4UA3A

Crystal structure of selenomethionine labeled spnatd
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
193
structure length
186
Chain Sequence
SRRMVTLEDVDFLKNLGVWVEIYHHLEKGLLQQCFNLVKKNMEALYRQSSFGWDDSEKLKEMEMEKLEYICIFEKTSKKLVGFLSFEDTVEAGLTCLYIYEIQLDEHIRGRNVGKWLLKNASILAYRRNLKYIFLTVFSANLNALNFYHHFDFVPHESSPQEKKFRSGKVIHPDYYILYTKSRKDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uncharacterized N-acetyltransferase C825.04c
publication title The Molecular Basis for Histone H4- and H2A-Specific Amino-Terminal Acetylation by NatD.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 52
structure length 186
sequence length 193
chains with identical sequence B
ec nomenclature ec 2.3.1.257: N-terminal L-serine N(alpha)-acetyltransferase NatD.
pdb deposition date 2014-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ua3A00
4KOTA 3EC4A 1IB1E 2GANA 5J8CA 2JDDA 4UBRA 1I21A 2C27A 2Q4YA 4MY3A 4YFJA 3R9EA 2QMLA 3TCVA 4KZTA 4NCZA 4L8AA 3S6KA 3D8PA 3PGPA 2R98A 2IL4A 2B4BA 4QC6A 1P4NA 4B5PA 2K5TA 1MK4A 1S5KA 3VWDA 1PU9A 1IYKA 2VQYA 3MGDA 4CRYB 5ISVA 1SQHA 3LODA 2Z10A 2Q44A 4H89A 3R95A 2J8RA 4GS4A 4H6UA 3W6XA 3V8IA 2PRBA 1QSTA 2ZXVA 3QB8A 4JXRA 4PK2A 4II9A 3SHPA 3W91A 1Y9KA 2CNTA 3FXTA 3E0KA 3DR8A 3C26A 3IWGA 1B6BA 4FD6A 4M3SA 2GE3A 4KVME 3UY5A 2Z11A 5C88A 2PC1A 3R96A 3F8KA 2REFA 2P6EA 2FIWA 4KOYA 4R9MA 5EBVA 4L89A 1LRZA 2KCWA 1K4JA 2ATRA 5H86A 3DR6A 1NMTA 1I1DA 4NSQA 1XIXA 3NE7A 1TIQA 3I3GA 5DWMA 5IB0A 2WPXA 3TOAA 4YGOA 2PQ8A 3D2MA 2P6GA 5DWNA 4J3GA 2A4NA 1UFHA 3IGRA 3S6GA 1XEBA 4RI1A 2VXKA 4UWIA 4XPKA 3CXQA 2BEIA 4OADA 3B8GA 2OZGA 4IF5A 5FVJA 4KOSA 2ZPAA 3ZJ0A 1M1DA 2J8NA 1XF8A 1M4GA 3BJ7A 4AB7A 3RYOA 4HNWB 1YGHA 3DSBA 1YVKA 2OZHA 4XPDB 2ZW4A 2VZYA 1QSMA 2H5MA 4X5KA 4KUAA 1YREA 5GCNA 4E8OA 1Z4EA 3TOBA 2FXFA 3OWCA 4NXYA 4CS0B 2FE7A 3FIXA 4HNXB 4KOUA 1RXTA 1Z9UA 2JLMA 2OH1A 3GYAA 4MHDA 1B87A 3EO4A 2FS5A 3QAHA 5HMNA 2FL4A 3DNSA 3GKRA 4B5OA 2VEZA 5I0CA 4Y49B 3BLNA 1IIDA 4FD4A 4LUAA 2ARHA 4OAEA 1YVOA 2D4OA 2FSRA 5KTCA 1S3ZA 1PUAA 2B5GA 2RC4A 3TO6A 1V0CA 4AG9A 3JVNA 1N71A 2ZW5A 5JPHA 1XMTA 4EVYA 1BO4A 4NF1A 1QSRA 1S7FA 1Q2YA 3LD2A 4KOXA 3R9GA 4F6AA 3G8WA 2HV2A 5IX3A 2B3VA 4KOVA 2VZZA 2JDCA 1S60A 4KVXA 2B5GB 2B58A 4MY0A 3TT2A 4IUSA 1NE9A 3D2PA 2QECA 4KOWA 2PSWA 2BL1A 4KORA 5F46A 4NEXA 1OZPA 2ZW6A 3H4QA 4JD6A 4UA3A 4XPDC 4DNCA 3P2HA 1P0HA 2Q7BA 2FCKA 4PSXA 2AE6A 2BSWA 1CJWA 1YLEA 4I49A 3WR7A 4ONUA 1GHEA 2NMTA 1Q2CA 5C82A 1Y9WA 2AJ6A 1NSLA 2PR8A 2Q0YA 4QUSA 4MI4A 5J8FA 2R8VA 4HNYB 4AVCA 2WPWA 5HH1A 2O28A 5KTAA 2CNMA 4Y49C 2CY2A 1U6MA 1KUXA 4ZBGA 3R9FA 2ZW7A 3CXPA 1MJ9A 1VHSA 2GIVA 1FY7A 3FYNA 4YRHA 1MJAA 2Q04A 1IICA 4AVAA 3FBUA 5KTDA 5H84A 1L0CA 3S6FA 2G0BA 2Z0ZA 4JWPA 2BUEA 2B4DA 1S7KA 2G3AA 4XPLA 2HUZA 3KKWA 3TE4A 3I9SA 3DDDA 3T90A 2EVNA 4XNHC 4K30A 4QVTA 2J8MA 4MJ8A 4MBUA 3T9YA 2X7BA 4KLVA 2QIRA 5F47A 4H6ZA 5CNPA 2FIAA 3FB3A 4CAVA 4LX9A 2B4DB 1WWZA 5F49A 1KZFA 3EXNA 1YR0A 1KUVA 4JJXA 2REEA 1YK3A 3VWEA 4UWJA 3R1KA 4FD5A 4FD7A 4OLLA 1M44A 2PR1A 2P6FA 3EY5A 3EFAA 1M4DA 1S7NA 2P0WA 2G3TA 3BJ8A 4HKFA 1Q2DA 3GY9A 4QB9A 1BOBA 2I79A 1CM0A 4PV6A 3N7ZA 5F48A 4E0AA 4XNHB 2VI7A 1J4JA 1Z4RA 4R3LA 3SXNA 3TO7A 3W6SA 1QSNA 2F5IA 4PK3A 1KUYA 4B5PB 2OZUA 1S7LA 3D3SA 1Y7RA 4RS2A 2R7HA 5E96A 1VKCA 2OB0A 3JUWA 3TTHA 4F0YA 4E2AA 3TO9A 2DXQA 5JQ4A 2FT0A 2JEVA 3FRMA 4U9ZA 1R57A 3PZJA 4CAWA 4R3KA 1YX0A 4R57A 5EC4A 3S6HA 3G3SA 5IV0A 1I12A 3P2FA 2CNSA 4U9YA 2VBQA 3CXSA 1MJBA 1ON0A 4CAXA 4JXQA 4AVBA 2R1IA 4BMHA 2OU2A 3PP9A 4KLWA 4KVOE 1IYLA 4PSWA 4CRZB 2I00A 4AG7A 1QSOA 4KUBA 4QBJA 1RO5A 1XE4A 4M85A 2D4PA 4JLYA 3F0AA 3K9UA 2HQYA 2B3UA 3SXOA 1M4IA 3F5BA 3TFYA 4ORFA 4R87A 3ZZIA 2PDOA 4U5YA 2EUIA 3FNCA 1WK4A 2Y0MA 2Q4VA
chains in the Genus database with same CATH superfamily
1Q7LA 4KOTA 3EC4A 3CPAA 5I4MA 1IB1E 2GANA 5J8CA 2JDDA 5J1QA 5A27A 4UBRA 1I21A 2C27A 2Q4YA 4MY3A 4R7MA 4YFJA 3S9NA 2C6PA 3R9EA 5IB9A 2QMLA 3TCVA 1VIXA 2PJAA 4KZTA 5LYDA 3KGQA 4NCZA 5BWAB 4L8AA 3S6KA 3D8PA 3PGPA 2R98A 2IL4A 3NFZA 1CPSA 2ZEDA 4UF4A 1BAVA 2B4BA 4QC6A 1P4NA 3KL9A 2K5TA 4B5PA 1MK4A 3H8FA 1LAMA 1TKHA 1DE4C 2BCOA 2V8HA 3L2NA 5HVGA 1S5KA 4UEEA 3SI0A 3VWDA 1PU9A 1IYKA 2VQYA 3MGDA 3N5FA 4CRYB 5ISVA 1SQHA 3LODA 2Z10A 2Q44A 1F57A 4H89A 3NH8A 3R95A 2J8RA 3IWEA 4GS4A 4H6UA 4JZ0A 3W6XA 3NE8A 3V8IA 4PPZA 2PRBA 4ZGYB 3LWUA 1R3NA 4HPSA 3FX6A 4CGMA 3K9TA 1QSTA 1YLOA 2ZXVA 2WZNA 3QB8A 1FNOA 4JXRA 4PK2A 4II9A 3SHPA 2AFSA 2PRQA 4O23A 5LRJA 4UIBA 1Y9KA 3W91A 2J9AA 3PFEA 2CNTA 2C6CA 3FXTA 2YNEA 2CTCA 3E0KA 3DR8A 3KZWA 3MRUA 4MFPA 1ARMA 1CBXA 3C26A 3KHZA 3IWGA 3KASA 1AMPA 1Z2LA 4UCPA 1B6BA 4FD6A 4M3SA 4UEZA 3TC8A 2F7VA 2GE3A 4P4JA 2YNCC 4KVME 5AG6A 3UY5A 2ZEMA 2Z11A 4OIWA 4Z65A 5C88A 2PC1A 3R96A 3D67A 4BD9A 3NH4A 3F8KA 2REFA 2P6EA 3BHXA 3D66A 2FIWA 3HLPA 2NSMA 3CT9A 5AG5A 5HVFA 4EWTA 4CGNA 2PIYA 4PQAA 4KOYA 4R9MA 4KSIA 5EBVA 1ZLHA 2PJ4A 4L89A 1LRZA 2QYVA 1ZG7A 2EO8A 2KCWA 4TNUA 1K4JA 3PFOA 4TWEA 2YNCA 2ATRA 2CF4A 5H86A 3DR6A 1NMTA 1I1DA 1GYTA 4NJQA 4NSQA 4X8IA 1XIXA 3NE7A 4UFVA 1TIQA 4CYQA 5EMIA 4A39A 4R8FA 1M4LA 3I3GA 1HEEA 4B14A 2ZEFA 5DWMA 1HDQA 2WPXA 4A30A 5IB0A 1Y0RA 4GM5A 4H2KA 3TOAA 3FF3A 4YGOA 2PQ8A 2HB6A 2P6GA 3D2MA 3SI1A 4M6GA 4X2TA 1ZG8A 4YU9A 5DWNA 2V77A 4J3GA 4OC5A 2A4NA 5K8PA 2PVWA 4FUUA 1UFHA 5G20A 3IGRA 1VHOA 3S6GA 1PYTB 3H5ZA 1XEBA 5THWA 4RI1A 2VXKA 2IQ6A 4KSFA 4PXEA 4UWIA 4XPKA 5LRGA 4OC2A 3WT4A 3CXQA 3VH9A 2BEIA 4OADA 3B8GA 2OZGA 1X10A 1HDUA 4IF5A 4KOSA 5FVJA 4A31A 5HXDA 1Y0YA 2ZPAA 3ZJ0A 3IO1A 1M1DA 1UWYA 2J8NA 4OC4A 1LANA 1XF8A 3B3CA 1M4GA 3BJ7A 4AB7A 4NJRA 3RYOA 2OR4A 4HNWB 1YGHA 1XOVA 2PJCA 3DSBA 1YVKA 4P6YA 1TF8A 2Z3KA 2OZHA 2WUUA 4MFQA 4B10A 4XPDB 2ZW4A 1CP7A 3DLJA 2VZYA 1QSMA 1X12A 2H5MA 3B3VA 4X5KA 4KUAA 1IOFA 1YREA 3IFEA 5GCNA 1Z5RA 2Z3PA 4E8OA 2Q43A 1Z4EA 3KI9A 3TOBA 2ZEHA 2FXFA 3OWCA 4NXYA 4G1PA 2FE7A 4CS0B 3RO0A 3FIXA 2CXAA 3FEDA 2PJ8A 3HUVA 4HNXB 4KOUA 1RXTA 1Z9UA 2JLMA 2OH1A 3GYAA 4MHDA 3D7DA 1QQ9A 1B87A 1YSJA 3PB8X 4Q36A 3EO4A 2GU2A 2FS5A 2PIZA 1ELMP 1JQGA 4R76A 4MMOA 3QAHA 4DJLA 2FL4A 4MCQA 3DNSA 2AFUA 4B11A 2AFOA 5CBMA 5HMNA 3GKRA 2PJ9A 4B5OA 4K3NA 3NA6A 2VEZA 4F8ZA 5I0CA 4Y49B 3BLNA 3S9MA 1IIDA 4FD4A 4LUAA 1YW4A 2Q51A 4CYNA 1IGBA 4NFRA 1RTQA 2ARHA 2I3CA 1IY7A 3D7GA 1CP6A 4DUKA 4OAEA 3JRUA 1YVOA 4MHPA 2D4OA 2FSRA 5KTCA 1ARLA 1S3ZA 1PUAA 4F9VA 3PB6X 2B5GA 4CGOA 2RC4A 3TO6A 1V0CA 4AG9A 2GLJA 4CGPA 3JVNA 1N71A 2ZW5A 4A33A 1XMTA 5JPHA 4EVYA 4F9UA 3WC6A 1XRYA 5AGEA 4NGPA 1CX8A 1BO4A 4NF1A 4A94A 2DEAA 2WSAA 4EFDA 1QSRA 1S7FA 1Z8XA 3RBUA 2BO9A 3IJ3A 4P4FA 1Q2YA 2PCUA 3LD2A 4KOXA 4P44A 3R9GA 1VGYA 3SI2A 2EK8A 3D4UA 3B3TA 3GIUA 4F6AA 3G8WA 2PJ7A 2HV2A 5IX3A 3T8WA 5AG4A 2B3VA 2ZOGA 4KOVA 2VZZA 2ABZA 2JDCA 1S60A 2G9DA 4ZX8A 4C68A 4KVXA 3I1UA 2B5GB 2B58A 1EE3P 3A9LA 4MY0A 1ZLIA 2EK9A 2ZEGA 3K2KA 4LQ6A 3TT2A 2ZENA 4IUSA 1NE9A 1CPXA 2ZOFA 4MXUA 3D2PA 3LMSA 2QECA 4A2ZA 5K8MA 1YMEA 2XEGA 5JGFA 2PJ0A 4KOWA 2PSWA 3B3SA 2BL1A 4KORA 5F46A 3PBEA 2AFWA 4NEXA 3TX8A 1OZPA 2ZW6A 3H4QA 4LQGA 4NGQA 4JD6A 4UA3A 4XPDC 4DNCA 1Z8WA 3P2HA 4UEFA 4ZY0A 1P0HA 2GLFA 2RB7A 3ISZA 2Q7BA 3SJFA 3VARA 2FCKA 4PSXA 5LYFA 4YWYA 2AE6A 1TF9A 2BSWA 1CJWA 1YLEA 2AFZA 1ZO0A 3FVLA 4OP4A 4B6ZA 4I49A 3KR5A 3WR7A 4ONWA 3DGVA 3KR4A 3B2YA 1GHEA 1CG2A 2NMTA 4ONUA 1Q2CA 4RN7A 4NGTA 2JBJA 5C82A 1Y9WA 1F2PA 3WABA 2AJ6A 3KHXA 2F8HA 2EWBA 1NSLA 3KQXA 2PR8A 3BI1A 2Q0YA 4QUSA 4MI4A 4MFZA 5J8FA 2R8VA 4HNYB 4AVCA 1Y7EA 4OC3A 2WPWA 5HH1A 2QVPA 2WYRA 4Q7AA 1LAPA 2O28A 5KTAA 5JH9A 2CNMA 2ZEEA 4Y49C 2CY2A 1U6MA 1KUXA 4MRIA 4P4IA 2ZW7A 2Q7SA 3CXPA 4ZBGA 3R9FA 1XJOA 1IU8A 1MJ9A 3KQZA 1VHSA 1LFWA 2GIVA 4PXBA 1PCAA 1FY7A 4C7HA 4A95A 4MHZA 3FYNA 2Z3NA 4YRHA 1MJAA 2Q04A 3FJUA 3IC1A 4MCPA 1IICA 5K8OA 4AVAA 3V7ZA 3FBUA 4ZI6A 5KTDA 5H84A 4P4BA 4IHMA 1L0CA 2IMOA 2ZELA 3PB9X 3S6FA 5D8NA 1BPNA 1ELLP 2G0BA 4CYPA 3GB0A 2Z0ZA 4JWPA 2BUEA 2B4DA 3D7HA 4NGSA 2PJBA 1S7KA 4MFLA 3D7FA 2G3AA 4MCSA 2QJ8A 4XPLA 2ZEPA 2HUZA 3KKWA 3TE4A 3I9SA 1YQEA 3DDDA 2PJ2A 4UFXA 4CGLA 3QNVA 3T90A 5AG7A 1XBUA 2EVNA 1XMBA 4XNHC 4K30A 4PXDA 4QVTA 1JWQA 2J8MA 4ZX9A 2YGWA 2PJ6A 4MJ8A 2V8DA 4MBUA 4X3RA 3WC5A 4FAIA 2Q4ZA 2Z3MA 4F0XA 3T9YA 4CAEA 4IK2A 1BPMA 2X7BA 2ODFA 2XEJA 2QIRA 3IU2A 4H6ZA 4KLVA 5F47A 5CNPA 2FIAA 1YW6A 2IJZA 3FB3A 3SJXA 4CAVA 4LX9A 2Z3OA 2POKA 3RZAA 2B4DB 3B35A 1WWZA 5F49A 1KZFA 3EXNA 2GFQA 4C2XA 1YR0A 2RFHA 2O4HA 3S9LA 5DS0A 1KUVA 2YNDA 4M6IA 4JJXA 2REEA 1YK3A 4MFKA 3IIBA 3VWEA 4UWJA 3R1KA 4FD5A 4FD7A 4M6HA 4OLLA 1M44A 3H8EA 2PR1A 4MCRA 2P6FA 2CIJA 3EY5A 3EFAA 3JTKA 1F2OA 1TKFA 2CTBA 4B13A 4EMEA 1M4DA 1S7NA 2P0WA 2DPSA 2V8VA 2G3TA 3PBBA 3BJ8A 5JM6A 5A28A 4HKFA 1Q2DA 3GY9A 4QB9A 4AXVA 1BOBA 2I79A 1CM0A 2DF5A 2BOAA 4PV6A 3FH4A 3N7ZA 4CPAA 5F48A 3V38A 3FMCA 4FWUA 4E0AA 4XNHB 2VI7A 5CPAA 4MHNA 3RNZA 4C2ZA 1J4JA 1H8LA 1Z4RA 1BLLE 4R3LA 3SXNA 3TO7A 2AFMA 1QSNA 3W6SA 1R43A 2F5IA 4PK3A 1KUYA 4B5PB 3IU1A 4CYOA 4NGRA 2OZUA 4Q38A 3PEIA 1S7LA 3D3SA 2PJ3A 1Y7RA 1OBRA 3GUXA 4UCMA 4RS2A 4WWVA 7CPAA 5LYLA 2R7HA 4PXCA 1A2ZA 4ZYQA 2Z3LA 5E96A 3CPXA 3B3WA 3D68A 2O53A 5HVHA 3BXMA 1FT7A 3FECA 4OMEA 5G21A 1VKCA 2OB0A 1IOIA 2XEFA 2XEIA 3JUWA 4ZY1A 3IWWA 3QAYA 3TTHA 4F0YA 3H8GA 1VHEA 1DTDA 4A37A 4E2AA 3SJEA 3TO9A 2DXQA 5JQ4A 2FT0A 2JEVA 3FRMA 3LACA 4U9ZA 2DPTA 2GREA 1R57A 2PJ1A 3PB4X 1LCPA 3PZJA 4W9YA 4BBHA 4CAWA 6CPAA 5LRKA 4R3KA 5G1ZA 1YX0A 4ZY2A 4R57A 2V8GA 3WC7A 3ISXA 1Z8LA 5EC4A 4C2YA 4NGNA 4UFWA 3B7IA 3PRTA 3S6HA 4A32A 3NH5A 4MFJA 5D29A 3G3SA 4WJBA 5IV0A 2JEWA 1I12A 3P2FA 4OC0A 5LYIA 1XFOA 2CNSA 3SJGA 4P10A 2HC9A 4C7IA 2PVVA 5K8NA 2OOTA 4U9YA 3GLJA 2VBQA 3CXSA 1MJBA 1ON0A 1Z8TA 4CAXA 1AUGA 4JXQA 4AVBA 1TKJA 2C6GA 2JBKA 2R1IA 4BMHA 1QMUA 2OU2A 4DYOA 3PP9A 4BINA 3MN8A 4KLWA 1NSAA 5ELYA 4IAVA 1TXRA 4KVOE 3VATA 4GXHA 1IYLA 2ANPA 4PSWA 3RAMA 4MHYA 4CRZB 2VL1A 2I00A 4NGMA 4AG7A 1QSOA 4P45A 3PB7X 4KUBA 4QBJA 4A38A 1RO5A 1KWMA 4OKOA 1XE4A 3FEEA 4M85A 2ZEOA 2FVGA 2D4PA 4UCNA 5G22A 2C1CA 2NYQA 4JLYA 2AFXA 2EBJA 3F0AA 4FBEA 3CDXA 2HQYA 3K9UA 3IEHA 4R6TA 2B3UA 2PJ5A 4CAFA 3SXOA 4OC1A 1M4IA 3BI0A 3F5BA 3TFYA 5F09A 4ORFA 3CZXA 4OIDA 1ZG9A 4R87A 3ZZIA 2PDOA 4U5YA 4B12A 1LOKA 4UIAA 2PE3A 2EUIA 4KSAA 3FNCA 1WK4A 2Y0MA 4KS9A 2Q4VA 4JYWA 4P4EA 4RUHA 4P4DA 8CPAA 1AYEA
chains in the Genus database with same CATH topology
4KOTA 3EC4A 1IB1E 2GANA 5J8CA 2JDDA 5A27A 4UBRA 1I21A 2C27A 2Q4YA 4MY3A 4YFJA 3R9EA 2QMLA 3TCVA 4KZTA 5BWAB 4NCZA 4L8AA 3S6KA 3D8PA 3PGPA 2R98A 2IL4A 2B4BA 4QC6A 1P4NA 4B5PA 2K5TA 1MK4A 1S5KA 3VWDA 1PU9A 1IYKA 2VQYA 3MGDA 4CRYB 5ISVA 1SQHA 3LODA 2Z10A 2Q44A 4H89A 3R95A 2J8RA 3IWEA 4GS4A 4H6UA 3W6XA 3V8IA 2PRBA 4ZGYB 4CGMA 1QSTA 2ZXVA 3QB8A 4JXRA 4PK2A 4II9A 3SHPA 3W91A 1Y9KA 2CNTA 3FXTA 2YNEA 3E0KA 3DR8A 4MFPA 3C26A 3IWGA 4UCPA 1B6BA 4FD6A 4M3SA 2GE3A 2YNCC 4KVME 5AG6A 3UY5A 2Z11A 5C88A 2PC1A 3R96A 3F8KA 2REFA 2P6EA 2FIWA 5AG5A 4CGNA 4KOYA 4R9MA 5EBVA 4L89A 1LRZA 2KCWA 1K4JA 2YNCA 2ATRA 5H86A 3DR6A 1NMTA 1I1DA 4NSQA 1XIXA 3NE7A 4UFVA 1TIQA 4CYQA 3I3GA 4B14A 5DWMA 4A30A 2WPXA 5IB0A 3TOAA 4YGOA 2PQ8A 3D2MA 2P6GA 5DWNA 4J3GA 2A4NA 1UFHA 5G20A 3IGRA 3S6GA 3H5ZA 1XEBA 4RI1A 2VXKA 4KSFA 4UWIA 4XPKA 3CXQA 2BEIA 4OADA 3B8GA 2OZGA 4IF5A 5FVJA 4KOSA 4A31A 2ZPAA 3ZJ0A 1M1DA 2J8NA 1XF8A 1M4GA 3BJ7A 4AB7A 3RYOA 4HNWB 1YGHA 3DSBA 1YVKA 2Z3KA 4B10A 2OZHA 2WUUA 4MFQA 4XPDB 2ZW4A 2VZYA 1QSMA 2H5MA 4X5KA 4KUAA 1YREA 5GCNA 2Z3PA 4E8OA 1Z4EA 3TOBA 2FXFA 3OWCA 4NXYA 4CS0B 2FE7A 3FIXA 2CXAA 4HNXB 4KOUA 1RXTA 1Z9UA 2JLMA 2OH1A 3GYAA 4MHDA 1B87A 4Q36A 3EO4A 2FS5A 3QAHA 5HMNA 2FL4A 3DNSA 4B11A 3GKRA 4B5OA 2VEZA 5I0CA 4Y49B 3BLNA 1IIDA 4FD4A 4LUAA 4CYNA 2ARHA 4OAEA 1YVOA 2D4OA 2FSRA 5KTCA 1S3ZA 1PUAA 2B5GA 4CGOA 2RC4A 3TO6A 1V0CA 4AG9A 4CGPA 3JVNA 1N71A 2ZW5A 4A33A 1XMTA 5JPHA 4EVYA 5AGEA 1BO4A 4NF1A 2WSAA 1QSRA 1S7FA 1Q2YA 3LD2A 4KOXA 3R9GA 4F6AA 3G8WA 2HV2A 5IX3A 5AG4A 2B3VA 4KOVA 2VZZA 2JDCA 1S60A 4C68A 4KVXA 2B5GB 2B58A 3A9LA 4MY0A 3TT2A 4IUSA 1NE9A 3D2PA 2QECA 4A2ZA 4KOWA 2PSWA 2BL1A 4KORA 5F46A 4NEXA 1OZPA 2ZW6A 3H4QA 4JD6A 4UA3A 4XPDC 4DNCA 3P2HA 1P0HA 2Q7BA 2FCKA 4PSXA 2AE6A 2BSWA 1CJWA 1YLEA 1ZO0A 4I49A 3WR7A 4ONUA 1GHEA 2NMTA 1Q2CA 5C82A 1Y9WA 2AJ6A 1NSLA 2PR8A 2Q0YA 4QUSA 4MI4A 4MFZA 5J8FA 2R8VA 4HNYB 4AVCA 2WPWA 5HH1A 2O28A 5KTAA 2CNMA 4Y49C 2CY2A 1U6MA 1KUXA 4ZBGA 3R9FA 2ZW7A 3CXPA 1MJ9A 1VHSA 2GIVA 1FY7A 4C7HA 4A95A 3FYNA 2Z3NA 4YRHA 1MJAA 2Q04A 1IICA 4AVAA 3FBUA 5KTDA 5H84A 1L0CA 3S6FA 4CYPA 2G0BA 2Z0ZA 4JWPA 2BUEA 2B4DA 1S7KA 4MFLA 2G3AA 4XPLA 2HUZA 3KKWA 3TE4A 3I9SA 3DDDA 4CGLA 4UFXA 3T90A 5AG7A 2EVNA 4XNHC 4K30A 4QVTA 2J8MA 2YGWA 4MJ8A 4MBUA 2Z3MA 4F0XA 3T9YA 4CAEA 2X7BA 3IU2A 4KLVA 2QIRA 5F47A 4H6ZA 5CNPA 2FIAA 3FB3A 4CAVA 4LX9A 2Z3OA 2B4DB 1WWZA 5F49A 1KZFA 3EXNA 4C2XA 1YR0A 1KUVA 2YNDA 4JJXA 2REEA 1YK3A 4MFKA 3VWEA 4UWJA 3R1KA 4FD5A 4FD7A 4OLLA 1M44A 2PR1A 2P6FA 3EY5A 3EFAA 3JTKA 4B13A 1M4DA 1S7NA 2P0WA 2DPSA 2G3TA 3BJ8A 5A28A 4HKFA 1Q2DA 3GY9A 4QB9A 1BOBA 2I79A 1CM0A 4PV6A 3N7ZA 5F48A 4E0AA 4XNHB 2VI7A 4C2ZA 1J4JA 1Z4RA 4R3LA 3SXNA 3TO7A 3W6SA 1QSNA 2F5IA 4PK3A 1KUYA 4B5PB 3IU1A 4CYOA 2OZUA 4Q38A 1S7LA 3D3SA 1Y7RA 4UCMA 4RS2A 2R7HA 2Z3LA 5E96A 5G21A 1VKCA 2OB0A 3JUWA 3TTHA 4F0YA 4E2AA 3TO9A 2DXQA 5JQ4A 2FT0A 2JEVA 3FRMA 4U9ZA 2DPTA 1R57A 3PZJA 4BBHA 4CAWA 4R3KA 5G1ZA 1YX0A 4R57A 5EC4A 4C2YA 4UFWA 3S6HA 4A32A 4MFJA 3G3SA 5IV0A 1I12A 3P2FA 2CNSA 4C7IA 4U9YA 2VBQA 3CXSA 1MJBA 1ON0A 4CAXA 4JXQA 4AVBA 2R1IA 4BMHA 2OU2A 3PP9A 4KLWA 4KVOE 1IYLA 4PSWA 4CRZB 2I00A 4AG7A 1QSOA 4KUBA 4QBJA 1RO5A 1XE4A 4M85A 2D4PA 4UCNA 5G22A 4JLYA 3F0AA 3K9UA 2HQYA 2B3UA 4CAFA 3SXOA 1M4IA 3F5BA 3TFYA 4ORFA 4R87A 3ZZIA 2PDOA 4U5YA 4B12A 2EUIA 4KSAA 3FNCA 1WK4A 2Y0MA 4KS9A 2Q4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOT A;  3EC4 A;  1IB1 E;  2GAN A;  5J8C A;  2JDD A;  4UBR A;  1I21 A;  2C27 A;  2Q4Y A;  4MY3 A;  4YFJ A;  3R9E A;  2QML A;  3TCV A;  4KZT A;  4NCZ A;  4L8A A;  3S6K A;  3D8P A;  3PGP A;  2R98 A;  2IL4 A;  2B4B A;  4QC6 A;  1P4N A;  4B5P A;  2K5T A;  1MK4 A;  1S5K A;  3VWD A;  1PU9 A;  1IYK A;  2VQY A;  3MGD A;  4CRY B;  5ISV A;  1SQH A;  3LOD A;  2Z10 A;  2Q44 A;  4H89 A;  3R95 A;  2J8R A;  4GS4 A;  4H6U A;  3W6X A;  3V8I A;  2PRB A;  1QST A;  2ZXV A;  3QB8 A;  4JXR A;  4PK2 A;  4II9 A;  3SHP A;  3W91 A;  1Y9K A;  2CNT A;  3FXT A;  3E0K A;  3DR8 A;  3C26 A;  3IWG A;  1B6B A;  4FD6 A;  4M3S A;  2GE3 A;  4KVM E;  3UY5 A;  2Z11 A;  5C88 A;  2PC1 A;  3R96 A;  3F8K A;  2REF A;  2P6E A;  2FIW A;  4KOY A;  4R9M A;  5EBV A;  4L89 A;  1LRZ A;  2KCW A;  1K4J A;  2ATR A;  5H86 A;  3DR6 A;  1NMT A;  1I1D A;  4NSQ A;  1XIX A;  3NE7 A;  1TIQ A;  3I3G A;  5DWM A;  5IB0 A;  2WPX A;  3TOA A;  4YGO A;  2PQ8 A;  3D2M A;  2P6G A;  5DWN A;  4J3G A;  2A4N A;  1UFH A;  3IGR A;  3S6G A;  1XEB A;  4RI1 A;  2VXK A;  4UWI A;  4XPK A;  3CXQ A;  2BEI A;  4OAD A;  3B8G A;  2OZG A;  4IF5 A;  5FVJ A;  4KOS A;  2ZPA A;  3ZJ0 A;  1M1D A;  2J8N A;  1XF8 A;  1M4G A;  3BJ7 A;  4AB7 A;  3RYO A;  4HNW B;  1YGH A;  3DSB A;  1YVK A;  2OZH A;  4XPD B;  2ZW4 A;  2VZY A;  1QSM A;  2H5M A;  4X5K A;  4KUA A;  1YRE A;  5GCN A;  4E8O A;  1Z4E A;  3TOB A;  2FXF A;  3OWC A;  4NXY A;  4CS0 B;  2FE7 A;  3FIX A;  4HNX B;  4KOU A;  1RXT A;  1Z9U A;  2JLM A;  2OH1 A;  3GYA A;  4MHD A;  1B87 A;  3EO4 A;  2FS5 A;  3QAH A;  5HMN A;  2FL4 A;  3DNS A;  3GKR A;  4B5O A;  2VEZ A;  5I0C A;  4Y49 B;  3BLN A;  1IID A;  4FD4 A;  4LUA A;  2ARH A;  4OAE A;  1YVO A;  2D4O A;  2FSR A;  5KTC A;  1S3Z A;  1PUA A;  2B5G A;  2RC4 A;  3TO6 A;  1V0C A;  4AG9 A;  3JVN A;  1N71 A;  2ZW5 A;  5JPH A;  1XMT A;  4EVY A;  1BO4 A;  4NF1 A;  1QSR A;  1S7F A;  1Q2Y A;  3LD2 A;  4KOX A;  3R9G A;  4F6A A;  3G8W A;  2HV2 A;  5IX3 A;  2B3V A;  4KOV A;  2VZZ A;  2JDC A;  1S60 A;  4KVX A;  2B5G B;  2B58 A;  4MY0 A;  3TT2 A;  4IUS A;  1NE9 A;  3D2P A;  2QEC A;  4KOW A;  2PSW A;  2BL1 A;  4KOR A;  5F46 A;  4NEX A;  1OZP A;  2ZW6 A;  3H4Q A;  4JD6 A;  4UA3 A;  4XPD C;  4DNC A;  3P2H A;  1P0H A;  2Q7B A;  2FCK A;  4PSX A;  2AE6 A;  2BSW A;  1CJW A;  1YLE A;  4I49 A;  3WR7 A;  4ONU A;  1GHE A;  2NMT A;  1Q2C A;  5C82 A;  1Y9W A;  2AJ6 A;  1NSL A;  2PR8 A;  2Q0Y A;  4QUS A;  4MI4 A;  5J8F A;  2R8V A;  4HNY B;  4AVC A;  2WPW A;  5HH1 A;  2O28 A;  5KTA A;  2CNM A;  4Y49 C;  2CY2 A;  1U6M A;  1KUX A;  4ZBG A;  3R9F A;  2ZW7 A;  3CXP A;  1MJ9 A;  1VHS A;  2GIV A;  1FY7 A;  3FYN A;  4YRH A;  1MJA A;  2Q04 A;  1IIC A;  4AVA A;  3FBU A;  5KTD A;  5H84 A;  1L0C A;  3S6F A;  2G0B A;  2Z0Z A;  4JWP A;  2BUE A;  2B4D A;  1S7K A;  2G3A A;  4XPL A;  2HUZ A;  3KKW A;  3TE4 A;  3I9S A;  3DDD A;  3T90 A;  2EVN A;  4XNH C;  4K30 A;  4QVT A;  2J8M A;  4MJ8 A;  4MBU A;  3T9Y A;  2X7B A;  4KLV A;  2QIR A;  5F47 A;  4H6Z A;  5CNP A;  2FIA A;  3FB3 A;  4CAV A;  4LX9 A;  2B4D B;  1WWZ A;  5F49 A;  1KZF A;  3EXN A;  1YR0 A;  1KUV A;  4JJX A;  2REE A;  1YK3 A;  3VWE A;  4UWJ A;  3R1K A;  4FD5 A;  4FD7 A;  4OLL A;  1M44 A;  2PR1 A;  2P6F A;  3EY5 A;  3EFA A;  1M4D A;  1S7N A;  2P0W A;  2G3T A;  3BJ8 A;  4HKF A;  1Q2D A;  3GY9 A;  4QB9 A;  1BOB A;  2I79 A;  1CM0 A;  4PV6 A;  3N7Z A;  5F48 A;  4E0A A;  4XNH B;  2VI7 A;  1J4J A;  1Z4R A;  4R3L A;  3SXN A;  3TO7 A;  3W6S A;  1QSN A;  2F5I A;  4PK3 A;  1KUY A;  4B5P B;  2OZU A;  1S7L A;  3D3S A;  1Y7R A;  4RS2 A;  2R7H A;  5E96 A;  1VKC A;  2OB0 A;  3JUW A;  3TTH A;  4F0Y A;  4E2A A;  3TO9 A;  2DXQ A;  5JQ4 A;  2FT0 A;  2JEV A;  3FRM A;  4U9Z A;  1R57 A;  3PZJ A;  4CAW A;  4R3K A;  1YX0 A;  4R57 A;  5EC4 A;  3S6H A;  3G3S A;  5IV0 A;  1I12 A;  3P2F A;  2CNS A;  4U9Y A;  2VBQ A;  3CXS A;  1MJB A;  1ON0 A;  4CAX A;  4JXQ A;  4AVB A;  2R1I A;  4BMH A;  2OU2 A;  3PP9 A;  4KLW A;  4KVO E;  1IYL A;  4PSW A;  4CRZ B;  2I00 A;  4AG7 A;  1QSO A;  4KUB A;  4QBJ A;  1RO5 A;  1XE4 A;  4M85 A;  2D4P A;  4JLY A;  3F0A A;  3K9U A;  2HQY A;  2B3U A;  3SXO A;  1M4I A;  3F5B A;  3TFY A;  4ORF A;  4R87 A;  3ZZI A;  2PDO A;  4U5Y A;  2EUI A;  3FNC A;  1WK4 A;  2Y0M A;  2Q4V A; 
#chains in the Genus database with same CATH topology
 1Q7L A;  4KOT A;  3EC4 A;  3CPA A;  5I4M A;  1IB1 E;  2GAN A;  5J8C A;  2JDD A;  5J1Q A;  5A27 A;  4UBR A;  1I21 A;  2C27 A;  2Q4Y A;  4MY3 A;  4R7M A;  4YFJ A;  3S9N A;  2C6P A;  3R9E A;  5IB9 A;  2QML A;  3TCV A;  1VIX A;  2PJA A;  4KZT A;  5LYD A;  3KGQ A;  4NCZ A;  5BWA B;  4L8A A;  3S6K A;  3D8P A;  3PGP A;  2R98 A;  2IL4 A;  3NFZ A;  1CPS A;  2ZED A;  4UF4 A;  1BAV A;  2B4B A;  4QC6 A;  1P4N A;  3KL9 A;  2K5T A;  4B5P A;  1MK4 A;  3H8F A;  1LAM A;  1TKH A;  1DE4 C;  2BCO A;  2V8H A;  3L2N A;  5HVG A;  1S5K A;  4UEE A;  3SI0 A;  3VWD A;  1PU9 A;  1IYK A;  2VQY A;  3MGD A;  3N5F A;  4CRY B;  5ISV A;  1SQH A;  3LOD A;  2Z10 A;  2Q44 A;  1F57 A;  4H89 A;  3NH8 A;  3R95 A;  2J8R A;  3IWE A;  4GS4 A;  4H6U A;  4JZ0 A;  3W6X A;  3NE8 A;  3V8I A;  4PPZ A;  2PRB A;  4ZGY B;  3LWU A;  1R3N A;  4HPS A;  3FX6 A;  4CGM A;  3K9T A;  1QST A;  1YLO A;  2ZXV A;  2WZN A;  3QB8 A;  1FNO A;  4JXR A;  4PK2 A;  4II9 A;  3SHP A;  2AFS A;  2PRQ A;  4O23 A;  5LRJ A;  4UIB A;  1Y9K A;  3W91 A;  2J9A A;  3PFE A;  2CNT A;  2C6C A;  3FXT A;  2YNE A;  2CTC A;  3E0K A;  3DR8 A;  3KZW A;  3MRU A;  4MFP A;  1ARM A;  1CBX A;  3C26 A;  3KHZ A;  3IWG A;  3KAS A;  1AMP A;  1Z2L A;  4UCP A;  1B6B A;  4FD6 A;  4M3S A;  4UEZ A;  3TC8 A;  2F7V A;  2GE3 A;  4P4J A;  2YNC C;  4KVM E;  5AG6 A;  3UY5 A;  2ZEM A;  2Z11 A;  4OIW A;  4Z65 A;  5C88 A;  2PC1 A;  3R96 A;  3D67 A;  4BD9 A;  3NH4 A;  3F8K A;  2REF A;  2P6E A;  3BHX A;  3D66 A;  2FIW A;  3HLP A;  2NSM A;  3CT9 A;  5AG5 A;  5HVF A;  4EWT A;  4CGN A;  2PIY A;  4PQA A;  4KOY A;  4R9M A;  4KSI A;  5EBV A;  1ZLH A;  2PJ4 A;  4L89 A;  1LRZ A;  2QYV A;  1ZG7 A;  2EO8 A;  2KCW A;  4TNU A;  1K4J A;  3PFO A;  4TWE A;  2YNC A;  2ATR A;  2CF4 A;  5H86 A;  3DR6 A;  1NMT A;  1I1D A;  1GYT A;  4NJQ A;  4NSQ A;  4X8I A;  1XIX A;  3NE7 A;  4UFV A;  1TIQ A;  4CYQ A;  5EMI A;  4A39 A;  4R8F A;  1M4L A;  3I3G A;  1HEE A;  4B14 A;  2ZEF A;  5DWM A;  1HDQ A;  2WPX A;  4A30 A;  5IB0 A;  1Y0R A;  4GM5 A;  4H2K A;  3TOA A;  3FF3 A;  4YGO A;  2PQ8 A;  2HB6 A;  2P6G A;  3D2M A;  3SI1 A;  4M6G A;  4X2T A;  1ZG8 A;  4YU9 A;  5DWN A;  2V77 A;  4J3G A;  4OC5 A;  2A4N A;  5K8P A;  2PVW A;  4FUU A;  1UFH A;  5G20 A;  3IGR A;  1VHO A;  3S6G A;  1PYT B;  3H5Z A;  1XEB A;  5THW A;  4RI1 A;  2VXK A;  2IQ6 A;  4KSF A;  4PXE A;  4UWI A;  4XPK A;  5LRG A;  4OC2 A;  3WT4 A;  3CXQ A;  3VH9 A;  2BEI A;  4OAD A;  3B8G A;  2OZG A;  1X10 A;  1HDU A;  4IF5 A;  4KOS A;  5FVJ A;  4A31 A;  5HXD A;  1Y0Y A;  2ZPA A;  3ZJ0 A;  3IO1 A;  1M1D A;  1UWY A;  2J8N A;  4OC4 A;  1LAN A;  1XF8 A;  3B3C A;  1M4G A;  3BJ7 A;  4AB7 A;  4NJR A;  3RYO A;  2OR4 A;  4HNW B;  1YGH A;  1XOV A;  2PJC A;  3DSB A;  1YVK A;  4P6Y A;  1TF8 A;  2Z3K A;  2OZH A;  2WUU A;  4MFQ A;  4B10 A;  4XPD B;  2ZW4 A;  1CP7 A;  3DLJ A;  2VZY A;  1QSM A;  1X12 A;  2H5M A;  3B3V A;  4X5K A;  4KUA A;  1IOF A;  1YRE A;  3IFE A;  5GCN A;  1Z5R A;  2Z3P A;  4E8O A;  2Q43 A;  1Z4E A;  3KI9 A;  3TOB A;  2ZEH A;  2FXF A;  3OWC A;  4NXY A;  4G1P A;  2FE7 A;  4CS0 B;  3RO0 A;  3FIX A;  2CXA A;  3FED A;  2PJ8 A;  3HUV A;  4HNX B;  4KOU A;  1RXT A;  1Z9U A;  2JLM A;  2OH1 A;  3GYA A;  4MHD A;  3D7D A;  1QQ9 A;  1B87 A;  1YSJ A;  3PB8 X;  4Q36 A;  3EO4 A;  2GU2 A;  2FS5 A;  2PIZ A;  1ELM P;  1JQG A;  4R76 A;  4MMO A;  3QAH A;  4DJL A;  2FL4 A;  4MCQ A;  3DNS A;  2AFU A;  4B11 A;  2AFO A;  5CBM A;  5HMN A;  3GKR A;  2PJ9 A;  4B5O A;  4K3N A;  3NA6 A;  2VEZ A;  4F8Z A;  5I0C A;  4Y49 B;  3BLN A;  3S9M A;  1IID A;  4FD4 A;  4LUA A;  1YW4 A;  2Q51 A;  4CYN A;  1IGB A;  4NFR A;  1RTQ A;  2ARH A;  2I3C A;  1IY7 A;  3D7G A;  1CP6 A;  4DUK A;  4OAE A;  3JRU A;  1YVO A;  4MHP A;  2D4O A;  2FSR A;  5KTC A;  1ARL A;  1S3Z A;  1PUA A;  4F9V A;  3PB6 X;  2B5G A;  4CGO A;  2RC4 A;  3TO6 A;  1V0C A;  4AG9 A;  2GLJ A;  4CGP A;  3JVN A;  1N71 A;  2ZW5 A;  4A33 A;  1XMT A;  5JPH A;  4EVY A;  4F9U A;  3WC6 A;  1XRY A;  5AGE A;  4NGP A;  1CX8 A;  1BO4 A;  4NF1 A;  4A94 A;  2DEA A;  2WSA A;  4EFD A;  1QSR A;  1S7F A;  1Z8X A;  3RBU A;  2BO9 A;  3IJ3 A;  4P4F A;  1Q2Y A;  2PCU A;  3LD2 A;  4KOX A;  4P44 A;  3R9G A;  1VGY A;  3SI2 A;  2EK8 A;  3D4U A;  3B3T A;  3GIU A;  4F6A A;  3G8W A;  2PJ7 A;  2HV2 A;  5IX3 A;  3T8W A;  5AG4 A;  2B3V A;  2ZOG A;  4KOV A;  2VZZ A;  2ABZ A;  2JDC A;  1S60 A;  2G9D A;  4ZX8 A;  4C68 A;  4KVX A;  3I1U A;  2B5G B;  2B58 A;  1EE3 P;  3A9L A;  4MY0 A;  1ZLI A;  2EK9 A;  2ZEG A;  3K2K A;  4LQ6 A;  3TT2 A;  2ZEN A;  4IUS A;  1NE9 A;  1CPX A;  2ZOF A;  4MXU A;  3D2P A;  3LMS A;  2QEC A;  4A2Z A;  5K8M A;  1YME A;  2XEG A;  5JGF A;  2PJ0 A;  4KOW A;  2PSW A;  3B3S A;  2BL1 A;  4KOR A;  5F46 A;  3PBE A;  2AFW A;  4NEX A;  3TX8 A;  1OZP A;  2ZW6 A;  3H4Q A;  4LQG A;  4NGQ A;  4JD6 A;  4UA3 A;  4XPD C;  4DNC A;  1Z8W A;  3P2H A;  4UEF A;  4ZY0 A;  1P0H A;  2GLF A;  2RB7 A;  3ISZ A;  2Q7B A;  3SJF A;  3VAR A;  2FCK A;  4PSX A;  5LYF A;  4YWY A;  2AE6 A;  1TF9 A;  2BSW A;  1CJW A;  1YLE A;  2AFZ A;  1ZO0 A;  3FVL A;  4OP4 A;  4B6Z A;  4I49 A;  3KR5 A;  3WR7 A;  4ONW A;  3DGV A;  3KR4 A;  3B2Y A;  1GHE A;  1CG2 A;  2NMT A;  4ONU A;  1Q2C A;  4RN7 A;  4NGT A;  2JBJ A;  5C82 A;  1Y9W A;  1F2P A;  3WAB A;  2AJ6 A;  3KHX A;  2F8H A;  2EWB A;  1NSL A;  3KQX A;  2PR8 A;  3BI1 A;  2Q0Y A;  4QUS A;  4MI4 A;  4MFZ A;  5J8F A;  2R8V A;  4HNY B;  4AVC A;  1Y7E A;  4OC3 A;  2WPW A;  5HH1 A;  2QVP A;  2WYR A;  4Q7A A;  1LAP A;  2O28 A;  5KTA A;  5JH9 A;  2CNM A;  2ZEE A;  4Y49 C;  2CY2 A;  1U6M A;  1KUX A;  4MRI A;  4P4I A;  2ZW7 A;  2Q7S A;  3CXP A;  4ZBG A;  3R9F A;  1XJO A;  1IU8 A;  1MJ9 A;  3KQZ A;  1VHS A;  1LFW A;  2GIV A;  4PXB A;  1PCA A;  1FY7 A;  4C7H A;  4A95 A;  4MHZ A;  3FYN A;  2Z3N A;  4YRH A;  1MJA A;  2Q04 A;  3FJU A;  3IC1 A;  4MCP A;  1IIC A;  5K8O A;  4AVA A;  3V7Z A;  3FBU A;  4ZI6 A;  5KTD A;  5H84 A;  4P4B A;  4IHM A;  1L0C A;  2IMO A;  2ZEL A;  3PB9 X;  3S6F A;  5D8N A;  1BPN A;  1ELL P;  2G0B A;  4CYP A;  3GB0 A;  2Z0Z A;  4JWP A;  2BUE A;  2B4D A;  3D7H A;  4NGS A;  2PJB A;  1S7K A;  4MFL A;  3D7F A;  2G3A A;  4MCS A;  2QJ8 A;  4XPL A;  2ZEP A;  2HUZ A;  3KKW A;  3TE4 A;  3I9S A;  1YQE A;  3DDD A;  2PJ2 A;  4UFX A;  4CGL A;  3QNV A;  3T90 A;  5AG7 A;  1XBU A;  2EVN A;  1XMB A;  4XNH C;  4K30 A;  4PXD A;  4QVT A;  1JWQ A;  2J8M A;  4ZX9 A;  2YGW A;  2PJ6 A;  4MJ8 A;  2V8D A;  4MBU A;  4X3R A;  3WC5 A;  4FAI A;  2Q4Z A;  2Z3M A;  4F0X A;  3T9Y A;  4CAE A;  4IK2 A;  1BPM A;  2X7B A;  2ODF A;  2XEJ A;  2QIR A;  3IU2 A;  4H6Z A;  4KLV A;  5F47 A;  5CNP A;  2FIA A;  1YW6 A;  2IJZ A;  3FB3 A;  3SJX A;  4CAV A;  4LX9 A;  2Z3O A;  2POK A;  3RZA A;  2B4D B;  3B35 A;  1WWZ A;  5F49 A;  1KZF A;  3EXN A;  2GFQ A;  4C2X A;  1YR0 A;  2RFH A;  2O4H A;  3S9L A;  5DS0 A;  1KUV A;  2YND A;  4M6I A;  4JJX A;  2REE A;  1YK3 A;  4MFK A;  3IIB A;  3VWE A;  4UWJ A;  3R1K A;  4FD5 A;  4FD7 A;  4M6H A;  4OLL A;  1M44 A;  3H8E A;  2PR1 A;  4MCR A;  2P6F A;  2CIJ A;  3EY5 A;  3EFA A;  3JTK A;  1F2O A;  1TKF A;  2CTB A;  4B13 A;  4EME A;  1M4D A;  1S7N A;  2P0W A;  2DPS A;  2V8V A;  2G3T A;  3PBB A;  3BJ8 A;  5JM6 A;  5A28 A;  4HKF A;  1Q2D A;  3GY9 A;  4QB9 A;  4AXV A;  1BOB A;  2I79 A;  1CM0 A;  2DF5 A;  2BOA A;  4PV6 A;  3FH4 A;  3N7Z A;  4CPA A;  5F48 A;  3V38 A;  3FMC A;  4FWU A;  4E0A A;  4XNH B;  2VI7 A;  5CPA A;  4MHN A;  3RNZ A;  4C2Z A;  1J4J A;  1H8L A;  1Z4R A;  1BLL E;  4R3L A;  3SXN A;  3TO7 A;  2AFM A;  1QSN A;  3W6S A;  1R43 A;  2F5I A;  4PK3 A;  1KUY A;  4B5P B;  3IU1 A;  4CYO A;  4NGR A;  2OZU A;  4Q38 A;  3PEI A;  1S7L A;  3D3S A;  2PJ3 A;  1Y7R A;  1OBR A;  3GUX A;  4UCM A;  4RS2 A;  4WWV A;  7CPA A;  5LYL A;  2R7H A;  4PXC A;  1A2Z A;  4ZYQ A;  2Z3L A;  5E96 A;  3CPX A;  3B3W A;  3D68 A;  2O53 A;  5HVH A;  3BXM A;  1FT7 A;  3FEC A;  4OME A;  5G21 A;  1VKC A;  2OB0 A;  1IOI A;  2XEF A;  2XEI A;  3JUW A;  4ZY1 A;  3IWW A;  3QAY A;  3TTH A;  4F0Y A;  3H8G A;  1VHE A;  1DTD A;  4A37 A;  4E2A A;  3SJE A;  3TO9 A;  2DXQ A;  5JQ4 A;  2FT0 A;  2JEV A;  3FRM A;  3LAC A;  4U9Z A;  2DPT A;  2GRE A;  1R57 A;  2PJ1 A;  3PB4 X;  1LCP A;  3PZJ A;  4W9Y A;  4BBH A;  4CAW A;  6CPA A;  5LRK A;  4R3K A;  5G1Z A;  1YX0 A;  4ZY2 A;  4R57 A;  2V8G A;  3WC7 A;  3ISX A;  1Z8L A;  5EC4 A;  4C2Y A;  4NGN A;  4UFW A;  3B7I A;  3PRT A;  3S6H A;  4A32 A;  3NH5 A;  4MFJ A;  5D29 A;  3G3S A;  4WJB A;  5IV0 A;  2JEW A;  1I12 A;  3P2F A;  4OC0 A;  5LYI A;  1XFO A;  2CNS A;  3SJG A;  4P10 A;  2HC9 A;  4C7I A;  2PVV A;  5K8N A;  2OOT A;  4U9Y A;  3GLJ A;  2VBQ A;  3CXS A;  1MJB A;  1ON0 A;  1Z8T A;  4CAX A;  1AUG A;  4JXQ A;  4AVB A;  1TKJ A;  2C6G A;  2JBK A;  2R1I A;  4BMH A;  1QMU A;  2OU2 A;  4DYO A;  3PP9 A;  4BIN A;  3MN8 A;  4KLW A;  1NSA A;  5ELY A;  4IAV A;  1TXR A;  4KVO E;  3VAT A;  4GXH A;  1IYL A;  2ANP A;  4PSW A;  3RAM A;  4MHY A;  4CRZ B;  2VL1 A;  2I00 A;  4NGM A;  4AG7 A;  1QSO A;  4P45 A;  3PB7 X;  4KUB A;  4QBJ A;  4A38 A;  1RO5 A;  1KWM A;  4OKO A;  1XE4 A;  3FEE A;  4M85 A;  2ZEO A;  2FVG A;  2D4P A;  4UCN A;  5G22 A;  2C1C A;  2NYQ A;  4JLY A;  2AFX A;  2EBJ A;  3F0A A;  4FBE A;  3CDX A;  2HQY A;  3K9U A;  3IEH A;  4R6T A;  2B3U A;  2PJ5 A;  4CAF A;  3SXO A;  4OC1 A;  1M4I A;  3BI0 A;  3F5B A;  3TFY A;  5F09 A;  4ORF A;  3CZX A;  4OID A;  1ZG9 A;  4R87 A;  3ZZI A;  2PDO A;  4U5Y A;  4B12 A;  1LOK A;  4UIA A;  2PE3 A;  2EUI A;  4KSA A;  3FNC A;  1WK4 A;  2Y0M A;  4KS9 A;  2Q4V A;  4JYW A;  4P4E A;  4RUH A;  4P4D A;  8CPA A;  1AYE A; 
#chains in the Genus database with same CATH homology
 4KOT A;  3EC4 A;  1IB1 E;  2GAN A;  5J8C A;  2JDD A;  5A27 A;  4UBR A;  1I21 A;  2C27 A;  2Q4Y A;  4MY3 A;  4YFJ A;  3R9E A;  2QML A;  3TCV A;  4KZT A;  5BWA B;  4NCZ A;  4L8A A;  3S6K A;  3D8P A;  3PGP A;  2R98 A;  2IL4 A;  2B4B A;  4QC6 A;  1P4N A;  4B5P A;  2K5T A;  1MK4 A;  1S5K A;  3VWD A;  1PU9 A;  1IYK A;  2VQY A;  3MGD A;  4CRY B;  5ISV A;  1SQH A;  3LOD A;  2Z10 A;  2Q44 A;  4H89 A;  3R95 A;  2J8R A;  3IWE A;  4GS4 A;  4H6U A;  3W6X A;  3V8I A;  2PRB A;  4ZGY B;  4CGM A;  1QST A;  2ZXV A;  3QB8 A;  4JXR A;  4PK2 A;  4II9 A;  3SHP A;  3W91 A;  1Y9K A;  2CNT A;  3FXT A;  2YNE A;  3E0K A;  3DR8 A;  4MFP A;  3C26 A;  3IWG A;  4UCP A;  1B6B A;  4FD6 A;  4M3S A;  2GE3 A;  2YNC C;  4KVM E;  5AG6 A;  3UY5 A;  2Z11 A;  5C88 A;  2PC1 A;  3R96 A;  3F8K A;  2REF A;  2P6E A;  2FIW A;  5AG5 A;  4CGN A;  4KOY A;  4R9M A;  5EBV A;  4L89 A;  1LRZ A;  2KCW A;  1K4J A;  2YNC A;  2ATR A;  5H86 A;  3DR6 A;  1NMT A;  1I1D A;  4NSQ A;  1XIX A;  3NE7 A;  4UFV A;  1TIQ A;  4CYQ A;  3I3G A;  4B14 A;  5DWM A;  4A30 A;  2WPX A;  5IB0 A;  3TOA A;  4YGO A;  2PQ8 A;  3D2M A;  2P6G A;  5DWN A;  4J3G A;  2A4N A;  1UFH A;  5G20 A;  3IGR A;  3S6G A;  3H5Z A;  1XEB A;  4RI1 A;  2VXK A;  4KSF A;  4UWI A;  4XPK A;  3CXQ A;  2BEI A;  4OAD A;  3B8G A;  2OZG A;  4IF5 A;  5FVJ A;  4KOS A;  4A31 A;  2ZPA A;  3ZJ0 A;  1M1D A;  2J8N A;  1XF8 A;  1M4G A;  3BJ7 A;  4AB7 A;  3RYO A;  4HNW B;  1YGH A;  3DSB A;  1YVK A;  2Z3K A;  4B10 A;  2OZH A;  2WUU A;  4MFQ A;  4XPD B;  2ZW4 A;  2VZY A;  1QSM A;  2H5M A;  4X5K A;  4KUA A;  1YRE A;  5GCN A;  2Z3P A;  4E8O A;  1Z4E A;  3TOB A;  2FXF A;  3OWC A;  4NXY A;  4CS0 B;  2FE7 A;  3FIX A;  2CXA A;  4HNX B;  4KOU A;  1RXT A;  1Z9U A;  2JLM A;  2OH1 A;  3GYA A;  4MHD A;  1B87 A;  4Q36 A;  3EO4 A;  2FS5 A;  3QAH A;  5HMN A;  2FL4 A;  3DNS A;  4B11 A;  3GKR A;  4B5O A;  2VEZ A;  5I0C A;  4Y49 B;  3BLN A;  1IID A;  4FD4 A;  4LUA A;  4CYN A;  2ARH A;  4OAE A;  1YVO A;  2D4O A;  2FSR A;  5KTC A;  1S3Z A;  1PUA A;  2B5G A;  4CGO A;  2RC4 A;  3TO6 A;  1V0C A;  4AG9 A;  4CGP A;  3JVN A;  1N71 A;  2ZW5 A;  4A33 A;  1XMT A;  5JPH A;  4EVY A;  5AGE A;  1BO4 A;  4NF1 A;  2WSA A;  1QSR A;  1S7F A;  1Q2Y A;  3LD2 A;  4KOX A;  3R9G A;  4F6A A;  3G8W A;  2HV2 A;  5IX3 A;  5AG4 A;  2B3V A;  4KOV A;  2VZZ A;  2JDC A;  1S60 A;  4C68 A;  4KVX A;  2B5G B;  2B58 A;  3A9L A;  4MY0 A;  3TT2 A;  4IUS A;  1NE9 A;  3D2P A;  2QEC A;  4A2Z A;  4KOW A;  2PSW A;  2BL1 A;  4KOR A;  5F46 A;  4NEX A;  1OZP A;  2ZW6 A;  3H4Q A;  4JD6 A;  4UA3 A;  4XPD C;  4DNC A;  3P2H A;  1P0H A;  2Q7B A;  2FCK A;  4PSX A;  2AE6 A;  2BSW A;  1CJW A;  1YLE A;  1ZO0 A;  4I49 A;  3WR7 A;  4ONU A;  1GHE A;  2NMT A;  1Q2C A;  5C82 A;  1Y9W A;  2AJ6 A;  1NSL A;  2PR8 A;  2Q0Y A;  4QUS A;  4MI4 A;  4MFZ A;  5J8F A;  2R8V A;  4HNY B;  4AVC A;  2WPW A;  5HH1 A;  2O28 A;  5KTA A;  2CNM A;  4Y49 C;  2CY2 A;  1U6M A;  1KUX A;  4ZBG A;  3R9F A;  2ZW7 A;  3CXP A;  1MJ9 A;  1VHS A;  2GIV A;  1FY7 A;  4C7H A;  4A95 A;  3FYN A;  2Z3N A;  4YRH A;  1MJA A;  2Q04 A;  1IIC A;  4AVA A;  3FBU A;  5KTD A;  5H84 A;  1L0C A;  3S6F A;  4CYP A;  2G0B A;  2Z0Z A;  4JWP A;  2BUE A;  2B4D A;  1S7K A;  4MFL A;  2G3A A;  4XPL A;  2HUZ A;  3KKW A;  3TE4 A;  3I9S A;  3DDD A;  4CGL A;  4UFX A;  3T90 A;  5AG7 A;  2EVN A;  4XNH C;  4K30 A;  4QVT A;  2J8M A;  2YGW A;  4MJ8 A;  4MBU A;  2Z3M A;  4F0X A;  3T9Y A;  4CAE A;  2X7B A;  3IU2 A;  4KLV A;  2QIR A;  5F47 A;  4H6Z A;  5CNP A;  2FIA A;  3FB3 A;  4CAV A;  4LX9 A;  2Z3O A;  2B4D B;  1WWZ A;  5F49 A;  1KZF A;  3EXN A;  4C2X A;  1YR0 A;  1KUV A;  2YND A;  4JJX A;  2REE A;  1YK3 A;  4MFK A;  3VWE A;  4UWJ A;  3R1K A;  4FD5 A;  4FD7 A;  4OLL A;  1M44 A;  2PR1 A;  2P6F A;  3EY5 A;  3EFA A;  3JTK A;  4B13 A;  1M4D A;  1S7N A;  2P0W A;  2DPS A;  2G3T A;  3BJ8 A;  5A28 A;  4HKF A;  1Q2D A;  3GY9 A;  4QB9 A;  1BOB A;  2I79 A;  1CM0 A;  4PV6 A;  3N7Z A;  5F48 A;  4E0A A;  4XNH B;  2VI7 A;  4C2Z A;  1J4J A;  1Z4R A;  4R3L A;  3SXN A;  3TO7 A;  3W6S A;  1QSN A;  2F5I A;  4PK3 A;  1KUY A;  4B5P B;  3IU1 A;  4CYO A;  2OZU A;  4Q38 A;  1S7L A;  3D3S A;  1Y7R A;  4UCM A;  4RS2 A;  2R7H A;  2Z3L A;  5E96 A;  5G21 A;  1VKC A;  2OB0 A;  3JUW A;  3TTH A;  4F0Y A;  4E2A A;  3TO9 A;  2DXQ A;  5JQ4 A;  2FT0 A;  2JEV A;  3FRM A;  4U9Z A;  2DPT A;  1R57 A;  3PZJ A;  4BBH A;  4CAW A;  4R3K A;  5G1Z A;  1YX0 A;  4R57 A;  5EC4 A;  4C2Y A;  4UFW A;  3S6H A;  4A32 A;  4MFJ A;  3G3S A;  5IV0 A;  1I12 A;  3P2F A;  2CNS A;  4C7I A;  4U9Y A;  2VBQ A;  3CXS A;  1MJB A;  1ON0 A;  4CAX A;  4JXQ A;  4AVB A;  2R1I A;  4BMH A;  2OU2 A;  3PP9 A;  4KLW A;  4KVO E;  1IYL A;  4PSW A;  4CRZ B;  2I00 A;  4AG7 A;  1QSO A;  4KUB A;  4QBJ A;  1RO5 A;  1XE4 A;  4M85 A;  2D4P A;  4UCN A;  5G22 A;  4JLY A;  3F0A A;  3K9U A;  2HQY A;  2B3U A;  4CAF A;  3SXO A;  1M4I A;  3F5B A;  3TFY A;  4ORF A;  4R87 A;  3ZZI A;  2PDO A;  4U5Y A;  4B12 A;  2EUI A;  4KSA A;  3FNC A;  1WK4 A;  2Y0M A;  4KS9 A;  2Q4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...