3G8WA

Crystal structure of a probable acetyltransferase from staphylococcus epidermidis atcc 12228
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
162
structure length
162
Chain Sequence
MNNIRLLNQNDLDSYIELMKFGHHNYEWDRYYLENVSIDRLKTILSNHTDYWNIFGAFEDDELVATCTLKQMNYVGKCHKAILENNFVKNNDEIVNRELINHIIQYAKEQNIETLMIAIASNNISAKVFFSSIGFENLAFEKNASKIGNEYFDENWLIYSTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a probable acetyltransferase from Staphylococcus epidermidis ATCC 12228.
rcsb
source organism Staphylococcus epidermidis atcc 12228
molecule tags Transferase
molecule keywords Lactococcal prophage ps3 protein 05
total genus 45
structure length 162
sequence length 162
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3g8wA00
4QB9A 1XMTA 3TOBA 3VWDA 4L89A 2Z10A 5FVJA 1XIXA 4BMHA 3S6FA 4CAVA 2B58A 4PV6A 2VZYA 3FIXA 3TE4A 4YGOA 3TO6A 4NXYA 4JXQA 4AG9A 1S7FA 4ONUA 4LX9A 5GCNA 4M3SA 2B5GB 2I79A 1M1DA 3LODA 1SQHA 4KLVA 1PUAA 2D4PA 2VQYA 4KOYA 1L0CA 2O28A 1IIDA 4R9MA 5H86A 1IYKA 3TO9A 2B4DB 3PP9A 2PDOA 4KOWA 5F48A 2ZPAA 1XF8A 5I0CA 2QIRA 1Y7RA 3IGRA 3IWGA 4CS0B 4MHDA 2VI7A 3FNCA 4FD6A 2BL1A 5J8FA 5J8CA 1BOBA 1YVOA 4KVME 4UWIA 2JLMA 2FE7A 3T90A 4KOVA 2QMLA 2FT0A 1YREA 1NSLA 3WR7A 3GKRA 4E0AA 4NCZA 2CNSA 2B4BA 1CM0A 2FIWA 3EC4A 2FCKA 2J8MA 1V0CA 2BUEA 4HNXB 1U6MA 4U5YA 2ARHA 1MJ9A 2OH1A 1UFHA 1S7LA 2KCWA 3F5BA 4KUBA 4K30A 1VKCA 1M4IA 4UA3A 4JXRA 1M4DA 1YK3A 3DDDA 1KUVA 3DSBA 1QSOA 4KUAA 2OU2A 4CAWA 5E96A 2D4OA 4XPLA 4MI4A 5JQ4A 4KOXA 2RC4A 3TO7A 4OAEA 4PK3A 2P0WA 1QSTA 3FBUA 2QECA 4R57A 3BLNA 3S6KA 3B8GA 4CRYB 3I9SA 4QUSA 4XNHB 4KOTA 4ZBGA 5DWMA 2BSWA 2VXKA 4AB7A 2WPXA 3NE7A 4PSXA 4HNWB 4H6ZA 5JPHA 4B5PA 1YVKA 3TTHA 3R95A 3R1KA 2FSRA 5KTDA 4AVBA 2P6FA 2PQ8A 2FXFA 2B3UA 4GS4A 3D2PA 2Z11A 4H89A 2PR1A 1M4GA 4M85A 4RI1A 1KZFA 1R57A 2PRBA 3CXSA 2G3TA 2PR8A 5IV0A 4OADA 2DXQA 4KOSA 5KTCA 1Y9WA 3KKWA 3TT2A 1ON0A 2B4DA 4PK2A 2K5TA 2CY2A 2P6GA 1RXTA 1MJBA 4YRHA 2JEVA 5HMNA 3D2MA 3T9YA 2IL4A 1Z9UA 4RS2A 4EVYA 3SXOA 4U9ZA 2Q4YA 3H4QA 4MBUA 5EBVA 3UY5A 3R9EA 1N71A 2JDCA 1CJWA 1KUXA 2R98A 4JWPA 4JD6A 3S6GA 2EUIA 2GIVA 3PZJA 4KLWA 2Q0YA 1S7KA 2AE6A 3FRMA 4XPKA 1K4JA 4KVXA 2B3VA 2AJ6A 2Y0MA 1LRZA 1P4NA 1QSNA 2F5IA 5C88A 4QC6A 3OWCA 4FD7A 3EY5A 4KORA 4F0YA 2Q04A 3EO4A 5F46A 3VWEA 1Q2YA 4I49A 3DNSA 2OB0A 1BO4A 4JJXA 2VEZA 4KZTA 4CRZB 1RO5A 3V8IA 2Q4VA 1Y9KA 3DR6A 3D3SA 4XPDC 3TCVA 4L8AA 4B5OA 2P6EA 3LD2A 4NEXA 3TFYA 3SHPA 1IB1E 3E0KA 2ZW4A 4KVOE 5KTAA 1YLEA 1I12A 4AVAA 3W91A 3ZZIA 3RYOA 2VZZA 2R7HA 3FB3A 2X7BA 1M44A 2PC1A 2ZW7A 5H84A 4QVTA 4FD4A 2FIAA 3G3SA 1KUYA 1MK4A 1S3ZA 1NE9A 4FD5A 2CNMA 2H5MA 1QSRA 2JDDA 1VHSA 1YX0A 3W6SA 2FL4A 1WK4A 2OZGA 2GANA 2J8NA 4UWJA 4ORFA 3FYNA 4HNYB 4Y49C 4Y49B 2WPWA 4R87A 1XEBA 4NF1A 1PU9A 1IICA 1YGHA 3I3GA 2C27A 3S6HA 1I21A 2VBQA 1S7NA 5C82A 4JLYA 3CXPA 3R9GA 1WWZA 2HUZA 2HV2A 2J8RA 4R3LA 4NSQA 2Q44A 1Q2CA 2G3AA 2REFA 1J4JA 4MY0A 2OZUA 2FS5A 4OLLA 4U9YA 5IB0A 3F8KA 1I1DA 2CNTA 4XPDB 2ZW6A 1Q2DA 4AVCA 3PGPA 1MJAA 4E8OA 3R9FA 5EC4A 3SXNA 2I00A 3MGDA 3EFAA 2ZW5A 2HQYA 4II9A 2ZXVA 1NMTA 1Z4EA 1B6BA 4HKFA 5CNPA 2NMTA 3ZJ0A 2R1IA 3N7ZA 2BEIA 4XNHC 4PSWA 3QB8A 1S60A 1B87A 5ISVA 3W6XA 2B5GA 5F47A 4UBRA 3CXQA 1YR0A 4MY3A 1QSMA 2EVNA 4AG7A 3D8PA 1GHEA 2REEA 4J3GA 4B5PB 2GE3A 3GY9A 2G0BA 2OZHA 4R3KA 4DNCA 4YFJA 4QBJA 4MJ8A 3QAHA 5IX3A 2PSWA 1OZPA 4IF5A 4H6UA 3K9UA 1XE4A 3G8WA 3TOAA 4CAXA 3JUWA 3F0AA 4X5KA 1S5KA 4F6AA 5DWNA 3BJ8A 3BJ7A 1IYLA 2Q7BA 3P2FA 2ATRA 2A4NA 3DR8A 3FXTA 5HH1A 4LUAA 1TIQA 3JVNA 1FY7A 2Z0ZA 1Z4RA 3R96A 3EXNA 3C26A 1P0HA 2R8VA 3P2HA 4KOUA 3GYAA 4IUSA 5F49A 4E2AA
chains in the Genus database with same CATH superfamily
4QB9A 4NGTA 1XMTA 3TOBA 4A30A 2ZOFA 3VWDA 4L89A 2O4HA 2Z10A 5FVJA 4M6IA 1XIXA 2J9AA 3S6FA 4BMHA 2B58A 4PV6A 4CAVA 3S9LA 2VZYA 4K30A 4WJBA 4ZGYB 1R3NA 4UFXA 3FIXA 2GLFA 3NH4A 5G21A 5LYFA 4CGLA 3TE4A 4YGOA 3TO6A 4NXYA 2QYVA 4JXQA 3WABA 4AG9A 1S7FA 4ONUA 4LX9A 1CG2A 1CP7A 5GCNA 2WSAA 4M3SA 2B5GB 2I79A 3KHZA 1M1DA 4H2KA 4P44A 4CGMA 3LODA 4B14A 3IO1A 1SQHA 4KLVA 4A38A 5HVGA 1YSJA 2C6CA 4CGPA 4A32A 1PUAA 2D4PA 2VQYA 4KOYA 1L0CA 3LWUA 1ZO0A 4A31A 2QVPA 2PRQA 2O28A 4ZY1A 1IIDA 2YNEA 4R9MA 4FUUA 5H86A 1IYKA 3TO9A 2PJ3A 4A2ZA 2B4DB 3PFOA 3PP9A 3JTKA 5G20A 2PDOA 4KOWA 5A27A 5F48A 4MFKA 2ZPAA 3V38A 1TKJA 1XF8A 3D4UA 4F8ZA 3QAYA 1BLLE 2ZELA 5I0CA 3NH8A 2F8HA 2QIRA 4B12A 1Y7RA 3RAMA 3IGRA 5F09A 2DEAA 2NSMA 3QNVA 3IWGA 2ZEPA 4CS0B 2PJ0A 5I4MA 5G22A 4MHDA 3BXMA 4PXCA 2VI7A 3MRUA 3FNCA 1ZLHA 3HUVA 4P4BA 4FD6A 3SI0A 2BL1A 2XEGA 2YGWA 5J8FA 5J8CA 3B3SA 2HC9A 1BOBA 1YVOA 4KVME 4UWIA 2JLMA 5BWAB 2FE7A 5AGEA 4PXBA 4P10A 4R8FA 3T90A 2AFMA 2RB7A 3NA6A 4KSFA 5LYDA 3WT4A 2Q7SA 2WZNA 4A37A 1F57A 4KOVA 3IWWA 2QMLA 4MHZA 4UEZA 3RBUA 2FT0A 1YREA 1NSLA 4UIAA 3WR7A 4FWUA 4PQAA 5AG7A 3GKRA 4BINA 4E0AA 4YU9A 3LMSA 4NCZA 4OKOA 5JGFA 4OIDA 2CNSA 2AFXA 2B4BA 1CM0A 2FIWA 2ZOGA 3D7FA 3EC4A 2FCKA 2J8MA 1V0CA 1VHOA 1YQEA 3RO0A 2PCUA 2BUEA 4HNXB 2OOTA 1U6MA 2PIYA 4U5YA 2ARHA 4C68A 1AUGA 2C6PA 5EMIA 3NH5A 1MJ9A 2OH1A 5G1ZA 4A39A 1UFHA 3CDXA 1S7LA 2KCWA 3F5BA 4KUBA 1M4IA 2FVGA 1M4DA 1VKCA 1YK3A 2V8DA 2XEJA 3DDDA 1KUVA 4JXRA 3DSBA 4UA3A 3SI2A 2ZEOA 1ELMP 1QSOA 4KUAA 1LAPA 2GFQA 5HVHA 2DF5A 2OU2A 3D7DA 3PBBA 4CAWA 3FX6A 2WYRA 3I1UA 4C7HA 5E96A 2D4OA 4B6ZA 4XPLA 4MI4A 4IAVA 5JQ4A 2RC4A 3CPAA 4KOXA 1X12A 4OC4A 2GREA 2Z3NA 3TO7A 4OAEA 4PK3A 2P0WA 1QSTA 3FBUA 2ZEFA 5JH9A 2QECA 4R57A 3FJUA 3SJGA 3BLNA 3PRTA 7CPAA 3PFEA 3B8GA 3S6KA 4CRYB 4CGOA 1IOFA 3I9SA 4LQGA 4QUSA 4MFJA 4OC2A 4XNHB 2PJCA 5K8MA 5K8NA 4KOTA 4ZBGA 4NJRA 5DWMA 2Z3LA 2BSWA 2VXKA 2BOAA 3FEEA 5LRJA 4AB7A 2WPXA 3NE7A 4PSXA 1FNOA 4HNWB 2BCOA 1YLOA 4MFZA 3DGVA 4H6ZA 5JPHA 3WC6A 1YVKA 3TTHA 2DPSA 3R1KA 4GM5A 5ELYA 4KS9A 2FSRA 3R95A 2PJ4A 1DTDA 4R7MA 5KTDA 4AVBA 3BI0A 2P6FA 2ZEMA 2PJ9A 2PQ8A 2FXFA 4MCSA 3MN8A 5HVFA 1AMPA 2B3UA 4GS4A 3D2PA 2Z11A 4H89A 2PR1A 2V8GA 1M4GA 4M85A 4RI1A 1XRYA 1KZFA 1R57A 2PRBA 3IC1A 4MFQA 4CPAA 3CXSA 2G3TA 2PR8A 3PB9X 4MHYA 3FF3A 4MXUA 1XJOA 4M6HA 5IV0A 1PCAA 4OP4A 1ZG8A 4OADA 1QMUA 4OIWA 3NFZA 2DXQA 1Z8XA 4KOSA 4R76A 5AG4A 5KTCA 4P6YA 4UF4A 4UIBA 3VATA 1X10A 1Y9WA 3KKWA 3FEDA 3KHXA 4NGQA 1ON0A 4P4EA 1ZG7A 3TT2A 2B4DA 4PK2A 5AG6A 2K5TA 3K9TA 2CY2A 2P6GA 3KQXA 3PBEA 1RXTA 2CXAA 3IJ3A 1LAMA 1MJBA 4OMEA 4YRHA 1VHEA 2JEVA 5HMNA 3D2MA 3B3WA 3T9YA 2IL4A 3B7IA 1Z9UA 4RS2A 4X3RA 4EVYA 4UFWA 3SXOA 4U9ZA 2Q4YA 1YW6A 3H4QA 1HEEA 4MBUA 1CPXA 4MHNA 5EBVA 2O53A 3UY5A 2ZEEA 1TKHA 3H8FA 3R9EA 1LANA 1Z8LA 1N71A 3GB0A 1VGYA 1CJWA 1KUXA 2JDCA 4JYWA 2R98A 4UEEA 2EK9A 1JWQA 2IQ6A 4JWPA 2YNCC 3L2NA 4JD6A 2Q43A 3WC7A 3S6GA 2EUIA 2PJ5A 4X8IA 2GIVA 2IJZA 3B3TA 3PZJA 4KLWA 2Q0YA 2EO8A 4KSAA 2V77A 4MFPA 1S7KA 2AE6A 3FRMA 1ZLIA 2PIZA 1K4JA 4XPKA 4KVXA 5D29A 2B3VA 2AJ6A 2ODFA 2Y0MA 2ZENA 3TC8A 2ZEDA 2F5IA 1LRZA 1P4NA 1QSNA 5C88A 2Q4ZA 4QC6A 3OWCA 4A94A 4FD7A 2AFWA 3EY5A 1TF9A 3PB4X 4NGNA 4P45A 4KORA 2PJ6A 4YWYA 3PEIA 4F0YA 4CYOA 1IU8A 2Q04A 3EO4A 4ZX8A 4CAEA 5F46A 3FH4A 1OBRA 1Z8TA 3VH9A 1CX8A 4NFRA 3GUXA 3VWEA 3T8WA 1ARLA 3H8EA 1Q2YA 4NGSA 4I49A 2NYQA 1F2OA 3A9LA 4F9UA 1LFWA 3JRUA 3CZXA 4AXVA 3DNSA 2OB0A 1BO4A 2PJ1A 3TX8A 4JJXA 2AFUA 2VEZA 4KZTA 3VARA 4B13A 2POKA 3KQZA 3N5FA 5DS0A 1RO5A 1F2PA 4CRZB 3V8IA 2Q4VA 1Y9KA 3DR6A 2EK8A 3D3SA 4XPDC 4MHPA 2IMOA 3TCVA 1LOKA 3D66A 4L8AA 4CYPA 4P4DA 4B5OA 4FBEA 2P6EA 5K8PA 1YMEA 4RUHA 4W9YA 2EBJA 3IIBA 3LD2A 4NEXA 3TFYA 4NGMA 3H5ZA 3SHPA 1IB1E 3E0KA 4Q36A 4O23A 2ZW4A 1HDQA 4KVOE 3SJXA 2JBJA 4HPSA 5KTAA 3RZAA 1YLEA 1I12A 2PJBA 4P4JA 3W91A 3ZZIA 2XEIA 4UCMA 3RYOA 4AVAA 2VZZA 2PE3A 3B3CA 2R7HA 2ZEHA 3FB3A 3SJEA 2X7BA 1M44A 2PC1A 2OR4A 2ZW7A 1Q7LA 5H84A 4QVTA 1CBXA 4FD4A 3KL9A 4MRIA 4Q38A 1VIXA 2DPTA 2FIAA 3G3SA 2BO9A 2Z3KA 4KSIA 5AG5A 2JEWA 2HB6A 1KUYA 1MK4A 1S3ZA 1NE9A 2AFSA 2ABZA 4FD5A 5IB9A 1YW4A 2CNMA 2H5MA 1QSRA 2JDDA 1VHSA 1YX0A 3W6SA 1KWMA 3DLJA 3K2KA 3BI1A 4Z65A 4MCQA 4ZY0A 2FL4A 1WK4A 2OZGA 2GANA 2J8NA 4UWJA 3FYNA 4ORFA 1IGBA 2AFOA 4HNYB 4Y49C 4Y49B 4EWTA 2WPWA 4R87A 1XEBA 4C2YA 4NF1A 1PU9A 2YNDA 4MCPA 3SJFA 1NSAA 4B10A 4UCPA 1IOIA 1IICA 1YGHA 2C6GA 4JZ0A 3IU2A 1A2ZA 1FT7A 1Y7EA 3I3GA 3ISXA 2C27A 1PYTB 2PJ8A 2V8HA 5LYIA 1Z2LA 3S6HA 4PPZA 2JBKA 4A95A 4TWEA 1I21A 2VBQA 4DUKA 3WC5A 1S7NA 3B2YA 3CPXA 1M4LA 5C82A 4PXDA 4JLYA 3CXPA 3R9GA 1WWZA 1CP6A 3GLJA 4UCNA 2HUZA 2HV2A 2J8RA 4GXHA 4NJQA 4P4FA 2Q51A 1UWYA 4R3LA 4NSQA 4TNUA 1GYTA 1BPMA 1R43A 3IU1A 1XBUA 2AFZA 2Q44A 1Q2CA 2G3AA 2REFA 5A28A 2VL1A 2CTCA 3BHXA 1J4JA 4MY0A 2OZUA 2CIJA 1LCPA 2FS5A 2CF4A 3D67A 3KASA 4OLLA 5LRGA 4U9YA 3IWEA 5IB0A 3PB8X 1ELLP 1EE3P 2PJ7A 2Z3PA 3F8KA 4UFVA 5LYLA 1I1DA 2CNTA 4XPDB 5THWA 4BD9A 1TF8A 4ZI6A 4X2TA 1Z8WA 2ZW6A 1Q2DA 3IFEA 4AVCA 1XMBA 4NGPA 4C2XA 2PJ2A 1MJAA 3PGPA 1Y0YA 3R9FA 5EC4A 4E8OA 3SXNA 2I00A 3MGDA 4C7IA 1DE4C 4M6GA 4FAIA 4MCRA 3EFAA 3H8GA 2Z3OA 4ZX9A 2ZW5A 4CYNA 2HQYA 4II9A 2ZXVA 1NMTA 1Z4EA 1CPSA 1RTQA 1B6BA 3FMCA 4HKFA 5CNPA 2NMTA 3S9NA 3ZJ0A 3GIUA 2R1IA 3CT9A 3N7ZA 4NGRA 1ARMA 2BEIA 4OC5A 3NE8A 4XNHC 1XOVA 1BPNA 3LACA 4IHMA 4OC0A 4DYOA 4PSWA 2GLJA 2RFHA 4A33A 3QB8A 1HDUA 5CBMA 1S60A 1B87A 2G9DA 4OC1A 5K8OA 5ISVA 3W6XA 2B5GA 5F47A 6CPAA 4UBRA 5J1QA 3CXQA 4DJLA 3V7ZA 1YR0A 4MY3A 2EWBA 1QSMA 2PVWA 4F0XA 4CAFA 2EVNA 3RNZA 4B5PA 4AG7A 1QQ9A 1IY7A 3D8PA 1GHEA 2REEA 3IEHA 1H8LA 1BAVA 4J3GA 4B5PB 2GE3A 2YNCA 3GY9A 2G0BA 1ZG9A 2OZHA 1Z5RA 2PVVA 4R3KA 4B11A 3KZWA 4C2ZA 4DNCA 3KI9A 5D8NA 4YFJA 4QBJA 4F9VA 4MJ8A 3QAHA 5IX3A 2PSWA 3ISZA 2Z3MA 1OZPA 3FVLA 3D7GA 4H6UA 4IF5A 3K9UA 2GU2A 8CPAA 4ZY2A 1XE4A 3B3VA 2I3CA 3G8WA 1AYEA 3TOAA 4CAXA 3JUWA 4CGNA 3F0AA 5HXDA 5LRKA 4Q7AA 4X5KA 1S5KA 4F6AA 5DWNA 3BJ8A 4CYQA 3B35A 4EFDA 4ZYQA 3BJ7A 1IYLA 1TKFA 2Q7BA 3P2FA 2ATRA 3KR4A 4OC3A 3D7HA 4UEFA 3FECA 2A4NA 3PB7X 4MMOA 4EMEA 4ONWA 4K3NA 3DR8A 2XEFA 2V8VA 3FXTA 4PXEA 5HH1A 4BBHA 4LUAA 1TIQA 1TXRA 2ANPA 3JVNA 2CTBA 4RN7A 1FY7A 2Z0ZA 3KR5A 4WWVA 1Z4RA 3R96A 3S9MA 3EXNA 3SI1A 3C26A 5CPAA 1P0HA 2R8VA 2WUUA 2ZEGA 1JQGA 3PB6X 4LQ6A 3P2HA 4KOUA 3D68A 5JM6A 4P4IA 2F7VA 3GYAA 4IUSA 4G1PA 1XFOA 4IK2A 3HLPA 5F49A 2C1CA 1Y0RA 4MFLA 2PJAA 4R6TA 4E2AA 2QJ8A 3KGQA
chains in the Genus database with same CATH topology
4QB9A 1XMTA 3TOBA 4A30A 3VWDA 4L89A 2Z10A 5FVJA 1XIXA 4BMHA 3S6FA 4CAVA 2B58A 4PV6A 2VZYA 4ZGYB 4UFXA 3FIXA 5G21A 4CGLA 3TE4A 4YGOA 3TO6A 4NXYA 4JXQA 4AG9A 1S7FA 4ONUA 4LX9A 5GCNA 2WSAA 4M3SA 2B5GB 2I79A 1M1DA 4CGMA 3LODA 4B14A 1SQHA 4KLVA 4CGPA 4A32A 1PUAA 2D4PA 2VQYA 4KOYA 1L0CA 4A31A 1ZO0A 2O28A 1IIDA 2YNEA 4R9MA 5H86A 1IYKA 3TO9A 4A2ZA 2B4DB 3PP9A 3JTKA 5G20A 2PDOA 4KOWA 5A27A 5F48A 4MFKA 2ZPAA 1XF8A 5I0CA 2QIRA 4B12A 1Y7RA 3IGRA 3IWGA 4CS0B 5G22A 4MHDA 2VI7A 3FNCA 4FD6A 2BL1A 2YGWA 5J8FA 5J8CA 1BOBA 1YVOA 4KVME 4UWIA 2JLMA 5BWAB 2FE7A 5AGEA 3T90A 4KSFA 4KOVA 2QMLA 2FT0A 1YREA 1NSLA 3WR7A 5AG7A 3GKRA 4E0AA 4NCZA 2CNSA 2B4BA 1CM0A 2FIWA 3EC4A 2FCKA 2J8MA 1V0CA 2BUEA 4HNXB 1U6MA 4U5YA 2ARHA 4C68A 1MJ9A 2OH1A 5G1ZA 1UFHA 1S7LA 2KCWA 3F5BA 4KUBA 4K30A 1VKCA 1M4IA 1M4DA 3DDDA 4JXRA 1YK3A 4UA3A 1KUVA 3DSBA 1QSOA 4KUAA 2OU2A 4CAWA 4C7HA 5E96A 2D4OA 4XPLA 4MI4A 5JQ4A 4KOXA 2RC4A 2Z3NA 3TO7A 4OAEA 4PK3A 2P0WA 1QSTA 3FBUA 2QECA 4R57A 3BLNA 3S6KA 3B8GA 4CRYB 4CGOA 3I9SA 4QUSA 4MFJA 4XNHB 4KOTA 4ZBGA 5DWMA 2Z3LA 2BSWA 2VXKA 4AB7A 2WPXA 3NE7A 4PSXA 4HNWB 4MFZA 4H6ZA 5JPHA 4B5PA 1YVKA 3TTHA 2DPSA 3R1KA 3R95A 4KS9A 2FSRA 5KTDA 4AVBA 2P6FA 2PQ8A 2FXFA 2B3UA 4GS4A 3D2PA 2Z11A 4H89A 2PR1A 1M4GA 4M85A 4RI1A 1KZFA 1R57A 4MFQA 2PRBA 3CXSA 2G3TA 2PR8A 5IV0A 4OADA 2DXQA 4KOSA 5AG4A 5KTCA 1Y9WA 3KKWA 3TT2A 1ON0A 2B4DA 4PK2A 5AG6A 2K5TA 2CY2A 2P6GA 1RXTA 2CXAA 1MJBA 4YRHA 2JEVA 5HMNA 3D2MA 3T9YA 2IL4A 1Z9UA 4RS2A 4EVYA 4UFWA 3SXOA 4U9ZA 2Q4YA 3H4QA 4MBUA 5EBVA 3UY5A 3R9EA 1N71A 2JDCA 1CJWA 1KUXA 2R98A 4JWPA 2YNCC 4JD6A 3S6GA 2EUIA 2GIVA 3PZJA 4KLWA 2Q0YA 4KSAA 4MFPA 1S7KA 2AE6A 3FRMA 4XPKA 1K4JA 4KVXA 2B3VA 2AJ6A 2Y0MA 1LRZA 1P4NA 1QSNA 2F5IA 5C88A 4QC6A 3OWCA 4FD7A 3EY5A 4KORA 4F0YA 4CYOA 2Q04A 3EO4A 5F46A 4CAEA 3VWEA 1Q2YA 4I49A 3A9LA 3DNSA 2OB0A 1BO4A 4JJXA 2VEZA 4KZTA 4B13A 4CRZB 1RO5A 3V8IA 2Q4VA 1Y9KA 3DR6A 3D3SA 4XPDC 3TCVA 4L8AA 4CYPA 4B5OA 2P6EA 3LD2A 4NEXA 3TFYA 3H5ZA 3SHPA 1IB1E 3E0KA 4Q36A 2ZW4A 4KVOE 5KTAA 1YLEA 1I12A 4AVAA 3W91A 3ZZIA 4UCMA 3RYOA 2VZZA 2R7HA 3FB3A 2X7BA 1M44A 2PC1A 2ZW7A 5H84A 4QVTA 4FD4A 4Q38A 2DPTA 2FIAA 3G3SA 2Z3KA 5AG5A 1KUYA 1MK4A 1S3ZA 1NE9A 4FD5A 2CNMA 2H5MA 1QSRA 2JDDA 1VHSA 1YX0A 3W6SA 2FL4A 1WK4A 2OZGA 2GANA 2J8NA 4UWJA 3FYNA 4ORFA 4HNYB 4Y49C 4Y49B 2WPWA 4R87A 1XEBA 4C2YA 4NF1A 1PU9A 2YNDA 4B10A 4UCPA 1IICA 1YGHA 3IU2A 3I3GA 2C27A 3S6HA 4A95A 1I21A 2VBQA 1S7NA 5C82A 4JLYA 3CXPA 3R9GA 1WWZA 4UCNA 2HUZA 2HV2A 2J8RA 4R3LA 4NSQA 3IU1A 2Q44A 1Q2CA 2G3AA 2REFA 5A28A 1J4JA 4MY0A 2OZUA 2FS5A 4OLLA 4U9YA 3IWEA 5IB0A 2Z3PA 3F8KA 4UFVA 1I1DA 2CNTA 4XPDB 2ZW6A 1Q2DA 4AVCA 4C2XA 3PGPA 1MJAA 4E8OA 3R9FA 5EC4A 3SXNA 2I00A 3MGDA 4C7IA 3EFAA 2Z3OA 2ZW5A 4CYNA 2HQYA 4II9A 2ZXVA 1NMTA 1Z4EA 1B6BA 4HKFA 5CNPA 2NMTA 3ZJ0A 2R1IA 3N7ZA 2BEIA 4XNHC 4PSWA 4A33A 3QB8A 1S60A 1B87A 5ISVA 3W6XA 2B5GA 5F47A 4UBRA 3CXQA 1YR0A 4MY3A 1QSMA 4F0XA 4CAFA 2EVNA 4AG7A 3D8PA 1GHEA 2REEA 4J3GA 4B5PB 2GE3A 2YNCA 3GY9A 2G0BA 2OZHA 4R3KA 4B11A 4C2ZA 4DNCA 4YFJA 4QBJA 4MJ8A 3QAHA 5IX3A 2PSWA 2Z3MA 1OZPA 4IF5A 4H6UA 3K9UA 1XE4A 3G8WA 3TOAA 4CAXA 3JUWA 4CGNA 3F0AA 4X5KA 1S5KA 4F6AA 5DWNA 3BJ8A 4CYQA 3BJ7A 1IYLA 2Q7BA 3P2FA 2ATRA 2A4NA 3DR8A 3FXTA 5HH1A 4BBHA 4LUAA 1TIQA 3JVNA 1FY7A 2Z0ZA 1Z4RA 3R96A 3EXNA 3C26A 1P0HA 2R8VA 2WUUA 3P2HA 4KOUA 3GYAA 4IUSA 5F49A 4MFLA 4E2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QB9 A;  1XMT A;  3TOB A;  3VWD A;  4L89 A;  2Z10 A;  5FVJ A;  1XIX A;  4BMH A;  3S6F A;  4CAV A;  2B58 A;  4PV6 A;  2VZY A;  3FIX A;  3TE4 A;  4YGO A;  3TO6 A;  4NXY A;  4JXQ A;  4AG9 A;  1S7F A;  4ONU A;  4LX9 A;  5GCN A;  4M3S A;  2B5G B;  2I79 A;  1M1D A;  3LOD A;  1SQH A;  4KLV A;  1PUA A;  2D4P A;  2VQY A;  4KOY A;  1L0C A;  2O28 A;  1IID A;  4R9M A;  5H86 A;  1IYK A;  3TO9 A;  2B4D B;  3PP9 A;  2PDO A;  4KOW A;  5F48 A;  2ZPA A;  1XF8 A;  5I0C A;  2QIR A;  1Y7R A;  3IGR A;  3IWG A;  4CS0 B;  4MHD A;  2VI7 A;  3FNC A;  4FD6 A;  2BL1 A;  5J8F A;  5J8C A;  1BOB A;  1YVO A;  4KVM E;  4UWI A;  2JLM A;  2FE7 A;  3T90 A;  4KOV A;  2QML A;  2FT0 A;  1YRE A;  1NSL A;  3WR7 A;  3GKR A;  4E0A A;  4NCZ A;  2CNS A;  2B4B A;  1CM0 A;  2FIW A;  3EC4 A;  2FCK A;  2J8M A;  1V0C A;  2BUE A;  4HNX B;  1U6M A;  4U5Y A;  2ARH A;  1MJ9 A;  2OH1 A;  1UFH A;  1S7L A;  2KCW A;  3F5B A;  4KUB A;  4K30 A;  1VKC A;  1M4I A;  4UA3 A;  4JXR A;  1M4D A;  1YK3 A;  3DDD A;  1KUV A;  3DSB A;  1QSO A;  4KUA A;  2OU2 A;  4CAW A;  5E96 A;  2D4O A;  4XPL A;  4MI4 A;  5JQ4 A;  4KOX A;  2RC4 A;  3TO7 A;  4OAE A;  4PK3 A;  2P0W A;  1QST A;  3FBU A;  2QEC A;  4R57 A;  3BLN A;  3S6K A;  3B8G A;  4CRY B;  3I9S A;  4QUS A;  4XNH B;  4KOT A;  4ZBG A;  5DWM A;  2BSW A;  2VXK A;  4AB7 A;  2WPX A;  3NE7 A;  4PSX A;  4HNW B;  4H6Z A;  5JPH A;  4B5P A;  1YVK A;  3TTH A;  3R95 A;  3R1K A;  2FSR A;  5KTD A;  4AVB A;  2P6F A;  2PQ8 A;  2FXF A;  2B3U A;  4GS4 A;  3D2P A;  2Z11 A;  4H89 A;  2PR1 A;  1M4G A;  4M85 A;  4RI1 A;  1KZF A;  1R57 A;  2PRB A;  3CXS A;  2G3T A;  2PR8 A;  5IV0 A;  4OAD A;  2DXQ A;  4KOS A;  5KTC A;  1Y9W A;  3KKW A;  3TT2 A;  1ON0 A;  2B4D A;  4PK2 A;  2K5T A;  2CY2 A;  2P6G A;  1RXT A;  1MJB A;  4YRH A;  2JEV A;  5HMN A;  3D2M A;  3T9Y A;  2IL4 A;  1Z9U A;  4RS2 A;  4EVY A;  3SXO A;  4U9Z A;  2Q4Y A;  3H4Q A;  4MBU A;  5EBV A;  3UY5 A;  3R9E A;  1N71 A;  2JDC A;  1CJW A;  1KUX A;  2R98 A;  4JWP A;  4JD6 A;  3S6G A;  2EUI A;  2GIV A;  3PZJ A;  4KLW A;  2Q0Y A;  1S7K A;  2AE6 A;  3FRM A;  4XPK A;  1K4J A;  4KVX A;  2B3V A;  2AJ6 A;  2Y0M A;  1LRZ A;  1P4N A;  1QSN A;  2F5I A;  5C88 A;  4QC6 A;  3OWC A;  4FD7 A;  3EY5 A;  4KOR A;  4F0Y A;  2Q04 A;  3EO4 A;  5F46 A;  3VWE A;  1Q2Y A;  4I49 A;  3DNS A;  2OB0 A;  1BO4 A;  4JJX A;  2VEZ A;  4KZT A;  4CRZ B;  1RO5 A;  3V8I A;  2Q4V A;  1Y9K A;  3DR6 A;  3D3S A;  4XPD C;  3TCV A;  4L8A A;  4B5O A;  2P6E A;  3LD2 A;  4NEX A;  3TFY A;  3SHP A;  1IB1 E;  3E0K A;  2ZW4 A;  4KVO E;  5KTA A;  1YLE A;  1I12 A;  4AVA A;  3W91 A;  3ZZI A;  3RYO A;  2VZZ A;  2R7H A;  3FB3 A;  2X7B A;  1M44 A;  2PC1 A;  2ZW7 A;  5H84 A;  4QVT A;  4FD4 A;  2FIA A;  3G3S A;  1KUY A;  1MK4 A;  1S3Z A;  1NE9 A;  4FD5 A;  2CNM A;  2H5M A;  1QSR A;  2JDD A;  1VHS A;  1YX0 A;  3W6S A;  2FL4 A;  1WK4 A;  2OZG A;  2GAN A;  2J8N A;  4UWJ A;  4ORF A;  3FYN A;  4HNY B;  4Y49 C;  4Y49 B;  2WPW A;  4R87 A;  1XEB A;  4NF1 A;  1PU9 A;  1IIC A;  1YGH A;  3I3G A;  2C27 A;  3S6H A;  1I21 A;  2VBQ A;  1S7N A;  5C82 A;  4JLY A;  3CXP A;  3R9G A;  1WWZ A;  2HUZ A;  2HV2 A;  2J8R A;  4R3L A;  4NSQ A;  2Q44 A;  1Q2C A;  2G3A A;  2REF A;  1J4J A;  4MY0 A;  2OZU A;  2FS5 A;  4OLL A;  4U9Y A;  5IB0 A;  3F8K A;  1I1D A;  2CNT A;  4XPD B;  2ZW6 A;  1Q2D A;  4AVC A;  3PGP A;  1MJA A;  4E8O A;  3R9F A;  5EC4 A;  3SXN A;  2I00 A;  3MGD A;  3EFA A;  2ZW5 A;  2HQY A;  4II9 A;  2ZXV A;  1NMT A;  1Z4E A;  1B6B A;  4HKF A;  5CNP A;  2NMT A;  3ZJ0 A;  2R1I A;  3N7Z A;  2BEI A;  4XNH C;  4PSW A;  3QB8 A;  1S60 A;  1B87 A;  5ISV A;  3W6X A;  2B5G A;  5F47 A;  4UBR A;  3CXQ A;  1YR0 A;  4MY3 A;  1QSM A;  2EVN A;  4AG7 A;  3D8P A;  1GHE A;  2REE A;  4J3G A;  4B5P B;  2GE3 A;  3GY9 A;  2G0B A;  2OZH A;  4R3K A;  4DNC A;  4YFJ A;  4QBJ A;  4MJ8 A;  3QAH A;  5IX3 A;  2PSW A;  1OZP A;  4IF5 A;  4H6U A;  3K9U A;  1XE4 A;  3G8W A;  3TOA A;  4CAX A;  3JUW A;  3F0A A;  4X5K A;  1S5K A;  4F6A A;  5DWN A;  3BJ8 A;  3BJ7 A;  1IYL A;  2Q7B A;  3P2F A;  2ATR A;  2A4N A;  3DR8 A;  3FXT A;  5HH1 A;  4LUA A;  1TIQ A;  3JVN A;  1FY7 A;  2Z0Z A;  1Z4R A;  3R96 A;  3EXN A;  3C26 A;  1P0H A;  2R8V A;  3P2H A;  4KOU A;  3GYA A;  4IUS A;  5F49 A;  4E2A A; 
#chains in the Genus database with same CATH topology
 4QB9 A;  4NGT A;  1XMT A;  3TOB A;  4A30 A;  2ZOF A;  3VWD A;  4L89 A;  2O4H A;  2Z10 A;  5FVJ A;  4M6I A;  1XIX A;  2J9A A;  3S6F A;  4BMH A;  2B58 A;  4PV6 A;  4CAV A;  3S9L A;  2VZY A;  4K30 A;  4WJB A;  4ZGY B;  1R3N A;  4UFX A;  3FIX A;  2GLF A;  3NH4 A;  5G21 A;  5LYF A;  4CGL A;  3TE4 A;  4YGO A;  3TO6 A;  4NXY A;  2QYV A;  4JXQ A;  3WAB A;  4AG9 A;  1S7F A;  4ONU A;  4LX9 A;  1CG2 A;  1CP7 A;  5GCN A;  2WSA A;  4M3S A;  2B5G B;  2I79 A;  3KHZ A;  1M1D A;  4H2K A;  4P44 A;  4CGM A;  3LOD A;  4B14 A;  3IO1 A;  1SQH A;  4KLV A;  4A38 A;  5HVG A;  1YSJ A;  2C6C A;  4CGP A;  4A32 A;  1PUA A;  2D4P A;  2VQY A;  4KOY A;  1L0C A;  3LWU A;  1ZO0 A;  4A31 A;  2QVP A;  2PRQ A;  2O28 A;  4ZY1 A;  1IID A;  2YNE A;  4R9M A;  4FUU A;  5H86 A;  1IYK A;  3TO9 A;  2PJ3 A;  4A2Z A;  2B4D B;  3PFO A;  3PP9 A;  3JTK A;  5G20 A;  2PDO A;  4KOW A;  5A27 A;  5F48 A;  4MFK A;  2ZPA A;  3V38 A;  1TKJ A;  1XF8 A;  3D4U A;  4F8Z A;  3QAY A;  1BLL E;  2ZEL A;  5I0C A;  3NH8 A;  2F8H A;  2QIR A;  4B12 A;  1Y7R A;  3RAM A;  3IGR A;  5F09 A;  2DEA A;  2NSM A;  3QNV A;  3IWG A;  2ZEP A;  4CS0 B;  2PJ0 A;  5I4M A;  5G22 A;  4MHD A;  3BXM A;  4PXC A;  2VI7 A;  3MRU A;  3FNC A;  1ZLH A;  3HUV A;  4P4B A;  4FD6 A;  3SI0 A;  2BL1 A;  2XEG A;  2YGW A;  5J8F A;  5J8C A;  3B3S A;  2HC9 A;  1BOB A;  1YVO A;  4KVM E;  4UWI A;  2JLM A;  5BWA B;  2FE7 A;  5AGE A;  4PXB A;  4P10 A;  4R8F A;  3T90 A;  2AFM A;  2RB7 A;  3NA6 A;  4KSF A;  5LYD A;  3WT4 A;  2Q7S A;  2WZN A;  4A37 A;  1F57 A;  4KOV A;  3IWW A;  2QML A;  4MHZ A;  4UEZ A;  3RBU A;  2FT0 A;  1YRE A;  1NSL A;  4UIA A;  3WR7 A;  4FWU A;  4PQA A;  5AG7 A;  3GKR A;  4BIN A;  4E0A A;  4YU9 A;  3LMS A;  4NCZ A;  4OKO A;  5JGF A;  4OID A;  2CNS A;  2AFX A;  2B4B A;  1CM0 A;  2FIW A;  2ZOG A;  3D7F A;  3EC4 A;  2FCK A;  2J8M A;  1V0C A;  1VHO A;  1YQE A;  3RO0 A;  2PCU A;  2BUE A;  4HNX B;  2OOT A;  1U6M A;  2PIY A;  4U5Y A;  2ARH A;  4C68 A;  1AUG A;  2C6P A;  5EMI A;  3NH5 A;  1MJ9 A;  2OH1 A;  5G1Z A;  4A39 A;  1UFH A;  3CDX A;  1S7L A;  2KCW A;  3F5B A;  4KUB A;  1M4I A;  2FVG A;  1M4D A;  1VKC A;  1YK3 A;  2V8D A;  2XEJ A;  3DDD A;  1KUV A;  4JXR A;  3DSB A;  4UA3 A;  3SI2 A;  2ZEO A;  1ELM P;  1QSO A;  4KUA A;  1LAP A;  2GFQ A;  5HVH A;  2DF5 A;  2OU2 A;  3D7D A;  3PBB A;  4CAW A;  3FX6 A;  2WYR A;  3I1U A;  4C7H A;  5E96 A;  2D4O A;  4B6Z A;  4XPL A;  4MI4 A;  4IAV A;  5JQ4 A;  2RC4 A;  3CPA A;  4KOX A;  1X12 A;  4OC4 A;  2GRE A;  2Z3N A;  3TO7 A;  4OAE A;  4PK3 A;  2P0W A;  1QST A;  3FBU A;  2ZEF A;  5JH9 A;  2QEC A;  4R57 A;  3FJU A;  3SJG A;  3BLN A;  3PRT A;  7CPA A;  3PFE A;  3B8G A;  3S6K A;  4CRY B;  4CGO A;  1IOF A;  3I9S A;  4LQG A;  4QUS A;  4MFJ A;  4OC2 A;  4XNH B;  2PJC A;  5K8M A;  5K8N A;  4KOT A;  4ZBG A;  4NJR A;  5DWM A;  2Z3L A;  2BSW A;  2VXK A;  2BOA A;  3FEE A;  5LRJ A;  4AB7 A;  2WPX A;  3NE7 A;  4PSX A;  1FNO A;  4HNW B;  2BCO A;  1YLO A;  4MFZ A;  3DGV A;  4H6Z A;  5JPH A;  3WC6 A;  1YVK A;  3TTH A;  2DPS A;  3R1K A;  4GM5 A;  5ELY A;  4KS9 A;  2FSR A;  3R95 A;  2PJ4 A;  1DTD A;  4R7M A;  5KTD A;  4AVB A;  3BI0 A;  2P6F A;  2ZEM A;  2PJ9 A;  2PQ8 A;  2FXF A;  4MCS A;  3MN8 A;  5HVF A;  1AMP A;  2B3U A;  4GS4 A;  3D2P A;  2Z11 A;  4H89 A;  2PR1 A;  2V8G A;  1M4G A;  4M85 A;  4RI1 A;  1XRY A;  1KZF A;  1R57 A;  2PRB A;  3IC1 A;  4MFQ A;  4CPA A;  3CXS A;  2G3T A;  2PR8 A;  3PB9 X;  4MHY A;  3FF3 A;  4MXU A;  1XJO A;  4M6H A;  5IV0 A;  1PCA A;  4OP4 A;  1ZG8 A;  4OAD A;  1QMU A;  4OIW A;  3NFZ A;  2DXQ A;  1Z8X A;  4KOS A;  4R76 A;  5AG4 A;  5KTC A;  4P6Y A;  4UF4 A;  4UIB A;  3VAT A;  1X10 A;  1Y9W A;  3KKW A;  3FED A;  3KHX A;  4NGQ A;  1ON0 A;  4P4E A;  1ZG7 A;  3TT2 A;  2B4D A;  4PK2 A;  5AG6 A;  2K5T A;  3K9T A;  2CY2 A;  2P6G A;  3KQX A;  3PBE A;  1RXT A;  2CXA A;  3IJ3 A;  1LAM A;  1MJB A;  4OME A;  4YRH A;  1VHE A;  2JEV A;  5HMN A;  3D2M A;  3B3W A;  3T9Y A;  2IL4 A;  3B7I A;  1Z9U A;  4RS2 A;  4X3R A;  4EVY A;  4UFW A;  3SXO A;  4U9Z A;  2Q4Y A;  1YW6 A;  3H4Q A;  1HEE A;  4MBU A;  1CPX A;  4MHN A;  5EBV A;  2O53 A;  3UY5 A;  2ZEE A;  1TKH A;  3H8F A;  3R9E A;  1LAN A;  1Z8L A;  1N71 A;  3GB0 A;  1VGY A;  1CJW A;  1KUX A;  2JDC A;  4JYW A;  2R98 A;  4UEE A;  2EK9 A;  1JWQ A;  2IQ6 A;  4JWP A;  2YNC C;  3L2N A;  4JD6 A;  2Q43 A;  3WC7 A;  3S6G A;  2EUI A;  2PJ5 A;  4X8I A;  2GIV A;  2IJZ A;  3B3T A;  3PZJ A;  4KLW A;  2Q0Y A;  2EO8 A;  4KSA A;  2V77 A;  4MFP A;  1S7K A;  2AE6 A;  3FRM A;  1ZLI A;  2PIZ A;  1K4J A;  4XPK A;  4KVX A;  5D29 A;  2B3V A;  2AJ6 A;  2ODF A;  2Y0M A;  2ZEN A;  3TC8 A;  2ZED A;  2F5I A;  1LRZ A;  1P4N A;  1QSN A;  5C88 A;  2Q4Z A;  4QC6 A;  3OWC A;  4A94 A;  4FD7 A;  2AFW A;  3EY5 A;  1TF9 A;  3PB4 X;  4NGN A;  4P45 A;  4KOR A;  2PJ6 A;  4YWY A;  3PEI A;  4F0Y A;  4CYO A;  1IU8 A;  2Q04 A;  3EO4 A;  4ZX8 A;  4CAE A;  5F46 A;  3FH4 A;  1OBR A;  1Z8T A;  3VH9 A;  1CX8 A;  4NFR A;  3GUX A;  3VWE A;  3T8W A;  1ARL A;  3H8E A;  1Q2Y A;  4NGS A;  4I49 A;  2NYQ A;  1F2O A;  3A9L A;  4F9U A;  1LFW A;  3JRU A;  3CZX A;  4AXV A;  3DNS A;  2OB0 A;  1BO4 A;  2PJ1 A;  3TX8 A;  4JJX A;  2AFU A;  2VEZ A;  4KZT A;  3VAR A;  4B13 A;  2POK A;  3KQZ A;  3N5F A;  5DS0 A;  1RO5 A;  1F2P A;  4CRZ B;  3V8I A;  2Q4V A;  1Y9K A;  3DR6 A;  2EK8 A;  3D3S A;  4XPD C;  4MHP A;  2IMO A;  3TCV A;  1LOK A;  3D66 A;  4L8A A;  4CYP A;  4P4D A;  4B5O A;  4FBE A;  2P6E A;  5K8P A;  1YME A;  4RUH A;  4W9Y A;  2EBJ A;  3IIB A;  3LD2 A;  4NEX A;  3TFY A;  4NGM A;  3H5Z A;  3SHP A;  1IB1 E;  3E0K A;  4Q36 A;  4O23 A;  2ZW4 A;  1HDQ A;  4KVO E;  3SJX A;  2JBJ A;  4HPS A;  5KTA A;  3RZA A;  1YLE A;  1I12 A;  2PJB A;  4P4J A;  3W91 A;  3ZZI A;  2XEI A;  4UCM A;  3RYO A;  4AVA A;  2VZZ A;  2PE3 A;  3B3C A;  2R7H A;  2ZEH A;  3FB3 A;  3SJE A;  2X7B A;  1M44 A;  2PC1 A;  2OR4 A;  2ZW7 A;  1Q7L A;  5H84 A;  4QVT A;  1CBX A;  4FD4 A;  3KL9 A;  4MRI A;  4Q38 A;  1VIX A;  2DPT A;  2FIA A;  3G3S A;  2BO9 A;  2Z3K A;  4KSI A;  5AG5 A;  2JEW A;  2HB6 A;  1KUY A;  1MK4 A;  1S3Z A;  1NE9 A;  2AFS A;  2ABZ A;  4FD5 A;  5IB9 A;  1YW4 A;  2CNM A;  2H5M A;  1QSR A;  2JDD A;  1VHS A;  1YX0 A;  3W6S A;  1KWM A;  3DLJ A;  3K2K A;  3BI1 A;  4Z65 A;  4MCQ A;  4ZY0 A;  2FL4 A;  1WK4 A;  2OZG A;  2GAN A;  2J8N A;  4UWJ A;  3FYN A;  4ORF A;  1IGB A;  2AFO A;  4HNY B;  4Y49 C;  4Y49 B;  4EWT A;  2WPW A;  4R87 A;  1XEB A;  4C2Y A;  4NF1 A;  1PU9 A;  2YND A;  4MCP A;  3SJF A;  1NSA A;  4B10 A;  4UCP A;  1IOI A;  1IIC A;  1YGH A;  2C6G A;  4JZ0 A;  3IU2 A;  1A2Z A;  1FT7 A;  1Y7E A;  3I3G A;  3ISX A;  2C27 A;  1PYT B;  2PJ8 A;  2V8H A;  5LYI A;  1Z2L A;  3S6H A;  4PPZ A;  2JBK A;  4A95 A;  4TWE A;  1I21 A;  2VBQ A;  4DUK A;  3WC5 A;  1S7N A;  3B2Y A;  3CPX A;  1M4L A;  5C82 A;  4PXD A;  4JLY A;  3CXP A;  3R9G A;  1WWZ A;  1CP6 A;  3GLJ A;  4UCN A;  2HUZ A;  2HV2 A;  2J8R A;  4GXH A;  4NJQ A;  4P4F A;  2Q51 A;  1UWY A;  4R3L A;  4NSQ A;  4TNU A;  1GYT A;  1BPM A;  1R43 A;  3IU1 A;  1XBU A;  2AFZ A;  2Q44 A;  1Q2C A;  2G3A A;  2REF A;  5A28 A;  2VL1 A;  2CTC A;  3BHX A;  1J4J A;  4MY0 A;  2OZU A;  2CIJ A;  1LCP A;  2FS5 A;  2CF4 A;  3D67 A;  3KAS A;  4OLL A;  5LRG A;  4U9Y A;  3IWE A;  5IB0 A;  3PB8 X;  1ELL P;  1EE3 P;  2PJ7 A;  2Z3P A;  3F8K A;  4UFV A;  5LYL A;  1I1D A;  2CNT A;  4XPD B;  5THW A;  4BD9 A;  1TF8 A;  4ZI6 A;  4X2T A;  1Z8W A;  2ZW6 A;  1Q2D A;  3IFE A;  4AVC A;  1XMB A;  4NGP A;  4C2X A;  2PJ2 A;  1MJA A;  3PGP A;  1Y0Y A;  3R9F A;  5EC4 A;  4E8O A;  3SXN A;  2I00 A;  3MGD A;  4C7I A;  1DE4 C;  4M6G A;  4FAI A;  4MCR A;  3EFA A;  3H8G A;  2Z3O A;  4ZX9 A;  2ZW5 A;  4CYN A;  2HQY A;  4II9 A;  2ZXV A;  1NMT A;  1Z4E A;  1CPS A;  1RTQ A;  1B6B A;  3FMC A;  4HKF A;  5CNP A;  2NMT A;  3S9N A;  3ZJ0 A;  3GIU A;  2R1I A;  3CT9 A;  3N7Z A;  4NGR A;  1ARM A;  2BEI A;  4OC5 A;  3NE8 A;  4XNH C;  1XOV A;  1BPN A;  3LAC A;  4IHM A;  4OC0 A;  4DYO A;  4PSW A;  2GLJ A;  2RFH A;  4A33 A;  3QB8 A;  1HDU A;  5CBM A;  1S60 A;  1B87 A;  2G9D A;  4OC1 A;  5K8O A;  5ISV A;  3W6X A;  2B5G A;  5F47 A;  6CPA A;  4UBR A;  5J1Q A;  3CXQ A;  4DJL A;  3V7Z A;  1YR0 A;  4MY3 A;  2EWB A;  1QSM A;  2PVW A;  4F0X A;  4CAF A;  2EVN A;  3RNZ A;  4B5P A;  4AG7 A;  1QQ9 A;  1IY7 A;  3D8P A;  1GHE A;  2REE A;  3IEH A;  1H8L A;  1BAV A;  4J3G A;  4B5P B;  2GE3 A;  2YNC A;  3GY9 A;  2G0B A;  1ZG9 A;  2OZH A;  1Z5R A;  2PVV A;  4R3K A;  4B11 A;  3KZW A;  4C2Z A;  4DNC A;  3KI9 A;  5D8N A;  4YFJ A;  4QBJ A;  4F9V A;  4MJ8 A;  3QAH A;  5IX3 A;  2PSW A;  3ISZ A;  2Z3M A;  1OZP A;  3FVL A;  3D7G A;  4H6U A;  4IF5 A;  3K9U A;  2GU2 A;  8CPA A;  4ZY2 A;  1XE4 A;  3B3V A;  2I3C A;  3G8W A;  1AYE A;  3TOA A;  4CAX A;  3JUW A;  4CGN A;  3F0A A;  5HXD A;  5LRK A;  4Q7A A;  4X5K A;  1S5K A;  4F6A A;  5DWN A;  3BJ8 A;  4CYQ A;  3B35 A;  4EFD A;  4ZYQ A;  3BJ7 A;  1IYL A;  1TKF A;  2Q7B A;  3P2F A;  2ATR A;  3KR4 A;  4OC3 A;  3D7H A;  4UEF A;  3FEC A;  2A4N A;  3PB7 X;  4MMO A;  4EME A;  4ONW A;  4K3N A;  3DR8 A;  2XEF A;  2V8V A;  3FXT A;  4PXE A;  5HH1 A;  4BBH A;  4LUA A;  1TIQ A;  1TXR A;  2ANP A;  3JVN A;  2CTB A;  4RN7 A;  1FY7 A;  2Z0Z A;  3KR5 A;  4WWV A;  1Z4R A;  3R96 A;  3S9M A;  3EXN A;  3SI1 A;  3C26 A;  5CPA A;  1P0H A;  2R8V A;  2WUU A;  2ZEG A;  1JQG A;  3PB6 X;  4LQ6 A;  3P2H A;  4KOU A;  3D68 A;  5JM6 A;  4P4I A;  2F7V A;  3GYA A;  4IUS A;  4G1P A;  1XFO A;  4IK2 A;  3HLP A;  5F49 A;  2C1C A;  1Y0R A;  4MFL A;  2PJA A;  4R6T A;  4E2A A;  2QJ8 A;  3KGQ A; 
#chains in the Genus database with same CATH homology
 4QB9 A;  1XMT A;  3TOB A;  4A30 A;  3VWD A;  4L89 A;  2Z10 A;  5FVJ A;  1XIX A;  4BMH A;  3S6F A;  4CAV A;  2B58 A;  4PV6 A;  2VZY A;  4ZGY B;  4UFX A;  3FIX A;  5G21 A;  4CGL A;  3TE4 A;  4YGO A;  3TO6 A;  4NXY A;  4JXQ A;  4AG9 A;  1S7F A;  4ONU A;  4LX9 A;  5GCN A;  2WSA A;  4M3S A;  2B5G B;  2I79 A;  1M1D A;  4CGM A;  3LOD A;  4B14 A;  1SQH A;  4KLV A;  4CGP A;  4A32 A;  1PUA A;  2D4P A;  2VQY A;  4KOY A;  1L0C A;  4A31 A;  1ZO0 A;  2O28 A;  1IID A;  2YNE A;  4R9M A;  5H86 A;  1IYK A;  3TO9 A;  4A2Z A;  2B4D B;  3PP9 A;  3JTK A;  5G20 A;  2PDO A;  4KOW A;  5A27 A;  5F48 A;  4MFK A;  2ZPA A;  1XF8 A;  5I0C A;  2QIR A;  4B12 A;  1Y7R A;  3IGR A;  3IWG A;  4CS0 B;  5G22 A;  4MHD A;  2VI7 A;  3FNC A;  4FD6 A;  2BL1 A;  2YGW A;  5J8F A;  5J8C A;  1BOB A;  1YVO A;  4KVM E;  4UWI A;  2JLM A;  5BWA B;  2FE7 A;  5AGE A;  3T90 A;  4KSF A;  4KOV A;  2QML A;  2FT0 A;  1YRE A;  1NSL A;  3WR7 A;  5AG7 A;  3GKR A;  4E0A A;  4NCZ A;  2CNS A;  2B4B A;  1CM0 A;  2FIW A;  3EC4 A;  2FCK A;  2J8M A;  1V0C A;  2BUE A;  4HNX B;  1U6M A;  4U5Y A;  2ARH A;  4C68 A;  1MJ9 A;  2OH1 A;  5G1Z A;  1UFH A;  1S7L A;  2KCW A;  3F5B A;  4KUB A;  4K30 A;  1VKC A;  1M4I A;  1M4D A;  3DDD A;  4JXR A;  1YK3 A;  4UA3 A;  1KUV A;  3DSB A;  1QSO A;  4KUA A;  2OU2 A;  4CAW A;  4C7H A;  5E96 A;  2D4O A;  4XPL A;  4MI4 A;  5JQ4 A;  4KOX A;  2RC4 A;  2Z3N A;  3TO7 A;  4OAE A;  4PK3 A;  2P0W A;  1QST A;  3FBU A;  2QEC A;  4R57 A;  3BLN A;  3S6K A;  3B8G A;  4CRY B;  4CGO A;  3I9S A;  4QUS A;  4MFJ A;  4XNH B;  4KOT A;  4ZBG A;  5DWM A;  2Z3L A;  2BSW A;  2VXK A;  4AB7 A;  2WPX A;  3NE7 A;  4PSX A;  4HNW B;  4MFZ A;  4H6Z A;  5JPH A;  4B5P A;  1YVK A;  3TTH A;  2DPS A;  3R1K A;  3R95 A;  4KS9 A;  2FSR A;  5KTD A;  4AVB A;  2P6F A;  2PQ8 A;  2FXF A;  2B3U A;  4GS4 A;  3D2P A;  2Z11 A;  4H89 A;  2PR1 A;  1M4G A;  4M85 A;  4RI1 A;  1KZF A;  1R57 A;  4MFQ A;  2PRB A;  3CXS A;  2G3T A;  2PR8 A;  5IV0 A;  4OAD A;  2DXQ A;  4KOS A;  5AG4 A;  5KTC A;  1Y9W A;  3KKW A;  3TT2 A;  1ON0 A;  2B4D A;  4PK2 A;  5AG6 A;  2K5T A;  2CY2 A;  2P6G A;  1RXT A;  2CXA A;  1MJB A;  4YRH A;  2JEV A;  5HMN A;  3D2M A;  3T9Y A;  2IL4 A;  1Z9U A;  4RS2 A;  4EVY A;  4UFW A;  3SXO A;  4U9Z A;  2Q4Y A;  3H4Q A;  4MBU A;  5EBV A;  3UY5 A;  3R9E A;  1N71 A;  2JDC A;  1CJW A;  1KUX A;  2R98 A;  4JWP A;  2YNC C;  4JD6 A;  3S6G A;  2EUI A;  2GIV A;  3PZJ A;  4KLW A;  2Q0Y A;  4KSA A;  4MFP A;  1S7K A;  2AE6 A;  3FRM A;  4XPK A;  1K4J A;  4KVX A;  2B3V A;  2AJ6 A;  2Y0M A;  1LRZ A;  1P4N A;  1QSN A;  2F5I A;  5C88 A;  4QC6 A;  3OWC A;  4FD7 A;  3EY5 A;  4KOR A;  4F0Y A;  4CYO A;  2Q04 A;  3EO4 A;  5F46 A;  4CAE A;  3VWE A;  1Q2Y A;  4I49 A;  3A9L A;  3DNS A;  2OB0 A;  1BO4 A;  4JJX A;  2VEZ A;  4KZT A;  4B13 A;  4CRZ B;  1RO5 A;  3V8I A;  2Q4V A;  1Y9K A;  3DR6 A;  3D3S A;  4XPD C;  3TCV A;  4L8A A;  4CYP A;  4B5O A;  2P6E A;  3LD2 A;  4NEX A;  3TFY A;  3H5Z A;  3SHP A;  1IB1 E;  3E0K A;  4Q36 A;  2ZW4 A;  4KVO E;  5KTA A;  1YLE A;  1I12 A;  4AVA A;  3W91 A;  3ZZI A;  4UCM A;  3RYO A;  2VZZ A;  2R7H A;  3FB3 A;  2X7B A;  1M44 A;  2PC1 A;  2ZW7 A;  5H84 A;  4QVT A;  4FD4 A;  4Q38 A;  2DPT A;  2FIA A;  3G3S A;  2Z3K A;  5AG5 A;  1KUY A;  1MK4 A;  1S3Z A;  1NE9 A;  4FD5 A;  2CNM A;  2H5M A;  1QSR A;  2JDD A;  1VHS A;  1YX0 A;  3W6S A;  2FL4 A;  1WK4 A;  2OZG A;  2GAN A;  2J8N A;  4UWJ A;  3FYN A;  4ORF A;  4HNY B;  4Y49 C;  4Y49 B;  2WPW A;  4R87 A;  1XEB A;  4C2Y A;  4NF1 A;  1PU9 A;  2YND A;  4B10 A;  4UCP A;  1IIC A;  1YGH A;  3IU2 A;  3I3G A;  2C27 A;  3S6H A;  4A95 A;  1I21 A;  2VBQ A;  1S7N A;  5C82 A;  4JLY A;  3CXP A;  3R9G A;  1WWZ A;  4UCN A;  2HUZ A;  2HV2 A;  2J8R A;  4R3L A;  4NSQ A;  3IU1 A;  2Q44 A;  1Q2C A;  2G3A A;  2REF A;  5A28 A;  1J4J A;  4MY0 A;  2OZU A;  2FS5 A;  4OLL A;  4U9Y A;  3IWE A;  5IB0 A;  2Z3P A;  3F8K A;  4UFV A;  1I1D A;  2CNT A;  4XPD B;  2ZW6 A;  1Q2D A;  4AVC A;  4C2X A;  3PGP A;  1MJA A;  4E8O A;  3R9F A;  5EC4 A;  3SXN A;  2I00 A;  3MGD A;  4C7I A;  3EFA A;  2Z3O A;  2ZW5 A;  4CYN A;  2HQY A;  4II9 A;  2ZXV A;  1NMT A;  1Z4E A;  1B6B A;  4HKF A;  5CNP A;  2NMT A;  3ZJ0 A;  2R1I A;  3N7Z A;  2BEI A;  4XNH C;  4PSW A;  4A33 A;  3QB8 A;  1S60 A;  1B87 A;  5ISV A;  3W6X A;  2B5G A;  5F47 A;  4UBR A;  3CXQ A;  1YR0 A;  4MY3 A;  1QSM A;  4F0X A;  4CAF A;  2EVN A;  4AG7 A;  3D8P A;  1GHE A;  2REE A;  4J3G A;  4B5P B;  2GE3 A;  2YNC A;  3GY9 A;  2G0B A;  2OZH A;  4R3K A;  4B11 A;  4C2Z A;  4DNC A;  4YFJ A;  4QBJ A;  4MJ8 A;  3QAH A;  5IX3 A;  2PSW A;  2Z3M A;  1OZP A;  4IF5 A;  4H6U A;  3K9U A;  1XE4 A;  3G8W A;  3TOA A;  4CAX A;  3JUW A;  4CGN A;  3F0A A;  4X5K A;  1S5K A;  4F6A A;  5DWN A;  3BJ8 A;  4CYQ A;  3BJ7 A;  1IYL A;  2Q7B A;  3P2F A;  2ATR A;  2A4N A;  3DR8 A;  3FXT A;  5HH1 A;  4BBH A;  4LUA A;  1TIQ A;  3JVN A;  1FY7 A;  2Z0Z A;  1Z4R A;  3R96 A;  3EXN A;  3C26 A;  1P0H A;  2R8V A;  2WUU A;  3P2H A;  4KOU A;  3GYA A;  4IUS A;  5F49 A;  4MFL A;  4E2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...