4UA3A

Crystal structure of selenomethionine labeled spnatd
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
193
structure length
186
Chain Sequence
SRRMVTLEDVDFLKNLGVWVEIYHHLEKGLLQQCFNLVKKNMEALYRQSSFGWDDSEKLKEMEMEKLEYICIFEKTSKKLVGFLSFEDTVEAGLTCLYIYEIQLDEHIRGRNVGKWLLKNASILAYRRNLKYIFLTVFSANLNALNFYHHFDFVPHESSPQEKKFRSGKVIHPDYYILYTKSRKDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized N-acetyltransferase C825.04c
publication title The Molecular Basis for Histone H4- and H2A-Specific Amino-Terminal Acetylation by NatD.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 52
structure length 186
sequence length 193
chains with identical sequence B
ec nomenclature ec 2.3.1.257: N-terminal L-serine N(alpha)-acetyltransferase NatD.
pdb deposition date 2014-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ua3A00
4MY3A 2ATRA 1IB1E 3D3SA 1QSOA 4MJ8A 3VWEA 5I0CA 1RXTA 3PP9A 1Q2DA 1B6BA 4LUAA 4QUSA 2EUIA 2HQYA 4AVBA 2R7HA 1KZFA 3W6XA 5DWNA 2DXQA 4AG7A 3EFAA 1NE9A 3IGRA 1CM0A 2VXKA 3TFYA 3DR6A 3LODA 1YX0A 2KCWA 4KOSA 1Q2CA 5IV0A 5ISVA 3R95A 4PV6A 4R3LA 2B3VA 1KUVA 4OADA 5F47A 2AJ6A 1S7LA 1Z4RA 3BJ8A 3E0KA 2FE7A 2GANA 4RS2A 4ORFA 5JQ4A 1VKCA 4E0AA 1NSLA 3DDDA 4AVAA 3UY5A 1UFHA 1QSRA 3V8IA 1B87A 3SXNA 2NMTA 4UA3A 3D8PA 4IF5A 2PDOA 4AB7A 4AVCA 2OZHA 4GS4A 3T9YA 3FIXA 4B5PB 4X5KA 2Q4VA 3N7ZA 4JXQA 4R87A 4YRHA 2GIVA 4U5YA 4E8OA 3KKWA 3PGPA 3R9EA 4L89A 3DR8A 2VZYA 1Y9WA 3R1KA 4B5PA 2Z10A 2VZZA 4NXYA 5GCNA 1YLEA 4NCZA 4AG9A 3S6KA 4CAVA 3R9FA 1QSNA 4KUAA 3TE4A 2J8MA 4KVME 4R3KA 2X7BA 3FBUA 3D2MA 4F0YA 2EVNA 4KUBA 5H86A 3OWCA 4M85A 3I3GA 2QMLA 2WPWA 3FRMA 2FT0A 5IX3A 3S6FA 4JXRA 2R8VA 3GYAA 4L8AA 4H6ZA 2ARHA 5F46A 4U9YA 2PRBA 4CAXA 2OB0A 2FS5A 2PR8A 3K9UA 4PK3A 4ZBGA 4XNHC 2Y0MA 3SXOA 4KLVA 4UBRA 4JWPA 4JJXA 1MK4A 3QB8A 2P6GA 1Z4EA 4KOXA 4XNHB 2G3TA 4QB9A 5FVJA 4CRZB 5F49A 2BUEA 1PUAA 5EC4A 4MHDA 3S6HA 2P0WA 5IB0A 3EC4A 1OZPA 1XIXA 3T90A 3G3SA 2J8RA 1IICA 5C82A 2D4PA 2PR1A 4UWJA 2CY2A 4KVOE 4KORA 4OLLA 1Z9UA 2H5MA 1M4DA 3P2FA 4DNCA 4II9A 4KOYA 2FL4A 2OZGA 3D2PA 2VQYA 4FD4A 4JD6A 1M4GA 4PSWA 1M1DA 2FIAA 2VEZA 3G8WA 1V0CA 2AE6A 3WR7A 2K5TA 2Q7BA 3F0AA 2REEA 2O28A 3W91A 1YGHA 3MGDA 5DWMA 3EY5A 4ONUA 3EO4A 1S7FA 2VI7A 2OH1A 4KVXA 1R57A 4KOVA 2CNTA 2FCKA 3TTHA 4FD6A 1BO4A 4I49A 2BL1A 1P4NA 3GKRA 5EBVA 2R1IA 3EXNA 1QSMA 4CAWA 2CNMA 3FXTA 3PZJA 2RC4A 1YVKA 2Q0YA 2FXFA 2ZW5A 4XPDC 4XPLA 2D4OA 2REFA 2B5GB 3GY9A 1I21A 2JLMA 1MJ9A 3SHPA 2PC1A 4KOTA 1YR0A 3LD2A 2WPXA 4XPDB 3TO7A 2JDCA 1Q2YA 1J4JA 4XPKA 3F5BA 3ZZIA 1S60A 2B5GA 5HH1A 1WWZA 4H6UA 3ZJ0A 5J8FA 1PU9A 2A4NA 1SQHA 3BLNA 1GHEA 1IIDA 1VHSA 3F8KA 4QVTA 5HMNA 1Y7RA 1TIQA 3H4QA 2P6FA 1WK4A 5F48A 2Q44A 5J8CA 3FYNA 2B58A 4IUSA 2B4DB 2ZW4A 3C26A 4YGOA 4QBJA 2PSWA 1S5KA 2OZUA 2HV2A 3P2HA 3VWDA 1S7KA 4HNXB 3S6GA 5KTDA 2JDDA 4LX9A 1KUXA 1LRZA 4J3GA 4E2AA 2BEIA 1XE4A 3JVNA 5KTCA 5E96A 3CXQA 4PK2A 2B4DA 4MY0A 4Y49C 3TT2A 4H89A 4HNWB 2Q04A 4BMHA 1YK3A 3B8GA 4K30A 3TO6A 4KOWA 3RYOA 2Q4YA 4Y49B 2ZW7A 3I9SA 2ZXVA 4RI1A 3CXSA 4YFJA 2FSRA 3BJ7A 3FNCA 4R57A 2G0BA 4UWIA 3FB3A 1MJBA 3TOBA 5C88A 1S3ZA 2C27A 2G3AA 3W6SA 4U9ZA 2Z11A 3DSBA 3JUWA 4MI4A 4KOUA 4FD5A 4CRYB 5JPHA 1FY7A 1S7NA 1M44A 2VBQA 1M4IA 3DNSA 2F5IA 4NF1A 2Z0ZA 1IYLA 3CXPA 2QECA 1YVOA 3TCVA 2QIRA 1Y9KA 5KTAA 4M3SA 1I1DA 2P6EA 1K4JA 3R9GA 4HKFA 5CNPA 1MJAA 1XMTA 2ZPAA 1KUYA 1XF8A 4R9MA 4FD7A 1NMTA 2ZW6A 1XEBA 3NE7A 4EVYA 4JLYA 1N71A 1YREA 2CNSA 4NSQA 1CJWA 5H84A 2OU2A 1L0CA 4NEXA 2R98A 4MBUA 2B4BA 4KLWA 4QC6A 2IL4A 3TOAA 2BSWA 1U6MA 3R96A 2FIWA 1I12A 4PSXA 3IWGA 4B5OA 2JEVA 1IYKA 3TO9A 2HUZA 2I00A 2J8NA 4F6AA 1ON0A 1P0HA 4KZTA 3QAHA 2B3UA 2PQ8A 1RO5A 4OAEA 1QSTA 1BOBA 4CS0B 2GE3A 4HNYB 2I79A
chains in the Genus database with same CATH superfamily
4MY3A 2ATRA 1IB1E 3KQZA 2PJ3A 4ZY1A 1IU8A 3D3SA 1QSOA 1YW4A 4MJ8A 3VWEA 5I0CA 1BLLE 4B13A 1RXTA 3PP9A 3IFEA 1Q2DA 4A2ZA 5JH9A 1ELMP 2V8VA 1B6BA 4LUAA 4MFKA 4QUSA 2PJ0A 2ZEEA 2EUIA 3TC8A 2HQYA 4AVBA 3TX8A 1PYTB 2R7HA 4H2KA 3S9LA 1KZFA 3W6XA 1BPNA 5HVHA 3S9NA 6CPAA 5DWNA 2DXQA 4LQGA 4AG7A 5CPAA 3EFAA 1NE9A 1XMBA 1JQGA 3B7IA 3IGRA 3KQXA 2Z3PA 3QNVA 1CM0A 5G20A 2VXKA 4P4JA 4W9YA 4ZX9A 3DR6A 3TFYA 3LODA 1YX0A 2KCWA 4KOSA 4UCNA 2WYRA 1Q2CA 2BO9A 3NH5A 5IV0A 5ISVA 4CYQA 2PCUA 1ARLA 3H8GA 3KR5A 4MHYA 4PV6A 2GU2A 2PRQA 3R95A 4R3LA 2B3VA 1DTDA 1KUVA 4OADA 2ZOFA 4ONWA 2AJ6A 2PJ1A 1S7LA 1Z4RA 3BJ8A 3FEEA 3KL9A 4NGMA 3E0KA 2FE7A 1ZG7A 2GANA 4ORFA 4RS2A 5JQ4A 5K8NA 1VKCA 4C7HA 4E0AA 3NH8A 4OC3A 1NSLA 5JGFA 3SJEA 3RO0A 3IJ3A 3DDDA 1CP7A 4AVAA 3VARA 4ZY2A 1GYTA 3FH4A 3UY5A 3SI1A 1UFHA 1QSRA 3V8IA 2PJ7A 4A95A 1B87A 4C7IA 4ZY0A 3SXNA 2G9DA 3PB4X 4OP4A 4MXUA 3QAYA 2NMTA 4UA3A 3D8PA 4IF5A 2PDOA 4AB7A 1XOVA 2V8HA 4OC2A 4AVCA 2OZHA 4ZI6A 2C6PA 4YWYA 4BD9A 5A27A 1EE3P 1M4LA 4GS4A 3T9YA 4PXBA 3FIXA 3V38A 4B5PB 3DGVA 4X5KA 3D68A 2Q4VA 3N7ZA 4JXQA 4ZYQA 4R87A 1R43A 2ZEHA 2PJ6A 3PB6X 4YRHA 4YU9A 2GIVA 1TXRA 4U5YA 3WC5A 4E8OA 1XFOA 3KASA 3WABA 2F8HA 4MFLA 2XEGA 2ZOGA 5G21A 1CG2A 2O53A 3KKWA 3PGPA 2PE3A 3R9EA 4B14A 2RFHA 3JRUA 1Z8XA 4L89A 4JYWA 3DR8A 2VZYA 1Y9WA 3R1KA 3RBUA 4NGPA 2Z10A 4B5PA 2Q43A 2VZZA 4UEEA 4A30A 4K3NA 4NXYA 5GCNA 1YLEA 2F7VA 4MHNA 4NCZA 4P4EA 1XBUA 2OR4A 4AG9A 4FAIA 3S6KA 4CAVA 2V8GA 2OOTA 4TNUA 4A33A 1VHEA 2EK8A 1NSAA 1ZLIA 1XRYA 3R9FA 1QSNA 4KUAA 3H5ZA 3TE4A 2J8MA 4P45A 4KVME 4R3KA 2X7BA 3MN8A 3PEIA 4P10A 4NGTA 3FBUA 4CYNA 3D2MA 3IWWA 2EVNA 3BXMA 4KUBA 4M6IA 4OC5A 5H86A 2YNDA 4F0YA 2AFMA 3OWCA 4M85A 2WUUA 2Q51A 2ZEMA 2ZEDA 1ZLHA 3FJUA 3I3GA 3SI2A 2QMLA 1VHOA 1LFWA 1Z2LA 2IQ6A 2WPWA 4M6HA 4CYOA 2EWBA 3FRMA 2FT0A 3T8WA 4IAVA 2DPSA 3CZXA 1YSJA 4OIDA 5IX3A 5G1ZA 2RB7A 4JXRA 2R8VA 4UIBA 3S6FA 3GYAA 3VH9A 4L8AA 4H6ZA 2ARHA 1F57A 5F46A 4U9YA 2PRBA 3FVLA 4CAXA 2OB0A 1H8LA 2FS5A 4IK2A 2PR8A 3K9UA 4PK3A 4R8FA 4BINA 4R7MA 4ZBGA 3FF3A 4XNHC 2Y0MA 3SXOA 2PIYA 3KZWA 4KLVA 4UBRA 4UF4A 4JWPA 3GIUA 4C2ZA 2PIZA 2HB6A 3V7ZA 3SI0A 2AFXA 1MK4A 4JJXA 3QB8A 2P6GA 1Z4EA 4KOXA 4XNHB 4MHPA 2G3TA 4QB9A 5LRKA 1FNOA 5FVJA 3H8FA 3D4UA 5DS0A 4CGPA 4CRZB 2EK9A 2AFSA 5F49A 1YW6A 3PB7X 2BUEA 4UEZA 1CPSA 4DUKA 4F8ZA 1Z5RA 1PUAA 2VL1A 4OC1A 5EC4A 2EBJA 4MHDA 3S6HA 2P0WA 5IB0A 3IWEA 3SJGA 3EC4A 1OZPA 1XIXA 4EMEA 4OC0A 3T90A 1A2ZA 3G3SA 4A38A 3H8EA 3IU2A 3BI0A 2J8RA 1IICA 1LAPA 1TKHA 5C82A 4NJRA 4X8IA 2D4PA 5LYFA 2PR1A 3K2KA 4MMOA 2PJAA 2CY2A 4UWJA 4A31A 3CPAA 4B11A 1HDUA 3GB0A 4KVOE 2DPTA 4KORA 4OLLA 5AG5A 1Z9UA 2ABZA 2H5MA 1M4DA 2QJ8A 4P4IA 3N5FA 1FT7A 5IB9A 5HVFA 3P2FA 5LYIA 4DNCA 4II9A 2ZEFA 4P6YA 4UFVA 4KOYA 2FL4A 2OZGA 2V8DA 3D2PA 2PVWA 1OBRA 2VQYA 4FD4A 4JD6A 1AMPA 4A32A 1M4GA 4PSWA 1M1DA 2Q7SA 2FIAA 2VEZA 4Q38A 1LOKA 4TWEA 3G8WA 1V0CA 2JEWA 2AE6A 5JM6A 4CGLA 3WR7A 2K5TA 5ELYA 1Q7LA 2O4HA 3D7DA 2Q7BA 3F0AA 2REEA 1AUGA 1VIXA 2O28A 5THWA 3IC1A 1F2PA 3A9LA 3W91A 5A28A 1YGHA 4ZGYB 3B3VA 3IU1A 3MGDA 2CIJA 5DWMA 3I1UA 2PJ9A 3EY5A 5EMIA 4ONUA 3HUVA 2FVGA 2PVVA 4ZX8A 4B6ZA 4CYPA 4X3RA 3EO4A 2Z3MA 1S7FA 1TF8A 4OMEA 2DEAA 4F9VA 3LMSA 5AG7A 3SJXA 2VI7A 3D66A 2OH1A 4KVXA 1R57A 4KOVA 3KHXA 2CNTA 2FCKA 1AYEA 4WWVA 3TTHA 3B3CA 4NFRA 2GLJA 5LYDA 4FD6A 3WC6A 2PJ5A 4A39A 1BO4A 3FECA 4I49A 2BL1A 1P4NA 3GKRA 2ZENA 5EBVA 4MRIA 2R1IA 4NGSA 2ZEPA 3EXNA 1QSMA 2XEIA 4O23A 4CAWA 1ZG8A 3S9MA 4WJBA 1PCAA 3B3WA 2CNMA 4Z65A 4RUHA 4G1PA 2I3CA 3FXTA 3PZJA 3CT9A 2RC4A 1YVKA 2Q0YA 2FXFA 2ZW5A 4XPDC 4CGMA 4XPLA 2D4OA 2REFA 2B5GB 2AFZA 3GY9A 1I21A 4Q36A 2EO8A 2JLMA 2C6GA 1MJ9A 2NYQA 4RN7A 3SHPA 5G22A 2PC1A 4KOTA 2YNCC 1YR0A 3LACA 4FUUA 3KGQA 3LD2A 4P4BA 2WPXA 1UWYA 4XPDB 3TO7A 2CTCA 3BI1A 3PFOA 2JDCA 1Q2YA 1J4JA 4FBEA 4XPKA 3CDXA 3D7GA 3F5BA 3ZZIA 7CPAA 2IJZA 3D67A 2ZEGA 1S60A 2B5GA 5HH1A 1WWZA 2YNEA 2NSMA 3PRTA 3BHXA 3GUXA 4H6UA 2CF4A 3ZJ0A 4CGNA 5J8FA 8CPAA 1IGBA 4P4FA 3ISXA 1PU9A 2A4NA 1SQHA 2Z3KA 3BLNA 2Z3NA 4KSFA 3HLPA 2XEFA 1GHEA 1IIDA 1Y0YA 1VHSA 3RAMA 3F8KA 4EWTA 2QVPA 2AFOA 3FMCA 4QVTA 2YNCA 5HMNA 1Y7RA 1TIQA 4MCQA 3H4QA 1QQ9A 2P6FA 1WK4A 4PPZA 3ISZA 5F48A 1BPMA 1KWMA 2Q44A 3RNZA 5J8CA 3B3SA 3FYNA 2B58A 5HXDA 2QYVA 5AG4A 1JWQA 2ZELA 4PXDA 4IUSA 2B4DB 2ZW4A 3C26A 4YGOA 2V77A 4CGOA 2GLFA 3IO1A 2JBJA 4QBJA 1Z8WA 2PSWA 4A94A 1S5KA 2OZUA 1F2OA 2HV2A 3JTKA 3MRUA 3P2HA 1HEEA 3VWDA 1S7KA 3DLJA 4HNXB 3S6GA 5KTDA 4GM5A 1LCPA 2JDDA 3NH4A 3L2NA 4MFQA 4F0XA 4JZ0A 4LX9A 1KUXA 1LRZA 3FX6A 4J3GA 4E2AA 2BEIA 4UFWA 4PXCA 1XE4A 3FEDA 3JVNA 4NGNA 5D29A 5KTCA 5E96A 3CXQA 4PK2A 2B4DA 2XEJA 4MY0A 4Y49C 3TT2A 4MCPA 4H89A 2PJ8A 4HPSA 1ZG9A 4P4DA 1BAVA 4HNWB 2PJ2A 4OKOA 3PB9X 1CP6A 2Q04A 4PXEA 4BMHA 3PBEA 1YK3A 4UIAA 2DF5A 3B8GA 4K30A 4P44A 3TO6A 4KOWA 3RYOA 2BOAA 2Q4YA 4Y49B 2ZW7A 3I9SA 2BCOA 1X12A 3D7HA 2PJBA 2Z3LA 2ZXVA 4RI1A 1X10A 2WZNA 4UCPA 4B12A 4GXHA 4KS9A 3CXSA 3KR4A 2IMOA 2POKA 5F09A 1DE4C 4FWUA 3B3TA 3SJFA 4YFJA 2FSRA 5D8NA 3BJ7A 5BWAB 2CXAA 1VGYA 3CPXA 3FNCA 4R57A 3NFZA 2G0BA 2J9AA 1Z8LA 4UWIA 4MCRA 3VATA 3FB3A 4C2XA 4R76A 1MJBA 3TOBA 5C88A 4PQAA 1RTQA 1S3ZA 3B35A 2C27A 2G3AA 2Z3OA 4MFJA 4UCMA 4DYOA 1Y0RA 4NGQA 5K8PA 3W6SA 4U9ZA 1HDQA 2Z11A 3DSBA 3JUWA 4MI4A 4KOUA 5K8MA 4FD5A 1XJOA 4CRYB 5I4MA 4LQ6A 4UEFA 5HVGA 5JPHA 5LYLA 4DJLA 1ARMA 1YLOA 3D7FA 3LWUA 4M6GA 1LANA 1FY7A 1IOIA 1S7NA 3NE8A 4A37A 4AXVA 4MFZA 1Z8TA 1M44A 2PJ4A 2VBQA 1M4IA 2C6CA 5LRJA 3PB8X 3DNSA 5AGEA 4C2YA 3KHZA 2F5IA 4NJQA 2GREA 4NF1A 2Z0ZA 1IYLA 3CXPA 3IEHA 4KSIA 4R6TA 2QECA 2HC9A 1YVOA 2JBKA 5J1QA 1ELLP 4NGRA 5AG6A 3TCVA 4UFXA 2QIRA 4CPAA 4KSAA 3PFEA 1CBXA 1Y9KA 5KTAA 3WT4A 4M3SA 2AFUA 1I1DA 2P6EA 1K4JA 3R9GA 4BBHA 4HKFA 1TKJA 2C1CA 3KI9A 1MJAA 5CNPA 1CPXA 1LAMA 5CBMA 1XMTA 2ZPAA 2ANPA 5F47A 1TKFA 4IHMA 1KUYA 1XF8A 4R9MA 2PJCA 4X2TA 4FD7A 2WSAA 1NMTA 2ZW6A 1XEBA 4MHZA 3NE7A 4EVYA 4JLYA 1YQEA 4OC4A 3PBBA 1N71A 3NA6A 1YREA 2CNSA 4NSQA 3RZAA 1CJWA 5H84A 1IOFA 2OU2A 1L0CA 4NEXA 4OIWA 2R98A 4MBUA 3B2YA 4MFPA 2YGWA 3WC7A 2B4BA 1ZO0A 4KLWA 1CX8A 2IL4A 2BSWA 4MCSA 1U6MA 4QC6A 3TOAA 4CAFA 1IY7A 3R96A 4C68A 2FIWA 1I12A 4B10A 2ZEOA 4PSXA 1TF9A 3IWGA 4B5OA 1QMUA 2JEVA 3K9TA 4F9UA 1IYKA 3TO9A 2HUZA 2I00A 1YMEA 2J8NA 4F6AA 1ON0A 1P0HA 3IIBA 1R3NA 3QAHA 4KZTA 4Q7AA 5LRGA 5K8OA 2B3UA 2PQ8A 1RO5A 2Q4ZA 2AFWA 1QSTA 4OAEA 4CAEA 2ODFA 1BOBA 4EFDA 2CTBA 4CS0B 2GFQA 1Y7EA 3GLJA 2GE3A 4HNYB 2I79A
chains in the Genus database with same CATH topology
4MY3A 2ATRA 1IB1E 3D3SA 1QSOA 4MJ8A 3VWEA 5I0CA 4B13A 1RXTA 3PP9A 1Q2DA 4A2ZA 1B6BA 4LUAA 4MFKA 4QUSA 2EUIA 2HQYA 4AVBA 2R7HA 1KZFA 3W6XA 5DWNA 2DXQA 4AG7A 3EFAA 1NE9A 3IGRA 2Z3PA 1CM0A 5G20A 2VXKA 3TFYA 3DR6A 3LODA 1YX0A 2KCWA 4KOSA 4UCNA 1Q2CA 5IV0A 5ISVA 4CYQA 3R95A 4PV6A 4R3LA 2B3VA 1KUVA 4OADA 5F47A 2AJ6A 1S7LA 1Z4RA 3BJ8A 4BBHA 4CAFA 3E0KA 2FE7A 2GANA 4RS2A 4ORFA 5JQ4A 1VKCA 4C7HA 4E0AA 1NSLA 3DDDA 4AVAA 3UY5A 1UFHA 1QSRA 3V8IA 4A95A 4C7IA 1B87A 3SXNA 2NMTA 4UA3A 3D8PA 4IF5A 2PDOA 4AB7A 4AVCA 2OZHA 5A27A 4GS4A 3T9YA 3FIXA 4B5PB 4X5KA 2Q4VA 3N7ZA 4JXQA 4R87A 4YRHA 2GIVA 4U5YA 4E8OA 4MFLA 5G21A 3KKWA 3PGPA 3R9EA 4B14A 4L89A 3DR8A 2VZYA 1Y9WA 3R1KA 4B5PA 2Z10A 2VZZA 4A30A 4NXYA 5GCNA 1YLEA 4NCZA 4AG9A 3S6KA 4CAVA 4A33A 3R9FA 1QSNA 4KUAA 3H5ZA 3TE4A 2J8MA 4KVME 4R3KA 2X7BA 3FBUA 4CYNA 3D2MA 4F0YA 2EVNA 4KUBA 5H86A 2YNDA 3OWCA 4M85A 2WUUA 3I3GA 2QMLA 2WPWA 4CYOA 3FRMA 2FT0A 2DPSA 5IX3A 5G1ZA 3S6FA 4JXRA 2R8VA 3GYAA 4L8AA 4H6ZA 2ARHA 5F46A 4U9YA 2PRBA 4CAXA 2OB0A 2FS5A 2PR8A 3K9UA 4PK3A 4ZBGA 4XNHC 2Y0MA 3SXOA 4KLVA 4UBRA 4JWPA 4C2ZA 4JJXA 1MK4A 3QB8A 2P6GA 1Z4EA 4KOXA 4XNHB 2G3TA 4QB9A 5FVJA 4CGPA 4CRZB 5F49A 2BUEA 1PUAA 5EC4A 4MHDA 3S6HA 2P0WA 5IB0A 3IWEA 3EC4A 1OZPA 1XIXA 3T90A 3G3SA 3IU2A 2J8RA 1IICA 5C82A 2D4PA 2PR1A 4UWJA 2CY2A 4A31A 4B11A 4KVOE 5AG5A 2DPTA 4KORA 4OLLA 1Z9UA 2H5MA 1M4DA 3P2FA 4DNCA 4II9A 4UFVA 4KOYA 2FL4A 2OZGA 3D2PA 2VQYA 4FD4A 4JD6A 4A32A 1M4GA 4PSWA 1M1DA 2FIAA 2VEZA 4Q38A 3G8WA 1V0CA 2AE6A 4CGLA 3WR7A 2K5TA 2Q7BA 3F0AA 2REEA 2O28A 3A9LA 3W91A 5A28A 1YGHA 4ZGYB 3IU1A 3MGDA 5DWMA 3EY5A 4ONUA 4CYPA 3EO4A 2Z3MA 1S7FA 5AG7A 2VI7A 2OH1A 4KVXA 1R57A 4KOVA 2CNTA 2FCKA 3TTHA 4FD6A 1BO4A 4I49A 2BL1A 1P4NA 3GKRA 5EBVA 2R1IA 3EXNA 1QSMA 4CAWA 2CNMA 3FXTA 3PZJA 2RC4A 1YVKA 2Q0YA 2FXFA 2ZW5A 4XPDC 4CGMA 4XPLA 2D4OA 2REFA 2B5GB 3GY9A 1I21A 4Q36A 2JLMA 1MJ9A 3SHPA 5G22A 2PC1A 4KOTA 2YNCC 1YR0A 3LD2A 2WPXA 4XPDB 3TO7A 2JDCA 1Q2YA 1J4JA 4XPKA 3F5BA 3ZZIA 1S60A 2B5GA 5HH1A 1WWZA 2YNEA 4H6UA 3ZJ0A 4CGNA 5J8FA 4KSFA 1PU9A 2A4NA 1SQHA 2Z3KA 3BLNA 2Z3NA 1GHEA 1IIDA 1VHSA 3F8KA 4QVTA 5HMNA 2YNCA 1Y7RA 1TIQA 3H4QA 2P6FA 1WK4A 5F48A 2Q44A 5J8CA 3FYNA 2B58A 5AG4A 4IUSA 2B4DB 2ZW4A 3C26A 4YGOA 4CGOA 4QBJA 2PSWA 1S5KA 2OZUA 2HV2A 3JTKA 3P2HA 3VWDA 1S7KA 4HNXB 3S6GA 5KTDA 2JDDA 4MFQA 4F0XA 4LX9A 1KUXA 1LRZA 4J3GA 4E2AA 2BEIA 4UFWA 1XE4A 3JVNA 5KTCA 5E96A 3CXQA 4PK2A 2B4DA 4MY0A 4Y49C 3TT2A 4H89A 4HNWB 2Q04A 4BMHA 1YK3A 3B8GA 4K30A 3TO6A 4KOWA 3RYOA 2Q4YA 4Y49B 2ZW7A 3I9SA 2ZXVA 2Z3LA 4RI1A 4UCPA 4B12A 4KS9A 3CXSA 4YFJA 2FSRA 5BWAB 3BJ7A 2CXAA 3FNCA 4R57A 2G0BA 4UWIA 3FB3A 4C2XA 1MJBA 3TOBA 5C88A 1S3ZA 2C27A 2G3AA 2Z3OA 4MFJA 4UCMA 3W6SA 4U9ZA 2Z11A 3DSBA 3JUWA 4MI4A 4KOUA 4FD5A 4CRYB 5JPHA 1FY7A 1S7NA 4MFZA 1M44A 2VBQA 1M4IA 3DNSA 5AGEA 4C2YA 2F5IA 4NF1A 2Z0ZA 3CXPA 1IYLA 2QECA 1YVOA 5AG6A 3TCVA 4UFXA 2QIRA 4KSAA 1Y9KA 5KTAA 4M3SA 1I1DA 2P6EA 1K4JA 3R9GA 4HKFA 5CNPA 1MJAA 1XMTA 2ZPAA 1KUYA 1XF8A 4R9MA 4FD7A 2WSAA 1NMTA 2ZW6A 1XEBA 3NE7A 4EVYA 4JLYA 1N71A 1YREA 2CNSA 4NSQA 1CJWA 5H84A 2OU2A 1L0CA 4NEXA 2R98A 4MBUA 4MFPA 2YGWA 2B4BA 1ZO0A 4KLWA 2IL4A 4QC6A 2BSWA 3TOAA 1U6MA 3R96A 4C68A 2FIWA 1I12A 4B10A 4PSXA 3IWGA 4B5OA 2JEVA 1IYKA 3TO9A 2HUZA 2I00A 2J8NA 4F6AA 1ON0A 1P0HA 4KZTA 3QAHA 2B3UA 2PQ8A 1RO5A 4OAEA 1QSTA 4CAEA 1BOBA 4CS0B 2GE3A 4HNYB 2I79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MY3 A;  2ATR A;  1IB1 E;  3D3S A;  1QSO A;  4MJ8 A;  3VWE A;  5I0C A;  1RXT A;  3PP9 A;  1Q2D A;  1B6B A;  4LUA A;  4QUS A;  2EUI A;  2HQY A;  4AVB A;  2R7H A;  1KZF A;  3W6X A;  5DWN A;  2DXQ A;  4AG7 A;  3EFA A;  1NE9 A;  3IGR A;  1CM0 A;  2VXK A;  3TFY A;  3DR6 A;  3LOD A;  1YX0 A;  2KCW A;  4KOS A;  1Q2C A;  5IV0 A;  5ISV A;  3R95 A;  4PV6 A;  4R3L A;  2B3V A;  1KUV A;  4OAD A;  5F47 A;  2AJ6 A;  1S7L A;  1Z4R A;  3BJ8 A;  3E0K A;  2FE7 A;  2GAN A;  4RS2 A;  4ORF A;  5JQ4 A;  1VKC A;  4E0A A;  1NSL A;  3DDD A;  4AVA A;  3UY5 A;  1UFH A;  1QSR A;  3V8I A;  1B87 A;  3SXN A;  2NMT A;  4UA3 A;  3D8P A;  4IF5 A;  2PDO A;  4AB7 A;  4AVC A;  2OZH A;  4GS4 A;  3T9Y A;  3FIX A;  4B5P B;  4X5K A;  2Q4V A;  3N7Z A;  4JXQ A;  4R87 A;  4YRH A;  2GIV A;  4U5Y A;  4E8O A;  3KKW A;  3PGP A;  3R9E A;  4L89 A;  3DR8 A;  2VZY A;  1Y9W A;  3R1K A;  4B5P A;  2Z10 A;  2VZZ A;  4NXY A;  5GCN A;  1YLE A;  4NCZ A;  4AG9 A;  3S6K A;  4CAV A;  3R9F A;  1QSN A;  4KUA A;  3TE4 A;  2J8M A;  4KVM E;  4R3K A;  2X7B A;  3FBU A;  3D2M A;  4F0Y A;  2EVN A;  4KUB A;  5H86 A;  3OWC A;  4M85 A;  3I3G A;  2QML A;  2WPW A;  3FRM A;  2FT0 A;  5IX3 A;  3S6F A;  4JXR A;  2R8V A;  3GYA A;  4L8A A;  4H6Z A;  2ARH A;  5F46 A;  4U9Y A;  2PRB A;  4CAX A;  2OB0 A;  2FS5 A;  2PR8 A;  3K9U A;  4PK3 A;  4ZBG A;  4XNH C;  2Y0M A;  3SXO A;  4KLV A;  4UBR A;  4JWP A;  4JJX A;  1MK4 A;  3QB8 A;  2P6G A;  1Z4E A;  4KOX A;  4XNH B;  2G3T A;  4QB9 A;  5FVJ A;  4CRZ B;  5F49 A;  2BUE A;  1PUA A;  5EC4 A;  4MHD A;  3S6H A;  2P0W A;  5IB0 A;  3EC4 A;  1OZP A;  1XIX A;  3T90 A;  3G3S A;  2J8R A;  1IIC A;  5C82 A;  2D4P A;  2PR1 A;  4UWJ A;  2CY2 A;  4KVO E;  4KOR A;  4OLL A;  1Z9U A;  2H5M A;  1M4D A;  3P2F A;  4DNC A;  4II9 A;  4KOY A;  2FL4 A;  2OZG A;  3D2P A;  2VQY A;  4FD4 A;  4JD6 A;  1M4G A;  4PSW A;  1M1D A;  2FIA A;  2VEZ A;  3G8W A;  1V0C A;  2AE6 A;  3WR7 A;  2K5T A;  2Q7B A;  3F0A A;  2REE A;  2O28 A;  3W91 A;  1YGH A;  3MGD A;  5DWM A;  3EY5 A;  4ONU A;  3EO4 A;  1S7F A;  2VI7 A;  2OH1 A;  4KVX A;  1R57 A;  4KOV A;  2CNT A;  2FCK A;  3TTH A;  4FD6 A;  1BO4 A;  4I49 A;  2BL1 A;  1P4N A;  3GKR A;  5EBV A;  2R1I A;  3EXN A;  1QSM A;  4CAW A;  2CNM A;  3FXT A;  3PZJ A;  2RC4 A;  1YVK A;  2Q0Y A;  2FXF A;  2ZW5 A;  4XPD C;  4XPL A;  2D4O A;  2REF A;  2B5G B;  3GY9 A;  1I21 A;  2JLM A;  1MJ9 A;  3SHP A;  2PC1 A;  4KOT A;  1YR0 A;  3LD2 A;  2WPX A;  4XPD B;  3TO7 A;  2JDC A;  1Q2Y A;  1J4J A;  4XPK A;  3F5B A;  3ZZI A;  1S60 A;  2B5G A;  5HH1 A;  1WWZ A;  4H6U A;  3ZJ0 A;  5J8F A;  1PU9 A;  2A4N A;  1SQH A;  3BLN A;  1GHE A;  1IID A;  1VHS A;  3F8K A;  4QVT A;  5HMN A;  1Y7R A;  1TIQ A;  3H4Q A;  2P6F A;  1WK4 A;  5F48 A;  2Q44 A;  5J8C A;  3FYN A;  2B58 A;  4IUS A;  2B4D B;  2ZW4 A;  3C26 A;  4YGO A;  4QBJ A;  2PSW A;  1S5K A;  2OZU A;  2HV2 A;  3P2H A;  3VWD A;  1S7K A;  4HNX B;  3S6G A;  5KTD A;  2JDD A;  4LX9 A;  1KUX A;  1LRZ A;  4J3G A;  4E2A A;  2BEI A;  1XE4 A;  3JVN A;  5KTC A;  5E96 A;  3CXQ A;  4PK2 A;  2B4D A;  4MY0 A;  4Y49 C;  3TT2 A;  4H89 A;  4HNW B;  2Q04 A;  4BMH A;  1YK3 A;  3B8G A;  4K30 A;  3TO6 A;  4KOW A;  3RYO A;  2Q4Y A;  4Y49 B;  2ZW7 A;  3I9S A;  2ZXV A;  4RI1 A;  3CXS A;  4YFJ A;  2FSR A;  3BJ7 A;  3FNC A;  4R57 A;  2G0B A;  4UWI A;  3FB3 A;  1MJB A;  3TOB A;  5C88 A;  1S3Z A;  2C27 A;  2G3A A;  3W6S A;  4U9Z A;  2Z11 A;  3DSB A;  3JUW A;  4MI4 A;  4KOU A;  4FD5 A;  4CRY B;  5JPH A;  1FY7 A;  1S7N A;  1M44 A;  2VBQ A;  1M4I A;  3DNS A;  2F5I A;  4NF1 A;  2Z0Z A;  1IYL A;  3CXP A;  2QEC A;  1YVO A;  3TCV A;  2QIR A;  1Y9K A;  5KTA A;  4M3S A;  1I1D A;  2P6E A;  1K4J A;  3R9G A;  4HKF A;  5CNP A;  1MJA A;  1XMT A;  2ZPA A;  1KUY A;  1XF8 A;  4R9M A;  4FD7 A;  1NMT A;  2ZW6 A;  1XEB A;  3NE7 A;  4EVY A;  4JLY A;  1N71 A;  1YRE A;  2CNS A;  4NSQ A;  1CJW A;  5H84 A;  2OU2 A;  1L0C A;  4NEX A;  2R98 A;  4MBU A;  2B4B A;  4KLW A;  4QC6 A;  2IL4 A;  3TOA A;  2BSW A;  1U6M A;  3R96 A;  2FIW A;  1I12 A;  4PSX A;  3IWG A;  4B5O A;  2JEV A;  1IYK A;  3TO9 A;  2HUZ A;  2I00 A;  2J8N A;  4F6A A;  1ON0 A;  1P0H A;  4KZT A;  3QAH A;  2B3U A;  2PQ8 A;  1RO5 A;  4OAE A;  1QST A;  1BOB A;  4CS0 B;  2GE3 A;  4HNY B;  2I79 A; 
#chains in the Genus database with same CATH topology
 4MY3 A;  2ATR A;  1IB1 E;  3KQZ A;  2PJ3 A;  4ZY1 A;  1IU8 A;  3D3S A;  1QSO A;  1YW4 A;  4MJ8 A;  3VWE A;  5I0C A;  1BLL E;  4B13 A;  1RXT A;  3PP9 A;  3IFE A;  1Q2D A;  4A2Z A;  5JH9 A;  1ELM P;  2V8V A;  1B6B A;  4LUA A;  4MFK A;  4QUS A;  2PJ0 A;  2ZEE A;  2EUI A;  3TC8 A;  2HQY A;  4AVB A;  3TX8 A;  1PYT B;  2R7H A;  4H2K A;  3S9L A;  1KZF A;  3W6X A;  1BPN A;  5HVH A;  3S9N A;  6CPA A;  5DWN A;  2DXQ A;  4LQG A;  4AG7 A;  5CPA A;  3EFA A;  1NE9 A;  1XMB A;  1JQG A;  3B7I A;  3IGR A;  3KQX A;  2Z3P A;  3QNV A;  1CM0 A;  5G20 A;  2VXK A;  4P4J A;  4W9Y A;  4ZX9 A;  3DR6 A;  3TFY A;  3LOD A;  1YX0 A;  2KCW A;  4KOS A;  4UCN A;  2WYR A;  1Q2C A;  2BO9 A;  3NH5 A;  5IV0 A;  5ISV A;  4CYQ A;  2PCU A;  1ARL A;  3H8G A;  3KR5 A;  4MHY A;  4PV6 A;  2GU2 A;  2PRQ A;  3R95 A;  4R3L A;  2B3V A;  1DTD A;  1KUV A;  4OAD A;  2ZOF A;  4ONW A;  2AJ6 A;  2PJ1 A;  1S7L A;  1Z4R A;  3BJ8 A;  3FEE A;  3KL9 A;  4NGM A;  3E0K A;  2FE7 A;  1ZG7 A;  2GAN A;  4ORF A;  4RS2 A;  5JQ4 A;  5K8N A;  1VKC A;  4C7H A;  4E0A A;  3NH8 A;  4OC3 A;  1NSL A;  5JGF A;  3SJE A;  3RO0 A;  3IJ3 A;  3DDD A;  1CP7 A;  4AVA A;  3VAR A;  4ZY2 A;  1GYT A;  3FH4 A;  3UY5 A;  3SI1 A;  1UFH A;  1QSR A;  3V8I A;  2PJ7 A;  4A95 A;  1B87 A;  4C7I A;  4ZY0 A;  3SXN A;  2G9D A;  3PB4 X;  4OP4 A;  4MXU A;  3QAY A;  2NMT A;  4UA3 A;  3D8P A;  4IF5 A;  2PDO A;  4AB7 A;  1XOV A;  2V8H A;  4OC2 A;  4AVC A;  2OZH A;  4ZI6 A;  2C6P A;  4YWY A;  4BD9 A;  5A27 A;  1EE3 P;  1M4L A;  4GS4 A;  3T9Y A;  4PXB A;  3FIX A;  3V38 A;  4B5P B;  3DGV A;  4X5K A;  3D68 A;  2Q4V A;  3N7Z A;  4JXQ A;  4ZYQ A;  4R87 A;  1R43 A;  2ZEH A;  2PJ6 A;  3PB6 X;  4YRH A;  4YU9 A;  2GIV A;  1TXR A;  4U5Y A;  3WC5 A;  4E8O A;  1XFO A;  3KAS A;  3WAB A;  2F8H A;  4MFL A;  2XEG A;  2ZOG A;  5G21 A;  1CG2 A;  2O53 A;  3KKW A;  3PGP A;  2PE3 A;  3R9E A;  4B14 A;  2RFH A;  3JRU A;  1Z8X A;  4L89 A;  4JYW A;  3DR8 A;  2VZY A;  1Y9W A;  3R1K A;  3RBU A;  4NGP A;  2Z10 A;  4B5P A;  2Q43 A;  2VZZ A;  4UEE A;  4A30 A;  4K3N A;  4NXY A;  5GCN A;  1YLE A;  2F7V A;  4MHN A;  4NCZ A;  4P4E A;  1XBU A;  2OR4 A;  4AG9 A;  4FAI A;  3S6K A;  4CAV A;  2V8G A;  2OOT A;  4TNU A;  4A33 A;  1VHE A;  2EK8 A;  1NSA A;  1ZLI A;  1XRY A;  3R9F A;  1QSN A;  4KUA A;  3H5Z A;  3TE4 A;  2J8M A;  4P45 A;  4KVM E;  4R3K A;  2X7B A;  3MN8 A;  3PEI A;  4P10 A;  4NGT A;  3FBU A;  4CYN A;  3D2M A;  3IWW A;  2EVN A;  3BXM A;  4KUB A;  4M6I A;  4OC5 A;  5H86 A;  2YND A;  4F0Y A;  2AFM A;  3OWC A;  4M85 A;  2WUU A;  2Q51 A;  2ZEM A;  2ZED A;  1ZLH A;  3FJU A;  3I3G A;  3SI2 A;  2QML A;  1VHO A;  1LFW A;  1Z2L A;  2IQ6 A;  2WPW A;  4M6H A;  4CYO A;  2EWB A;  3FRM A;  2FT0 A;  3T8W A;  4IAV A;  2DPS A;  3CZX A;  1YSJ A;  4OID A;  5IX3 A;  5G1Z A;  2RB7 A;  4JXR A;  2R8V A;  4UIB A;  3S6F A;  3GYA A;  3VH9 A;  4L8A A;  4H6Z A;  2ARH A;  1F57 A;  5F46 A;  4U9Y A;  2PRB A;  3FVL A;  4CAX A;  2OB0 A;  1H8L A;  2FS5 A;  4IK2 A;  2PR8 A;  3K9U A;  4PK3 A;  4R8F A;  4BIN A;  4R7M A;  4ZBG A;  3FF3 A;  4XNH C;  2Y0M A;  3SXO A;  2PIY A;  3KZW A;  4KLV A;  4UBR A;  4UF4 A;  4JWP A;  3GIU A;  4C2Z A;  2PIZ A;  2HB6 A;  3V7Z A;  3SI0 A;  2AFX A;  1MK4 A;  4JJX A;  3QB8 A;  2P6G A;  1Z4E A;  4KOX A;  4XNH B;  4MHP A;  2G3T A;  4QB9 A;  5LRK A;  1FNO A;  5FVJ A;  3H8F A;  3D4U A;  5DS0 A;  4CGP A;  4CRZ B;  2EK9 A;  2AFS A;  5F49 A;  1YW6 A;  3PB7 X;  2BUE A;  4UEZ A;  1CPS A;  4DUK A;  4F8Z A;  1Z5R A;  1PUA A;  2VL1 A;  4OC1 A;  5EC4 A;  2EBJ A;  4MHD A;  3S6H A;  2P0W A;  5IB0 A;  3IWE A;  3SJG A;  3EC4 A;  1OZP A;  1XIX A;  4EME A;  4OC0 A;  3T90 A;  1A2Z A;  3G3S A;  4A38 A;  3H8E A;  3IU2 A;  3BI0 A;  2J8R A;  1IIC A;  1LAP A;  1TKH A;  5C82 A;  4NJR A;  4X8I A;  2D4P A;  5LYF A;  2PR1 A;  3K2K A;  4MMO A;  2PJA A;  2CY2 A;  4UWJ A;  4A31 A;  3CPA A;  4B11 A;  1HDU A;  3GB0 A;  4KVO E;  2DPT A;  4KOR A;  4OLL A;  5AG5 A;  1Z9U A;  2ABZ A;  2H5M A;  1M4D A;  2QJ8 A;  4P4I A;  3N5F A;  1FT7 A;  5IB9 A;  5HVF A;  3P2F A;  5LYI A;  4DNC A;  4II9 A;  2ZEF A;  4P6Y A;  4UFV A;  4KOY A;  2FL4 A;  2OZG A;  2V8D A;  3D2P A;  2PVW A;  1OBR A;  2VQY A;  4FD4 A;  4JD6 A;  1AMP A;  4A32 A;  1M4G A;  4PSW A;  1M1D A;  2Q7S A;  2FIA A;  2VEZ A;  4Q38 A;  1LOK A;  4TWE A;  3G8W A;  1V0C A;  2JEW A;  2AE6 A;  5JM6 A;  4CGL A;  3WR7 A;  2K5T A;  5ELY A;  1Q7L A;  2O4H A;  3D7D A;  2Q7B A;  3F0A A;  2REE A;  1AUG A;  1VIX A;  2O28 A;  5THW A;  3IC1 A;  1F2P A;  3A9L A;  3W91 A;  5A28 A;  1YGH A;  4ZGY B;  3B3V A;  3IU1 A;  3MGD A;  2CIJ A;  5DWM A;  3I1U A;  2PJ9 A;  3EY5 A;  5EMI A;  4ONU A;  3HUV A;  2FVG A;  2PVV A;  4ZX8 A;  4B6Z A;  4CYP A;  4X3R A;  3EO4 A;  2Z3M A;  1S7F A;  1TF8 A;  4OME A;  2DEA A;  4F9V A;  3LMS A;  5AG7 A;  3SJX A;  2VI7 A;  3D66 A;  2OH1 A;  4KVX A;  1R57 A;  4KOV A;  3KHX A;  2CNT A;  2FCK A;  1AYE A;  4WWV A;  3TTH A;  3B3C A;  4NFR A;  2GLJ A;  5LYD A;  4FD6 A;  3WC6 A;  2PJ5 A;  4A39 A;  1BO4 A;  3FEC A;  4I49 A;  2BL1 A;  1P4N A;  3GKR A;  2ZEN A;  5EBV A;  4MRI A;  2R1I A;  4NGS A;  2ZEP A;  3EXN A;  1QSM A;  2XEI A;  4O23 A;  4CAW A;  1ZG8 A;  3S9M A;  4WJB A;  1PCA A;  3B3W A;  2CNM A;  4Z65 A;  4RUH A;  4G1P A;  2I3C A;  3FXT A;  3PZJ A;  3CT9 A;  2RC4 A;  1YVK A;  2Q0Y A;  2FXF A;  2ZW5 A;  4XPD C;  4CGM A;  4XPL A;  2D4O A;  2REF A;  2B5G B;  2AFZ A;  3GY9 A;  1I21 A;  4Q36 A;  2EO8 A;  2JLM A;  2C6G A;  1MJ9 A;  2NYQ A;  4RN7 A;  3SHP A;  5G22 A;  2PC1 A;  4KOT A;  2YNC C;  1YR0 A;  3LAC A;  4FUU A;  3KGQ A;  3LD2 A;  4P4B A;  2WPX A;  1UWY A;  4XPD B;  3TO7 A;  2CTC A;  3BI1 A;  3PFO A;  2JDC A;  1Q2Y A;  1J4J A;  4FBE A;  4XPK A;  3CDX A;  3D7G A;  3F5B A;  3ZZI A;  7CPA A;  2IJZ A;  3D67 A;  2ZEG A;  1S60 A;  2B5G A;  5HH1 A;  1WWZ A;  2YNE A;  2NSM A;  3PRT A;  3BHX A;  3GUX A;  4H6U A;  2CF4 A;  3ZJ0 A;  4CGN A;  5J8F A;  8CPA A;  1IGB A;  4P4F A;  3ISX A;  1PU9 A;  2A4N A;  1SQH A;  2Z3K A;  3BLN A;  2Z3N A;  4KSF A;  3HLP A;  2XEF A;  1GHE A;  1IID A;  1Y0Y A;  1VHS A;  3RAM A;  3F8K A;  4EWT A;  2QVP A;  2AFO A;  3FMC A;  4QVT A;  2YNC A;  5HMN A;  1Y7R A;  1TIQ A;  4MCQ A;  3H4Q A;  1QQ9 A;  2P6F A;  1WK4 A;  4PPZ A;  3ISZ A;  5F48 A;  1BPM A;  1KWM A;  2Q44 A;  3RNZ A;  5J8C A;  3B3S A;  3FYN A;  2B58 A;  5HXD A;  2QYV A;  5AG4 A;  1JWQ A;  2ZEL A;  4PXD A;  4IUS A;  2B4D B;  2ZW4 A;  3C26 A;  4YGO A;  2V77 A;  4CGO A;  2GLF A;  3IO1 A;  2JBJ A;  4QBJ A;  1Z8W A;  2PSW A;  4A94 A;  1S5K A;  2OZU A;  1F2O A;  2HV2 A;  3JTK A;  3MRU A;  3P2H A;  1HEE A;  3VWD A;  1S7K A;  3DLJ A;  4HNX B;  3S6G A;  5KTD A;  4GM5 A;  1LCP A;  2JDD A;  3NH4 A;  3L2N A;  4MFQ A;  4F0X A;  4JZ0 A;  4LX9 A;  1KUX A;  1LRZ A;  3FX6 A;  4J3G A;  4E2A A;  2BEI A;  4UFW A;  4PXC A;  1XE4 A;  3FED A;  3JVN A;  4NGN A;  5D29 A;  5KTC A;  5E96 A;  3CXQ A;  4PK2 A;  2B4D A;  2XEJ A;  4MY0 A;  4Y49 C;  3TT2 A;  4MCP A;  4H89 A;  2PJ8 A;  4HPS A;  1ZG9 A;  4P4D A;  1BAV A;  4HNW B;  2PJ2 A;  4OKO A;  3PB9 X;  1CP6 A;  2Q04 A;  4PXE A;  4BMH A;  3PBE A;  1YK3 A;  4UIA A;  2DF5 A;  3B8G A;  4K30 A;  4P44 A;  3TO6 A;  4KOW A;  3RYO A;  2BOA A;  2Q4Y A;  4Y49 B;  2ZW7 A;  3I9S A;  2BCO A;  1X12 A;  3D7H A;  2PJB A;  2Z3L A;  2ZXV A;  4RI1 A;  1X10 A;  2WZN A;  4UCP A;  4B12 A;  4GXH A;  4KS9 A;  3CXS A;  3KR4 A;  2IMO A;  2POK A;  5F09 A;  1DE4 C;  4FWU A;  3B3T A;  3SJF A;  4YFJ A;  2FSR A;  5D8N A;  3BJ7 A;  5BWA B;  2CXA A;  1VGY A;  3CPX A;  3FNC A;  4R57 A;  3NFZ A;  2G0B A;  2J9A A;  1Z8L A;  4UWI A;  4MCR A;  3VAT A;  3FB3 A;  4C2X A;  4R76 A;  1MJB A;  3TOB A;  5C88 A;  4PQA A;  1RTQ A;  1S3Z A;  3B35 A;  2C27 A;  2G3A A;  2Z3O A;  4MFJ A;  4UCM A;  4DYO A;  1Y0R A;  4NGQ A;  5K8P A;  3W6S A;  4U9Z A;  1HDQ A;  2Z11 A;  3DSB A;  3JUW A;  4MI4 A;  4KOU A;  5K8M A;  4FD5 A;  1XJO A;  4CRY B;  5I4M A;  4LQ6 A;  4UEF A;  5HVG A;  5JPH A;  5LYL A;  4DJL A;  1ARM A;  1YLO A;  3D7F A;  3LWU A;  4M6G A;  1LAN A;  1FY7 A;  1IOI A;  1S7N A;  3NE8 A;  4A37 A;  4AXV A;  4MFZ A;  1Z8T A;  1M44 A;  2PJ4 A;  2VBQ A;  1M4I A;  2C6C A;  5LRJ A;  3PB8 X;  3DNS A;  5AGE A;  4C2Y A;  3KHZ A;  2F5I A;  4NJQ A;  2GRE A;  4NF1 A;  2Z0Z A;  1IYL A;  3CXP A;  3IEH A;  4KSI A;  4R6T A;  2QEC A;  2HC9 A;  1YVO A;  2JBK A;  5J1Q A;  1ELL P;  4NGR A;  5AG6 A;  3TCV A;  4UFX A;  2QIR A;  4CPA A;  4KSA A;  3PFE A;  1CBX A;  1Y9K A;  5KTA A;  3WT4 A;  4M3S A;  2AFU A;  1I1D A;  2P6E A;  1K4J A;  3R9G A;  4BBH A;  4HKF A;  1TKJ A;  2C1C A;  3KI9 A;  1MJA A;  5CNP A;  1CPX A;  1LAM A;  5CBM A;  1XMT A;  2ZPA A;  2ANP A;  5F47 A;  1TKF A;  4IHM A;  1KUY A;  1XF8 A;  4R9M A;  2PJC A;  4X2T A;  4FD7 A;  2WSA A;  1NMT A;  2ZW6 A;  1XEB A;  4MHZ A;  3NE7 A;  4EVY A;  4JLY A;  1YQE A;  4OC4 A;  3PBB A;  1N71 A;  3NA6 A;  1YRE A;  2CNS A;  4NSQ A;  3RZA A;  1CJW A;  5H84 A;  1IOF A;  2OU2 A;  1L0C A;  4NEX A;  4OIW A;  2R98 A;  4MBU A;  3B2Y A;  4MFP A;  2YGW A;  3WC7 A;  2B4B A;  1ZO0 A;  4KLW A;  1CX8 A;  2IL4 A;  2BSW A;  4MCS A;  1U6M A;  4QC6 A;  3TOA A;  4CAF A;  1IY7 A;  3R96 A;  4C68 A;  2FIW A;  1I12 A;  4B10 A;  2ZEO A;  4PSX A;  1TF9 A;  3IWG A;  4B5O A;  1QMU A;  2JEV A;  3K9T A;  4F9U A;  1IYK A;  3TO9 A;  2HUZ A;  2I00 A;  1YME A;  2J8N A;  4F6A A;  1ON0 A;  1P0H A;  3IIB A;  1R3N A;  3QAH A;  4KZT A;  4Q7A A;  5LRG A;  5K8O A;  2B3U A;  2PQ8 A;  1RO5 A;  2Q4Z A;  2AFW A;  1QST A;  4OAE A;  4CAE A;  2ODF A;  1BOB A;  4EFD A;  2CTB A;  4CS0 B;  2GFQ A;  1Y7E A;  3GLJ A;  2GE3 A;  4HNY B;  2I79 A; 
#chains in the Genus database with same CATH homology
 4MY3 A;  2ATR A;  1IB1 E;  3D3S A;  1QSO A;  4MJ8 A;  3VWE A;  5I0C A;  4B13 A;  1RXT A;  3PP9 A;  1Q2D A;  4A2Z A;  1B6B A;  4LUA A;  4MFK A;  4QUS A;  2EUI A;  2HQY A;  4AVB A;  2R7H A;  1KZF A;  3W6X A;  5DWN A;  2DXQ A;  4AG7 A;  3EFA A;  1NE9 A;  3IGR A;  2Z3P A;  1CM0 A;  5G20 A;  2VXK A;  3TFY A;  3DR6 A;  3LOD A;  1YX0 A;  2KCW A;  4KOS A;  4UCN A;  1Q2C A;  5IV0 A;  5ISV A;  4CYQ A;  3R95 A;  4PV6 A;  4R3L A;  2B3V A;  1KUV A;  4OAD A;  5F47 A;  2AJ6 A;  1S7L A;  1Z4R A;  3BJ8 A;  4BBH A;  4CAF A;  3E0K A;  2FE7 A;  2GAN A;  4RS2 A;  4ORF A;  5JQ4 A;  1VKC A;  4C7H A;  4E0A A;  1NSL A;  3DDD A;  4AVA A;  3UY5 A;  1UFH A;  1QSR A;  3V8I A;  4A95 A;  4C7I A;  1B87 A;  3SXN A;  2NMT A;  4UA3 A;  3D8P A;  4IF5 A;  2PDO A;  4AB7 A;  4AVC A;  2OZH A;  5A27 A;  4GS4 A;  3T9Y A;  3FIX A;  4B5P B;  4X5K A;  2Q4V A;  3N7Z A;  4JXQ A;  4R87 A;  4YRH A;  2GIV A;  4U5Y A;  4E8O A;  4MFL A;  5G21 A;  3KKW A;  3PGP A;  3R9E A;  4B14 A;  4L89 A;  3DR8 A;  2VZY A;  1Y9W A;  3R1K A;  4B5P A;  2Z10 A;  2VZZ A;  4A30 A;  4NXY A;  5GCN A;  1YLE A;  4NCZ A;  4AG9 A;  3S6K A;  4CAV A;  4A33 A;  3R9F A;  1QSN A;  4KUA A;  3H5Z A;  3TE4 A;  2J8M A;  4KVM E;  4R3K A;  2X7B A;  3FBU A;  4CYN A;  3D2M A;  4F0Y A;  2EVN A;  4KUB A;  5H86 A;  2YND A;  3OWC A;  4M85 A;  2WUU A;  3I3G A;  2QML A;  2WPW A;  4CYO A;  3FRM A;  2FT0 A;  2DPS A;  5IX3 A;  5G1Z A;  3S6F A;  4JXR A;  2R8V A;  3GYA A;  4L8A A;  4H6Z A;  2ARH A;  5F46 A;  4U9Y A;  2PRB A;  4CAX A;  2OB0 A;  2FS5 A;  2PR8 A;  3K9U A;  4PK3 A;  4ZBG A;  4XNH C;  2Y0M A;  3SXO A;  4KLV A;  4UBR A;  4JWP A;  4C2Z A;  4JJX A;  1MK4 A;  3QB8 A;  2P6G A;  1Z4E A;  4KOX A;  4XNH B;  2G3T A;  4QB9 A;  5FVJ A;  4CGP A;  4CRZ B;  5F49 A;  2BUE A;  1PUA A;  5EC4 A;  4MHD A;  3S6H A;  2P0W A;  5IB0 A;  3IWE A;  3EC4 A;  1OZP A;  1XIX A;  3T90 A;  3G3S A;  3IU2 A;  2J8R A;  1IIC A;  5C82 A;  2D4P A;  2PR1 A;  4UWJ A;  2CY2 A;  4A31 A;  4B11 A;  4KVO E;  5AG5 A;  2DPT A;  4KOR A;  4OLL A;  1Z9U A;  2H5M A;  1M4D A;  3P2F A;  4DNC A;  4II9 A;  4UFV A;  4KOY A;  2FL4 A;  2OZG A;  3D2P A;  2VQY A;  4FD4 A;  4JD6 A;  4A32 A;  1M4G A;  4PSW A;  1M1D A;  2FIA A;  2VEZ A;  4Q38 A;  3G8W A;  1V0C A;  2AE6 A;  4CGL A;  3WR7 A;  2K5T A;  2Q7B A;  3F0A A;  2REE A;  2O28 A;  3A9L A;  3W91 A;  5A28 A;  1YGH A;  4ZGY B;  3IU1 A;  3MGD A;  5DWM A;  3EY5 A;  4ONU A;  4CYP A;  3EO4 A;  2Z3M A;  1S7F A;  5AG7 A;  2VI7 A;  2OH1 A;  4KVX A;  1R57 A;  4KOV A;  2CNT A;  2FCK A;  3TTH A;  4FD6 A;  1BO4 A;  4I49 A;  2BL1 A;  1P4N A;  3GKR A;  5EBV A;  2R1I A;  3EXN A;  1QSM A;  4CAW A;  2CNM A;  3FXT A;  3PZJ A;  2RC4 A;  1YVK A;  2Q0Y A;  2FXF A;  2ZW5 A;  4XPD C;  4CGM A;  4XPL A;  2D4O A;  2REF A;  2B5G B;  3GY9 A;  1I21 A;  4Q36 A;  2JLM A;  1MJ9 A;  3SHP A;  5G22 A;  2PC1 A;  4KOT A;  2YNC C;  1YR0 A;  3LD2 A;  2WPX A;  4XPD B;  3TO7 A;  2JDC A;  1Q2Y A;  1J4J A;  4XPK A;  3F5B A;  3ZZI A;  1S60 A;  2B5G A;  5HH1 A;  1WWZ A;  2YNE A;  4H6U A;  3ZJ0 A;  4CGN A;  5J8F A;  4KSF A;  1PU9 A;  2A4N A;  1SQH A;  2Z3K A;  3BLN A;  2Z3N A;  1GHE A;  1IID A;  1VHS A;  3F8K A;  4QVT A;  5HMN A;  2YNC A;  1Y7R A;  1TIQ A;  3H4Q A;  2P6F A;  1WK4 A;  5F48 A;  2Q44 A;  5J8C A;  3FYN A;  2B58 A;  5AG4 A;  4IUS A;  2B4D B;  2ZW4 A;  3C26 A;  4YGO A;  4CGO A;  4QBJ A;  2PSW A;  1S5K A;  2OZU A;  2HV2 A;  3JTK A;  3P2H A;  3VWD A;  1S7K A;  4HNX B;  3S6G A;  5KTD A;  2JDD A;  4MFQ A;  4F0X A;  4LX9 A;  1KUX A;  1LRZ A;  4J3G A;  4E2A A;  2BEI A;  4UFW A;  1XE4 A;  3JVN A;  5KTC A;  5E96 A;  3CXQ A;  4PK2 A;  2B4D A;  4MY0 A;  4Y49 C;  3TT2 A;  4H89 A;  4HNW B;  2Q04 A;  4BMH A;  1YK3 A;  3B8G A;  4K30 A;  3TO6 A;  4KOW A;  3RYO A;  2Q4Y A;  4Y49 B;  2ZW7 A;  3I9S A;  2ZXV A;  2Z3L A;  4RI1 A;  4UCP A;  4B12 A;  4KS9 A;  3CXS A;  4YFJ A;  2FSR A;  5BWA B;  3BJ7 A;  2CXA A;  3FNC A;  4R57 A;  2G0B A;  4UWI A;  3FB3 A;  4C2X A;  1MJB A;  3TOB A;  5C88 A;  1S3Z A;  2C27 A;  2G3A A;  2Z3O A;  4MFJ A;  4UCM A;  3W6S A;  4U9Z A;  2Z11 A;  3DSB A;  3JUW A;  4MI4 A;  4KOU A;  4FD5 A;  4CRY B;  5JPH A;  1FY7 A;  1S7N A;  4MFZ A;  1M44 A;  2VBQ A;  1M4I A;  3DNS A;  5AGE A;  4C2Y A;  2F5I A;  4NF1 A;  2Z0Z A;  3CXP A;  1IYL A;  2QEC A;  1YVO A;  5AG6 A;  3TCV A;  4UFX A;  2QIR A;  4KSA A;  1Y9K A;  5KTA A;  4M3S A;  1I1D A;  2P6E A;  1K4J A;  3R9G A;  4HKF A;  5CNP A;  1MJA A;  1XMT A;  2ZPA A;  1KUY A;  1XF8 A;  4R9M A;  4FD7 A;  2WSA A;  1NMT A;  2ZW6 A;  1XEB A;  3NE7 A;  4EVY A;  4JLY A;  1N71 A;  1YRE A;  2CNS A;  4NSQ A;  1CJW A;  5H84 A;  2OU2 A;  1L0C A;  4NEX A;  2R98 A;  4MBU A;  4MFP A;  2YGW A;  2B4B A;  1ZO0 A;  4KLW A;  2IL4 A;  4QC6 A;  2BSW A;  3TOA A;  1U6M A;  3R96 A;  4C68 A;  2FIW A;  1I12 A;  4B10 A;  4PSX A;  3IWG A;  4B5O A;  2JEV A;  1IYK A;  3TO9 A;  2HUZ A;  2I00 A;  2J8N A;  4F6A A;  1ON0 A;  1P0H A;  4KZT A;  3QAH A;  2B3U A;  2PQ8 A;  1RO5 A;  4OAE A;  1QST A;  4CAE A;  1BOB A;  4CS0 B;  2GE3 A;  4HNY B;  2I79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...