3G8WA

Crystal structure of a probable acetyltransferase from staphylococcus epidermidis atcc 12228
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
162
structure length
162
Chain Sequence
MNNIRLLNQNDLDSYIELMKFGHHNYEWDRYYLENVSIDRLKTILSNHTDYWNIFGAFEDDELVATCTLKQMNYVGKCHKAILENNFVKNNDEIVNRELINHIIQYAKEQNIETLMIAIASNNISAKVFFSSIGFENLAFEKNASKIGNEYFDENWLIYSTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lactococcal prophage ps3 protein 05
publication title The crystal structure of a probable acetyltransferase from Staphylococcus epidermidis ATCC 12228.
rcsb
source organism Staphylococcus epidermidis atcc 12228
molecule tags Transferase
total genus 45
structure length 162
sequence length 162
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3g8wA00
3WR7A 3G8WA 3S6FA 4MY3A 1IB1E 3D2MA 2R7HA 3OWCA 2B4DA 4RI1A 3F0AA 2WPXA 1IYKA 3P2FA 3S6HA 1UFHA 4AVCA 4R3LA 2Q0YA 1IIDA 3DDDA 1QSOA 3EO4A 4B5PA 2CY2A 4MJ8A 2Y0MA 2G3TA 3I3GA 4KLVA 3FBUA 3QAHA 1S60A 1KUXA 4K30A 4R57A 3TO9A 5JPHA 2ZW4A 2K5TA 2ZXVA 3GYAA 1Y7RA 2Q7BA 5DWMA 4KOSA 1B6BA 2OZUA 2ARHA 1Q2DA 1V0CA 4FD4A 3D2PA 1QSRA 4L89A 4KUBA 2J8NA 2FIWA 2Q04A 4QBJA 3EC4A 4NCZA 2WPWA 1NE9A 4H6UA 4KOWA 3BLNA 4AG9A 5JQ4A 1S5KA 1TIQA 2P6FA 4ONUA 2PSWA 4Y49B 2R8VA 2BEIA 3SXNA 2D4OA 3TOAA 2EUIA 1RXTA 1YR0A 3CXPA 1XIXA 4F6AA 3FNCA 2QECA 3DR8A 4UWJA 1RO5A 3PGPA 2VI7A 3TO7A 1M44A 2BL1A 1CJWA 3IWGA 4XNHB 3R95A 4NEXA 2G0BA 2FXFA 4YRHA 5HMNA 3TE4A 2JDCA 1MK4A 5KTDA 3G3SA 5H84A 3TFYA 4E2AA 3GY9A 4E8OA 3K9UA 3IGRA 2EVNA 3D3SA 2PR8A 3EXNA 2Z0ZA 4XPDC 5EBVA 4QB9A 5H86A 1ON0A 2OH1A 2G3AA 3E0KA 1VHSA 3V8IA 1XMTA 4PSWA 4RS2A 3DSBA 1R57A 2FS5A 3DR6A 3JUWA 1S7LA 4X5KA 4JWPA 1XF8A 4HNXB 2R98A 2QIRA 3CXQA 3R1KA 4AVAA 4U9ZA 3PP9A 4KVXA 5KTCA 2Z11A 2I00A 3EY5A 1YLEA 1WK4A 1Q2YA 2BSWA 2B3VA 1KZFA 4HNWB 5E96A 4R3KA 2FSRA 1PU9A 3TTHA 2PC1A 2AE6A 1N71A 2R1IA 2AJ6A 3FIXA 4KVME 3FB3A 5HH1A 1YX0A 3FRMA 2H5MA 3FXTA 5FVJA 1QSTA 4B5OA 2PR1A 3R9GA 1Z4RA 4ORFA 4KZTA 5DWNA 5I0CA 4NXYA 2PDOA 1SQHA 3GKRA 2B4DB 2FIAA 3P2HA 3N7ZA 2P6EA 2REEA 4OAEA 4H6ZA 1QSNA 2CNTA 4CAWA 2JLMA 2PQ8A 1MJBA 4XPKA 4LX9A 2B5GB 1VKCA 4LUAA 4CRYB 5F47A 4B5PB 3H4QA 4MI4A 1FY7A 4UBRA 2P6GA 4AVBA 1M4IA 1YVKA 3R96A 1M4GA 1L0CA 4ZBGA 2B58A 1YK3A 3TO6A 2B3UA 4KOXA 4BMHA 1Y9WA 3C26A 5C82A 1XEBA 2OZGA 2JDDA 3B8GA 3TOBA 1YVOA 3BJ8A 2DXQA 4J3GA 5IV0A 4R87A 4QC6A 1GHEA 1M1DA 3KKWA 4FD5A 2GIVA 3S6GA 2ZW5A 3F8KA 4KOVA 4GS4A 5EC4A 1P0HA 3PZJA 1P4NA 3I9SA 4KORA 4U5YA 5IX3A 2J8RA 1MJ9A 4AG7A 4QVTA 2HUZA 4Y49C 3VWEA 4MBUA 3FYNA 4OADA 3NE7A 1XE4A 4L8AA 2KCWA 4CS0B 1IYLA 4KOYA 4M3SA 1KUYA 4JD6A 4CRZB 2Z10A 2VZYA 2A4NA 2GANA 4AB7A 2FT0A 4XNHC 4KVOE 5ISVA 4NF1A 2NMTA 3JVNA 4YFJA 5IB0A 2C27A 3T9YA 4U9YA 2HV2A 4CAXA 4EVYA 2P0WA 4E0AA 1Y9KA 2IL4A 2RC4A 3TT2A 2B5GA 5F46A 3MGDA 4UA3A 4DNCA 5GCNA 3VWDA 2Q4VA 2FL4A 4F0YA 2REFA 1NSLA 2X7BA 3CXSA 3UY5A 3W6SA 3ZJ0A 5KTAA 2Q4YA 4JJXA 4KUAA 2OZHA 1S7NA 2ZW7A 3SHPA 4HNYB 3SXOA 1K4JA 2B4BA 2JEVA 2GE3A 4II9A 2BUEA 4M85A 4FD6A 4H89A 4JLYA 1Z9UA 4R9MA 2J8MA 3LD2A 3TCVA 4NSQA 2I79A 1I1DA 1MJAA 4XPDB 2Q44A 4PK2A 1B87A 1WWZA 3R9EA 4KOUA 1CM0A 4HKFA 2OU2A 2QMLA 1S7FA 3W6XA 3QB8A 2O28A 1I21A 2VEZA 1QSMA 1OZPA 4PSXA 3R9FA 2VZZA 3EFAA 4JXRA 4PK3A 5C88A 1YREA 1I12A 2D4PA 2ZW6A 2ZPAA 1Z4EA 3RYOA 4KLWA 5J8CA 1LRZA 5F48A 3LODA 2VXKA 1YGHA 2CNSA 1U6MA 3BJ7A 1M4DA 3T90A 1BOBA 2HQYA 4QUSA 4IF5A 4IUSA 4XPLA 3S6KA 4I49A 1S7KA 3W91A 1Q2CA 2FE7A 3DNSA 3F5BA 1BO4A 1S3ZA 4KOTA 1PUAA 1J4JA 4OLLA 5J8FA 4MY0A 1NMTA 2CNMA 4CAVA 4JXQA 4MHDA 2OB0A 1KUVA 4PV6A 2VQYA 3ZZIA 2F5IA 4FD7A 2PRBA 2FCKA 2ATRA 5F49A 1IICA 3D8PA 4YGOA 2VBQA 4UWIA 5CNPA
chains in the Genus database with same CATH superfamily
4OKOA 3WR7A 2PJ8A 3G8WA 3S6FA 1LOKA 2ZOFA 2ZELA 4MY3A 1IB1E 1F57A 3D2MA 4CGNA 1LAMA 2ZEMA 3IO1A 3T8WA 3SJXA 2R7HA 4PXEA 3RO0A 3OWCA 5AG6A 4A33A 2B4DA 5AG7A 4NGSA 4RI1A 3F0AA 2WPXA 3GB0A 5LRGA 3IC1A 1IYKA 1NSAA 1Q7LA 1QQ9A 3P2FA 3S6HA 5K8OA 5LYLA 2BCOA 3FECA 3KZWA 1UFHA 3I1UA 4AVCA 1IOFA 4R3LA 4UIAA 2Q0YA 1IIDA 1YMEA 1QSOA 2QVPA 3DDDA 3EO4A 3V38A 2V8HA 4B5PA 2CY2A 4MJ8A 5HVHA 2GFQA 1LFWA 3KL9A 2Q43A 2JBKA 2Y0MA 2C6PA 2G3TA 3I3GA 4KLVA 2PJ0A 2PE3A 3FBUA 3QAHA 1S60A 1VGYA 1KUXA 2AFUA 4K30A 3PB6X 4R57A 1TKJA 3CPAA 3TO9A 3GLJA 5JPHA 2ZW4A 2K5TA 2ZXVA 3CDXA 1XOVA 3CPXA 3GYAA 3D67A 2BO9A 3KQXA 4A37A 2F8HA 1Y7RA 1QMUA 4GXHA 4A95A 2Q7BA 5DWMA 4KOSA 3FF3A 3HUVA 1B6BA 2J9AA 2OZUA 2ARHA 1LANA 1AYEA 1Q2DA 1V0CA 1VHEA 4FD4A 4UFVA 3D2PA 3FVLA 1CG2A 4B10A 1TF9A 4LQGA 3GUXA 4PXBA 1RTQA 1QSRA 5K8NA 4FAIA 3D7FA 4L89A 4KUBA 2J8NA 1M4LA 2FIWA 2Q04A 2ZEOA 4QBJA 3EC4A 4NCZA 2WPWA 1NE9A 2DEAA 4H6UA 4BD9A 1ZG9A 4C2XA 3B3SA 4IAVA 4MHYA 3B3CA 3BLNA 4KOWA 1Z2LA 4KS9A 2XEGA 3H8FA 2WYRA 4P10A 4P44A 4P4FA 1S5KA 4YU9A 4B12A 5JQ4A 3IU1A 1TIQA 5CBMA 5K8PA 2P6FA 4ONUA 5LYIA 4B14A 2PSWA 4Y49B 1ARLA 2V8DA 2R8VA 3QNVA 4UFXA 3D68A 2BEIA 4X8IA 1XBUA 1X12A 2C6CA 4TWEA 3SXNA 3V7ZA 3IEHA 2ZEEA 2D4OA 3TOAA 2POKA 2EUIA 3LACA 1RXTA 1YR0A 3CXPA 4CYQA 1XIXA 3NE8A 4P4IA 3FMCA 4F6AA 3FNCA 5F09A 4UCPA 2QECA 1Z8LA 3DR8A 3GIUA 4UWJA 1RO5A 2YGWA 3PGPA 2VI7A 1CP6A 1M44A 3TO7A 2BL1A 3BI0A 4M6HA 1CJWA 3IWGA 5LYFA 2WUUA 1DE4C 4XNHB 3R95A 4NEXA 4OC0A 2IJZA 2NSMA 2G0BA 2G9DA 2FXFA 4YRHA 5HMNA 3IWWA 3TE4A 2JDCA 1MK4A 4CYPA 5KTDA 3NH8A 3G3SA 3KR4A 2CTBA 1PYTB 4R7MA 4F9UA 5H84A 3TFYA 2AFMA 2Z3NA 4E2AA 4PPZA 5G20A 2PCUA 3GY9A 4E8OA 4OC4A 1IOIA 5AGEA 3K9UA 2ANPA 2V8VA 4MHZA 3IGRA 2EVNA 3D3SA 2PR8A 3WC6A 1IU8A 4MFLA 4WWVA 5IB9A 4R76A 3EXNA 2AFOA 2Z0ZA 3NH4A 2PIZA 4OC5A 4XPDC 4BBHA 2Z3KA 2IMOA 5EBVA 4QB9A 5H86A 4OMEA 4F9VA 1ON0A 4RN7A 2CF4A 4C7IA 3RBUA 2OH1A 2V77A 1JWQA 2G3AA 3E0KA 5JH9A 1HDQA 1VHSA 3N5FA 3B7IA 5D8NA 3JRUA 3V8IA 5A28A 4F0XA 1XMTA 1HEEA 2Z3LA 4PSWA 4RS2A 3DSBA 2Z3MA 4UEFA 1BAVA 3CT9A 4FUUA 1KWMA 1R57A 2FS5A 3DR6A 4M6IA 3JUWA 1S7LA 4X5KA 2AFXA 3HLPA 4JWPA 3A9LA 1AUGA 1ZLIA 2IQ6A 1XF8A 2C1CA 2QYVA 1IY7A 4HNXB 2R98A 2QIRA 2VL1A 3CXQA 5HXDA 1UWYA 1OBRA 4OC2A 2EBJA 2ZENA 4UIBA 5HVGA 3KGQA 3R1KA 2BOAA 4AVAA 4U9ZA 3BHXA 3PP9A 4M6GA 1DTDA 2PJAA 4KVXA 4LQ6A 3FX6A 2O4HA 3IIBA 5KTCA 2Z11A 2YNCA 2I00A 3EY5A 1YLEA 1WK4A 1Q2YA 2BSWA 4FBEA 4KSAA 2B3VA 1KZFA 4HNWB 5E96A 1CPSA 4C2ZA 2JEWA 4H2KA 2PRQA 4OIDA 4R3KA 3D4UA 2FSRA 1LAPA 1PU9A 1Y0YA 4MFQA 1YW4A 3TTHA 2EK8A 2PC1A 1LCPA 2AE6A 1N71A 2R1IA 4KSFA 5A27A 2AJ6A 2ZEPA 3FIXA 3KR5A 3FB3A 4KVME 4NJRA 2PVWA 5HH1A 1YX0A 4P45A 3FRMA 2EO8A 3MRUA 2H5MA 3FXTA 5FVJA 1QSTA 3DLJA 4BINA 4B5OA 1HDUA 2PR1A 3R9GA 1Z4RA 4ORFA 2NYQA 4KZTA 3IU2A 5DWNA 4CYNA 5I0CA 5G22A 2GLFA 4NXYA 2PDOA 1SQHA 2PJBA 3GKRA 4CAFA 2B4DB 1CP7A 2FIAA 3P2HA 3N7ZA 1XFOA 2ZOGA 2P6EA 4UF4A 2REEA 4OAEA 1TKFA 4H6ZA 3BI1A 1QSNA 2CNTA 3MN8A 4CAWA 2JLMA 2PQ8A 5K8MA 4CYOA 2PJ3A 2AFWA 2XEIA 1YLOA 3H8GA 1MJBA 4XPKA 4R8FA 2HC9A 3SI1A 4LX9A 2PJ6A 2PJ4A 2B5GB 1CPXA 1VKCA 2PJ5A 4LUAA 4CRYB 5F47A 2EWBA 4A30A 2XEFA 2RB7A 4P4BA 4AXVA 4G1PA 1F2OA 3H4QA 4MI4A 3H8EA 4NGPA 4B5PB 3PFOA 1FY7A 4B11A 4UBRA 2P6GA 4MFZA 2GREA 2XEJA 4AVBA 4IHMA 2ZEHA 3TC8A 2Q7SA 3VARA 1M4IA 4NJQA 1YVKA 3R96A 4B6ZA 3ISZA 5AG4A 1M4GA 1BLLE 1L0CA 2Q51A 4X2TA 4ZBGA 1Z8TA 2Q4ZA 2PJ1A 1H8LA 5LRJA 5JGFA 2PIYA 5LYDA 2DF5A 2B58A 3KASA 1YK3A 3TO6A 4C7HA 5BWAB 2B3UA 4KOXA 4Q38A 4UCNA 3D7DA 4BMHA 1Y9WA 3C26A 2AFSA 5AG5A 4OIWA 5C82A 3KQZA 1XEBA 4O23A 2ODFA 1GYTA 3IFEA 5G1ZA 4UCMA 4PQAA 4A39A 4ZYQA 2DPTA 2OZGA 2JDDA 3B8GA 5ELYA 3D7HA 4DYOA 1YW6A 2YNCC 1TF8A 3TOBA 1YVOA 4C68A 3FEDA 3BJ8A 2DXQA 4J3GA 4PXDA 5IV0A 1ARMA 7CPAA 1CX8A 2CXAA 3H5ZA 4R87A 4QC6A 2PJCA 3L2NA 1BPMA 4TNUA 1GHEA 1M1DA 4MHPA 3BXMA 1EE3P 3KKWA 4FD5A 3NH5A 4EMEA 2GIVA 4K3NA 3PBEA 5I4MA 3S6GA 2ZW5A 3PB4X 3F8KA 4MCPA 4ONWA 3SJFA 1Z5RA 3FJUA 4KOVA 4GS4A 5D29A 5EC4A 3RAMA 1P0HA 2ZEDA 1ZLHA 3PZJA 1IGBA 1P4NA 3I9SA 4C2YA 4KORA 4U5YA 4A38A 5IX3A 2QJ8A 2J8RA 1MJ9A 4AG7A 6CPAA 3B3TA 4QVTA 2HUZA 4Y49C 3VWEA 4MBUA 3FYNA 4NGNA 3TX8A 4OADA 4WJBA 4MRIA 2JBJA 1TKHA 1XRYA 3NE7A 1XE4A 4L8AA 3ISXA 2WSAA 3PB7X 4NFRA 4DUKA 4A94A 2KCWA 4IK2A 4CS0B 2CIJA 4ZX8A 1IYLA 3PBBA 3SI0A 2PJ2A 3KHXA 4KOYA 4M3SA 3CZXA 3WC5A 1KUYA 4JD6A 4CRZB 1X10A 4MFJA 2Z10A 3PB8X 4X3RA 2VZYA 3K2KA 5G21A 2A4NA 2GANA 3IWEA 3PFEA 1AMPA 2Z3PA 3RNZA 4AB7A 1VHOA 2FT0A 2ABZA 2PJ9A 4CGLA 4XNHC 1R3NA 4ZY0A 4KVOE 2V8GA 5ISVA 2ZEFA 4JYWA 4NF1A 4CPAA 2NMTA 5DS0A 3K9TA 3JVNA 1YQEA 4YFJA 1BPNA 3D7GA 4FWUA 4ZI6A 5IB0A 3NFZA 2C27A 4EFDA 3LWUA 3NA6A 3B2YA 3T9YA 4U9YA 8CPAA 2HV2A 2PVVA 3WABA 4OP4A 4CAXA 4EVYA 2P0WA 3SJEA 4E0AA 1Y9KA 4OC3A 2IL4A 2RC4A 4UFWA 3TT2A 3QAYA 2B5GA 4MCSA 3MGDA 4UA3A 5F46A 4ZGYB 4DNCA 5GCNA 3VWDA 2Q4VA 2HB6A 4DJLA 2FL4A 4MFKA 4F0YA 1TXRA 5J1QA 1XMBA 3D66A 2REFA 1NSLA 2X7BA 4MCQA 3CXSA 3UY5A 3W6SA 3ZJ0A 5KTAA 2Q4YA 4JJXA 4MMOA 4PXCA 4KUAA 2OZHA 3WT4A 4MCRA 1S7NA 2ZW7A 4OC1A 2FVGA 3SHPA 3PB9X 3S9MA 4HNYB 4F8ZA 3SXOA 1K4JA 2B4BA 2JEVA 2GE3A 2GLJA 2BUEA 4M85A 4II9A 4FD6A 4H89A 4JLYA 2OR4A 1Z9UA 3KHZA 4JZ0A 4R9MA 4UEEA 2J8MA 3LD2A 1ELMP 3TCVA 4NSQA 4NGRA 1JQGA 3PEIA 2I79A 1I1DA 4AG9A 1MJAA 1Y7EA 4XPDB 2Q44A 4PK2A 1B87A 1WWZA 4MXUA 3R9EA 4KOUA 1CM0A 2C6GA 2OU2A 4HKFA 4NGQA 2QMLA 1S7FA 2CTCA 3W6XA 2WZNA 3QB8A 2O28A 1I21A 2DPSA 3VATA 4MFPA 2GU2A 2VEZA 1QSMA 1OZPA 2RFHA 4P4EA 4PSXA 1XJOA 2O53A 3R9FA 2VZZA 3EFAA 4CAEA 4JXRA 4PK3A 5C88A 4KSIA 1YREA 3RZAA 1I12A 2YNDA 1ZG7A 2D4PA 1VIXA 4ZY1A 2ZW6A 2ZPAA 1Z4EA 1A2ZA 3RYOA 4NGMA 4KLWA 3SI2A 1ZG8A 4HPSA 1Y0RA 4R6TA 5CPAA 1PCAA 1LRZA 5F48A 5J8CA 3LODA 2VXKA 1YGHA 1ELLP 2CNSA 2F7VA 3KI9A 4CGMA 1U6MA 3BJ7A 4A2ZA 4MHNA 4Q36A 4CGPA 1M4DA 3T90A 1BOBA 1CBXA 2HQYA 4QUSA 2Z3OA 1FNOA 4IF5A 4IUSA 5THWA 5JM6A 4GM5A 1FT7A 1Z8WA 4XPLA 4P4JA 2ZEGA 3S6KA 3VH9A 4I49A 1YSJA 3SJGA 5LRKA 4Q7AA 1S7KA 3B35A 4NGTA 4CGOA 4RUHA 1F2PA 3B3WA 1Q2CA 3W91A 3FEEA 4W9YA 3FH4A 4EWTA 3JTKA 2EK9A 4B13A 1ZO0A 2FE7A 3DNSA 3F5BA 1BO4A 1R43A 1S3ZA 4KOTA 1PUAA 1J4JA 3DGVA 4OLLA 4P4DA 5J8FA 5EMIA 4MY0A 1NMTA 2PJ7A 1Z8XA 2CNMA 3IJ3A 4CAVA 4JXQA 4MHDA 2OB0A 4A31A 1KUVA 3B3VA 4PV6A 4ZX9A 2VQYA 3ZZIA 2F5IA 4FD7A 2PRBA 4Z65A 3LMSA 4YWYA 4A32A 2FCKA 3WC7A 5HVFA 2ATRA 5F49A 1IICA 4P6YA 3D8PA 2YNEA 4UEZA 4YGOA 3S9LA 2VBQA 3PRTA 4UWIA 2OOTA 2AFZA 4ZY2A 3S9NA 5CNPA 2I3CA
chains in the Genus database with same CATH topology
3WR7A 3G8WA 3S6FA 4MY3A 1IB1E 3D2MA 4CGNA 2R7HA 3OWCA 5AG6A 4A33A 2B4DA 5AG7A 4RI1A 3F0AA 2WPXA 1IYKA 3P2FA 3S6HA 1UFHA 4AVCA 4R3LA 2Q0YA 1IIDA 3DDDA 1QSOA 3EO4A 4B5PA 2CY2A 4MJ8A 2Y0MA 2G3TA 3I3GA 4KLVA 3FBUA 3QAHA 1S60A 1KUXA 4K30A 4R57A 3TO9A 5JPHA 2ZW4A 2K5TA 2ZXVA 3GYAA 1Y7RA 4A95A 2Q7BA 5DWMA 4KOSA 1B6BA 2OZUA 2ARHA 1Q2DA 1V0CA 4FD4A 4UFVA 3D2PA 4B10A 1QSRA 4L89A 4KUBA 2J8NA 2FIWA 2Q04A 4QBJA 3EC4A 4NCZA 2WPWA 1NE9A 4H6UA 4C2XA 4KOWA 3BLNA 4AG9A 4KS9A 5JQ4A 4B12A 1S5KA 3IU1A 1TIQA 2P6FA 4ONUA 2PSWA 4Y49B 4UFXA 2R8VA 2BEIA 3SXNA 2D4OA 3TOAA 2EUIA 1RXTA 1YR0A 3CXPA 4CYQA 1XIXA 4F6AA 3FNCA 4UCPA 2QECA 3DR8A 4UWJA 1RO5A 2YGWA 3PGPA 2VI7A 3TO7A 1M44A 2BL1A 1CJWA 3IWGA 2WUUA 4XNHB 3R95A 4NEXA 2G0BA 2FXFA 4YRHA 5HMNA 3TE4A 2JDCA 1MK4A 4CYPA 5KTDA 3G3SA 5H84A 3TFYA 2Z3NA 4E2AA 5G20A 3GY9A 4E8OA 5AGEA 3K9UA 3IGRA 2EVNA 3D3SA 2PR8A 4MFLA 3EXNA 2Z0ZA 4XPDC 4BBHA 2Z3KA 5EBVA 4QB9A 5H86A 1ON0A 4C7IA 2OH1A 2G3AA 3E0KA 1VHSA 3V8IA 5A28A 4F0XA 1XMTA 2Z3LA 4PSWA 4RS2A 3DSBA 2Z3MA 1R57A 2FS5A 3DR6A 3JUWA 1S7LA 4X5KA 4JWPA 3A9LA 1XF8A 4HNXB 2R98A 2QIRA 3CXQA 3R1KA 4AVAA 4U9ZA 3PP9A 4KVXA 5KTCA 2Z11A 2YNCA 2I00A 3EY5A 1YLEA 1WK4A 1Q2YA 2BSWA 4KSAA 2B3VA 1KZFA 4HNWB 5E96A 4C2ZA 4R3KA 2FSRA 1PU9A 4MFQA 3TTHA 2PC1A 2AE6A 1N71A 2R1IA 4KSFA 5A27A 2AJ6A 3FIXA 4KVME 3FB3A 5HH1A 1YX0A 3FRMA 2H5MA 3FXTA 5FVJA 1QSTA 4B5OA 2PR1A 3R9GA 1Z4RA 4ORFA 4KZTA 5DWNA 3IU2A 4CYNA 5I0CA 5G22A 4NXYA 2PDOA 1SQHA 3GKRA 4CAFA 2B4DB 2FIAA 3P2HA 3N7ZA 2P6EA 2REEA 4OAEA 4H6ZA 1QSNA 2CNTA 4CAWA 2JLMA 2PQ8A 4CYOA 1MJBA 4XPKA 4LX9A 2B5GB 1VKCA 4LUAA 4CRYB 5F47A 4A30A 4B14A 4B5PB 3H4QA 4MI4A 1FY7A 4B11A 4UBRA 2P6GA 4MFZA 4AVBA 1M4IA 1YVKA 3R96A 5AG4A 1M4GA 1L0CA 4ZBGA 2B58A 1YK3A 3TO6A 4C7HA 5BWAB 2B3UA 4KOXA 4Q38A 4UCNA 4BMHA 1Y9WA 3C26A 5AG5A 5C82A 1XEBA 5G1ZA 4UCMA 2DPTA 2OZGA 2JDDA 3B8GA 2YNCC 3TOBA 1YVOA 4C68A 3BJ8A 2DXQA 4J3GA 5IV0A 2CXAA 3H5ZA 4R87A 4QC6A 1GHEA 1M1DA 3KKWA 4FD5A 2GIVA 3S6GA 2ZW5A 3F8KA 4KOVA 4GS4A 5EC4A 1P0HA 3PZJA 1P4NA 3I9SA 4C2YA 4KORA 4U5YA 5IX3A 2J8RA 1MJ9A 4AG7A 4QVTA 2HUZA 4Y49C 3VWEA 4MBUA 3FYNA 4OADA 3NE7A 1XE4A 4L8AA 2WSAA 2KCWA 4CS0B 1IYLA 4KOYA 4M3SA 1KUYA 4JD6A 4CRZB 4MFJA 2Z10A 2VZYA 5G21A 2A4NA 2GANA 3IWEA 2Z3PA 4AB7A 2FT0A 4CGLA 4XNHC 4KVOE 5ISVA 4NF1A 2NMTA 3JVNA 4YFJA 5IB0A 2C27A 3T9YA 4U9YA 2HV2A 4CAXA 4EVYA 2P0WA 4E0AA 1Y9KA 2IL4A 2RC4A 4UFWA 3TT2A 2B5GA 5F46A 3MGDA 4UA3A 4ZGYB 4DNCA 5GCNA 3VWDA 2Q4VA 2FL4A 4MFKA 4F0YA 2REFA 1NSLA 2X7BA 3CXSA 3UY5A 3W6SA 3ZJ0A 5KTAA 2Q4YA 4JJXA 4KUAA 2OZHA 1S7NA 2ZW7A 3SHPA 4HNYB 3SXOA 1K4JA 2B4BA 2JEVA 2GE3A 4II9A 2BUEA 4M85A 4FD6A 4H89A 4JLYA 1Z9UA 4R9MA 2J8MA 3LD2A 3TCVA 4NSQA 2I79A 1I1DA 1MJAA 4XPDB 2Q44A 4PK2A 1B87A 1WWZA 3R9EA 4KOUA 1CM0A 4HKFA 2OU2A 2QMLA 1S7FA 3W6XA 3QB8A 2O28A 1I21A 2DPSA 4MFPA 2VEZA 1QSMA 1OZPA 4PSXA 3R9FA 2VZZA 3EFAA 4CAEA 4JXRA 4PK3A 5C88A 1YREA 1I12A 2YNDA 2D4PA 2ZW6A 2ZPAA 1Z4EA 3RYOA 4KLWA 5J8CA 1LRZA 5F48A 3LODA 2VXKA 1YGHA 2CNSA 4CGMA 1U6MA 3BJ7A 4A2ZA 4Q36A 4CGPA 1M4DA 3T90A 1BOBA 2HQYA 4QUSA 2Z3OA 4IF5A 4IUSA 4XPLA 3S6KA 4I49A 1S7KA 4CGOA 3W91A 1Q2CA 3JTKA 4B13A 1ZO0A 2FE7A 3DNSA 3F5BA 1BO4A 1S3ZA 4KOTA 1PUAA 1J4JA 4OLLA 5J8FA 4MY0A 1NMTA 2CNMA 4CAVA 4JXQA 4MHDA 2OB0A 4A31A 1KUVA 4PV6A 2VQYA 3ZZIA 2F5IA 4FD7A 2PRBA 4A32A 2FCKA 2ATRA 5F49A 1IICA 3D8PA 2YNEA 4YGOA 2VBQA 4UWIA 5CNPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WR7 A;  3G8W A;  3S6F A;  4MY3 A;  1IB1 E;  3D2M A;  2R7H A;  3OWC A;  2B4D A;  4RI1 A;  3F0A A;  2WPX A;  1IYK A;  3P2F A;  3S6H A;  1UFH A;  4AVC A;  4R3L A;  2Q0Y A;  1IID A;  3DDD A;  1QSO A;  3EO4 A;  4B5P A;  2CY2 A;  4MJ8 A;  2Y0M A;  2G3T A;  3I3G A;  4KLV A;  3FBU A;  3QAH A;  1S60 A;  1KUX A;  4K30 A;  4R57 A;  3TO9 A;  5JPH A;  2ZW4 A;  2K5T A;  2ZXV A;  3GYA A;  1Y7R A;  2Q7B A;  5DWM A;  4KOS A;  1B6B A;  2OZU A;  2ARH A;  1Q2D A;  1V0C A;  4FD4 A;  3D2P A;  1QSR A;  4L89 A;  4KUB A;  2J8N A;  2FIW A;  2Q04 A;  4QBJ A;  3EC4 A;  4NCZ A;  2WPW A;  1NE9 A;  4H6U A;  4KOW A;  3BLN A;  4AG9 A;  5JQ4 A;  1S5K A;  1TIQ A;  2P6F A;  4ONU A;  2PSW A;  4Y49 B;  2R8V A;  2BEI A;  3SXN A;  2D4O A;  3TOA A;  2EUI A;  1RXT A;  1YR0 A;  3CXP A;  1XIX A;  4F6A A;  3FNC A;  2QEC A;  3DR8 A;  4UWJ A;  1RO5 A;  3PGP A;  2VI7 A;  3TO7 A;  1M44 A;  2BL1 A;  1CJW A;  3IWG A;  4XNH B;  3R95 A;  4NEX A;  2G0B A;  2FXF A;  4YRH A;  5HMN A;  3TE4 A;  2JDC A;  1MK4 A;  5KTD A;  3G3S A;  5H84 A;  3TFY A;  4E2A A;  3GY9 A;  4E8O A;  3K9U A;  3IGR A;  2EVN A;  3D3S A;  2PR8 A;  3EXN A;  2Z0Z A;  4XPD C;  5EBV A;  4QB9 A;  5H86 A;  1ON0 A;  2OH1 A;  2G3A A;  3E0K A;  1VHS A;  3V8I A;  1XMT A;  4PSW A;  4RS2 A;  3DSB A;  1R57 A;  2FS5 A;  3DR6 A;  3JUW A;  1S7L A;  4X5K A;  4JWP A;  1XF8 A;  4HNX B;  2R98 A;  2QIR A;  3CXQ A;  3R1K A;  4AVA A;  4U9Z A;  3PP9 A;  4KVX A;  5KTC A;  2Z11 A;  2I00 A;  3EY5 A;  1YLE A;  1WK4 A;  1Q2Y A;  2BSW A;  2B3V A;  1KZF A;  4HNW B;  5E96 A;  4R3K A;  2FSR A;  1PU9 A;  3TTH A;  2PC1 A;  2AE6 A;  1N71 A;  2R1I A;  2AJ6 A;  3FIX A;  4KVM E;  3FB3 A;  5HH1 A;  1YX0 A;  3FRM A;  2H5M A;  3FXT A;  5FVJ A;  1QST A;  4B5O A;  2PR1 A;  3R9G A;  1Z4R A;  4ORF A;  4KZT A;  5DWN A;  5I0C A;  4NXY A;  2PDO A;  1SQH A;  3GKR A;  2B4D B;  2FIA A;  3P2H A;  3N7Z A;  2P6E A;  2REE A;  4OAE A;  4H6Z A;  1QSN A;  2CNT A;  4CAW A;  2JLM A;  2PQ8 A;  1MJB A;  4XPK A;  4LX9 A;  2B5G B;  1VKC A;  4LUA A;  4CRY B;  5F47 A;  4B5P B;  3H4Q A;  4MI4 A;  1FY7 A;  4UBR A;  2P6G A;  4AVB A;  1M4I A;  1YVK A;  3R96 A;  1M4G A;  1L0C A;  4ZBG A;  2B58 A;  1YK3 A;  3TO6 A;  2B3U A;  4KOX A;  4BMH A;  1Y9W A;  3C26 A;  5C82 A;  1XEB A;  2OZG A;  2JDD A;  3B8G A;  3TOB A;  1YVO A;  3BJ8 A;  2DXQ A;  4J3G A;  5IV0 A;  4R87 A;  4QC6 A;  1GHE A;  1M1D A;  3KKW A;  4FD5 A;  2GIV A;  3S6G A;  2ZW5 A;  3F8K A;  4KOV A;  4GS4 A;  5EC4 A;  1P0H A;  3PZJ A;  1P4N A;  3I9S A;  4KOR A;  4U5Y A;  5IX3 A;  2J8R A;  1MJ9 A;  4AG7 A;  4QVT A;  2HUZ A;  4Y49 C;  3VWE A;  4MBU A;  3FYN A;  4OAD A;  3NE7 A;  1XE4 A;  4L8A A;  2KCW A;  4CS0 B;  1IYL A;  4KOY A;  4M3S A;  1KUY A;  4JD6 A;  4CRZ B;  2Z10 A;  2VZY A;  2A4N A;  2GAN A;  4AB7 A;  2FT0 A;  4XNH C;  4KVO E;  5ISV A;  4NF1 A;  2NMT A;  3JVN A;  4YFJ A;  5IB0 A;  2C27 A;  3T9Y A;  4U9Y A;  2HV2 A;  4CAX A;  4EVY A;  2P0W A;  4E0A A;  1Y9K A;  2IL4 A;  2RC4 A;  3TT2 A;  2B5G A;  5F46 A;  3MGD A;  4UA3 A;  4DNC A;  5GCN A;  3VWD A;  2Q4V A;  2FL4 A;  4F0Y A;  2REF A;  1NSL A;  2X7B A;  3CXS A;  3UY5 A;  3W6S A;  3ZJ0 A;  5KTA A;  2Q4Y A;  4JJX A;  4KUA A;  2OZH A;  1S7N A;  2ZW7 A;  3SHP A;  4HNY B;  3SXO A;  1K4J A;  2B4B A;  2JEV A;  2GE3 A;  4II9 A;  2BUE A;  4M85 A;  4FD6 A;  4H89 A;  4JLY A;  1Z9U A;  4R9M A;  2J8M A;  3LD2 A;  3TCV A;  4NSQ A;  2I79 A;  1I1D A;  1MJA A;  4XPD B;  2Q44 A;  4PK2 A;  1B87 A;  1WWZ A;  3R9E A;  4KOU A;  1CM0 A;  4HKF A;  2OU2 A;  2QML A;  1S7F A;  3W6X A;  3QB8 A;  2O28 A;  1I21 A;  2VEZ A;  1QSM A;  1OZP A;  4PSX A;  3R9F A;  2VZZ A;  3EFA A;  4JXR A;  4PK3 A;  5C88 A;  1YRE A;  1I12 A;  2D4P A;  2ZW6 A;  2ZPA A;  1Z4E A;  3RYO A;  4KLW A;  5J8C A;  1LRZ A;  5F48 A;  3LOD A;  2VXK A;  1YGH A;  2CNS A;  1U6M A;  3BJ7 A;  1M4D A;  3T90 A;  1BOB A;  2HQY A;  4QUS A;  4IF5 A;  4IUS A;  4XPL A;  3S6K A;  4I49 A;  1S7K A;  3W91 A;  1Q2C A;  2FE7 A;  3DNS A;  3F5B A;  1BO4 A;  1S3Z A;  4KOT A;  1PUA A;  1J4J A;  4OLL A;  5J8F A;  4MY0 A;  1NMT A;  2CNM A;  4CAV A;  4JXQ A;  4MHD A;  2OB0 A;  1KUV A;  4PV6 A;  2VQY A;  3ZZI A;  2F5I A;  4FD7 A;  2PRB A;  2FCK A;  2ATR A;  5F49 A;  1IIC A;  3D8P A;  4YGO A;  2VBQ A;  4UWI A;  5CNP A; 
#chains in the Genus database with same CATH topology
 4OKO A;  3WR7 A;  2PJ8 A;  3G8W A;  3S6F A;  1LOK A;  2ZOF A;  2ZEL A;  4MY3 A;  1IB1 E;  1F57 A;  3D2M A;  4CGN A;  1LAM A;  2ZEM A;  3IO1 A;  3T8W A;  3SJX A;  2R7H A;  4PXE A;  3RO0 A;  3OWC A;  5AG6 A;  4A33 A;  2B4D A;  5AG7 A;  4NGS A;  4RI1 A;  3F0A A;  2WPX A;  3GB0 A;  5LRG A;  3IC1 A;  1IYK A;  1NSA A;  1Q7L A;  1QQ9 A;  3P2F A;  3S6H A;  5K8O A;  5LYL A;  2BCO A;  3FEC A;  3KZW A;  1UFH A;  3I1U A;  4AVC A;  1IOF A;  4R3L A;  4UIA A;  2Q0Y A;  1IID A;  1YME A;  1QSO A;  2QVP A;  3DDD A;  3EO4 A;  3V38 A;  2V8H A;  4B5P A;  2CY2 A;  4MJ8 A;  5HVH A;  2GFQ A;  1LFW A;  3KL9 A;  2Q43 A;  2JBK A;  2Y0M A;  2C6P A;  2G3T A;  3I3G A;  4KLV A;  2PJ0 A;  2PE3 A;  3FBU A;  3QAH A;  1S60 A;  1VGY A;  1KUX A;  2AFU A;  4K30 A;  3PB6 X;  4R57 A;  1TKJ A;  3CPA A;  3TO9 A;  3GLJ A;  5JPH A;  2ZW4 A;  2K5T A;  2ZXV A;  3CDX A;  1XOV A;  3CPX A;  3GYA A;  3D67 A;  2BO9 A;  3KQX A;  4A37 A;  2F8H A;  1Y7R A;  1QMU A;  4GXH A;  4A95 A;  2Q7B A;  5DWM A;  4KOS A;  3FF3 A;  3HUV A;  1B6B A;  2J9A A;  2OZU A;  2ARH A;  1LAN A;  1AYE A;  1Q2D A;  1V0C A;  1VHE A;  4FD4 A;  4UFV A;  3D2P A;  3FVL A;  1CG2 A;  4B10 A;  1TF9 A;  4LQG A;  3GUX A;  4PXB A;  1RTQ A;  1QSR A;  5K8N A;  4FAI A;  3D7F A;  4L89 A;  4KUB A;  2J8N A;  1M4L A;  2FIW A;  2Q04 A;  2ZEO A;  4QBJ A;  3EC4 A;  4NCZ A;  2WPW A;  1NE9 A;  2DEA A;  4H6U A;  4BD9 A;  1ZG9 A;  4C2X A;  3B3S A;  4IAV A;  4MHY A;  3B3C A;  3BLN A;  4KOW A;  1Z2L A;  4KS9 A;  2XEG A;  3H8F A;  2WYR A;  4P10 A;  4P44 A;  4P4F A;  1S5K A;  4YU9 A;  4B12 A;  5JQ4 A;  3IU1 A;  1TIQ A;  5CBM A;  5K8P A;  2P6F A;  4ONU A;  5LYI A;  4B14 A;  2PSW A;  4Y49 B;  1ARL A;  2V8D A;  2R8V A;  3QNV A;  4UFX A;  3D68 A;  2BEI A;  4X8I A;  1XBU A;  1X12 A;  2C6C A;  4TWE A;  3SXN A;  3V7Z A;  3IEH A;  2ZEE A;  2D4O A;  3TOA A;  2POK A;  2EUI A;  3LAC A;  1RXT A;  1YR0 A;  3CXP A;  4CYQ A;  1XIX A;  3NE8 A;  4P4I A;  3FMC A;  4F6A A;  3FNC A;  5F09 A;  4UCP A;  2QEC A;  1Z8L A;  3DR8 A;  3GIU A;  4UWJ A;  1RO5 A;  2YGW A;  3PGP A;  2VI7 A;  1CP6 A;  1M44 A;  3TO7 A;  2BL1 A;  3BI0 A;  4M6H A;  1CJW A;  3IWG A;  5LYF A;  2WUU A;  1DE4 C;  4XNH B;  3R95 A;  4NEX A;  4OC0 A;  2IJZ A;  2NSM A;  2G0B A;  2G9D A;  2FXF A;  4YRH A;  5HMN A;  3IWW A;  3TE4 A;  2JDC A;  1MK4 A;  4CYP A;  5KTD A;  3NH8 A;  3G3S A;  3KR4 A;  2CTB A;  1PYT B;  4R7M A;  4F9U A;  5H84 A;  3TFY A;  2AFM A;  2Z3N A;  4E2A A;  4PPZ A;  5G20 A;  2PCU A;  3GY9 A;  4E8O A;  4OC4 A;  1IOI A;  5AGE A;  3K9U A;  2ANP A;  2V8V A;  4MHZ A;  3IGR A;  2EVN A;  3D3S A;  2PR8 A;  3WC6 A;  1IU8 A;  4MFL A;  4WWV A;  5IB9 A;  4R76 A;  3EXN A;  2AFO A;  2Z0Z A;  3NH4 A;  2PIZ A;  4OC5 A;  4XPD C;  4BBH A;  2Z3K A;  2IMO A;  5EBV A;  4QB9 A;  5H86 A;  4OME A;  4F9V A;  1ON0 A;  4RN7 A;  2CF4 A;  4C7I A;  3RBU A;  2OH1 A;  2V77 A;  1JWQ A;  2G3A A;  3E0K A;  5JH9 A;  1HDQ A;  1VHS A;  3N5F A;  3B7I A;  5D8N A;  3JRU A;  3V8I A;  5A28 A;  4F0X A;  1XMT A;  1HEE A;  2Z3L A;  4PSW A;  4RS2 A;  3DSB A;  2Z3M A;  4UEF A;  1BAV A;  3CT9 A;  4FUU A;  1KWM A;  1R57 A;  2FS5 A;  3DR6 A;  4M6I A;  3JUW A;  1S7L A;  4X5K A;  2AFX A;  3HLP A;  4JWP A;  3A9L A;  1AUG A;  1ZLI A;  2IQ6 A;  1XF8 A;  2C1C A;  2QYV A;  1IY7 A;  4HNX B;  2R98 A;  2QIR A;  2VL1 A;  3CXQ A;  5HXD A;  1UWY A;  1OBR A;  4OC2 A;  2EBJ A;  2ZEN A;  4UIB A;  5HVG A;  3KGQ A;  3R1K A;  2BOA A;  4AVA A;  4U9Z A;  3BHX A;  3PP9 A;  4M6G A;  1DTD A;  2PJA A;  4KVX A;  4LQ6 A;  3FX6 A;  2O4H A;  3IIB A;  5KTC A;  2Z11 A;  2YNC A;  2I00 A;  3EY5 A;  1YLE A;  1WK4 A;  1Q2Y A;  2BSW A;  4FBE A;  4KSA A;  2B3V A;  1KZF A;  4HNW B;  5E96 A;  1CPS A;  4C2Z A;  2JEW A;  4H2K A;  2PRQ A;  4OID A;  4R3K A;  3D4U A;  2FSR A;  1LAP A;  1PU9 A;  1Y0Y A;  4MFQ A;  1YW4 A;  3TTH A;  2EK8 A;  2PC1 A;  1LCP A;  2AE6 A;  1N71 A;  2R1I A;  4KSF A;  5A27 A;  2AJ6 A;  2ZEP A;  3FIX A;  3KR5 A;  3FB3 A;  4KVM E;  4NJR A;  2PVW A;  5HH1 A;  1YX0 A;  4P45 A;  3FRM A;  2EO8 A;  3MRU A;  2H5M A;  3FXT A;  5FVJ A;  1QST A;  3DLJ A;  4BIN A;  4B5O A;  1HDU A;  2PR1 A;  3R9G A;  1Z4R A;  4ORF A;  2NYQ A;  4KZT A;  3IU2 A;  5DWN A;  4CYN A;  5I0C A;  5G22 A;  2GLF A;  4NXY A;  2PDO A;  1SQH A;  2PJB A;  3GKR A;  4CAF A;  2B4D B;  1CP7 A;  2FIA A;  3P2H A;  3N7Z A;  1XFO A;  2ZOG A;  2P6E A;  4UF4 A;  2REE A;  4OAE A;  1TKF A;  4H6Z A;  3BI1 A;  1QSN A;  2CNT A;  3MN8 A;  4CAW A;  2JLM A;  2PQ8 A;  5K8M A;  4CYO A;  2PJ3 A;  2AFW A;  2XEI A;  1YLO A;  3H8G A;  1MJB A;  4XPK A;  4R8F A;  2HC9 A;  3SI1 A;  4LX9 A;  2PJ6 A;  2PJ4 A;  2B5G B;  1CPX A;  1VKC A;  2PJ5 A;  4LUA A;  4CRY B;  5F47 A;  2EWB A;  4A30 A;  2XEF A;  2RB7 A;  4P4B A;  4AXV A;  4G1P A;  1F2O A;  3H4Q A;  4MI4 A;  3H8E A;  4NGP A;  4B5P B;  3PFO A;  1FY7 A;  4B11 A;  4UBR A;  2P6G A;  4MFZ A;  2GRE A;  2XEJ A;  4AVB A;  4IHM A;  2ZEH A;  3TC8 A;  2Q7S A;  3VAR A;  1M4I A;  4NJQ A;  1YVK A;  3R96 A;  4B6Z A;  3ISZ A;  5AG4 A;  1M4G A;  1BLL E;  1L0C A;  2Q51 A;  4X2T A;  4ZBG A;  1Z8T A;  2Q4Z A;  2PJ1 A;  1H8L A;  5LRJ A;  5JGF A;  2PIY A;  5LYD A;  2DF5 A;  2B58 A;  3KAS A;  1YK3 A;  3TO6 A;  4C7H A;  5BWA B;  2B3U A;  4KOX A;  4Q38 A;  4UCN A;  3D7D A;  4BMH A;  1Y9W A;  3C26 A;  2AFS A;  5AG5 A;  4OIW A;  5C82 A;  3KQZ A;  1XEB A;  4O23 A;  2ODF A;  1GYT A;  3IFE A;  5G1Z A;  4UCM A;  4PQA A;  4A39 A;  4ZYQ A;  2DPT A;  2OZG A;  2JDD A;  3B8G A;  5ELY A;  3D7H A;  4DYO A;  1YW6 A;  2YNC C;  1TF8 A;  3TOB A;  1YVO A;  4C68 A;  3FED A;  3BJ8 A;  2DXQ A;  4J3G A;  4PXD A;  5IV0 A;  1ARM A;  7CPA A;  1CX8 A;  2CXA A;  3H5Z A;  4R87 A;  4QC6 A;  2PJC A;  3L2N A;  1BPM A;  4TNU A;  1GHE A;  1M1D A;  4MHP A;  3BXM A;  1EE3 P;  3KKW A;  4FD5 A;  3NH5 A;  4EME A;  2GIV A;  4K3N A;  3PBE A;  5I4M A;  3S6G A;  2ZW5 A;  3PB4 X;  3F8K A;  4MCP A;  4ONW A;  3SJF A;  1Z5R A;  3FJU A;  4KOV A;  4GS4 A;  5D29 A;  5EC4 A;  3RAM A;  1P0H A;  2ZED A;  1ZLH A;  3PZJ A;  1IGB A;  1P4N A;  3I9S A;  4C2Y A;  4KOR A;  4U5Y A;  4A38 A;  5IX3 A;  2QJ8 A;  2J8R A;  1MJ9 A;  4AG7 A;  6CPA A;  3B3T A;  4QVT A;  2HUZ A;  4Y49 C;  3VWE A;  4MBU A;  3FYN A;  4NGN A;  3TX8 A;  4OAD A;  4WJB A;  4MRI A;  2JBJ A;  1TKH A;  1XRY A;  3NE7 A;  1XE4 A;  4L8A A;  3ISX A;  2WSA A;  3PB7 X;  4NFR A;  4DUK A;  4A94 A;  2KCW A;  4IK2 A;  4CS0 B;  2CIJ A;  4ZX8 A;  1IYL A;  3PBB A;  3SI0 A;  2PJ2 A;  3KHX A;  4KOY A;  4M3S A;  3CZX A;  3WC5 A;  1KUY A;  4JD6 A;  4CRZ B;  1X10 A;  4MFJ A;  2Z10 A;  3PB8 X;  4X3R A;  2VZY A;  3K2K A;  5G21 A;  2A4N A;  2GAN A;  3IWE A;  3PFE A;  1AMP A;  2Z3P A;  3RNZ A;  4AB7 A;  1VHO A;  2FT0 A;  2ABZ A;  2PJ9 A;  4CGL A;  4XNH C;  1R3N A;  4ZY0 A;  4KVO E;  2V8G A;  5ISV A;  2ZEF A;  4JYW A;  4NF1 A;  4CPA A;  2NMT A;  5DS0 A;  3K9T A;  3JVN A;  1YQE A;  4YFJ A;  1BPN A;  3D7G A;  4FWU A;  4ZI6 A;  5IB0 A;  3NFZ A;  2C27 A;  4EFD A;  3LWU A;  3NA6 A;  3B2Y A;  3T9Y A;  4U9Y A;  8CPA A;  2HV2 A;  2PVV A;  3WAB A;  4OP4 A;  4CAX A;  4EVY A;  2P0W A;  3SJE A;  4E0A A;  1Y9K A;  4OC3 A;  2IL4 A;  2RC4 A;  4UFW A;  3TT2 A;  3QAY A;  2B5G A;  4MCS A;  3MGD A;  4UA3 A;  5F46 A;  4ZGY B;  4DNC A;  5GCN A;  3VWD A;  2Q4V A;  2HB6 A;  4DJL A;  2FL4 A;  4MFK A;  4F0Y A;  1TXR A;  5J1Q A;  1XMB A;  3D66 A;  2REF A;  1NSL A;  2X7B A;  4MCQ A;  3CXS A;  3UY5 A;  3W6S A;  3ZJ0 A;  5KTA A;  2Q4Y A;  4JJX A;  4MMO A;  4PXC A;  4KUA A;  2OZH A;  3WT4 A;  4MCR A;  1S7N A;  2ZW7 A;  4OC1 A;  2FVG A;  3SHP A;  3PB9 X;  3S9M A;  4HNY B;  4F8Z A;  3SXO A;  1K4J A;  2B4B A;  2JEV A;  2GE3 A;  2GLJ A;  2BUE A;  4M85 A;  4II9 A;  4FD6 A;  4H89 A;  4JLY A;  2OR4 A;  1Z9U A;  3KHZ A;  4JZ0 A;  4R9M A;  4UEE A;  2J8M A;  3LD2 A;  1ELM P;  3TCV A;  4NSQ A;  4NGR A;  1JQG A;  3PEI A;  2I79 A;  1I1D A;  4AG9 A;  1MJA A;  1Y7E A;  4XPD B;  2Q44 A;  4PK2 A;  1B87 A;  1WWZ A;  4MXU A;  3R9E A;  4KOU A;  1CM0 A;  2C6G A;  2OU2 A;  4HKF A;  4NGQ A;  2QML A;  1S7F A;  2CTC A;  3W6X A;  2WZN A;  3QB8 A;  2O28 A;  1I21 A;  2DPS A;  3VAT A;  4MFP A;  2GU2 A;  2VEZ A;  1QSM A;  1OZP A;  2RFH A;  4P4E A;  4PSX A;  1XJO A;  2O53 A;  3R9F A;  2VZZ A;  3EFA A;  4CAE A;  4JXR A;  4PK3 A;  5C88 A;  4KSI A;  1YRE A;  3RZA A;  1I12 A;  2YND A;  1ZG7 A;  2D4P A;  1VIX A;  4ZY1 A;  2ZW6 A;  2ZPA A;  1Z4E A;  1A2Z A;  3RYO A;  4NGM A;  4KLW A;  3SI2 A;  1ZG8 A;  4HPS A;  1Y0R A;  4R6T A;  5CPA A;  1PCA A;  1LRZ A;  5F48 A;  5J8C A;  3LOD A;  2VXK A;  1YGH A;  1ELL P;  2CNS A;  2F7V A;  3KI9 A;  4CGM A;  1U6M A;  3BJ7 A;  4A2Z A;  4MHN A;  4Q36 A;  4CGP A;  1M4D A;  3T90 A;  1BOB A;  1CBX A;  2HQY A;  4QUS A;  2Z3O A;  1FNO A;  4IF5 A;  4IUS A;  5THW A;  5JM6 A;  4GM5 A;  1FT7 A;  1Z8W A;  4XPL A;  4P4J A;  2ZEG A;  3S6K A;  3VH9 A;  4I49 A;  1YSJ A;  3SJG A;  5LRK A;  4Q7A A;  1S7K A;  3B35 A;  4NGT A;  4CGO A;  4RUH A;  1F2P A;  3B3W A;  1Q2C A;  3W91 A;  3FEE A;  4W9Y A;  3FH4 A;  4EWT A;  3JTK A;  2EK9 A;  4B13 A;  1ZO0 A;  2FE7 A;  3DNS A;  3F5B A;  1BO4 A;  1R43 A;  1S3Z A;  4KOT A;  1PUA A;  1J4J A;  3DGV A;  4OLL A;  4P4D A;  5J8F A;  5EMI A;  4MY0 A;  1NMT A;  2PJ7 A;  1Z8X A;  2CNM A;  3IJ3 A;  4CAV A;  4JXQ A;  4MHD A;  2OB0 A;  4A31 A;  1KUV A;  3B3V A;  4PV6 A;  4ZX9 A;  2VQY A;  3ZZI A;  2F5I A;  4FD7 A;  2PRB A;  4Z65 A;  3LMS A;  4YWY A;  4A32 A;  2FCK A;  3WC7 A;  5HVF A;  2ATR A;  5F49 A;  1IIC A;  4P6Y A;  3D8P A;  2YNE A;  4UEZ A;  4YGO A;  3S9L A;  2VBQ A;  3PRT A;  4UWI A;  2OOT A;  2AFZ A;  4ZY2 A;  3S9N A;  5CNP A;  2I3C A; 
#chains in the Genus database with same CATH homology
 3WR7 A;  3G8W A;  3S6F A;  4MY3 A;  1IB1 E;  3D2M A;  4CGN A;  2R7H A;  3OWC A;  5AG6 A;  4A33 A;  2B4D A;  5AG7 A;  4RI1 A;  3F0A A;  2WPX A;  1IYK A;  3P2F A;  3S6H A;  1UFH A;  4AVC A;  4R3L A;  2Q0Y A;  1IID A;  3DDD A;  1QSO A;  3EO4 A;  4B5P A;  2CY2 A;  4MJ8 A;  2Y0M A;  2G3T A;  3I3G A;  4KLV A;  3FBU A;  3QAH A;  1S60 A;  1KUX A;  4K30 A;  4R57 A;  3TO9 A;  5JPH A;  2ZW4 A;  2K5T A;  2ZXV A;  3GYA A;  1Y7R A;  4A95 A;  2Q7B A;  5DWM A;  4KOS A;  1B6B A;  2OZU A;  2ARH A;  1Q2D A;  1V0C A;  4FD4 A;  4UFV A;  3D2P A;  4B10 A;  1QSR A;  4L89 A;  4KUB A;  2J8N A;  2FIW A;  2Q04 A;  4QBJ A;  3EC4 A;  4NCZ A;  2WPW A;  1NE9 A;  4H6U A;  4C2X A;  4KOW A;  3BLN A;  4AG9 A;  4KS9 A;  5JQ4 A;  4B12 A;  1S5K A;  3IU1 A;  1TIQ A;  2P6F A;  4ONU A;  2PSW A;  4Y49 B;  4UFX A;  2R8V A;  2BEI A;  3SXN A;  2D4O A;  3TOA A;  2EUI A;  1RXT A;  1YR0 A;  3CXP A;  4CYQ A;  1XIX A;  4F6A A;  3FNC A;  4UCP A;  2QEC A;  3DR8 A;  4UWJ A;  1RO5 A;  2YGW A;  3PGP A;  2VI7 A;  3TO7 A;  1M44 A;  2BL1 A;  1CJW A;  3IWG A;  2WUU A;  4XNH B;  3R95 A;  4NEX A;  2G0B A;  2FXF A;  4YRH A;  5HMN A;  3TE4 A;  2JDC A;  1MK4 A;  4CYP A;  5KTD A;  3G3S A;  5H84 A;  3TFY A;  2Z3N A;  4E2A A;  5G20 A;  3GY9 A;  4E8O A;  5AGE A;  3K9U A;  3IGR A;  2EVN A;  3D3S A;  2PR8 A;  4MFL A;  3EXN A;  2Z0Z A;  4XPD C;  4BBH A;  2Z3K A;  5EBV A;  4QB9 A;  5H86 A;  1ON0 A;  4C7I A;  2OH1 A;  2G3A A;  3E0K A;  1VHS A;  3V8I A;  5A28 A;  4F0X A;  1XMT A;  2Z3L A;  4PSW A;  4RS2 A;  3DSB A;  2Z3M A;  1R57 A;  2FS5 A;  3DR6 A;  3JUW A;  1S7L A;  4X5K A;  4JWP A;  3A9L A;  1XF8 A;  4HNX B;  2R98 A;  2QIR A;  3CXQ A;  3R1K A;  4AVA A;  4U9Z A;  3PP9 A;  4KVX A;  5KTC A;  2Z11 A;  2YNC A;  2I00 A;  3EY5 A;  1YLE A;  1WK4 A;  1Q2Y A;  2BSW A;  4KSA A;  2B3V A;  1KZF A;  4HNW B;  5E96 A;  4C2Z A;  4R3K A;  2FSR A;  1PU9 A;  4MFQ A;  3TTH A;  2PC1 A;  2AE6 A;  1N71 A;  2R1I A;  4KSF A;  5A27 A;  2AJ6 A;  3FIX A;  4KVM E;  3FB3 A;  5HH1 A;  1YX0 A;  3FRM A;  2H5M A;  3FXT A;  5FVJ A;  1QST A;  4B5O A;  2PR1 A;  3R9G A;  1Z4R A;  4ORF A;  4KZT A;  5DWN A;  3IU2 A;  4CYN A;  5I0C A;  5G22 A;  4NXY A;  2PDO A;  1SQH A;  3GKR A;  4CAF A;  2B4D B;  2FIA A;  3P2H A;  3N7Z A;  2P6E A;  2REE A;  4OAE A;  4H6Z A;  1QSN A;  2CNT A;  4CAW A;  2JLM A;  2PQ8 A;  4CYO A;  1MJB A;  4XPK A;  4LX9 A;  2B5G B;  1VKC A;  4LUA A;  4CRY B;  5F47 A;  4A30 A;  4B14 A;  4B5P B;  3H4Q A;  4MI4 A;  1FY7 A;  4B11 A;  4UBR A;  2P6G A;  4MFZ A;  4AVB A;  1M4I A;  1YVK A;  3R96 A;  5AG4 A;  1M4G A;  1L0C A;  4ZBG A;  2B58 A;  1YK3 A;  3TO6 A;  4C7H A;  5BWA B;  2B3U A;  4KOX A;  4Q38 A;  4UCN A;  4BMH A;  1Y9W A;  3C26 A;  5AG5 A;  5C82 A;  1XEB A;  5G1Z A;  4UCM A;  2DPT A;  2OZG A;  2JDD A;  3B8G A;  2YNC C;  3TOB A;  1YVO A;  4C68 A;  3BJ8 A;  2DXQ A;  4J3G A;  5IV0 A;  2CXA A;  3H5Z A;  4R87 A;  4QC6 A;  1GHE A;  1M1D A;  3KKW A;  4FD5 A;  2GIV A;  3S6G A;  2ZW5 A;  3F8K A;  4KOV A;  4GS4 A;  5EC4 A;  1P0H A;  3PZJ A;  1P4N A;  3I9S A;  4C2Y A;  4KOR A;  4U5Y A;  5IX3 A;  2J8R A;  1MJ9 A;  4AG7 A;  4QVT A;  2HUZ A;  4Y49 C;  3VWE A;  4MBU A;  3FYN A;  4OAD A;  3NE7 A;  1XE4 A;  4L8A A;  2WSA A;  2KCW A;  4CS0 B;  1IYL A;  4KOY A;  4M3S A;  1KUY A;  4JD6 A;  4CRZ B;  4MFJ A;  2Z10 A;  2VZY A;  5G21 A;  2A4N A;  2GAN A;  3IWE A;  2Z3P A;  4AB7 A;  2FT0 A;  4CGL A;  4XNH C;  4KVO E;  5ISV A;  4NF1 A;  2NMT A;  3JVN A;  4YFJ A;  5IB0 A;  2C27 A;  3T9Y A;  4U9Y A;  2HV2 A;  4CAX A;  4EVY A;  2P0W A;  4E0A A;  1Y9K A;  2IL4 A;  2RC4 A;  4UFW A;  3TT2 A;  2B5G A;  5F46 A;  3MGD A;  4UA3 A;  4ZGY B;  4DNC A;  5GCN A;  3VWD A;  2Q4V A;  2FL4 A;  4MFK A;  4F0Y A;  2REF A;  1NSL A;  2X7B A;  3CXS A;  3UY5 A;  3W6S A;  3ZJ0 A;  5KTA A;  2Q4Y A;  4JJX A;  4KUA A;  2OZH A;  1S7N A;  2ZW7 A;  3SHP A;  4HNY B;  3SXO A;  1K4J A;  2B4B A;  2JEV A;  2GE3 A;  4II9 A;  2BUE A;  4M85 A;  4FD6 A;  4H89 A;  4JLY A;  1Z9U A;  4R9M A;  2J8M A;  3LD2 A;  3TCV A;  4NSQ A;  2I79 A;  1I1D A;  1MJA A;  4XPD B;  2Q44 A;  4PK2 A;  1B87 A;  1WWZ A;  3R9E A;  4KOU A;  1CM0 A;  4HKF A;  2OU2 A;  2QML A;  1S7F A;  3W6X A;  3QB8 A;  2O28 A;  1I21 A;  2DPS A;  4MFP A;  2VEZ A;  1QSM A;  1OZP A;  4PSX A;  3R9F A;  2VZZ A;  3EFA A;  4CAE A;  4JXR A;  4PK3 A;  5C88 A;  1YRE A;  1I12 A;  2YND A;  2D4P A;  2ZW6 A;  2ZPA A;  1Z4E A;  3RYO A;  4KLW A;  5J8C A;  1LRZ A;  5F48 A;  3LOD A;  2VXK A;  1YGH A;  2CNS A;  4CGM A;  1U6M A;  3BJ7 A;  4A2Z A;  4Q36 A;  4CGP A;  1M4D A;  3T90 A;  1BOB A;  2HQY A;  4QUS A;  2Z3O A;  4IF5 A;  4IUS A;  4XPL A;  3S6K A;  4I49 A;  1S7K A;  4CGO A;  3W91 A;  1Q2C A;  3JTK A;  4B13 A;  1ZO0 A;  2FE7 A;  3DNS A;  3F5B A;  1BO4 A;  1S3Z A;  4KOT A;  1PUA A;  1J4J A;  4OLL A;  5J8F A;  4MY0 A;  1NMT A;  2CNM A;  4CAV A;  4JXQ A;  4MHD A;  2OB0 A;  4A31 A;  1KUV A;  4PV6 A;  2VQY A;  3ZZI A;  2F5I A;  4FD7 A;  2PRB A;  4A32 A;  2FCK A;  2ATR A;  5F49 A;  1IIC A;  3D8P A;  2YNE A;  4YGO A;  2VBQ A;  4UWI A;  5CNP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...