3G8WA

Crystal structure of a probable acetyltransferase from staphylococcus epidermidis atcc 12228
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
162
structure length
162
Chain Sequence
MNNIRLLNQNDLDSYIELMKFGHHNYEWDRYYLENVSIDRLKTILSNHTDYWNIFGAFEDDELVATCTLKQMNYVGKCHKAILENNFVKNNDEIVNRELINHIIQYAKEQNIETLMIAIASNNISAKVFFSSIGFENLAFEKNASKIGNEYFDENWLIYSTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lactococcal prophage ps3 protein 05
publication title The crystal structure of a probable acetyltransferase from Staphylococcus epidermidis ATCC 12228.
rcsb
source organism Staphylococcus epidermidis atcc 12228
molecule tags Transferase
total genus 45
structure length 162
sequence length 162
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3g8wA00
2FS5A 2PRBA 4CS0B 1QSTA 2Z0ZA 4JD6A 4PK3A 4R3LA 4XNHB 1Z4RA 2B5GA 4QUSA 4E2AA 2A4NA 4MY3A 2FIAA 3TFYA 3T9YA 2ZW7A 1L0CA 2Q4YA 1M4IA 2ZW6A 4KOYA 4CAVA 2VZZA 2F5IA 1Q2YA 2HQYA 3TO9A 2ZW5A 2Q0YA 1QSRA 4LX9A 5F49A 4OLLA 4I49A 1I21A 4FD5A 2GIVA 1IICA 3I3GA 4AG7A 3FYNA 1P4NA 4ZBGA 4YFJA 4X5KA 2PQ8A 5KTCA 2B58A 1WK4A 3WR7A 2FIWA 2FE7A 1K4JA 2B3VA 3TO7A 2P6GA 1V0CA 4QVTA 1Y9KA 5C88A 1KUYA 2NMTA 4HKFA 4B5PB 3R9GA 2K5TA 4XNHC 4KVXA 2VXKA 4XPDB 3D2PA 4PSWA 3N7ZA 4E8OA 3F5BA 3D8PA 3EO4A 2GE3A 2EUIA 3TOBA 4HNXB 4ONUA 3D3SA 3W6SA 4MY0A 2PR8A 2Z11A 3V8IA 3VWEA 5KTDA 1YK3A 1PUAA 3DR8A 2C27A 3B8GA 4HNYB 4KOTA 4U9YA 2VI7A 4BMHA 4NCZA 3KKWA 2B4BA 4U9ZA 2CNSA 2VBQA 1LRZA 2P0WA 2J8MA 2CNMA 2R7HA 4B5OA 4KUBA 2BEIA 2JDCA 5GCNA 2JDDA 4XPDC 2REFA 4RS2A 3DNSA 4IF5A 1MJAA 1YVKA 4UWIA 2R98A 4JXQA 4H6ZA 3E0KA 5H86A 1QSOA 4KLVA 3W6XA 4IUSA 2ATRA 5J8CA 2RC4A 4KOUA 5C82A 5CNPA 1S60A 3BJ8A 4KUAA 1CJWA 1YREA 4AB7A 4FD4A 1KZFA 2D4OA 1KUXA 4KVOE 3OWCA 1MJBA 1RXTA 2OU2A 3EC4A 2J8NA 3ZZIA 4J3GA 4MJ8A 1IYLA 4KORA 3S6FA 2G3AA 2OZGA 1Z4EA 3LODA 5I0CA 2B4DA 2P6FA 1MJ9A 3PZJA 1IB1E 3NE7A 5IB0A 1N71A 1S5KA 2D4PA 2BUEA 1S3ZA 2AJ6A 2GANA 3JUWA 4QC6A 2BL1A 4KOWA 4M3SA 1Y9WA 4KVME 4CAXA 4K30A 2FSRA 1QSNA 5F48A 4L89A 3TCVA 4II9A 2AE6A 1UFHA 4CRYB 4PV6A 1B87A 4DNCA 5JQ4A 2FXFA 4NF1A 2PR1A 3P2HA 3SXOA 3G8WA 3DR6A 2ZPAA 3H4QA 4CAWA 4NXYA 3S6HA 2OZUA 1KUVA 1WWZA 3F0AA 4Y49B 5JPHA 1YX0A 3TE4A 2OH1A 4AVCA 1XE4A 3QAHA 4R57A 1OZPA 4CRZB 3IWGA 2G0BA 4MBUA 2Z10A 5DWNA 4XPLA 2G3TA 4JXRA 2JLMA 4B5PA 2VQYA 3C26A 2I00A 5HH1A 4UBRA 4AG9A 4KLWA 1I1DA 2ARHA 1YR0A 3R96A 5KTAA 1SQHA 3IGRA 3MGDA 2Q7BA 3EY5A 4M85A 1M44A 4EVYA 1NE9A 1J4JA 3GY9A 1P0HA 2R8VA 5E96A 2QECA 2R1IA 3P2FA 5EBVA 3T90A 2VZYA 5ISVA 2B5GB 1XIXA 2REEA 1Z9UA 2FL4A 3R1KA 4AVAA 1YGHA 4R3KA 4OAEA 4OADA 2KCWA 4NSQA 3S6KA 3R95A 4L8AA 4FD6A 4R87A 3TT2A 3VWDA 3FBUA 3SXNA 1PU9A 1S7NA 3FRMA 1S7FA 4AVBA 5DWMA 2Q4VA 4YRHA 2OZHA 2PSWA 2QIRA 2ZW4A 3GKRA 4H6UA 2HUZA 3K9UA 3S6GA 1IYKA 1M4DA 3TOAA 4KOXA 4ORFA 2OB0A 2CNTA 1S7KA 3G3SA 2Q04A 3PGPA 1I12A 1XMTA 1Q2DA 1XF8A 4E0AA 3DDDA 2Y0MA 3QB8A 3GYAA 5F47A 5HMNA 1QSMA 4UWJA 2IL4A 4QB9A 1B6BA 4JWPA 5EC4A 4PK2A 2BSWA 1BO4A 2P6EA 2H5MA 3CXQA 4NEXA 3FXTA 3D2MA 2JEVA 1YVOA 5FVJA 3SHPA 4JJXA 4PSXA 3CXSA 4F6AA 3R9EA 2FT0A 1MK4A 3FB3A 4U5YA 2CY2A 1TIQA 2I79A 2WPWA 3DSBA 1RO5A 3W91A 3ZJ0A 1M4GA 1U6MA 3EXNA 4H89A 1FY7A 4FD7A 3RYOA 1CM0A 1YLEA 3LD2A 1VKCA 1XEBA 4HNWB 4JLYA 4QBJA 5J8FA 1NMTA 4MHDA 3UY5A 4YGOA 3TTHA 1Y7RA 5IV0A 4RI1A 3FIXA 4XPKA 1BOBA 2HV2A 3F8KA 5IX3A 4UA3A 3BLNA 3EFAA 1IIDA 4F0YA 2PDOA 4R9MA 3R9FA 2ZXVA 2EVNA 2PC1A 1S7LA 3BJ7A 3TO6A 4GS4A 2O28A 2QMLA 2Q44A 3FNCA 4LUAA 4KZTA 1ON0A 2WPXA 4Y49C 2B3UA 4KOVA 1Q2CA 2FCKA 3PP9A 2B4DB 3CXPA 3JVNA 4MI4A 2X7BA 2DXQA 4KOSA 1NSLA 5F46A 1VHSA 2VEZA 1R57A 2J8RA 5H84A 1M1DA 1GHEA 3I9SA
chains in the Genus database with same CATH superfamily
2FS5A 2PRBA 4A2ZA 1Z8XA 1Z8LA 2CF4A 4CS0B 1QSTA 4TWEA 4R6TA 4R76A 5G20A 2BO9A 2Z0ZA 3KL9A 4JD6A 5HVFA 4PK3A 4BD9A 2PJAA 1CBXA 4R3LA 4XNHB 1Z4RA 4OIDA 3WT4A 4F0XA 2B5GA 4B14A 2HC9A 4QUSA 3VH9A 4E2AA 1F2PA 2A4NA 3H8FA 3IFEA 3QAYA 4JZ0A 4MY3A 2FIAA 3TFYA 2PJ0A 4MFQA 3T9YA 2ZW7A 1L0CA 3CT9A 2Q4YA 1M4IA 2ZW6A 4KOYA 4CAVA 2VZZA 2F5IA 3KHZA 1Q2YA 3KQZA 2VL1A 2HQYA 3TO9A 3IU2A 2IMOA 5IB9A 1TF9A 2ZW5A 4H2KA 2CTBA 2GLJA 2C1CA 4P10A 2Q0YA 1QSRA 4F9VA 4UFVA 4LX9A 5F49A 4OLLA 4I49A 2ZEOA 1I21A 4FD5A 2GIVA 1IICA 3I3GA 2PJ6A 4NGSA 4AG7A 4AXVA 1JWQA 4CGNA 2DPTA 3FYNA 1P4NA 4LQ6A 4P6YA 2IJZA 4MFPA 2V8DA 1YW4A 3H8GA 4OC5A 4ZBGA 4YFJA 5BWAB 4X5KA 2PQ8A 4CGLA 5KTCA 2B58A 4MXUA 1WK4A 5LRJA 3KR4A 2FIWA 2FE7A 3D7FA 3HUVA 3WR7A 1K4JA 4MRIA 3D7GA 4UCMA 2IQ6A 1TKFA 2AFWA 2B3VA 3SI0A 3TO7A 2CIJA 2P6GA 1V0CA 1R3NA 4QVTA 1Y9KA 4PXCA 3LWUA 1X10A 1LAPA 5C88A 1KUYA 2NMTA 4HKFA 5A27A 2EO8A 3FMCA 4B5PB 2PJ2A 4YWYA 3R9GA 3IWWA 2K5TA 4XNHC 4P4FA 4KVXA 2VXKA 4XPDB 4CGOA 3D2PA 4PSWA 4KSIA 4DUKA 2PVWA 2YNCA 1OBRA 2ABZA 2F8HA 3RNZA 4EWTA 3N5FA 3N7ZA 4E8OA 3F5BA 4MFZA 3D8PA 3EO4A 4F8ZA 2GE3A 2PRQA 2YNCC 2EUIA 4MFJA 4UCNA 3TOBA 4HNXB 3PRTA 4ONUA 2DF5A 4TNUA 4CGPA 7CPAA 3D3SA 4BINA 5K8MA 3A9LA 2XEIA 3FJUA 3W6SA 2HB6A 4Q36A 3TX8A 3PB7X 1PYTB 3FX6A 4MY0A 2PR8A 4OP4A 2Z11A 1ZG8A 3V8IA 3VWEA 5KTDA 1YK3A 3H8EA 1PUAA 2BOAA 3DR8A 2C27A 3B8GA 3IWEA 4HNYB 3S9MA 4KOTA 4U9YA 2RFHA 1CG2A 4MCSA 3CDXA 2BCOA 2VI7A 4BMHA 4NCZA 3KKWA 2B4BA 2WYRA 4GM5A 4ZX9A 1ARLA 1XOVA 4U9ZA 3WABA 1EE3P 3DGVA 1LFWA 4C2YA 2AFXA 2CNSA 1LRZA 2P0WA 2VBQA 3KR5A 2J8MA 5JM6A 3QNVA 2CNMA 2R7HA 4IAVA 4NGRA 4NFRA 4B5OA 4KUBA 3WC6A 4B13A 3H5ZA 2NSMA 2BEIA 5J1QA 4M6HA 2JDCA 5GCNA 4A95A 1CPSA 3GIUA 2V8HA 2JDDA 4XPDC 2REFA 1DE4C 4RS2A 3DNSA 1IOFA 4IF5A 1KWMA 1MJAA 1YVKA 4UWIA 2V77A 2I3CA 2R98A 4JXQA 3KZWA 4WWVA 4H6ZA 3E0KA 5H86A 1QSOA 4KLVA 3W6XA 4IUSA 1F57A 4PXBA 2ATRA 5J8CA 2RC4A 1HDUA 3BI1A 4KOUA 4P45A 4MFLA 2EK9A 5C82A 4DJLA 1BAVA 5CNPA 5K8PA 4RUHA 3S9NA 1S60A 3BJ8A 4KUAA 1CJWA 2XEJA 3CPAA 1YREA 4AB7A 4LQGA 3KQXA 4FD4A 1KZFA 1ZG9A 2D4OA 8CPAA 1KUXA 4KVOE 3OWCA 1MJBA 2PCUA 1RXTA 4FBEA 2OU2A 3RAMA 4JYWA 3EC4A 1Z8WA 2J8NA 3FECA 3ZZIA 4J3GA 4MJ8A 1IYLA 2Z3KA 3GB0A 1LANA 4KORA 3S6FA 4G1PA 4B6ZA 3B3SA 3BXMA 4ZX8A 2G3AA 2OZGA 1Z4EA 3LODA 4EMEA 5I0CA 2B4DA 2DPSA 2P6FA 1MJ9A 2YNDA 2GFQA 3PZJA 2NYQA 4KS9A 2WSAA 1IB1E 1XMBA 2YNEA 3MRUA 3NE7A 5IB0A 3B3WA 1ELLP 2Z3OA 3FH4A 5LYDA 5D29A 4A33A 1ZLHA 1N71A 1S5KA 4B12A 3B3CA 2Q4ZA 1YLOA 2YGWA 1YQEA 3PFOA 4CAEA 2ZEEA 3GUXA 4C2XA 2D4PA 4X2TA 4NGMA 2BUEA 1S3ZA 5A28A 4A37A 2AJ6A 1Z5RA 5AG6A 3V38A 2GANA 1ZO0A 1H8LA 3JUWA 1F2OA 3LACA 5DS0A 4QC6A 4A94A 4P4BA 2BL1A 4KOWA 4M3SA 1BPMA 1Y9WA 4KVME 3RBUA 2PJ7A 4CAXA 4K30A 2FSRA 1QSNA 1ARMA 5F48A 4L89A 3TCVA 1CP7A 5AG7A 2AE6A 4II9A 1UFHA 4CRYB 5JGFA 4PV6A 1B87A 3D7DA 1CP6A 2ZEDA 3KHXA 4UCPA 4DNCA 3LMSA 3PB4X 1ELMP 5JQ4A 2FXFA 1ZG7A 4NF1A 2O53A 2PR1A 2XEGA 3P2HA 4PXEA 4ZY2A 3CZXA 3G8WA 3NE8A 3SXOA 1LOKA 5I4MA 3DR6A 4MCPA 5CBMA 4NGTA 2ZPAA 3H4QA 4P4DA 4NXYA 3S6HA 2OZUA 4CAWA 1KUVA 1WWZA 3F0AA 4Y49B 3S9LA 5JPHA 1YX0A 1JQGA 2ZEGA 3TE4A 2OH1A 1AMPA 4AVCA 1XE4A 3QAHA 4R57A 1OZPA 3VARA 4CRZB 5D8NA 1TKHA 2G0BA 3IWGA 4OC2A 4UF4A 2RB7A 4MBUA 2Z10A 5DWNA 1A2ZA 2JBJA 4XPLA 1NSAA 1VHEA 4HPSA 2G3TA 4UFWA 2AFZA 2ZEFA 4JXRA 2JLMA 4B5PA 4CAFA 2VQYA 3C26A 2I00A 5HH1A 3BI0A 4UEFA 5ELYA 4UBRA 4AG9A 4KLWA 1I1DA 2ARHA 1UWYA 1YR0A 4CYOA 3MN8A 1TKJA 4UIBA 4FUUA 3R96A 3RO0A 5KTAA 4OKOA 1VGYA 1SQHA 4K3NA 3IGRA 4R7MA 2PIYA 2WUUA 2WZNA 2ZEHA 2CXAA 3MGDA 2V8VA 2Q7BA 1VIXA 3IJ3A 3EY5A 4M85A 1M44A 4A39A 4NJRA 4EVYA 3IEHA 2EWBA 1NE9A 1CPXA 1J4JA 1P0HA 2C6PA 1LCPA 1Y7EA 2AFMA 2R8VA 3GY9A 4P4EA 1XRYA 2QECA 2R1IA 2Q51A 3P2FA 5E96A 4PXDA 1IY7A 5EBVA 2VZYA 4UEEA 3T90A 4A38A 5ISVA 4ONWA 1YW6A 2B5GB 4CGMA 1XIXA 3D66A 3D67A 2REEA 1Z9UA 2FL4A 3R1KA 1DTDA 4AVAA 2POKA 3FEEA 1YGHA 1FT7A 1IOIA 4R3KA 4NJQA 4OAEA 4OADA 2Z3LA 4X3RA 3SI1A 2CTCA 4F9UA 2KCWA 4NSQA 1PCAA 3S6KA 3R95A 3IU1A 3SI2A 4B11A 1Z2LA 4CPAA 2V8GA 4FWUA 4L8AA 4FD6A 4R87A 3TT2A 3VWDA 4DYOA 3FBUA 1IGBA 4Z65A 3SXNA 1PU9A 2AFOA 2ZEPA 3PBEA 1Q7LA 1S7NA 1TXRA 3PBBA 5CPAA 3FRMA 4P44A 1S7FA 2J9AA 2QJ8A 4AVBA 4ZI6A 2ZEMA 5DWMA 2Q4VA 4MCQA 4YRHA 2OZHA 2PSWA 4IK2A 5LRKA 2QIRA 4Q38A 1BPNA 2ZW4A 3GKRA 4H6UA 3SJXA 3HLPA 2HUZA 4KSAA 6CPAA 3WC7A 2JEWA 4OC3A 3K9UA 3S6GA 1IYKA 3PB6X 1M4DA 3TOAA 4A31A 1HEEA 2Z3NA 2O4HA 2GU2A 4KOXA 1ZLIA 2PJ8A 4BBHA 4ZY1A 4ORFA 4KSFA 2OB0A 1XBUA 1HDQA 2CNTA 2EBJA 4C7HA 5EMIA 3NFZA 1S7KA 4MHNA 5G1ZA 5HVGA 4CYPA 4CYNA 3G3SA 1YMEA 3NH5A 1QQ9A 2Z3PA 3D7HA 3NH4A 2XEFA 2Q04A 3KI9A 1I12A 1XMTA 3PGPA 4R8FA 1Q2DA 2ZELA 2OR4A 5F09A 1XF8A 4E0AA 3DDDA 4C68A 2Y0MA 3QB8A 3GYAA 1R43A 2EK8A 5F47A 3B35A 2PE3A 2JBKA 5HMNA 3RZAA 1QSMA 4UWJA 2IL4A 4MMOA 4QB9A 1B6BA 2PJBA 4JWPA 2PJ9A 4M6IA 5EC4A 3PB9X 1GYTA 3PEIA 4PK2A 2BSWA 4MHZA 4NGNA 1BO4A 1VHOA 2Q43A 2P6EA 1FNOA 2AFSA 3NH8A 3PB8X 2Z3MA 4OC1A 4B10A 2H5MA 3ISZA 3CXQA 4ZYQA 3L2NA 3JRUA 4NEXA 3SJEA 3FXTA 3SJGA 2Q7SA 3D2MA 4OC4A 5AG5A 2JEVA 5LYIA 4ZY0A 3WC5A 1AYEA 1YVOA 3IO1A 1TF8A 3B3TA 5FVJA 3SHPA 4NGPA 4IHMA 4OMEA 4JJXA 2C6GA 4PSXA 1BLLE 3CXSA 3K2KA 1M4LA 3R9EA 3VATA 2FT0A 4F6AA 1MK4A 3FB3A 5K8NA 4U5YA 2CY2A 2QVPA 3GLJA 1TIQA 4X8IA 1Y0RA 3TC8A 2PIZA 2GREA 1Z8TA 2I79A 2WPWA 3DSBA 1RO5A 4P4IA 1XFOA 3W91A 5LYFA 4FAIA 3ISXA 2PJ5A 2ZOFA 3ZJ0A 4A30A 5THWA 1M4GA 1U6MA 3EXNA 4H89A 5G22A 1FY7A 1RTQA 4FD7A 4OIWA 5LRGA 3RYOA 1CM0A 1YLEA 3BHXA 4M6GA 2AFUA 3T8WA 1IU8A 5K8OA 2DEAA 3LD2A 4UFXA 3FVLA 1X12A 1LAMA 4GXHA 4CYQA 5HXDA 1VKCA 1XEBA 4HNWB 2ZOGA 4JLYA 4QBJA 5J8FA 1NMTA 4MHDA 3UY5A 3FF3A 1XJOA 4YGOA 3TTHA 3V7ZA 3CPXA 1Y7RA 3KGQA 5IV0A 4RI1A 4RN7A 3FIXA 2GLFA 3IIBA 4UEZA 2ZENA 4XPKA 4EFDA 4PQAA 1BOBA 2HV2A 3F8KA 5IX3A 1Y0YA 5G21A 4MFKA 3I1UA 5HVHA 4UA3A 3BLNA 4P4JA 2ANPA 3EFAA 1IIDA 2C6CA 3B7IA 3D4UA 4F0YA 2F7VA 4O23A 5AG4A 2PDOA 4R9MA 3R9FA 3D68A 2ZXVA 4ZGYB 2EVNA 2G9DA 2PC1A 3DLJA 2QYVA 1S7LA 3BJ7A 3TO6A 4GS4A 4OC0A 4C7IA 3IC1A 2O28A 2QMLA 2PVVA 4MHPA 3SJFA 2Q44A 3B2YA 3FNCA 4LUAA 4WJBA 2PJ3A 3K9TA 4C2ZA 4MCRA 4YU9A 1QMUA 2PJ4A 4KZTA 1ON0A 2WPXA 4UIAA 2B3UA 4Y49C 4KOVA 3KASA 1Q2CA 1CX8A 2ODFA 2FCKA 3PP9A 2OOTA 2B4DB 4A32A 5AGEA 3CXPA 1AUGA 3JVNA 4W9YA 4MI4A 3JTKA 5JH9A 2X7BA 3NA6A 5LYLA 2DXQA 3B3VA 4KOSA 1NSLA 1YSJA 3PFEA 4MHYA 5F46A 1VHSA 3FEDA 2VEZA 1R57A 2J8RA 2PJCA 4PPZA 2FVGA 4NGQA 5H84A 1M1DA 1GHEA 2PJ1A 3I9SA 4Q7AA
chains in the Genus database with same CATH topology
2FS5A 2PRBA 4A2ZA 4CS0B 1QSTA 5G20A 2Z0ZA 4JD6A 4PK3A 4R3LA 4XNHB 1Z4RA 4F0XA 2B5GA 4B14A 4QUSA 4E2AA 2A4NA 4MY3A 2FIAA 3TFYA 4MFQA 3T9YA 2ZW7A 1L0CA 2Q4YA 1M4IA 2ZW6A 4KOYA 4CAVA 2VZZA 2F5IA 1Q2YA 2HQYA 3TO9A 3IU2A 2ZW5A 2Q0YA 1QSRA 4UFVA 4LX9A 5F49A 4OLLA 4I49A 1I21A 4FD5A 2GIVA 1IICA 3I3GA 4AG7A 4CGNA 2DPTA 3FYNA 1P4NA 4MFPA 4ZBGA 5BWAB 4YFJA 4X5KA 2PQ8A 4CGLA 5KTCA 2B58A 1WK4A 3WR7A 2FIWA 2FE7A 1K4JA 4UCMA 2B3VA 3TO7A 2P6GA 1V0CA 4QVTA 1Y9KA 5C88A 1KUYA 2NMTA 4HKFA 5A27A 4B5PB 3R9GA 2K5TA 4XNHC 4KVXA 2VXKA 4XPDB 4CGOA 3D2PA 4PSWA 2YNCA 3N7ZA 4E8OA 3F5BA 4MFZA 3D8PA 3EO4A 2GE3A 2YNCC 2EUIA 4MFJA 4UCNA 3TOBA 4HNXB 4ONUA 4CGPA 3D3SA 3A9LA 3W6SA 4Q36A 4MY0A 2PR8A 2Z11A 3V8IA 3VWEA 5KTDA 1YK3A 1PUAA 3DR8A 2C27A 3B8GA 3IWEA 4HNYB 4KOTA 4U9YA 2VI7A 4BMHA 4NCZA 3KKWA 2B4BA 4C2YA 4U9ZA 2CNSA 2VBQA 1LRZA 2P0WA 2J8MA 2CNMA 2R7HA 4B5OA 4KUBA 4B13A 3H5ZA 2BEIA 2JDCA 5GCNA 4A95A 2JDDA 4XPDC 2REFA 4RS2A 3DNSA 4IF5A 1MJAA 1YVKA 4UWIA 2R98A 4JXQA 4H6ZA 3E0KA 5H86A 1QSOA 4KLVA 3W6XA 4IUSA 2ATRA 5J8CA 2RC4A 4KOUA 5C82A 4MFLA 5CNPA 1S60A 3BJ8A 4KUAA 1CJWA 1YREA 4AB7A 4FD4A 1KZFA 2D4OA 1KUXA 4KVOE 3OWCA 1MJBA 1RXTA 2OU2A 3EC4A 2J8NA 3ZZIA 4J3GA 4MJ8A 1IYLA 2Z3KA 4KORA 3S6FA 2G3AA 2OZGA 1Z4EA 3LODA 5I0CA 2B4DA 2DPSA 2P6FA 1MJ9A 2YNDA 3PZJA 4KS9A 2WSAA 1IB1E 2YNEA 3NE7A 5IB0A 2Z3OA 4A33A 1N71A 1S5KA 4B12A 2YGWA 4CAEA 4C2XA 2D4PA 2BUEA 1S3ZA 5A28A 2AJ6A 5AG6A 2GANA 1ZO0A 3JUWA 4QC6A 2BL1A 4KOWA 4M3SA 1Y9WA 4KVME 4CAXA 4K30A 2FSRA 1QSNA 5F48A 4L89A 3TCVA 5AG7A 4II9A 2AE6A 1UFHA 4CRYB 4PV6A 1B87A 4UCPA 4DNCA 5JQ4A 2FXFA 4NF1A 2PR1A 3P2HA 3SXOA 3G8WA 3DR6A 2ZPAA 3H4QA 4CAWA 4NXYA 3S6HA 2OZUA 1KUVA 1WWZA 3F0AA 4Y49B 5JPHA 1YX0A 3TE4A 2OH1A 4AVCA 1XE4A 3QAHA 4R57A 1OZPA 4CRZB 3IWGA 2G0BA 4MBUA 2Z10A 5DWNA 4XPLA 2G3TA 4UFWA 4JXRA 2JLMA 4B5PA 4CAFA 2VQYA 3C26A 2I00A 5HH1A 4UBRA 4AG9A 4KLWA 1I1DA 2ARHA 1YR0A 4CYOA 3R96A 5KTAA 1SQHA 3IGRA 2WUUA 2CXAA 3MGDA 2Q7BA 3EY5A 4M85A 1M44A 4EVYA 1NE9A 1J4JA 3GY9A 1P0HA 2R8VA 5E96A 4A32A 2QECA 2R1IA 3P2FA 5EBVA 3T90A 2VZYA 5ISVA 2B5GB 4CGMA 1XIXA 2REEA 1Z9UA 2FL4A 3R1KA 4AVAA 1YGHA 4R3KA 4OAEA 4OADA 2Z3LA 2KCWA 4NSQA 3S6KA 3R95A 3IU1A 4B11A 4L8AA 4FD6A 4R87A 3TT2A 3VWDA 3FBUA 3SXNA 1PU9A 1S7NA 3FRMA 1S7FA 4AVBA 5DWMA 2Q4VA 4YRHA 2OZHA 2PSWA 2QIRA 4Q38A 2ZW4A 3GKRA 4H6UA 4KSAA 2HUZA 3K9UA 3S6GA 1IYKA 1M4DA 3TOAA 4A31A 2Z3NA 4BBHA 4KOXA 4ORFA 4KSFA 2OB0A 2CNTA 4C7HA 1S7KA 5G1ZA 4CYPA 4CYNA 3G3SA 2Z3PA 2Q04A 3PGPA 1I12A 1XMTA 1Q2DA 1XF8A 4E0AA 3DDDA 4C68A 2Y0MA 3QB8A 3GYAA 5F47A 5HMNA 1QSMA 4UWJA 2IL4A 4QB9A 1B6BA 4JWPA 5EC4A 4PK2A 2BSWA 1BO4A 2P6EA 2Z3MA 4B10A 2H5MA 3CXQA 4NEXA 3FXTA 5AG5A 3D2MA 2JEVA 1YVOA 5FVJA 3SHPA 4JJXA 4PSXA 3CXSA 4F6AA 3R9EA 2FT0A 1MK4A 3FB3A 4U5YA 2CY2A 1TIQA 2I79A 2WPWA 3DSBA 1RO5A 3W91A 3ZJ0A 4A30A 1M4GA 1U6MA 3EXNA 4H89A 5G22A 1FY7A 4FD7A 3RYOA 1CM0A 1YLEA 3LD2A 4UFXA 4CYQA 1VKCA 1XEBA 4HNWB 4JLYA 4QBJA 5J8FA 1NMTA 4MHDA 3UY5A 4YGOA 3TTHA 1Y7RA 5IV0A 4RI1A 3FIXA 4XPKA 1BOBA 2HV2A 3F8KA 5IX3A 5G21A 4MFKA 4UA3A 3BLNA 3EFAA 1IIDA 4F0YA 5AG4A 2PDOA 4R9MA 3R9FA 2ZXVA 4ZGYB 2EVNA 2PC1A 1S7LA 3BJ7A 3TO6A 4GS4A 4C7IA 2O28A 2QMLA 2Q44A 3FNCA 4LUAA 4C2ZA 4KZTA 1ON0A 2WPXA 4Y49C 2B3UA 4KOVA 1Q2CA 2FCKA 3PP9A 2B4DB 5AGEA 3CXPA 3JVNA 4MI4A 3JTKA 2X7BA 2DXQA 4KOSA 1NSLA 5F46A 1VHSA 2VEZA 1R57A 2J8RA 5H84A 1M1DA 1GHEA 3I9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FS5 A;  2PRB A;  4CS0 B;  1QST A;  2Z0Z A;  4JD6 A;  4PK3 A;  4R3L A;  4XNH B;  1Z4R A;  2B5G A;  4QUS A;  4E2A A;  2A4N A;  4MY3 A;  2FIA A;  3TFY A;  3T9Y A;  2ZW7 A;  1L0C A;  2Q4Y A;  1M4I A;  2ZW6 A;  4KOY A;  4CAV A;  2VZZ A;  2F5I A;  1Q2Y A;  2HQY A;  3TO9 A;  2ZW5 A;  2Q0Y A;  1QSR A;  4LX9 A;  5F49 A;  4OLL A;  4I49 A;  1I21 A;  4FD5 A;  2GIV A;  1IIC A;  3I3G A;  4AG7 A;  3FYN A;  1P4N A;  4ZBG A;  4YFJ A;  4X5K A;  2PQ8 A;  5KTC A;  2B58 A;  1WK4 A;  3WR7 A;  2FIW A;  2FE7 A;  1K4J A;  2B3V A;  3TO7 A;  2P6G A;  1V0C A;  4QVT A;  1Y9K A;  5C88 A;  1KUY A;  2NMT A;  4HKF A;  4B5P B;  3R9G A;  2K5T A;  4XNH C;  4KVX A;  2VXK A;  4XPD B;  3D2P A;  4PSW A;  3N7Z A;  4E8O A;  3F5B A;  3D8P A;  3EO4 A;  2GE3 A;  2EUI A;  3TOB A;  4HNX B;  4ONU A;  3D3S A;  3W6S A;  4MY0 A;  2PR8 A;  2Z11 A;  3V8I A;  3VWE A;  5KTD A;  1YK3 A;  1PUA A;  3DR8 A;  2C27 A;  3B8G A;  4HNY B;  4KOT A;  4U9Y A;  2VI7 A;  4BMH A;  4NCZ A;  3KKW A;  2B4B A;  4U9Z A;  2CNS A;  2VBQ A;  1LRZ A;  2P0W A;  2J8M A;  2CNM A;  2R7H A;  4B5O A;  4KUB A;  2BEI A;  2JDC A;  5GCN A;  2JDD A;  4XPD C;  2REF A;  4RS2 A;  3DNS A;  4IF5 A;  1MJA A;  1YVK A;  4UWI A;  2R98 A;  4JXQ A;  4H6Z A;  3E0K A;  5H86 A;  1QSO A;  4KLV A;  3W6X A;  4IUS A;  2ATR A;  5J8C A;  2RC4 A;  4KOU A;  5C82 A;  5CNP A;  1S60 A;  3BJ8 A;  4KUA A;  1CJW A;  1YRE A;  4AB7 A;  4FD4 A;  1KZF A;  2D4O A;  1KUX A;  4KVO E;  3OWC A;  1MJB A;  1RXT A;  2OU2 A;  3EC4 A;  2J8N A;  3ZZI A;  4J3G A;  4MJ8 A;  1IYL A;  4KOR A;  3S6F A;  2G3A A;  2OZG A;  1Z4E A;  3LOD A;  5I0C A;  2B4D A;  2P6F A;  1MJ9 A;  3PZJ A;  1IB1 E;  3NE7 A;  5IB0 A;  1N71 A;  1S5K A;  2D4P A;  2BUE A;  1S3Z A;  2AJ6 A;  2GAN A;  3JUW A;  4QC6 A;  2BL1 A;  4KOW A;  4M3S A;  1Y9W A;  4KVM E;  4CAX A;  4K30 A;  2FSR A;  1QSN A;  5F48 A;  4L89 A;  3TCV A;  4II9 A;  2AE6 A;  1UFH A;  4CRY B;  4PV6 A;  1B87 A;  4DNC A;  5JQ4 A;  2FXF A;  4NF1 A;  2PR1 A;  3P2H A;  3SXO A;  3G8W A;  3DR6 A;  2ZPA A;  3H4Q A;  4CAW A;  4NXY A;  3S6H A;  2OZU A;  1KUV A;  1WWZ A;  3F0A A;  4Y49 B;  5JPH A;  1YX0 A;  3TE4 A;  2OH1 A;  4AVC A;  1XE4 A;  3QAH A;  4R57 A;  1OZP A;  4CRZ B;  3IWG A;  2G0B A;  4MBU A;  2Z10 A;  5DWN A;  4XPL A;  2G3T A;  4JXR A;  2JLM A;  4B5P A;  2VQY A;  3C26 A;  2I00 A;  5HH1 A;  4UBR A;  4AG9 A;  4KLW A;  1I1D A;  2ARH A;  1YR0 A;  3R96 A;  5KTA A;  1SQH A;  3IGR A;  3MGD A;  2Q7B A;  3EY5 A;  4M85 A;  1M44 A;  4EVY A;  1NE9 A;  1J4J A;  3GY9 A;  1P0H A;  2R8V A;  5E96 A;  2QEC A;  2R1I A;  3P2F A;  5EBV A;  3T90 A;  2VZY A;  5ISV A;  2B5G B;  1XIX A;  2REE A;  1Z9U A;  2FL4 A;  3R1K A;  4AVA A;  1YGH A;  4R3K A;  4OAE A;  4OAD A;  2KCW A;  4NSQ A;  3S6K A;  3R95 A;  4L8A A;  4FD6 A;  4R87 A;  3TT2 A;  3VWD A;  3FBU A;  3SXN A;  1PU9 A;  1S7N A;  3FRM A;  1S7F A;  4AVB A;  5DWM A;  2Q4V A;  4YRH A;  2OZH A;  2PSW A;  2QIR A;  2ZW4 A;  3GKR A;  4H6U A;  2HUZ A;  3K9U A;  3S6G A;  1IYK A;  1M4D A;  3TOA A;  4KOX A;  4ORF A;  2OB0 A;  2CNT A;  1S7K A;  3G3S A;  2Q04 A;  3PGP A;  1I12 A;  1XMT A;  1Q2D A;  1XF8 A;  4E0A A;  3DDD A;  2Y0M A;  3QB8 A;  3GYA A;  5F47 A;  5HMN A;  1QSM A;  4UWJ A;  2IL4 A;  4QB9 A;  1B6B A;  4JWP A;  5EC4 A;  4PK2 A;  2BSW A;  1BO4 A;  2P6E A;  2H5M A;  3CXQ A;  4NEX A;  3FXT A;  3D2M A;  2JEV A;  1YVO A;  5FVJ A;  3SHP A;  4JJX A;  4PSX A;  3CXS A;  4F6A A;  3R9E A;  2FT0 A;  1MK4 A;  3FB3 A;  4U5Y A;  2CY2 A;  1TIQ A;  2I79 A;  2WPW A;  3DSB A;  1RO5 A;  3W91 A;  3ZJ0 A;  1M4G A;  1U6M A;  3EXN A;  4H89 A;  1FY7 A;  4FD7 A;  3RYO A;  1CM0 A;  1YLE A;  3LD2 A;  1VKC A;  1XEB A;  4HNW B;  4JLY A;  4QBJ A;  5J8F A;  1NMT A;  4MHD A;  3UY5 A;  4YGO A;  3TTH A;  1Y7R A;  5IV0 A;  4RI1 A;  3FIX A;  4XPK A;  1BOB A;  2HV2 A;  3F8K A;  5IX3 A;  4UA3 A;  3BLN A;  3EFA A;  1IID A;  4F0Y A;  2PDO A;  4R9M A;  3R9F A;  2ZXV A;  2EVN A;  2PC1 A;  1S7L A;  3BJ7 A;  3TO6 A;  4GS4 A;  2O28 A;  2QML A;  2Q44 A;  3FNC A;  4LUA A;  4KZT A;  1ON0 A;  2WPX A;  4Y49 C;  2B3U A;  4KOV A;  1Q2C A;  2FCK A;  3PP9 A;  2B4D B;  3CXP A;  3JVN A;  4MI4 A;  2X7B A;  2DXQ A;  4KOS A;  1NSL A;  5F46 A;  1VHS A;  2VEZ A;  1R57 A;  2J8R A;  5H84 A;  1M1D A;  1GHE A;  3I9S A; 
#chains in the Genus database with same CATH topology
 2FS5 A;  2PRB A;  4A2Z A;  1Z8X A;  1Z8L A;  2CF4 A;  4CS0 B;  1QST A;  4TWE A;  4R6T A;  4R76 A;  5G20 A;  2BO9 A;  2Z0Z A;  3KL9 A;  4JD6 A;  5HVF A;  4PK3 A;  4BD9 A;  2PJA A;  1CBX A;  4R3L A;  4XNH B;  1Z4R A;  4OID A;  3WT4 A;  4F0X A;  2B5G A;  4B14 A;  2HC9 A;  4QUS A;  3VH9 A;  4E2A A;  1F2P A;  2A4N A;  3H8F A;  3IFE A;  3QAY A;  4JZ0 A;  4MY3 A;  2FIA A;  3TFY A;  2PJ0 A;  4MFQ A;  3T9Y A;  2ZW7 A;  1L0C A;  3CT9 A;  2Q4Y A;  1M4I A;  2ZW6 A;  4KOY A;  4CAV A;  2VZZ A;  2F5I A;  3KHZ A;  1Q2Y A;  3KQZ A;  2VL1 A;  2HQY A;  3TO9 A;  3IU2 A;  2IMO A;  5IB9 A;  1TF9 A;  2ZW5 A;  4H2K A;  2CTB A;  2GLJ A;  2C1C A;  4P10 A;  2Q0Y A;  1QSR A;  4F9V A;  4UFV A;  4LX9 A;  5F49 A;  4OLL A;  4I49 A;  2ZEO A;  1I21 A;  4FD5 A;  2GIV A;  1IIC A;  3I3G A;  2PJ6 A;  4NGS A;  4AG7 A;  4AXV A;  1JWQ A;  4CGN A;  2DPT A;  3FYN A;  1P4N A;  4LQ6 A;  4P6Y A;  2IJZ A;  4MFP A;  2V8D A;  1YW4 A;  3H8G A;  4OC5 A;  4ZBG A;  4YFJ A;  5BWA B;  4X5K A;  2PQ8 A;  4CGL A;  5KTC A;  2B58 A;  4MXU A;  1WK4 A;  5LRJ A;  3KR4 A;  2FIW A;  2FE7 A;  3D7F A;  3HUV A;  3WR7 A;  1K4J A;  4MRI A;  3D7G A;  4UCM A;  2IQ6 A;  1TKF A;  2AFW A;  2B3V A;  3SI0 A;  3TO7 A;  2CIJ A;  2P6G A;  1V0C A;  1R3N A;  4QVT A;  1Y9K A;  4PXC A;  3LWU A;  1X10 A;  1LAP A;  5C88 A;  1KUY A;  2NMT A;  4HKF A;  5A27 A;  2EO8 A;  3FMC A;  4B5P B;  2PJ2 A;  4YWY A;  3R9G A;  3IWW A;  2K5T A;  4XNH C;  4P4F A;  4KVX A;  2VXK A;  4XPD B;  4CGO A;  3D2P A;  4PSW A;  4KSI A;  4DUK A;  2PVW A;  2YNC A;  1OBR A;  2ABZ A;  2F8H A;  3RNZ A;  4EWT A;  3N5F A;  3N7Z A;  4E8O A;  3F5B A;  4MFZ A;  3D8P A;  3EO4 A;  4F8Z A;  2GE3 A;  2PRQ A;  2YNC C;  2EUI A;  4MFJ A;  4UCN A;  3TOB A;  4HNX B;  3PRT A;  4ONU A;  2DF5 A;  4TNU A;  4CGP A;  7CPA A;  3D3S A;  4BIN A;  5K8M A;  3A9L A;  2XEI A;  3FJU A;  3W6S A;  2HB6 A;  4Q36 A;  3TX8 A;  3PB7 X;  1PYT B;  3FX6 A;  4MY0 A;  2PR8 A;  4OP4 A;  2Z11 A;  1ZG8 A;  3V8I A;  3VWE A;  5KTD A;  1YK3 A;  3H8E A;  1PUA A;  2BOA A;  3DR8 A;  2C27 A;  3B8G A;  3IWE A;  4HNY B;  3S9M A;  4KOT A;  4U9Y A;  2RFH A;  1CG2 A;  4MCS A;  3CDX A;  2BCO A;  2VI7 A;  4BMH A;  4NCZ A;  3KKW A;  2B4B A;  2WYR A;  4GM5 A;  4ZX9 A;  1ARL A;  1XOV A;  4U9Z A;  3WAB A;  1EE3 P;  3DGV A;  1LFW A;  4C2Y A;  2AFX A;  2CNS A;  1LRZ A;  2P0W A;  2VBQ A;  3KR5 A;  2J8M A;  5JM6 A;  3QNV A;  2CNM A;  2R7H A;  4IAV A;  4NGR A;  4NFR A;  4B5O A;  4KUB A;  3WC6 A;  4B13 A;  3H5Z A;  2NSM A;  2BEI A;  5J1Q A;  4M6H A;  2JDC A;  5GCN A;  4A95 A;  1CPS A;  3GIU A;  2V8H A;  2JDD A;  4XPD C;  2REF A;  1DE4 C;  4RS2 A;  3DNS A;  1IOF A;  4IF5 A;  1KWM A;  1MJA A;  1YVK A;  4UWI A;  2V77 A;  2I3C A;  2R98 A;  4JXQ A;  3KZW A;  4WWV A;  4H6Z A;  3E0K A;  5H86 A;  1QSO A;  4KLV A;  3W6X A;  4IUS A;  1F57 A;  4PXB A;  2ATR A;  5J8C A;  2RC4 A;  1HDU A;  3BI1 A;  4KOU A;  4P45 A;  4MFL A;  2EK9 A;  5C82 A;  4DJL A;  1BAV A;  5CNP A;  5K8P A;  4RUH A;  3S9N A;  1S60 A;  3BJ8 A;  4KUA A;  1CJW A;  2XEJ A;  3CPA A;  1YRE A;  4AB7 A;  4LQG A;  3KQX A;  4FD4 A;  1KZF A;  1ZG9 A;  2D4O A;  8CPA A;  1KUX A;  4KVO E;  3OWC A;  1MJB A;  2PCU A;  1RXT A;  4FBE A;  2OU2 A;  3RAM A;  4JYW A;  3EC4 A;  1Z8W A;  2J8N A;  3FEC A;  3ZZI A;  4J3G A;  4MJ8 A;  1IYL A;  2Z3K A;  3GB0 A;  1LAN A;  4KOR A;  3S6F A;  4G1P A;  4B6Z A;  3B3S A;  3BXM A;  4ZX8 A;  2G3A A;  2OZG A;  1Z4E A;  3LOD A;  4EME A;  5I0C A;  2B4D A;  2DPS A;  2P6F A;  1MJ9 A;  2YND A;  2GFQ A;  3PZJ A;  2NYQ A;  4KS9 A;  2WSA A;  1IB1 E;  1XMB A;  2YNE A;  3MRU A;  3NE7 A;  5IB0 A;  3B3W A;  1ELL P;  2Z3O A;  3FH4 A;  5LYD A;  5D29 A;  4A33 A;  1ZLH A;  1N71 A;  1S5K A;  4B12 A;  3B3C A;  2Q4Z A;  1YLO A;  2YGW A;  1YQE A;  3PFO A;  4CAE A;  2ZEE A;  3GUX A;  4C2X A;  2D4P A;  4X2T A;  4NGM A;  2BUE A;  1S3Z A;  5A28 A;  4A37 A;  2AJ6 A;  1Z5R A;  5AG6 A;  3V38 A;  2GAN A;  1ZO0 A;  1H8L A;  3JUW A;  1F2O A;  3LAC A;  5DS0 A;  4QC6 A;  4A94 A;  4P4B A;  2BL1 A;  4KOW A;  4M3S A;  1BPM A;  1Y9W A;  4KVM E;  3RBU A;  2PJ7 A;  4CAX A;  4K30 A;  2FSR A;  1QSN A;  1ARM A;  5F48 A;  4L89 A;  3TCV A;  1CP7 A;  5AG7 A;  2AE6 A;  4II9 A;  1UFH A;  4CRY B;  5JGF A;  4PV6 A;  1B87 A;  3D7D A;  1CP6 A;  2ZED A;  3KHX A;  4UCP A;  4DNC A;  3LMS A;  3PB4 X;  1ELM P;  5JQ4 A;  2FXF A;  1ZG7 A;  4NF1 A;  2O53 A;  2PR1 A;  2XEG A;  3P2H A;  4PXE A;  4ZY2 A;  3CZX A;  3G8W A;  3NE8 A;  3SXO A;  1LOK A;  5I4M A;  3DR6 A;  4MCP A;  5CBM A;  4NGT A;  2ZPA A;  3H4Q A;  4P4D A;  4NXY A;  3S6H A;  2OZU A;  4CAW A;  1KUV A;  1WWZ A;  3F0A A;  4Y49 B;  3S9L A;  5JPH A;  1YX0 A;  1JQG A;  2ZEG A;  3TE4 A;  2OH1 A;  1AMP A;  4AVC A;  1XE4 A;  3QAH A;  4R57 A;  1OZP A;  3VAR A;  4CRZ B;  5D8N A;  1TKH A;  2G0B A;  3IWG A;  4OC2 A;  4UF4 A;  2RB7 A;  4MBU A;  2Z10 A;  5DWN A;  1A2Z A;  2JBJ A;  4XPL A;  1NSA A;  1VHE A;  4HPS A;  2G3T A;  4UFW A;  2AFZ A;  2ZEF A;  4JXR A;  2JLM A;  4B5P A;  4CAF A;  2VQY A;  3C26 A;  2I00 A;  5HH1 A;  3BI0 A;  4UEF A;  5ELY A;  4UBR A;  4AG9 A;  4KLW A;  1I1D A;  2ARH A;  1UWY A;  1YR0 A;  4CYO A;  3MN8 A;  1TKJ A;  4UIB A;  4FUU A;  3R96 A;  3RO0 A;  5KTA A;  4OKO A;  1VGY A;  1SQH A;  4K3N A;  3IGR A;  4R7M A;  2PIY A;  2WUU A;  2WZN A;  2ZEH A;  2CXA A;  3MGD A;  2V8V A;  2Q7B A;  1VIX A;  3IJ3 A;  3EY5 A;  4M85 A;  1M44 A;  4A39 A;  4NJR A;  4EVY A;  3IEH A;  2EWB A;  1NE9 A;  1CPX A;  1J4J A;  1P0H A;  2C6P A;  1LCP A;  1Y7E A;  2AFM A;  2R8V A;  3GY9 A;  4P4E A;  1XRY A;  2QEC A;  2R1I A;  2Q51 A;  3P2F A;  5E96 A;  4PXD A;  1IY7 A;  5EBV A;  2VZY A;  4UEE A;  3T90 A;  4A38 A;  5ISV A;  4ONW A;  1YW6 A;  2B5G B;  4CGM A;  1XIX A;  3D66 A;  3D67 A;  2REE A;  1Z9U A;  2FL4 A;  3R1K A;  1DTD A;  4AVA A;  2POK A;  3FEE A;  1YGH A;  1FT7 A;  1IOI A;  4R3K A;  4NJQ A;  4OAE A;  4OAD A;  2Z3L A;  4X3R A;  3SI1 A;  2CTC A;  4F9U A;  2KCW A;  4NSQ A;  1PCA A;  3S6K A;  3R95 A;  3IU1 A;  3SI2 A;  4B11 A;  1Z2L A;  4CPA A;  2V8G A;  4FWU A;  4L8A A;  4FD6 A;  4R87 A;  3TT2 A;  3VWD A;  4DYO A;  3FBU A;  1IGB A;  4Z65 A;  3SXN A;  1PU9 A;  2AFO A;  2ZEP A;  3PBE A;  1Q7L A;  1S7N A;  1TXR A;  3PBB A;  5CPA A;  3FRM A;  4P44 A;  1S7F A;  2J9A A;  2QJ8 A;  4AVB A;  4ZI6 A;  2ZEM A;  5DWM A;  2Q4V A;  4MCQ A;  4YRH A;  2OZH A;  2PSW A;  4IK2 A;  5LRK A;  2QIR A;  4Q38 A;  1BPN A;  2ZW4 A;  3GKR A;  4H6U A;  3SJX A;  3HLP A;  2HUZ A;  4KSA A;  6CPA A;  3WC7 A;  2JEW A;  4OC3 A;  3K9U A;  3S6G A;  1IYK A;  3PB6 X;  1M4D A;  3TOA A;  4A31 A;  1HEE A;  2Z3N A;  2O4H A;  2GU2 A;  4KOX A;  1ZLI A;  2PJ8 A;  4BBH A;  4ZY1 A;  4ORF A;  4KSF A;  2OB0 A;  1XBU A;  1HDQ A;  2CNT A;  2EBJ A;  4C7H A;  5EMI A;  3NFZ A;  1S7K A;  4MHN A;  5G1Z A;  5HVG A;  4CYP A;  4CYN A;  3G3S A;  1YME A;  3NH5 A;  1QQ9 A;  2Z3P A;  3D7H A;  3NH4 A;  2XEF A;  2Q04 A;  3KI9 A;  1I12 A;  1XMT A;  3PGP A;  4R8F A;  1Q2D A;  2ZEL A;  2OR4 A;  5F09 A;  1XF8 A;  4E0A A;  3DDD A;  4C68 A;  2Y0M A;  3QB8 A;  3GYA A;  1R43 A;  2EK8 A;  5F47 A;  3B35 A;  2PE3 A;  2JBK A;  5HMN A;  3RZA A;  1QSM A;  4UWJ A;  2IL4 A;  4MMO A;  4QB9 A;  1B6B A;  2PJB A;  4JWP A;  2PJ9 A;  4M6I A;  5EC4 A;  3PB9 X;  1GYT A;  3PEI A;  4PK2 A;  2BSW A;  4MHZ A;  4NGN A;  1BO4 A;  1VHO A;  2Q43 A;  2P6E A;  1FNO A;  2AFS A;  3NH8 A;  3PB8 X;  2Z3M A;  4OC1 A;  4B10 A;  2H5M A;  3ISZ A;  3CXQ A;  4ZYQ A;  3L2N A;  3JRU A;  4NEX A;  3SJE A;  3FXT A;  3SJG A;  2Q7S A;  3D2M A;  4OC4 A;  5AG5 A;  2JEV A;  5LYI A;  4ZY0 A;  3WC5 A;  1AYE A;  1YVO A;  3IO1 A;  1TF8 A;  3B3T A;  5FVJ A;  3SHP A;  4NGP A;  4IHM A;  4OME A;  4JJX A;  2C6G A;  4PSX A;  1BLL E;  3CXS A;  3K2K A;  1M4L A;  3R9E A;  3VAT A;  2FT0 A;  4F6A A;  1MK4 A;  3FB3 A;  5K8N A;  4U5Y A;  2CY2 A;  2QVP A;  3GLJ A;  1TIQ A;  4X8I A;  1Y0R A;  3TC8 A;  2PIZ A;  2GRE A;  1Z8T A;  2I79 A;  2WPW A;  3DSB A;  1RO5 A;  4P4I A;  1XFO A;  3W91 A;  5LYF A;  4FAI A;  3ISX A;  2PJ5 A;  2ZOF A;  3ZJ0 A;  4A30 A;  5THW A;  1M4G A;  1U6M A;  3EXN A;  4H89 A;  5G22 A;  1FY7 A;  1RTQ A;  4FD7 A;  4OIW A;  5LRG A;  3RYO A;  1CM0 A;  1YLE A;  3BHX A;  4M6G A;  2AFU A;  3T8W A;  1IU8 A;  5K8O A;  2DEA A;  3LD2 A;  4UFX A;  3FVL A;  1X12 A;  1LAM A;  4GXH A;  4CYQ A;  5HXD A;  1VKC A;  1XEB A;  4HNW B;  2ZOG A;  4JLY A;  4QBJ A;  5J8F A;  1NMT A;  4MHD A;  3UY5 A;  3FF3 A;  1XJO A;  4YGO A;  3TTH A;  3V7Z A;  3CPX A;  1Y7R A;  3KGQ A;  5IV0 A;  4RI1 A;  4RN7 A;  3FIX A;  2GLF A;  3IIB A;  4UEZ A;  2ZEN A;  4XPK A;  4EFD A;  4PQA A;  1BOB A;  2HV2 A;  3F8K A;  5IX3 A;  1Y0Y A;  5G21 A;  4MFK A;  3I1U A;  5HVH A;  4UA3 A;  3BLN A;  4P4J A;  2ANP A;  3EFA A;  1IID A;  2C6C A;  3B7I A;  3D4U A;  4F0Y A;  2F7V A;  4O23 A;  5AG4 A;  2PDO A;  4R9M A;  3R9F A;  3D68 A;  2ZXV A;  4ZGY B;  2EVN A;  2G9D A;  2PC1 A;  3DLJ A;  2QYV A;  1S7L A;  3BJ7 A;  3TO6 A;  4GS4 A;  4OC0 A;  4C7I A;  3IC1 A;  2O28 A;  2QML A;  2PVV A;  4MHP A;  3SJF A;  2Q44 A;  3B2Y A;  3FNC A;  4LUA A;  4WJB A;  2PJ3 A;  3K9T A;  4C2Z A;  4MCR A;  4YU9 A;  1QMU A;  2PJ4 A;  4KZT A;  1ON0 A;  2WPX A;  4UIA A;  2B3U A;  4Y49 C;  4KOV A;  3KAS A;  1Q2C A;  1CX8 A;  2ODF A;  2FCK A;  3PP9 A;  2OOT A;  2B4D B;  4A32 A;  5AGE A;  3CXP A;  1AUG A;  3JVN A;  4W9Y A;  4MI4 A;  3JTK A;  5JH9 A;  2X7B A;  3NA6 A;  5LYL A;  2DXQ A;  3B3V A;  4KOS A;  1NSL A;  1YSJ A;  3PFE A;  4MHY A;  5F46 A;  1VHS A;  3FED A;  2VEZ A;  1R57 A;  2J8R A;  2PJC A;  4PPZ A;  2FVG A;  4NGQ A;  5H84 A;  1M1D A;  1GHE A;  2PJ1 A;  3I9S A;  4Q7A A; 
#chains in the Genus database with same CATH homology
 2FS5 A;  2PRB A;  4A2Z A;  4CS0 B;  1QST A;  5G20 A;  2Z0Z A;  4JD6 A;  4PK3 A;  4R3L A;  4XNH B;  1Z4R A;  4F0X A;  2B5G A;  4B14 A;  4QUS A;  4E2A A;  2A4N A;  4MY3 A;  2FIA A;  3TFY A;  4MFQ A;  3T9Y A;  2ZW7 A;  1L0C A;  2Q4Y A;  1M4I A;  2ZW6 A;  4KOY A;  4CAV A;  2VZZ A;  2F5I A;  1Q2Y A;  2HQY A;  3TO9 A;  3IU2 A;  2ZW5 A;  2Q0Y A;  1QSR A;  4UFV A;  4LX9 A;  5F49 A;  4OLL A;  4I49 A;  1I21 A;  4FD5 A;  2GIV A;  1IIC A;  3I3G A;  4AG7 A;  4CGN A;  2DPT A;  3FYN A;  1P4N A;  4MFP A;  4ZBG A;  5BWA B;  4YFJ A;  4X5K A;  2PQ8 A;  4CGL A;  5KTC A;  2B58 A;  1WK4 A;  3WR7 A;  2FIW A;  2FE7 A;  1K4J A;  4UCM A;  2B3V A;  3TO7 A;  2P6G A;  1V0C A;  4QVT A;  1Y9K A;  5C88 A;  1KUY A;  2NMT A;  4HKF A;  5A27 A;  4B5P B;  3R9G A;  2K5T A;  4XNH C;  4KVX A;  2VXK A;  4XPD B;  4CGO A;  3D2P A;  4PSW A;  2YNC A;  3N7Z A;  4E8O A;  3F5B A;  4MFZ A;  3D8P A;  3EO4 A;  2GE3 A;  2YNC C;  2EUI A;  4MFJ A;  4UCN A;  3TOB A;  4HNX B;  4ONU A;  4CGP A;  3D3S A;  3A9L A;  3W6S A;  4Q36 A;  4MY0 A;  2PR8 A;  2Z11 A;  3V8I A;  3VWE A;  5KTD A;  1YK3 A;  1PUA A;  3DR8 A;  2C27 A;  3B8G A;  3IWE A;  4HNY B;  4KOT A;  4U9Y A;  2VI7 A;  4BMH A;  4NCZ A;  3KKW A;  2B4B A;  4C2Y A;  4U9Z A;  2CNS A;  2VBQ A;  1LRZ A;  2P0W A;  2J8M A;  2CNM A;  2R7H A;  4B5O A;  4KUB A;  4B13 A;  3H5Z A;  2BEI A;  2JDC A;  5GCN A;  4A95 A;  2JDD A;  4XPD C;  2REF A;  4RS2 A;  3DNS A;  4IF5 A;  1MJA A;  1YVK A;  4UWI A;  2R98 A;  4JXQ A;  4H6Z A;  3E0K A;  5H86 A;  1QSO A;  4KLV A;  3W6X A;  4IUS A;  2ATR A;  5J8C A;  2RC4 A;  4KOU A;  5C82 A;  4MFL A;  5CNP A;  1S60 A;  3BJ8 A;  4KUA A;  1CJW A;  1YRE A;  4AB7 A;  4FD4 A;  1KZF A;  2D4O A;  1KUX A;  4KVO E;  3OWC A;  1MJB A;  1RXT A;  2OU2 A;  3EC4 A;  2J8N A;  3ZZI A;  4J3G A;  4MJ8 A;  1IYL A;  2Z3K A;  4KOR A;  3S6F A;  2G3A A;  2OZG A;  1Z4E A;  3LOD A;  5I0C A;  2B4D A;  2DPS A;  2P6F A;  1MJ9 A;  2YND A;  3PZJ A;  4KS9 A;  2WSA A;  1IB1 E;  2YNE A;  3NE7 A;  5IB0 A;  2Z3O A;  4A33 A;  1N71 A;  1S5K A;  4B12 A;  2YGW A;  4CAE A;  4C2X A;  2D4P A;  2BUE A;  1S3Z A;  5A28 A;  2AJ6 A;  5AG6 A;  2GAN A;  1ZO0 A;  3JUW A;  4QC6 A;  2BL1 A;  4KOW A;  4M3S A;  1Y9W A;  4KVM E;  4CAX A;  4K30 A;  2FSR A;  1QSN A;  5F48 A;  4L89 A;  3TCV A;  5AG7 A;  4II9 A;  2AE6 A;  1UFH A;  4CRY B;  4PV6 A;  1B87 A;  4UCP A;  4DNC A;  5JQ4 A;  2FXF A;  4NF1 A;  2PR1 A;  3P2H A;  3SXO A;  3G8W A;  3DR6 A;  2ZPA A;  3H4Q A;  4CAW A;  4NXY A;  3S6H A;  2OZU A;  1KUV A;  1WWZ A;  3F0A A;  4Y49 B;  5JPH A;  1YX0 A;  3TE4 A;  2OH1 A;  4AVC A;  1XE4 A;  3QAH A;  4R57 A;  1OZP A;  4CRZ B;  3IWG A;  2G0B A;  4MBU A;  2Z10 A;  5DWN A;  4XPL A;  2G3T A;  4UFW A;  4JXR A;  2JLM A;  4B5P A;  4CAF A;  2VQY A;  3C26 A;  2I00 A;  5HH1 A;  4UBR A;  4AG9 A;  4KLW A;  1I1D A;  2ARH A;  1YR0 A;  4CYO A;  3R96 A;  5KTA A;  1SQH A;  3IGR A;  2WUU A;  2CXA A;  3MGD A;  2Q7B A;  3EY5 A;  4M85 A;  1M44 A;  4EVY A;  1NE9 A;  1J4J A;  3GY9 A;  1P0H A;  2R8V A;  5E96 A;  4A32 A;  2QEC A;  2R1I A;  3P2F A;  5EBV A;  3T90 A;  2VZY A;  5ISV A;  2B5G B;  4CGM A;  1XIX A;  2REE A;  1Z9U A;  2FL4 A;  3R1K A;  4AVA A;  1YGH A;  4R3K A;  4OAE A;  4OAD A;  2Z3L A;  2KCW A;  4NSQ A;  3S6K A;  3R95 A;  3IU1 A;  4B11 A;  4L8A A;  4FD6 A;  4R87 A;  3TT2 A;  3VWD A;  3FBU A;  3SXN A;  1PU9 A;  1S7N A;  3FRM A;  1S7F A;  4AVB A;  5DWM A;  2Q4V A;  4YRH A;  2OZH A;  2PSW A;  2QIR A;  4Q38 A;  2ZW4 A;  3GKR A;  4H6U A;  4KSA A;  2HUZ A;  3K9U A;  3S6G A;  1IYK A;  1M4D A;  3TOA A;  4A31 A;  2Z3N A;  4BBH A;  4KOX A;  4ORF A;  4KSF A;  2OB0 A;  2CNT A;  4C7H A;  1S7K A;  5G1Z A;  4CYP A;  4CYN A;  3G3S A;  2Z3P A;  2Q04 A;  3PGP A;  1I12 A;  1XMT A;  1Q2D A;  1XF8 A;  4E0A A;  3DDD A;  4C68 A;  2Y0M A;  3QB8 A;  3GYA A;  5F47 A;  5HMN A;  1QSM A;  4UWJ A;  2IL4 A;  4QB9 A;  1B6B A;  4JWP A;  5EC4 A;  4PK2 A;  2BSW A;  1BO4 A;  2P6E A;  2Z3M A;  4B10 A;  2H5M A;  3CXQ A;  4NEX A;  3FXT A;  5AG5 A;  3D2M A;  2JEV A;  1YVO A;  5FVJ A;  3SHP A;  4JJX A;  4PSX A;  3CXS A;  4F6A A;  3R9E A;  2FT0 A;  1MK4 A;  3FB3 A;  4U5Y A;  2CY2 A;  1TIQ A;  2I79 A;  2WPW A;  3DSB A;  1RO5 A;  3W91 A;  3ZJ0 A;  4A30 A;  1M4G A;  1U6M A;  3EXN A;  4H89 A;  5G22 A;  1FY7 A;  4FD7 A;  3RYO A;  1CM0 A;  1YLE A;  3LD2 A;  4UFX A;  4CYQ A;  1VKC A;  1XEB A;  4HNW B;  4JLY A;  4QBJ A;  5J8F A;  1NMT A;  4MHD A;  3UY5 A;  4YGO A;  3TTH A;  1Y7R A;  5IV0 A;  4RI1 A;  3FIX A;  4XPK A;  1BOB A;  2HV2 A;  3F8K A;  5IX3 A;  5G21 A;  4MFK A;  4UA3 A;  3BLN A;  3EFA A;  1IID A;  4F0Y A;  5AG4 A;  2PDO A;  4R9M A;  3R9F A;  2ZXV A;  4ZGY B;  2EVN A;  2PC1 A;  1S7L A;  3BJ7 A;  3TO6 A;  4GS4 A;  4C7I A;  2O28 A;  2QML A;  2Q44 A;  3FNC A;  4LUA A;  4C2Z A;  4KZT A;  1ON0 A;  2WPX A;  4Y49 C;  2B3U A;  4KOV A;  1Q2C A;  2FCK A;  3PP9 A;  2B4D B;  5AGE A;  3CXP A;  3JVN A;  4MI4 A;  3JTK A;  2X7B A;  2DXQ A;  4KOS A;  1NSL A;  5F46 A;  1VHS A;  2VEZ A;  1R57 A;  2J8R A;  5H84 A;  1M1D A;  1GHE A;  3I9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...