3G8WA

Crystal structure of a probable acetyltransferase from staphylococcus epidermidis atcc 12228
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
162
structure length
162
Chain Sequence
MNNIRLLNQNDLDSYIELMKFGHHNYEWDRYYLENVSIDRLKTILSNHTDYWNIFGAFEDDELVATCTLKQMNYVGKCHKAILENNFVKNNDEIVNRELINHIIQYAKEQNIETLMIAIASNNISAKVFFSSIGFENLAFEKNASKIGNEYFDENWLIYSTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Lactococcal prophage ps3 protein 05
publication title The crystal structure of a probable acetyltransferase from Staphylococcus epidermidis ATCC 12228.
rcsb
source organism Staphylococcus epidermidis atcc 12228
total genus 45
structure length 162
sequence length 162
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3g8wA00
4E2AA 2B5GB 1UFHA 4OLLA 1B6BA 3GY9A 3FYNA 4MY3A 3DSBA 3EC4A 4B5OA 2FT0A 3ZJ0A 4JLYA 3TO9A 3S6KA 1CM0A 4KUBA 4UWJA 3JVNA 1FY7A 2Q4VA 2X7BA 1I12A 4FD6A 2Q4YA 4IUSA 3W6XA 1Q2DA 3TT2A 3DNSA 1IYLA 3QB8A 3WR7A 2B4DA 5IX3A 4M85A 4KVOE 4CRYB 5KTDA 2ZW5A 3VWEA 2J8RA 5HH1A 3LODA 1CJWA 1Y9KA 4MY0A 2P0WA 2JDDA 1MK4A 2VEZA 1GHEA 4KZTA 2K5TA 1Q2YA 3F8KA 2EUIA 1I21A 3PZJA 3PGPA 2CY2A 4KORA 4FD5A 1S7NA 1B87A 3EY5A 2VBQA 3FXTA 1XIXA 4ZBGA 1Y9WA 3NE7A 4PV6A 2OZHA 1RXTA 3JUWA 4KOWA 2Y0MA 3DDDA 4ORFA 3OWCA 5J8FA 4MBUA 4AG7A 3QAHA 2CNSA 2VI7A 4JXQA 2FS5A 4CAXA 3C26A 1M4IA 4NCZA 1QSNA 4R3KA 1OZPA 2P6EA 1KUYA 2HUZA 1I1DA 1V0CA 2QMLA 5FVJA 3TTHA 3B8GA 4AG9A 4F0YA 1S7LA 5J8CA 1J4JA 3P2FA 2OZUA 3BJ7A 4CRZB 1WK4A 1M4DA 2F5IA 2OH1A 3BJ8A 4CAVA 1MJ9A 4PSWA 2FXFA 1YX0A 4UA3A 3H4QA 3F5BA 4NF1A 1PU9A 4XPDB 3D3SA 3E0KA 2BUEA 4L89A 3TFYA 3ZZIA 1YVOA 1IYKA 4LUAA 4JJXA 3W6SA 4X5KA 1S7KA 3TE4A 4FD7A 5E96A 2KCWA 5CNPA 1MJBA 5H86A 3LD2A 2G3AA 4R87A 2BSWA 1S5KA 4NSQA 3G8WA 4HKFA 1QSTA 3TO7A 1S7FA 2CNTA 1Z9UA 3D2MA 4LX9A 2JLMA 3GYAA 2FSRA 1ON0A 2VXKA 4H6ZA 3FIXA 4QB9A 4B5PA 4Y49C 4U9YA 2AJ6A 1NSLA 3S6GA 2J8NA 1WWZA 5IB0A 4UBRA 1P0HA 4KOXA 3W91A 1VHSA 5HMNA 4U9ZA 1QSOA 2VZZA 3MGDA 3G3SA 2ATRA 2QIRA 1XF8A 2P6FA 2Q44A 2AE6A 2ZXVA 3I3GA 5C88A 2ZW4A 2J8MA 2HV2A 3PP9A 4XNHC 4E8OA 1BOBA 3F0AA 4KLVA 3TOAA 4YFJA 2PDOA 3SXNA 2ARHA 1N71A 3FB3A 1Y7RA 1Z4EA 3CXPA 3FNCA 1NE9A 2O28A 2HQYA 3FBUA 2VQYA 3T90A 2JEVA 2Z0ZA 4JXRA 4KVME 4KOTA 3SXOA 2B5GA 2GANA 1KUXA 2Z11A 2PRBA 1MJAA 4QBJA 1Q2CA 1SQHA 4F6AA 4H89A 1XMTA 1M1DA 3TOBA 2OU2A 5EBVA 2B58A 2NMTA 4KOVA 2PR8A 4PSXA 3S6FA 4FD4A 4NXYA 5F46A 3K9UA 4XPDC 2EVNA 1PUAA 4GS4A 2PR1A 1QSRA 5I0CA 4AVBA 3T9YA 1YK3A 4II9A 1M44A 1YGHA 4YRHA 1YLEA 2CNMA 2BEIA 3FRMA 5F47A 2FIWA 3N7ZA 1IICA 1S3ZA 4DNCA 3TO6A 1NMTA 4U5YA 4IF5A 3R95A 1XEBA 4MHDA 3IGRA 4M3SA 1Z4RA 3BLNA 5ISVA 2I79A 2R98A 5F49A 1LRZA 4R9MA 2PSWA 2B4BA 2G3TA 1IB1E 2R1IA 2R7HA 1QSMA 2I00A 1VKCA 4OAEA 1YR0A 5GCNA 2Q04A 5DWNA 4KOUA 4BMHA 4QC6A 3R9FA 3EO4A 5IV0A 1KUVA 1K4JA 4E0AA 4PK3A 5JQ4A 2OZGA 3SHPA 3GKRA 3D2PA 5EC4A 2REFA 4AVAA 3TCVA 4Y49B 3EXNA 4JWPA 4R57A 4J3GA 2IL4A 4AVCA 3I9SA 3DR6A 1XE4A 2ZPAA 1YVKA 3R9GA 4OADA 2WPWA 2GIVA 4CS0B 2P6GA 4K30A 2BL1A 3KKWA 2PC1A 4CAWA 4YGOA 2QECA 2RC4A 2FL4A 4XPKA 5DWMA 2OB0A 4KUAA 4HNYB 5F48A 4PK2A 2REEA 1P4NA 5KTCA 4QUSA 4XNHB 4ONUA 4XPLA 3EFAA 2A4NA 4KVXA 4MI4A 2FE7A 4KOYA 3R9EA 4HNXB 3D8PA 4KOSA 2B3UA 2Q7BA 2ZW6A 3UY5A 1KZFA 4B5PB 2JDCA 4HNWB 4EVYA 2GE3A 3DR8A 2FCKA 3R96A 4AB7A 4R3LA 2D4OA 4QVTA 5JPHA 2G0BA 2PQ8A 2C27A 1R57A 4H6UA 4KLWA 1BO4A 3CXSA 1L0CA 2Z10A 2R8VA 2B4DB 4RS2A 4UWIA 1TIQA 5H84A 1IIDA 3R1KA 5C82A 4I49A 2WPXA 3VWDA 3IWGA 1U6MA 2D4PA 2B3VA 3CXQA 2VZYA 2H5MA 2ZW7A 5KTAA 1RO5A 4JD6A 4RI1A 3S6HA 2Q0YA 3V8IA 1S60A 4MJ8A 3RYOA 3P2HA 2FIAA 4L8AA 4NEXA 1M4GA 2DXQA 1YREA
chains in the Genus database with same CATH superfamily
4E2AA 2B5GB 1UFHA 2WZNA 4OLLA 3RNZA 2GU2A 1LANA 3VATA 1B6BA 3GY9A 4MFPA 3FYNA 4MY3A 3DSBA 4CGOA 1YW6A 3B3WA 2QVPA 3H8GA 3KR5A 2CXAA 3EC4A 4B5OA 2Q4ZA 2FT0A 1IOFA 2GLJA 3ZJ0A 4CYOA 2PJ0A 4JLYA 3TO9A 3S6KA 1CM0A 1JQGA 4KUBA 1X10A 4UCNA 4YWYA 4MHPA 1LCPA 4UWJA 5G22A 1F2OA 3JVNA 1FY7A 2Q4VA 1BPNA 2X7BA 4KSAA 4OMEA 1I12A 4X3RA 3FVLA 1YMEA 4FD6A 2Q4YA 4C2YA 1QQ9A 2O53A 4R7MA 3CPAA 1XRYA 4IUSA 1FT7A 3FF3A 1Q2DA 4PXCA 2CF4A 3W6XA 4CGLA 2I3CA 5JGFA 3TT2A 3DNSA 1IYLA 3QB8A 4MCSA 3DLJA 3WR7A 2V8GA 2B4DA 4MHYA 5IX3A 1FNOA 4EMEA 4M85A 4KVOE 4CRYB 4PXBA 2VL1A 1M4LA 4NJRA 3KQXA 5KTDA 3RO0A 4BD9A 3CPXA 2GFQA 4OIWA 1YQEA 4CPAA 2ZW5A 3VWEA 2J8RA 5HH1A 3FH4A 4NGMA 5LYFA 3LODA 1CJWA 2PVWA 1Y9KA 3IJ3A 2P0WA 4MY0A 2JDDA 4JZ0A 1MK4A 1TF9A 1XJOA 2VEZA 1GHEA 1ARMA 2PJCA 3ISZA 4KZTA 4MCRA 3MN8A 1LOKA 2K5TA 1Q2YA 4A30A 5A28A 4P4EA 1KWMA 3F8KA 2EUIA 1I21A 1IU8A 3PZJA 2Q7SA 3PGPA 2CY2A 4KORA 4FD5A 4NGTA 3SI0A 1S7NA 1HEEA 1B87A 3EY5A 2VBQA 3FXTA 3PBEA 4OIDA 2EK8A 1XIXA 4ZBGA 1Y9WA 3NE7A 4PV6A 2OZHA 1RXTA 4Q7AA 4BBHA 3JUWA 3K2KA 2Y0MA 3DDDA 4KOWA 3OWCA 4ORFA 2PJBA 4OC3A 4ZX9A 5J8FA 4UEZA 3KQZA 2ZEFA 4MBUA 4AG7A 3GLJA 3QAHA 4B13A 2CNSA 2VI7A 1Z5RA 2AFOA 2FS5A 2HC9A 4JXQA 4PPZA 3C26A 4OC5A 1M4IA 4NCZA 3S9MA 4CAXA 3S9LA 5LRKA 2Z3LA 3TC8A 1QSNA 4R3KA 1OZPA 4EFDA 2P6EA 4MXUA 1ZLIA 1CPSA 8CPAA 4A31A 1KUYA 2HUZA 2NYQA 1HDQA 1I1DA 2YGWA 1RTQA 1V0CA 2QMLA 5FVJA 3TTHA 4P10A 3IU1A 1Y0YA 2F7VA 2V77A 3B8GA 3CT9A 3GUXA 4AG9A 4F0YA 1S7LA 2DF5A 5J8CA 2C6CA 1J4JA 3P2FA 2OZUA 3BJ7A 4CRZB 1WK4A 3V38A 1M4DA 3PB9X 2F5IA 2OH1A 3BJ8A 4YU9A 3RAMA 1MJ9A 4R8FA 4CAVA 4UFVA 4PSWA 3SI2A 3SJEA 3H8EA 2FXFA 1YX0A 4WWVA 4UA3A 3B7IA 1A2ZA 3D7GA 4OC2A 3H4QA 3F5BA 3IIBA 3IU2A 4PXEA 4NF1A 1PU9A 2XEFA 4XPDB 3D3SA 3E0KA 4CYQA 2BUEA 1NSAA 4ZYQA 3NE8A 1CP6A 4L89A 4MHNA 3D66A 2GREA 3ZZIA 4C2ZA 3TFYA 4OC0A 1YVOA 3T8WA 1IYKA 2ZEMA 4LUAA 2ODFA 3BXMA 1TXRA 3CDXA 4JJXA 2ZEHA 3W6SA 4X5KA 4B11A 1CG2A 3DGVA 2RB7A 1S7KA 2XEGA 4F0XA 3TE4A 4IAVA 2CTBA 2EBJA 4FD7A 5E96A 5AG4A 2KCWA 5CNPA 2PJ4A 1MJBA 2ANPA 2ZEPA 5H86A 3SJXA 1XOVA 4DUKA 4F8ZA 3LD2A 2ZELA 4M6IA 1AYEA 2G3AA 4R87A 4A37A 2BSWA 1S5KA 4NSQA 4MMOA 3WC6A 4C68A 3G8WA 3I1UA 1Z8TA 3KHXA 3PEIA 4HKFA 1VGYA 3GIUA 1QSTA 1Q7LA 4A38A 5LYIA 3TO7A 2V8HA 1S7FA 2CNTA 2Z3NA 1Z9UA 3LWUA 3D2MA 4LX9A 2JLMA 3GYAA 3PB4X 1AMPA 1ON0A 2FSRA 3SI1A 1CX8A 2VXKA 4DJLA 4H6ZA 2FVGA 3TX8A 2ZOFA 3FIXA 4QB9A 4R76A 2AFZA 4B5PA 4Y49C 2PJ6A 4RN7A 2PJ1A 5K8NA 3D7HA 4U9YA 2AJ6A 1NSLA 2C6PA 3S6GA 5LYDA 4PQAA 4FUUA 2J8NA 4WJBA 2PJ3A 4CGNA 1WWZA 4CGPA 4FAIA 5IB0A 4UBRA 2J9AA 1VIXA 1TKFA 4X2TA 3VARA 4CGMA 1P0HA 2CTCA 2AFUA 3B3SA 2GLFA 4Q36A 4KSFA 2YNCC 4KOXA 3B2YA 3W91A 3IFEA 4A94A 1VHSA 5HMNA 5HXDA 2POKA 4U9ZA 5LYLA 1QSOA 2VZZA 3H8FA 4UCPA 3MGDA 1CPXA 2NSMA 3G3SA 2ATRA 2QIRA 1XF8A 2P6FA 4NJQA 2Q44A 2AE6A 2JBJA 3RBUA 3GB0A 4CYPA 7CPAA 3SJFA 2ZXVA 3I3GA 5C88A 1CP7A 1ELMP 2ZW4A 1H8LA 5LRJA 1LFWA 2J8MA 2HV2A 3CZXA 3PP9A 4XNHC 3NH4A 4E8OA 4UEEA 4MFZA 1BOBA 3F0AA 1VHEA 3FX6A 4KLVA 4OKOA 3TOAA 4YFJA 2PDOA 4H2KA 1YSJA 2AFSA 3SXNA 2ARHA 3LMSA 1N71A 3FB3A 1Y7RA 4MFQA 4FBEA 1Z4EA 3CXPA 5JM6A 3FNCA 2AFWA 1NE9A 4OC1A 4OC4A 2O28A 2HQYA 3FBUA 1Z8WA 4ONWA 1YW4A 2VQYA 3T90A 2Z3PA 1ARLA 4B14A 2BOAA 5AG5A 1BPMA 2JEVA 2Z0ZA 4JXRA 1QMUA 2JEWA 4OP4A 4KVME 4A95A 4KOTA 3K9TA 3FEDA 3IWWA 3SXOA 4NFRA 4B12A 5BWAB 2B5GA 2GANA 3HUVA 1KUXA 2Z11A 2PRBA 1MJAA 2V8DA 4QBJA 5F09A 5AG7A 1Q2CA 1SQHA 1Y7EA 4H89A 4F6AA 1XMTA 1M1DA 2QYVA 3HLPA 3TOBA 2OU2A 5EBVA 2B58A 3IO1A 6CPAA 4CYNA 2NMTA 4KOVA 4UFWA 2PR8A 1BLLE 3KI9A 4PSXA 1F57A 3S6FA 3D67A 4FD4A 1ELLP 1DTDA 4NXYA 2IQ6A 5F46A 3K9UA 4F9UA 1PYTB 4Q38A 4XPDC 2EVNA 4NGNA 1PUAA 4GS4A 3B3TA 2PR1A 3MRUA 1QSRA 4P45A 5DS0A 3KL9A 4MCPA 4DYOA 2XEJA 1BAVA 2OR4A 5G1ZA 2WSAA 4MCQA 4A39A 5I0CA 2PCUA 4AVBA 3T9YA 4C7HA 1YK3A 4NGRA 4UEFA 4II9A 1M44A 1XMBA 1YGHA 4YRHA 1YLEA 3KGQA 2CNMA 2QJ8A 1HDUA 2BEIA 2ABZA 3FRMA 4P6YA 4BINA 2Q43A 2DPSA 5F47A 2V8VA 2FIWA 1TKJA 1IICA 1S3ZA 3N7ZA 3TO6A 5G20A 4DNCA 5CBMA 2ZEDA 3D7DA 1NMTA 4M6GA 4U5YA 4IF5A 4MHZA 4ZY1A 3R95A 1XEBA 4MHDA 1TF8A 3IGRA 4TNUA 4F9VA 1TKHA 2BO9A 4M3SA 1Z4RA 3BLNA 1F2PA 5ISVA 4CAFA 2I79A 2R98A 4P4DA 5F49A 5ELYA 4EWTA 1LRZA 4IK2A 4R9MA 2PSWA 4A32A 3B3VA 3BI1A 2ZENA 3D4UA 2B4BA 2G3TA 5HVHA 4MRIA 2C6GA 2ZEEA 1IB1E 3A9LA 2R1IA 3FECA 2C1CA 2R7HA 4NGPA 4RUHA 3KZWA 1QSMA 2I00A 3H5ZA 1VKCA 3NFZA 1YR0A 4OAEA 1ZLHA 2Q04A 3IWEA 2IMOA 3QAYA 4KOUA 5DWNA 5GCNA 4BMHA 4QC6A 3KASA 1IOIA 2RFHA 3R9FA 3EO4A 3IC1A 5IV0A 1ZG8A 1KUVA 2DEAA 2HB6A 4C2XA 1K4JA 4ZGYB 1DE4C 4E0AA 3PBBA 3L2NA 1ZO0A 2Z3KA 4LQGA 3D7FA 4PK3A 4CAEA 2EWBA 2OZGA 5JQ4A 1ZG9A 4MFKA 5LRGA 2Q51A 3SHPA 2EK9A 3NA6A 3GKRA 4A2ZA 2Z3OA 3PRTA 5D29A 3D2PA 5EC4A 4P4BA 4W9YA 2WUUA 2REFA 4AVAA 4UFXA 3WABA 2ZOGA 4FWUA 5K8MA 4JYWA 3TCVA 4Y49B 4A33A 3EXNA 2XEIA 4JWPA 4R57A 1CBXA 2PJ8A 4J3GA 4UIAA 1XFOA 2IL4A 5J1QA 4MFJA 4AVCA 2PJ7A 2WYRA 3DR6A 3I9SA 5AGEA 5HVGA 1XE4A 2ZPAA 1YVKA 2PIZA 3R9GA 4OADA 2WPWA 2Z3MA 4IHMA 1XBUA 2GIVA 4CS0B 2IJZA 2P6GA 4NGQA 4ZY2A 2CIJA 1JWQA 2BL1A 3KKWA 4K30A 4ZY0A 5EMIA 3JTKA 2PC1A 4M6HA 4CAWA 5HVFA 4YGOA 4ZX8A 1VHOA 2QECA 2ZEOA 2RC4A 4G1PA 2AFMA 2FL4A 4XPKA 5DWMA 2PE3A 2OB0A 2PJ2A 4KUAA 4HNYB 5F48A 1R43A 4KS9A 4PK2A 5K8OA 4P4FA 5K8PA 2REEA 1P4NA 5KTCA 4QUSA 5AG6A 3RZAA 4XNHB 4ONUA 4XPLA 2PRQA 1LAMA 3EFAA 4TWEA 2A4NA 4KVXA 4MI4A 2FE7A 4KOYA 2PIYA 3PFEA 4P4IA 3R9EA 5I4MA 4HNXB 3D8PA 4KOSA 2B3UA 1Z8LA 2Q7BA 4AXVA 4B10A 2YNEA 2ZW6A 3UY5A 1KZFA 1LAPA 3QNVA 4B5PB 2JDCA 4HNWB 3NH8A 2DPTA 4EVYA 5JH9A 2GE3A 4LQ6A 3DR8A 3VH9A 5IB9A 4K3NA 3WT4A 2FCKA 3R96A 2OOTA 1UWYA 5D8NA 4AB7A 4R3LA 3WC7A 2D4OA 3JRUA 4QVTA 5JPHA 2O4HA 2G0BA 2PQ8A 2C27A 1R57A 4C7IA 1R3NA 4UIBA 4H6UA 4KLWA 1X12A 1BO4A 3CXSA 2JBKA 1L0CA 2Z10A 3KHZA 4UCMA 2R8VA 2AFXA 2B4DB 4RS2A 1PCAA 3FJUA 3FMCA 3IEHA 3S9NA 2PJ5A 4UWIA 1TIQA 4MFLA 5H84A 3N5FA 1IIDA 3R1KA 3SJGA 4NGSA 3D68A 3FEEA 3B35A 1AUGA 3PB6X 2PJ9A 4I49A 5C82A 2WPXA 4P4JA 4UF4A 3VWDA 3B3CA 2PJAA 4GM5A 1GYTA 1Z2LA 2YNDA 3NH5A 3IWGA 3KR4A 3LACA 1U6MA 2G9DA 4ZI6A 3V7ZA 4P44A 2D4PA 1Y0RA 5CPAA 4R6TA 2ZEGA 2B3VA 3CXQA 2YNCA 4KSIA 2VZYA 4Z65A 4X8IA 5A27A 4PXDA 2H5MA 2ZW7A 5KTAA 1RO5A 1Z8XA 4JD6A 3PB8X 4RI1A 3S6HA 2Q0YA 4HPSA 3PFOA 3BI0A 3V8IA 3PB7X 1S60A 1ZG7A 4MJ8A 4B6ZA 1YLOA 3ISXA 4O23A 3RYOA 2EO8A 3BHXA 1EE3P 2FIAA 3P2HA 4L8AA 1IGBA 2PVVA 2F8HA 1IY7A 4GXHA 5G21A 4NEXA 5THWA 1M4GA 3WC5A 2DXQA 1OBRA 1YREA 2BCOA
chains in the Genus database with same CATH topology
4E2AA 2B5GB 1UFHA 4OLLA 1B6BA 3GY9A 4MFPA 3FYNA 4MY3A 3DSBA 4CGOA 2CXAA 3EC4A 4B5OA 2FT0A 3ZJ0A 4CYOA 4JLYA 3TO9A 3S6KA 1CM0A 4KUBA 4UCNA 4UWJA 5G22A 3JVNA 1FY7A 2Q4VA 2X7BA 4KSAA 1I12A 4FD6A 2Q4YA 4C2YA 4IUSA 3W6XA 1Q2DA 4CGLA 3TT2A 3DNSA 1IYLA 3QB8A 3WR7A 2B4DA 5IX3A 4M85A 4KVOE 4CRYB 5KTDA 2ZW5A 3VWEA 2J8RA 5HH1A 3LODA 1CJWA 1Y9KA 4MY0A 2P0WA 2JDDA 1MK4A 2VEZA 1GHEA 4KZTA 2K5TA 1Q2YA 4A30A 5A28A 3F8KA 2EUIA 1I21A 3PZJA 3PGPA 2CY2A 4KORA 4FD5A 1S7NA 1B87A 3EY5A 2VBQA 3FXTA 4C2XA 1XIXA 4ZBGA 3NE7A 1Y9WA 4PV6A 2OZHA 1RXTA 4BBHA 3JUWA 4KOWA 2Y0MA 3DDDA 4ORFA 3OWCA 5J8FA 4MBUA 4AG7A 3QAHA 4B13A 2CNSA 2VI7A 4JXQA 2FS5A 4CAXA 3C26A 1M4IA 4NCZA 2Z3LA 1QSNA 4R3KA 1OZPA 2P6EA 4A31A 1KUYA 2HUZA 1I1DA 2YGWA 1V0CA 2QMLA 5FVJA 3TTHA 3IU1A 3B8GA 4AG9A 4F0YA 1S7LA 5J8CA 1J4JA 3P2FA 2OZUA 3BJ7A 4CRZB 1WK4A 1M4DA 2F5IA 2OH1A 3BJ8A 4CAVA 1MJ9A 4UFVA 4PSWA 2FXFA 1YX0A 4UA3A 3H4QA 3F5BA 3IU2A 4NF1A 1PU9A 4CYQA 4XPDB 3D3SA 3E0KA 2BUEA 4L89A 3TFYA 4C2ZA 3ZZIA 1YVOA 1IYKA 4LUAA 4JJXA 3W6SA 4B11A 4X5KA 1S7KA 4F0XA 3TE4A 4FD7A 5E96A 5AG4A 2KCWA 5CNPA 1MJBA 5H86A 3LD2A 2G3AA 4R87A 2BSWA 1S5KA 4NSQA 4C68A 3G8WA 4HKFA 1QSTA 3TO7A 1S7FA 2CNTA 2Z3NA 1Z9UA 3D2MA 4LX9A 2JLMA 3GYAA 2FSRA 1ON0A 2VXKA 4H6ZA 3FIXA 4QB9A 4B5PA 4Y49C 4U9YA 2AJ6A 1NSLA 3S6GA 2J8NA 4CGNA 1WWZA 4CGPA 5IB0A 4UBRA 4CGMA 1P0HA 4Q36A 4KSFA 2YNCC 4KOXA 3W91A 1VHSA 5HMNA 4U9ZA 1QSOA 2VZZA 4UCPA 3MGDA 3G3SA 2ATRA 2QIRA 1XF8A 2P6FA 2Q44A 2AE6A 4CYPA 2ZXVA 3I3GA 5C88A 2ZW4A 2J8MA 2HV2A 3PP9A 4XNHC 4E8OA 4MFZA 1BOBA 3F0AA 4KLVA 3TOAA 4YFJA 2PDOA 3SXNA 2ARHA 4MFQA 1N71A 3FB3A 1Y7RA 1Z4EA 3CXPA 3FNCA 1NE9A 2O28A 2HQYA 3FBUA 2VQYA 3T90A 2Z3PA 4B14A 5AG5A 2JEVA 2Z0ZA 4JXRA 4KVME 4A95A 4KOTA 4B12A 3SXOA 2B5GA 2GANA 1KUXA 2Z11A 2PRBA 1MJAA 4QBJA 5AG7A 1Q2CA 1SQHA 4F6AA 4H89A 1XMTA 1M1DA 3TOBA 2OU2A 5EBVA 2B58A 4CYNA 2NMTA 4KOVA 4UFWA 2PR8A 4PSXA 3S6FA 4FD4A 4NXYA 5F46A 3K9UA 4Q38A 4XPDC 2EVNA 1PUAA 4GS4A 2PR1A 1QSRA 5G1ZA 2WSAA 5I0CA 4AVBA 3T9YA 4C7HA 1YK3A 4II9A 1M44A 1YGHA 4YRHA 1YLEA 2CNMA 2BEIA 3FRMA 2DPSA 5F47A 2FIWA 3N7ZA 1IICA 1S3ZA 4DNCA 3TO6A 5G20A 1NMTA 4U5YA 4IF5A 3R95A 1XEBA 4MHDA 3IGRA 4M3SA 1Z4RA 3BLNA 5ISVA 4CAFA 2I79A 2R98A 5F49A 1LRZA 4R9MA 2PSWA 4A32A 2B4BA 2G3TA 1IB1E 3A9LA 2R1IA 2R7HA 1QSMA 2I00A 3H5ZA 1VKCA 4OAEA 1YR0A 5GCNA 2Q04A 3IWEA 4KOUA 5DWNA 4BMHA 4QC6A 3R9FA 3EO4A 5IV0A 1KUVA 1K4JA 4ZGYB 4E0AA 1ZO0A 2Z3KA 4PK3A 4CAEA 2OZGA 5JQ4A 4MFKA 3SHPA 4A2ZA 3GKRA 2Z3OA 3D2PA 5EC4A 2WUUA 2REFA 4AVAA 4UFXA 3TCVA 4Y49B 4A33A 3EXNA 4JWPA 4R57A 4J3GA 2IL4A 4MFJA 4AVCA 3I9SA 3DR6A 5AGEA 1XE4A 2ZPAA 1YVKA 3R9GA 4OADA 2WPWA 2Z3MA 2GIVA 4CS0B 2P6GA 4K30A 2BL1A 3KKWA 3JTKA 2PC1A 4CAWA 4YGOA 2QECA 2RC4A 2FL4A 4XPKA 5DWMA 2OB0A 4KUAA 4HNYB 5F48A 4KS9A 4PK2A 2REEA 1P4NA 5KTCA 4QUSA 5AG6A 4XNHB 4ONUA 4XPLA 3EFAA 2A4NA 4KVXA 4MI4A 2FE7A 4KOYA 3R9EA 4HNXB 3D8PA 4KOSA 2B3UA 2Q7BA 4B10A 2YNEA 2ZW6A 3UY5A 1KZFA 4B5PB 2JDCA 4HNWB 2DPTA 4EVYA 2GE3A 3DR8A 2FCKA 3R96A 4AB7A 4R3LA 2D4OA 4QVTA 5JPHA 2G0BA 2PQ8A 2C27A 1R57A 4C7IA 4H6UA 4KLWA 1BO4A 3CXSA 1L0CA 2Z10A 4UCMA 2R8VA 2B4DB 4RS2A 4UWIA 1TIQA 4MFLA 5H84A 1IIDA 3R1KA 5C82A 4I49A 2WPXA 3VWDA 2YNDA 3IWGA 1U6MA 2D4PA 2B3VA 3CXQA 2YNCA 2VZYA 5A27A 2H5MA 2ZW7A 5KTAA 1RO5A 4JD6A 4RI1A 3S6HA 2Q0YA 3V8IA 1S60A 4MJ8A 3RYOA 3P2HA 2FIAA 4L8AA 5G21A 4NEXA 1M4GA 2DXQA 1YREA 5BWAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E2A A;  2B5G B;  1UFH A;  4OLL A;  1B6B A;  3GY9 A;  3FYN A;  4MY3 A;  3DSB A;  3EC4 A;  4B5O A;  2FT0 A;  3ZJ0 A;  4JLY A;  3TO9 A;  3S6K A;  1CM0 A;  4KUB A;  4UWJ A;  3JVN A;  1FY7 A;  2Q4V A;  2X7B A;  1I12 A;  4FD6 A;  2Q4Y A;  4IUS A;  3W6X A;  1Q2D A;  3TT2 A;  3DNS A;  1IYL A;  3QB8 A;  3WR7 A;  2B4D A;  5IX3 A;  4M85 A;  4KVO E;  4CRY B;  5KTD A;  2ZW5 A;  3VWE A;  2J8R A;  5HH1 A;  3LOD A;  1CJW A;  1Y9K A;  4MY0 A;  2P0W A;  2JDD A;  1MK4 A;  2VEZ A;  1GHE A;  4KZT A;  2K5T A;  1Q2Y A;  3F8K A;  2EUI A;  1I21 A;  3PZJ A;  3PGP A;  2CY2 A;  4KOR A;  4FD5 A;  1S7N A;  1B87 A;  3EY5 A;  2VBQ A;  3FXT A;  1XIX A;  4ZBG A;  1Y9W A;  3NE7 A;  4PV6 A;  2OZH A;  1RXT A;  3JUW A;  4KOW A;  2Y0M A;  3DDD A;  4ORF A;  3OWC A;  5J8F A;  4MBU A;  4AG7 A;  3QAH A;  2CNS A;  2VI7 A;  4JXQ A;  2FS5 A;  4CAX A;  3C26 A;  1M4I A;  4NCZ A;  1QSN A;  4R3K A;  1OZP A;  2P6E A;  1KUY A;  2HUZ A;  1I1D A;  1V0C A;  2QML A;  5FVJ A;  3TTH A;  3B8G A;  4AG9 A;  4F0Y A;  1S7L A;  5J8C A;  1J4J A;  3P2F A;  2OZU A;  3BJ7 A;  4CRZ B;  1WK4 A;  1M4D A;  2F5I A;  2OH1 A;  3BJ8 A;  4CAV A;  1MJ9 A;  4PSW A;  2FXF A;  1YX0 A;  4UA3 A;  3H4Q A;  3F5B A;  4NF1 A;  1PU9 A;  4XPD B;  3D3S A;  3E0K A;  2BUE A;  4L89 A;  3TFY A;  3ZZI A;  1YVO A;  1IYK A;  4LUA A;  4JJX A;  3W6S A;  4X5K A;  1S7K A;  3TE4 A;  4FD7 A;  5E96 A;  2KCW A;  5CNP A;  1MJB A;  5H86 A;  3LD2 A;  2G3A A;  4R87 A;  2BSW A;  1S5K A;  4NSQ A;  3G8W A;  4HKF A;  1QST A;  3TO7 A;  1S7F A;  2CNT A;  1Z9U A;  3D2M A;  4LX9 A;  2JLM A;  3GYA A;  2FSR A;  1ON0 A;  2VXK A;  4H6Z A;  3FIX A;  4QB9 A;  4B5P A;  4Y49 C;  4U9Y A;  2AJ6 A;  1NSL A;  3S6G A;  2J8N A;  1WWZ A;  5IB0 A;  4UBR A;  1P0H A;  4KOX A;  3W91 A;  1VHS A;  5HMN A;  4U9Z A;  1QSO A;  2VZZ A;  3MGD A;  3G3S A;  2ATR A;  2QIR A;  1XF8 A;  2P6F A;  2Q44 A;  2AE6 A;  2ZXV A;  3I3G A;  5C88 A;  2ZW4 A;  2J8M A;  2HV2 A;  3PP9 A;  4XNH C;  4E8O A;  1BOB A;  3F0A A;  4KLV A;  3TOA A;  4YFJ A;  2PDO A;  3SXN A;  2ARH A;  1N71 A;  3FB3 A;  1Y7R A;  1Z4E A;  3CXP A;  3FNC A;  1NE9 A;  2O28 A;  2HQY A;  3FBU A;  2VQY A;  3T90 A;  2JEV A;  2Z0Z A;  4JXR A;  4KVM E;  4KOT A;  3SXO A;  2B5G A;  2GAN A;  1KUX A;  2Z11 A;  2PRB A;  1MJA A;  4QBJ A;  1Q2C A;  1SQH A;  4F6A A;  4H89 A;  1XMT A;  1M1D A;  3TOB A;  2OU2 A;  5EBV A;  2B58 A;  2NMT A;  4KOV A;  2PR8 A;  4PSX A;  3S6F A;  4FD4 A;  4NXY A;  5F46 A;  3K9U A;  4XPD C;  2EVN A;  1PUA A;  4GS4 A;  2PR1 A;  1QSR A;  5I0C A;  4AVB A;  3T9Y A;  1YK3 A;  4II9 A;  1M44 A;  1YGH A;  4YRH A;  1YLE A;  2CNM A;  2BEI A;  3FRM A;  5F47 A;  2FIW A;  3N7Z A;  1IIC A;  1S3Z A;  4DNC A;  3TO6 A;  1NMT A;  4U5Y A;  4IF5 A;  3R95 A;  1XEB A;  4MHD A;  3IGR A;  4M3S A;  1Z4R A;  3BLN A;  5ISV A;  2I79 A;  2R98 A;  5F49 A;  1LRZ A;  4R9M A;  2PSW A;  2B4B A;  2G3T A;  1IB1 E;  2R1I A;  2R7H A;  1QSM A;  2I00 A;  1VKC A;  4OAE A;  1YR0 A;  5GCN A;  2Q04 A;  5DWN A;  4KOU A;  4BMH A;  4QC6 A;  3R9F A;  3EO4 A;  5IV0 A;  1KUV A;  1K4J A;  4E0A A;  4PK3 A;  5JQ4 A;  2OZG A;  3SHP A;  3GKR A;  3D2P A;  5EC4 A;  2REF A;  4AVA A;  3TCV A;  4Y49 B;  3EXN A;  4JWP A;  4R57 A;  4J3G A;  2IL4 A;  4AVC A;  3I9S A;  3DR6 A;  1XE4 A;  2ZPA A;  1YVK A;  3R9G A;  4OAD A;  2WPW A;  2GIV A;  4CS0 B;  2P6G A;  4K30 A;  2BL1 A;  3KKW A;  2PC1 A;  4CAW A;  4YGO A;  2QEC A;  2RC4 A;  2FL4 A;  4XPK A;  5DWM A;  2OB0 A;  4KUA A;  4HNY B;  5F48 A;  4PK2 A;  2REE A;  1P4N A;  5KTC A;  4QUS A;  4XNH B;  4ONU A;  4XPL A;  3EFA A;  2A4N A;  4KVX A;  4MI4 A;  2FE7 A;  4KOY A;  3R9E A;  4HNX B;  3D8P A;  4KOS A;  2B3U A;  2Q7B A;  2ZW6 A;  3UY5 A;  1KZF A;  4B5P B;  2JDC A;  4HNW B;  4EVY A;  2GE3 A;  3DR8 A;  2FCK A;  3R96 A;  4AB7 A;  4R3L A;  2D4O A;  4QVT A;  5JPH A;  2G0B A;  2PQ8 A;  2C27 A;  1R57 A;  4H6U A;  4KLW A;  1BO4 A;  3CXS A;  1L0C A;  2Z10 A;  2R8V A;  2B4D B;  4RS2 A;  4UWI A;  1TIQ A;  5H84 A;  1IID A;  3R1K A;  5C82 A;  4I49 A;  2WPX A;  3VWD A;  3IWG A;  1U6M A;  2D4P A;  2B3V A;  3CXQ A;  2VZY A;  2H5M A;  2ZW7 A;  5KTA A;  1RO5 A;  4JD6 A;  4RI1 A;  3S6H A;  2Q0Y A;  3V8I A;  1S60 A;  4MJ8 A;  3RYO A;  3P2H A;  2FIA A;  4L8A A;  4NEX A;  1M4G A;  2DXQ A;  1YRE A; 
#chains in the Genus database with same CATH topology
 4E2A A;  2B5G B;  1UFH A;  2WZN A;  4OLL A;  3RNZ A;  2GU2 A;  1LAN A;  3VAT A;  1B6B A;  3GY9 A;  4MFP A;  3FYN A;  4MY3 A;  3DSB A;  4CGO A;  1YW6 A;  3B3W A;  2QVP A;  3H8G A;  3KR5 A;  2CXA A;  3EC4 A;  4B5O A;  2Q4Z A;  2FT0 A;  1IOF A;  2GLJ A;  3ZJ0 A;  4CYO A;  2PJ0 A;  4JLY A;  3TO9 A;  3S6K A;  1CM0 A;  1JQG A;  4KUB A;  1X10 A;  4UCN A;  4YWY A;  4MHP A;  1LCP A;  4UWJ A;  5G22 A;  1F2O A;  3JVN A;  1FY7 A;  2Q4V A;  1BPN A;  2X7B A;  4KSA A;  4OME A;  1I12 A;  4X3R A;  3FVL A;  1YME A;  4FD6 A;  2Q4Y A;  4C2Y A;  1QQ9 A;  2O53 A;  4R7M A;  3CPA A;  1XRY A;  4IUS A;  1FT7 A;  3FF3 A;  1Q2D A;  4PXC A;  2CF4 A;  3W6X A;  4CGL A;  2I3C A;  5JGF A;  3TT2 A;  3DNS A;  1IYL A;  3QB8 A;  4MCS A;  3DLJ A;  3WR7 A;  2V8G A;  2B4D A;  4MHY A;  5IX3 A;  1FNO A;  4EME A;  4M85 A;  4KVO E;  4CRY B;  4PXB A;  2VL1 A;  1M4L A;  4NJR A;  3KQX A;  5KTD A;  3RO0 A;  4BD9 A;  3CPX A;  2GFQ A;  4OIW A;  1YQE A;  4CPA A;  2ZW5 A;  3VWE A;  2J8R A;  5HH1 A;  3FH4 A;  4NGM A;  5LYF A;  3LOD A;  1CJW A;  2PVW A;  1Y9K A;  3IJ3 A;  2P0W A;  4MY0 A;  2JDD A;  4JZ0 A;  1MK4 A;  1TF9 A;  1XJO A;  2VEZ A;  1GHE A;  1ARM A;  2PJC A;  3ISZ A;  4KZT A;  4MCR A;  3MN8 A;  1LOK A;  2K5T A;  1Q2Y A;  4A30 A;  5A28 A;  4P4E A;  1KWM A;  3F8K A;  2EUI A;  1I21 A;  1IU8 A;  3PZJ A;  2Q7S A;  3PGP A;  2CY2 A;  4KOR A;  4FD5 A;  4NGT A;  3SI0 A;  1S7N A;  1HEE A;  1B87 A;  3EY5 A;  2VBQ A;  3FXT A;  3PBE A;  4OID A;  2EK8 A;  1XIX A;  4ZBG A;  1Y9W A;  3NE7 A;  4PV6 A;  2OZH A;  1RXT A;  4Q7A A;  4BBH A;  3JUW A;  3K2K A;  2Y0M A;  3DDD A;  4KOW A;  3OWC A;  4ORF A;  2PJB A;  4OC3 A;  4ZX9 A;  5J8F A;  4UEZ A;  3KQZ A;  2ZEF A;  4MBU A;  4AG7 A;  3GLJ A;  3QAH A;  4B13 A;  2CNS A;  2VI7 A;  1Z5R A;  2AFO A;  2FS5 A;  2HC9 A;  4JXQ A;  4PPZ A;  3C26 A;  4OC5 A;  1M4I A;  4NCZ A;  3S9M A;  4CAX A;  3S9L A;  5LRK A;  2Z3L A;  3TC8 A;  1QSN A;  4R3K A;  1OZP A;  4EFD A;  2P6E A;  4MXU A;  1ZLI A;  1CPS A;  8CPA A;  4A31 A;  1KUY A;  2HUZ A;  2NYQ A;  1HDQ A;  1I1D A;  2YGW A;  1RTQ A;  1V0C A;  2QML A;  5FVJ A;  3TTH A;  4P10 A;  3IU1 A;  1Y0Y A;  2F7V A;  2V77 A;  3B8G A;  3CT9 A;  3GUX A;  4AG9 A;  4F0Y A;  1S7L A;  2DF5 A;  5J8C A;  2C6C A;  1J4J A;  3P2F A;  2OZU A;  3BJ7 A;  4CRZ B;  1WK4 A;  3V38 A;  1M4D A;  3PB9 X;  2F5I A;  2OH1 A;  3BJ8 A;  4YU9 A;  3RAM A;  1MJ9 A;  4R8F A;  4CAV A;  4UFV A;  4PSW A;  3SI2 A;  3SJE A;  3H8E A;  2FXF A;  1YX0 A;  4WWV A;  4UA3 A;  3B7I A;  1A2Z A;  3D7G A;  4OC2 A;  3H4Q A;  3F5B A;  3IIB A;  3IU2 A;  4PXE A;  4NF1 A;  1PU9 A;  2XEF A;  4XPD B;  3D3S A;  3E0K A;  4CYQ A;  2BUE A;  1NSA A;  4ZYQ A;  3NE8 A;  1CP6 A;  4L89 A;  4MHN A;  3D66 A;  2GRE A;  3ZZI A;  4C2Z A;  3TFY A;  4OC0 A;  1YVO A;  3T8W A;  1IYK A;  2ZEM A;  4LUA A;  2ODF A;  3BXM A;  1TXR A;  3CDX A;  4JJX A;  2ZEH A;  3W6S A;  4X5K A;  4B11 A;  1CG2 A;  3DGV A;  2RB7 A;  1S7K A;  2XEG A;  4F0X A;  3TE4 A;  4IAV A;  2CTB A;  2EBJ A;  4FD7 A;  5E96 A;  5AG4 A;  2KCW A;  5CNP A;  2PJ4 A;  1MJB A;  2ANP A;  2ZEP A;  5H86 A;  3SJX A;  1XOV A;  4DUK A;  4F8Z A;  3LD2 A;  2ZEL A;  4M6I A;  1AYE A;  2G3A A;  4R87 A;  4A37 A;  2BSW A;  1S5K A;  4NSQ A;  4MMO A;  3WC6 A;  4C68 A;  3G8W A;  3I1U A;  1Z8T A;  3KHX A;  3PEI A;  4HKF A;  1VGY A;  3GIU A;  1QST A;  1Q7L A;  4A38 A;  5LYI A;  3TO7 A;  2V8H A;  1S7F A;  2CNT A;  2Z3N A;  1Z9U A;  3LWU A;  3D2M A;  4LX9 A;  2JLM A;  3GYA A;  3PB4 X;  1AMP A;  1ON0 A;  2FSR A;  3SI1 A;  1CX8 A;  2VXK A;  4DJL A;  4H6Z A;  2FVG A;  3TX8 A;  2ZOF A;  3FIX A;  4QB9 A;  4R76 A;  2AFZ A;  4B5P A;  4Y49 C;  2PJ6 A;  4RN7 A;  2PJ1 A;  5K8N A;  3D7H A;  4U9Y A;  2AJ6 A;  1NSL A;  2C6P A;  3S6G A;  5LYD A;  4PQA A;  4FUU A;  2J8N A;  4WJB A;  2PJ3 A;  4CGN A;  1WWZ A;  4CGP A;  4FAI A;  5IB0 A;  4UBR A;  2J9A A;  1VIX A;  1TKF A;  4X2T A;  3VAR A;  4CGM A;  1P0H A;  2CTC A;  2AFU A;  3B3S A;  2GLF A;  4Q36 A;  4KSF A;  2YNC C;  4KOX A;  3B2Y A;  3W91 A;  3IFE A;  4A94 A;  1VHS A;  5HMN A;  5HXD A;  2POK A;  4U9Z A;  5LYL A;  1QSO A;  2VZZ A;  3H8F A;  4UCP A;  3MGD A;  1CPX A;  2NSM A;  3G3S A;  2ATR A;  2QIR A;  1XF8 A;  2P6F A;  4NJQ A;  2Q44 A;  2AE6 A;  2JBJ A;  3RBU A;  3GB0 A;  4CYP A;  7CPA A;  3SJF A;  2ZXV A;  3I3G A;  5C88 A;  1CP7 A;  1ELM P;  2ZW4 A;  1H8L A;  5LRJ A;  1LFW A;  2J8M A;  2HV2 A;  3CZX A;  3PP9 A;  4XNH C;  3NH4 A;  4E8O A;  4UEE A;  4MFZ A;  1BOB A;  3F0A A;  1VHE A;  3FX6 A;  4KLV A;  4OKO A;  3TOA A;  4YFJ A;  2PDO A;  4H2K A;  1YSJ A;  2AFS A;  3SXN A;  2ARH A;  3LMS A;  1N71 A;  3FB3 A;  1Y7R A;  4MFQ A;  4FBE A;  1Z4E A;  3CXP A;  5JM6 A;  3FNC A;  2AFW A;  1NE9 A;  4OC1 A;  4OC4 A;  2O28 A;  2HQY A;  3FBU A;  1Z8W A;  4ONW A;  1YW4 A;  2VQY A;  3T90 A;  2Z3P A;  1ARL A;  4B14 A;  2BOA A;  5AG5 A;  1BPM A;  2JEV A;  2Z0Z A;  4JXR A;  1QMU A;  2JEW A;  4OP4 A;  4KVM E;  4A95 A;  4KOT A;  3K9T A;  3FED A;  3IWW A;  3SXO A;  4NFR A;  4B12 A;  5BWA B;  2B5G A;  2GAN A;  3HUV A;  1KUX A;  2Z11 A;  2PRB A;  1MJA A;  2V8D A;  4QBJ A;  5F09 A;  5AG7 A;  1Q2C A;  1SQH A;  1Y7E A;  4H89 A;  4F6A A;  1XMT A;  1M1D A;  2QYV A;  3HLP A;  3TOB A;  2OU2 A;  5EBV A;  2B58 A;  3IO1 A;  6CPA A;  4CYN A;  2NMT A;  4KOV A;  4UFW A;  2PR8 A;  1BLL E;  3KI9 A;  4PSX A;  1F57 A;  3S6F A;  3D67 A;  4FD4 A;  1ELL P;  1DTD A;  4NXY A;  2IQ6 A;  5F46 A;  3K9U A;  4F9U A;  1PYT B;  4Q38 A;  4XPD C;  2EVN A;  4NGN A;  1PUA A;  4GS4 A;  3B3T A;  2PR1 A;  3MRU A;  1QSR A;  4P45 A;  5DS0 A;  3KL9 A;  4MCP A;  4DYO A;  2XEJ A;  1BAV A;  2OR4 A;  5G1Z A;  2WSA A;  4MCQ A;  4A39 A;  5I0C A;  2PCU A;  4AVB A;  3T9Y A;  4C7H A;  1YK3 A;  4NGR A;  4UEF A;  4II9 A;  1M44 A;  1XMB A;  1YGH A;  4YRH A;  1YLE A;  3KGQ A;  2CNM A;  2QJ8 A;  1HDU A;  2BEI A;  2ABZ A;  3FRM A;  4P6Y A;  4BIN A;  2Q43 A;  2DPS A;  5F47 A;  2V8V A;  2FIW A;  1TKJ A;  1IIC A;  1S3Z A;  3N7Z A;  3TO6 A;  5G20 A;  4DNC A;  5CBM A;  2ZED A;  3D7D A;  1NMT A;  4M6G A;  4U5Y A;  4IF5 A;  4MHZ A;  4ZY1 A;  3R95 A;  1XEB A;  4MHD A;  1TF8 A;  3IGR A;  4TNU A;  4F9V A;  1TKH A;  2BO9 A;  4M3S A;  1Z4R A;  3BLN A;  1F2P A;  5ISV A;  4CAF A;  2I79 A;  2R98 A;  4P4D A;  5F49 A;  5ELY A;  4EWT A;  1LRZ A;  4IK2 A;  4R9M A;  2PSW A;  4A32 A;  3B3V A;  3BI1 A;  2ZEN A;  3D4U A;  2B4B A;  2G3T A;  5HVH A;  4MRI A;  2C6G A;  2ZEE A;  1IB1 E;  3A9L A;  2R1I A;  3FEC A;  2C1C A;  2R7H A;  4NGP A;  4RUH A;  3KZW A;  1QSM A;  2I00 A;  3H5Z A;  1VKC A;  3NFZ A;  1YR0 A;  4OAE A;  1ZLH A;  2Q04 A;  3IWE A;  2IMO A;  3QAY A;  4KOU A;  5DWN A;  5GCN A;  4BMH A;  4QC6 A;  3KAS A;  1IOI A;  2RFH A;  3R9F A;  3EO4 A;  3IC1 A;  5IV0 A;  1ZG8 A;  1KUV A;  2DEA A;  2HB6 A;  4C2X A;  1K4J A;  4ZGY B;  1DE4 C;  4E0A A;  3PBB A;  3L2N A;  1ZO0 A;  2Z3K A;  4LQG A;  3D7F A;  4PK3 A;  4CAE A;  2EWB A;  2OZG A;  5JQ4 A;  1ZG9 A;  4MFK A;  5LRG A;  2Q51 A;  3SHP A;  2EK9 A;  3NA6 A;  3GKR A;  4A2Z A;  2Z3O A;  3PRT A;  5D29 A;  3D2P A;  5EC4 A;  4P4B A;  4W9Y A;  2WUU A;  2REF A;  4AVA A;  4UFX A;  3WAB A;  2ZOG A;  4FWU A;  5K8M A;  4JYW A;  3TCV A;  4Y49 B;  4A33 A;  3EXN A;  2XEI A;  4JWP A;  4R57 A;  1CBX A;  2PJ8 A;  4J3G A;  4UIA A;  1XFO A;  2IL4 A;  5J1Q A;  4MFJ A;  4AVC A;  2PJ7 A;  2WYR A;  3DR6 A;  3I9S A;  5AGE A;  5HVG A;  1XE4 A;  2ZPA A;  1YVK A;  2PIZ A;  3R9G A;  4OAD A;  2WPW A;  2Z3M A;  4IHM A;  1XBU A;  2GIV A;  4CS0 B;  2IJZ A;  2P6G A;  4NGQ A;  4ZY2 A;  2CIJ A;  1JWQ A;  2BL1 A;  3KKW A;  4K30 A;  4ZY0 A;  5EMI A;  3JTK A;  2PC1 A;  4M6H A;  4CAW A;  5HVF A;  4YGO A;  4ZX8 A;  1VHO A;  2QEC A;  2ZEO A;  2RC4 A;  4G1P A;  2AFM A;  2FL4 A;  4XPK A;  5DWM A;  2PE3 A;  2OB0 A;  2PJ2 A;  4KUA A;  4HNY B;  5F48 A;  1R43 A;  4KS9 A;  4PK2 A;  5K8O A;  4P4F A;  5K8P A;  2REE A;  1P4N A;  5KTC A;  4QUS A;  5AG6 A;  3RZA A;  4XNH B;  4ONU A;  4XPL A;  2PRQ A;  1LAM A;  3EFA A;  4TWE A;  2A4N A;  4KVX A;  4MI4 A;  2FE7 A;  4KOY A;  2PIY A;  3PFE A;  4P4I A;  3R9E A;  5I4M A;  4HNX B;  3D8P A;  4KOS A;  2B3U A;  1Z8L A;  2Q7B A;  4AXV A;  4B10 A;  2YNE A;  2ZW6 A;  3UY5 A;  1KZF A;  1LAP A;  3QNV A;  4B5P B;  2JDC A;  4HNW B;  3NH8 A;  2DPT A;  4EVY A;  5JH9 A;  2GE3 A;  4LQ6 A;  3DR8 A;  3VH9 A;  5IB9 A;  4K3N A;  3WT4 A;  2FCK A;  3R96 A;  2OOT A;  1UWY A;  5D8N A;  4AB7 A;  4R3L A;  3WC7 A;  2D4O A;  3JRU A;  4QVT A;  5JPH A;  2O4H A;  2G0B A;  2PQ8 A;  2C27 A;  1R57 A;  4C7I A;  1R3N A;  4UIB A;  4H6U A;  4KLW A;  1X12 A;  1BO4 A;  3CXS A;  2JBK A;  1L0C A;  2Z10 A;  3KHZ A;  4UCM A;  2R8V A;  2AFX A;  2B4D B;  4RS2 A;  1PCA A;  3FJU A;  3FMC A;  3IEH A;  3S9N A;  2PJ5 A;  4UWI A;  1TIQ A;  4MFL A;  5H84 A;  3N5F A;  1IID A;  3R1K A;  3SJG A;  4NGS A;  3D68 A;  3FEE A;  3B35 A;  1AUG A;  3PB6 X;  2PJ9 A;  4I49 A;  5C82 A;  2WPX A;  4P4J A;  4UF4 A;  3VWD A;  3B3C A;  2PJA A;  4GM5 A;  1GYT A;  1Z2L A;  2YND A;  3NH5 A;  3IWG A;  3KR4 A;  3LAC A;  1U6M A;  2G9D A;  4ZI6 A;  3V7Z A;  4P44 A;  2D4P A;  1Y0R A;  5CPA A;  4R6T A;  2ZEG A;  2B3V A;  3CXQ A;  2YNC A;  4KSI A;  2VZY A;  4Z65 A;  4X8I A;  5A27 A;  4PXD A;  2H5M A;  2ZW7 A;  5KTA A;  1RO5 A;  1Z8X A;  4JD6 A;  3PB8 X;  4RI1 A;  3S6H A;  2Q0Y A;  4HPS A;  3PFO A;  3BI0 A;  3V8I A;  3PB7 X;  1S60 A;  1ZG7 A;  4MJ8 A;  4B6Z A;  1YLO A;  3ISX A;  4O23 A;  3RYO A;  2EO8 A;  3BHX A;  1EE3 P;  2FIA A;  3P2H A;  4L8A A;  1IGB A;  2PVV A;  2F8H A;  1IY7 A;  4GXH A;  5G21 A;  4NEX A;  5THW A;  1M4G A;  3WC5 A;  2DXQ A;  1OBR A;  1YRE A;  2BCO A; 
#chains in the Genus database with same CATH homology
 4E2A A;  2B5G B;  1UFH A;  4OLL A;  1B6B A;  3GY9 A;  4MFP A;  3FYN A;  4MY3 A;  3DSB A;  4CGO A;  2CXA A;  3EC4 A;  4B5O A;  2FT0 A;  3ZJ0 A;  4CYO A;  4JLY A;  3TO9 A;  3S6K A;  1CM0 A;  4KUB A;  4UCN A;  4UWJ A;  5G22 A;  3JVN A;  1FY7 A;  2Q4V A;  2X7B A;  4KSA A;  1I12 A;  4FD6 A;  2Q4Y A;  4C2Y A;  4IUS A;  3W6X A;  1Q2D A;  4CGL A;  3TT2 A;  3DNS A;  1IYL A;  3QB8 A;  3WR7 A;  2B4D A;  5IX3 A;  4M85 A;  4KVO E;  4CRY B;  5KTD A;  2ZW5 A;  3VWE A;  2J8R A;  5HH1 A;  3LOD A;  1CJW A;  1Y9K A;  4MY0 A;  2P0W A;  2JDD A;  1MK4 A;  2VEZ A;  1GHE A;  4KZT A;  2K5T A;  1Q2Y A;  4A30 A;  5A28 A;  3F8K A;  2EUI A;  1I21 A;  3PZJ A;  3PGP A;  2CY2 A;  4KOR A;  4FD5 A;  1S7N A;  1B87 A;  3EY5 A;  2VBQ A;  3FXT A;  4C2X A;  1XIX A;  4ZBG A;  3NE7 A;  1Y9W A;  4PV6 A;  2OZH A;  1RXT A;  4BBH A;  3JUW A;  4KOW A;  2Y0M A;  3DDD A;  4ORF A;  3OWC A;  5J8F A;  4MBU A;  4AG7 A;  3QAH A;  4B13 A;  2CNS A;  2VI7 A;  4JXQ A;  2FS5 A;  4CAX A;  3C26 A;  1M4I A;  4NCZ A;  2Z3L A;  1QSN A;  4R3K A;  1OZP A;  2P6E A;  4A31 A;  1KUY A;  2HUZ A;  1I1D A;  2YGW A;  1V0C A;  2QML A;  5FVJ A;  3TTH A;  3IU1 A;  3B8G A;  4AG9 A;  4F0Y A;  1S7L A;  5J8C A;  1J4J A;  3P2F A;  2OZU A;  3BJ7 A;  4CRZ B;  1WK4 A;  1M4D A;  2F5I A;  2OH1 A;  3BJ8 A;  4CAV A;  1MJ9 A;  4UFV A;  4PSW A;  2FXF A;  1YX0 A;  4UA3 A;  3H4Q A;  3F5B A;  3IU2 A;  4NF1 A;  1PU9 A;  4CYQ A;  4XPD B;  3D3S A;  3E0K A;  2BUE A;  4L89 A;  3TFY A;  4C2Z A;  3ZZI A;  1YVO A;  1IYK A;  4LUA A;  4JJX A;  3W6S A;  4B11 A;  4X5K A;  1S7K A;  4F0X A;  3TE4 A;  4FD7 A;  5E96 A;  5AG4 A;  2KCW A;  5CNP A;  1MJB A;  5H86 A;  3LD2 A;  2G3A A;  4R87 A;  2BSW A;  1S5K A;  4NSQ A;  4C68 A;  3G8W A;  4HKF A;  1QST A;  3TO7 A;  1S7F A;  2CNT A;  2Z3N A;  1Z9U A;  3D2M A;  4LX9 A;  2JLM A;  3GYA A;  2FSR A;  1ON0 A;  2VXK A;  4H6Z A;  3FIX A;  4QB9 A;  4B5P A;  4Y49 C;  4U9Y A;  2AJ6 A;  1NSL A;  3S6G A;  2J8N A;  4CGN A;  1WWZ A;  4CGP A;  5IB0 A;  4UBR A;  4CGM A;  1P0H A;  4Q36 A;  4KSF A;  2YNC C;  4KOX A;  3W91 A;  1VHS A;  5HMN A;  4U9Z A;  1QSO A;  2VZZ A;  4UCP A;  3MGD A;  3G3S A;  2ATR A;  2QIR A;  1XF8 A;  2P6F A;  2Q44 A;  2AE6 A;  4CYP A;  2ZXV A;  3I3G A;  5C88 A;  2ZW4 A;  2J8M A;  2HV2 A;  3PP9 A;  4XNH C;  4E8O A;  4MFZ A;  1BOB A;  3F0A A;  4KLV A;  3TOA A;  4YFJ A;  2PDO A;  3SXN A;  2ARH A;  4MFQ A;  1N71 A;  3FB3 A;  1Y7R A;  1Z4E A;  3CXP A;  3FNC A;  1NE9 A;  2O28 A;  2HQY A;  3FBU A;  2VQY A;  3T90 A;  2Z3P A;  4B14 A;  5AG5 A;  2JEV A;  2Z0Z A;  4JXR A;  4KVM E;  4A95 A;  4KOT A;  4B12 A;  3SXO A;  2B5G A;  2GAN A;  1KUX A;  2Z11 A;  2PRB A;  1MJA A;  4QBJ A;  5AG7 A;  1Q2C A;  1SQH A;  4F6A A;  4H89 A;  1XMT A;  1M1D A;  3TOB A;  2OU2 A;  5EBV A;  2B58 A;  4CYN A;  2NMT A;  4KOV A;  4UFW A;  2PR8 A;  4PSX A;  3S6F A;  4FD4 A;  4NXY A;  5F46 A;  3K9U A;  4Q38 A;  4XPD C;  2EVN A;  1PUA A;  4GS4 A;  2PR1 A;  1QSR A;  5G1Z A;  2WSA A;  5I0C A;  4AVB A;  3T9Y A;  4C7H A;  1YK3 A;  4II9 A;  1M44 A;  1YGH A;  4YRH A;  1YLE A;  2CNM A;  2BEI A;  3FRM A;  2DPS A;  5F47 A;  2FIW A;  3N7Z A;  1IIC A;  1S3Z A;  4DNC A;  3TO6 A;  5G20 A;  1NMT A;  4U5Y A;  4IF5 A;  3R95 A;  1XEB A;  4MHD A;  3IGR A;  4M3S A;  1Z4R A;  3BLN A;  5ISV A;  4CAF A;  2I79 A;  2R98 A;  5F49 A;  1LRZ A;  4R9M A;  2PSW A;  4A32 A;  2B4B A;  2G3T A;  1IB1 E;  3A9L A;  2R1I A;  2R7H A;  1QSM A;  2I00 A;  3H5Z A;  1VKC A;  4OAE A;  1YR0 A;  5GCN A;  2Q04 A;  3IWE A;  4KOU A;  5DWN A;  4BMH A;  4QC6 A;  3R9F A;  3EO4 A;  5IV0 A;  1KUV A;  1K4J A;  4ZGY B;  4E0A A;  1ZO0 A;  2Z3K A;  4PK3 A;  4CAE A;  2OZG A;  5JQ4 A;  4MFK A;  3SHP A;  4A2Z A;  3GKR A;  2Z3O A;  3D2P A;  5EC4 A;  2WUU A;  2REF A;  4AVA A;  4UFX A;  3TCV A;  4Y49 B;  4A33 A;  3EXN A;  4JWP A;  4R57 A;  4J3G A;  2IL4 A;  4MFJ A;  4AVC A;  3I9S A;  3DR6 A;  5AGE A;  1XE4 A;  2ZPA A;  1YVK A;  3R9G A;  4OAD A;  2WPW A;  2Z3M A;  2GIV A;  4CS0 B;  2P6G A;  4K30 A;  2BL1 A;  3KKW A;  3JTK A;  2PC1 A;  4CAW A;  4YGO A;  2QEC A;  2RC4 A;  2FL4 A;  4XPK A;  5DWM A;  2OB0 A;  4KUA A;  4HNY B;  5F48 A;  4KS9 A;  4PK2 A;  2REE A;  1P4N A;  5KTC A;  4QUS A;  5AG6 A;  4XNH B;  4ONU A;  4XPL A;  3EFA A;  2A4N A;  4KVX A;  4MI4 A;  2FE7 A;  4KOY A;  3R9E A;  4HNX B;  3D8P A;  4KOS A;  2B3U A;  2Q7B A;  4B10 A;  2YNE A;  2ZW6 A;  3UY5 A;  1KZF A;  4B5P B;  2JDC A;  4HNW B;  2DPT A;  4EVY A;  2GE3 A;  3DR8 A;  2FCK A;  3R96 A;  4AB7 A;  4R3L A;  2D4O A;  4QVT A;  5JPH A;  2G0B A;  2PQ8 A;  2C27 A;  1R57 A;  4C7I A;  4H6U A;  4KLW A;  1BO4 A;  3CXS A;  1L0C A;  2Z10 A;  4UCM A;  2R8V A;  2B4D B;  4RS2 A;  4UWI A;  1TIQ A;  4MFL A;  5H84 A;  1IID A;  3R1K A;  5C82 A;  4I49 A;  2WPX A;  3VWD A;  2YND A;  3IWG A;  1U6M A;  2D4P A;  2B3V A;  3CXQ A;  2YNC A;  2VZY A;  5A27 A;  2H5M A;  2ZW7 A;  5KTA A;  1RO5 A;  4JD6 A;  4RI1 A;  3S6H A;  2Q0Y A;  3V8I A;  1S60 A;  4MJ8 A;  3RYO A;  3P2H A;  2FIA A;  4L8A A;  5G21 A;  4NEX A;  1M4G A;  2DXQ A;  1YRE A;  5BWA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...