A;  3AG3 H;  3KET A;  1MSE C;  1BBY A;  2CG4 A;  3ZPL A;  1BR2 A;  2DOF A;  4IHV A;  1HST A;  3KGQ A;  5LBQ A;  4HPQ A;  2DOE A;  1HEE A;  1ZN2 A;  4OMY A;  4CO8 A;  3E3V A;  3CT9 A;  4A2U A;  4OAY A;  1MNE A;  3DTK A;  3I55 I;  4LJZ F;  1OBR A;  5AG5 A;  2EIL H;  2XV4 S;  4OIR F;  2LSO A;  1TL8 A;  3GLX A;  5B3S H;  5D8N A;  2CQX A;  3EQL F;  2NVQ J;  4CCL A;  3WU1 B;  2M8G X;  3E6C C;  4AVC A;  5GAH J;  3T9Y A;  4DZP A;  1KUV A;  3N4M A; 
#chains in the Genus database with same CATH homology
 1M4G A;  2KP6 A;  2B4D A;  4I49 A;  2MC4 A;  2WAD A;  3ZZI A;  2GIV A;  1KUX A;  4G6T B;  2WY8 Q;  3ZXS A;  3KEY A;  2IL4 A;  3IWG A;  3D2M A;  1X1A A;  5J8C A;  4BXF A;  2X6W A;  5CPR B;  4C2Z A;  2CUZ A;  1CM0 A;  3OIP A;  2P6E A;  3QAH A;  4KOU A;  3U21 A;  3ONQ A;  2VJJ A;  2JVG A;  2OU2 A;  4D1Q A;  1QST A;  4FD4 A;  2HVQ A;  3TMO A;  4BU2 A;  1GLN A;  3LSH A;  2F6C A;  3K6G A;  4II3 A;  3K4K A;  5EC4 A;  3NWT A;  3SDB A;  4C2Y A;  2XF6 A;  4B14 A;  2CV0 A;  4R57 A;  2AQE A;  2B5G B;  2VL8 A;  3LMM A;  4CSW A;  3LSK A;  2CNT A;  4NF1 A;  4Y49 B;  4KLW A;  3R95 A;  3HG9 A;  4PFP A;  2FXF A;  1S3Z A;  2YGW A;  4OAZ A;  5JHF A;  3W2A A;  3KYL A;  1TIQ A;  3CXQ A;  2KRH A;  2ZSI B;  2NMT A;  4XPK A;  4HST A;  2P6F A;  2HVR A;  2RC4 A;  3S6K A;  4B10 A;  1MJB A;  4BE0 A;  2VXK A;  2Q2E B;  2HZD A;  2Z11 A;  4KVM E;  1DGW Y;  3I9V 2;  3OYF A;  3K4N A;  5FRO A;  1NG6 A;  1S9H A;  2QML A;  3LOD A;  4CAX A;  2Z2S B;  2PMZ A;  2J8R A;  4KOY A;  1Q2C A;  2IGN A;  4AG9 A;  2XSJ C;  1TT0 A;  1FY7 A;  5H86 A;  3EPZ A;  3BG7 A;  4FD7 A;  1MMD A;  1X1D A;  2M3A A;  2A6T A;  2V1N A;  4XON A;  3J7A Y;  1IB1 E;  2BEI A;  3S6F A;  1ERD A;  3IP4 B;  4CAW A;  4AG7 A;  4F93 B;  4R87 A;  4A33 A;  4HNU A;  2CXA A;  4KUB A;  3UNG C;  4F92 B;  2R7T A;  1V0C A;  4DNC A;  4BMH A;  4AVB A;  3PNV A;  2UUZ A;  1YRE A;  4L89 A;  4IQ4 A;  2OV7 A;  1IIC A;  4ZDO A;  1E0E A;  2O5R A;  4U87 A;  1WJB A;  3VWE A;  3E0K A;  4BL0 B;  2Q7B A;  1DGR M;  4ZDP A;  3BJ7 A;  3OYD A;  5KCM A;  3K4J A;  2JSP A;  4P5O A;  2AE6 A;  2DPS A;  2VEZ A;  4J3G A;  4UFX A;  2VQG A;  2X1D A;  5JQ4 A;  3JVN A;  3TOA A;  3OR1 C;  3SZG A;  3I9S A;  3OWC A;  2GAN A;  1YX3 A;  2CUJ A;  3EUK L;  4ZDL A;  2IS1 A;  4B48 A;  1Z7L A;  4F91 B;  3PFY A;  2VXZ A;  4LIT A;  2FSR A;  3F0A A;  4IZZ A;  2WA0 A;  2JUG A;  1L0C A;  4J01 A;  2OC6 A;  5FRN A;  5G1Z A;  1MMG A;  2IS2 A;  2RNG A;  1M1D A;  4YFJ A;  3LL7 A;  3CP2 A;  3OR2 C;  1NE9 A;  2R7V A;  2R7W A;  3FB3 A;  4KSF A;  1KON A;  3VWB A;  3W91 A;  4X0G A;  3CXS A;  3CZ6 A;  3A9L A;  3DPL C;  2HPM A;  1D1B A;  3MKY B;  3L2V A;  4FD6 A;  1PU9 A;  4LUA A;  1YE9 A;  4K30 A;  3H0D A;  2PQ8 A;  2G3T A;  1DQU A;  3D5R C;  3VDX A;  4FET A;  2NOJ B;  4MFL A;  5E96 A;  2KQR A;  2VJ4 A;  2VPL A;  4E4H A;  2V4J C;  2DOA A;  3EUA A;  4U9Z A;  3TL4 X;  3DEE A;  4MBU A;  2M4G A;  2FIA A;  4MHD A;  1QSR A;  2PRB A;  3C2H A;  4XQF A;  3FHN A;  3ZR8 X;  3OYH A;  3AL0 C;  1NSL A;  4JD6 A;  5HLT A;  4KSA A;  4PUS A;  1J09 A;  2RQQ A;  2UV1 A;  3CP8 A;  2BOL A;  4BQN A;  4BUP A;  2DJI A;  4BS9 A;  4D9J A;  3OYL A;  1R57 A;  4ORF A;  2KRC A;  2E5Z A;  2KPM A;  2B58 A;  4GRI A;  4YEJ A;  3BLY A;  4UFV A;  3S6G A;  2M7B A;  1QHH D;  3I3L A;  2XDV A;  2BW3 A;  2K5C A;  4BQQ A;  4CCO A;  3W3C A;  2WUU A;  4HNW B;  4EAT A;  1VHS A;  2Z3K A;  3F5B A;  3DKY A;  4A31 A;  3G3S A;  4DBR A;  2FCK A;  4XKC A;  5F46 A;  5IB0 A;  4CA0 A;  1LVK A;  1BOB A;  3BCB A;  3BG6 A;  2B4B A;  4A30 A;  4KOT A;  4BEH B;  4MFK A;  2X6Y A;  3A1Y A;  4FAS D;  4BE1 A;  2VXD A;  2K9L A;  2B4D B;  2OH1 A;  2VI7 A;  4PK3 A;  5JPH A;  2X1E A;  1P9Q C;  2E60 A;  5G20 A;  1T0F C;  2CH0 A;  4MY0 A;  1ZO0 A;  4NQW B;  3SEZ A;  3S32 A;  5IX3 A;  2LY1 A;  4PJJ A;  2YNE A;  4UCP A;  3OL4 A;  4XL9 A;  1X19 A;  3QYF A;  4C30 A;  1MW7 A;  2PJR B;  1U6M A;  3QB8 A;  1NMT A;  4JXQ A;  4OLL A;  1WJA A;  3GBG A;  4XPD C;  4MJ8 A;  3IUO A;  3OL3 A;  4KLV A;  3B8G A;  3S3O A;  1MK4 A;  5HNF A;  3D5L A;  4PSX A;  1P0H A;  1M44 A;  4DBQ A;  1VKC A;  1X4P A;  2VB6 A;  2VBQ A;  1V5E A;  2J8M A;  2DT6 A;  1J4J A;  2Q1Z B;  4CGM A;  2OZU A;  4XMY A;  3GY9 A;  5CNP A;  2Z3O A;  1WJC A;  1I12 A;  4XOR A;  2R7X A;  4E7I A;  4A2Z A;  3S93 A;  2FT0 A;  2OZG A;  3OS1 A;  5KTA A;  3H5R A;  3P2H A;  3F8K A;  4CYO A;  1IRX A;  1WJ5 A;  2P6G A;  2R7H A;  2F5I A;  3FDY A;  1Z3X A;  2YND A;  2CV1 A;  4H6U A;  1Z21 A;  3VYS B;  4PJN A;  2V26 A;  2HV2 A;  2VKH A;  2F4I A;  2R7O A;  4C2T A;  3C26 A;  2Q0Y A;  5AG6 A;  2X51 A;  2WAF A;  2R7R A;  3S3M A;  2R7S A;  4KUA A;  4XPD B;  3FBN B;  1B6B A;  1W36 C;  2Z10 A;  3MMY B;  4RS2 A;  4UFW A;  4B5O A;  4E7J A;  2HU9 A;  1UG0 A;  2CW8 A;  2MD0 A;  2EUI A;  4MI4 A;  2CMP A;  1QU3 A;  4A32 A;  3OMY A;  3PSF A;  4QPO A;  5DWN A;  3R9G A;  3SYT A;  3TOB A;  4C7H A;  2IXS A;  2LY2 A;  1D1A A;  4U7B A;  4E7H A;  1Z4E A;  2JDD A;  4JQF A;  5HMN A;  4IKF A;  4NCZ A;  2R4G A;  2LBF A;  5FRM A;  4B5P A;  1BR1 A;  2WAQ A;  3PL8 A;  2VZZ A;  2BVL A;  4AYB A;  4KOW A;  4CAE A;  3FBU A;  2WAE A;  3IAM 2;  2DXI A;  2RRE A;  1Y9K A;  4KVO E;  4R9M A;  2HVS A;  3DTE A;  2X85 A;  3D5S C;  3TO9 A;  1S7K A;  1ZEL A;  4JXR A;  3GKR A;  2Y0S A;  5LD2 C;  2L9N A;  3VWD A;  4C2X A;  4C68 A;  1LDK B;  1S60 A;  2F5V A;  2V7F A;  2L7K A;  2Z16 A;  3R1K A;  4CUG A;  2Z3P A;  2W7N A;  3UR3 C;  2GE3 A;  1RO5 A;  2KDO A;  3FKJ A;  4KOR A;  4JWP A;  4B5P B;  1QSN A;  2M4K A;  1YLE A;  2Y0M A;  4KVX A;  2LH9 A;  4PK2 A;  4PJM A;  2Z3N A;  4UCN A;  4CAF A;  4KZT A;  1TZL A;  4PSW A;  4BJ6 C;  2BW3 B;  4CAV A;  2BUE A;  3EUH C;  3OYJ A;  2V6E A;  2BL1 A;  1Y6I A;  2EVN A;  3DDD A;  4F6A A;  2VKD A;  4OWR B;  4AB7 A;  2LRD A;  3DU6 A;  3OYC A;  4AVZ A;  4XNH C;  1DP3 A;  3EXN A;  3VYU B;  4BEH A;  3K70 D;  2IGM A;  3QOD A;  4XLE A;  4Y3O A;  5DWM A;  2VQC A;  4NNJ A;  4PK4 A;  4RM2 A;  2LRE A;  2YNC C;  5G21 A;  4CGL A;  2DCE A;  2VQH A;  2X1C A;  4XOP A;  2Z0Z A;  1QSM A;  4HEA 2;  4KS9 A;  3DPU A;  1S7L A;  3SXN A;  3TTH A;  3K4M A;  1D0Y A;  1OR7 C;  1SFK A;  4LG3 A;  4ZC3 A;  3K70 C;  1MJ9 A;  2KCW A;  3DR8 A;  3NE7 A;  2R7U A;  1Q2Y A;  3OYE A;  3HKZ A;  2PC1 A;  4BQO A;  4F55 A;  3K4B A;  2KLO A;  1UAA A;  4QB9 A;  2J8N A;  2Q4Y A;  5C88 A;  3JUW A;  1Y7R A;  3DSB A;  3W2W A;  3OS2 A;  1K6Y A;  3LSI A;  2LBF B;  4PJL A;  2I79 A;  3H35 A;  3TCV A;  5AGE A;  5F49 A;  3PGP A;  3RYO A;  1OZP A;  4YGO A;  3KKW A;  4ZGY B;  4XKB A;  3S3N A;  1V5F A;  5CQE A;  5I0C A;  2B3U A;  5EBV A;  2D4O A;  3RSN A;  3KX2 A;  1M4D A;  2FL4 A;  1Z4R A;  3QYE A;  4IF5 A;  4CRZ B;  3IAS 2;  4CCJ A;  3L2W A;  2ZW7 A;  2R98 A;  4E8O A;  2B3V A;  2ZSH B;  2PR1 A;  2W00 A;  3TBI A;  4HNX B;  2ZXH A;  1XE4 A;  4XN0 A;  3PSI A;  2IGK A;  3MD2 A;  3IWE A;  3ZJ0 A;  2Q44 A;  2R7Q A;  2PSW A;  3SXO A;  3ZQQ A;  2G0B A;  3PUB A;  3L2U A;  2X7B A;  4M3S A;  1Y56 A;  2ELJ A;  2L5Q A;  3S8P A;  1VZ0 A;  4C9Y A;  5AG4 A;  1ON0 A;  3LD2 A;  4BDZ A;  2L9S A;  4OAE A;  2REE A;  4H89 A;  2UWM A;  5H84 A;  1T95 A;  2JLM A;  5A28 A;  3DR6 A;  4FD5 A;  2X6X A;  2VAS A;  1YVO A;  1SAU A;  2GOM A;  2K9M A;  1PYV A;  4XLH A;  2VQY A;  4II9 A;  4M85 A;  4C2U A;  2XF5 A;  5ISV A;  4UCM A;  1IID A;  4JOM A;  4B13 A;  4OAD A;  1LKX A;  1MND A;  1K4J A;  2FIW A;  2PDO A;  3D8P A;  1YK3 A;  3E0J B;  3R9F A;  2XF7 A;  4BGD A;  3CF2 A;  2PJR A;  1S7F A;  3OYN A;  4RLQ A;  4IQJ A;  3A2K A;  1KUY A;  2ARH A;  4XNF A;  2LOO A;  2WSA A;  3EO4 A;  3SHP A;  2E5N A;  4KOX A;  2IGO A;  3G2B A;  3BCA A;  4LX9 A;  4YEL A;  1D1C A;  4ONU A;  3T90 A;  3HOS A;  4Y49 C;  4RI1 A;  3HC7 A;  2MFZ A;  2WBM A;  3D3S A;  2KZV A;  4MLO A;  3ZRG A;  2K3P A;  5TGT A;  1YX5 A;  4N4N B;  4NXY A;  4CYN A;  5KTC A;  3H9J A;  1IYL A;  2JDC A;  1WFX A;  1G59 A;  3EFA A;  4CS0 B;  4NEX A;  4ZYA A;  5A27 A;  2QKM B;  3OYI A;  1AA7 A;  3TO7 A;  3IGR A;  4XKV A;  4HNT A;  4B44 A;  1JI8 A;  1PJR A;  2FUG 2;  1G8X A;  3DQV C;  1YR0 A;  1IYK A;  3CJR B;  4LIV A;  5CQG A;  1Z9U A;  4GS4 A;  5HH1 A;  1MJA A;  3H9Q A;  2E1M C;  3ZCO A;  1UEL B;  3AL0 B;  1N71 A;  1NG7 A;  4QBJ A;  4AU7 A;  4BJT A;  4KOV A;  4UWJ A;  2QKL B;  1PUA A;  3LSM A;  3PZJ A;  1B87 A;  3FYN A;  4JLY A;  2G3A A;  4YRV A;  2WPW A;  3TFY A;  3H5Z A;  3FBI B;  2Q4V A;  3MGD A;  4Q38 A;  3R9E A;  4XKW A;  2IS4 A;  1FMW A;  3FIX A;  3UY5 A;  3F9K A;  4ZJZ A;  5FVJ A;  2HNH A;  3K10 A;  3OWT A;  1WWZ A;  3TT2 A;  1MMN A;  2W1O A;  3OYM A;  1N78 A;  3BC8 A;  3DTI A;  2CFO A;  2V9K A;  3PNY A;  4XLC A;  3W2V A;  3MKW B;  2CNM A;  3DU5 A;  3EY5 A;  4Y4R A;  2AJ6 A;  3FRM A;  4Q36 A;  1EA3 A;  1S7N A;  3S6H A;  4ANJ A;  3WR7 A;  5CKT A;  5KHD A;  2L2O A;  4CCK A;  3TO6 A;  1P4N A;  4CRY B;  2I00 A;  1N77 A;  4H4K C;  2REF A;  3V8I A;  2ZW6 A;  1WJF A;  4J00 A;  2BVM A;  2JEV A;  1BR4 A;  4PV6 A;  4CGO A;  2M0M A;  5LFA A;  4DJA A;  2ATR A;  2HDW A;  3M8J A;  3H9G A;  3N05 A;  4KIT B;  2CV2 A;  2KHM A;  3CMM A;  4CZC A;  1MMA A;  3OOU A;  3QYB A;  4MFZ A;  4AVA A;  3V42 A;  4B11 A;  2WPX A;  2VJ5 A;  3LFU A;  2JA2 A;  4F3Q A;  2W4S A;  3OY9 A;  4QUS A;  5GCN A;  4X5K A;  3R96 A;  3VYT B;  4HG2 A;  3H5A A;  3W6S A;  3DKX A;  2ZFU A;  3A4C A;  3PJR A;  2R1I A;  3K9U A;  3ZGK A;  1QHG A;  2P0W A;  1W36 D;  4DIQ A;  1XF8 A;  2C27 A;  4BBH A;  5IV0 A;  2VLA A;  4C7I A;  1XIX A;  1I21 A;  3RTR A;  2DPT A;  4B47 A;  2CW7 A;  4BJ5 C;  4UBR A;  2O28 A;  4HNY B;  1HA8 A;  2LC2 A;  3JTK A;  2CNS A;  4E7S A;  3DNS A;  3BLN A;  3DPT A;  2K5T A;  4XOT A;  2ZW4 A;  3EC4 A;  1R6R A;  2LG4 A;  2ZW5 A;  1FMV A;  4KJZ A;  3W6X A;  4CCM A;  2OUM A;  3CXP A;  5J8F A;  3OYB A;  4JJX A;  4HRI A;  2CS3 A;  2OB0 A;  2QEC A;  5G22 A;  1S5K A;  3HL2 A;  4N4O B;  2VZY A;  2GOX B;  3L2Q A;  1CJW A;  3HOT A;  4DOZ A;  2HQY A;  2XAU A;  4RMN A;  1D0X A;  1I1D A;  1WJD A;  2Z1D A;  3E1S A;  2Z3M A;  5F47 A;  1U0J A;  4XR6 A;  2WB1 A;  4KT6 A;  4E7K A;  4U5Y A;  4UWI A;  3AFH A;  4II2 A;  2XC7 A;  3IU2 A;  1V5G A;  1X4O A;  4XN3 A;  1KZF A;  4Y33 A;  4MFP A;  3IU1 A;  3PNT A;  2AQF A;  2A5W A;  3G8W A;  4CGP A;  1RXT A;  2HUZ A;  5AG7 A;  1N75 A;  2IS6 A;  2M7A A;  3P2F A;  2B5G A;  4IX7 A;  3VSL A;  4IUS A;  3N7Z A;  4XLF A;  3SEQ A;  3VSK A;  4QVT A;  5HOO A;  3HPH A;  2MAB A;  1WJE A;  2ZPA A;  1YVK A;  2ZXV A;  3HXL A;  4BDY A;  2HQA A;  2VIX A;  4NC7 A;  4CYP A;  2E1M B;  3LSG A;  1Q2D A;  1Z3Y A;  2KMU A;  3OS0 A;  2H5M A;  3PP9 A;  1GHE A;  3I3G A;  2I8D A;  1YX0 A;  5F48 A;  5BWA B;  4L8A A;  4EVY A;  3FXT A;  4HSR A;  2Q04 A;  2CY2 A;  5C82 A;  2HPI A;  1LRZ A;  3HPG A;  4XM3 A;  3NWS A;  3M1C A;  4LIU A;  2LYC A;  4PFO A;  4CCN A;  3OYK A;  4XNH B;  3D2P A;  3GYA A;  4MFQ A;  4NSQ A;  4E2A A;  3TE4 A;  2FS5 A;  3K4C A;  4RLF A;  4BAC A;  1BO4 A;  4MFJ A;  4ZBG A;  2VJI A;  4B43 A;  4RM3 A;  5HVQ C;  1QSO A;  2Z3L A;  3OYA A;  1UFH A;  3H4Q A;  2PR8 A;  2YNC A;  4A95 A;  4E7Z A;  4QPQ A;  3RCO A;  4ZTF A;  1OLT A;  3OYG A;  4UA3 A;  4XPL A;  4F0X A;  2BSW A;  4CYQ A;  1XEB A;  3CES A;  4ITV A;  4XLA A;  2R8V A;  2ZXI A;  4QC6 A;  3HUG B;  1X1B A;  2JVH A;  3OIQ A;  4NUB A;  3K4L A;  5KNL A;  3L2R A;  4ZTJ A;  3BJ8 A;  4F52 A;  3C2G A;  3FNC A;  4KIS A;  4HKF A;  2A4N A;  4DGW B;  4B12 A;  1SQH A;  5KTD A;  1Y9W A;  4H6Z A;  4F0Y A;  2FE7 A;  3VYR B;  3CJQ B;  3DWL E;  3QOE A;  2MYS A;  4E7L A;  4KOS A;  4CH7 A;  4U9Y A;  4E0A A;  4E6K G;  2KL4 A;  4B3X A;  1BR2 A;  2DT7 B;  2QIR A;  3RQ4 A;  3DLA A;  1M4I A;  2D4P A;  4HPQ A;  4YRH A;  2OZH A;  2VQL A;  4R79 A;  1X1C A;  4OAY A;  1MNE A;  3DTK A;  3MKZ A;  4NC8 A;  1YGH A;  2DXQ A;  5AG5 A;  4P1W A;  4BE2 A;  1WK4 A;  1XMT A;  4CGN A;  1LFP A;  2W82 A;  1D0Z A;  4CCL A;  4R3L A;  5HNH A;  4AVC A;  3H5N A;  3RPU D;  4R3K A;  3T9Y A;  3AKZ A;  1KUV A;  2WY7 Q;  4MY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...