4PSXA

Crystal structure of histone acetyltransferase complex
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
313
structure length
313
Chain Sequence
KPETWTSSANEALRVSIVGENAVQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDSVTFKPYVNVKYSAKLGDDNIVDVEKKLLSFLPKDDVIVRDEAKWVDCFAEERKTHNLSDVFEKVSEYSLNGEEFVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLLNKKTKELIGFVTTYKYWHYLGAKSFDEDIDKKFRAKISQFLIFPPYQNKGHGSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKLGYDAVFQKHSDLSDEFLESSRKSLKLEERQFNRLVEMLLLLNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone acetyltransferase type B catalytic subunit
publication title Hat2p recognizes the histone H3 tail to specify the acetylation of the newly synthesized H3/H4 heterodimer by the Hat1p/Hat2p complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Histone/transferase
total genus 98
structure length 313
sequence length 313
chains with identical sequence D
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2014-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4psxA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4psxA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 4psxA01
1YK3A 2Z0ZA 2AE6A 2GIVA 3UY5A 2AJ6A 3BLNA 1YLEA 2P6FA 2VEZA 4PV6A 1XEBA 5DWMA 4OADA 2RC4A 2ATRA 4H6ZA 1XF8A 1Y9KA 2FIAA 5HMNA 1VHSA 1GHEA 4FD5A 3NE7A 1WWZA 3S6FA 1ON0A 5DWNA 2G3AA 5E96A 1MJAA 4U5YA 2CNMA 1Z9UA 1M4GA 3LD2A 4YFJA 4L8AA 4B5PA 5KTCA 1KUVA 3H4QA 4NXYA 1P0HA 4NSQA 2J8MA 5F47A 4L89A 1CJWA 2REEA 4AVAA 3SXOA 3MGDA 1M1DA 4E8OA 1UFHA 3LODA 4KOXA 2Z11A 4Y49B 5FVJA 4BMHA 2FS5A 4FD4A 3ZJ0A 2VZZA 4IF5A 4LUAA 2ARHA 1U6MA 3FNCA 1Q2DA 4KVOE 3W91A 2HUZA 4MHDA 4JLYA 4R3LA 5I0CA 3D3SA 3S6GA 1MJ9A 4HKFA 4I49A 1N71A 4CAVA 3EFAA 4MI4A 4KOWA 1KZFA 2OZUA 1IIDA 2Q0YA 1IYLA 2P6GA 4PSWA 2PR1A 4KLVA 3R9EA 4FD7A 4XPKA 1S5KA 2BL1A 5KTAA 4OAEA 1YREA 4KVXA 4CAXA 3BJ7A 1QSOA 4JJXA 3JUWA 2D4PA 1IICA 2WPWA 3PZJA 3EO4A 2VBQA 3FB3A 2BSWA 1RXTA 3T9YA 2Q7BA 3FRMA 4RI1A 1P4NA 3I9SA 2VQYA 3ZZIA 2B3VA 2FCKA 2H5MA 4KOSA 5H86A 1FY7A 4ZBGA 3F5BA 2B3UA 3GY9A 3N7ZA 2I79A 1TIQA 2B4DA 3TOBA 3PP9A 4QUSA 2B58A 2B5GB 1NMTA 2Q04A 4YGOA 4XPDC 4AVCA 1KUYA 3DDDA 1M4DA 1XIXA 5C88A 3K9UA 2JLMA 4KLWA 2EVNA 1S7LA 3T90A 4F0YA 2CY2A 5ISVA 4LX9A 1YGHA 2CNTA 4RS2A 3QAHA 3I3GA 2OZGA 1S7NA 3TFYA 5JPHA 1XE4A 4UWIA 3CXPA 1R57A 3WR7A 2PSWA 4HNWB 2OZHA 3F0AA 3TO9A 2OH1A 1QSTA 1NSLA 2C27A 3D2PA 4JD6A 3EC4A 3R1KA 4XPDB 4OLLA 4UA3A 2FXFA 2I00A 3G8WA 5KTDA 4PK3A 2QMLA 4F6AA 1NE9A 1B6BA 1S7KA 2JDDA 2HV2A 4H89A 1MJBA 3W6SA 4YRHA 3S6HA 2Z10A 4MBUA 4CRYB 1I1DA 3R9FA 1B87A 4EVYA 2VZYA 4GS4A 1V0CA 4M85A 2P0WA 3FXTA 2IL4A 1QSNA 4MY3A 4CAWA 3QB8A 3DSBA 2PRBA 2BEIA 2CNSA 4NEXA 4ONUA 3C26A 2FE7A 3G3SA 2R1IA 5F46A 3CXSA 2JDCA 3GYAA 4AG9A 1BOBA 4XPLA 5C82A 2WPXA 4KOTA 2B4BA 2PQ8A 3TCVA 4AVBA 2PR8A 5IX3A 5EBVA 5H84A 1SQHA 1S3ZA 4UBRA 1M44A 4KVME 2FSRA 4KOUA 3FIXA 3DNSA 4CRZB 3EY5A 1K4JA 2QECA 2G0BA 4NF1A 1YX0A 3R96A 4UWJA 2EUIA 2B5GA 5GCNA 2VXKA 3DR6A 2R98A 2JEVA 1MK4A 2Q44A 2D4OA 3SXNA 1RO5A 3VWDA 1M4IA 2REFA 1PU9A 3OWCA 4JXQA 3TOAA 4MY0A 1OZPA 4JXRA 2KCWA 2A4NA 4NCZA 3FYNA 4II9A 4QC6A 3SHPA 1XMTA 1CM0A 3D2MA 4K30A 3BJ8A 4AB7A 1L0CA 4KOVA 4KORA 1I12A 1S7FA 3R9GA 4PK2A 1Z4RA 1YVOA 3F8KA 2ZW4A 5IB0A 2OU2A 2P6EA 4ORFA 5IV0A 4J3GA 2Q4YA 4QVTA 3S6KA 4B5PB 3TO6A 1IYKA 3EXNA 4QBJA 1KUXA 2GANA 3TE4A 2GE3A 4R9MA 3VWEA 3IWGA 4H6UA 1BO4A 4KOYA 4JWPA 3IGRA 3KKWA 1QSMA 2ZXVA 4XNHC 4CS0B 2BUEA 4FD6A 3FBUA 3JVNA 4B5OA 1PUAA 4U9ZA 2ZPAA 2DXQA 2R8VA 2Y0MA 1J4JA 2HQYA 2VI7A 3TTHA 1WK4A 5EC4A 4KUBA 4X5KA 1Y9WA 2X7BA 5F48A 2J8NA 2Q4VA 4IUSA 3TT2A 4KUAA 2F5IA 1Y7RA 1Z4EA 1S60A 4AG7A 2OB0A 2ZW7A 3PGPA 5J8CA 3DR8A 4DNCA 3TO7A 3B8GA 2PC1A 1LRZA 2R7HA 2J8RA 4PSXA 3RYOA 2K5TA 4HNYB 3P2FA 4HNXB 2G3TA 4MJ8A 4XNHB 4R57A 3V8IA 2ZW6A 1I21A 4QB9A 2PDOA 2FL4A 2QIRA 4U9YA 5JQ4A 4E2AA 3P2HA 4M3SA 2B4DB 1YVKA 4R3KA 2NMTA 3GKRA 3R95A 2O28A 1IB1E 3D8PA 1VKCA 5J8FA 5CNPA 3CXQA 2FIWA 4R87A 5F49A 1Q2CA 3E0KA 1QSRA 4KZTA 1Q2YA 4Y49C 5HH1A 4E0AA 2ZW5A 1YR0A 3W6XA 2FT0A
chains in the Genus database with same CATH superfamily
1FNNA 1N75A 1YK3A 2Z0ZA 1LPQA 3PFYA 1L3LA 5DCMA 3KP7A 1H8AC 2P5LC 2XAJA 1LFUP 5K8PA 4F93B 1XEBA 5DWMA 2ATRA 1G3SA 2KFDA 3RNZA 1RI7A 3I4PA 3HOYJ 4FTHA 1XF8A 4QTRA 2DJIA 1Y9KA 1KA8A 4HLXA 4A6DA 1V55H 1J0RA 4C9YA 1TWHJ 5LGUA 2FIAA 4KSAA 3BTIA 2JA5J 4FD5A 3ULQB 3NE7A 2HYGD 4XM3A 4KIFA 1HC8A 1FZPB 5TJJA 2AFXA 3S6FA 5E96A 2MBFA 4U5YA 2F4IA 2CNMA 1JHFA 2DYRH 2XAGA 1B8IB 4M6VA 1OBRA 3D66A 5JLXA 3WHCA 4B5PA 1NG6A 1FSHA 1FYLA 1KUVA 2GREA 4NXYA 4MFQA 4NSQA 4MTEA 3LSPA 1X12A 1R4MB 2BVLA 2REEA 3CMEI 2DMNA 1IO2A 2FU4A 3MGDA 4HA8A 1FOXA 2IBDA 2Z11A 1LAPA 4YEJA 4BMHA 2E1MB 4CICA 2KP6A 2FS5A 4Q7AA 4FD4A 5IYBJ 4A94A 1CQTA 1K7AA 2PEXA 1OR7A 1FX7A 4RGRA 3V8JA 2HVSA 1V5EA 1RR8C 1OYIA 5J3LA 3TDZC 1AYEA 2JVHA 1CF7A 3H0GJ 2HDWA 3BJOA 4G7HF 4R79A 2DU9A 4U7BA 3DCFA 1B72B 4HKFA 4G9YA 1XMBA 4BJTA 5JFRA 4CAVA 2FBKA 4UCPA 5EMIA 3BY6A 3BJ6A 2E2IJ 3I3LA 1ZR2A 5FFZA 3OS1A 2BZTA 4MI4A 1KZFA 2NYQA 4BQAA 3R61A 3F8MA 3U21A 1VQ8I 1IIDA 1LQ1A 5L3CA 1IRXA 2CSOA 3CUQB 3GTLJ 3R0AA 2RNGA 4YELA 1IYLA 4PUSA 1ZG7A 2LY9A 4KT6A 3FDYA 5CJ9A 4KLVA 2STWA 2H6BA 2RB7A 3JRFA 3KP2A 2UV1A 2Y30A 5EGOA 4IRIA 1Z6RA 1IRFA 4ZYAA 2PJ1A 4OAEA 2A6HF 1S7EA 3MN2A 3D67A 4PPZA 4A31A 4CAXA 2LOOA 3BTLA 1ETOA 3PNVA 1IXRC 3BJ7A 1LUJB 5E20A 4A69C 1XDSA 4U7DA 2ZJ2A 3HUGA 1SMTA 2MABA 2X6YA 2GIZA 4BXFA 5HVQC 1IICA 1XDUA 5L3DA 3VDXA 3HYIA 3I4MJ 4WK8F 1K61A 3T9YA 3DEEA 2COBA 1U8RA 1ZR4A 5KAIC 1QVUA 4X6AJ 4NGMA 3BR6A 2ZNZA 3SDBA 4EM2A 1P4AA 3NAUA 4S0HB 2DPUA 1WHUA 2E2JJ 1OKRA 4P6YA 1LVAA 4C3JJ 2MLGA 4B48A 2PJAA 4GDFA 3NRVA 3G3ZA 2QCOA 3LA7A 2EH3A 2MSYA 4RM2A 3WU2C 1MIJA 5EYRA 2XVCA 3TOBA 3V7ZA 4XRSG 3PP9A 4KICA 4Q47A 4A33A 4C2YA 1XS9A 2VUMJ 4OWRB 2B58A 3KZWA 4UFVA 3SI1A 5C44J 3BI0A 2A6TA 3HHGA 7CPAA 1N78A 4AYBN 3A01B 2LP0A 5IYCJ 2EO8A 4XPDC 3S93A 3K4MA 1K79A 3RYPA 5DDGA 4GFBA 3D7FA 4M3BA 4CYPA 3WHBA 1MMAA 3RSNA 4KN4X 4RUHA 3SJXA 1DU0A 4A3FJ 1T38A 4FCYA 3IWFA 3M1CA 4EMSA 3A2KA 3CPXA 3LSIA 2D5VA 2XGEA 2JWTA 1D1AA 2KZVA 2IA1A 2Y9ZA 4OP4A 4XKBA 2PE3A 5ISVA 3E1SA 4LX9A 1D0XA 3O6BB 1F4KA 3WGGA 1YGHA 2CNTA 2NVUB 4A3DJ 2OQGA 1G8XA 1GV5A 3PB9X 4HG2A 3DKWA 4XOTA 3SZTA 4E7KA 1FNOA 1S7NA 5LYFA 1YX5A 1RPWA 3UR3C 1ETXA 3OYKA 3KI9A 4Y7NJ 3S9MA 2JUCA 1XGSA 1ITYA 2XAFA 3WU1B 3GFJA 1ETQA 1IDZA 4XN3A 2WSAA 3CXPA 4A0YA 2XAQA 4XR6A 1OPCA 3LAPA 2VJJA 1G59A 5AG5A 3C7JA 3B02A 4R1HA 3PB4X 3WR7A 4ZGYB 1ERDA 3P9KA 1B8IA 3MFKA 2DFFA 3VEPA 1F36A 2CW0F 1QSTA 2L7FP 2RQPA 4IHXA 4PQAA 3MVPA 1Z3YA 3OWTA 3MZHA 3QP5A 1BL0A 3N05A 3RKXA 1MBGA 4P5OA 1UMQA 2R93J 2ZO4A 4CYOA 1X1AA 3R1KA 4FBEA 2R4GA 3A1YA 5K5OA 5EG0B 2LD5A 2DW4A 4UA3A 3I58A 2CU7A 2HDCA 1B9MA 1T56A 3DTIA 4BNCA 4NGQA 1Z8WA 2HVRA 5B3SH 2F4OB 4ASNA 3U1KA 2M2EA 2YR2A 1ZLJA 2HDDA 1B6BA 3CC2I 5LYLA 4H89A 1R49A 3CMAI 3AG3H 1B72A 3TL4X 3W6SA 4YRHA 3S9LA 3GFMA 4XLNF 3H3ZA 1TZLA 2L7ZA 4ZTJA 4WX9A 3S16J 3CDHA 1BA5A 1Y1VJ 1W7PD 3IRQA 2PJ0A 1SD7A 1B87A 3H8EA 3U9GA 3DTKA 1AHDP 2V8DA 4MFJA 3EPZA 4AVZA 4UCNA 2L9VA 3CESA 1L0OC 4WXHA 1R22A 2KHMA 3F8CA 1WJAA 1OYYA 3CUQA 1V0CA 3SEQA 3GZNB 3IC1A 4ABZA 4ZJZA 5D29A 2FBIA 3EETA 2I3CA 4MY3A 1QZYA 5THWA 2Q4ZA 1YYVA 2X1DA 2BEIA 3ECOA 3FX3A 1LFWA 3GTMJ 3RZDJ 2JTVA 3D68A 3PB8X 2QQBA 2DMTA 3OMYA 3T8RA 4C3IJ 3CC4I 3KQZA 5C4JJ 1LDDA 3G3SA 1WGXA 1VQ7I 1HDUA 4A95A 2FRHA 1UFMA 3M8JA 4U88A 5F46A 4LQ6A 3OYCA 4MQVA 4B3XA 4Y15A 2H6CA 4JP0A 3SI2A 2O9LA 3SXYA 3V4GA 1VQ6I 3UKGA 3IH3A 3IHUA 1QPIA 4NUBA 5C82A 2VI6A 4IO9F 4KOTA 2P5KA 4WJBA 3PQJA 1YOVB 2DFIA 2PBIA 2DPTA 5B1AH 1R00A 5LGTA 3HOVJ 2A6EF 1W4MA 2V1NA 2QVPA 3LSTA 5EBVA 4FQGA 3FXUA 1M44A 1BIBA 2DDAA 4KVME 2PN6A 4UFWA 5IP7J 1Y8QB 4XSZF 2HWVA 4V2GA 5F0HA 4AYBA 1K83J 1V3FA 1BAVA 4IHSA 3AL0C 4KIBA 3OYBA 3V7RA 2VKEA 4XK4A 3WG7H 2GXGA 4UWJA 2GBYA 4G7OF 2HR3A 5LHIA 2Q8KA 1WSUA 2EUIA 2ZEMA 2GOXB 2DYSH 3FBIB 1WFXA 3A01A 3DR6A 2A5WA 1T95A 2E36A 3OR1C 1V54H 3ONQA 5C3EJ 2PJBA 1E2XA 4BHCA 2K3FA 3PM1A 1VQNI 3OS2A 2RREA 1XSXA 3TEDA 5LLQA 1DDNA 1RRJA 3DBHB 3IJ3A 2FXAA 2CYYA 2EV0A 2F7VA 5K8NA 1XPXA 1MMDA 3TOAA 5TGTA 1H9TA 1KU7A 2Z3MA 2ZFWA 2PI0A 2E19A 5B66C 2A4NA 3WODF 2ICWG 2BVMA 1O7LA 3SHPA 3TX8A 2BW3B 2VE9A 3E6CC 4B13A 1RESA 4RB0A 2LRDA 4AB7A 2BHYA 4KITB 5EZHA 1X1CA 3ZGKA 4LJZF 3ZN1A 2O3FA 3F8FA 3NH8A 4XMYA 1BPMA 4HNUA 1X2NA 4HDUA 3EUAA 1KU9A 1PYVA 3OIPA 4KJZA 3TGNA 4CYCB 2YGWA 1AUGA 2CS3A 4W9YA 3W2AA 2ISZA 4I09A 4WWVA 2HZTA 5IB0A 1IW7F 1J5YA 2CQXA 2K9MA 4I99C 5DS0A 4L9VA 5DUIA 3HSRA 1TWAJ 1WRJA 1FOYA 3DKXA 2QYVA 2PX9A 2FD5A 4QVTA 4EWTA 3IU2A 3S6KA 3V7SA 3K7AJ 1GVDA 2VKVA 5EG0A 5LRJA 4FHTA 2ZC2A 3F72A 4IKFA 5AIPA 2V9KA 4E7SA 1BI2A 1EV7A 5ICFA 3KR4A 3K4LA 1BM9A 2COMA 3OYHA 4H6UA 1D5VA 2EFOA 1X3UA 2BY2A 5AONA 1IN4A 4KOYA 3HOUJ 2DOEA 4XKWA 1Y0YA 1PCAA 5KK1A 1S6LA 1MD0A 2E60A 1I50J 2ECCA 2J5PA 2QQAA 5LBQA 1SD4A 1RNLA 2R5YB 1RC9A 2BUEA 3Q9VA 2GQQA 4U9ZA 2LFBA 1DTDA 2BBYA 2NOJB 3CMYA 2ZPAA 4XLEA 2R3SA 4PZJA 4AVPA 4JQFA 2Y0MA 4PFPA 2Y0SA 1BR4A 1T33A 2VBZA 4NGSA 4F0XA 2VI7A 3E0JB 2PJPA 1YW4A 3PNYA 5K8OA 5F27A 4BXUA 3OOPA 4I6ZA 4EJWA 1WI3A 3ZMDA 1Y9WA 2Z3LA 5F48A 2IT0A 5FD6A 1W1WE 2LF8A 4IUSA 5HLGA 2XEGA 3GWZA 4XLHA 3IAS2 3PRTA 2O7OA 3QPSA 3OYLA 1YMEA 3CCQI 3JREA 3G1LA 5DM7F 1J9IA 4KSIA 3BG7A 3K70D 5FKNA 1IN6A 4QLCU 5GAGJ 5CVVA 1NK3P 3WU0A 4LQGA 3DR8A 4DNCA 3B8GA 1YJWI 1WJDA 3M9AA 1KZHA 1U9NA 4NDLA 5G22A 1FC3A 4H4KC 4XKCA 3EYIA 3BDDA 2J8RA 2L7MP 2CG4A 4BE0A 4PSXA 3JRDA 2QVOA 3QQAA 4WF2A 4LFUA 3W2VA 3C2BA 4I2OA 4P9UA 4MFDA 2QQ9A 4L5IA 2R7RA 3P2FA 3SHFA 2Q43A 4MJ8A 1ZLKA 2DA4A 3ZP5A 2PDOA 2HU9A 3IKTA 2VONA 2DA1A 3I1UA 4M73A 3BR3A 1AMPA 1WJFA 2DA6A 1I5ZA 2DOAA 4A12A 2C6CA 2QIRA 4E4HA 1YS6A 4HNVA 1KYZA 2M87A 4XBFA 1KU2A 2XGCA 2B7EA 4LG0B 2NAZA 4I01A 2PG4A 5M3MJ 3EUKL 1IV6A 1RKTA 1S7AA 2K9LA 4M3SA 1IDYA 4OC0A 3GLLA 5HS8A 5M5WJ 1YVKA 4IL6C 4EEFG 2CXAA 1LDJA 4N0BA 4A3CJ 3PFEA 4LG3A 2XV4S 3BTCA 4P55A 4QPOA 3T5XA 1UJ8A 5IB9A 2XF5A 3UNGC 2L4AA 2R7VA 1YHQI 1CGPA 5IT9Z 4ENJA 4RB2C 4FX0A 2QBYB 1Q2CA 3HXLA 4M9SA 3RI4A 1QSRA 2OR4A 3D5SC 4A3EJ 1Y39A 4HLYA 4F52A 1Q2YA 2DMUA 4E0AA 1ZTRA 1JUPA 3S15J 3CPAA 1R1VA 2ESNA 1Q1HA 4KT5C 5J1UA 1BBYA 2BW3A 4KIGA 2Y69H 2VXZA 1Y7EA 2AE6A 4BXXJ 2CW8A 3RQIA 3DLAA 1YLEA 2IS2A 3S9NA 2E34A 3QPLA 1RIOH 4PV6A 1XBUA 2RC4A 3KYDB 1T6SA 3BG6A 3W6VA 1JXSA 4S05A 2AO9A 3MQ0A 4OIQF 1SMYF 4H6ZA 2R7TA 3D1NI 4LK0F 3B7IA 3E5XA 2L9RA 5F0FA 1GHEA 4NGTA 1RKWA 1TC3C 3K2AA 4Y13A 4CYCA 1WJEA 1X1DA 2DN0A 3IFEA 2VBXA 2G9WA 3AKZA 4F9VA 3VFZA 3HGYA 2DOFA 4L0ZB 1KQ0A 4D5FA 2ZXHA 2IP2A 2XAUA 1M4GA 1FJLA 4M9ZA 3JRCA 2P4WA 4BUPA 4L8AA 3L9FA 2FNAA 4IEJA 4CSWA 2L01A 5KTCA 4BDZA 3H4QA 4DOZA 2XROA 2MGQA 1P0HA 1YRNB 2J8MA 4JOMA 2ACJA 4YFKF 2FBHA 3DBRB 1QU3A 4HSRA 1FMVA 1TKJA 4L89A 5F47A 3PIOF 3CMMA 5IOYA 4EJVA 1EE3P 4AVAA 1I3AA 1FTTA 1LFPA 2I8DA 4LLNA 1M1DA 4KOXA 1DQUA 4JX6A 4F3QA 3GEZA 3DV8A 3ZJ0A 4UVAA 2VASA 3W3CA 4LUAA 2ARHA 4BQQA 1HBXG 3B6AA 2OZ6A 4A3BJ 3FNCA 4CO8A 1Q2DA 4KVOE 3W91A 3IP4B 2WV0A 3HJEA 2PJ3A 4IK2A 4CA0A 4QIWN 2Z1DA 4UB6C 4JLYA 1I3QJ 3QU3A 2R5YA 4R3LA 4IJAA 3D3SA 4UNOA 2RVCA 2GA1A 2JZYA 3L2RA 3E5UA 1BPNA 2K9SA 2O6GE 5GP9A 1MBKA 3CCMI 1ZG9A 3TW7A 4A93J 1E0EA 4JYKA 4W1UA 3U2RA 2NS7A 5B5EC 1ZRFA 1SVMA 2M45A 2X51A 1IV8A 2FOWA 2OOTA 1Y8RB 1V4RA 4KOWA 4ENKA 1O3SA 1G3TA 3OYEA 3JRGA 2AQFA 1PP7U 4HRIA 2Q0YA 2DCEA 2W82A 2QJ8A 2JSCA 2XRNA 2ZSHB 4NBQA 2GFQA 3D0SA 2PR1A 5ILUA 1OCZH 4IF4A 4LLLA 4A2UA 4B11A 2OC6A 1TWFJ 1X4OA 2UXXA 1R23A 3LAJA 2JA7J 3H3VK 4UIAA 4DZJA 3L2UA 5KTAA 4H0EA 1D1CA 2V79A 3WG9A 4HDVA 1YREA 4KVXA 1BC8C 3BQZA 5IPAA 5FLXK 1ON2A 2WY8Q 1LNWA 1XGNA 3V8LA 5JGFA 5CPRB 4DQ2A 3RCOA 1SFXA 3PJRA 2G9DA 2F4MB 3GUXA 3C2HA 3CCLI 3WTTC 3K2ZA 3V7CA 2WPWA 3FECA 3L2NA 2DA7A 3KZZA 3EO4A 2VBQA 3FB3A 2VL1A 2XKOA 1QRYA 1RXTA 2VLAA 2Q7BA 2H1LA 5J4YA 3CCEI 2WAFA 3FRMA 2V4JC 1CX8A 2AFWA 2L3DA 4M74A 2KDZA 1P4NA 1LEAA 4IQ4A 3DPLC 2KIUA 5DD8A 2VQYA 4A39A 2KT0A 1YW8A 1TT0A 1K6YA 2EK5A 4D0PA 2KKOA 2B3VA 3N5FA 1U8BA 4AWXB 2R92J 4KOSA 1KONA 1SANA 2O4HA 5ILSA 4ETSA 4P4JA 3K2KA 1FY7A 1R5GA 1NHAA 3LQRA 1Y1WJ 2QSHX 1U5TC 1MKMA 4LG0A 3JRHA 3H3UA 3GY9A 5JR3A 3HDDA 1TIQA 2QKLB 1ZREA 1J09A 5GADJ 1TW3A 4A3LJ 3ASNH 2DFEA 2B5GB 5LYDA 2VBYA 2W00A 2XGDA 3LSRA 3S8PA 4YGOA 3M1EA 2EWBA 2KIFA 1UB9A 1H8LA 2QBYA 5J1YA 3KHXA 1R1UA 1KUYA 3B3SA 3CF5F 3S14J 2CUFA 1ACIA 1HKTA 2WA0A 3L2CA 1ZELA 4RS8A 3EUHC 4JX4A 2E5NA 3KCCA 4AIDA 1UHSA 2WADA 2CQNA 1W0TA 4DYCA 2F6CA 1FLIA 2CMPA 1EH7A 2MG4A 1W5SA 2AQEA 2YX7A 3BQYA 4XONA 1VQLI 3ESWB 1E3HA 4A32A 5HDGA 4AU7A 5F04A 4RS2A 4A0ZA 4CZCA 1Q1VA 3I3GA 3C1DA 2OZGA 1Z91A 1S3JA 4MMOA 1XE4A 4MRIA 1ZLIA 3M3YJ 2DK5A 2X1EA 1YS7A 2FEZA 3TE4A 6CPAA 5IYDJ 3J81K 4U87A 1WCMJ 1Y0NA 4II3A 1EH8A 5HNHA 4GGGA 3B3TA 2NYXA 2NNYA 4Q48A 5LRRA 3LMSA 4LB5A 4HNWB 4PDKA 3DFGA 3F6OA 3TO9A 4EM0B 2OH1A 2W57A 2CF4A 2FMYA 3HSFA 3F0AA 1FOWA 3P7NA 5BNGA 3AL0B 2C27A 1RTQA 2XEJA 5F1JA 5FKKA 4OMYA 3G2BA 1MW7A 3ZCOA 1YRNA 3EC4A 4V19K 3ASOH 4OLLA 3DBLB 4HZFA 1H88C 2ZKZA 2LNBA 5K7ZA 3BCBA 3TP3A 2OJED 3SI0A 1R71A 1Z8LA 4BQOA 2K86A 2QGUA 3BT9A 3OYDA 3REOA 2NS0A 3ZQIA 1X3ZB 3PO2J 1CG2A 3I9V2 2P7CB 4A5NA 1ON1A 1ZG5A 3B3VA 2RQQA 3WTSC 4KMUX 1GDTA 4F6AA 1LKXA 2DT6A 2PJ5A 4IHVA 4XRSA 2HV2A 3K69A 3CTAA 2VC0A 1F57A 3CT9A 3DXJF 4OINF 4EVIA 1JGSA 1TQPA 2Z10A 4ZYHA 2KDOA 2WV1A 3BG9A 5KCMA 4X2TA 3WC5A 1Z8TA 2TCTA 2BY3A 2HTSA 3EQLF 3SYTA 2GLFA 1FSEA 3FH4A 1TKHA 1D5YA 5DM6F 1E17A 4A3IJ 2P0WA 3KFWX 4X0GA 3FXTA 1Y0UA 1QSNA 1A6IA 2PRQA 2RAEA 4CAWA 3QB8A 1GYTA 2BYVE 1DE4C 1SAXA 4BBHA 2XB5A 4A5MA 2EIJH 5H20A 3LNQA 3OYFA 2YNCC 3C26A 1FYMA 3S3MA 4UB8C 4HBLA 3I64A 1WI9A 3VYSB 3DTEA 5BQTA 1RZ4A 1W7PB 3WTWC 2CV0A 4AIHA 3OYGA 4AG9A 2K9QA 3FF5A 5E79C 3T1BA 3IWWA 3DPTA 2I10A 2VQLA 4N4NB 2A69F 5F64A 4IHWA 3RPUD 1ZN2A 4KA4A 2E5ZA 2M7BA 4XRFA 2IJZA 3ISXA 2OTJI 2PQ8A 2NSMA 2VBWA 1FOKA 1Y0RA 4E7LA 4Y52J 1IUFA 2WUUA 3OYMA 1HA8A 3CCUI 2RV8A 3A0HC 2CQQA 4XORA 3FMCA 1SQHA 1FEXA 1W0UA 1CP6A 4B44A 4YFNF 4UBRA 5A27A 2HOSA 3AG4H 2Z3OA 2E1CA 5G20A 2ZNYA 3J7ZI 4NFRA 2W4SA 1MMSA 3NQOA 5J1QA 2EBJA 2NS8A 3KZYA 1A31A 1ARLA 2KZGA 2XRLA 4CRZB 5AG7A 4DJLA 1USTA 2QECA 2KPMA 3M8EA 3HOTA 2FJ1A 1AU7A 2Y31A 2IA2A 5ICCA 4B43A 1YX0A 3JSOA 1E3OC 3DQVC 4I76A 1O3RA 2DODA 5I4MA 5D6EA 3BZKA 5BPIA 2B5GA 5GCNA 4F8ZA 3ELKA 3HB9A 2PJ6A 2VXKA 2JQ7A 3S1NJ 1UZCA 2HPIA 3PSIA 1MK4A 4YIIA 4CDGA 5E8GA 1G3WA 4DBQA 2D4OA 3VWDA 3IWEA 1M4IA 3OL4A 4BQNA 2REFA 4CH7A 1IRZA 5HDNA 3KGQA 3OWCA 1LCPA 4BKXA 4MHGA 4MY0A 2HXIA 2KCWA 4NCZA 4DYRA 1EA3A 4HF2A 3VODA 3LOCA 3TBIA 2IS1A 3G1OA 4Y33A 5CVIA 5E3OA 2Z9OA 3CC7I 1W5TA 2NNNA 3NH4A 1FWZA 4QC6A 3RAMA 3D2MA 4K3NA 5HNFA 4XL9A 2OQRA 2ANPA 4X3RA 2E2HJ 2RFHA 3RO0A 3E6DA 3CCSI 1I12A 2L9SA 1WWXA 3V38A 1GHCA 2LG4A 2E35A 4UVCA 3JRAA 1J59A 4HF1A 3B3WA 1D8JA 3B3CA 3OL3A 4BD9A 5J40A 5F6FA 2O5RA 2CUZA 4NJQA 3ZZIA 1LANA 1WQ2A 5F0CA 3AAFA 2VQHA 3Q0UA 3K4CA 3F0CA 4ON0A 1PDNC 2CV2A 2GU2A 3F8KA 2ZW4A 1A35A 4MFZA 3NWTA 4D1QA 2P6EA 1Z67A 1FP2A 1S7OA 4DZPA 4PCQA 2FE3A 3KETA 4WXCA 2LSOA 4IOCF 4J3GA 3BPXA 2AXTC 3WTVC 3HEFA 4XN0A 1YO5C 3ZPLA 5AGEA 1MNMC 2HOAA 2Z3KA 5FKOA 4DIQA 3KEOA 4F55A 4G8XA 1JQGA 2KJCA 3L00A 1VIXA 3RZAA 1ZAOA 2ZEEA 1FYKA 2FUG2 2Q51A 2ELKA 2YS9A 2ZJPF 2JBKA 4R9MA 4LIUA 2HYFA 2XGXA 2RGVA 4LK1F 2XEFA 4Z65A 2MH2A 3RJPA 4AD9A 3GF2A 3JR9A 3IWGA 3LSMA 3A02A 4BHPA 4ITVA 1BO4A 3IEHA 3NA6A 4CGLA 1T0FA 1WH5A 1SFUA 2V1UA 3KKWA 3LFKA 1BN5A 3GX4X 1QSMA 5DTDA 5L3BA 2ZXVA 5ERIA 2A07F 1U6GA 2BE5F 4CS0B 8CPAA 4B5OA 1PUAA 1X1PA 4MEYF 3Q9SA 3JAMK 3VATA 4OIOF 2DXQA 5JM6A 2ETHA 1Z0XA 2DMQA 3S17J 3ISPA 2R8VA 5K5QA 1XMAA 5JI6A 4G1PA 4I0AA 1TNSA 3LL7A 5FROA 3COAC 4ENMA 2BO9A 4TNUA 2IGNA 4X5KA 1ZK8A 3KYLA 3LSHA 2CGPA 3ZQFA 3FEEA 4OAYA 3HOXJ 3LA3A 4HYEA 3TT2A 1P6RA 4OC2A 3LFUA 3NE8A 4P4EA 3WC6A 3IAM2 1NG7A 2W85A 4OIRF 2C6YA 3A03A 5CYVA 3VYRB 2FF4A 2QWWA 4AG7A 2LLKA 1TQMA 3IH2A 2PJ7A 3QODA 2V8VA 1Y56A 4J19A 2VJIA 2OB0A 6PAXA 4BBSJ 3MRUA 5LGNA 5L3EA 2B0LA 1D3YA 1W7PA 2O8XA 4E2AA 2WTEA 3IU1A 3PGPA 3IRRA 3VH9A 4A3GJ 1DP3A 4EATA 2JPBA 3SFIA 2PC1A 4II2A 4KN7X 1LRZA 2R7HA 4DW6A 2ZELA 4GXOA 3RYOA 2DI3A 2F5FA 4ZYGA 3HRTA 2PMZN 3R0JA 2FVGA 4B4CA 3BG3A 3RTRA 3IV5A 4B6ZA 5D6FA 3B2YA 1IG7A 2ZW6A 4R57A 5D5WB 4QB9A 4ZX9A 3RKYA 4AC0A 2FL4A 1ZGAA 2Y2ZA 3S1QJ 1TQIA 2F5VA 1D8KA 3KEYA 5A2QK 5DS9A 1V5GA 4U9YA 1OCTC 2NVQJ 4OKOA 3QPHA 4FE7A 1TBXA 3KHZA 3CCYA 4M6IA 2KL4A 1D1BA 2GOMA 1B4AA 4A0XA 3LQQA 3EYYA 1A5JA 3FXJA 1QPMA 3FXKA 2WYRA 2OCEA 1XOVA 3GW2A 1IOFA 2A5YB 2G0EA 1X4PA 3PO3J 3NWSA 3ZMVA 3PB7X 1S29A 3S1RJ 1Y6IA 3HSEA 1QO0D 4XLAA 1QGPA 1XN7A 3BWGA 3GKRA 3R95A 3I0TA 1MH3A 2PMHA 1OJLA 1IB1E 3FXOA 4G94A 5J8FA 1FT7A 1BOAA 2F48A 2CW7A 1AOYA 2DDBA 2FIWA 1JT0A 2L5QA 3LSKA 1DUXC 3H36A 1FT9A 5H6QA 3CZ6A 2R7WA 3FM5A 3TP0A 4D9JA 3HRSA 4HX7A 2C6GA 4P4BA 2DA5A 4OMEA 3FEDA 4MCPA 4I7HA 5K5RA 2JVGA 2WWYA 4CCOA 4Q38A 3E3VA 5E3NA 2F5CA 1MMNA 2IGKA 4BE2A 4IOAF 4NGPA 4CGNA 3E97A 4ZDOA 2E71A 4CYQA 1OCCH 3O8HA 2ZENA 2GIVA 1ZRCA 4BDYA 3FHZA 3UY5A 1T39A 2GM4A 3BLNA 5CKTA 2HTJA 2ZSIB 1XMXA 2P6FA 3G6EI 4OADA 1BI3A 3K4KA 1VQKI 4M9XA 1HXDA 2W48A 2HQRA 4P1WA 3M4OJ 2L02A 2W7NA 1JJ8C 2Z16A 4PXCA 1VHSA 1BW5A 4RA2A 1RR7A 4LD5A 5CBMA 1VHOA 1Z6TA 4HV5A 1Z7LA 4MFEA 2W25A 1ON0A 1WWZA 1YLOA 3DP7A 1ELMP 1MJAA 1X19A 4M6YA 1EJ9A 1Z9UA 3S3NA 3LD2A 2IA0A 1U5TB 4YFJA 3MEXA 4E7ZA 4KYWA 3HBLA 1FBQA 4MGRA 2R7SA 1P4WA 1D0ZA 3G71I 1WZ2A 2DFHA 1LEBA 2RN7A 4PJLA 1C0WA 2V9VA 3CLQA 3K9TA 3GTOJ 1CJWA 4ZC3A 2X0LA 2LKPA 2OD5A 3TW6A 2DK8A 2UXNA 4DBRA 3GTJJ 3OSFA 2PJRB 4NC8A 3ZRGA 2IVMA 4ZTFA 3S2WA 4E8OA 5FGMA 2Z99A 3GLXA 2XUBA 4Y49B 5FVJA 1DPUA 4Q4ZF 4TV7A 2EB7A 4PJJA 3KQXA 1F2PA 5E18F 5GAEJ 1P2FA 2KRFA 2PJ9A 4IF5A 4XSXF 4ESFA 1U6MA 1REPC 2GWRA 3JW4A 3K4NA 5HS9A 1IC8A 2H1KA 4QWQA 2ECBA 3BC8A 4MHDA 1MBHA 1ELLP 5LRKA 1MJ9A 5E1XA 2ZB9A 4JX5A 5E1ZB 1YQEA 5BMZA 3EFAA 4L0YB 3OSGA 2PJ8A 3PUBA 1HF0A 2AHQA 3GMEA 4BL0B 1FBUA 2A3SA 3ZR8X 4E7HA 1SVOA 2V6EA 4HNTA 3CJRB 4KNYA 3JTHA 1YQAA 3VWBA 1OCOH 3S2DJ 1ONVA 2R7ZJ 3O2PE 1FMWA 1O4XA 1MSFC 5K7HA 2DQLA 3N4MA 2R7XA 1LFBA 2JK3A 2M0CA 3HHHA 4N4OB 3ABMH 3ZXSA 3R9EA 5IP9J 4FD7A 1POGA 2I5UA 4XPKA 2BXZA 2XASA 1S5KA 2BL1A 3VYUB 2A68F 5K7FA 4P4FA 2M0MA 2JRTA 3LA2A 3R60A 3RBUA 1P9QC 4OIDA 3FK7A 3F3XA 1OISA 2FX0A 1DP7P 4R7MA 4PXBA 3BJAA 4RDUA 3P9CA 5E3MA 1ZGJA 1F43A 3QYBA 2LBFB 3NEUA 4B1RA 4L9NA 4JJXA 3JUWA 1XMKA 1QHGA 2E1NA 3Q0WA 3PZJA 2M30A 2YU3A 3OYJA 2CTCA 4UFXA 2V77A 2W24A 5FLXZ 4E7JA 1TLHB 1IF1A 3FZVA 2BSWA 2K85A 3RYRA 2VKHA 4RI1A 3QP6A 2K27A 1BLLE 2WBMA 3FM3A 3GCMA 3L7WA 1QQ9A 1BI0A 2MW8A 2Q1ZB 2W84A 2R7OA 1ETVA 2R7QA 4EQQA 1X3WB 3P5JA 4N9HA 5D5VB 4L18B 2DT5A 2DPSA 2FCKA 5ELYA 2H5MA 4C2ZA 4PJNA 3LACA 4LOCA 4CHUA 2LR8A 2OPTA 2X6OA 4ZBGA 4WXDA 3F5BA 5IY5H 4KSFA 5BWAB 3GFLA 3H1CA 2G7UA 2YX4A 2IAIA 5FB2A 4R6TA 2I79A 2D2WA 1MZBA 3H9GA 1ZGWA 1BIAA 4KISA 2ZBKA 3DF8A 1YSJA 2EFQA 2ELJA 1YI2I 3PBEA 2PCUA 1HCRA 4MHNA 1S9HA 1R5HA 4B8XA 3JRBA 1YJNI 2XKPA 3N97A 4AVCA 2Z3NA 1JTYA 2WB1N 3GVAA 2JBJA 4CUGA 3VSLA 3DDDA 5HVHA 3GXOA 5C88A 3I5UA 3PB6X 5LYIA 3K9UA 4UUSB 1PUEE 2JLMA 4KLWA 1Z8XA 2GXAA 4B12A 1ETWA 4P45A 2IGMA 1O3TA 3T0YA 3T90A 2H27A 4F0YA 1HLVA 3BZCA 4CCJA 1YIJI 4OAZA 1JT6A 1SVLA 1XB4A 1P92A 3PIPF 1RUNA 2J9AA 2PFBA 3QAHA 4FWUA 3I54A 3VPRA 3J80K 1PJRA 3QOEA 1YX3A 4MQ9F 3BR0A 4FE4A 3GYHX 4HPQA 4C3HJ 4UWIA 4JYWA 4OMZA 2OUMA 1HQCA 2C6PA 1YE9A 4ZZDA 2XIGA 3QYFA 1R57A 3QRFF 1QHHD 2PSWA 4X1EA 2NVYJ 3KZIC 1U78A 2OZHA 1HW1A 1U5TA 3FXMA 4MO7A 4XRMA 3J81Z 1YIOA 2M7AA 1S8NA 3ZN0A 2JA8J 5FKMA 3D2PA 2CUJA 2OA4A 4JD6A 3LSJA 2L9NA 2VPRA 1UCRA 1IXCA 4XPDB 4R8FA 2HPMA 2LREA 1ZLHA 2PJRA 2ZEPA 2ZMEC 5GPCA 2I00A 2CJJA 4MHZA 2KQRA 3OS0A 3IWZA 2HS5A 2LDUA 5H6RA 4EJTA 5D5XB 4PK3A 1MSEC 3ABKH 4HQEA 1QBJA 4UUVA 4C7IA 3I59B 4RAYA 2FMLA 3PEIA 1ULYA 2MC4A 2GZWA 2V26A 3EUHA 4UV9A 4BHBA 5FKLA 1USSA 4BINA 3ZMUA 1NE9A 4HEA2 2JDDA 4AUXA 2HZDA 1P7IA 4C68A 4KS9A 1OQYA 2H94A 1O7FA 1Z3XA 4MBUA 4CRYB 2DA3A 5AG6A 3CD6I 3BOQA 1N77A 1O3QA 3R9FA 3K1PA 1ZQ3P 3M8FA 5DEQA 3AFHA 1I27A 1YITI 4GS4A 2PVWA 1F1ZA 2QA4I 2ZEFA 1U3EM 1B59A 1PVEA 1R7JA 2DTZA 4CAEA 2DMPA 1YW9A 1QZZA 4M6GA 2EFNA 3QAYA 3K1MA 4IRHA 3VSKA 1SFEA 3VB2A 3KP4A 4AIKA 2Q2EB 3DSBA 4ONWA 4GYIA 1X1BA 2PRBA 4V2FA 5FLMJ 1ZRDA 2B63J 1NSAA 2IGOA 2CNSA 2EFWA 1JKOC 1MNDA 2PIZA 5J4VA 2QSFX 1M4LA 3BP8A 3FMSA 1PYTB 1JKPC 1MGTA 2IS4A 5ILVA 2R1IA 3FMRA 1UHMA 3I53A 3JRUA 3GZ6A 3BCAA 5C4XJ 3SQNA 2BY1A 2HKOA 3BR2A 3GYAA 2PIYA 2LBFA 4ZY2A 2HI3A 4ZY1A 5J1RA 4TWEA 5E1WA 1BOBA 4XPLA 1R43A 2Z33A 5D8KB 4UEFA 2CQKA 3QOPA 4X8IA 1XRYA 2GA2A 1GXPA 1EF4A 1MBFA 2F8HA 1TT5B 3K0LA 1R3NA 4L9TA 4AVBA 5IX3A 2L54A 4UF4A 5H84A 2PVVA 1DGRM 4ZI6A 5ICEA 1ZARA 1AA7A 3RPQA 4Q36A 2QKMB 3WC7A 2H8RA 3FIXA 2FQ3A 4RAZA 3ABTA 5CQEA 3F21A 2XSJC 1VQPI 1HOMA 3DNSA 3EY5A 2WB1A 1K4JA 3HTSB 2M4KA 2G0BA 4NJRA 4BGDA 3OIOA 5LD2C 3I56I 2EZLA 5KHDA 2R5ZB 2LK2A 2VT3A 3RIRA 4IX7A 4G7ZF 3E7LA 4KDPA 2IQ6A 3BZ6A 3L2QA 4M3GA 4XLPF 5L3GA 3RQ4A 3GO5A 3CCRI 3ROUA 4PGGA 3NH5A 5J47A 2Q44A 2OCCH 1BW6A 4O6JA 4MCQA 5KNLA 5D8NA 1ETYA 2H8WA 4BJ6C 5KAFC 4A2ZA 4UCMA 2HB6A 1SC7A 1JUSA 1I39A 4UUSA 1LE8B 3ML6A 4AIJA 2K9NA 4U0VA 1GXQA 5F1RA 1YW7A 5AIQA 3S2HJ 1G4DA 4BS9A 2B9SA 1U0JA 3ZQCA 4YRVA 4BJ5C 4II9A 1M1EB 3FXQA 4M71A 1XSVA 2W1OA 2BEOA 4P96A 5CVRA 2VIXA 2LC2A 4Y3OA 4K30A 1KYWA 2ZCWA 3BJ8A 5EEHA 3SJMA 1L0CA 1XD7A 3JTKA 2F5DA 4HW0A 4QPQA 3KL9A 4KOVA 1K4TA 1JJ6C 1JGGA 2F5EA 3H9QA 2XAHA 5D4RA 4KORA 4M3EA 4IHTA 2IS6A 1ARMA 2PJ2A 4G6TB 4D7NA 1A36A 2MC3A 5D4SA 4NB5A 1Z4RA 1KU3A 3HL2A 2VXDA 3OIQA 2P5VA 5CQGA 4CCKA 1APLC 3MWMA 1B9NA 3TC8A 3BXMA 4UVBA 1IRGA 4A38A 1T08B 2OU2A 4ORFA 1IXSB 3HGGA 5HS7A 5IV0A 5E8IA 1CBXA 5HXDA 1GV2A 3Q5FA 4XLCA 2O61A 1XCVA 4ZDLA 3CP8A 3W6KB 4XNFA 1UHWA 4GYGA 3BHXA 1OMIA 4ZDPA 2LH9A 4F91B 1DU6A 3EXNA 1XFOA 4QBJA 2R7FA 3ZMZA 1KUXA 5ICGA 1H89C 2GANA 5LFAA 5LHGA 1UG2A 2GE3A 1JHHA 1WH7A 3W6JB 4XOPA 2HQAA 4CYDA 1ORKA 2FQ4A 4A6EA 2X6XA 4JK1X 5F08A 1TL8A 3VWEA 2LKSA 3I59A 1FP1D 3CJNA 4DJAA 1QZEA 1HKSA 1CPSA 1LAMA 4PGHA 2NOGA 3RZOJ 4B14A 4D7MA 1WPKA 5JH9A 5CLSA 1SEUA 3CF2A 3CJTB 2V1XA 1KQ9A 4FD6A 2POKA 3FBUA 3JVNA 4RLFA 1HDDC 1F5TA 3L2VA 3F8NA 1P7JA 3CZXA 1IN8A 2EV5A 5EDNA 3X2QH 2CO5A 4MNUA 3F22A 1J4JA 2HQYA 2X85A 3P9IA 1ZG8A 3LSGA 5EZGA 4YG2F 5EC4A 2EWNA 4YFXF 4KUBA 2EV6A 2WAEA 2CTBA 2ZEHA 3JAMZ 4MEXF 2X7BA 1BI1A 5HODA 2ZEOA 2J8NA 4B10A 3TMOA 2XPVA 2Q2EA 1LOKA 2LY1A 2V8GA 1F2OA 5G21A 4Q5SF 2ME0A 4KUAA 2E7XA 2TDXA 3TQNA 2F5IA 1Y7RA 3WTXC 4RLQA 1S60A 1VGYA 2MD0A 2M8EA 1I1GA 1XSDA 1AWCA 1HEEA 2ZW7A 1X10A 3CJQB 4F7ZA 5KVRA 2UZKA 5IT3A 4R8HA 5J8CA 1XJOA 1XGOA 2MYSA 4C30A 1ZKGA 2JRMA 3TO7A 2BOAA 2ZFUA 4FUUA 3WABA 3BI1A 2XPUA 1IN7A 2EBIA 2PMUA 4FT8A 3D5RC 4M3FA 1OLTA 4UXNA 2ZXIA 4RB1A 2Z3YA 1E3PA 4HNYB 5DYMA 2H09A 3VARA 3GTQJ 4HNXB 3CDLA 4P4IA 4XNHB 2NVTJ 3V8IA 3FHNA 2K4JA 1N25A 3KLNA 4FAIA 4J00A 3ZQ7A 1MBJA 3HRMA 3TDUC 1TTYA 4DYQA 2AFSA 4PK4A 4ESJA 1JKQC 1K6OA 5CVJA 2DXIA 1D0YA 1W5CC 3BROA 5FJ8J 3QWLA 2O0YA 5BOXA 2VE8A 2WAQN 2YPRA 2Q0OA 2J5OA 3MN8A 1BJAA 2K3PA 2R5ZA 2PLYA 5A2QZ 4RAFA 4BE1A 2B4DB 1HW5A 4F9UA 3ABLH 3RPUA 1F9NA 1G3YA 2F2EA 5LEKA 4EFDA 2NMTA 4U0YA 1VQ4I 1XX5A 2EIMH 3D8PA 2XSDC 1KWMA 1HDPA 4PXEA 1EH6A 3BLYA 3QYEA 2IW5A 4LITA 2EK9A 3CXQA 1MBEA 4OC3A 3I71A 4UEZA 4YIRX 2MLKA 4R87A 5F49A 5FO5A 1LE8A 4NHJA 4KZTA 5D5UB 2X4HA 2QSGX 3ZQHA 5J6XA 4WCGA 3LMMA 2LKXA 1OR7C 4UEEA 2WC2A 2X48A 1R4NB 4CZZA 5FRNA 3FXRA 2EPFA 2KRCA 2ME6A 3A0BC 3H0DA 1YR0A 4YU9A 3C3WA 3W6XA 2HXOA 3H92A 4ZYQA 3TKYA 1ENHA 1IU8A 1IOIA 2AJ6A 1B1BA 3I55I 3OYIA 3JRIA 1IZ1A 2EA2A 5B1BH 2VEZA 2VODA 5IP6A 4R76A 2D1VA 3GZ5A 3PUFA 4IVNA 2UWMA 3D7GA 2VN2A 4DGWB 3HPGA 3KIOA 1GVJA 2CQ7A 2AS5F 3IO1A 5HMNA 3DLLF 2VC1A 2E1OA 1DPRA 4CPAA 1LVKA 4RM3A 4NC7A 2ZJRF 1FIAA 1R5ID 3FKJA 3SZGA 5DWNA 4IHYA 2G3AA 2JN6A 1TF9A 4PJ0C 1K78B 1UWYA 3GLJA 4O23A 2EJRA 3H5NA 4NGNA 1STZA 4A3JJ 3G1MA 1R9TJ 1MH4A 1XG1A 3B6CA 5JLWA 3SFZA 3G73A 1MDMB 3LWFA 4U0WA 2BOLA 2HYJA 2HOEA 3ZQLA 4KUMA 3SXOA 2G7HA 3MZYA 3DU6A 1LB2A 1UFHA 5LHHA 3LODA 3RKWA 4YWYA 1ODDA 3DKYA 4CCNA 4S04A 2ZXWH 2IPQX 1LDKB 4HOBA 5H2FC 2HEOA 1I1SA 2IMOA 2VZZA 3FF3A 1XGMA 1QVTA 1TWGJ 2EINH 2Z2SB 4K2EA 3IL2A 2HUZA 1IGBA 2EQRA 2HOTA 2JSPA 5I0CA 3F8BA 1S5LC 2V6CA 3V42A 5M5XJ 2MA3A 4B3AA 3LWUA 3S6GA 2EZIA 4I49A 1N71A 1QA6A 4RGXA 3OYNA 4ZYEA 3KP5A 3DEWA 4OIPF 2EFPA 3KE2A 4Y4RA 1H0MA 1ZG3A 2BHZA 2GLJA 2V8HA 3HOSA 2VQGA 3IUOA 3PNTA 4NQWB 1J75A 2OZUA 3HG9A 3Q3SA 3FXLA 1UELB 2BV6A 3KX2A 3DGVA 2CFXA 3SJFA 2VJ4A 3T8TA 2P6GA 1S72I 5HLHA 4YIFA 4PSWA 3K6GA 1VQ5I 1I6XA 1YJ9I 2YUSA 2MH9A 3L09A 2NVXJ 3U1DA 4NGRA 2DBBA 3FISA 4CCMA 2AFMA 2AFOA 4KMFA 3OYAA 1TP4A 3DU5A 4FISA 3BG5A 2Y0SN 4RMNA 2X9DA 3GUDA 3NARA 5TRDA 2ODFA 2HC9A 3OY9A 1ZYRF 1NH3A 1IGNA 4RAGA 3HIFA 4A3MJ 2GAUA 4BYYA 1QSOA 2ZMEB 4BACA 3J7YJ 3GIUA 1XTAA 2D4PA 2DF5A 1X2MA 1FTZA 1NTCA 1HDQA 1CPXA 3GB0A 4MFLA 4HV6A 5LRSA 4XNHC 2ID3A 1VTNC 4HX8A 4MHYA 4FETA 3ZOBA 2WAQA 2QEXI 3CO6C 2YSRA 3I9SA 4C2XA 4J01A 2N8GA 2DT7B 1UG0A 4NC6A 4P9FA 1IJWC 5CPAA 1T98A 1BR1A 5H86A 4RB3C 4MFPA 2CFOA 1YTYA 2B3UA 4Z6YA 3N7ZA 3CCJI 4G6DA 5EEAA 2B4DA 1HSJA 1QMUA 4QUSA 3SJEA 4EGZA 2M3AA 2EZKA 3J7AY 3EDPA 2JMWA 4RBOA 1NMTA 3D5LA 1CP7A 2Q04A 4IPAA 2O8KA 4BBRJ 3A4CA 2E1MC 4I02A 2NRAC 2YNEA 4OC4A 1M4DA 1XIXA 3ECHA 4HAMA 5JHFA 5K8MA 5GTIC 3DEUA 3CDIA 3AG2H 2WZNA 2EVNA 4BY1J 3VOEA 4MCSA 1BJZA 1RETA 1S7LA 2DLLA 2VJ5A 3WE3A 4D5CA 1A6QA 2D45A 3HLPA 3PBBA 4BEHB 2CY2A 2OF7A 1T0FC 4JZ0A 2QF7A 1ZG1A 1JKRC 2OAZA 3K4JA 4M6HA 2JEWA 3IKVA 1YW6A 2AFZA 1JE8A 5GAHJ 5FFXA 4MLOA 2M9HA 2GXBA 3WGHA 3JSPA 3TFYA 2XHKA 5HDKA 5JPHA 3BR5A 5L3FA 1BC7C 3PQKA 1OFCX 3CUQC 1AKHB 5DD4A 2P8TA 3NFZA 4EV0A 1P4XA 4XLFA 3HPHA 3ABUA 1W36D 1DGWY 1TWCJ 1BR2A 3CLOA 3J80Z 4EMEA 2KRHA 4O5VA 2M8GX 3HZJA 2QZ8A 5HLIA 4Y17A 2L7KA 1T2KA 1K78A 3KLOA 2ZEGA 2BXYA 1PUFB 4IAVA 1NSLA 4XQFA 3OOUA 4WWCA 1V5FA 2DJNA 4UUTA 3M7GA 5D8LB 4EJUA 5JVGF 3D7HA 5DV5A 5IOZA 2XC7A 1MDMA 5EF6A 3RDIA 3CUOA 3K4BA 4NNJA 2AXLA 3HUVA 3ERMA 1SFOJ 3ZMTA 3D4UA 2HVQA 3KASA 3MZ8A 5EEGA 3KR5A 1O57A 2ESHA 2FXFA 3G8WA 2K7LA 1T8IA 5KTDA 3H5RA 1WKMA 3I4NJ 2MFZA 3PSFA 3ERED 4DUKA 3W2WA 5HLTA 1HW2A 4QSHA 2QMLA 2GLOA 1R1TA 5FLVA 2LF7A 5K1YA 1VQ9I 4GO1A 3HRUA 3SZPA 2Z3PA 1HKQA 3WTUC 1U9OA 1VFCA 1S7KA 1SD6A 3WTZA 1MJBA 3O3KA 4E70A 3R4KA 4GM5A 3S6HA 2HGCA 3JTGA 5BS6A 1I1DA 2O03A 5TISC 4C2TA 3WT4A 4EVYA 1G2HA 2VZYA 4CGZA 3MKWB 3H35A 2FNPA 4NQWA 3VYTB 4O3MA 1IUYA 5F09A 2XPWA 2JJ7A 3HC7A 3MMYB 4EJOA 2HQ5A 4M85A 2BGCA 5ED4A 3J7AO 5E3LA 5HVFA 1YG2A 1ZO0A 2IL4A 4RGSA 3DPUA 5JHUA 1NK2P 4C2UA 2JA6J 2ID6A 3H8FA 2PMZA 2L4MA 4NEXA 4HSTA 1Z1DA 4A3KJ 2K4BA 4ONUA 2QM3A 2P6TA 4N9IA 1MNEA 4P4DA 2OV7A 3SJGA 2P81A 3HM5A 2FE7A 4MIMA 2ELHA 2AFUA 3CXSA 2JDCA 2ZOGA 4KFCA 2CV1A 4AXVA 4M3DA 4OOIA 3HOZJ 2EILH 2JUGA 1FPQA 3QU6A 2ZMEA 4M6XA 2ISYA 4I98B 3PFIA 3R6SA 3S3OA 2QLZA 4B47A 3GTPJ 1H9GA 2XDVA 2WPXA 2JA2A 2KIMA 2TRTA 4MTDA 2IEKA 2B4BA 2NXNB 3F9KA 3MD2A 2FSWA 2XF7A 4XKVA 1R36A 2XB0X 4BU2A 3TCVA 2JPCA 3JCUC 1WVRA 1SFKA 4BAYA 2PR8A 1Z7UA 4GCVA 1LJ9A 2IRFG 1Z21A 4L5EA 5E17F 1S3ZA 1YFHA 1IN5A 4CGPA 2BCOA 3L1PA 2FSRA 3E5QA 1A04A 2ZOFA 4KOUA 5FRMA 4AM3A 4EM1A 4LIVA 2M34A 4BY7J 3FX6A 4MCRA 4CGMA 2DEAA 2RKHA 3B73A 4ZX8A 4UHTA 3HOWJ 2PJ4A 1TF8A 2CH0A 2LY2A 4RGUA 3FJUA 4W97A 2HKXA 4NF1A 2RNJA 1QQIA 1XC5A 1B6AA 4G12A 2LTPA 3R96A 2VOOA 3C18A 3CP2A 3H9JA 3ZQGA 1U2WA 4XICA 4IXAA 2ZEDA 1TNTA 4MXUA 3V8KA 2DA2A 2JEVA 2R98A 1A2ZA 4UIBA 3DWLE 3SXNA 1RO5A 4HF0A 2KIQA 3OR2C 3CO7C 5AG4A 4ESBA 5GTHC 3PL8A 1W36C 1JI8A 1PU9A 4P10A 4H2KA 4CGOA 2QUFA 4JXQA 2WY7Q 4CXFA 2X6WA 4EGYA 2C1CA 3HKZN 2MD5A 2Y75A 5EJCA 1OZPA 3KP3A 2UUZA 1UAAA 4JXRA 2P6SA 2M4GA 3FYNA 4PXDA 3KYCB 4BEHA 2EZHA 3D7DA 3QPTA 3ZMSA 1XMTA 1CM0A 3KEQA 3GTGJ 5DCMB 3FBNB 3F23A 1GLNA 4ANJA 2IJLA 4I0BA 2KISA 3HTUA 2R7UA 1QNTA 1S7FA 4CYNA 4ENNA 3R9GA 2CUEA 4E7IA 4PK2A 1AKHA 1GUUA 4IQJA 1YVOA 4LLGF 3RKQA 2V7FA 4M72A 3KP6A 3B35A 5LRGA 3BR1A 3SDGA 3E6MA 3IH4A 4GRIA 1PUFA 2OBPA 2DAOA 2QYOA 2Y9YA 3KPHA 1ZH5A 3PFOA 1Z77A 4IRGA 2Q4YA 4HX4A 3F6VA 2ADUA 2DPDA 4B5PB 2EA4A 3TO6A 3FVLA 4PJMA 1IYKA 4OU0A 3IC7A 2K02A 2IXSA 3ISZA 1J2XA 2KJBA 2KMUA 5M5YJ 2A61A 3MKLA 1IAWA 4ZH4F 5A28A 3FKIJ 2FOKA 3FMQA 3ZQQA 1Z2LA 4LB6B 4C7HA 2KLOA 2V1DA 5HOOA 2QQ8A 2ABZA 4IZZA 2CRGA 4JWPA 1K4SA 1PP8F 3FIWA 3IGRA 1ETKA 3OV8A 4LGWA 5GPAA 5JVTA 4P44A 4CCLA 4ZY0A 2X1CA 1CF7B 3Q0VA 4MFKA 4OC1A 3FK6A 3MAJA 4FX4A 3S1MJ 1SD5A 5DCFA 2VL8A 9ANTA 3S32A 4L9JA 2D1HA 2K40A 2BY0A 1YLFA 3MCZA 3K10A 3O8GA 1VQMI 3H5ZA 1VI0A 2PJCA 2VT2A 1ZHFA 2Q7SA 2XEIA 2HQNA 3K70C 2LMDA 1VZ0A 1OCRH 1SAUA 4Z2YA 2ZJQF 3CCVI 3TTHA 1WK4A 1OCPA 1FBSA 2OTLI 4G6QA 3BTJA 4L5JA 3GFIA 2Q4VA 2P7VB 1KQ8A 2R0QC 2CWEA 3C2GA 4ZZLA 5BPDA 2VQCA 3CQZJ 3E6BA 2A05A 2K5CA 1Z05A 4JBAA 3AG1H 1Z4EA 1MMGA 4OIWA 3WGIA 2XF6A 2HNHA 2LYCA 1OYWA 5EGOB 3BPVA 2HFHA 4C2MJ 4UV8A 4FASD 1KGSA 5DUKA 1HSTA 2R7DA 1FIPA 1XCBA 4F92B 2STTA 2RDPA 5CVUA 2VOPA 2JT1A 2E7WA 4GXHA 1G6NA 3HUGB 4ZYDA 1IY7A 1R6RA 3K1NA 2Z5UA 1WJBA 4RN7A 2K5TA 1WJCA 3H8GA 4MHPA 1VNDA 1X58A 2V9PA 5FD5A 1RUOA 2VKDA 3MKZA 2G3TA 2CIJA 4XIDA 2EK8A 1I21A 1JUMA 4HQMA 3CDXA 1R58A 1VQOI 4B09A 2QENA 4A30A 3GTKJ 1GT0C 1EKEA 1TW2A 2EIKH 4DYOA 3WE2A 3QNVA 2LVSA 4UY8I 3A9LA 4IHMA 2M5WA 1JWQA 3SEZA 5G1ZA 2DQRA 5JQ4A 3GBGA 3M07A 5IT9K 2L0KA 3P2HA 5M3FJ 2DO7A 3MKYB 2YU9J 4R3KA 4A37A 4E6KG 1VHEA 2DTRA 3HKZA 2O28A 2YNCA 1JTXA 3FWEA 5HVGA 1VF9A 3L2WA 1VKCA 4HPSA 2FA5A 2ZXJA 5CNPA 1Z9CA 4LMYA 1Q7LA 3H5AA 3IIBA 1J7KA 1I6HJ 4BH9A 2L2OA 3E0KA 2VPLA 3DLJA 2M1BA 1TKFA 1TXRA 2O53A 3T8WA 2YNDA 1WJ5A 3G4SI 4OC5A 2Y48A 4Y49C 5HH1A 5LEJA 3WTYC 4CAFA 2VB6A 4PFOA 1Z5RA 2ZW5A 2FT0A
chains in the Genus database with same CATH topology
1N75A 2BW3A 1YK3A 2Z0ZA 3PFYA 2VXZA 2AE6A 2GIVA 4BDYA 2CW8A 2AJ6A 3DLAA 3UY5A 3OYIA 3BLNA 1YLEA 5CKTA 2ZSIB 2IS2A 2P6FA 2VEZA 4F93B 1XEBA 4PV6A 4OADA 2RC4A 2ATRA 5DWMA 3BG6A 3K4KA 2UWMA 4DGWB 4H6ZA 3HPGA 4P1WA 1XF8A 2R7TA 2W7NA 2DJIA 1Y9KA 2Z16A 4C9YA 2FIAA 1VHSA 5HMNA 1GHEA 4KSAA 4FD5A 3NE7A 1LVKA 1WJEA 1X1DA 4RM3A 4NC7A 4XM3A 3AKZA 1Z7LA 3FKJA 1WWZA 3SZGA 1ON0A 3S6FA 5DWNA 2G3AA 5E96A 1MJAA 1X19A 4U5YA 2ZXHA 2F4IA 2XAUA 1Z9UA 2CNMA 1M4GA 3S3NA 3LD2A 4YFJA 3H5NA 4BUPA 4E7ZA 4L8AA 4CSWA 4B5PA 1NG6A 4BDZA 2R7SA 1D0ZA 1KUVA 4DOZA 3H4QA 4NXYA 5KTCA 4MFQA 1P0HA 4NSQA 2J8MA 4PJLA 4JOMA 5F47A 4L89A 1QU3A 4HSRA 1FMVA 1CJWA 2BOLA 4ZC3A 4DBRA 2BVLA 3CMMA 2REEA 2PJRB 4NC8A 3ZRGA 3SXOA 4AVAA 4ZTFA 3MGDA 1LFPA 2I8DA 3DU6A 1M1DA 1UFHA 3LODA 4KOXA 4E8OA 1DQUA 2Z11A 4YEJA 4Y49B 2E1MB 4F3QA 5FVJA 4BMHA 2KP6A 2FS5A 3DKYA 4CCNA 4PJJA 4FD4A 3ZJ0A 2VASA 3W3CA 1LDKB 2VZZA 2ARHA 4BQQA 4IF5A 2HVSA 1U6MA 4LUAA 1V5EA 3FNCA 3K4NA 1Q2DA 4KVOE 3W91A 2JVHA 3IP4B 2Z2SB 2HUZA 4CA0A 3BC8A 2Z1DA 4JLYA 4MHDA 2HDWA 2JSPA 4R3LA 5I0CA 4R79A 3D3SA 4U7BA 3V42A 3L2RA 3S6GA 1MJ9A 4HKFA 4I49A 4BJTA 1N71A 4CAVA 1E0EA 4UCPA 3OYNA 3EFAA 3PUBA 4Y4RA 3I3LA 2X51A 4BL0B 3OS1A 2VQGA 3IUOA 3HOSA 3PNTA 4KOWA 3ZR8X 1KZFA 4MI4A 3OYEA 4E7HA 4NQWB 2V6EA 2AQFA 4HNTA 3CJRB 2OZUA 3HG9A 3U21A 1IIDA 4HRIA 2Q0YA 2DCEA 1UELB 2W82A 1IRXA 3KX2A 3VWBA 2ZSHB 4YELA 2RNGA 4BE2A 2VJ4A 4PUSA 1IYLA 2P6GA 4CGNA 1FMWA 4KT6A 4PSWA 2PR1A 3K6GA 3FDYA 2R7XA 4KLVA 4B11A 3R9EA 4N4OB 3ZXSA 2OC6A 1X4OA 4FD7A 4XPKA 1S5KA 2BL1A 3L2UA 3VYUB 4CCMA 5KTAA 1D1CA 2M0MA 2UV1A 4OAEA 3OYAA 1YREA 4ZYAA 1P9QC 3DU5A 4KVXA 4RMNA 4A31A 1YR0A 2WY8Q 3OY9A 2LOOA 4CAXA 3PNVA 5CPRB 3BJ7A 3RCOA 3PJRA 3QYBA 2LBFB 1QSOA 3C2HA 4JJXA 2MABA 2X6YA 3JUWA 4BXFA 4BACA 1QHGA 5HVQC 1IICA 2D4PA 2WPWA 3PZJA 4UFXA 3VDXA 3OYJA 3EO4A 2VBQA 3FB3A 4E7JA 2BSWA 4MFLA 1RXTA 3T9YA 3DEEA 2VLAA 2Q7BA 2WAFA 3FRMA 2VKHA 4RI1A 2V4JC 4FETA 2WAQA 2WBMA 1P4NA 3SDBA 3I9SA 4IQ4A 3DPLC 4C2XA 2VQYA 4J01A 2Q1ZB 2R7OA 3ZZIA 1TT0A 1K6YA 2DT7B 1UG0A 2R7QA 2B3VA 2DPSA 2FCKA 4C2ZA 2H5MA 4KOSA 1KONA 4PJNA 1BR1A 5H86A 1FY7A 4ZBGA 3F5BA 4MFPA 5BWAB 2CFOA 4B48A 4KSFA 2B3UA 3GY9A 3DR6A 3N7ZA 4RM2A 2I79A 1TIQA 2QKLB 2B4DA 3TOBA 3H9GA 3PP9A 4KISA 1J09A 4QUSA 4A33A 4C2YA 2ELJA 4OWRB 2B58A 4UFVA 2M3AA 3J7AY 2B5GB 1S9HA 2A6TA 1N78A 1NMTA 2W00A 3D5LA 2Q04A 3S8PA 4YGOA 4XPDC 3S93A 2Z3NA 4AVCA 3K4MA 3A4CA 2E1MC 1KUYA 4CUGA 2YNEA 3VSLA 3DDDA 4CYPA 1MMAA 3RSNA 1M4DA 1XIXA 2WA0A 5JHFA 5C88A 3K9UA 1ZELA 3EUHC 2E5NA 2JLMA 3M1CA 4KLWA 2WADA 4B12A 3A2KA 2EVNA 3LSIA 1D1AA 2KZVA 1S7LA 2IGMA 2VJ5A 4XKBA 2F6CA 3T90A 4F0YA 2CMPA 4BEHB 4CCJA 2AQEA 2CY2A 3E1SA 1T0FC 4OAZA 1D0XA 4XONA 4LX9A 5ISVA 1YGHA 3K4JA 2CNTA 4A32A 4AU7A 4RS2A 1G8XA 4CZCA 3QAHA 4HG2A 4MLOA 4XOTA 4E7KA 2OZGA 3I3GA 1S7NA 3TFYA 1YX5A 1PJRA 5JPHA 3QOEA 3UR3C 1YX3A 3OYKA 1XE4A 4HPQA 4UWIA 2X1EA 2OUMA 4U87A 4XN3A 4II3A 5HNHA 2WSAA 3CXPA 1YE9A 4XLFA 3HPHA 1W36D 1DGWY 3QYFA 4XR6A 1G59A 1BR2A 2VJJA 1R57A 5AG5A 3WR7A 1QHHD 4ZGYB 2PSWA 2KRHA 4HNWB 1ERDA 2OZHA 2L7KA 3F0AA 3TO9A 2OH1A 1QSTA 1NSLA 3AL0B 2M7AA 3OOUA 4XQFA 2C27A 3D2PA 1V5FA 1Z3YA 2CUJA 3OWTA 3G2BA 1MW7A 3N05A 3ZCOA 4P5OA 2XC7A 4JD6A 4CYOA 2L9NA 4NNJA 1X1AA 3K4BA 3EC4A 3R1KA 4XPDB 2HPMA 4OLLA 2LREA 2HVQA 2R4GA 3A1YA 4UA3A 3BCBA 2PJRA 2FXFA 2I00A 3G8WA 2KQRA 4BQOA 5KTDA 3H5RA 3OS0A 2YGWA 4PK3A 2MFZA 3PSFA 3DTIA 3OYDA 3W2WA 5HLTA 3I9V2 4C7IA 2QMLA 2HVRA 2MC4A 2V26A 2RQQA 4F6AA 1LKXA 2DT6A 2Z3PA 1NE9A 1B6BA 4HEA2 1S7KA 2HV2A 2HZDA 2JDDA 4H89A 1MJBA 4C68A 4KS9A 3TL4X 3W6SA 4YRHA 3S6HA 4ZTJA 1TZLA 2Z10A 1Z3XA 4MBUA 4CRYB 2KDOA 5AG6A 1I1DA 1N77A 5KCMA 4MFJA 1B87A 3R9FA 4EVYA 3DTKA 3SYTA 3EPZA 3AFHA 4AVZA 2VZYA 4GS4A 3MKWB 3H35A 4UCNA 3CESA 3VYTB 4CAEA 3HC7A 3MMYB 2KHMA 1WJAA 1V0CA 3SEQA 4M85A 4ZJZA 2P0WA 4X0GA 3FXTA 3VSKA 1ZO0A 2IL4A 1QSNA 4MY3A 3DPUA 4C2UA 4CAWA 3QB8A 3DSBA 2Q2EB 2X1DA 2PRBA 1X1BA 2BEIA 4BBHA 2PMZA 2IGOA 2CNSA 4NEXA 4HSTA 3OYFA 2YNCC 3C26A 1MNDA 4ONUA 1MNEA 2OV7A 3OMYA 2IS4A 3S3MA 2FE7A 3G3SA 4A95A 2R1IA 5F46A 3CXSA 2JDCA 3BCAA 3M8JA 3VYSB 3DTEA 2CV0A 2CV1A 3OYGA 3GYAA 4AG9A 3OYCA 4B3XA 2JUGA 2LBFA 1BOBA 4XPLA 3DPTA 4N4NB 2VQLA 2VXKA 3S3OA 4NUBA 3RPUD 2XDVA 4B47A 5C82A 2E5ZA 2JA2A 2M7BA 2WPXA 4KOTA 2B4BA 3F9KA 3MD2A 4XKVA 2PQ8A 2XF7A 4BU2A 2DPTA 3TCVA 4E7LA 2WUUA 4AVBA 1SFKA 3OYMA 2V1NA 1HA8A 2PR8A 5IX3A 5EBVA 4XORA 5H84A 3W6XA 1Z21A 1SQHA 5A27A 4B44A 1S3ZA 1DGRM 4UBRA 4CGPA 1M44A 1AA7A 2Z3OA 4KVME 5G20A 4Q36A 2QKMB 2FSRA 4UFWA 4KOUA 2W4SA 5FRMA 3FIXA 5CQEA 4LIVA 4AYBA 2XSJC 3DNSA 4CGMA 4CRZB 5AG7A 3AL0C 3EY5A 2WB1A 1K4JA 3OYBA 2M4KA 2G0BA 2KPMA 2QECA 3HOTA 4BGDA 2CH0A 2LY2A 4NF1A 4B43A 5LD2C 1YX0A 5KHDA 3R96A 4UWJA 3DQVC 4IX7A 3CP2A 3H9JA 3L2QA 2B5GA 2EUIA 5GCNA 2GOXB 3FBIB 1WFXA 3RQ4A 2R98A 2A5WA 1T95A 2HPIA 3PSIA 3OR1C 1MK4A 2JEVA 3ONQA 2Q44A 5KNLA 4DBQA 2D4OA 3DWLE 4BJ6C 3OS2A 2RREA 1RO5A 3SXNA 4UCMA 3VWDA 3OR2C 4A2ZA 5AG4A 3IWEA 1M4IA 3OL4A 1W36C 1JI8A 3PL8A 4BQNA 4CH7A 1PU9A 2REFA 4CGOA 3OWCA 4JXQA 2WY7Q 2X6WA 1MMDA 3TOAA 5TGTA 4MY0A 2Z3MA 4BS9A 1OZPA 1U0JA 2UUZA 1UAAA 2KCWA 4JXRA 2A4NA 4YRVA 2M4GA 4BJ5C 3FYNA 4NCZA 4II9A 1EA3A 4BEHA 2IS1A 3TBIA 2BVMA 2W1OA 4Y33A 4QC6A 3SHPA 2BW3B 1CM0A 2VIXA 1XMTA 3FBNB 2LC2A 4Y3OA 3D2MA 4K30A 5HNFA 4XL9A 3BJ8A 2LRDA 4AB7A 4B13A 1L0CA 1GLNA 4ANJA 3JTKA 4QPQA 4KOVA 4KITB 4KORA 1X1CA 2L9SA 3H9QA 3ZGKA 1I12A 2R7UA 2IS6A 2LG4A 1S7FA 4CYNA 4G6TB 4XMYA 3OL3A 3R9GA 4E7IA 4HNUA 4PK2A 4IQJA 1Z4RA 2O5RA 2CUZA 1YVOA 3HL2A 2VXDA 3EUAA 3OIQA 1PYVA 3OIPA 4KJZA 5CQGA 4CCKA 2V7FA 2VQHA 3K4CA 2CS3A 2CV2A 3F8KA 3W2AA 2ZW4A 4MFZA 5IB0A 3NWTA 2K9MA 4D1QA 2OU2A 2P6EA 4ORFA 4GRIA 3DKXA 5IV0A 4J3GA 2Q4YA 4QVTA 4XLCA 4ZDLA 3CP8A 4XN0A 3IU2A 4XNFA 5AGEA 3S6KA 4B5PB 3TO6A 4PJMA 4ZDPA 4DIQA 1IYKA 2Z3KA 2LH9A 4F55A 4F91B 2IXSA 3EXNA 2KMUA 4QBJA 4IKFA 2FUG2 1KUXA 5A28A 2GANA 5LFAA 3TE4A 2V9KA 2GE3A 4R9MA 4E7SA 4XOPA 2HQAA 4LIUA 3ZQQA 3VWEA 2X6XA 4C7HA 2KLOA 3K4LA 4DJAA 3OYHA 3IWGA 5HOOA 4H6UA 3LSMA 4ITVA 1BO4A 4CGLA 4IZZA 4KOYA 4JWPA 4B14A 3IGRA 3KKWA 4XKWA 4CCLA 1QSMA 2ZXVA 3CF2A 2X1CA 2E60A 4MFKA 4XNHC 4CS0B 2BUEA 4FD6A 2VL8A 3FBUA 3S32A 4C2TA 3JVNA 1PUAA 4RLFA 3H5ZA 4B5OA 3K10A 4U9ZA 3L2VA 2NOJB 2ZPAA 4XLEA 2DXQA 3K70C 4JQFA 2R8VA 2Y0MA 4PFPA 1VZ0A 1BR4A 1SAUA 2Y0SA 2X85A 1J4JA 2HQYA 3LSGA 4F0XA 2VI7A 3TTHA 1WK4A 3LL7A 3E0JB 5FROA 5EC4A 3PNYA 4KUBA 2IGNA 2WAEA 4X5KA 1Y9WA 3KYLA 3LSHA 2X7BA 2Z3LA 5F48A 2J8NA 2Q4VA 4IUSA 4B10A 4OAYA 3TT2A 3TMOA 4XLHA 3IAS2 3C2GA 2LY1A 3LFUA 2VQCA 3IAM2 3OYLA 5G21A 1NG7A 4KUAA 2K5CA 2F5IA 3VYRB 1Y7RA 4RLQA 1Z4EA 1MMGA 3BG7A 1S60A 4AG7A 2MD0A 3K70D 2XF6A 2HNHA 3QODA 2LYCA 1Y56A 2VJIA 2OB0A 2ZW7A 3CJQB 4FASD 3IU1A 3PGPA 5J8CA 1DP3A 2MYSA 3DR8A 4DNCA 4C30A 4EATA 3B8GA 3TO7A 4F92B 2ZFUA 1WJDA 2PC1A 4II2A 5G22A 1LRZA 4H4KC 4XKCA 2R7HA 2J8RA 3HUGB 1R6RA 3D5RC 4PSXA 1OLTA 1WJBA 2ZXIA 4BE0A 1WJCA 3W2VA 2K5TA 3RYOA 4HNYB 2R7RA 3P2FA 2VKDA 4HNXB 3MKZA 2G3TA 4MJ8A 4XNHB 3RTRA 4R57A 3FHNA 2ZW6A 1I21A 3V8IA 4QB9A 4J00A 2PDOA 2HU9A 2FL4A 4A30A 1WJFA 2F5VA 3KEYA 2DOAA 2QIRA 4PK4A 1V5GA 4E4HA 2DXIA 4U9YA 1D0YA 3A9LA 5JQ4A 3SEZA 5G1ZA 2KL4A 1D1BA 2GOMA 3GBGA 4E2AA 3EUKL 2K9LA 3P2HA 4M3SA 2K3PA 2B4DB 4BE1A 1YVKA 1X4PA 2CXAA 3NWSA 3MKYB 4R3KA 1Y6IA 4XLAA 4E6KG 2NMTA 4LG3A 3GKRA 3R95A 3HKZA 4QPOA 2O28A 1IB1E 2YNCA 3D8PA 2XF5A 3UNGC 3L2WA 2R7VA 1VKCA 5J8FA 3BLYA 3QYEA 5CNPA 4LITA 2FIWA 2CW7A 3CXQA 2L5QA 3H5AA 3LSKA 4R87A 1Q2CA 2R7WA 3CZ6A 3HXLA 5F49A 4D9JA 2L2OA 1QSRA 2VPLA 3E0KA 4KZTA 3D5SC 2YNDA 1WJ5A 3LMMA 1OR7C 4F52A 2JVGA 1Q2YA 4Y49C 5HH1A 4CCOA 4E0AA 4Q38A 5FRNA 4CAFA 2VB6A 1MMNA 2KRCA 2IGKA 4PFOA 3H0DA 2FT0A 2ZW5A 4CYQA 4ZDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YK3 A;  2Z0Z A;  2AE6 A;  2GIV A;  3UY5 A;  2AJ6 A;  3BLN A;  1YLE A;  2P6F A;  2VEZ A;  4PV6 A;  1XEB A;  5DWM A;  4OAD A;  2RC4 A;  2ATR A;  4H6Z A;  1XF8 A;  1Y9K A;  2FIA A;  5HMN A;  1VHS A;  1GHE A;  4FD5 A;  3NE7 A;  1WWZ A;  3S6F A;  1ON0 A;  5DWN A;  2G3A A;  5E96 A;  1MJA A;  4U5Y A;  2CNM A;  1Z9U A;  1M4G A;  3LD2 A;  4YFJ A;  4L8A A;  4B5P A;  5KTC A;  1KUV A;  3H4Q A;  4NXY A;  1P0H A;  4NSQ A;  2J8M A;  5F47 A;  4L89 A;  1CJW A;  2REE A;  4AVA A;  3SXO A;  3MGD A;  1M1D A;  4E8O A;  1UFH A;  3LOD A;  4KOX A;  2Z11 A;  4Y49 B;  5FVJ A;  4BMH A;  2FS5 A;  4FD4 A;  3ZJ0 A;  2VZZ A;  4IF5 A;  4LUA A;  2ARH A;  1U6M A;  3FNC A;  1Q2D A;  4KVO E;  3W91 A;  2HUZ A;  4MHD A;  4JLY A;  4R3L A;  5I0C A;  3D3S A;  3S6G A;  1MJ9 A;  4HKF A;  4I49 A;  1N71 A;  4CAV A;  3EFA A;  4MI4 A;  4KOW A;  1KZF A;  2OZU A;  1IID A;  2Q0Y A;  1IYL A;  2P6G A;  4PSW A;  2PR1 A;  4KLV A;  3R9E A;  4FD7 A;  4XPK A;  1S5K A;  2BL1 A;  5KTA A;  4OAE A;  1YRE A;  4KVX A;  4CAX A;  3BJ7 A;  1QSO A;  4JJX A;  3JUW A;  2D4P A;  1IIC A;  2WPW A;  3PZJ A;  3EO4 A;  2VBQ A;  3FB3 A;  2BSW A;  1RXT A;  3T9Y A;  2Q7B A;  3FRM A;  4RI1 A;  1P4N A;  3I9S A;  2VQY A;  3ZZI A;  2B3V A;  2FCK A;  2H5M A;  4KOS A;  5H86 A;  1FY7 A;  4ZBG A;  3F5B A;  2B3U A;  3GY9 A;  3N7Z A;  2I79 A;  1TIQ A;  2B4D A;  3TOB A;  3PP9 A;  4QUS A;  2B58 A;  2B5G B;  1NMT A;  2Q04 A;  4YGO A;  4XPD C;  4AVC A;  1KUY A;  3DDD A;  1M4D A;  1XIX A;  5C88 A;  3K9U A;  2JLM A;  4KLW A;  2EVN A;  1S7L A;  3T90 A;  4F0Y A;  2CY2 A;  5ISV A;  4LX9 A;  1YGH A;  2CNT A;  4RS2 A;  3QAH A;  3I3G A;  2OZG A;  1S7N A;  3TFY A;  5JPH A;  1XE4 A;  4UWI A;  3CXP A;  1R57 A;  3WR7 A;  2PSW A;  4HNW B;  2OZH A;  3F0A A;  3TO9 A;  2OH1 A;  1QST A;  1NSL A;  2C27 A;  3D2P A;  4JD6 A;  3EC4 A;  3R1K A;  4XPD B;  4OLL A;  4UA3 A;  2FXF A;  2I00 A;  3G8W A;  5KTD A;  4PK3 A;  2QML A;  4F6A A;  1NE9 A;  1B6B A;  1S7K A;  2JDD A;  2HV2 A;  4H89 A;  1MJB A;  3W6S A;  4YRH A;  3S6H A;  2Z10 A;  4MBU A;  4CRY B;  1I1D A;  3R9F A;  1B87 A;  4EVY A;  2VZY A;  4GS4 A;  1V0C A;  4M85 A;  2P0W A;  3FXT A;  2IL4 A;  1QSN A;  4MY3 A;  4CAW A;  3QB8 A;  3DSB A;  2PRB A;  2BEI A;  2CNS A;  4NEX A;  4ONU A;  3C26 A;  2FE7 A;  3G3S A;  2R1I A;  5F46 A;  3CXS A;  2JDC A;  3GYA A;  4AG9 A;  1BOB A;  4XPL A;  5C82 A;  2WPX A;  4KOT A;  2B4B A;  2PQ8 A;  3TCV A;  4AVB A;  2PR8 A;  5IX3 A;  5EBV A;  5H84 A;  1SQH A;  1S3Z A;  4UBR A;  1M44 A;  4KVM E;  2FSR A;  4KOU A;  3FIX A;  3DNS A;  4CRZ B;  3EY5 A;  1K4J A;  2QEC A;  2G0B A;  4NF1 A;  1YX0 A;  3R96 A;  4UWJ A;  2EUI A;  2B5G A;  5GCN A;  2VXK A;  3DR6 A;  2R98 A;  2JEV A;  1MK4 A;  2Q44 A;  2D4O A;  3SXN A;  1RO5 A;  3VWD A;  1M4I A;  2REF A;  1PU9 A;  3OWC A;  4JXQ A;  3TOA A;  4MY0 A;  1OZP A;  4JXR A;  2KCW A;  2A4N A;  4NCZ A;  3FYN A;  4II9 A;  4QC6 A;  3SHP A;  1XMT A;  1CM0 A;  3D2M A;  4K30 A;  3BJ8 A;  4AB7 A;  1L0C A;  4KOV A;  4KOR A;  1I12 A;  1S7F A;  3R9G A;  4PK2 A;  1Z4R A;  1YVO A;  3F8K A;  2ZW4 A;  5IB0 A;  2OU2 A;  2P6E A;  4ORF A;  5IV0 A;  4J3G A;  2Q4Y A;  4QVT A;  3S6K A;  4B5P B;  3TO6 A;  1IYK A;  3EXN A;  4QBJ A;  1KUX A;  2GAN A;  3TE4 A;  2GE3 A;  4R9M A;  3VWE A;  3IWG A;  4H6U A;  1BO4 A;  4KOY A;  4JWP A;  3IGR A;  3KKW A;  1QSM A;  2ZXV A;  4XNH C;  4CS0 B;  2BUE A;  4FD6 A;  3FBU A;  3JVN A;  4B5O A;  1PUA A;  4U9Z A;  2ZPA A;  2DXQ A;  2R8V A;  2Y0M A;  1J4J A;  2HQY A;  2VI7 A;  3TTH A;  1WK4 A;  5EC4 A;  4KUB A;  4X5K A;  1Y9W A;  2X7B A;  5F48 A;  2J8N A;  2Q4V A;  4IUS A;  3TT2 A;  4KUA A;  2F5I A;  1Y7R A;  1Z4E A;  1S60 A;  4AG7 A;  2OB0 A;  2ZW7 A;  3PGP A;  5J8C A;  3DR8 A;  4DNC A;  3TO7 A;  3B8G A;  2PC1 A;  1LRZ A;  2R7H A;  2J8R A;  4PSX A;  3RYO A;  2K5T A;  4HNY B;  3P2F A;  4HNX B;  2G3T A;  4MJ8 A;  4XNH B;  4R57 A;  3V8I A;  2ZW6 A;  1I21 A;  4QB9 A;  2PDO A;  2FL4 A;  2QIR A;  4U9Y A;  5JQ4 A;  4E2A A;  3P2H A;  4M3S A;  2B4D B;  1YVK A;  4R3K A;  2NMT A;  3GKR A;  3R95 A;  2O28 A;  1IB1 E;  3D8P A;  1VKC A;  5J8F A;  5CNP A;  3CXQ A;  2FIW A;  4R87 A;  5F49 A;  1Q2C A;  3E0K A;  1QSR A;  4KZT A;  1Q2Y A;  4Y49 C;  5HH1 A;  4E0A A;  2ZW5 A;  1YR0 A;  3W6X A;  2FT0 A; 
#chains in the Genus database with same CATH topology
 1FNN A;  1N75 A;  1YK3 A;  2Z0Z A;  1LPQ A;  3PFY A;  1L3L A;  5DCM A;  3KP7 A;  1H8A C;  2P5L C;  2XAJ A;  1LFU P;  5K8P A;  4F93 B;  1XEB A;  5DWM A;  2ATR A;  1G3S A;  2KFD A;  3RNZ A;  1RI7 A;  3I4P A;  3HOY J;  4FTH A;  1XF8 A;  4QTR A;  2DJI A;  1Y9K A;  1KA8 A;  4HLX A;  4A6D A;  1V55 H;  1J0R A;  4C9Y A;  1TWH J;  5LGU A;  2FIA A;  4KSA A;  3BTI A;  2JA5 J;  4FD5 A;  3ULQ B;  3NE7 A;  2HYG D;  4XM3 A;  4KIF A;  1HC8 A;  1FZP B;  5TJJ A;  2AFX A;  3S6F A;  5E96 A;  2MBF A;  4U5Y A;  2F4I A;  2CNM A;  1JHF A;  2DYR H;  2XAG A;  1B8I B;  4M6V A;  1OBR A;  3D66 A;  5JLX A;  3WHC A;  4B5P A;  1NG6 A;  1FSH A;  1FYL A;  1KUV A;  2GRE A;  4NXY A;  4MFQ A;  4NSQ A;  4MTE A;  3LSP A;  1X12 A;  1R4M B;  2BVL A;  2REE A;  3CME I;  2DMN A;  1IO2 A;  2FU4 A;  3MGD A;  4HA8 A;  1FOX A;  2IBD A;  2Z11 A;  1LAP A;  4YEJ A;  4BMH A;  2E1M B;  4CIC A;  2KP6 A;  2FS5 A;  4Q7A A;  4FD4 A;  5IYB J;  4A94 A;  1CQT A;  1K7A A;  2PEX A;  1OR7 A;  1FX7 A;  4RGR A;  3V8J A;  2HVS A;  1V5E A;  1RR8 C;  1OYI A;  5J3L A;  3TDZ C;  1AYE A;  2JVH A;  1CF7 A;  3H0G J;  2HDW A;  3BJO A;  4G7H F;  4R79 A;  2DU9 A;  4U7B A;  3DCF A;  1B72 B;  4HKF A;  4G9Y A;  1XMB A;  4BJT A;  5JFR A;  4CAV A;  2FBK A;  4UCP A;  5EMI A;  3BY6 A;  3BJ6 A;  2E2I J;  3I3L A;  1ZR2 A;  5FFZ A;  3OS1 A;  2BZT A;  4MI4 A;  1KZF A;  2NYQ A;  4BQA A;  3R61 A;  3F8M A;  3U21 A;  1VQ8 I;  1IID A;  1LQ1 A;  5L3C A;  1IRX A;  2CSO A;  3CUQ B;  3GTL J;  3R0A A;  2RNG A;  4YEL A;  1IYL A;  4PUS A;  1ZG7 A;  2LY9 A;  4KT6 A;  3FDY A;  5CJ9 A;  4KLV A;  2STW A;  2H6B A;  2RB7 A;  3JRF A;  3KP2 A;  2UV1 A;  2Y30 A;  5EGO A;  4IRI A;  1Z6R A;  1IRF A;  4ZYA A;  2PJ1 A;  4OAE A;  2A6H F;  1S7E A;  3MN2 A;  3D67 A;  4PPZ A;  4A31 A;  4CAX A;  2LOO A;  3BTL A;  1ETO A;  3PNV A;  1IXR C;  3BJ7 A;  1LUJ B;  5E20 A;  4A69 C;  1XDS A;  4U7D A;  2ZJ2 A;  3HUG A;  1SMT A;  2MAB A;  2X6Y A;  2GIZ A;  4BXF A;  5HVQ C;  1IIC A;  1XDU A;  5L3D A;  3VDX A;  3HYI A;  3I4M J;  4WK8 F;  1K61 A;  3T9Y A;  3DEE A;  2COB A;  1U8R A;  1ZR4 A;  5KAI C;  1QVU A;  4X6A J;  4NGM A;  3BR6 A;  2ZNZ A;  3SDB A;  4EM2 A;  1P4A A;  3NAU A;  4S0H B;  2DPU A;  1WHU A;  2E2J J;  1OKR A;  4P6Y A;  1LVA A;  4C3J J;  2MLG A;  4B48 A;  2PJA A;  4GDF A;  3NRV A;  3G3Z A;  2QCO A;  3LA7 A;  2EH3 A;  2MSY A;  4RM2 A;  3WU2 C;  1MIJ A;  5EYR A;  2XVC A;  3TOB A;  3V7Z A;  4XRS G;  3PP9 A;  4KIC A;  4Q47 A;  4A33 A;  4C2Y A;  1XS9 A;  2VUM J;  4OWR B;  2B58 A;  3KZW A;  4UFV A;  3SI1 A;  5C44 J;  3BI0 A;  2A6T A;  3HHG A;  7CPA A;  1N78 A;  4AYB N;  3A01 B;  2LP0 A;  5IYC J;  2EO8 A;  4XPD C;  3S93 A;  3K4M A;  1K79 A;  3RYP A;  5DDG A;  4GFB A;  3D7F A;  4M3B A;  4CYP A;  3WHB A;  1MMA A;  3RSN A;  4KN4 X;  4RUH A;  3SJX A;  1DU0 A;  4A3F J;  1T38 A;  4FCY A;  3IWF A;  3M1C A;  4EMS A;  3A2K A;  3CPX A;  3LSI A;  2D5V A;  2XGE A;  2JWT A;  1D1A A;  2KZV A;  2IA1 A;  2Y9Z A;  4OP4 A;  4XKB A;  2PE3 A;  5ISV A;  3E1S A;  4LX9 A;  1D0X A;  3O6B B;  1F4K A;  3WGG A;  1YGH A;  2CNT A;  2NVU B;  4A3D J;  2OQG A;  1G8X A;  1GV5 A;  3PB9 X;  4HG2 A;  3DKW A;  4XOT A;  3SZT A;  4E7K A;  1FNO A;  1S7N A;  5LYF A;  1YX5 A;  1RPW A;  3UR3 C;  1ETX A;  3OYK A;  3KI9 A;  4Y7N J;  3S9M A;  2JUC A;  1XGS A;  1ITY A;  2XAF A;  3WU1 B;  3GFJ A;  1ETQ A;  1IDZ A;  4XN3 A;  2WSA A;  3CXP A;  4A0Y A;  2XAQ A;  4XR6 A;  1OPC A;  3LAP A;  2VJJ A;  1G59 A;  5AG5 A;  3C7J A;  3B02 A;  4R1H A;  3PB4 X;  3WR7 A;  4ZGY B;  1ERD A;  3P9K A;  1B8I A;  3MFK A;  2DFF A;  3VEP A;  1F36 A;  2CW0 F;  1QST A;  2L7F P;  2RQP A;  4IHX A;  4PQA A;  3MVP A;  1Z3Y A;  3OWT A;  3MZH A;  3QP5 A;  1BL0 A;  3N05 A;  3RKX A;  1MBG A;  4P5O A;  1UMQ A;  2R93 J;  2ZO4 A;  4CYO A;  1X1A A;  3R1K A;  4FBE A;  2R4G A;  3A1Y A;  5K5O A;  5EG0 B;  2LD5 A;  2DW4 A;  4UA3 A;  3I58 A;  2CU7 A;  2HDC A;  1B9M A;  1T56 A;  3DTI A;  4BNC A;  4NGQ A;  1Z8W A;  2HVR A;  5B3S H;  2F4O B;  4ASN A;  3U1K A;  2M2E A;  2YR2 A;  1ZLJ A;  2HDD A;  1B6B A;  3CC2 I;  5LYL A;  4H89 A;  1R49 A;  3CMA I;  3AG3 H;  1B72 A;  3TL4 X;  3W6S A;  4YRH A;  3S9L A;  3GFM A;  4XLN F;  3H3Z A;  1TZL A;  2L7Z A;  4ZTJ A;  4WX9 A;  3S16 J;  3CDH A;  1BA5 A;  1Y1V J;  1W7P D;  3IRQ A;  2PJ0 A;  1SD7 A;  1B87 A;  3H8E A;  3U9G A;  3DTK A;  1AHD P;  2V8D A;  4MFJ A;  3EPZ A;  4AVZ A;  4UCN A;  2L9V A;  3CES A;  1L0O C;  4WXH A;  1R22 A;  2KHM A;  3F8C A;  1WJA A;  1OYY A;  3CUQ A;  1V0C A;  3SEQ A;  3GZN B;  3IC1 A;  4ABZ A;  4ZJZ A;  5D29 A;  2FBI A;  3EET A;  2I3C A;  4MY3 A;  1QZY A;  5THW A;  2Q4Z A;  1YYV A;  2X1D A;  2BEI A;  3ECO A;  3FX3 A;  1LFW A;  3GTM J;  3RZD J;  2JTV A;  3D68 A;  3PB8 X;  2QQB A;  2DMT A;  3OMY A;  3T8R A;  4C3I J;  3CC4 I;  3KQZ A;  5C4J J;  1LDD A;  3G3S A;  1WGX A;  1VQ7 I;  1HDU A;  4A95 A;  2FRH A;  1UFM A;  3M8J A;  4U88 A;  5F46 A;  4LQ6 A;  3OYC A;  4MQV A;  4B3X A;  4Y15 A;  2H6C A;  4JP0 A;  3SI2 A;  2O9L A;  3SXY A;  3V4G A;  1VQ6 I;  3UKG A;  3IH3 A;  3IHU A;  1QPI A;  4NUB A;  5C82 A;  2VI6 A;  4IO9 F;  4KOT A;  2P5K A;  4WJB A;  3PQJ A;  1YOV B;  2DFI A;  2PBI A;  2DPT A;  5B1A H;  1R00 A;  5LGT A;  3HOV J;  2A6E F;  1W4M A;  2V1N A;  2QVP A;  3LST A;  5EBV A;  4FQG A;  3FXU A;  1M44 A;  1BIB A;  2DDA A;  4KVM E;  2PN6 A;  4UFW A;  5IP7 J;  1Y8Q B;  4XSZ F;  2HWV A;  4V2G A;  5F0H A;  4AYB A;  1K83 J;  1V3F A;  1BAV A;  4IHS A;  3AL0 C;  4KIB A;  3OYB A;  3V7R A;  2VKE A;  4XK4 A;  3WG7 H;  2GXG A;  4UWJ A;  2GBY A;  4G7O F;  2HR3 A;  5LHI A;  2Q8K A;  1WSU A;  2EUI A;  2ZEM A;  2GOX B;  2DYS H;  3FBI B;  1WFX A;  3A01 A;  3DR6 A;  2A5W A;  1T95 A;  2E36 A;  3OR1 C;  1V54 H;  3ONQ A;  5C3E J;  2PJB A;  1E2X A;  4BHC A;  2K3F A;  3PM1 A;  1VQN I;  3OS2 A;  2RRE A;  1XSX A;  3TED A;  5LLQ A;  1DDN A;  1RRJ A;  3DBH B;  3IJ3 A;  2FXA A;  2CYY A;  2EV0 A;  2F7V A;  5K8N A;  1XPX A;  1MMD A;  3TOA A;  5TGT A;  1H9T A;  1KU7 A;  2Z3M A;  2ZFW A;  2PI0 A;  2E19 A;  5B66 C;  2A4N A;  3WOD F;  2ICW G;  2BVM A;  1O7L A;  3SHP A;  3TX8 A;  2BW3 B;  2VE9 A;  3E6C C;  4B13 A;  1RES A;  4RB0 A;  2LRD A;  4AB7 A;  2BHY A;  4KIT B;  5EZH A;  1X1C A;  3ZGK A;  4LJZ F;  3ZN1 A;  2O3F A;  3F8F A;  3NH8 A;  4XMY A;  1BPM A;  4HNU A;  1X2N A;  4HDU A;  3EUA A;  1KU9 A;  1PYV A;  3OIP A;  4KJZ A;  3TGN A;  4CYC B;  2YGW A;  1AUG A;  2CS3 A;  4W9Y A;  3W2A A;  2ISZ A;  4I09 A;  4WWV A;  2HZT A;  5IB0 A;  1IW7 F;  1J5Y A;  2CQX A;  2K9M A;  4I99 C;  5DS0 A;  4L9V A;  5DUI A;  3HSR A;  1TWA J;  1WRJ A;  1FOY A;  3DKX A;  2QYV A;  2PX9 A;  2FD5 A;  4QVT A;  4EWT A;  3IU2 A;  3S6K A;  3V7S A;  3K7A J;  1GVD A;  2VKV A;  5EG0 A;  5LRJ A;  4FHT A;  2ZC2 A;  3F72 A;  4IKF A;  5AIP A;  2V9K A;  4E7S A;  1BI2 A;  1EV7 A;  5ICF A;  3KR4 A;  3K4L A;  1BM9 A;  2COM A;  3OYH A;  4H6U A;  1D5V A;  2EFO A;  1X3U A;  2BY2 A;  5AON A;  1IN4 A;  4KOY A;  3HOU J;  2DOE A;  4XKW A;  1Y0Y A;  1PCA A;  5KK1 A;  1S6L A;  1MD0 A;  2E60 A;  1I50 J;  2ECC A;  2J5P A;  2QQA A;  5LBQ A;  1SD4 A;  1RNL A;  2R5Y B;  1RC9 A;  2BUE A;  3Q9V A;  2GQQ A;  4U9Z A;  2LFB A;  1DTD A;  2BBY A;  2NOJ B;  3CMY A;  2ZPA A;  4XLE A;  2R3S A;  4PZJ A;  4AVP A;  4JQF A;  2Y0M A;  4PFP A;  2Y0S A;  1BR4 A;  1T33 A;  2VBZ A;  4NGS A;  4F0X A;  2VI7 A;  3E0J B;  2PJP A;  1YW4 A;  3PNY A;  5K8O A;  5F27 A;  4BXU A;  3OOP A;  4I6Z A;  4EJW A;  1WI3 A;  3ZMD A;  1Y9W A;  2Z3L A;  5F48 A;  2IT0 A;  5FD6 A;  1W1W E;  2LF8 A;  4IUS A;  5HLG A;  2XEG A;  3GWZ A;  4XLH A;  3IAS 2;  3PRT A;  2O7O A;  3QPS A;  3OYL A;  1YME A;  3CCQ I;  3JRE A;  3G1L A;  5DM7 F;  1J9I A;  4KSI A;  3BG7 A;  3K70 D;  5FKN A;  1IN6 A;  4QLC U;  5GAG J;  5CVV A;  1NK3 P;  3WU0 A;  4LQG A;  3DR8 A;  4DNC A;  3B8G A;  1YJW I;  1WJD A;  3M9A A;  1KZH A;  1U9N A;  4NDL A;  5G22 A;  1FC3 A;  4H4K C;  4XKC A;  3EYI A;  3BDD A;  2J8R A;  2L7M P;  2CG4 A;  4BE0 A;  4PSX A;  3JRD A;  2QVO A;  3QQA A;  4WF2 A;  4LFU A;  3W2V A;  3C2B A;  4I2O A;  4P9U A;  4MFD A;  2QQ9 A;  4L5I A;  2R7R A;  3P2F A;  3SHF A;  2Q43 A;  4MJ8 A;  1ZLK A;  2DA4 A;  3ZP5 A;  2PDO A;  2HU9 A;  3IKT A;  2VON A;  2DA1 A;  3I1U A;  4M73 A;  3BR3 A;  1AMP A;  1WJF A;  2DA6 A;  1I5Z A;  2DOA A;  4A12 A;  2C6C A;  2QIR A;  4E4H A;  1YS6 A;  4HNV A;  1KYZ A;  2M87 A;  4XBF A;  1KU2 A;  2XGC A;  2B7E A;  4LG0 B;  2NAZ A;  4I01 A;  2PG4 A;  5M3M J;  3EUK L;  1IV6 A;  1RKT A;  1S7A A;  2K9L A;  4M3S A;  1IDY A;  4OC0 A;  3GLL A;  5HS8 A;  5M5W J;  1YVK A;  4IL6 C;  4EEF G;  2CXA A;  1LDJ A;  4N0B A;  4A3C J;  3PFE A;  4LG3 A;  2XV4 S;  3BTC A;  4P55 A;  4QPO A;  3T5X A;  1UJ8 A;  5IB9 A;  2XF5 A;  3UNG C;  2L4A A;  2R7V A;  1YHQ I;  1CGP A;  5IT9 Z;  4ENJ A;  4RB2 C;  4FX0 A;  2QBY B;  1Q2C A;  3HXL A;  4M9S A;  3RI4 A;  1QSR A;  2OR4 A;  3D5S C;  4A3E J;  1Y39 A;  4HLY A;  4F52 A;  1Q2Y A;  2DMU A;  4E0A A;  1ZTR A;  1JUP A;  3S15 J;  3CPA A;  1R1V A;  2ESN A;  1Q1H A;  4KT5 C;  5J1U A;  1BBY A;  2BW3 A;  4KIG A;  2Y69 H;  2VXZ A;  1Y7E A;  2AE6 A;  4BXX J;  2CW8 A;  3RQI A;  3DLA A;  1YLE A;  2IS2 A;  3S9N A;  2E34 A;  3QPL A;  1RIO H;  4PV6 A;  1XBU A;  2RC4 A;  3KYD B;  1T6S A;  3BG6 A;  3W6V A;  1JXS A;  4S05 A;  2AO9 A;  3MQ0 A;  4OIQ F;  1SMY F;  4H6Z A;  2R7T A;  3D1N I;  4LK0 F;  3B7I A;  3E5X A;  2L9R A;  5F0F A;  1GHE A;  4NGT A;  1RKW A;  1TC3 C;  3K2A A;  4Y13 A;  4CYC A;  1WJE A;  1X1D A;  2DN0 A;  3IFE A;  2VBX A;  2G9W A;  3AKZ A;  4F9V A;  3VFZ A;  3HGY A;  2DOF A;  4L0Z B;  1KQ0 A;  4D5F A;  2ZXH A;  2IP2 A;  2XAU A;  1M4G A;  1FJL A;  4M9Z A;  3JRC A;  2P4W A;  4BUP A;  4L8A A;  3L9F A;  2FNA A;  4IEJ A;  4CSW A;  2L01 A;  5KTC A;  4BDZ A;  3H4Q A;  4DOZ A;  2XRO A;  2MGQ A;  1P0H A;  1YRN B;  2J8M A;  4JOM A;  2ACJ A;  4YFK F;  2FBH A;  3DBR B;  1QU3 A;  4HSR A;  1FMV A;  1TKJ A;  4L89 A;  5F47 A;  3PIO F;  3CMM A;  5IOY A;  4EJV A;  1EE3 P;  4AVA A;  1I3A A;  1FTT A;  1LFP A;  2I8D A;  4LLN A;  1M1D A;  4KOX A;  1DQU A;  4JX6 A;  4F3Q A;  3GEZ A;  3DV8 A;  3ZJ0 A;  4UVA A;  2VAS A;  3W3C A;  4LUA A;  2ARH A;  4BQQ A;  1HBX G;  3B6A A;  2OZ6 A;  4A3B J;  3FNC A;  4CO8 A;  1Q2D A;  4KVO E;  3W91 A;  3IP4 B;  2WV0 A;  3HJE A;  2PJ3 A;  4IK2 A;  4CA0 A;  4QIW N;  2Z1D A;  4UB6 C;  4JLY A;  1I3Q J;  3QU3 A;  2R5Y A;  4R3L A;  4IJA A;  3D3S A;  4UNO A;  2RVC A;  2GA1 A;  2JZY A;  3L2R A;  3E5U A;  1BPN A;  2K9S A;  2O6G E;  5GP9 A;  1MBK A;  3CCM I;  1ZG9 A;  3TW7 A;  4A93 J;  1E0E A;  4JYK A;  4W1U A;  3U2R A;  2NS7 A;  5B5E C;  1ZRF A;  1SVM A;  2M45 A;  2X51 A;  1IV8 A;  2FOW A;  2OOT A;  1Y8R B;  1V4R A;  4KOW A;  4ENK A;  1O3S A;  1G3T A;  3OYE A;  3JRG A;  2AQF A;  1PP7 U;  4HRI A;  2Q0Y A;  2DCE A;  2W82 A;  2QJ8 A;  2JSC A;  2XRN A;  2ZSH B;  4NBQ A;  2GFQ A;  3D0S A;  2PR1 A;  5ILU A;  1OCZ H;  4IF4 A;  4LLL A;  4A2U A;  4B11 A;  2OC6 A;  1TWF J;  1X4O A;  2UXX A;  1R23 A;  3LAJ A;  2JA7 J;  3H3V K;  4UIA A;  4DZJ A;  3L2U A;  5KTA A;  4H0E A;  1D1C A;  2V79 A;  3WG9 A;  4HDV A;  1YRE A;  4KVX A;  1BC8 C;  3BQZ A;  5IPA A;  5FLX K;  1ON2 A;  2WY8 Q;  1LNW A;  1XGN A;  3V8L A;  5JGF A;  5CPR B;  4DQ2 A;  3RCO A;  1SFX A;  3PJR A;  2G9D A;  2F4M B;  3GUX A;  3C2H A;  3CCL I;  3WTT C;  3K2Z A;  3V7C A;  2WPW A;  3FEC A;  3L2N A;  2DA7 A;  3KZZ A;  3EO4 A;  2VBQ A;  3FB3 A;  2VL1 A;  2XKO A;  1QRY A;  1RXT A;  2VLA A;  2Q7B A;  2H1L A;  5J4Y A;  3CCE I;  2WAF A;  3FRM A;  2V4J C;  1CX8 A;  2AFW A;  2L3D A;  4M74 A;  2KDZ A;  1P4N A;  1LEA A;  4IQ4 A;  3DPL C;  2KIU A;  5DD8 A;  2VQY A;  4A39 A;  2KT0 A;  1YW8 A;  1TT0 A;  1K6Y A;  2EK5 A;  4D0P A;  2KKO A;  2B3V A;  3N5F A;  1U8B A;  4AWX B;  2R92 J;  4KOS A;  1KON A;  1SAN A;  2O4H A;  5ILS A;  4ETS A;  4P4J A;  3K2K A;  1FY7 A;  1R5G A;  1NHA A;  3LQR A;  1Y1W J;  2QSH X;  1U5T C;  1MKM A;  4LG0 A;  3JRH A;  3H3U A;  3GY9 A;  5JR3 A;  3HDD A;  1TIQ A;  2QKL B;  1ZRE A;  1J09 A;  5GAD J;  1TW3 A;  4A3L J;  3ASN H;  2DFE A;  2B5G B;  5LYD A;  2VBY A;  2W00 A;  2XGD A;  3LSR A;  3S8P A;  4YGO A;  3M1E A;  2EWB A;  2KIF A;  1UB9 A;  1H8L A;  2QBY A;  5J1Y A;  3KHX A;  1R1U A;  1KUY A;  3B3S A;  3CF5 F;  3S14 J;  2CUF A;  1ACI A;  1HKT A;  2WA0 A;  3L2C A;  1ZEL A;  4RS8 A;  3EUH C;  4JX4 A;  2E5N A;  3KCC A;  4AID A;  1UHS A;  2WAD A;  2CQN A;  1W0T A;  4DYC A;  2F6C A;  1FLI A;  2CMP A;  1EH7 A;  2MG4 A;  1W5S A;  2AQE A;  2YX7 A;  3BQY A;  4XON A;  1VQL I;  3ESW B;  1E3H A;  4A32 A;  5HDG A;  4AU7 A;  5F04 A;  4RS2 A;  4A0Z A;  4CZC A;  1Q1V A;  3I3G A;  3C1D A;  2OZG A;  1Z91 A;  1S3J A;  4MMO A;  1XE4 A;  4MRI A;  1ZLI A;  3M3Y J;  2DK5 A;  2X1E A;  1YS7 A;  2FEZ A;  3TE4 A;  6CPA A;  5IYD J;  3J81 K;  4U87 A;  1WCM J;  1Y0N A;  4II3 A;  1EH8 A;  5HNH A;  4GGG A;  3B3T A;  2NYX A;  2NNY A;  4Q48 A;  5LRR A;  3LMS A;  4LB5 A;  4HNW B;  4PDK A;  3DFG A;  3F6O A;  3TO9 A;  4EM0 B;  2OH1 A;  2W57 A;  2CF4 A;  2FMY A;  3HSF A;  3F0A A;  1FOW A;  3P7N A;  5BNG A;  3AL0 B;  2C27 A;  1RTQ A;  2XEJ A;  5F1J A;  5FKK A;  4OMY A;  3G2B A;  1MW7 A;  3ZCO A;  1YRN A;  3EC4 A;  4V19 K;  3ASO H;  4OLL A;  3DBL B;  4HZF A;  1H88 C;  2ZKZ A;  2LNB A;  5K7Z A;  3BCB A;  3TP3 A;  2OJE D;  3SI0 A;  1R71 A;  1Z8L A;  4BQO A;  2K86 A;  2QGU A;  3BT9 A;  3OYD A;  3REO A;  2NS0 A;  3ZQI A;  1X3Z B;  3PO2 J;  1CG2 A;  3I9V 2;  2P7C B;  4A5N A;  1ON1 A;  1ZG5 A;  3B3V A;  2RQQ A;  3WTS C;  4KMU X;  1GDT A;  4F6A A;  1LKX A;  2DT6 A;  2PJ5 A;  4IHV A;  4XRS A;  2HV2 A;  3K69 A;  3CTA A;  2VC0 A;  1F57 A;  3CT9 A;  3DXJ F;  4OIN F;  4EVI A;  1JGS A;  1TQP A;  2Z10 A;  4ZYH A;  2KDO A;  2WV1 A;  3BG9 A;  5KCM A;  4X2T A;  3WC5 A;  1Z8T A;  2TCT A;  2BY3 A;  2HTS A;  3EQL F;  3SYT A;  2GLF A;  1FSE A;  3FH4 A;  1TKH A;  1D5Y A;  5DM6 F;  1E17 A;  4A3I J;  2P0W A;  3KFW X;  4X0G A;  3FXT A;  1Y0U A;  1QSN A;  1A6I A;  2PRQ A;  2RAE A;  4CAW A;  3QB8 A;  1GYT A;  2BYV E;  1DE4 C;  1SAX A;  4BBH A;  2XB5 A;  4A5M A;  2EIJ H;  5H20 A;  3LNQ A;  3OYF A;  2YNC C;  3C26 A;  1FYM A;  3S3M A;  4UB8 C;  4HBL A;  3I64 A;  1WI9 A;  3VYS B;  3DTE A;  5BQT A;  1RZ4 A;  1W7P B;  3WTW C;  2CV0 A;  4AIH A;  3OYG A;  4AG9 A;  2K9Q A;  3FF5 A;  5E79 C;  3T1B A;  3IWW A;  3DPT A;  2I10 A;  2VQL A;  4N4N B;  2A69 F;  5F64 A;  4IHW A;  3RPU D;  1ZN2 A;  4KA4 A;  2E5Z A;  2M7B A;  4XRF A;  2IJZ A;  3ISX A;  2OTJ I;  2PQ8 A;  2NSM A;  2VBW A;  1FOK A;  1Y0R A;  4E7L A;  4Y52 J;  1IUF A;  2WUU A;  3OYM A;  1HA8 A;  3CCU I;  2RV8 A;  3A0H C;  2CQQ A;  4XOR A;  3FMC A;  1SQH A;  1FEX A;  1W0U A;  1CP6 A;  4B44 A;  4YFN F;  4UBR A;  5A27 A;  2HOS A;  3AG4 H;  2Z3O A;  2E1C A;  5G20 A;  2ZNY A;  3J7Z I;  4NFR A;  2W4S A;  1MMS A;  3NQO A;  5J1Q A;  2EBJ A;  2NS8 A;  3KZY A;  1A31 A;  1ARL A;  2KZG A;  2XRL A;  4CRZ B;  5AG7 A;  4DJL A;  1UST A;  2QEC A;  2KPM A;  3M8E A;  3HOT A;  2FJ1 A;  1AU7 A;  2Y31 A;  2IA2 A;  5ICC A;  4B43 A;  1YX0 A;  3JSO A;  1E3O C;  3DQV C;  4I76 A;  1O3R A;  2DOD A;  5I4M A;  5D6E A;  3BZK A;  5BPI A;  2B5G A;  5GCN A;  4F8Z A;  3ELK A;  3HB9 A;  2PJ6 A;  2VXK A;  2JQ7 A;  3S1N J;  1UZC A;  2HPI A;  3PSI A;  1MK4 A;  4YII A;  4CDG A;  5E8G A;  1G3W A;  4DBQ A;  2D4O A;  3VWD A;  3IWE A;  1M4I A;  3OL4 A;  4BQN A;  2REF A;  4CH7 A;  1IRZ A;  5HDN A;  3KGQ A;  3OWC A;  1LCP A;  4BKX A;  4MHG A;  4MY0 A;  2HXI A;  2KCW A;  4NCZ A;  4DYR A;  1EA3 A;  4HF2 A;  3VOD A;  3LOC A;  3TBI A;  2IS1 A;  3G1O A;  4Y33 A;  5CVI A;  5E3O A;  2Z9O A;  3CC7 I;  1W5T A;  2NNN A;  3NH4 A;  1FWZ A;  4QC6 A;  3RAM A;  3D2M A;  4K3N A;  5HNF A;  4XL9 A;  2OQR A;  2ANP A;  4X3R A;  2E2H J;  2RFH A;  3RO0 A;  3E6D A;  3CCS I;  1I12 A;  2L9S A;  1WWX A;  3V38 A;  1GHC A;  2LG4 A;  2E35 A;  4UVC A;  3JRA A;  1J59 A;  4HF1 A;  3B3W A;  1D8J A;  3B3C A;  3OL3 A;  4BD9 A;  5J40 A;  5F6F A;  2O5R A;  2CUZ A;  4NJQ A;  3ZZI A;  1LAN A;  1WQ2 A;  5F0C A;  3AAF A;  2VQH A;  3Q0U A;  3K4C A;  3F0C A;  4ON0 A;  1PDN C;  2CV2 A;  2GU2 A;  3F8K A;  2ZW4 A;  1A35 A;  4MFZ A;  3NWT A;  4D1Q A;  2P6E A;  1Z67 A;  1FP2 A;  1S7O A;  4DZP A;  4PCQ A;  2FE3 A;  3KET A;  4WXC A;  2LSO A;  4IOC F;  4J3G A;  3BPX A;  2AXT C;  3WTV C;  3HEF A;  4XN0 A;  1YO5 C;  3ZPL A;  5AGE A;  1MNM C;  2HOA A;  2Z3K A;  5FKO A;  4DIQ A;  3KEO A;  4F55 A;  4G8X A;  1JQG A;  2KJC A;  3L00 A;  1VIX A;  3RZA A;  1ZAO A;  2ZEE A;  1FYK A;  2FUG 2;  2Q51 A;  2ELK A;  2YS9 A;  2ZJP F;  2JBK A;  4R9M A;  4LIU A;  2HYF A;  2XGX A;  2RGV A;  4LK1 F;  2XEF A;  4Z65 A;  2MH2 A;  3RJP A;  4AD9 A;  3GF2 A;  3JR9 A;  3IWG A;  3LSM A;  3A02 A;  4BHP A;  4ITV A;  1BO4 A;  3IEH A;  3NA6 A;  4CGL A;  1T0F A;  1WH5 A;  1SFU A;  2V1U A;  3KKW A;  3LFK A;  1BN5 A;  3GX4 X;  1QSM A;  5DTD A;  5L3B A;  2ZXV A;  5ERI A;  2A07 F;  1U6G A;  2BE5 F;  4CS0 B;  8CPA A;  4B5O A;  1PUA A;  1X1P A;  4MEY F;  3Q9S A;  3JAM K;  3VAT A;  4OIO F;  2DXQ A;  5JM6 A;  2ETH A;  1Z0X A;  2DMQ A;  3S17 J;  3ISP A;  2R8V A;  5K5Q A;  1XMA A;  5JI6 A;  4G1P A;  4I0A A;  1TNS A;  3LL7 A;  5FRO A;  3COA C;  4ENM A;  2BO9 A;  4TNU A;  2IGN A;  4X5K A;  1ZK8 A;  3KYL A;  3LSH A;  2CGP A;  3ZQF A;  3FEE A;  4OAY A;  3HOX J;  3LA3 A;  4HYE A;  3TT2 A;  1P6R A;  4OC2 A;  3LFU A;  3NE8 A;  4P4E A;  3WC6 A;  3IAM 2;  1NG7 A;  2W85 A;  4OIR F;  2C6Y A;  3A03 A;  5CYV A;  3VYR B;  2FF4 A;  2QWW A;  4AG7 A;  2LLK A;  1TQM A;  3IH2 A;  2PJ7 A;  3QOD A;  2V8V A;  1Y56 A;  4J19 A;  2VJI A;  2OB0 A;  6PAX A;  4BBS J;  3MRU A;  5LGN A;  5L3E A;  2B0L A;  1D3Y A;  1W7P A;  2O8X A;  4E2A A;  2WTE A;  3IU1 A;  3PGP A;  3IRR A;  3VH9 A;  4A3G J;  1DP3 A;  4EAT A;  2JPB A;  3SFI A;  2PC1 A;  4II2 A;  4KN7 X;  1LRZ A;  2R7H A;  4DW6 A;  2ZEL A;  4GXO A;  3RYO A;  2DI3 A;  2F5F A;  4ZYG A;  3HRT A;  2PMZ N;  3R0J A;  2FVG A;  4B4C A;  3BG3 A;  3RTR A;  3IV5 A;  4B6Z A;  5D6F A;  3B2Y A;  1IG7 A;  2ZW6 A;  4R57 A;  5D5W B;  4QB9 A;  4ZX9 A;  3RKY A;  4AC0 A;  2FL4 A;  1ZGA A;  2Y2Z A;  3S1Q J;  1TQI A;  2F5V A;  1D8K A;  3KEY A;  5A2Q K;  5DS9 A;  1V5G A;  4U9Y A;  1OCT C;  2NVQ J;  4OKO A;  3QPH A;  4FE7 A;  1TBX A;  3KHZ A;  3CCY A;  4M6I A;  2KL4 A;  1D1B A;  2GOM A;  1B4A A;  4A0X A;  3LQQ A;  3EYY A;  1A5J A;  3FXJ A;  1QPM A;  3FXK A;  2WYR A;  2OCE A;  1XOV A;  3GW2 A;  1IOF A;  2A5Y B;  2G0E A;  1X4P A;  3PO3 J;  3NWS A;  3ZMV A;  3PB7 X;  1S29 A;  3S1R J;  1Y6I A;  3HSE A;  1QO0 D;  4XLA A;  1QGP A;  1XN7 A;  3BWG A;  3GKR A;  3R95 A;  3I0T A;  1MH3 A;  2PMH A;  1OJL A;  1IB1 E;  3FXO A;  4G94 A;  5J8F A;  1FT7 A;  1BOA A;  2F48 A;  2CW7 A;  1AOY A;  2DDB A;  2FIW A;  1JT0 A;  2L5Q A;  3LSK A;  1DUX C;  3H36 A;  1FT9 A;  5H6Q A;  3CZ6 A;  2R7W A;  3FM5 A;  3TP0 A;  4D9J A;  3HRS A;  4HX7 A;  2C6G A;  4P4B A;  2DA5 A;  4OME A;  3FED A;  4MCP A;  4I7H A;  5K5R A;  2JVG A;  2WWY A;  4CCO A;  4Q38 A;  3E3V A;  5E3N A;  2F5C A;  1MMN A;  2IGK A;  4BE2 A;  4IOA F;  4NGP A;  4CGN A;  3E97 A;  4ZDO A;  2E71 A;  4CYQ A;  1OCC H;  3O8H A;  2ZEN A;  2GIV A;  1ZRC A;  4BDY A;  3FHZ A;  3UY5 A;  1T39 A;  2GM4 A;  3BLN A;  5CKT A;  2HTJ A;  2ZSI B;  1XMX A;  2P6F A;  3G6E I;  4OAD A;  1BI3 A;  3K4K A;  1VQK I;  4M9X A;  1HXD A;  2W48 A;  2HQR A;  4P1W A;  3M4O J;  2L02 A;  2W7N A;  1JJ8 C;  2Z16 A;  4PXC A;  1VHS A;  1BW5 A;  4RA2 A;  1RR7 A;  4LD5 A;  5CBM A;  1VHO A;  1Z6T A;  4HV5 A;  1Z7L A;  4MFE A;  2W25 A;  1ON0 A;  1WWZ A;  1YLO A;  3DP7 A;  1ELM P;  1MJA A;  1X19 A;  4M6Y A;  1EJ9 A;  1Z9U A;  3S3N A;  3LD2 A;  2IA0 A;  1U5T B;  4YFJ A;  3MEX A;  4E7Z A;  4KYW A;  3HBL A;  1FBQ A;  4MGR A;  2R7S A;  1P4W A;  1D0Z A;  3G71 I;  1WZ2 A;  2DFH A;  1LEB A;  2RN7 A;  4PJL A;  1C0W A;  2V9V A;  3CLQ A;  3K9T A;  3GTO J;  1CJW A;  4ZC3 A;  2X0L A;  2LKP A;  2OD5 A;  3TW6 A;  2DK8 A;  2UXN A;  4DBR A;  3GTJ J;  3OSF A;  2PJR B;  4NC8 A;  3ZRG A;  2IVM A;  4ZTF A;  3S2W A;  4E8O A;  5FGM A;  2Z99 A;  3GLX A;  2XUB A;  4Y49 B;  5FVJ A;  1DPU A;  4Q4Z F;  4TV7 A;  2EB7 A;  4PJJ A;  3KQX A;  1F2P A;  5E18 F;  5GAE J;  1P2F A;  2KRF A;  2PJ9 A;  4IF5 A;  4XSX F;  4ESF A;  1U6M A;  1REP C;  2GWR A;  3JW4 A;  3K4N A;  5HS9 A;  1IC8 A;  2H1K A;  4QWQ A;  2ECB A;  3BC8 A;  4MHD A;  1MBH A;  1ELL P;  5LRK A;  1MJ9 A;  5E1X A;  2ZB9 A;  4JX5 A;  5E1Z B;  1YQE A;  5BMZ A;  3EFA A;  4L0Y B;  3OSG A;  2PJ8 A;  3PUB A;  1HF0 A;  2AHQ A;  3GME A;  4BL0 B;  1FBU A;  2A3S A;  3ZR8 X;  4E7H A;  1SVO A;  2V6E A;  4HNT A;  3CJR B;  4KNY A;  3JTH A;  1YQA A;  3VWB A;  1OCO H;  3S2D J;  1ONV A;  2R7Z J;  3O2P E;  1FMW A;  1O4X A;  1MSF C;  5K7H A;  2DQL A;  3N4M A;  2R7X A;  1LFB A;  2JK3 A;  2M0C A;  3HHH A;  4N4O B;  3ABM H;  3ZXS A;  3R9E A;  5IP9 J;  4FD7 A;  1POG A;  2I5U A;  4XPK A;  2BXZ A;  2XAS A;  1S5K A;  2BL1 A;  3VYU B;  2A68 F;  5K7F A;  4P4F A;  2M0M A;  2JRT A;  3LA2 A;  3R60 A;  3RBU A;  1P9Q C;  4OID A;  3FK7 A;  3F3X A;  1OIS A;  2FX0 A;  1DP7 P;  4R7M A;  4PXB A;  3BJA A;  4RDU A;  3P9C A;  5E3M A;  1ZGJ A;  1F43 A;  3QYB A;  2LBF B;  3NEU A;  4B1R A;  4L9N A;  4JJX A;  3JUW A;  1XMK A;  1QHG A;  2E1N A;  3Q0W A;  3PZJ A;  2M30 A;  2YU3 A;  3OYJ A;  2CTC A;  4UFX A;  2V77 A;  2W24 A;  5FLX Z;  4E7J A;  1TLH B;  1IF1 A;  3FZV A;  2BSW A;  2K85 A;  3RYR A;  2VKH A;  4RI1 A;  3QP6 A;  2K27 A;  1BLL E;  2WBM A;  3FM3 A;  3GCM A;  3L7W A;  1QQ9 A;  1BI0 A;  2MW8 A;  2Q1Z B;  2W84 A;  2R7O A;  1ETV A;  2R7Q A;  4EQQ A;  1X3W B;  3P5J A;  4N9H A;  5D5V B;  4L18 B;  2DT5 A;  2DPS A;  2FCK A;  5ELY A;  2H5M A;  4C2Z A;  4PJN A;  3LAC A;  4LOC A;  4CHU A;  2LR8 A;  2OPT A;  2X6O A;  4ZBG A;  4WXD A;  3F5B A;  5IY5 H;  4KSF A;  5BWA B;  3GFL A;  3H1C A;  2G7U A;  2YX4 A;  2IAI A;  5FB2 A;  4R6T A;  2I79 A;  2D2W A;  1MZB A;  3H9G A;  1ZGW A;  1BIA A;  4KIS A;  2ZBK A;  3DF8 A;  1YSJ A;  2EFQ A;  2ELJ A;  1YI2 I;  3PBE A;  2PCU A;  1HCR A;  4MHN A;  1S9H A;  1R5H A;  4B8X A;  3JRB A;  1YJN I;  2XKP A;  3N97 A;  4AVC A;  2Z3N A;  1JTY A;  2WB1 N;  3GVA A;  2JBJ A;  4CUG A;  3VSL A;  3DDD A;  5HVH A;  3GXO A;  5C88 A;  3I5U A;  3PB6 X;  5LYI A;  3K9U A;  4UUS B;  1PUE E;  2JLM A;  4KLW A;  1Z8X A;  2GXA A;  4B12 A;  1ETW A;  4P45 A;  2IGM A;  1O3T A;  3T0Y A;  3T90 A;  2H27 A;  4F0Y A;  1HLV A;  3BZC A;  4CCJ A;  1YIJ I;  4OAZ A;  1JT6 A;  1SVL A;  1XB4 A;  1P92 A;  3PIP F;  1RUN A;  2J9A A;  2PFB A;  3QAH A;  4FWU A;  3I54 A;  3VPR A;  3J80 K;  1PJR A;  3QOE A;  1YX3 A;  4MQ9 F;  3BR0 A;  4FE4 A;  3GYH X;  4HPQ A;  4C3H J;  4UWI A;  4JYW A;  4OMZ A;  2OUM A;  1HQC A;  2C6P A;  1YE9 A;  4ZZD A;  2XIG A;  3QYF A;  1R57 A;  3QRF F;  1QHH D;  2PSW A;  4X1E A;  2NVY J;  3KZI C;  1U78 A;  2OZH A;  1HW1 A;  1U5T A;  3FXM A;  4MO7 A;  4XRM A;  3J81 Z;  1YIO A;  2M7A A;  1S8N A;  3ZN0 A;  2JA8 J;  5FKM A;  3D2P A;  2CUJ A;  2OA4 A;  4JD6 A;  3LSJ A;  2L9N A;  2VPR A;  1UCR A;  1IXC A;  4XPD B;  4R8F A;  2HPM A;  2LRE A;  1ZLH A;  2PJR A;  2ZEP A;  2ZME C;  5GPC A;  2I00 A;  2CJJ A;  4MHZ A;  2KQR A;  3OS0 A;  3IWZ A;  2HS5 A;  2LDU A;  5H6R A;  4EJT A;  5D5X B;  4PK3 A;  1MSE C;  3ABK H;  4HQE A;  1QBJ A;  4UUV A;  4C7I A;  3I59 B;  4RAY A;  2FML A;  3PEI A;  1ULY A;  2MC4 A;  2GZW A;  2V26 A;  3EUH A;  4UV9 A;  4BHB A;  5FKL A;  1USS A;  4BIN A;  3ZMU A;  1NE9 A;  4HEA 2;  2JDD A;  4AUX A;  2HZD A;  1P7I A;  4C68 A;  4KS9 A;  1OQY A;  2H94 A;  1O7F A;  1Z3X A;  4MBU A;  4CRY B;  2DA3 A;  5AG6 A;  3CD6 I;  3BOQ A;  1N77 A;  1O3Q A;  3R9F A;  3K1P A;  1ZQ3 P;  3M8F A;  5DEQ A;  3AFH A;  1I27 A;  1YIT I;  4GS4 A;  2PVW A;  1F1Z A;  2QA4 I;  2ZEF A;  1U3E M;  1B59 A;  1PVE A;  1R7J A;  2DTZ A;  4CAE A;  2DMP A;  1YW9 A;  1QZZ A;  4M6G A;  2EFN A;  3QAY A;  3K1M A;  4IRH A;  3VSK A;  1SFE A;  3VB2 A;  3KP4 A;  4AIK A;  2Q2E B;  3DSB A;  4ONW A;  4GYI A;  1X1B A;  2PRB A;  4V2F A;  5FLM J;  1ZRD A;  2B63 J;  1NSA A;  2IGO A;  2CNS A;  2EFW A;  1JKO C;  1MND A;  2PIZ A;  5J4V A;  2QSF X;  1M4L A;  3BP8 A;  3FMS A;  1PYT B;  1JKP C;  1MGT A;  2IS4 A;  5ILV A;  2R1I A;  3FMR A;  1UHM A;  3I53 A;  3JRU A;  3GZ6 A;  3BCA A;  5C4X J;  3SQN A;  2BY1 A;  2HKO A;  3BR2 A;  3GYA A;  2PIY A;  2LBF A;  4ZY2 A;  2HI3 A;  4ZY1 A;  5J1R A;  4TWE A;  5E1W A;  1BOB A;  4XPL A;  1R43 A;  2Z33 A;  5D8K B;  4UEF A;  2CQK A;  3QOP A;  4X8I A;  1XRY A;  2GA2 A;  1GXP A;  1EF4 A;  1MBF A;  2F8H A;  1TT5 B;  3K0L A;  1R3N A;  4L9T A;  4AVB A;  5IX3 A;  2L54 A;  4UF4 A;  5H84 A;  2PVV A;  1DGR M;  4ZI6 A;  5ICE A;  1ZAR A;  1AA7 A;  3RPQ A;  4Q36 A;  2QKM B;  3WC7 A;  2H8R A;  3FIX A;  2FQ3 A;  4RAZ A;  3ABT A;  5CQE A;  3F21 A;  2XSJ C;  1VQP I;  1HOM A;  3DNS A;  3EY5 A;  2WB1 A;  1K4J A;  3HTS B;  2M4K A;  2G0B A;  4NJR A;  4BGD A;  3OIO A;  5LD2 C;  3I56 I;  2EZL A;  5KHD A;  2R5Z B;  2LK2 A;  2VT3 A;  3RIR A;  4IX7 A;  4G7Z F;  3E7L A;  4KDP A;  2IQ6 A;  3BZ6 A;  3L2Q A;  4M3G A;  4XLP F;  5L3G A;  3RQ4 A;  3GO5 A;  3CCR I;  3ROU A;  4PGG A;  3NH5 A;  5J47 A;  2Q44 A;  2OCC H;  1BW6 A;  4O6J A;  4MCQ A;  5KNL A;  5D8N A;  1ETY A;  2H8W A;  4BJ6 C;  5KAF C;  4A2Z A;  4UCM A;  2HB6 A;  1SC7 A;  1JUS A;  1I39 A;  4UUS A;  1LE8 B;  3ML6 A;  4AIJ A;  2K9N A;  4U0V A;  1GXQ A;  5F1R A;  1YW7 A;  5AIQ A;  3S2H J;  1G4D A;  4BS9 A;  2B9S A;  1U0J A;  3ZQC A;  4YRV A;  4BJ5 C;  4II9 A;  1M1E B;  3FXQ A;  4M71 A;  1XSV A;  2W1O A;  2BEO A;  4P96 A;  5CVR A;  2VIX A;  2LC2 A;  4Y3O A;  4K30 A;  1KYW A;  2ZCW A;  3BJ8 A;  5EEH A;  3SJM A;  1L0C A;  1XD7 A;  3JTK A;  2F5D A;  4HW0 A;  4QPQ A;  3KL9 A;  4KOV A;  1K4T A;  1JJ6 C;  1JGG A;  2F5E A;  3H9Q A;  2XAH A;  5D4R A;  4KOR A;  4M3E A;  4IHT A;  2IS6 A;  1ARM A;  2PJ2 A;  4G6T B;  4D7N A;  1A36 A;  2MC3 A;  5D4S A;  4NB5 A;  1Z4R A;  1KU3 A;  3HL2 A;  2VXD A;  3OIQ A;  2P5V A;  5CQG A;  4CCK A;  1APL C;  3MWM A;  1B9N A;  3TC8 A;  3BXM A;  4UVB A;  1IRG A;  4A38 A;  1T08 B;  2OU2 A;  4ORF A;  1IXS B;  3HGG A;  5HS7 A;  5IV0 A;  5E8I A;  1CBX A;  5HXD A;  1GV2 A;  3Q5F A;  4XLC A;  2O61 A;  1XCV A;  4ZDL A;  3CP8 A;  3W6K B;  4XNF A;  1UHW A;  4GYG A;  3BHX A;  1OMI A;  4ZDP A;  2LH9 A;  4F91 B;  1DU6 A;  3EXN A;  1XFO A;  4QBJ A;  2R7F A;  3ZMZ A;  1KUX A;  5ICG A;  1H89 C;  2GAN A;  5LFA A;  5LHG A;  1UG2 A;  2GE3 A;  1JHH A;  1WH7 A;  3W6J B;  4XOP A;  2HQA A;  4CYD A;  1ORK A;  2FQ4 A;  4A6E A;  2X6X A;  4JK1 X;  5F08 A;  1TL8 A;  3VWE A;  2LKS A;  3I59 A;  1FP1 D;  3CJN A;  4DJA A;  1QZE A;  1HKS A;  1CPS A;  1LAM A;  4PGH A;  2NOG A;  3RZO J;  4B14 A;  4D7M A;  1WPK A;  5JH9 A;  5CLS A;  1SEU A;  3CF2 A;  3CJT B;  2V1X A;  1KQ9 A;  4FD6 A;  2POK A;  3FBU A;  3JVN A;  4RLF A;  1HDD C;  1F5T A;  3L2V A;  3F8N A;  1P7J A;  3CZX A;  1IN8 A;  2EV5 A;  5EDN A;  3X2Q H;  2CO5 A;  4MNU A;  3F22 A;  1J4J A;  2HQY A;  2X85 A;  3P9I A;  1ZG8 A;  3LSG A;  5EZG A;  4YG2 F;  5EC4 A;  2EWN A;  4YFX F;  4KUB A;  2EV6 A;  2WAE A;  2CTB A;  2ZEH A;  3JAM Z;  4MEX F;  2X7B A;  1BI1 A;  5HOD A;  2ZEO A;  2J8N A;  4B10 A;  3TMO A;  2XPV A;  2Q2E A;  1LOK A;  2LY1 A;  2V8G A;  1F2O A;  5G21 A;  4Q5S F;  2ME0 A;  4KUA A;  2E7X A;  2TDX A;  3TQN A;  2F5I A;  1Y7R A;  3WTX C;  4RLQ A;  1S60 A;  1VGY A;  2MD0 A;  2M8E A;  1I1G A;  1XSD A;  1AWC A;  1HEE A;  2ZW7 A;  1X10 A;  3CJQ B;  4F7Z A;  5KVR A;  2UZK A;  5IT3 A;  4R8H A;  5J8C A;  1XJO A;  1XGO A;  2MYS A;  4C30 A;  1ZKG A;  2JRM A;  3TO7 A;  2BOA A;  2ZFU A;  4FUU A;  3WAB A;  3BI1 A;  2XPU A;  1IN7 A;  2EBI A;  2PMU A;  4FT8 A;  3D5R C;  4M3F A;  1OLT A;  4UXN A;  2ZXI A;  4RB1 A;  2Z3Y A;  1E3P A;  4HNY B;  5DYM A;  2H09 A;  3VAR A;  3GTQ J;  4HNX B;  3CDL A;  4P4I A;  4XNH B;  2NVT J;  3V8I A;  3FHN A;  2K4J A;  1N25 A;  3KLN A;  4FAI A;  4J00 A;  3ZQ7 A;  1MBJ A;  3HRM A;  3TDU C;  1TTY A;  4DYQ A;  2AFS A;  4PK4 A;  4ESJ A;  1JKQ C;  1K6O A;  5CVJ A;  2DXI A;  1D0Y A;  1W5C C;  3BRO A;  5FJ8 J;  3QWL A;  2O0Y A;  5BOX A;  2VE8 A;  2WAQ N;  2YPR A;  2Q0O A;  2J5O A;  3MN8 A;  1BJA A;  2K3P A;  2R5Z A;  2PLY A;  5A2Q Z;  4RAF A;  4BE1 A;  2B4D B;  1HW5 A;  4F9U A;  3ABL H;  3RPU A;  1F9N A;  1G3Y A;  2F2E A;  5LEK A;  4EFD A;  2NMT A;  4U0Y A;  1VQ4 I;  1XX5 A;  2EIM H;  3D8P A;  2XSD C;  1KWM A;  1HDP A;  4PXE A;  1EH6 A;  3BLY A;  3QYE A;  2IW5 A;  4LIT A;  2EK9 A;  3CXQ A;  1MBE A;  4OC3 A;  3I71 A;  4UEZ A;  4YIR X;  2MLK A;  4R87 A;  5F49 A;  5FO5 A;  1LE8 A;  4NHJ A;  4KZT A;  5D5U B;  2X4H A;  2QSG X;  3ZQH A;  5J6X A;  4WCG A;  3LMM A;  2LKX A;  1OR7 C;  4UEE A;  2WC2 A;  2X48 A;  1R4N B;  4CZZ A;  5FRN A;  3FXR A;  2EPF A;  2KRC A;  2ME6 A;  3A0B C;  3H0D A;  1YR0 A;  4YU9 A;  3C3W A;  3W6X A;  2HXO A;  3H92 A;  4ZYQ A;  3TKY A;  1ENH A;  1IU8 A;  1IOI A;  2AJ6 A;  1B1B A;  3I55 I;  3OYI A;  3JRI A;  1IZ1 A;  2EA2 A;  5B1B H;  2VEZ A;  2VOD A;  5IP6 A;  4R76 A;  2D1V A;  3GZ5 A;  3PUF A;  4IVN A;  2UWM A;  3D7G A;  2VN2 A;  4DGW B;  3HPG A;  3KIO A;  1GVJ A;  2CQ7 A;  2AS5 F;  3IO1 A;  5HMN A;  3DLL F;  2VC1 A;  2E1O A;  1DPR A;  4CPA A;  1LVK A;  4RM3 A;  4NC7 A;  2ZJR F;  1FIA A;  1R5I D;  3FKJ A;  3SZG A;  5DWN A;  4IHY A;  2G3A A;  2JN6 A;  1TF9 A;  4PJ0 C;  1K78 B;  1UWY A;  3GLJ A;  4O23 A;  2EJR A;  3H5N A;  4NGN A;  1STZ A;  4A3J J;  3G1M A;  1R9T J;  1MH4 A;  1XG1 A;  3B6C A;  5JLW A;  3SFZ A;  3G73 A;  1MDM B;  3LWF A;  4U0W A;  2BOL A;  2HYJ A;  2HOE A;  3ZQL A;  4KUM A;  3SXO A;  2G7H A;  3MZY A;  3DU6 A;  1LB2 A;  1UFH A;  5LHH A;  3LOD A;  3RKW A;  4YWY A;  1ODD A;  3DKY A;  4CCN A;  4S04 A;  2ZXW H;  2IPQ X;  1LDK B;  4HOB A;  5H2F C;  2HEO A;  1I1S A;  2IMO A;  2VZZ A;  3FF3 A;  1XGM A;  1QVT A;  1TWG J;  2EIN H;  2Z2S B;  4K2E A;  3IL2 A;  2HUZ A;  1IGB A;  2EQR A;  2HOT A;  2JSP A;  5I0C A;  3F8B A;  1S5L C;  2V6C A;  3V42 A;  5M5X J;  2MA3 A;  4B3A A;  3LWU A;  3S6G A;  2EZI A;  4I49 A;  1N71 A;  1QA6 A;  4RGX A;  3OYN A;  4ZYE A;  3KP5 A;  3DEW A;  4OIP F;  2EFP A;  3KE2 A;  4Y4R A;  1H0M A;  1ZG3 A;  2BHZ A;  2GLJ A;  2V8H A;  3HOS A;  2VQG A;  3IUO A;  3PNT A;  4NQW B;  1J75 A;  2OZU A;  3HG9 A;  3Q3S A;  3FXL A;  1UEL B;  2BV6 A;  3KX2 A;  3DGV A;  2CFX A;  3SJF A;  2VJ4 A;  3T8T A;  2P6G A;  1S72 I;  5HLH A;  4YIF A;  4PSW A;  3K6G A;  1VQ5 I;  1I6X A;  1YJ9 I;  2YUS A;  2MH9 A;  3L09 A;  2NVX J;  3U1D A;  4NGR A;  2DBB A;  3FIS A;  4CCM A;  2AFM A;  2AFO A;  4KMF A;  3OYA A;  1TP4 A;  3DU5 A;  4FIS A;  3BG5 A;  2Y0S N;  4RMN A;  2X9D A;  3GUD A;  3NAR A;  5TRD A;  2ODF A;  2HC9 A;  3OY9 A;  1ZYR F;  1NH3 A;  1IGN A;  4RAG A;  3HIF A;  4A3M J;  2GAU A;  4BYY A;  1QSO A;  2ZME B;  4BAC A;  3J7Y J;  3GIU A;  1XTA A;  2D4P A;  2DF5 A;  1X2M A;  1FTZ A;  1NTC A;  1HDQ A;  1CPX A;  3GB0 A;  4MFL A;  4HV6 A;  5LRS A;  4XNH C;  2ID3 A;  1VTN C;  4HX8 A;  4MHY A;  4FET A;  3ZOB A;  2WAQ A;  2QEX I;  3CO6 C;  2YSR A;  3I9S A;  4C2X A;  4J01 A;  2N8G A;  2DT7 B;  1UG0 A;  4NC6 A;  4P9F A;  1IJW C;  5CPA A;  1T98 A;  1BR1 A;  5H86 A;  4RB3 C;  4MFP A;  2CFO A;  1YTY A;  2B3U A;  4Z6Y A;  3N7Z A;  3CCJ I;  4G6D A;  5EEA A;  2B4D A;  1HSJ A;  1QMU A;  4QUS A;  3SJE A;  4EGZ A;  2M3A A;  2EZK A;  3J7A Y;  3EDP A;  2JMW A;  4RBO A;  1NMT A;  3D5L A;  1CP7 A;  2Q04 A;  4IPA A;  2O8K A;  4BBR J;  3A4C A;  2E1M C;  4I02 A;  2NRA C;  2YNE A;  4OC4 A;  1M4D A;  1XIX A;  3ECH A;  4HAM A;  5JHF A;  5K8M A;  5GTI C;  3DEU A;  3CDI A;  3AG2 H;  2WZN A;  2EVN A;  4BY1 J;  3VOE A;  4MCS A;  1BJZ A;  1RET A;  1S7L A;  2DLL A;  2VJ5 A;  3WE3 A;  4D5C A;  1A6Q A;  2D45 A;  3HLP A;  3PBB A;  4BEH B;  2CY2 A;  2OF7 A;  1T0F C;  4JZ0 A;  2QF7 A;  1ZG1 A;  1JKR C;  2OAZ A;  3K4J A;  4M6H A;  2JEW A;  3IKV A;  1YW6 A;  2AFZ A;  1JE8 A;  5GAH J;  5FFX A;  4MLO A;  2M9H A;  2GXB A;  3WGH A;  3JSP A;  3TFY A;  2XHK A;  5HDK A;  5JPH A;  3BR5 A;  5L3F A;  1BC7 C;  3PQK A;  1OFC X;  3CUQ C;  1AKH B;  5DD4 A;  2P8T A;  3NFZ A;  4EV0 A;  1P4X A;  4XLF A;  3HPH A;  3ABU A;  1W36 D;  1DGW Y;  1TWC J;  1BR2 A;  3CLO A;  3J80 Z;  4EME A;  2KRH A;  4O5V A;  2M8G X;  3HZJ A;  2QZ8 A;  5HLI A;  4Y17 A;  2L7K A;  1T2K A;  1K78 A;  3KLO A;  2ZEG A;  2BXY A;  1PUF B;  4IAV A;  1NSL A;  4XQF A;  3OOU A;  4WWC A;  1V5F A;  2DJN A;  4UUT A;  3M7G A;  5D8L B;  4EJU A;  5JVG F;  3D7H A;  5DV5 A;  5IOZ A;  2XC7 A;  1MDM A;  5EF6 A;  3RDI A;  3CUO A;  3K4B A;  4NNJ A;  2AXL A;  3HUV A;  3ERM A;  1SFO J;  3ZMT A;  3D4U A;  2HVQ A;  3KAS A;  3MZ8 A;  5EEG A;  3KR5 A;  1O57 A;  2ESH A;  2FXF A;  3G8W A;  2K7L A;  1T8I A;  5KTD A;  3H5R A;  1WKM A;  3I4N J;  2MFZ A;  3PSF A;  3ERE D;  4DUK A;  3W2W A;  5HLT A;  1HW2 A;  4QSH A;  2QML A;  2GLO A;  1R1T A;  5FLV A;  2LF7 A;  5K1Y A;  1VQ9 I;  4GO1 A;  3HRU A;  3SZP A;  2Z3P A;  1HKQ A;  3WTU C;  1U9O A;  1VFC A;  1S7K A;  1SD6 A;  3WTZ A;  1MJB A;  3O3K A;  4E70 A;  3R4K A;  4GM5 A;  3S6H A;  2HGC A;  3JTG A;  5BS6 A;  1I1D A;  2O03 A;  5TIS C;  4C2T A;  3WT4 A;  4EVY A;  1G2H A;  2VZY A;  4CGZ A;  3MKW B;  3H35 A;  2FNP A;  4NQW A;  3VYT B;  4O3M A;  1IUY A;  5F09 A;  2XPW A;  2JJ7 A;  3HC7 A;  3MMY B;  4EJO A;  2HQ5 A;  4M85 A;  2BGC A;  5ED4 A;  3J7A O;  5E3L A;  5HVF A;  1YG2 A;  1ZO0 A;  2IL4 A;  4RGS A;  3DPU A;  5JHU A;  1NK2 P;  4C2U A;  2JA6 J;  2ID6 A;  3H8F A;  2PMZ A;  2L4M A;  4NEX A;  4HST A;  1Z1D A;  4A3K J;  2K4B A;  4ONU A;  2QM3 A;  2P6T A;  4N9I A;  1MNE A;  4P4D A;  2OV7 A;  3SJG A;  2P81 A;  3HM5 A;  2FE7 A;  4MIM A;  2ELH A;  2AFU A;  3CXS A;  2JDC A;  2ZOG A;  4KFC A;  2CV1 A;  4AXV A;  4M3D A;  4OOI A;  3HOZ J;  2EIL H;  2JUG A;  1FPQ A;  3QU6 A;  2ZME A;  4M6X A;  2ISY A;  4I98 B;  3PFI A;  3R6S A;  3S3O A;  2QLZ A;  4B47 A;  3GTP J;  1H9G A;  2XDV A;  2WPX A;  2JA2 A;  2KIM A;  2TRT A;  4MTD A;  2IEK A;  2B4B A;  2NXN B;  3F9K A;  3MD2 A;  2FSW A;  2XF7 A;  4XKV A;  1R36 A;  2XB0 X;  4BU2 A;  3TCV A;  2JPC A;  3JCU C;  1WVR A;  1SFK A;  4BAY A;  2PR8 A;  1Z7U A;  4GCV A;  1LJ9 A;  2IRF G;  1Z21 A;  4L5E A;  5E17 F;  1S3Z A;  1YFH A;  1IN5 A;  4CGP A;  2BCO A;  3L1P A;  2FSR A;  3E5Q A;  1A04 A;  2ZOF A;  4KOU A;  5FRM A;  4AM3 A;  4EM1 A;  4LIV A;  2M34 A;  4BY7 J;  3FX6 A;  4MCR A;  4CGM A;  2DEA A;  2RKH A;  3B73 A;  4ZX8 A;  4UHT A;  3HOW J;  2PJ4 A;  1TF8 A;  2CH0 A;  2LY2 A;  4RGU A;  3FJU A;  4W97 A;  2HKX A;  4NF1 A;  2RNJ A;  1QQI A;  1XC5 A;  1B6A A;  4G12 A;  2LTP A;  3R96 A;  2VOO A;  3C18 A;  3CP2 A;  3H9J A;  3ZQG A;  1U2W A;  4XIC A;  4IXA A;  2ZED A;  1TNT A;  4MXU A;  3V8K A;  2DA2 A;  2JEV A;  2R98 A;  1A2Z A;  4UIB A;  3DWL E;  3SXN A;  1RO5 A;  4HF0 A;  2KIQ A;  3OR2 C;  3CO7 C;  5AG4 A;  4ESB A;  5GTH C;  3PL8 A;  1W36 C;  1JI8 A;  1PU9 A;  4P10 A;  4H2K A;  4CGO A;  2QUF A;  4JXQ A;  2WY7 Q;  4CXF A;  2X6W A;  4EGY A;  2C1C A;  3HKZ N;  2MD5 A;  2Y75 A;  5EJC A;  1OZP A;  3KP3 A;  2UUZ A;  1UAA A;  4JXR A;  2P6S A;  2M4G A;  3FYN A;  4PXD A;  3KYC B;  4BEH A;  2EZH A;  3D7D A;  3QPT A;  3ZMS A;  1XMT A;  1CM0 A;  3KEQ A;  3GTG J;  5DCM B;  3FBN B;  3F23 A;  1GLN A;  4ANJ A;  2IJL A;  4I0B A;  2KIS A;  3HTU A;  2R7U A;  1QNT A;  1S7F A;  4CYN A;  4ENN A;  3R9G A;  2CUE A;  4E7I A;  4PK2 A;  1AKH A;  1GUU A;  4IQJ A;  1YVO A;  4LLG F;  3RKQ A;  2V7F A;  4M72 A;  3KP6 A;  3B35 A;  5LRG A;  3BR1 A;  3SDG A;  3E6M A;  3IH4 A;  4GRI A;  1PUF A;  2OBP A;  2DAO A;  2QYO A;  2Y9Y A;  3KPH A;  1ZH5 A;  3PFO A;  1Z77 A;  4IRG A;  2Q4Y A;  4HX4 A;  3F6V A;  2ADU A;  2DPD A;  4B5P B;  2EA4 A;  3TO6 A;  3FVL A;  4PJM A;  1IYK A;  4OU0 A;  3IC7 A;  2K02 A;  2IXS A;  3ISZ A;  1J2X A;  2KJB A;  2KMU A;  5M5Y J;  2A61 A;  3MKL A;  1IAW A;  4ZH4 F;  5A28 A;  3FKI J;  2FOK A;  3FMQ A;  3ZQQ A;  1Z2L A;  4LB6 B;  4C7H A;  2KLO A;  2V1D A;  5HOO A;  2QQ8 A;  2ABZ A;  4IZZ A;  2CRG A;  4JWP A;  1K4S A;  1PP8 F;  3FIW A;  3IGR A;  1ETK A;  3OV8 A;  4LGW A;  5GPA A;  5JVT A;  4P44 A;  4CCL A;  4ZY0 A;  2X1C A;  1CF7 B;  3Q0V A;  4MFK A;  4OC1 A;  3FK6 A;  3MAJ A;  4FX4 A;  3S1M J;  1SD5 A;  5DCF A;  2VL8 A;  9ANT A;  3S32 A;  4L9J A;  2D1H A;  2K40 A;  2BY0 A;  1YLF A;  3MCZ A;  3K10 A;  3O8G A;  1VQM I;  3H5Z A;  1VI0 A;  2PJC A;  2VT2 A;  1ZHF A;  2Q7S A;  2XEI A;  2HQN A;  3K70 C;  2LMD A;  1VZ0 A;  1OCR H;  1SAU A;  4Z2Y A;  2ZJQ F;  3CCV I;  3TTH A;  1WK4 A;  1OCP A;  1FBS A;  2OTL I;  4G6Q A;  3BTJ A;  4L5J A;  3GFI A;  2Q4V A;  2P7V B;  1KQ8 A;  2R0Q C;  2CWE A;  3C2G A;  4ZZL A;  5BPD A;  2VQC A;  3CQZ J;  3E6B A;  2A05 A;  2K5C A;  1Z05 A;  4JBA A;  3AG1 H;  1Z4E A;  1MMG A;  4OIW A;  3WGI A;  2XF6 A;  2HNH A;  2LYC A;  1OYW A;  5EGO B;  3BPV A;  2HFH A;  4C2M J;  4UV8 A;  4FAS D;  1KGS A;  5DUK A;  1HST A;  2R7D A;  1FIP A;  1XCB A;  4F92 B;  2STT A;  2RDP A;  5CVU A;  2VOP A;  2JT1 A;  2E7W A;  4GXH A;  1G6N A;  3HUG B;  4ZYD A;  1IY7 A;  1R6R A;  3K1N A;  2Z5U A;  1WJB A;  4RN7 A;  2K5T A;  1WJC A;  3H8G A;  4MHP A;  1VND A;  1X58 A;  2V9P A;  5FD5 A;  1RUO A;  2VKD A;  3MKZ A;  2G3T A;  2CIJ A;  4XID A;  2EK8 A;  1I21 A;  1JUM A;  4HQM A;  3CDX A;  1R58 A;  1VQO I;  4B09 A;  2QEN A;  4A30 A;  3GTK J;  1GT0 C;  1EKE A;  1TW2 A;  2EIK H;  4DYO A;  3WE2 A;  3QNV A;  2LVS A;  4UY8 I;  3A9L A;  4IHM A;  2M5W A;  1JWQ A;  3SEZ A;  5G1Z A;  2DQR A;  5JQ4 A;  3GBG A;  3M07 A;  5IT9 K;  2L0K A;  3P2H A;  5M3F J;  2DO7 A;  3MKY B;  2YU9 J;  4R3K A;  4A37 A;  4E6K G;  1VHE A;  2DTR A;  3HKZ A;  2O28 A;  2YNC A;  1JTX A;  3FWE A;  5HVG A;  1VF9 A;  3L2W A;  1VKC A;  4HPS A;  2FA5 A;  2ZXJ A;  5CNP A;  1Z9C A;  4LMY A;  1Q7L A;  3H5A A;  3IIB A;  1J7K A;  1I6H J;  4BH9 A;  2L2O A;  3E0K A;  2VPL A;  3DLJ A;  2M1B A;  1TKF A;  1TXR A;  2O53 A;  3T8W A;  2YND A;  1WJ5 A;  3G4S I;  4OC5 A;  2Y48 A;  4Y49 C;  5HH1 A;  5LEJ A;  3WTY C;  4CAF A;  2VB6 A;  4PFO A;  1Z5R A;  2ZW5 A;  2FT0 A; 
#chains in the Genus database with same CATH homology
 1N75 A;  2BW3 A;  1YK3 A;  2Z0Z A;  3PFY A;  2VXZ A;  2AE6 A;  2GIV A;  4BDY A;  2CW8 A;  2AJ6 A;  3DLA A;  3UY5 A;  3OYI A;  3BLN A;  1YLE A;  5CKT A;  2ZSI B;  2IS2 A;  2P6F A;  2VEZ A;  4F93 B;  1XEB A;  4PV6 A;  4OAD A;  2RC4 A;  2ATR A;  5DWM A;  3BG6 A;  3K4K A;  2UWM A;  4DGW B;  4H6Z A;  3HPG A;  4P1W A;  1XF8 A;  2R7T A;  2W7N A;  2DJI A;  1Y9K A;  2Z16 A;  4C9Y A;  2FIA A;  1VHS A;  5HMN A;  1GHE A;  4KSA A;  4FD5 A;  3NE7 A;  1LVK A;  1WJE A;  1X1D A;  4RM3 A;  4NC7 A;  4XM3 A;  3AKZ A;  1Z7L A;  3FKJ A;  1WWZ A;  3SZG A;  1ON0 A;  3S6F A;  5DWN A;  2G3A A;  5E96 A;  1MJA A;  1X19 A;  4U5Y A;  2ZXH A;  2F4I A;  2XAU A;  1Z9U A;  2CNM A;  1M4G A;  3S3N A;  3LD2 A;  4YFJ A;  3H5N A;  4BUP A;  4E7Z A;  4L8A A;  4CSW A;  4B5P A;  1NG6 A;  4BDZ A;  2R7S A;  1D0Z A;  1KUV A;  4DOZ A;  3H4Q A;  4NXY A;  5KTC A;  4MFQ A;  1P0H A;  4NSQ A;  2J8M A;  4PJL A;  4JOM A;  5F47 A;  4L89 A;  1QU3 A;  4HSR A;  1FMV A;  1CJW A;  2BOL A;  4ZC3 A;  4DBR A;  2BVL A;  3CMM A;  2REE A;  2PJR B;  4NC8 A;  3ZRG A;  3SXO A;  4AVA A;  4ZTF A;  3MGD A;  1LFP A;  2I8D A;  3DU6 A;  1M1D A;  1UFH A;  3LOD A;  4KOX A;  4E8O A;  1DQU A;  2Z11 A;  4YEJ A;  4Y49 B;  2E1M B;  4F3Q A;  5FVJ A;  4BMH A;  2KP6 A;  2FS5 A;  3DKY A;  4CCN A;  4PJJ A;  4FD4 A;  3ZJ0 A;  2VAS A;  3W3C A;  1LDK B;  2VZZ A;  2ARH A;  4BQQ A;  4IF5 A;  2HVS A;  1U6M A;  4LUA A;  1V5E A;  3FNC A;  3K4N A;  1Q2D A;  4KVO E;  3W91 A;  2JVH A;  3IP4 B;  2Z2S B;  2HUZ A;  4CA0 A;  3BC8 A;  2Z1D A;  4JLY A;  4MHD A;  2HDW A;  2JSP A;  4R3L A;  5I0C A;  4R79 A;  3D3S A;  4U7B A;  3V42 A;  3L2R A;  3S6G A;  1MJ9 A;  4HKF A;  4I49 A;  4BJT A;  1N71 A;  4CAV A;  1E0E A;  4UCP A;  3OYN A;  3EFA A;  3PUB A;  4Y4R A;  3I3L A;  2X51 A;  4BL0 B;  3OS1 A;  2VQG A;  3IUO A;  3HOS A;  3PNT A;  4KOW A;  3ZR8 X;  1KZF A;  4MI4 A;  3OYE A;  4E7H A;  4NQW B;  2V6E A;  2AQF A;  4HNT A;  3CJR B;  2OZU A;  3HG9 A;  3U21 A;  1IID A;  4HRI A;  2Q0Y A;  2DCE A;  1UEL B;  2W82 A;  1IRX A;  3KX2 A;  3VWB A;  2ZSH B;  4YEL A;  2RNG A;  4BE2 A;  2VJ4 A;  4PUS A;  1IYL A;  2P6G A;  4CGN A;  1FMW A;  4KT6 A;  4PSW A;  2PR1 A;  3K6G A;  3FDY A;  2R7X A;  4KLV A;  4B11 A;  3R9E A;  4N4O B;  3ZXS A;  2OC6 A;  1X4O A;  4FD7 A;  4XPK A;  1S5K A;  2BL1 A;  3L2U A;  3VYU B;  4CCM A;  5KTA A;  1D1C A;  2M0M A;  2UV1 A;  4OAE A;  3OYA A;  1YRE A;  4ZYA A;  1P9Q C;  3DU5 A;  4KVX A;  4RMN A;  4A31 A;  1YR0 A;  2WY8 Q;  3OY9 A;  2LOO A;  4CAX A;  3PNV A;  5CPR B;  3BJ7 A;  3RCO A;  3PJR A;  3QYB A;  2LBF B;  1QSO A;  3C2H A;  4JJX A;  2MAB A;  2X6Y A;  3JUW A;  4BXF A;  4BAC A;  1QHG A;  5HVQ C;  1IIC A;  2D4P A;  2WPW A;  3PZJ A;  4UFX A;  3VDX A;  3OYJ A;  3EO4 A;  2VBQ A;  3FB3 A;  4E7J A;  2BSW A;  4MFL A;  1RXT A;  3T9Y A;  3DEE A;  2VLA A;  2Q7B A;  2WAF A;  3FRM A;  2VKH A;  4RI1 A;  2V4J C;  4FET A;  2WAQ A;  2WBM A;  1P4N A;  3SDB A;  3I9S A;  4IQ4 A;  3DPL C;  4C2X A;  2VQY A;  4J01 A;  2Q1Z B;  2R7O A;  3ZZI A;  1TT0 A;  1K6Y A;  2DT7 B;  1UG0 A;  2R7Q A;  2B3V A;  2DPS A;  2FCK A;  4C2Z A;  2H5M A;  4KOS A;  1KON A;  4PJN A;  1BR1 A;  5H86 A;  1FY7 A;  4ZBG A;  3F5B A;  4MFP A;  5BWA B;  2CFO A;  4B48 A;  4KSF A;  2B3U A;  3GY9 A;  3DR6 A;  3N7Z A;  4RM2 A;  2I79 A;  1TIQ A;  2QKL B;  2B4D A;  3TOB A;  3H9G A;  3PP9 A;  4KIS A;  1J09 A;  4QUS A;  4A33 A;  4C2Y A;  2ELJ A;  4OWR B;  2B58 A;  4UFV A;  2M3A A;  3J7A Y;  2B5G B;  1S9H A;  2A6T A;  1N78 A;  1NMT A;  2W00 A;  3D5L A;  2Q04 A;  3S8P A;  4YGO A;  4XPD C;  3S93 A;  2Z3N A;  4AVC A;  3K4M A;  3A4C A;  2E1M C;  1KUY A;  4CUG A;  2YNE A;  3VSL A;  3DDD A;  4CYP A;  1MMA A;  3RSN A;  1M4D A;  1XIX A;  2WA0 A;  5JHF A;  5C88 A;  3K9U A;  1ZEL A;  3EUH C;  2E5N A;  2JLM A;  3M1C A;  4KLW A;  2WAD A;  4B12 A;  3A2K A;  2EVN A;  3LSI A;  1D1A A;  2KZV A;  1S7L A;  2IGM A;  2VJ5 A;  4XKB A;  2F6C A;  3T90 A;  4F0Y A;  2CMP A;  4BEH B;  4CCJ A;  2AQE A;  2CY2 A;  3E1S A;  1T0F C;  4OAZ A;  1D0X A;  4XON A;  4LX9 A;  5ISV A;  1YGH A;  3K4J A;  2CNT A;  4A32 A;  4AU7 A;  4RS2 A;  1G8X A;  4CZC A;  3QAH A;  4HG2 A;  4MLO A;  4XOT A;  4E7K A;  2OZG A;  3I3G A;  1S7N A;  3TFY A;  1YX5 A;  1PJR A;  5JPH A;  3QOE A;  3UR3 C;  1YX3 A;  3OYK A;  1XE4 A;  4HPQ A;  4UWI A;  2X1E A;  2OUM A;  4U87 A;  4XN3 A;  4II3 A;  5HNH A;  2WSA A;  3CXP A;  1YE9 A;  4XLF A;  3HPH A;  1W36 D;  1DGW Y;  3QYF A;  4XR6 A;  1G59 A;  1BR2 A;  2VJJ A;  1R57 A;  5AG5 A;  3WR7 A;  1QHH D;  4ZGY B;  2PSW A;  2KRH A;  4HNW B;  1ERD A;  2OZH A;  2L7K A;  3F0A A;  3TO9 A;  2OH1 A;  1QST A;  1NSL A;  3AL0 B;  2M7A A;  3OOU A;  4XQF A;  2C27 A;  3D2P A;  1V5F A;  1Z3Y A;  2CUJ A;  3OWT A;  3G2B A;  1MW7 A;  3N05 A;  3ZCO A;  4P5O A;  2XC7 A;  4JD6 A;  4CYO A;  2L9N A;  4NNJ A;  1X1A A;  3K4B A;  3EC4 A;  3R1K A;  4XPD B;  2HPM A;  4OLL A;  2LRE A;  2HVQ A;  2R4G A;  3A1Y A;  4UA3 A;  3BCB A;  2PJR A;  2FXF A;  2I00 A;  3G8W A;  2KQR A;  4BQO A;  5KTD A;  3H5R A;  3OS0 A;  2YGW A;  4PK3 A;  2MFZ A;  3PSF A;  3DTI A;  3OYD A;  3W2W A;  5HLT A;  3I9V 2;  4C7I A;  2QML A;  2HVR A;  2MC4 A;  2V26 A;  2RQQ A;  4F6A A;  1LKX A;  2DT6 A;  2Z3P A;  1NE9 A;  1B6B A;  4HEA 2;  1S7K A;  2HV2 A;  2HZD A;  2JDD A;  4H89 A;  1MJB A;  4C68 A;  4KS9 A;  3TL4 X;  3W6S A;  4YRH A;  3S6H A;  4ZTJ A;  1TZL A;  2Z10 A;  1Z3X A;  4MBU A;  4CRY B;  2KDO A;  5AG6 A;  1I1D A;  1N77 A;  5KCM A;  4MFJ A;  1B87 A;  3R9F A;  4EVY A;  3DTK A;  3SYT A;  3EPZ A;  3AFH A;  4AVZ A;  2VZY A;  4GS4 A;  3MKW B;  3H35 A;  4UCN A;  3CES A;  3VYT B;  4CAE A;  3HC7 A;  3MMY B;  2KHM A;  1WJA A;  1V0C A;  3SEQ A;  4M85 A;  4ZJZ A;  2P0W A;  4X0G A;  3FXT A;  3VSK A;  1ZO0 A;  2IL4 A;  1QSN A;  4MY3 A;  3DPU A;  4C2U A;  4CAW A;  3QB8 A;  3DSB A;  2Q2E B;  2X1D A;  2PRB A;  1X1B A;  2BEI A;  4BBH A;  2PMZ A;  2IGO A;  2CNS A;  4NEX A;  4HST A;  3OYF A;  2YNC C;  3C26 A;  1MND A;  4ONU A;  1MNE A;  2OV7 A;  3OMY A;  2IS4 A;  3S3M A;  2FE7 A;  3G3S A;  4A95 A;  2R1I A;  5F46 A;  3CXS A;  2JDC A;  3BCA A;  3M8J A;  3VYS B;  3DTE A;  2CV0 A;  2CV1 A;  3OYG A;  3GYA A;  4AG9 A;  3OYC A;  4B3X A;  2JUG A;  2LBF A;  1BOB A;  4XPL A;  3DPT A;  4N4N B;  2VQL A;  2VXK A;  3S3O A;  4NUB A;  3RPU D;  2XDV A;  4B47 A;  5C82 A;  2E5Z A;  2JA2 A;  2M7B A;  2WPX A;  4KOT A;  2B4B A;  3F9K A;  3MD2 A;  4XKV A;  2PQ8 A;  2XF7 A;  4BU2 A;  2DPT A;  3TCV A;  4E7L A;  2WUU A;  4AVB A;  1SFK A;  3OYM A;  2V1N A;  1HA8 A;  2PR8 A;  5IX3 A;  5EBV A;  4XOR A;  5H84 A;  3W6X A;  1Z21 A;  1SQH A;  5A27 A;  4B44 A;  1S3Z A;  1DGR M;  4UBR A;  4CGP A;  1M44 A;  1AA7 A;  2Z3O A;  4KVM E;  5G20 A;  4Q36 A;  2QKM B;  2FSR A;  4UFW A;  4KOU A;  2W4S A;  5FRM A;  3FIX A;  5CQE A;  4LIV A;  4AYB A;  2XSJ C;  3DNS A;  4CGM A;  4CRZ B;  5AG7 A;  3AL0 C;  3EY5 A;  2WB1 A;  1K4J A;  3OYB A;  2M4K A;  2G0B A;  2KPM A;  2QEC A;  3HOT A;  4BGD A;  2CH0 A;  2LY2 A;  4NF1 A;  4B43 A;  5LD2 C;  1YX0 A;  5KHD A;  3R96 A;  4UWJ A;  3DQV C;  4IX7 A;  3CP2 A;  3H9J A;  3L2Q A;  2B5G A;  2EUI A;  5GCN A;  2GOX B;  3FBI B;  1WFX A;  3RQ4 A;  2R98 A;  2A5W A;  1T95 A;  2HPI A;  3PSI A;  3OR1 C;  1MK4 A;  2JEV A;  3ONQ A;  2Q44 A;  5KNL A;  4DBQ A;  2D4O A;  3DWL E;  4BJ6 C;  3OS2 A;  2RRE A;  1RO5 A;  3SXN A;  4UCM A;  3VWD A;  3OR2 C;  4A2Z A;  5AG4 A;  3IWE A;  1M4I A;  3OL4 A;  1W36 C;  1JI8 A;  3PL8 A;  4BQN A;  4CH7 A;  1PU9 A;  2REF A;  4CGO A;  3OWC A;  4JXQ A;  2WY7 Q;  2X6W A;  1MMD A;  3TOA A;  5TGT A;  4MY0 A;  2Z3M A;  4BS9 A;  1OZP A;  1U0J A;  2UUZ A;  1UAA A;  2KCW A;  4JXR A;  2A4N A;  4YRV A;  2M4G A;  4BJ5 C;  3FYN A;  4NCZ A;  4II9 A;  1EA3 A;  4BEH A;  2IS1 A;  3TBI A;  2BVM A;  2W1O A;  4Y33 A;  4QC6 A;  3SHP A;  2BW3 B;  1CM0 A;  2VIX A;  1XMT A;  3FBN B;  2LC2 A;  4Y3O A;  3D2M A;  4K30 A;  5HNF A;  4XL9 A;  3BJ8 A;  2LRD A;  4AB7 A;  4B13 A;  1L0C A;  1GLN A;  4ANJ A;  3JTK A;  4QPQ A;  4KOV A;  4KIT B;  4KOR A;  1X1C A;  2L9S A;  3H9Q A;  3ZGK A;  1I12 A;  2R7U A;  2IS6 A;  2LG4 A;  1S7F A;  4CYN A;  4G6T B;  4XMY A;  3OL3 A;  3R9G A;  4E7I A;  4HNU A;  4PK2 A;  4IQJ A;  1Z4R A;  2O5R A;  2CUZ A;  1YVO A;  3HL2 A;  2VXD A;  3EUA A;  3OIQ A;  1PYV A;  3OIP A;  4KJZ A;  5CQG A;  4CCK A;  2V7F A;  2VQH A;  3K4C A;  2CS3 A;  2CV2 A;  3F8K A;  3W2A A;  2ZW4 A;  4MFZ A;  5IB0 A;  3NWT A;  2K9M A;  4D1Q A;  2OU2 A;  2P6E A;  4ORF A;  4GRI A;  3DKX A;  5IV0 A;  4J3G A;  2Q4Y A;  4QVT A;  4XLC A;  4ZDL A;  3CP8 A;  4XN0 A;  3IU2 A;  4XNF A;  5AGE A;  3S6K A;  4B5P B;  3TO6 A;  4PJM A;  4ZDP A;  4DIQ A;  1IYK A;  2Z3K A;  2LH9 A;  4F55 A;  4F91 B;  2IXS A;  3EXN A;  2KMU A;  4QBJ A;  4IKF A;  2FUG 2;  1KUX A;  5A28 A;  2GAN A;  5LFA A;  3TE4 A;  2V9K A;  2GE3 A;  4R9M A;  4E7S A;  4XOP A;  2HQA A;  4LIU A;  3ZQQ A;  3VWE A;  2X6X A;  4C7H A;  2KLO A;  3K4L A;  4DJA A;  3OYH A;  3IWG A;  5HOO A;  4H6U A;  3LSM A;  4ITV A;  1BO4 A;  4CGL A;  4IZZ A;  4KOY A;  4JWP A;  4B14 A;  3IGR A;  3KKW A;  4XKW A;  4CCL A;  1QSM A;  2ZXV A;  3CF2 A;  2X1C A;  2E60 A;  4MFK A;  4XNH C;  4CS0 B;  2BUE A;  4FD6 A;  2VL8 A;  3FBU A;  3S32 A;  4C2T A;  3JVN A;  1PUA A;  4RLF A;  3H5Z A;  4B5O A;  3K10 A;  4U9Z A;  3L2V A;  2NOJ B;  2ZPA A;  4XLE A;  2DXQ A;  3K70 C;  4JQF A;  2R8V A;  2Y0M A;  4PFP A;  1VZ0 A;  1BR4 A;  1SAU A;  2Y0S A;  2X85 A;  1J4J A;  2HQY A;  3LSG A;  4F0X A;  2VI7 A;  3TTH A;  1WK4 A;  3LL7 A;  3E0J B;  5FRO A;  5EC4 A;  3PNY A;  4KUB A;  2IGN A;  2WAE A;  4X5K A;  1Y9W A;  3KYL A;  3LSH A;  2X7B A;  2Z3L A;  5F48 A;  2J8N A;  2Q4V A;  4IUS A;  4B10 A;  4OAY A;  3TT2 A;  3TMO A;  4XLH A;  3IAS 2;  3C2G A;  2LY1 A;  3LFU A;  2VQC A;  3IAM 2;  3OYL A;  5G21 A;  1NG7 A;  4KUA A;  2K5C A;  2F5I A;  3VYR B;  1Y7R A;  4RLQ A;  1Z4E A;  1MMG A;  3BG7 A;  1S60 A;  4AG7 A;  2MD0 A;  3K70 D;  2XF6 A;  2HNH A;  3QOD A;  2LYC A;  1Y56 A;  2VJI A;  2OB0 A;  2ZW7 A;  3CJQ B;  4FAS D;  3IU1 A;  3PGP A;  5J8C A;  1DP3 A;  2MYS A;  3DR8 A;  4DNC A;  4C30 A;  4EAT A;  3B8G A;  3TO7 A;  4F92 B;  2ZFU A;  1WJD A;  2PC1 A;  4II2 A;  5G22 A;  1LRZ A;  4H4K C;  4XKC A;  2R7H A;  2J8R A;  3HUG B;  1R6R A;  3D5R C;  4PSX A;  1OLT A;  1WJB A;  2ZXI A;  4BE0 A;  1WJC A;  3W2V A;  2K5T A;  3RYO A;  4HNY B;  2R7R A;  3P2F A;  2VKD A;  4HNX B;  3MKZ A;  2G3T A;  4MJ8 A;  4XNH B;  3RTR A;  4R57 A;  3FHN A;  2ZW6 A;  1I21 A;  3V8I A;  4QB9 A;  4J00 A;  2PDO A;  2HU9 A;  2FL4 A;  4A30 A;  1WJF A;  2F5V A;  3KEY A;  2DOA A;  2QIR A;  4PK4 A;  1V5G A;  4E4H A;  2DXI A;  4U9Y A;  1D0Y A;  3A9L A;  5JQ4 A;  3SEZ A;  5G1Z A;  2KL4 A;  1D1B A;  2GOM A;  3GBG A;  4E2A A;  3EUK L;  2K9L A;  3P2H A;  4M3S A;  2K3P A;  2B4D B;  4BE1 A;  1YVK A;  1X4P A;  2CXA A;  3NWS A;  3MKY B;  4R3K A;  1Y6I A;  4XLA A;  4E6K G;  2NMT A;  4LG3 A;  3GKR A;  3R95 A;  3HKZ A;  4QPO A;  2O28 A;  1IB1 E;  2YNC A;  3D8P A;  2XF5 A;  3UNG C;  3L2W A;  2R7V A;  1VKC A;  5J8F A;  3BLY A;  3QYE A;  5CNP A;  4LIT A;  2FIW A;  2CW7 A;  3CXQ A;  2L5Q A;  3H5A A;  3LSK A;  4R87 A;  1Q2C A;  2R7W A;  3CZ6 A;  3HXL A;  5F49 A;  4D9J A;  2L2O A;  1QSR A;  2VPL A;  3E0K A;  4KZT A;  3D5S C;  2YND A;  1WJ5 A;  3LMM A;  1OR7 C;  4F52 A;  2JVG A;  1Q2Y A;  4Y49 C;  5HH1 A;  4CCO A;  4E0A A;  4Q38 A;  5FRN A;  4CAF A;  2VB6 A;  1MMN A;  2KRC A;  2IGK A;  4PFO A;  3H0D A;  2FT0 A;  2ZW5 A;  4CYQ A;  4ZDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...