3G8WA

Crystal structure of a probable acetyltransferase from staphylococcus epidermidis atcc 12228
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
162
structure length
162
Chain Sequence
b'MNNIRLLNQNDLDSYIELMKFGHHNYEWDRYYLENVSIDRLKTILSNHTDYWNIFGAFEDDELVATCTLKQMNYVGKCHKAILENNFVKNNDEIVNRELINHIIQYAKEQNIETLMIAIASNNISAKVFFSSIGFENLAFEKNASKIGNEYFDENWLIYSTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lactococcal prophage ps3 protein 05
publication title The crystal structure of a probable acetyltransferase from Staphylococcus epidermidis ATCC 12228.
rcsb
source organism Staphylococcus epidermidis atcc 12228
molecule tags Transferase
total genus 45
structure length 162
sequence length 162
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3g8wA00
4I49A 4QB9A 2ATRA 5JQ4A 2ZW5A 3G8WA 4LUAA 2VZYA 3TT2A 4UBRA 1Z4RA 4R9MA 2B4DB 2FSRA 2ZW7A 4F6AA 2FT0A 3QB8A 1VKCA 4KOYA 1S7KA 2GIVA 3S6FA 4KVXA 2AJ6A 4CRZB 3EY5A 4F0YA 3V8IA 2Z0ZA 4E8OA 3R96A 3WR7A 4E2AA 3C26A 4K30A 1YREA 4CAWA 4CAVA 2G0BA 2B5GA 4IUSA 3UY5A 1I21A 3FXTA 3SHPA 4HNWB 4PK3A 4R87A 3SXOA 5HMNA 2B58A 3P2FA 1UFHA 2QIRA 2JLMA 1Z4EA 2WPXA 2A4NA 1B6BA 2ZPAA 4UA3A 4IF5A 4PSXA 2WPWA 2PDOA 4XNHC 4FD5A 4Y49C 3GYAA 5IB0A 1IIDA 1XEBA 3EO4A 2R1IA 2Q04A 1QSRA 2VI7A 1FY7A 3LD2A 2Z11A 4DNCA 1YVOA 2J8RA 1YVKA 4QBJA 1KUXA 2OZHA 5GCNA 4RI1A 3S6GA 2R98A 3DDDA 3EXNA 4XNHB 4Y49B 2FS5A 4EVYA 4UWIA 2P6FA 2REFA 2ZW4A 3GY9A 4KOTA 4B5OA 1S7FA 1Y9WA 1P4NA 1M4IA 1VHSA 5ISVA 4L89A 2PC1A 4JXQA 4JWPA 2BSWA 4NSQA 1Q2DA 2EVNA 4KZTA 3K9UA 1BOBA 1U6MA 1QSTA 3BJ7A 2H5MA 4AG9A 3TO9A 2P6EA 2J8NA 3RYOA 1Q2CA 3S6HA 4HKFA 3KKWA 4R3KA 4H6UA 3JUWA 5DWMA 3D3SA 2JDDA 1R57A 1YK3A 5H86A 4XPKA 4ORFA 3R95A 2GE3A 3LODA 3TCVA 2C27A 4OLLA 3T9YA 3ZZIA 2P6GA 5E96A 2Q0YA 3DNSA 2Q44A 5F46A 1OZPA 1NE9A 1KUVA 4KOWA 4AVCA 4B5PA 2HQYA 4YGOA 5J8FA 2Y0MA 3S6KA 4MJ8A 2BUEA 4XPLA 4KVOE 2P0WA 4PSWA 4OADA 2FCKA 1WWZA 1QSNA 3ZJ0A 3IWGA 1M4DA 4KORA 4NCZA 4XPDC 3F8KA 4AB7A 4MY3A 5F49A 1KZFA 5EC4A 4MY0A 2FIAA 3H4QA 2OB0A 3TFYA 1M1DA 5KTDA 3EFAA 3R9FA 2FE7A 1M44A 2OZUA 3F0AA 2B4BA 2OU2A 4FD7A 4R3LA 5IV0A 4GS4A 3DR8A 2ZW6A 5C82A 4UWJA 4MI4A 1XF8A 1QSMA 2FL4A 4NEXA 2JDCA 1S7LA 4YFJA 1NSLA 3D8PA 4AVBA 4XPDB 3F5BA 3W91A 3SXNA 1M4GA 1PU9A 2VQYA 2PQ8A 2IL4A 2AE6A 2I79A 2CY2A 1QSOA 1ON0A 2JEVA 4CAXA 3TE4A 2G3TA 4KLWA 1XMTA 4CRYB 1TIQA 1XIXA 4X5KA 4U9ZA 2B5GB 2OH1A 4QVTA 4JXRA 2I00A 3I3GA 2PRBA 4KOXA 1RO5A 5HH1A 2Q7BA 2VEZA 3MGDA 4KUBA 1SQHA 3TOAA 2B3VA 1L0CA 1IYLA 1IB1E 1MJ9A 3D2PA 2PR8A 3GKRA 1S60A 3JVNA 3CXPA 2Q4VA 2B4DA 3FBUA 4R57A 4RS2A 2BL1A 2QMLA 3CXSA 2KCWA 2R8VA 4KLVA 3FRMA 3BJ8A 3VWDA 3R9GA 1WK4A 4KUAA 3FYNA 3BLNA 4LX9A 2EUIA 1J4JA 2CNSA 4KOSA 1YGHA 3IGRA 1S3ZA 2B3UA 4M3SA 3VWEA 3TO6A 4OAEA 2O28A 2D4OA 4HNXB 2CNMA 1S5KA 1IICA 1MJBA 1KUYA 3D2MA 1MJAA 3DSBA 2F5IA 5DWNA 4U5YA 5F48A 2OZGA 2ARHA 3TOBA 2NMTA 2R7HA 1XE4A 4L8AA 1P0HA 2Q4YA 1Y7RA 5CNPA 3TTHA 1I12A 1BO4A 5KTCA 2D4PA 5KTAA 4E0AA 4B5PB 1V0CA 1B87A 2J8MA 3DR6A 4NF1A 1LRZA 1Z9UA 2FXFA 4QUSA 1GHEA 4CS0B 4J3GA 4QC6A 2Z10A 2GANA 1RXTA 4HNYB 1Q2YA 4ONUA 1YX0A 4ZBGA 3W6SA 1CJWA 1Y9KA 3G3SA 4KOVA 4YRHA 5IX3A 2BEIA 4AVAA 1S7NA 4U9YA 3B8GA 5EBVA 5H84A 1K4JA 5I0CA 4MBUA 3R9EA 4BMHA 2HUZA 4JLYA 3I9SA 2FIWA 5J8CA 4NXYA 3CXQA 4H6ZA 2CNTA 2VBQA 3QAHA 4PV6A 2G3AA 2X7BA 4MHDA 1IYKA 3FNCA 2ZXVA 1PUAA 2QECA 2HV2A 4H89A 4KVME 3R1KA 2K5TA 5FVJA 4JJXA 2VXKA 1MK4A 4FD4A 1N71A 2REEA 1YLEA 5F47A 3NE7A 5C88A 3T90A 1I1DA 5JPHA 1YR0A 4II9A 4KOUA 3PP9A 2RC4A 4JD6A 3PZJA 4M85A 3EC4A 1NMTA 4AG7A 2VZZA 3FIXA 4FD6A 3N7ZA 3OWCA 4PK2A 3PGPA 3TO7A 2PSWA 2PR1A 2DXQA 1CM0A 3E0KA 3P2HA 3FB3A 3W6XA
chains in the Genus database with same CATH superfamily
2PJ5A 4I49A 4W9YA 1TKFA 4QB9A 2ATRA 5JQ4A 4LQ6A 3FEDA 4NFRA 2ZW5A 3G8WA 2EBJA 4LUAA 4UEFA 4EWTA 1JQGA 3KR4A 2VZYA 5AG5A 4MFJA 3TT2A 4UBRA 1Z4RA 3KHZA 4R9MA 2B4DB 2FSRA 1CG2A 2ZW7A 4CGPA 1XBUA 4F6AA 4ZI6A 3K2KA 2FT0A 3T8WA 1IOFA 4C2XA 3QB8A 1VKCA 1AUGA 2IMOA 3IFEA 2ZOFA 4MRIA 4B10A 4KOYA 5JM6A 1S7KA 4R76A 2GIVA 4K3NA 3S6FA 2YNDA 2WUUA 4KVXA 2PJAA 3PB9X 4CYQA 3SJFA 2AJ6A 2Z3KA 4CRZB 3CT9A 3EY5A 2OOTA 2Z0ZA 4NGTA 3V8IA 3WC6A 4F0YA 4E8OA 4MHZA 1Y0RA 3R96A 3WR7A 2AFMA 4E2AA 4TWEA 3C26A 4R6TA 4K30A 1ZG8A 1YREA 4CAWA 4CAVA 2G0BA 2B5GA 1HEEA 2F7VA 4IUSA 3UY5A 3WC7A 1I21A 5AGEA 2ZEHA 5A28A 2IJZA 3H8GA 4DJLA 3CZXA 1LOKA 3CDXA 3FXTA 2ZEEA 3PB8X 3SHPA 3CPXA 3QNVA 4HNWB 4PK3A 4R87A 3SXOA 5HMNA 2POKA 2B58A 2RB7A 3GLJA 3P2FA 3SJGA 4B12A 1UFHA 2QIRA 1FT7A 2Z3NA 3PB6X 5LYFA 2C1CA 2JLMA 1Z4EA 4ONWA 3B2YA 2WPXA 2A4NA 1B6BA 1LANA 2ZPAA 4IF5A 4UA3A 1BLLE 3ISZA 3NFZA 4PSXA 2WPWA 2PDOA 4XNHC 4FD5A 4Y49C 3SI2A 4P4BA 5LRKA 3GB0A 1QMUA 2ANPA 3GYAA 4X3RA 5IB0A 1KWMA 1YW6A 1IIDA 1XEBA 3EO4A 3IWWA 4OC3A 4NGSA 2R1IA 2WSAA 8CPAA 2Q04A 1QSRA 2VI7A 5K8OA 1FY7A 4CGLA 3LD2A 3IC1A 2PIZA 1RTQA 1F2OA 2Z11A 1CPSA 4UEEA 4DNCA 1YVOA 2J8RA 1YVKA 4QBJA 5IB9A 3D7FA 1KUXA 2OZHA 3RAMA 5LRGA 5GCNA 2V8VA 4WWVA 2IQ6A 4RI1A 1CPXA 4MFZA 5HVFA 3S6GA 1DE4C 2Q51A 1TKJA 2R98A 3DDDA 4M6HA 3EXNA 6CPAA 4R7MA 4XNHB 4Y49B 4P45A 2FS5A 5JH9A 2PRQA 4EVYA 1LAMA 4UWIA 4P4IA 4EMEA 3KL9A 2P6FA 2REFA 4OKOA 2AFXA 2ZW4A 3GY9A 3KASA 4KOTA 4B5OA 2RFHA 5G22A 2YNCA 4BINA 3PBEA 1S7FA 1YW4A 2OR4A 1Y9WA 1P4NA 1M4IA 1VHSA 5ISVA 4L89A 2PC1A 4OIDA 4JXQA 4JWPA 2BSWA 4NSQA 1Q2DA 1ELMP 2ZEFA 2EVNA 4KZTA 3VARA 3K9UA 2PJ8A 1BOBA 2ZEPA 1CP7A 1U6MA 2F8HA 2G9DA 1QSTA 2BCOA 2PVWA 1ARMA 3BJ7A 2H5MA 4AG9A 4NGNA 3RNZA 3H5ZA 4HPSA 1M4LA 2BOAA 2P6EA 3TO9A 2J8NA 3RYOA 4C7IA 1Q2CA 3S6HA 4HKFA 2VL1A 3KKWA 2XEFA 1LFWA 2JEWA 3S9MA 4R3KA 4H6UA 3JUWA 5DWMA 3D3SA 2JDDA 4ZX8A 1R57A 1YK3A 5H86A 4BD9A 2I3CA 2QVPA 3CPAA 3GUXA 4XPKA 4ORFA 1Z8TA 3IIBA 2PJ1A 3R95A 4MCPA 4NGPA 2V8HA 2GE3A 2DPTA 3BXMA 3NA6A 3D67A 3LODA 3IJ3A 2C27A 4OLLA 3T9YA 3TCVA 2P6GA 3TX8A 3ZZIA 5LYLA 5E96A 2Q0YA 2ZEDA 5CBMA 1ZLHA 2CTCA 2WZNA 2XEJA 3DNSA 1Z2LA 2Q44A 3PBBA 1OZPA 4UFVA 5F46A 1NE9A 1KUVA 3MRUA 5CPAA 4KOWA 2J9AA 2NSMA 4M6GA 4AVCA 4B5PA 4CAEA 4WJBA 2HQYA 3PFEA 4UCPA 4YGOA 4A37A 2Y0MA 3FVLA 3S6KA 4MJ8A 5J8FA 2BUEA 4XPLA 2ABZA 4KVOE 2P0WA 4PSWA 4R8FA 3SI1A 4MMOA 1VHEA 2PIYA 4OADA 2FCKA 1WWZA 1QSNA 3ZJ0A 3IWGA 1BPMA 4OC5A 1M4DA 2PJ6A 1ARLA 4KORA 4NCZA 4MHNA 4XPDC 2HC9A 3LACA 3F8KA 5AG4A 4AB7A 3JTKA 4MY3A 5F49A 1KZFA 2DF5A 4KSAA 1NSAA 5EC4A 4PXBA 4MY0A 2FIAA 1GYTA 2OB0A 3H4QA 1M1DA 3QAYA 4B11A 2AFZA 5KTDA 3EFAA 3R9FA 1AMPA 3TFYA 2FE7A 1M44A 4CGNA 2OZUA 1Z8XA 5G20A 1TKHA 3F0AA 2B4BA 2OU2A 3D7HA 4FD7A 3PEIA 4R3LA 4MCSA 4GS4A 5IV0A 5K8PA 4NJQA 2ZEMA 3DR8A 4IHMA 2ZENA 5G1ZA 2ZW6A 5LRJA 4GM5A 3GIUA 1TF9A 5C82A 4UWJA 4MI4A 4F9VA 1XF8A 1VIXA 3D66A 1Z8LA 4A94A 1QSMA 2FL4A 4NEXA 2AFWA 3I1UA 4LQGA 2JDCA 1S7LA 4YFJA 1NSLA 3SI0A 3D8PA 4FWUA 4AVBA 4OC4A 4XPDB 3RZAA 3F5BA 3W91A 4ZY0A 3SXNA 1M4GA 2QJ8A 1PU9A 2VQYA 2PQ8A 3FH4A 3PB4X 2Q4ZA 2IL4A 3ISXA 4AXVA 2AE6A 3D68A 3DLJA 4BBHA 3NH5A 1IY7A 2I79A 5HVGA 2CY2A 1QSOA 1ON0A 4NGQA 4PPZA 4MFPA 3BHXA 3FX6A 3LWUA 2JEVA 4OMEA 4CAXA 3TE4A 2ODFA 2G3TA 2AFSA 4KLWA 4A95A 1XMTA 3B3TA 4CGMA 4CRYB 4NGRA 1TIQA 2YGWA 1XIXA 2HB6A 4X5KA 4DUKA 4OIWA 5A27A 1HDUA 4X2TA 2EO8A 4PXCA 2PJ9A 4U9ZA 3RO0A 2B5GB 2OH1A 3BI1A 4QVTA 3WC5A 4JXRA 2I00A 3I3GA 1CP6A 4A2ZA 2PRBA 4KOXA 2XEGA 1RO5A 5HH1A 5D8NA 2Q7BA 3HUVA 4YWYA 2C6CA 2ZOGA 4B6ZA 2PJCA 1Y7EA 2VEZA 1FNOA 3MGDA 4CYNA 4KUBA 3DGVA 1X10A 1SQHA 3TC8A 2CIJA 2O53A 3TOAA 2PVVA 4MFLA 4ZX9A 4CPAA 1YLOA 2B3VA 1H8LA 3N5FA 1L0CA 1IYLA 3SJEA 4M6IA 1IB1E 3PRTA 4B13A 1MJ9A 2EK9A 3D2PA 5K8NA 2YNCC 4FAIA 2PR8A 1ZLIA 3GKRA 1S60A 2PJ7A 1A2ZA 3JVNA 1F2PA 1PYTB 1JWQA 1ZG7A 4GXHA 4EFDA 2C6PA 5AG6A 4F8ZA 4P6YA 3CXPA 3WABA 2C6GA 2Q4VA 3SJXA 7CPAA 2B4DA 2GLFA 4MHYA 3FBUA 4OP4A 4R57A 4RS2A 2BL1A 4IK2A 3W6XA 1LAPA 5DS0A 4JZ0A 2QMLA 3CXSA 2KCWA 2R8VA 2Z3MA 5D29A 4ZGYB 2V77A 5G21A 4KLVA 3FRMA 1IOIA 4Q38A 4C7HA 3NH4A 3BJ8A 3IO1A 3R9GA 3VWDA 4RUHA 1WK4A 2CXAA 4UEZA 2DPSA 4KUAA 3BI0A 3FYNA 4CYOA 2WYRA 3BLNA 4LX9A 2EUIA 2Z3LA 1J4JA 2V8DA 1F57A 1Y0YA 2PJ4A 4UF4A 3RBUA 2CNSA 4KOSA 1YGHA 4P4JA 3B7IA 1VHOA 2PJ2A 3IGRA 2Q43A 3V7ZA 1S3ZA 3IEHA 3NH8A 4RN7A 2V8GA 2B3UA 4CGOA 4A32A 4A33A 1BAVA 4M3SA 5ELYA 4FBEA 3VWEA 1Q7LA 2JBKA 3NE8A 3JRUA 3TO6A 4CYPA 4OAEA 4P4FA 2O28A 2D4OA 1OBRA 3H8EA 2CNMA 2DEAA 1S5KA 4HNXB 4MCRA 1IICA 4Q7AA 2ZEGA 1MJBA 4PXDA 1KUYA 3KHXA 1YQEA 3PB7X 3D2MA 4Q36A 1MJAA 4ZY1A 3IU2A 4NJRA 3DSBA 4KSIA 1XJOA 2F5IA 5DWNA 1X12A 3D4UA 2GU2A 3KGQA 3FF3A 4OC2A 2OZGA 3FJUA 4U5YA 5F48A 3IWEA 2ARHA 3TOBA 2NMTA 4PXEA 2R7HA 2Q7SA 3H8FA 1PCAA 4YU9A 1XE4A 5LYIA 2AFUA 4O23A 1P0HA 4L8AA 5EMIA 2Q4YA 1Y7RA 5CNPA 3TTHA 1I12A 3VH9A 1YMEA 1BO4A 3KQZA 4OC0A 1UWYA 4UFXA 5KTCA 2D4PA 5F09A 5J1QA 5KTAA 1XMBA 4MFKA 4E0AA 4B5PB 4P4EA 1V0CA 1ZO0A 1DTDA 4C68A 3WT4A 3FEEA 5HVHA 1B87A 2J8MA 3DR6A 4NF1A 1LRZA 1Z9UA 2FXFA 3KQXA 2AFOA 3VATA 4QUSA 4G1PA 4ZYQA 1CX8A 5LYDA 4P4DA 1GHEA 3S9NA 4CS0B 2ZELA 4J3GA 4QC6A 2Z10A 4UCNA 4UIBA 2GANA 2GLJA 1RXTA 4HNYB 1Q2YA 4ONUA 1YX0A 2PJ0A 2Z3OA 4ZBGA 4P44A 3W6SA 4B14A 1CJWA 1Y9KA 3G3SA 4KOVA 4A38A 4C2YA 4YRHA 4A31A 2BEIA 5THWA 4AVAA 5IX3A 4X8IA 3B3WA 1S7NA 2PJ3A 4U9YA 1IU8A 1R43A 3B8GA 4MFQA 5EBVA 5H84A 1AYEA 1K4JA 5I0CA 4MBUA 1EE3P 4A39A 4H2KA 1XRYA 3L2NA 3R9EA 4BMHA 2HUZA 4JLYA 2NYQA 4DYOA 3I9SA 3B35A 1CBXA 4MHPA 2FIWA 5J8CA 2JBJA 4NXYA 1QQ9A 3CXQA 1XFOA 3V38A 4H6ZA 2CF4A 2CNTA 2VBQA 3QAHA 2Z3PA 4PV6A 4A30A 2G3AA 3FECA 5JGFA 2X7BA 4F0XA 4KS9A 4UFWA 4MHDA 1IYKA 3FNCA 1YSJA 2ZXVA 4MXUA 4IAVA 5BWAB 1PUAA 4Z65A 2QECA 3S9LA 2QYVA 2HV2A 1ZG9A 2O4HA 1ELLP 2XEIA 2ZEOA 4H89A 4KVME 3B3SA 3R1KA 1IGBA 2PCUA 2PE3A 2PJBA 2YNEA 2K5TA 3K9TA 3MN8A 4UCMA 4KSFA 5FVJA 4JJXA 3B3CA 4TNUA 4NGMA 2VXKA 5AG7A 1MK4A 1Z8WA 4FD4A 1HDQA 3D7DA 3FMCA 2EWBA 5K8MA 3IU1A 1TXRA 1N71A 2REEA 1YLEA 1XOVA 5F47A 4ZY2A 1TF8A 3NE7A 1LCPA 5C88A 2EK8A 3T90A 1I1DA 5JPHA 1YR0A 3D7GA 3PFOA 3HLPA 4II9A 4KOUA 3PP9A 2RC4A 4JD6A 4C2ZA 3PZJA 4OC1A 3KR5A 2GREA 4M85A 5HXDA 3EC4A 1NMTA 3KI9A 2CTBA 2BO9A 4AG7A 4JYWA 2VZZA 3FIXA 1Z5RA 4P10A 4FD6A 4F9UA 3N7ZA 3OWCA 4PK2A 3B3VA 5I4MA 3KZWA 4FUUA 1VGYA 1R3NA 3A9LA 4UIAA 3PGPA 2FVGA 4MCQA 2PSWA 3TO7A 2GFQA 2PR1A 2DXQA 1CM0A 3E0KA 3LMSA 1BPNA 3P2HA 3FB3A 4CAFA 4PQAA
chains in the Genus database with same CATH topology
4I49A 4QB9A 2ATRA 5JQ4A 2ZW5A 3G8WA 4LUAA 2VZYA 5AG5A 4MFJA 3TT2A 4UBRA 1Z4RA 4R9MA 2B4DB 2FSRA 4CGPA 2ZW7A 4F6AA 2FT0A 4C2XA 3QB8A 1VKCA 4B10A 4KOYA 1S7KA 2GIVA 3S6FA 2YNDA 2WUUA 4KVXA 4CYQA 2AJ6A 2Z3KA 4CRZB 3EY5A 4F0YA 3V8IA 2Z0ZA 4E8OA 3R96A 3WR7A 4E2AA 3C26A 4K30A 1YREA 4CAWA 4CAVA 2G0BA 2B5GA 4IUSA 3UY5A 1I21A 5AGEA 5A28A 3FXTA 3SHPA 4HNWB 4PK3A 4R87A 3SXOA 5HMNA 2B58A 3P2FA 4B12A 1UFHA 2QIRA 2Z3NA 2JLMA 1Z4EA 2WPXA 2A4NA 1B6BA 2ZPAA 4UA3A 4IF5A 4PSXA 2WPWA 2PDOA 4XNHC 4FD5A 4Y49C 3GYAA 5IB0A 1IIDA 1XEBA 3EO4A 2R1IA 2WSAA 2Q04A 1QSRA 2VI7A 1FY7A 4CGLA 3LD2A 2Z11A 4DNCA 1YVOA 2J8RA 1YVKA 4QBJA 1KUXA 2OZHA 5GCNA 4RI1A 4MFZA 3S6GA 2R98A 3DDDA 3EXNA 4XNHB 4Y49B 2FS5A 4EVYA 4UWIA 2P6FA 2REFA 2ZW4A 3GY9A 4KOTA 4B5OA 5G22A 2YNCA 1S7FA 1Y9WA 1P4NA 1M4IA 1VHSA 5ISVA 4L89A 2PC1A 4JXQA 4JWPA 2BSWA 4NSQA 1Q2DA 2EVNA 4KZTA 3K9UA 1BOBA 1U6MA 1QSTA 3BJ7A 2H5MA 4AG9A 3TO9A 4CYOA 3H5ZA 2P6EA 4C7IA 2J8NA 3RYOA 1Q2CA 3S6HA 4HKFA 3KKWA 4R3KA 4H6UA 3JUWA 5DWMA 3D3SA 2JDDA 1R57A 1YK3A 5H86A 4XPKA 4ORFA 3R95A 2GE3A 2DPTA 3LODA 3TCVA 2C27A 4OLLA 3T9YA 3ZZIA 2P6GA 5E96A 2Q0YA 3DNSA 2Q44A 5F46A 1OZPA 4UFVA 1NE9A 1KUVA 4KOWA 4AVCA 4B5PA 4CAEA 2HQYA 4UCPA 4YGOA 5J8FA 2Y0MA 3S6KA 4MJ8A 2BUEA 4XPLA 4KVOE 2P0WA 4PSWA 4OADA 2FCKA 1WWZA 1QSNA 3ZJ0A 3IWGA 1M4DA 4KORA 4NCZA 4XPDC 5AG4A 3F8KA 4AB7A 3JTKA 4MY3A 5F49A 1KZFA 4KSAA 5EC4A 4MY0A 2FIAA 3H4QA 2OB0A 3TFYA 1M1DA 4B11A 5KTDA 3EFAA 3R9FA 2FE7A 1M44A 4CGNA 2OZUA 5G20A 3F0AA 2B4BA 2OU2A 4FD7A 4R3LA 5IV0A 4GS4A 3DR8A 5G1ZA 2ZW6A 5C82A 4UWJA 4MI4A 1XF8A 1QSMA 2FL4A 4NEXA 2JDCA 1S7LA 4YFJA 1NSLA 3D8PA 4AVBA 4XPDB 3F5BA 3W91A 3SXNA 1M4GA 1PU9A 2VQYA 2PQ8A 2IL4A 2AE6A 4BBHA 2I79A 2CY2A 1QSOA 1ON0A 4MFPA 2JEVA 4CAXA 3TE4A 2G3TA 4KLWA 4A95A 1XMTA 4CGMA 4CRYB 1TIQA 2YGWA 1XIXA 4X5KA 5A27A 4U9ZA 2B5GB 2OH1A 4QVTA 4JXRA 2I00A 3I3GA 4A2ZA 2PRBA 4KOXA 1RO5A 5HH1A 2Q7BA 2VEZA 3MGDA 4CYNA 4KUBA 1SQHA 3TOAA 4MFLA 2B3VA 1L0CA 1IYLA 1IB1E 4B13A 1MJ9A 3D2PA 2YNCC 2PR8A 3GKRA 1S60A 3JVNA 5AG6A 3CXPA 2Q4VA 2B4DA 3FBUA 4R57A 4RS2A 2BL1A 2QMLA 3CXSA 2KCWA 2R8VA 2Z3MA 4ZGYB 5G21A 4KLVA 3FRMA 4Q38A 4C7HA 3BJ8A 3VWDA 3R9GA 1WK4A 2CXAA 2DPSA 4KUAA 3FYNA 3BLNA 4LX9A 2EUIA 2Z3LA 1J4JA 2CNSA 4KOSA 1YGHA 3IGRA 1S3ZA 2B3UA 4CGOA 4A32A 4A33A 4M3SA 3VWEA 3TO6A 4CYPA 4OAEA 2O28A 2D4OA 4HNXB 2CNMA 1S5KA 1IICA 1MJBA 1KUYA 4Q36A 3D2MA 1MJAA 3IU2A 3DSBA 2F5IA 5DWNA 4U5YA 5F48A 2OZGA 3IWEA 2ARHA 3TOBA 2NMTA 2R7HA 1XE4A 1P0HA 4L8AA 2Q4YA 1Y7RA 5CNPA 3TTHA 1I12A 1BO4A 4UFXA 5KTCA 2D4PA 5KTAA 4MFKA 4E0AA 4B5PB 1V0CA 1ZO0A 4C68A 1B87A 2J8MA 3DR6A 4NF1A 1LRZA 1Z9UA 2FXFA 4QUSA 1GHEA 4CS0B 4J3GA 4QC6A 2Z10A 4UCNA 2GANA 1RXTA 4HNYB 1Q2YA 4ONUA 1YX0A 2Z3OA 4ZBGA 3W6SA 4B14A 1CJWA 1Y9KA 3G3SA 4KOVA 4C2YA 4YRHA 4A31A 2BEIA 4AVAA 5IX3A 1S7NA 4U9YA 3B8GA 4MFQA 5EBVA 5H84A 1K4JA 5I0CA 4MBUA 3R9EA 4BMHA 2HUZA 4JLYA 3I9SA 2FIWA 5J8CA 4NXYA 3CXQA 4H6ZA 2CNTA 2VBQA 3QAHA 2Z3PA 4PV6A 4A30A 2G3AA 2X7BA 4F0XA 4KS9A 4UFWA 4MHDA 1IYKA 3FNCA 2ZXVA 5BWAB 1PUAA 2QECA 2HV2A 4H89A 4KVME 3R1KA 2YNEA 2K5TA 5FVJA 4UCMA 4KSFA 4JJXA 2VXKA 5AG7A 1MK4A 4FD4A 3IU1A 1N71A 2REEA 1YLEA 5F47A 3NE7A 5C88A 3T90A 1I1DA 5JPHA 1YR0A 4II9A 4KOUA 3PP9A 2RC4A 4JD6A 4C2ZA 3PZJA 4M85A 3EC4A 1NMTA 4AG7A 2VZZA 3FIXA 4FD6A 3N7ZA 3OWCA 4PK2A 3A9LA 3PGPA 3TO7A 2PSWA 2PR1A 2DXQA 1CM0A 3E0KA 3P2HA 3FB3A 4CAFA 3W6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I49 A;  4QB9 A;  2ATR A;  5JQ4 A;  2ZW5 A;  3G8W A;  4LUA A;  2VZY A;  3TT2 A;  4UBR A;  1Z4R A;  4R9M A;  2B4D B;  2FSR A;  2ZW7 A;  4F6A A;  2FT0 A;  3QB8 A;  1VKC A;  4KOY A;  1S7K A;  2GIV A;  3S6F A;  4KVX A;  2AJ6 A;  4CRZ B;  3EY5 A;  4F0Y A;  3V8I A;  2Z0Z A;  4E8O A;  3R96 A;  3WR7 A;  4E2A A;  3C26 A;  4K30 A;  1YRE A;  4CAW A;  4CAV A;  2G0B A;  2B5G A;  4IUS A;  3UY5 A;  1I21 A;  3FXT A;  3SHP A;  4HNW B;  4PK3 A;  4R87 A;  3SXO A;  5HMN A;  2B58 A;  3P2F A;  1UFH A;  2QIR A;  2JLM A;  1Z4E A;  2WPX A;  2A4N A;  1B6B A;  2ZPA A;  4UA3 A;  4IF5 A;  4PSX A;  2WPW A;  2PDO A;  4XNH C;  4FD5 A;  4Y49 C;  3GYA A;  5IB0 A;  1IID A;  1XEB A;  3EO4 A;  2R1I A;  2Q04 A;  1QSR A;  2VI7 A;  1FY7 A;  3LD2 A;  2Z11 A;  4DNC A;  1YVO A;  2J8R A;  1YVK A;  4QBJ A;  1KUX A;  2OZH A;  5GCN A;  4RI1 A;  3S6G A;  2R98 A;  3DDD A;  3EXN A;  4XNH B;  4Y49 B;  2FS5 A;  4EVY A;  4UWI A;  2P6F A;  2REF A;  2ZW4 A;  3GY9 A;  4KOT A;  4B5O A;  1S7F A;  1Y9W A;  1P4N A;  1M4I A;  1VHS A;  5ISV A;  4L89 A;  2PC1 A;  4JXQ A;  4JWP A;  2BSW A;  4NSQ A;  1Q2D A;  2EVN A;  4KZT A;  3K9U A;  1BOB A;  1U6M A;  1QST A;  3BJ7 A;  2H5M A;  4AG9 A;  3TO9 A;  2P6E A;  2J8N A;  3RYO A;  1Q2C A;  3S6H A;  4HKF A;  3KKW A;  4R3K A;  4H6U A;  3JUW A;  5DWM A;  3D3S A;  2JDD A;  1R57 A;  1YK3 A;  5H86 A;  4XPK A;  4ORF A;  3R95 A;  2GE3 A;  3LOD A;  3TCV A;  2C27 A;  4OLL A;  3T9Y A;  3ZZI A;  2P6G A;  5E96 A;  2Q0Y A;  3DNS A;  2Q44 A;  5F46 A;  1OZP A;  1NE9 A;  1KUV A;  4KOW A;  4AVC A;  4B5P A;  2HQY A;  4YGO A;  5J8F A;  2Y0M A;  3S6K A;  4MJ8 A;  2BUE A;  4XPL A;  4KVO E;  2P0W A;  4PSW A;  4OAD A;  2FCK A;  1WWZ A;  1QSN A;  3ZJ0 A;  3IWG A;  1M4D A;  4KOR A;  4NCZ A;  4XPD C;  3F8K A;  4AB7 A;  4MY3 A;  5F49 A;  1KZF A;  5EC4 A;  4MY0 A;  2FIA A;  3H4Q A;  2OB0 A;  3TFY A;  1M1D A;  5KTD A;  3EFA A;  3R9F A;  2FE7 A;  1M44 A;  2OZU A;  3F0A A;  2B4B A;  2OU2 A;  4FD7 A;  4R3L A;  5IV0 A;  4GS4 A;  3DR8 A;  2ZW6 A;  5C82 A;  4UWJ A;  4MI4 A;  1XF8 A;  1QSM A;  2FL4 A;  4NEX A;  2JDC A;  1S7L A;  4YFJ A;  1NSL A;  3D8P A;  4AVB A;  4XPD B;  3F5B A;  3W91 A;  3SXN A;  1M4G A;  1PU9 A;  2VQY A;  2PQ8 A;  2IL4 A;  2AE6 A;  2I79 A;  2CY2 A;  1QSO A;  1ON0 A;  2JEV A;  4CAX A;  3TE4 A;  2G3T A;  4KLW A;  1XMT A;  4CRY B;  1TIQ A;  1XIX A;  4X5K A;  4U9Z A;  2B5G B;  2OH1 A;  4QVT A;  4JXR A;  2I00 A;  3I3G A;  2PRB A;  4KOX A;  1RO5 A;  5HH1 A;  2Q7B A;  2VEZ A;  3MGD A;  4KUB A;  1SQH A;  3TOA A;  2B3V A;  1L0C A;  1IYL A;  1IB1 E;  1MJ9 A;  3D2P A;  2PR8 A;  3GKR A;  1S60 A;  3JVN A;  3CXP A;  2Q4V A;  2B4D A;  3FBU A;  4R57 A;  4RS2 A;  2BL1 A;  2QML A;  3CXS A;  2KCW A;  2R8V A;  4KLV A;  3FRM A;  3BJ8 A;  3VWD A;  3R9G A;  1WK4 A;  4KUA A;  3FYN A;  3BLN A;  4LX9 A;  2EUI A;  1J4J A;  2CNS A;  4KOS A;  1YGH A;  3IGR A;  1S3Z A;  2B3U A;  4M3S A;  3VWE A;  3TO6 A;  4OAE A;  2O28 A;  2D4O A;  4HNX B;  2CNM A;  1S5K A;  1IIC A;  1MJB A;  1KUY A;  3D2M A;  1MJA A;  3DSB A;  2F5I A;  5DWN A;  4U5Y A;  5F48 A;  2OZG A;  2ARH A;  3TOB A;  2NMT A;  2R7H A;  1XE4 A;  4L8A A;  1P0H A;  2Q4Y A;  1Y7R A;  5CNP A;  3TTH A;  1I12 A;  1BO4 A;  5KTC A;  2D4P A;  5KTA A;  4E0A A;  4B5P B;  1V0C A;  1B87 A;  2J8M A;  3DR6 A;  4NF1 A;  1LRZ A;  1Z9U A;  2FXF A;  4QUS A;  1GHE A;  4CS0 B;  4J3G A;  4QC6 A;  2Z10 A;  2GAN A;  1RXT A;  4HNY B;  1Q2Y A;  4ONU A;  1YX0 A;  4ZBG A;  3W6S A;  1CJW A;  1Y9K A;  3G3S A;  4KOV A;  4YRH A;  5IX3 A;  2BEI A;  4AVA A;  1S7N A;  4U9Y A;  3B8G A;  5EBV A;  5H84 A;  1K4J A;  5I0C A;  4MBU A;  3R9E A;  4BMH A;  2HUZ A;  4JLY A;  3I9S A;  2FIW A;  5J8C A;  4NXY A;  3CXQ A;  4H6Z A;  2CNT A;  2VBQ A;  3QAH A;  4PV6 A;  2G3A A;  2X7B A;  4MHD A;  1IYK A;  3FNC A;  2ZXV A;  1PUA A;  2QEC A;  2HV2 A;  4H89 A;  4KVM E;  3R1K A;  2K5T A;  5FVJ A;  4JJX A;  2VXK A;  1MK4 A;  4FD4 A;  1N71 A;  2REE A;  1YLE A;  5F47 A;  3NE7 A;  5C88 A;  3T90 A;  1I1D A;  5JPH A;  1YR0 A;  4II9 A;  4KOU A;  3PP9 A;  2RC4 A;  4JD6 A;  3PZJ A;  4M85 A;  3EC4 A;  1NMT A;  4AG7 A;  2VZZ A;  3FIX A;  4FD6 A;  3N7Z A;  3OWC A;  4PK2 A;  3PGP A;  3TO7 A;  2PSW A;  2PR1 A;  2DXQ A;  1CM0 A;  3E0K A;  3P2H A;  3FB3 A;  3W6X A; 
#chains in the Genus database with same CATH topology
 2PJ5 A;  4I49 A;  4W9Y A;  1TKF A;  4QB9 A;  2ATR A;  5JQ4 A;  4LQ6 A;  3FED A;  4NFR A;  2ZW5 A;  3G8W A;  2EBJ A;  4LUA A;  4UEF A;  4EWT A;  1JQG A;  3KR4 A;  2VZY A;  5AG5 A;  4MFJ A;  3TT2 A;  4UBR A;  1Z4R A;  3KHZ A;  4R9M A;  2B4D B;  2FSR A;  1CG2 A;  2ZW7 A;  4CGP A;  1XBU A;  4F6A A;  4ZI6 A;  3K2K A;  2FT0 A;  3T8W A;  1IOF A;  4C2X A;  3QB8 A;  1VKC A;  1AUG A;  2IMO A;  3IFE A;  2ZOF A;  4MRI A;  4B10 A;  4KOY A;  5JM6 A;  1S7K A;  4R76 A;  2GIV A;  4K3N A;  3S6F A;  2YND A;  2WUU A;  4KVX A;  2PJA A;  3PB9 X;  4CYQ A;  3SJF A;  2AJ6 A;  2Z3K A;  4CRZ B;  3CT9 A;  3EY5 A;  2OOT A;  2Z0Z A;  4NGT A;  3V8I A;  3WC6 A;  4F0Y A;  4E8O A;  4MHZ A;  1Y0R A;  3R96 A;  3WR7 A;  2AFM A;  4E2A A;  4TWE A;  3C26 A;  4R6T A;  4K30 A;  1ZG8 A;  1YRE A;  4CAW A;  4CAV A;  2G0B A;  2B5G A;  1HEE A;  2F7V A;  4IUS A;  3UY5 A;  3WC7 A;  1I21 A;  5AGE A;  2ZEH A;  5A28 A;  2IJZ A;  3H8G A;  4DJL A;  3CZX A;  1LOK A;  3CDX A;  3FXT A;  2ZEE A;  3PB8 X;  3SHP A;  3CPX A;  3QNV A;  4HNW B;  4PK3 A;  4R87 A;  3SXO A;  5HMN A;  2POK A;  2B58 A;  2RB7 A;  3GLJ A;  3P2F A;  3SJG A;  4B12 A;  1UFH A;  2QIR A;  1FT7 A;  2Z3N A;  3PB6 X;  5LYF A;  2C1C A;  2JLM A;  1Z4E A;  4ONW A;  3B2Y A;  2WPX A;  2A4N A;  1B6B A;  1LAN A;  2ZPA A;  4IF5 A;  4UA3 A;  1BLL E;  3ISZ A;  3NFZ A;  4PSX A;  2WPW A;  2PDO A;  4XNH C;  4FD5 A;  4Y49 C;  3SI2 A;  4P4B A;  5LRK A;  3GB0 A;  1QMU A;  2ANP A;  3GYA A;  4X3R A;  5IB0 A;  1KWM A;  1YW6 A;  1IID A;  1XEB A;  3EO4 A;  3IWW A;  4OC3 A;  4NGS A;  2R1I A;  2WSA A;  8CPA A;  2Q04 A;  1QSR A;  2VI7 A;  5K8O A;  1FY7 A;  4CGL A;  3LD2 A;  3IC1 A;  2PIZ A;  1RTQ A;  1F2O A;  2Z11 A;  1CPS A;  4UEE A;  4DNC A;  1YVO A;  2J8R A;  1YVK A;  4QBJ A;  5IB9 A;  3D7F A;  1KUX A;  2OZH A;  3RAM A;  5LRG A;  5GCN A;  2V8V A;  4WWV A;  2IQ6 A;  4RI1 A;  1CPX A;  4MFZ A;  5HVF A;  3S6G A;  1DE4 C;  2Q51 A;  1TKJ A;  2R98 A;  3DDD A;  4M6H A;  3EXN A;  6CPA A;  4R7M A;  4XNH B;  4Y49 B;  4P45 A;  2FS5 A;  5JH9 A;  2PRQ A;  4EVY A;  1LAM A;  4UWI A;  4P4I A;  4EME A;  3KL9 A;  2P6F A;  2REF A;  4OKO A;  2AFX A;  2ZW4 A;  3GY9 A;  3KAS A;  4KOT A;  4B5O A;  2RFH A;  5G22 A;  2YNC A;  4BIN A;  3PBE A;  1S7F A;  1YW4 A;  2OR4 A;  1Y9W A;  1P4N A;  1M4I A;  1VHS A;  5ISV A;  4L89 A;  2PC1 A;  4OID A;  4JXQ A;  4JWP A;  2BSW A;  4NSQ A;  1Q2D A;  1ELM P;  2ZEF A;  2EVN A;  4KZT A;  3VAR A;  3K9U A;  2PJ8 A;  1BOB A;  2ZEP A;  1CP7 A;  1U6M A;  2F8H A;  2G9D A;  1QST A;  2BCO A;  2PVW A;  1ARM A;  3BJ7 A;  2H5M A;  4AG9 A;  4NGN A;  3RNZ A;  3H5Z A;  4HPS A;  1M4L A;  2BOA A;  2P6E A;  3TO9 A;  2J8N A;  3RYO A;  4C7I A;  1Q2C A;  3S6H A;  4HKF A;  2VL1 A;  3KKW A;  2XEF A;  1LFW A;  2JEW A;  3S9M A;  4R3K A;  4H6U A;  3JUW A;  5DWM A;  3D3S A;  2JDD A;  4ZX8 A;  1R57 A;  1YK3 A;  5H86 A;  4BD9 A;  2I3C A;  2QVP A;  3CPA A;  3GUX A;  4XPK A;  4ORF A;  1Z8T A;  3IIB A;  2PJ1 A;  3R95 A;  4MCP A;  4NGP A;  2V8H A;  2GE3 A;  2DPT A;  3BXM A;  3NA6 A;  3D67 A;  3LOD A;  3IJ3 A;  2C27 A;  4OLL A;  3T9Y A;  3TCV A;  2P6G A;  3TX8 A;  3ZZI A;  5LYL A;  5E96 A;  2Q0Y A;  2ZED A;  5CBM A;  1ZLH A;  2CTC A;  2WZN A;  2XEJ A;  3DNS A;  1Z2L A;  2Q44 A;  3PBB A;  1OZP A;  4UFV A;  5F46 A;  1NE9 A;  1KUV A;  3MRU A;  5CPA A;  4KOW A;  2J9A A;  2NSM A;  4M6G A;  4AVC A;  4B5P A;  4CAE A;  4WJB A;  2HQY A;  3PFE A;  4UCP A;  4YGO A;  4A37 A;  2Y0M A;  3FVL A;  3S6K A;  4MJ8 A;  5J8F A;  2BUE A;  4XPL A;  2ABZ A;  4KVO E;  2P0W A;  4PSW A;  4R8F A;  3SI1 A;  4MMO A;  1VHE A;  2PIY A;  4OAD A;  2FCK A;  1WWZ A;  1QSN A;  3ZJ0 A;  3IWG A;  1BPM A;  4OC5 A;  1M4D A;  2PJ6 A;  1ARL A;  4KOR A;  4NCZ A;  4MHN A;  4XPD C;  2HC9 A;  3LAC A;  3F8K A;  5AG4 A;  4AB7 A;  3JTK A;  4MY3 A;  5F49 A;  1KZF A;  2DF5 A;  4KSA A;  1NSA A;  5EC4 A;  4PXB A;  4MY0 A;  2FIA A;  1GYT A;  2OB0 A;  3H4Q A;  1M1D A;  3QAY A;  4B11 A;  2AFZ A;  5KTD A;  3EFA A;  3R9F A;  1AMP A;  3TFY A;  2FE7 A;  1M44 A;  4CGN A;  2OZU A;  1Z8X A;  5G20 A;  1TKH A;  3F0A A;  2B4B A;  2OU2 A;  3D7H A;  4FD7 A;  3PEI A;  4R3L A;  4MCS A;  4GS4 A;  5IV0 A;  5K8P A;  4NJQ A;  2ZEM A;  3DR8 A;  4IHM A;  2ZEN A;  5G1Z A;  2ZW6 A;  5LRJ A;  4GM5 A;  3GIU A;  1TF9 A;  5C82 A;  4UWJ A;  4MI4 A;  4F9V A;  1XF8 A;  1VIX A;  3D66 A;  1Z8L A;  4A94 A;  1QSM A;  2FL4 A;  4NEX A;  2AFW A;  3I1U A;  4LQG A;  2JDC A;  1S7L A;  4YFJ A;  1NSL A;  3SI0 A;  3D8P A;  4FWU A;  4AVB A;  4OC4 A;  4XPD B;  3RZA A;  3F5B A;  3W91 A;  4ZY0 A;  3SXN A;  1M4G A;  2QJ8 A;  1PU9 A;  2VQY A;  2PQ8 A;  3FH4 A;  3PB4 X;  2Q4Z A;  2IL4 A;  3ISX A;  4AXV A;  2AE6 A;  3D68 A;  3DLJ A;  4BBH A;  3NH5 A;  1IY7 A;  2I79 A;  5HVG A;  2CY2 A;  1QSO A;  1ON0 A;  4NGQ A;  4PPZ A;  4MFP A;  3BHX A;  3FX6 A;  3LWU A;  2JEV A;  4OME A;  4CAX A;  3TE4 A;  2ODF A;  2G3T A;  2AFS A;  4KLW A;  4A95 A;  1XMT A;  3B3T A;  4CGM A;  4CRY B;  4NGR A;  1TIQ A;  2YGW A;  1XIX A;  2HB6 A;  4X5K A;  4DUK A;  4OIW A;  5A27 A;  1HDU A;  4X2T A;  2EO8 A;  4PXC A;  2PJ9 A;  4U9Z A;  3RO0 A;  2B5G B;  2OH1 A;  3BI1 A;  4QVT A;  3WC5 A;  4JXR A;  2I00 A;  3I3G A;  1CP6 A;  4A2Z A;  2PRB A;  4KOX A;  2XEG A;  1RO5 A;  5HH1 A;  5D8N A;  2Q7B A;  3HUV A;  4YWY A;  2C6C A;  2ZOG A;  4B6Z A;  2PJC A;  1Y7E A;  2VEZ A;  1FNO A;  3MGD A;  4CYN A;  4KUB A;  3DGV A;  1X10 A;  1SQH A;  3TC8 A;  2CIJ A;  2O53 A;  3TOA A;  2PVV A;  4MFL A;  4ZX9 A;  4CPA A;  1YLO A;  2B3V A;  1H8L A;  3N5F A;  1L0C A;  1IYL A;  3SJE A;  4M6I A;  1IB1 E;  3PRT A;  4B13 A;  1MJ9 A;  2EK9 A;  3D2P A;  5K8N A;  2YNC C;  4FAI A;  2PR8 A;  1ZLI A;  3GKR A;  1S60 A;  2PJ7 A;  1A2Z A;  3JVN A;  1F2P A;  1PYT B;  1JWQ A;  1ZG7 A;  4GXH A;  4EFD A;  2C6P A;  5AG6 A;  4F8Z A;  4P6Y A;  3CXP A;  3WAB A;  2C6G A;  2Q4V A;  3SJX A;  7CPA A;  2B4D A;  2GLF A;  4MHY A;  3FBU A;  4OP4 A;  4R57 A;  4RS2 A;  2BL1 A;  4IK2 A;  3W6X A;  1LAP A;  5DS0 A;  4JZ0 A;  2QML A;  3CXS A;  2KCW A;  2R8V A;  2Z3M A;  5D29 A;  4ZGY B;  2V77 A;  5G21 A;  4KLV A;  3FRM A;  1IOI A;  4Q38 A;  4C7H A;  3NH4 A;  3BJ8 A;  3IO1 A;  3R9G A;  3VWD A;  4RUH A;  1WK4 A;  2CXA A;  4UEZ A;  2DPS A;  4KUA A;  3BI0 A;  3FYN A;  4CYO A;  2WYR A;  3BLN A;  4LX9 A;  2EUI A;  2Z3L A;  1J4J A;  2V8D A;  1F57 A;  1Y0Y A;  2PJ4 A;  4UF4 A;  3RBU A;  2CNS A;  4KOS A;  1YGH A;  4P4J A;  3B7I A;  1VHO A;  2PJ2 A;  3IGR A;  2Q43 A;  3V7Z A;  1S3Z A;  3IEH A;  3NH8 A;  4RN7 A;  2V8G A;  2B3U A;  4CGO A;  4A32 A;  4A33 A;  1BAV A;  4M3S A;  5ELY A;  4FBE A;  3VWE A;  1Q7L A;  2JBK A;  3NE8 A;  3JRU A;  3TO6 A;  4CYP A;  4OAE A;  4P4F A;  2O28 A;  2D4O A;  1OBR A;  3H8E A;  2CNM A;  2DEA A;  1S5K A;  4HNX B;  4MCR A;  1IIC A;  4Q7A A;  2ZEG A;  1MJB A;  4PXD A;  1KUY A;  3KHX A;  1YQE A;  3PB7 X;  3D2M A;  4Q36 A;  1MJA A;  4ZY1 A;  3IU2 A;  4NJR A;  3DSB A;  4KSI A;  1XJO A;  2F5I A;  5DWN A;  1X12 A;  3D4U A;  2GU2 A;  3KGQ A;  3FF3 A;  4OC2 A;  2OZG A;  3FJU A;  4U5Y A;  5F48 A;  3IWE A;  2ARH A;  3TOB A;  2NMT A;  4PXE A;  2R7H A;  2Q7S A;  3H8F A;  1PCA A;  4YU9 A;  1XE4 A;  5LYI A;  2AFU A;  4O23 A;  1P0H A;  4L8A A;  5EMI A;  2Q4Y A;  1Y7R A;  5CNP A;  3TTH A;  1I12 A;  3VH9 A;  1YME A;  1BO4 A;  3KQZ A;  4OC0 A;  1UWY A;  4UFX A;  5KTC A;  2D4P A;  5F09 A;  5J1Q A;  5KTA A;  1XMB A;  4MFK A;  4E0A A;  4B5P B;  4P4E A;  1V0C A;  1ZO0 A;  1DTD A;  4C68 A;  3WT4 A;  3FEE A;  5HVH A;  1B87 A;  2J8M A;  3DR6 A;  4NF1 A;  1LRZ A;  1Z9U A;  2FXF A;  3KQX A;  2AFO A;  3VAT A;  4QUS A;  4G1P A;  4ZYQ A;  1CX8 A;  5LYD A;  4P4D A;  1GHE A;  3S9N A;  4CS0 B;  2ZEL A;  4J3G A;  4QC6 A;  2Z10 A;  4UCN A;  4UIB A;  2GAN A;  2GLJ A;  1RXT A;  4HNY B;  1Q2Y A;  4ONU A;  1YX0 A;  2PJ0 A;  2Z3O A;  4ZBG A;  4P44 A;  3W6S A;  4B14 A;  1CJW A;  1Y9K A;  3G3S A;  4KOV A;  4A38 A;  4C2Y A;  4YRH A;  4A31 A;  2BEI A;  5THW A;  4AVA A;  5IX3 A;  4X8I A;  3B3W A;  1S7N A;  2PJ3 A;  4U9Y A;  1IU8 A;  1R43 A;  3B8G A;  4MFQ A;  5EBV A;  5H84 A;  1AYE A;  1K4J A;  5I0C A;  4MBU A;  1EE3 P;  4A39 A;  4H2K A;  1XRY A;  3L2N A;  3R9E A;  4BMH A;  2HUZ A;  4JLY A;  2NYQ A;  4DYO A;  3I9S A;  3B35 A;  1CBX A;  4MHP A;  2FIW A;  5J8C A;  2JBJ A;  4NXY A;  1QQ9 A;  3CXQ A;  1XFO A;  3V38 A;  4H6Z A;  2CF4 A;  2CNT A;  2VBQ A;  3QAH A;  2Z3P A;  4PV6 A;  4A30 A;  2G3A A;  3FEC A;  5JGF A;  2X7B A;  4F0X A;  4KS9 A;  4UFW A;  4MHD A;  1IYK A;  3FNC A;  1YSJ A;  2ZXV A;  4MXU A;  4IAV A;  5BWA B;  1PUA A;  4Z65 A;  2QEC A;  3S9L A;  2QYV A;  2HV2 A;  1ZG9 A;  2O4H A;  1ELL P;  2XEI A;  2ZEO A;  4H89 A;  4KVM E;  3B3S A;  3R1K A;  1IGB A;  2PCU A;  2PE3 A;  2PJB A;  2YNE A;  2K5T A;  3K9T A;  3MN8 A;  4UCM A;  4KSF A;  5FVJ A;  4JJX A;  3B3C A;  4TNU A;  4NGM A;  2VXK A;  5AG7 A;  1MK4 A;  1Z8W A;  4FD4 A;  1HDQ A;  3D7D A;  3FMC A;  2EWB A;  5K8M A;  3IU1 A;  1TXR A;  1N71 A;  2REE A;  1YLE A;  1XOV A;  5F47 A;  4ZY2 A;  1TF8 A;  3NE7 A;  1LCP A;  5C88 A;  2EK8 A;  3T90 A;  1I1D A;  5JPH A;  1YR0 A;  3D7G A;  3PFO A;  3HLP A;  4II9 A;  4KOU A;  3PP9 A;  2RC4 A;  4JD6 A;  4C2Z A;  3PZJ A;  4OC1 A;  3KR5 A;  2GRE A;  4M85 A;  5HXD A;  3EC4 A;  1NMT A;  3KI9 A;  2CTB A;  2BO9 A;  4AG7 A;  4JYW A;  2VZZ A;  3FIX A;  1Z5R A;  4P10 A;  4FD6 A;  4F9U A;  3N7Z A;  3OWC A;  4PK2 A;  3B3V A;  5I4M A;  3KZW A;  4FUU A;  1VGY A;  1R3N A;  3A9L A;  4UIA A;  3PGP A;  2FVG A;  4MCQ A;  2PSW A;  3TO7 A;  2GFQ A;  2PR1 A;  2DXQ A;  1CM0 A;  3E0K A;  3LMS A;  1BPN A;  3P2H A;  3FB3 A;  4CAF A;  4PQA A; 
#chains in the Genus database with same CATH homology
 4I49 A;  4QB9 A;  2ATR A;  5JQ4 A;  2ZW5 A;  3G8W A;  4LUA A;  2VZY A;  5AG5 A;  4MFJ A;  3TT2 A;  4UBR A;  1Z4R A;  4R9M A;  2B4D B;  2FSR A;  4CGP A;  2ZW7 A;  4F6A A;  2FT0 A;  4C2X A;  3QB8 A;  1VKC A;  4B10 A;  4KOY A;  1S7K A;  2GIV A;  3S6F A;  2YND A;  2WUU A;  4KVX A;  4CYQ A;  2AJ6 A;  2Z3K A;  4CRZ B;  3EY5 A;  4F0Y A;  3V8I A;  2Z0Z A;  4E8O A;  3R96 A;  3WR7 A;  4E2A A;  3C26 A;  4K30 A;  1YRE A;  4CAW A;  4CAV A;  2G0B A;  2B5G A;  4IUS A;  3UY5 A;  1I21 A;  5AGE A;  5A28 A;  3FXT A;  3SHP A;  4HNW B;  4PK3 A;  4R87 A;  3SXO A;  5HMN A;  2B58 A;  3P2F A;  4B12 A;  1UFH A;  2QIR A;  2Z3N A;  2JLM A;  1Z4E A;  2WPX A;  2A4N A;  1B6B A;  2ZPA A;  4UA3 A;  4IF5 A;  4PSX A;  2WPW A;  2PDO A;  4XNH C;  4FD5 A;  4Y49 C;  3GYA A;  5IB0 A;  1IID A;  1XEB A;  3EO4 A;  2R1I A;  2WSA A;  2Q04 A;  1QSR A;  2VI7 A;  1FY7 A;  4CGL A;  3LD2 A;  2Z11 A;  4DNC A;  1YVO A;  2J8R A;  1YVK A;  4QBJ A;  1KUX A;  2OZH A;  5GCN A;  4RI1 A;  4MFZ A;  3S6G A;  2R98 A;  3DDD A;  3EXN A;  4XNH B;  4Y49 B;  2FS5 A;  4EVY A;  4UWI A;  2P6F A;  2REF A;  2ZW4 A;  3GY9 A;  4KOT A;  4B5O A;  5G22 A;  2YNC A;  1S7F A;  1Y9W A;  1P4N A;  1M4I A;  1VHS A;  5ISV A;  4L89 A;  2PC1 A;  4JXQ A;  4JWP A;  2BSW A;  4NSQ A;  1Q2D A;  2EVN A;  4KZT A;  3K9U A;  1BOB A;  1U6M A;  1QST A;  3BJ7 A;  2H5M A;  4AG9 A;  3TO9 A;  4CYO A;  3H5Z A;  2P6E A;  4C7I A;  2J8N A;  3RYO A;  1Q2C A;  3S6H A;  4HKF A;  3KKW A;  4R3K A;  4H6U A;  3JUW A;  5DWM A;  3D3S A;  2JDD A;  1R57 A;  1YK3 A;  5H86 A;  4XPK A;  4ORF A;  3R95 A;  2GE3 A;  2DPT A;  3LOD A;  3TCV A;  2C27 A;  4OLL A;  3T9Y A;  3ZZI A;  2P6G A;  5E96 A;  2Q0Y A;  3DNS A;  2Q44 A;  5F46 A;  1OZP A;  4UFV A;  1NE9 A;  1KUV A;  4KOW A;  4AVC A;  4B5P A;  4CAE A;  2HQY A;  4UCP A;  4YGO A;  5J8F A;  2Y0M A;  3S6K A;  4MJ8 A;  2BUE A;  4XPL A;  4KVO E;  2P0W A;  4PSW A;  4OAD A;  2FCK A;  1WWZ A;  1QSN A;  3ZJ0 A;  3IWG A;  1M4D A;  4KOR A;  4NCZ A;  4XPD C;  5AG4 A;  3F8K A;  4AB7 A;  3JTK A;  4MY3 A;  5F49 A;  1KZF A;  4KSA A;  5EC4 A;  4MY0 A;  2FIA A;  3H4Q A;  2OB0 A;  3TFY A;  1M1D A;  4B11 A;  5KTD A;  3EFA A;  3R9F A;  2FE7 A;  1M44 A;  4CGN A;  2OZU A;  5G20 A;  3F0A A;  2B4B A;  2OU2 A;  4FD7 A;  4R3L A;  5IV0 A;  4GS4 A;  3DR8 A;  5G1Z A;  2ZW6 A;  5C82 A;  4UWJ A;  4MI4 A;  1XF8 A;  1QSM A;  2FL4 A;  4NEX A;  2JDC A;  1S7L A;  4YFJ A;  1NSL A;  3D8P A;  4AVB A;  4XPD B;  3F5B A;  3W91 A;  3SXN A;  1M4G A;  1PU9 A;  2VQY A;  2PQ8 A;  2IL4 A;  2AE6 A;  4BBH A;  2I79 A;  2CY2 A;  1QSO A;  1ON0 A;  4MFP A;  2JEV A;  4CAX A;  3TE4 A;  2G3T A;  4KLW A;  4A95 A;  1XMT A;  4CGM A;  4CRY B;  1TIQ A;  2YGW A;  1XIX A;  4X5K A;  5A27 A;  4U9Z A;  2B5G B;  2OH1 A;  4QVT A;  4JXR A;  2I00 A;  3I3G A;  4A2Z A;  2PRB A;  4KOX A;  1RO5 A;  5HH1 A;  2Q7B A;  2VEZ A;  3MGD A;  4CYN A;  4KUB A;  1SQH A;  3TOA A;  4MFL A;  2B3V A;  1L0C A;  1IYL A;  1IB1 E;  4B13 A;  1MJ9 A;  3D2P A;  2YNC C;  2PR8 A;  3GKR A;  1S60 A;  3JVN A;  5AG6 A;  3CXP A;  2Q4V A;  2B4D A;  3FBU A;  4R57 A;  4RS2 A;  2BL1 A;  2QML A;  3CXS A;  2KCW A;  2R8V A;  2Z3M A;  4ZGY B;  5G21 A;  4KLV A;  3FRM A;  4Q38 A;  4C7H A;  3BJ8 A;  3VWD A;  3R9G A;  1WK4 A;  2CXA A;  2DPS A;  4KUA A;  3FYN A;  3BLN A;  4LX9 A;  2EUI A;  2Z3L A;  1J4J A;  2CNS A;  4KOS A;  1YGH A;  3IGR A;  1S3Z A;  2B3U A;  4CGO A;  4A32 A;  4A33 A;  4M3S A;  3VWE A;  3TO6 A;  4CYP A;  4OAE A;  2O28 A;  2D4O A;  4HNX B;  2CNM A;  1S5K A;  1IIC A;  1MJB A;  1KUY A;  4Q36 A;  3D2M A;  1MJA A;  3IU2 A;  3DSB A;  2F5I A;  5DWN A;  4U5Y A;  5F48 A;  2OZG A;  3IWE A;  2ARH A;  3TOB A;  2NMT A;  2R7H A;  1XE4 A;  1P0H A;  4L8A A;  2Q4Y A;  1Y7R A;  5CNP A;  3TTH A;  1I12 A;  1BO4 A;  4UFX A;  5KTC A;  2D4P A;  5KTA A;  4MFK A;  4E0A A;  4B5P B;  1V0C A;  1ZO0 A;  4C68 A;  1B87 A;  2J8M A;  3DR6 A;  4NF1 A;  1LRZ A;  1Z9U A;  2FXF A;  4QUS A;  1GHE A;  4CS0 B;  4J3G A;  4QC6 A;  2Z10 A;  4UCN A;  2GAN A;  1RXT A;  4HNY B;  1Q2Y A;  4ONU A;  1YX0 A;  2Z3O A;  4ZBG A;  3W6S A;  4B14 A;  1CJW A;  1Y9K A;  3G3S A;  4KOV A;  4C2Y A;  4YRH A;  4A31 A;  2BEI A;  4AVA A;  5IX3 A;  1S7N A;  4U9Y A;  3B8G A;  4MFQ A;  5EBV A;  5H84 A;  1K4J A;  5I0C A;  4MBU A;  3R9E A;  4BMH A;  2HUZ A;  4JLY A;  3I9S A;  2FIW A;  5J8C A;  4NXY A;  3CXQ A;  4H6Z A;  2CNT A;  2VBQ A;  3QAH A;  2Z3P A;  4PV6 A;  4A30 A;  2G3A A;  2X7B A;  4F0X A;  4KS9 A;  4UFW A;  4MHD A;  1IYK A;  3FNC A;  2ZXV A;  5BWA B;  1PUA A;  2QEC A;  2HV2 A;  4H89 A;  4KVM E;  3R1K A;  2YNE A;  2K5T A;  5FVJ A;  4UCM A;  4KSF A;  4JJX A;  2VXK A;  5AG7 A;  1MK4 A;  4FD4 A;  3IU1 A;  1N71 A;  2REE A;  1YLE A;  5F47 A;  3NE7 A;  5C88 A;  3T90 A;  1I1D A;  5JPH A;  1YR0 A;  4II9 A;  4KOU A;  3PP9 A;  2RC4 A;  4JD6 A;  4C2Z A;  3PZJ A;  4M85 A;  3EC4 A;  1NMT A;  4AG7 A;  2VZZ A;  3FIX A;  4FD6 A;  3N7Z A;  3OWC A;  4PK2 A;  3A9L A;  3PGP A;  3TO7 A;  2PSW A;  2PR1 A;  2DXQ A;  1CM0 A;  3E0K A;  3P2H A;  3FB3 A;  4CAF A;  3W6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...