3SI0A

Structure of glycosylated human glutaminyl cyclase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
324
structure length
314
Chain Sequence
EEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFNNRVFVGATDSAVPCAMMLELARALDKKLLSLKDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title Structures of Glycosylated Mammalian Glutaminyl Cyclases Reveal Conformational Variability near the Active Center.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 104
structure length 314
sequence length 324
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3si0A00
2CTBA 3FEEA 5JGFA 3RAMA 4F8ZA 4PQAA 4ZI6A 2NSMA 3RZAA 2PVVA 2POKA 4NGQA 4ZY1A 3FX6A 3BXMA 4OMEA 3SJGA 1IGBA 2HC9A 2JEWA 1ZLIA 3NH5A 1H8LA 2C6PA 5LRGA 3SJEA 3FVLA 3CDXA 4IAVA 1TF9A 3IWWA 3PFOA 2IQ6A 2HB6A 2O4HA 4IHMA 5LYIA 4MRIA 4LQGA 3L2NA 3K9TA 1GYTA 4JZ0A 1YW6A 3B3TA 5HVGA 5D29A 3ISXA 2BO9A 4MMOA 3D66A 3CPXA 1RTQA 3KGQA 4MHZA 1CBXA 2BCOA 4P4IA 4FWUA 5LYLA 3BI0A 4P45A 3PBBA 3B3VA 1AYEA 1VHEA 5LYFA 1ELMP 4DUKA 1HEEA 4R8FA 4H2KA 4NGNA 2C6GA 2RB7A 3NH4A 1HDQA 1ZG8A 4P4BA 1TKHA 4F9VA 3B35A 3FF3A 3HLPA 1BPNA 2GREA 4OIWA 3IO1A 4P6YA 4R6TA 4X2TA 2V77A 3SJXA 5D8NA 3FH4A 3SJFA 3KHXA 4A94A 4UEFA 2PJ1A 4EWTA 2ZEHA 4RUHA 1CG2A 2EK8A 4P4JA 2OOTA 3WT4A 4NJQA 4OC4A 4NFRA 2ZEFA 2ZEEA 2CIJA 4OC5A 2GLJA 2AFMA 2PJ6A 2PJ5A 3K2KA 4NGRA 4PXDA 4ONWA 3LWUA 3VATA 1OBRA 4DJLA 4A39A 3DGVA 2GU2A 1FNOA 4MXUA 3MRUA 2AFXA 2RFHA 2J9AA 3D68A 2AFZA 2PJ9A 3H8GA 3WC6A 1YW4A 1KWMA 2VL1A 3B3SA 5K8OA 1HDUA 4BD9A 4NJRA 4DYOA 3BHXA 3D7HA 3FMCA 3TC8A 5LRKA 5HVHA 4EFDA 2PVWA 2ABZA 2IMOA 3NA6A 3PRTA 2OR4A 5DS0A 3KQZA 4EMEA 5CPAA 1VIXA 1XMBA 2PJCA 4ZYQA 3V7ZA 4NGMA 5HVFA 1UWYA 1TKFA 2JBJA 3IIBA 1NSAA 4FBEA 2AFUA 3S9MA 2F7VA 1ZG9A 3FEDA 4G1PA 4R7MA 4K3NA 5CBMA 4OC0A 3SI1A 3WABA 1YSJA 3RBUA 2QVPA 4P44A 8CPAA 3LMSA 4UF4A 1BPMA 1PYTB 3D67A 3B7IA 3PB9X 3KL9A 1ARLA 2I3CA 1Z2LA 2V8GA 4MHNA 4FUUA 4WJBA 2PJAA 3QNVA 4OC1A 3PB7X 2EK9A 3IEHA 4B6ZA 2ZEMA 2ZEPA 4F9UA 2ZEDA 4R76A 1LCPA 2Q43A 2C1CA 3B3WA 2XEJA 1XFOA 3GUXA 5K8PA 4P10A 1F2OA 4A38A 1TXRA 2JBKA 4ZX8A 2IJZA 1CX8A 2CF4A 5I4MA 4TWEA 3KR5A 4UEZA 2PCUA 5JH9A 2DEAA 1Y0YA 1IY7A 3JRUA 4KSIA 2PJ2A 2PRQA 3T8WA 3S9LA 1DTDA 1F2PA 4PXEA 1CPXA 2AFOA 4P4FA 5ELYA 3H8FA 2PJBA 5F09A 6CPAA 1LANA 4NGTA 4P4EA 2PJ4A 2O53A 1Y7EA 4JYWA 2WYRA 3I1UA 2PIZA 4A37A 7CPAA 3FECA 3CPAA 2V8HA 1BAVA 3PB4X 1YMEA 3TX8A 4AXVA 3KASA 1DE4C 2ZEOA 2FVGA 2GLFA 2PJ7A 3HUVA 3D4UA 2QJ8A 1ZLHA 1CP7A 1FT7A 3GB0A 2PE3A 2NYQA 3KZWA 4ZX9A 2EWBA 4FAIA 2XEGA 3D7DA 3KI9A 1YLOA 4UIAA 2C6CA 3D7FA 3FJUA 2AFWA 1BLLE 1XJOA 1XBUA 1XRYA 4OC3A 3ISZA 1Z5RA 2ZOFA 3SI2A 4Q7AA 5LYDA 4O23A 3PFEA 4X8IA 3WC7A 4ZY0A 3VH9A 1JQGA 2V8DA 2V8VA 4OP4A 3PBEA 2ZOGA 5LRJA 3WC5A 2WZNA 3KHZA 1PCAA 3CT9A 3B3CA 3KQXA 1EE3P 1CP6A 5K8NA 3BI1A 1QQ9A 4OIDA 2ZELA 4W9YA 1TKJA 3H8EA 2BOAA 1QMUA 2PIYA 3NH8A 2F8HA 4P4DA 1Y0RA 1CPSA 4UIBA 3B2YA 3GLJA 3NFZA 4WWVA 5K8MA 4PXBA 4TNUA 1TF8A 2PJ3A 5HXDA 3DLJA 4MCSA 1LOKA 4YU9A 3SI0A 1R3NA 2XEIA 3S9NA 2Q51A 2PJ0A 3KR4A 4PXCA 2XEFA 4X3RA 3IJ3A 3V38A 1LAMA 3D7GA 3IC1A 4OC2A 1VGYA 2PJ8A 1Z8LA 2Q4ZA 3PB6X 4OKOA 4MCPA 3MN8A 4GM5A 1ARMA 2ZEGA 4MCQA 2AFSA 1LAPA 2ANPA 5JM6A 5IB9A 1F57A 2QYVA 3IFEA 5THWA 1VHOA 4Z65A 4YWYA 4NGSA 3PB8X 3N5FA 4NGPA 1M4LA 1R43A 3VARA 4IK2A 4CPAA 2CTCA 5J1QA 4PPZA 4MHPA 2G9DA 1ELLP 1AMPA 4MHYA 4MCRA 1Q7LA 4UEEA 4ZY2A 2ZENA 3PEIA 1ZG7A 1LFWA
chains in the Genus database with same CATH superfamily
4KS9A 1BO4A 4I49A 4B12A 2CTBA 3FEEA 5JGFA 3RAMA 4F8ZA 1QSNA 2OZUA 4PK2A 4QC6A 4PQAA 2JDDA 4B5OA 4ZI6A 2NSMA 2Q0YA 4LX9A 2Q04A 3RZAA 2PVVA 2POKA 2Z3NA 4NGQA 4ZY1A 4PSXA 3FX6A 3D8PA 1S7NA 3BXMA 2REEA 4OMEA 3SJGA 1IGBA 3N7ZA 2Q4YA 4MY0A 4QVTA 4XNHB 2HC9A 5I0CA 5JPHA 2JEWA 5HMNA 1ZLIA 1MJAA 4KORA 3NH5A 1H8LA 1Z8WA 1I12A 2C6PA 5LRGA 3SJEA 4BBHA 3FVLA 2A4NA 4KLWA 3CDXA 4XPDB 4IAVA 4RI1A 1TF9A 2J8NA 3IWWA 3PFOA 5H86A 4R3LA 2IQ6A 2FXFA 2HB6A 2O4HA 2R8VA 4IHMA 1TIQA 3JUWA 2CNTA 4NXYA 3IWGA 5LYIA 4MRIA 1IICA 2P0WA 2OU2A 3F8KA 4CRYB 3IGRA 4LQGA 3S6HA 4A33A 4KUBA 2P6FA 3TO7A 1Y7RA 3L2NA 3K9TA 5DWNA 1GYTA 3C26A 1OZPA 4CAWA 2Z3LA 4JZ0A 3R9FA 1YW6A 3B3TA 4CYNA 4PV6A 5HVGA 5D29A 2J8RA 3ISXA 2BO9A 1IIDA 4MMOA 3D66A 4CAEA 3ZJ0A 2GANA 5F49A 3CPXA 1RTQA 3TO9A 3KGQA 2ZW4A 3ZZIA 4E0AA 4MHZA 2PQ8A 1CBXA 1YR0A 2BCOA 4P4IA 4AB7A 4FWUA 2CY2A 5LYLA 4NCZA 4PSWA 4KOYA 3BI0A 2Z3KA 4P45A 1I1DA 5DWMA 2AJ6A 3PBBA 3QAYA 2WPXA 3B3VA 3PZJA 1AYEA 4K30A 4A32A 1VHEA 4M85A 4B14A 5LYFA 1ELMP 4CYQA 4RS2A 4DUKA 1HEEA 4R8FA 2Y0MA 3LACA 4H2KA 2Q7SA 4NGNA 2B5GB 2C6GA 2RB7A 3NH4A 2FIWA 1HDQA 5IX3A 1ZG8A 2AE6A 4MFLA 4UFWA 4P4BA 3R1KA 4M6HA 3QAHA 1TKHA 4F9VA 3BJ7A 1NMTA 3B35A 3FF3A 3HLPA 4ONUA 4GS4A 1BPNA 4JWPA 5BWAB 2GREA 4KOTA 3IO1A 4OIWA 3FBUA 4P6YA 1AUGA 1S7LA 2FT0A 4R6TA 4X2TA 2B4DA 1XE4A 2HV2A 2V77A 1X12A 4MFZA 5E96A 4CGPA 3A9LA 3SJXA 5D8NA 3FH4A 3SJFA 5F46A 2Q4VA 1XOVA 3KHXA 4A94A 5GCNA 4U5YA 4R87A 2PJ1A 3IU1A 4M6GA 4UEFA 4L8AA 1S7KA 3EFAA 4JXQA 1QSMA 1YVOA 2ZEHA 3R9GA 4E8OA 4EWTA 3TE4A 5A27A 4RUHA 4QBJA 2NMTA 1CG2A 4UWIA 2EK8A 4P4JA 2OOTA 3WT4A 4GXHA 2O28A 3I9SA 4NJQA 4H6UA 1Y9WA 4OC4A 4NFRA 2ZEFA 4H6ZA 4HNXB 4AVCA 2F5IA 2ZEEA 2CIJA 1IU8A 2YNDA 2B58A 3H4QA 4OC5A 2GLJA 2AFMA 2PJ6A 2PJ5A 3CXSA 3DDDA 3K2KA 2WSAA 4A95A 4IF5A 4NGRA 4ORFA 4PXDA 4ZBGA 5G21A 4ONWA 3LWUA 3VATA 1MJ9A 1OBRA 2J8MA 4DJLA 1SQHA 4A39A 4C7HA 3DGVA 5J8FA 1KZFA 1FNOA 2GU2A 4JD6A 1KUYA 2GIVA 4MXUA 4CGMA 3MRUA 5A28A 3T90A 4KOXA 2AFXA 2JDCA 2RFHA 4HKFA 2YNCC 2Z10A 2J9AA 3D68A 3JTKA 4BINA 3D2PA 1GHEA 2AFZA 2PJ9A 2FIAA 3H8GA 3WC6A 1YW4A 1KWMA 2VL1A 3B3SA 2PR1A 3DR6A 4LQ6A 5K8OA 4XPLA 1HDUA 4BD9A 5IB0A 4NJRA 4DYOA 3BHXA 3D7HA 5AG5A 3TOBA 2Z3PA 3FMCA 2R98A 3TC8A 4CAXA 2JLMA 2B3UA 5HVHA 5LRKA 2DF5A 2EUIA 3FYNA 3R95A 4B10A 4EFDA 5JQ4A 4UA3A 3DSBA 1J4JA 2PVWA 2WUUA 4OAEA 3S6KA 4C7IA 2ABZA 2IMOA 3NA6A 4B5PB 3PRTA 5F47A 1N71A 2OR4A 3FRMA 5DS0A 3VWDA 3KQZA 1YGHA 1P4NA 5C88A 1Q2CA 3TOAA 1R57A 2DXQA 3DR8A 4UFVA 1VKCA 4EMEA 5CPAA 1VIXA 1U6MA 1XMBA 2PJCA 4Q36A 2B4BA 3K9UA 4MFPA 4ZYQA 4II9A 3V7ZA 4NGMA 3RNZA 5KTAA 5HVFA 3GYAA 2CXAA 2PSWA 2D4OA 1CJWA 1UWYA 3SXOA 2GFQA 1TKFA 4CAVA 1NE9A 2JBJA 3IIBA 1NSAA 4FD5A 4FBEA 2AFUA 2OZHA 3S9MA 2F7VA 1YREA 1ZG9A 3FEDA 3JVNA 4G1PA 4R7MA 5ISVA 4K3NA 2DPSA 5CBMA 4B11A 2HQYA 4OC0A 1P0HA 3SI1A 3WABA 4HNYB 1S3ZA 3R9EA 1YSJA 3RBUA 2QVPA 2R7HA 4OLLA 3T9YA 3TCVA 4CGLA 3TO6A 4P44A 8CPAA 1FY7A 3LMSA 2I00A 3EY5A 1BPMA 4UF4A 4Y49C 1PYTB 1B6BA 3D67A 4L89A 1V0CA 1S60A 1A2ZA 4QB9A 2B3VA 3B7IA 3H5ZA 3KL9A 3PB9X 1B87A 3P2FA 3TTHA 1UFHA 2VZYA 1ARLA 1Q2YA 2I3CA 1Z2LA 3FXTA 2EVNA 2V8GA 5AG7A 4ZGYB 5EC4A 4CRZB 4YGOA 2HUZA 4MHNA 4FUUA 4WJBA 2PJAA 3QNVA 3OWCA 4OC1A 3PB7X 2Q7BA 2EK9A 3IEHA 1VHSA 4B6ZA 2ZEMA 2ZEPA 4KLVA 1YX0A 4MI4A 4KUAA 4F9UA 2BUEA 2I79A 2ZEDA 4JLYA 4R76A 1K4JA 2B5GA 4KVOE 1LCPA 2Q43A 2C1CA 3B3WA 2DPTA 4FD6A 1QSRA 5EBVA 1IOFA 1NSLA 2XEJA 4A30A 4M3SA 1XFOA 3GUXA 4YFJA 5K8PA 4P10A 1F2OA 4A38A 1TXRA 3CXQA 3IU2A 5G1ZA 2JBKA 4ZX8A 2IJZA 1CX8A 1M4IA 2CF4A 5I4MA 4TWEA 2IL4A 4AVBA 2ZW5A 1M4DA 3KR5A 2FCKA 4UEZA 3EXNA 1L0CA 2PCUA 2DEAA 3LODA 4A2ZA 5JH9A 4F6AA 1Y0YA 3W91A 1IY7A 3JRUA 1IOIA 1Q2DA 1XEBA 4KSIA 2QMLA 2FS5A 2PJ2A 2PRQA 3T8WA 2KCWA 2FL4A 3I3GA 3S9LA 3DNSA 5AGEA 1DTDA 3RO0A 1F2PA 3FB3A 4PXEA 2G3AA 4UCPA 2OZGA 1CPXA 2AFOA 3CZXA 4P4FA 4IUSA 5ELYA 3H8FA 4JXRA 2PJBA 1Z4EA 5F09A 5IV0A 6CPAA 1LANA 4NGTA 4XPKA 2YNEA 4P4EA 1BOBA 2PJ4A 4HPSA 4C2XA 1M44A 4UCMA 2O53A 4MJ8A 1Y7EA 2RC4A 2K5TA 1MJBA 1KUVA 4JYWA 1S5KA 4MBUA 2WYRA 4F0XA 3I1UA 2PIZA 1YVKA 4A37A 7CPAA 3FECA 5KTDA 2PRBA 4CYOA 3P2HA 4KSAA 4PK3A 3CPAA 2V8HA 2Z3MA 1Z4RA 2REFA 1BAVA 3PB4X 3IWEA 1YMEA 3E0KA 4F0YA 1Z8XA 3TX8A 2R1IA 3KASA 1DE4C 4NEXA 4MHDA 4AXVA 2ZEOA 3LD2A 2FVGA 2GLFA 2PJ7A 1X10A 3HUVA 3D4UA 1Z9UA 2QJ8A 1ZLHA 1CP7A 1FT7A 2VQYA 3GB0A 4OADA 4M6IA 2PE3A 2NYQA 1JWQA 3KZWA 2PC1A 3GIUA 4ZX9A 4R3KA 4E2AA 2EWBA 4FAIA 5G22A 3V8IA 2XEGA 3D7DA 3KI9A 4Y49B 1YLOA 4KOUA 5F48A 1YK3A 4KVME 4EVYA 5C82A 1QSTA 4UIAA 2CNMA 1ON0A 2CNSA 5G20A 2X7BA 2C6CA 3D7FA 3KKWA 3FJUA 3PGPA 4JJXA 3S6FA 5KTCA 4UBRA 3RYOA 2AFWA 1BLLE 1XJOA 2VBQA 1XBUA 1XRYA 4OC3A 3SHPA 3ISZA 4B5PA 4KOSA 4B13A 4Q38A 4KVXA 4AG9A 1Z5RA 2ZOFA 1IYKA 2Q44A 1M4GA 1IYLA 2Z0ZA 3SI2A 4Q7AA 5LYDA 2FSRA 4MFKA 4O23A 1PU9A 2ZW7A 3PFEA 3BJ8A 4X8IA 2ZW6A 3UY5A 3VH9A 3NE8A 3WC7A 4ZY0A 2FE7A 1JQGA 2V8DA 2V8VA 4OP4A 3PBEA 2ZOGA 4U9YA 5LRJA 3VWEA 1Z8TA 3WC5A 2WZNA 2BEIA 4MY3A 3G8WA 2OB0A 4NF1A 2PR8A 2VEZA 3TT2A 2H5MA 4CYPA 2Z11A 3KHZA 1LRZA 2JEVA 1PCAA 3CT9A 3B3CA 3KQXA 1EE3P 4C2ZA 1CP6A 3MGDA 5K8NA 3BI1A 2QECA 1WWZA 5HH1A 2D4PA 2WPWA 3BLNA 1QQ9A 5CNPA 1IB1E 1PUAA 1CM0A 4OIDA 2ZELA 3G3SA 1TKJA 4W9YA 4C2YA 1RO5A 3H8EA 4NSQA 2GE3A 2VZZA 2BOAA 1QMUA 2PIYA 3NH8A 2F8HA 5FVJA 4P4DA 1Y0RA 4FD4A 1YQEA 4KSFA 1CPSA 4UIBA 3B2YA 3GLJA 3NFZA 4WWVA 5AG4A 3GY9A 5K8MA 4PXBA 4TNUA 1TF8A 2PJ3A 5HXDA 4H89A 3DLJA 1S7FA 4XNHC 4MCSA 1LOKA 4YU9A 3SI0A 1R3NA 1QSOA 2ZXVA 2EO8A 2XEIA 3S9NA 2Q51A 2PJ0A 4A31A 2YGWA 4RN7A 3TFYA 3KR4A 2VXKA 4MFQA 4BMHA 4CGOA 2BL1A 4PXCA 2XEFA 4X3RA 4R9MA 5AG6A 2ZPAA 1RXTA 4XPDC 3IJ3A 3V38A 2YNCA 1LAMA 3D7GA 3IC1A 4OC2A 1VGYA 1WK4A 2G3TA 4MFJA 2Z3OA 4UWJA 2P6GA 2PJ8A 1Z8LA 4CAFA 3WR7A 2Q4ZA 3PB6X 1XIXA 5EMIA 1XMTA 4OKOA 2ARHA 3EC4A 4DNCA 4MCPA 3MN8A 4GM5A 1MK4A 2B4DB 1ARMA 2ZEGA 2G0BA 4KOVA 4LUAA 2AFSA 1LAPA 2ANPA 4MCQA 3PP9A 5J8CA 5IB9A 5JM6A 1F57A 3FIXA 4C68A 3F5BA 4KZTA 3EO4A 2QYVA 1YLEA 2P6EA 3IFEA 4KOWA 3D2MA 3CXPA 4AVAA 5THWA 4HNWB 1VHOA 1XF8A 2QIRA 4AG7A 3B8GA 4Z65A 4YWYA 4QUSA 4UFXA 4NGSA 3PB8X 3N5FA 3W6XA 1ZO0A 4NGPA 1M4LA 1KUXA 1R43A 4R57A 2BSWA 3VARA 2OH1A 4CGNA 4CS0B 4IK2A 4CPAA 5H84A 3QB8A 2CTCA 3D3SA 3GKRA 5J1QA 4PPZA 4MHPA 2PDOA 3SXNA 4YRHA 2G9DA 4FD7A 1ELLP 1AMPA 3R96A 4J3GA 3S6GA 4X5KA 3F0AA 4U9ZA 2VI7A 4MHYA 2ATRA 4MCRA 1Q7LA 4UEEA 4UCNA 3W6SA 2ODFA 4ZY2A 3NE7A 2EBJA 2ZENA 1M1DA 1I21A 1ZG7A 2C27A 3PEIA 1Y9KA 1LFWA 3FNCA
chains in the Genus database with same CATH topology
2CTBA 3FEEA 5JGFA 3RAMA 4F8ZA 4PQAA 4ZI6A 2NSMA 3RZAA 2PVVA 2POKA 4NGQA 4ZY1A 3FX6A 3BXMA 4OMEA 3SJGA 1IGBA 2HC9A 2JEWA 1ZLIA 3NH5A 1H8LA 2C6PA 5LRGA 3SJEA 3FVLA 3CDXA 4IAVA 1TF9A 3IWWA 3PFOA 2IQ6A 2HB6A 2O4HA 4IHMA 5LYIA 4MRIA 4LQGA 3L2NA 3K9TA 1GYTA 4JZ0A 1YW6A 3B3TA 5HVGA 5D29A 3ISXA 2BO9A 4MMOA 3D66A 3CPXA 1RTQA 3KGQA 4MHZA 1CBXA 2BCOA 4P4IA 4FWUA 5LYLA 3BI0A 4P45A 3PBBA 3B3VA 1AYEA 1VHEA 5LYFA 1ELMP 4DUKA 1HEEA 4R8FA 4H2KA 4NGNA 2C6GA 2RB7A 3NH4A 1HDQA 1ZG8A 4P4BA 1TKHA 4F9VA 3B35A 3FF3A 3HLPA 1BPNA 2GREA 4OIWA 3IO1A 4P6YA 4R6TA 4X2TA 2V77A 3SJXA 5D8NA 3FH4A 3SJFA 3KHXA 4A94A 4UEFA 2PJ1A 4EWTA 2ZEHA 4RUHA 1CG2A 2EK8A 4P4JA 2OOTA 3WT4A 4NJQA 4OC4A 4NFRA 2ZEFA 2ZEEA 2CIJA 4OC5A 2GLJA 2AFMA 2PJ6A 2PJ5A 3K2KA 4NGRA 4PXDA 4ONWA 3LWUA 3VATA 1OBRA 4DJLA 4A39A 3DGVA 2GU2A 1FNOA 4MXUA 3MRUA 2AFXA 2RFHA 2J9AA 3D68A 2AFZA 2PJ9A 3H8GA 3WC6A 1YW4A 1KWMA 2VL1A 3B3SA 5K8OA 1HDUA 4BD9A 4NJRA 4DYOA 3BHXA 3D7HA 3FMCA 3TC8A 5LRKA 5HVHA 4EFDA 2PVWA 2ABZA 2IMOA 3NA6A 3PRTA 2OR4A 5DS0A 3KQZA 4EMEA 5CPAA 1VIXA 1XMBA 2PJCA 4ZYQA 3V7ZA 4NGMA 5HVFA 1UWYA 1TKFA 2JBJA 3IIBA 1NSAA 4FBEA 2AFUA 3S9MA 2F7VA 1ZG9A 3FEDA 4G1PA 4R7MA 4K3NA 5CBMA 4OC0A 3SI1A 3WABA 1YSJA 3RBUA 2QVPA 4P44A 8CPAA 3LMSA 4UF4A 1BPMA 1PYTB 3D67A 3B7IA 3PB9X 3KL9A 1ARLA 2I3CA 1Z2LA 2V8GA 4MHNA 4FUUA 4WJBA 2PJAA 3QNVA 4OC1A 3PB7X 2EK9A 3IEHA 4B6ZA 2ZEMA 2ZEPA 4F9UA 2ZEDA 4R76A 1LCPA 2Q43A 2C1CA 3B3WA 2XEJA 1XFOA 3GUXA 5K8PA 4P10A 1F2OA 4A38A 1TXRA 2JBKA 4ZX8A 2IJZA 1CX8A 2CF4A 5I4MA 4TWEA 3KR5A 4UEZA 2PCUA 5JH9A 2DEAA 1Y0YA 1IY7A 3JRUA 4KSIA 2PJ2A 2PRQA 3T8WA 3S9LA 1DTDA 1F2PA 4PXEA 1CPXA 2AFOA 4P4FA 5ELYA 3H8FA 2PJBA 5F09A 6CPAA 1LANA 4NGTA 4P4EA 2PJ4A 2O53A 1Y7EA 4JYWA 2WYRA 3I1UA 2PIZA 4A37A 7CPAA 3FECA 3CPAA 2V8HA 1BAVA 3PB4X 1YMEA 3TX8A 4AXVA 3KASA 1DE4C 2ZEOA 2FVGA 2GLFA 2PJ7A 3HUVA 3D4UA 2QJ8A 1ZLHA 1CP7A 1FT7A 3GB0A 2PE3A 2NYQA 3KZWA 4ZX9A 2EWBA 4FAIA 2XEGA 3D7DA 3KI9A 1YLOA 4UIAA 2C6CA 3D7FA 3FJUA 2AFWA 1BLLE 1XJOA 1XBUA 1XRYA 4OC3A 3ISZA 1Z5RA 2ZOFA 3SI2A 4Q7AA 5LYDA 4O23A 3PFEA 4X8IA 3WC7A 4ZY0A 3VH9A 1JQGA 2V8DA 2V8VA 4OP4A 3PBEA 2ZOGA 5LRJA 3WC5A 2WZNA 3KHZA 1PCAA 3CT9A 3B3CA 3KQXA 1EE3P 1CP6A 5K8NA 3BI1A 1QQ9A 4OIDA 2ZELA 4W9YA 1TKJA 3H8EA 2BOAA 1QMUA 2PIYA 3NH8A 2F8HA 4P4DA 1Y0RA 1CPSA 4UIBA 3B2YA 3GLJA 3NFZA 4WWVA 5K8MA 4PXBA 4TNUA 1TF8A 2PJ3A 5HXDA 3DLJA 4MCSA 1LOKA 4YU9A 3SI0A 1R3NA 2XEIA 3S9NA 2Q51A 2PJ0A 3KR4A 4PXCA 2XEFA 4X3RA 3IJ3A 3V38A 1LAMA 3D7GA 3IC1A 4OC2A 1VGYA 2PJ8A 1Z8LA 2Q4ZA 3PB6X 4OKOA 4MCPA 3MN8A 4GM5A 1ARMA 2ZEGA 4MCQA 2AFSA 1LAPA 2ANPA 5JM6A 5IB9A 1F57A 2QYVA 3IFEA 5THWA 1VHOA 4Z65A 4YWYA 4NGSA 3PB8X 3N5FA 4NGPA 1M4LA 1R43A 3VARA 4IK2A 4CPAA 2CTCA 5J1QA 4PPZA 4MHPA 2G9DA 1ELLP 1AMPA 4MHYA 4MCRA 1Q7LA 4UEEA 4ZY2A 2ZENA 3PEIA 1ZG7A 1LFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTB A;  3FEE A;  5JGF A;  3RAM A;  4F8Z A;  4PQA A;  4ZI6 A;  2NSM A;  3RZA A;  2PVV A;  2POK A;  4NGQ A;  4ZY1 A;  3FX6 A;  3BXM A;  4OME A;  3SJG A;  1IGB A;  2HC9 A;  2JEW A;  1ZLI A;  3NH5 A;  1H8L A;  2C6P A;  5LRG A;  3SJE A;  3FVL A;  3CDX A;  4IAV A;  1TF9 A;  3IWW A;  3PFO A;  2IQ6 A;  2HB6 A;  2O4H A;  4IHM A;  5LYI A;  4MRI A;  4LQG A;  3L2N A;  3K9T A;  1GYT A;  4JZ0 A;  1YW6 A;  3B3T A;  5HVG A;  5D29 A;  3ISX A;  2BO9 A;  4MMO A;  3D66 A;  3CPX A;  1RTQ A;  3KGQ A;  4MHZ A;  1CBX A;  2BCO A;  4P4I A;  4FWU A;  5LYL A;  3BI0 A;  4P45 A;  3PBB A;  3B3V A;  1AYE A;  1VHE A;  5LYF A;  1ELM P;  4DUK A;  1HEE A;  4R8F A;  4H2K A;  4NGN A;  2C6G A;  2RB7 A;  3NH4 A;  1HDQ A;  1ZG8 A;  4P4B A;  1TKH A;  4F9V A;  3B35 A;  3FF3 A;  3HLP A;  1BPN A;  2GRE A;  4OIW A;  3IO1 A;  4P6Y A;  4R6T A;  4X2T A;  2V77 A;  3SJX A;  5D8N A;  3FH4 A;  3SJF A;  3KHX A;  4A94 A;  4UEF A;  2PJ1 A;  4EWT A;  2ZEH A;  4RUH A;  1CG2 A;  2EK8 A;  4P4J A;  2OOT A;  3WT4 A;  4NJQ A;  4OC4 A;  4NFR A;  2ZEF A;  2ZEE A;  2CIJ A;  4OC5 A;  2GLJ A;  2AFM A;  2PJ6 A;  2PJ5 A;  3K2K A;  4NGR A;  4PXD A;  4ONW A;  3LWU A;  3VAT A;  1OBR A;  4DJL A;  4A39 A;  3DGV A;  2GU2 A;  1FNO A;  4MXU A;  3MRU A;  2AFX A;  2RFH A;  2J9A A;  3D68 A;  2AFZ A;  2PJ9 A;  3H8G A;  3WC6 A;  1YW4 A;  1KWM A;  2VL1 A;  3B3S A;  5K8O A;  1HDU A;  4BD9 A;  4NJR A;  4DYO A;  3BHX A;  3D7H A;  3FMC A;  3TC8 A;  5LRK A;  5HVH A;  4EFD A;  2PVW A;  2ABZ A;  2IMO A;  3NA6 A;  3PRT A;  2OR4 A;  5DS0 A;  3KQZ A;  4EME A;  5CPA A;  1VIX A;  1XMB A;  2PJC A;  4ZYQ A;  3V7Z A;  4NGM A;  5HVF A;  1UWY A;  1TKF A;  2JBJ A;  3IIB A;  1NSA A;  4FBE A;  2AFU A;  3S9M A;  2F7V A;  1ZG9 A;  3FED A;  4G1P A;  4R7M A;  4K3N A;  5CBM A;  4OC0 A;  3SI1 A;  3WAB A;  1YSJ A;  3RBU A;  2QVP A;  4P44 A;  8CPA A;  3LMS A;  4UF4 A;  1BPM A;  1PYT B;  3D67 A;  3B7I A;  3PB9 X;  3KL9 A;  1ARL A;  2I3C A;  1Z2L A;  2V8G A;  4MHN A;  4FUU A;  4WJB A;  2PJA A;  3QNV A;  4OC1 A;  3PB7 X;  2EK9 A;  3IEH A;  4B6Z A;  2ZEM A;  2ZEP A;  4F9U A;  2ZED A;  4R76 A;  1LCP A;  2Q43 A;  2C1C A;  3B3W A;  2XEJ A;  1XFO A;  3GUX A;  5K8P A;  4P10 A;  1F2O A;  4A38 A;  1TXR A;  2JBK A;  4ZX8 A;  2IJZ A;  1CX8 A;  2CF4 A;  5I4M A;  4TWE A;  3KR5 A;  4UEZ A;  2PCU A;  5JH9 A;  2DEA A;  1Y0Y A;  1IY7 A;  3JRU A;  4KSI A;  2PJ2 A;  2PRQ A;  3T8W A;  3S9L A;  1DTD A;  1F2P A;  4PXE A;  1CPX A;  2AFO A;  4P4F A;  5ELY A;  3H8F A;  2PJB A;  5F09 A;  6CPA A;  1LAN A;  4NGT A;  4P4E A;  2PJ4 A;  2O53 A;  1Y7E A;  4JYW A;  2WYR A;  3I1U A;  2PIZ A;  4A37 A;  7CPA A;  3FEC A;  3CPA A;  2V8H A;  1BAV A;  3PB4 X;  1YME A;  3TX8 A;  4AXV A;  3KAS A;  1DE4 C;  2ZEO A;  2FVG A;  2GLF A;  2PJ7 A;  3HUV A;  3D4U A;  2QJ8 A;  1ZLH A;  1CP7 A;  1FT7 A;  3GB0 A;  2PE3 A;  2NYQ A;  3KZW A;  4ZX9 A;  2EWB A;  4FAI A;  2XEG A;  3D7D A;  3KI9 A;  1YLO A;  4UIA A;  2C6C A;  3D7F A;  3FJU A;  2AFW A;  1BLL E;  1XJO A;  1XBU A;  1XRY A;  4OC3 A;  3ISZ A;  1Z5R A;  2ZOF A;  3SI2 A;  4Q7A A;  5LYD A;  4O23 A;  3PFE A;  4X8I A;  3WC7 A;  4ZY0 A;  3VH9 A;  1JQG A;  2V8D A;  2V8V A;  4OP4 A;  3PBE A;  2ZOG A;  5LRJ A;  3WC5 A;  2WZN A;  3KHZ A;  1PCA A;  3CT9 A;  3B3C A;  3KQX A;  1EE3 P;  1CP6 A;  5K8N A;  3BI1 A;  1QQ9 A;  4OID A;  2ZEL A;  4W9Y A;  1TKJ A;  3H8E A;  2BOA A;  1QMU A;  2PIY A;  3NH8 A;  2F8H A;  4P4D A;  1Y0R A;  1CPS A;  4UIB A;  3B2Y A;  3GLJ A;  3NFZ A;  4WWV A;  5K8M A;  4PXB A;  4TNU A;  1TF8 A;  2PJ3 A;  5HXD A;  3DLJ A;  4MCS A;  1LOK A;  4YU9 A;  3SI0 A;  1R3N A;  2XEI A;  3S9N A;  2Q51 A;  2PJ0 A;  3KR4 A;  4PXC A;  2XEF A;  4X3R A;  3IJ3 A;  3V38 A;  1LAM A;  3D7G A;  3IC1 A;  4OC2 A;  1VGY A;  2PJ8 A;  1Z8L A;  2Q4Z A;  3PB6 X;  4OKO A;  4MCP A;  3MN8 A;  4GM5 A;  1ARM A;  2ZEG A;  4MCQ A;  2AFS A;  1LAP A;  2ANP A;  5JM6 A;  5IB9 A;  1F57 A;  2QYV A;  3IFE A;  5THW A;  1VHO A;  4Z65 A;  4YWY A;  4NGS A;  3PB8 X;  3N5F A;  4NGP A;  1M4L A;  1R43 A;  3VAR A;  4IK2 A;  4CPA A;  2CTC A;  5J1Q A;  4PPZ A;  4MHP A;  2G9D A;  1ELL P;  1AMP A;  4MHY A;  4MCR A;  1Q7L A;  4UEE A;  4ZY2 A;  2ZEN A;  3PEI A;  1ZG7 A;  1LFW A; 
#chains in the Genus database with same CATH topology
 4KS9 A;  1BO4 A;  4I49 A;  4B12 A;  2CTB A;  3FEE A;  5JGF A;  3RAM A;  4F8Z A;  1QSN A;  2OZU A;  4PK2 A;  4QC6 A;  4PQA A;  2JDD A;  4B5O A;  4ZI6 A;  2NSM A;  2Q0Y A;  4LX9 A;  2Q04 A;  3RZA A;  2PVV A;  2POK A;  2Z3N A;  4NGQ A;  4ZY1 A;  4PSX A;  3FX6 A;  3D8P A;  1S7N A;  3BXM A;  2REE A;  4OME A;  3SJG A;  1IGB A;  3N7Z A;  2Q4Y A;  4MY0 A;  4QVT A;  4XNH B;  2HC9 A;  5I0C A;  5JPH A;  2JEW A;  5HMN A;  1ZLI A;  1MJA A;  4KOR A;  3NH5 A;  1H8L A;  1Z8W A;  1I12 A;  2C6P A;  5LRG A;  3SJE A;  4BBH A;  3FVL A;  2A4N A;  4KLW A;  3CDX A;  4XPD B;  4IAV A;  4RI1 A;  1TF9 A;  2J8N A;  3IWW A;  3PFO A;  5H86 A;  4R3L A;  2IQ6 A;  2FXF A;  2HB6 A;  2O4H A;  2R8V A;  4IHM A;  1TIQ A;  3JUW A;  2CNT A;  4NXY A;  3IWG A;  5LYI A;  4MRI A;  1IIC A;  2P0W A;  2OU2 A;  3F8K A;  4CRY B;  3IGR A;  4LQG A;  3S6H A;  4A33 A;  4KUB A;  2P6F A;  3TO7 A;  1Y7R A;  3L2N A;  3K9T A;  5DWN A;  1GYT A;  3C26 A;  1OZP A;  4CAW A;  2Z3L A;  4JZ0 A;  3R9F A;  1YW6 A;  3B3T A;  4CYN A;  4PV6 A;  5HVG A;  5D29 A;  2J8R A;  3ISX A;  2BO9 A;  1IID A;  4MMO A;  3D66 A;  4CAE A;  3ZJ0 A;  2GAN A;  5F49 A;  3CPX A;  1RTQ A;  3TO9 A;  3KGQ A;  2ZW4 A;  3ZZI A;  4E0A A;  4MHZ A;  2PQ8 A;  1CBX A;  1YR0 A;  2BCO A;  4P4I A;  4AB7 A;  4FWU A;  2CY2 A;  5LYL A;  4NCZ A;  4PSW A;  4KOY A;  3BI0 A;  2Z3K A;  4P45 A;  1I1D A;  5DWM A;  2AJ6 A;  3PBB A;  3QAY A;  2WPX A;  3B3V A;  3PZJ A;  1AYE A;  4K30 A;  4A32 A;  1VHE A;  4M85 A;  4B14 A;  5LYF A;  1ELM P;  4CYQ A;  4RS2 A;  4DUK A;  1HEE A;  4R8F A;  2Y0M A;  3LAC A;  4H2K A;  2Q7S A;  4NGN A;  2B5G B;  2C6G A;  2RB7 A;  3NH4 A;  2FIW A;  1HDQ A;  5IX3 A;  1ZG8 A;  2AE6 A;  4MFL A;  4UFW A;  4P4B A;  3R1K A;  4M6H A;  3QAH A;  1TKH A;  4F9V A;  3BJ7 A;  1NMT A;  3B35 A;  3FF3 A;  3HLP A;  4ONU A;  4GS4 A;  1BPN A;  4JWP A;  5BWA B;  2GRE A;  4KOT A;  3IO1 A;  4OIW A;  3FBU A;  4P6Y A;  1AUG A;  1S7L A;  2FT0 A;  4R6T A;  4X2T A;  2B4D A;  1XE4 A;  2HV2 A;  2V77 A;  1X12 A;  4MFZ A;  5E96 A;  4CGP A;  3A9L A;  3SJX A;  5D8N A;  3FH4 A;  3SJF A;  5F46 A;  2Q4V A;  1XOV A;  3KHX A;  4A94 A;  5GCN A;  4U5Y A;  4R87 A;  2PJ1 A;  3IU1 A;  4M6G A;  4UEF A;  4L8A A;  1S7K A;  3EFA A;  4JXQ A;  1QSM A;  1YVO A;  2ZEH A;  3R9G A;  4E8O A;  4EWT A;  3TE4 A;  5A27 A;  4RUH A;  4QBJ A;  2NMT A;  1CG2 A;  4UWI A;  2EK8 A;  4P4J A;  2OOT A;  3WT4 A;  4GXH A;  2O28 A;  3I9S A;  4NJQ A;  4H6U A;  1Y9W A;  4OC4 A;  4NFR A;  2ZEF A;  4H6Z A;  4HNX B;  4AVC A;  2F5I A;  2ZEE A;  2CIJ A;  1IU8 A;  2YND A;  2B58 A;  3H4Q A;  4OC5 A;  2GLJ A;  2AFM A;  2PJ6 A;  2PJ5 A;  3CXS A;  3DDD A;  3K2K A;  2WSA A;  4A95 A;  4IF5 A;  4NGR A;  4ORF A;  4PXD A;  4ZBG A;  5G21 A;  4ONW A;  3LWU A;  3VAT A;  1MJ9 A;  1OBR A;  2J8M A;  4DJL A;  1SQH A;  4A39 A;  4C7H A;  3DGV A;  5J8F A;  1KZF A;  1FNO A;  2GU2 A;  4JD6 A;  1KUY A;  2GIV A;  4MXU A;  4CGM A;  3MRU A;  5A28 A;  3T90 A;  4KOX A;  2AFX A;  2JDC A;  2RFH A;  4HKF A;  2YNC C;  2Z10 A;  2J9A A;  3D68 A;  3JTK A;  4BIN A;  3D2P A;  1GHE A;  2AFZ A;  2PJ9 A;  2FIA A;  3H8G A;  3WC6 A;  1YW4 A;  1KWM A;  2VL1 A;  3B3S A;  2PR1 A;  3DR6 A;  4LQ6 A;  5K8O A;  4XPL A;  1HDU A;  4BD9 A;  5IB0 A;  4NJR A;  4DYO A;  3BHX A;  3D7H A;  5AG5 A;  3TOB A;  2Z3P A;  3FMC A;  2R98 A;  3TC8 A;  4CAX A;  2JLM A;  2B3U A;  5HVH A;  5LRK A;  2DF5 A;  2EUI A;  3FYN A;  3R95 A;  4B10 A;  4EFD A;  5JQ4 A;  4UA3 A;  3DSB A;  1J4J A;  2PVW A;  2WUU A;  4OAE A;  3S6K A;  4C7I A;  2ABZ A;  2IMO A;  3NA6 A;  4B5P B;  3PRT A;  5F47 A;  1N71 A;  2OR4 A;  3FRM A;  5DS0 A;  3VWD A;  3KQZ A;  1YGH A;  1P4N A;  5C88 A;  1Q2C A;  3TOA A;  1R57 A;  2DXQ A;  3DR8 A;  4UFV A;  1VKC A;  4EME A;  5CPA A;  1VIX A;  1U6M A;  1XMB A;  2PJC A;  4Q36 A;  2B4B A;  3K9U A;  4MFP A;  4ZYQ A;  4II9 A;  3V7Z A;  4NGM A;  3RNZ A;  5KTA A;  5HVF A;  3GYA A;  2CXA A;  2PSW A;  2D4O A;  1CJW A;  1UWY A;  3SXO A;  2GFQ A;  1TKF A;  4CAV A;  1NE9 A;  2JBJ A;  3IIB A;  1NSA A;  4FD5 A;  4FBE A;  2AFU A;  2OZH A;  3S9M A;  2F7V A;  1YRE A;  1ZG9 A;  3FED A;  3JVN A;  4G1P A;  4R7M A;  5ISV A;  4K3N A;  2DPS A;  5CBM A;  4B11 A;  2HQY A;  4OC0 A;  1P0H A;  3SI1 A;  3WAB A;  4HNY B;  1S3Z A;  3R9E A;  1YSJ A;  3RBU A;  2QVP A;  2R7H A;  4OLL A;  3T9Y A;  3TCV A;  4CGL A;  3TO6 A;  4P44 A;  8CPA A;  1FY7 A;  3LMS A;  2I00 A;  3EY5 A;  1BPM A;  4UF4 A;  4Y49 C;  1PYT B;  1B6B A;  3D67 A;  4L89 A;  1V0C A;  1S60 A;  1A2Z A;  4QB9 A;  2B3V A;  3B7I A;  3H5Z A;  3KL9 A;  3PB9 X;  1B87 A;  3P2F A;  3TTH A;  1UFH A;  2VZY A;  1ARL A;  1Q2Y A;  2I3C A;  1Z2L A;  3FXT A;  2EVN A;  2V8G A;  5AG7 A;  4ZGY B;  5EC4 A;  4CRZ B;  4YGO A;  2HUZ A;  4MHN A;  4FUU A;  4WJB A;  2PJA A;  3QNV A;  3OWC A;  4OC1 A;  3PB7 X;  2Q7B A;  2EK9 A;  3IEH A;  1VHS A;  4B6Z A;  2ZEM A;  2ZEP A;  4KLV A;  1YX0 A;  4MI4 A;  4KUA A;  4F9U A;  2BUE A;  2I79 A;  2ZED A;  4JLY A;  4R76 A;  1K4J A;  2B5G A;  4KVO E;  1LCP A;  2Q43 A;  2C1C A;  3B3W A;  2DPT A;  4FD6 A;  1QSR A;  5EBV A;  1IOF A;  1NSL A;  2XEJ A;  4A30 A;  4M3S A;  1XFO A;  3GUX A;  4YFJ A;  5K8P A;  4P10 A;  1F2O A;  4A38 A;  1TXR A;  3CXQ A;  3IU2 A;  5G1Z A;  2JBK A;  4ZX8 A;  2IJZ A;  1CX8 A;  1M4I A;  2CF4 A;  5I4M A;  4TWE A;  2IL4 A;  4AVB A;  2ZW5 A;  1M4D A;  3KR5 A;  2FCK A;  4UEZ A;  3EXN A;  1L0C A;  2PCU A;  2DEA A;  3LOD A;  4A2Z A;  5JH9 A;  4F6A A;  1Y0Y A;  3W91 A;  1IY7 A;  3JRU A;  1IOI A;  1Q2D A;  1XEB A;  4KSI A;  2QML A;  2FS5 A;  2PJ2 A;  2PRQ A;  3T8W A;  2KCW A;  2FL4 A;  3I3G A;  3S9L A;  3DNS A;  5AGE A;  1DTD A;  3RO0 A;  1F2P A;  3FB3 A;  4PXE A;  2G3A A;  4UCP A;  2OZG A;  1CPX A;  2AFO A;  3CZX A;  4P4F A;  4IUS A;  5ELY A;  3H8F A;  4JXR A;  2PJB A;  1Z4E A;  5F09 A;  5IV0 A;  6CPA A;  1LAN A;  4NGT A;  4XPK A;  2YNE A;  4P4E A;  1BOB A;  2PJ4 A;  4HPS A;  4C2X A;  1M44 A;  4UCM A;  2O53 A;  4MJ8 A;  1Y7E A;  2RC4 A;  2K5T A;  1MJB A;  1KUV A;  4JYW A;  1S5K A;  4MBU A;  2WYR A;  4F0X A;  3I1U A;  2PIZ A;  1YVK A;  4A37 A;  7CPA A;  3FEC A;  5KTD A;  2PRB A;  4CYO A;  3P2H A;  4KSA A;  4PK3 A;  3CPA A;  2V8H A;  2Z3M A;  1Z4R A;  2REF A;  1BAV A;  3PB4 X;  3IWE A;  1YME A;  3E0K A;  4F0Y A;  1Z8X A;  3TX8 A;  2R1I A;  3KAS A;  1DE4 C;  4NEX A;  4MHD A;  4AXV A;  2ZEO A;  3LD2 A;  2FVG A;  2GLF A;  2PJ7 A;  1X10 A;  3HUV A;  3D4U A;  1Z9U A;  2QJ8 A;  1ZLH A;  1CP7 A;  1FT7 A;  2VQY A;  3GB0 A;  4OAD A;  4M6I A;  2PE3 A;  2NYQ A;  1JWQ A;  3KZW A;  2PC1 A;  3GIU A;  4ZX9 A;  4R3K A;  4E2A A;  2EWB A;  4FAI A;  5G22 A;  3V8I A;  2XEG A;  3D7D A;  3KI9 A;  4Y49 B;  1YLO A;  4KOU A;  5F48 A;  1YK3 A;  4KVM E;  4EVY A;  5C82 A;  1QST A;  4UIA A;  2CNM A;  1ON0 A;  2CNS A;  5G20 A;  2X7B A;  2C6C A;  3D7F A;  3KKW A;  3FJU A;  3PGP A;  4JJX A;  3S6F A;  5KTC A;  4UBR A;  3RYO A;  2AFW A;  1BLL E;  1XJO A;  2VBQ A;  1XBU A;  1XRY A;  4OC3 A;  3SHP A;  3ISZ A;  4B5P A;  4KOS A;  4B13 A;  4Q38 A;  4KVX A;  4AG9 A;  1Z5R A;  2ZOF A;  1IYK A;  2Q44 A;  1M4G A;  1IYL A;  2Z0Z A;  3SI2 A;  4Q7A A;  5LYD A;  2FSR A;  4MFK A;  4O23 A;  1PU9 A;  2ZW7 A;  3PFE A;  3BJ8 A;  4X8I A;  2ZW6 A;  3UY5 A;  3VH9 A;  3NE8 A;  3WC7 A;  4ZY0 A;  2FE7 A;  1JQG A;  2V8D A;  2V8V A;  4OP4 A;  3PBE A;  2ZOG A;  4U9Y A;  5LRJ A;  3VWE A;  1Z8T A;  3WC5 A;  2WZN A;  2BEI A;  4MY3 A;  3G8W A;  2OB0 A;  4NF1 A;  2PR8 A;  2VEZ A;  3TT2 A;  2H5M A;  4CYP A;  2Z11 A;  3KHZ A;  1LRZ A;  2JEV A;  1PCA A;  3CT9 A;  3B3C A;  3KQX A;  1EE3 P;  4C2Z A;  1CP6 A;  3MGD A;  5K8N A;  3BI1 A;  2QEC A;  1WWZ A;  5HH1 A;  2D4P A;  2WPW A;  3BLN A;  1QQ9 A;  5CNP A;  1IB1 E;  1PUA A;  1CM0 A;  4OID A;  2ZEL A;  3G3S A;  1TKJ A;  4W9Y A;  4C2Y A;  1RO5 A;  3H8E A;  4NSQ A;  2GE3 A;  2VZZ A;  2BOA A;  1QMU A;  2PIY A;  3NH8 A;  2F8H A;  5FVJ A;  4P4D A;  1Y0R A;  4FD4 A;  1YQE A;  4KSF A;  1CPS A;  4UIB A;  3B2Y A;  3GLJ A;  3NFZ A;  4WWV A;  5AG4 A;  3GY9 A;  5K8M A;  4PXB A;  4TNU A;  1TF8 A;  2PJ3 A;  5HXD A;  4H89 A;  3DLJ A;  1S7F A;  4XNH C;  4MCS A;  1LOK A;  4YU9 A;  3SI0 A;  1R3N A;  1QSO A;  2ZXV A;  2EO8 A;  2XEI A;  3S9N A;  2Q51 A;  2PJ0 A;  4A31 A;  2YGW A;  4RN7 A;  3TFY A;  3KR4 A;  2VXK A;  4MFQ A;  4BMH A;  4CGO A;  2BL1 A;  4PXC A;  2XEF A;  4X3R A;  4R9M A;  5AG6 A;  2ZPA A;  1RXT A;  4XPD C;  3IJ3 A;  3V38 A;  2YNC A;  1LAM A;  3D7G A;  3IC1 A;  4OC2 A;  1VGY A;  1WK4 A;  2G3T A;  4MFJ A;  2Z3O A;  4UWJ A;  2P6G A;  2PJ8 A;  1Z8L A;  4CAF A;  3WR7 A;  2Q4Z A;  3PB6 X;  1XIX A;  5EMI A;  1XMT A;  4OKO A;  2ARH A;  3EC4 A;  4DNC A;  4MCP A;  3MN8 A;  4GM5 A;  1MK4 A;  2B4D B;  1ARM A;  2ZEG A;  2G0B A;  4KOV A;  4LUA A;  2AFS A;  1LAP A;  2ANP A;  4MCQ A;  3PP9 A;  5J8C A;  5IB9 A;  5JM6 A;  1F57 A;  3FIX A;  4C68 A;  3F5B A;  4KZT A;  3EO4 A;  2QYV A;  1YLE A;  2P6E A;  3IFE A;  4KOW A;  3D2M A;  3CXP A;  4AVA A;  5THW A;  4HNW B;  1VHO A;  1XF8 A;  2QIR A;  4AG7 A;  3B8G A;  4Z65 A;  4YWY A;  4QUS A;  4UFX A;  4NGS A;  3PB8 X;  3N5F A;  3W6X A;  1ZO0 A;  4NGP A;  1M4L A;  1KUX A;  1R43 A;  4R57 A;  2BSW A;  3VAR A;  2OH1 A;  4CGN A;  4CS0 B;  4IK2 A;  4CPA A;  5H84 A;  3QB8 A;  2CTC A;  3D3S A;  3GKR A;  5J1Q A;  4PPZ A;  4MHP A;  2PDO A;  3SXN A;  4YRH A;  2G9D A;  4FD7 A;  1ELL P;  1AMP A;  3R96 A;  4J3G A;  3S6G A;  4X5K A;  3F0A A;  4U9Z A;  2VI7 A;  4MHY A;  2ATR A;  4MCR A;  1Q7L A;  4UEE A;  4UCN A;  3W6S A;  2ODF A;  4ZY2 A;  3NE7 A;  2EBJ A;  2ZEN A;  1M1D A;  1I21 A;  1ZG7 A;  2C27 A;  3PEI A;  1Y9K A;  1LFW A;  3FNC A; 
#chains in the Genus database with same CATH homology
 2CTB A;  3FEE A;  5JGF A;  3RAM A;  4F8Z A;  4PQA A;  4ZI6 A;  2NSM A;  3RZA A;  2PVV A;  2POK A;  4NGQ A;  4ZY1 A;  3FX6 A;  3BXM A;  4OME A;  3SJG A;  1IGB A;  2HC9 A;  2JEW A;  1ZLI A;  3NH5 A;  1H8L A;  2C6P A;  5LRG A;  3SJE A;  3FVL A;  3CDX A;  4IAV A;  1TF9 A;  3IWW A;  3PFO A;  2IQ6 A;  2HB6 A;  2O4H A;  4IHM A;  5LYI A;  4MRI A;  4LQG A;  3L2N A;  3K9T A;  1GYT A;  4JZ0 A;  1YW6 A;  3B3T A;  5HVG A;  5D29 A;  3ISX A;  2BO9 A;  4MMO A;  3D66 A;  3CPX A;  1RTQ A;  3KGQ A;  4MHZ A;  1CBX A;  2BCO A;  4P4I A;  4FWU A;  5LYL A;  3BI0 A;  4P45 A;  3PBB A;  3B3V A;  1AYE A;  1VHE A;  5LYF A;  1ELM P;  4DUK A;  1HEE A;  4R8F A;  4H2K A;  4NGN A;  2C6G A;  2RB7 A;  3NH4 A;  1HDQ A;  1ZG8 A;  4P4B A;  1TKH A;  4F9V A;  3B35 A;  3FF3 A;  3HLP A;  1BPN A;  2GRE A;  4OIW A;  3IO1 A;  4P6Y A;  4R6T A;  4X2T A;  2V77 A;  3SJX A;  5D8N A;  3FH4 A;  3SJF A;  3KHX A;  4A94 A;  4UEF A;  2PJ1 A;  4EWT A;  2ZEH A;  4RUH A;  1CG2 A;  2EK8 A;  4P4J A;  2OOT A;  3WT4 A;  4NJQ A;  4OC4 A;  4NFR A;  2ZEF A;  2ZEE A;  2CIJ A;  4OC5 A;  2GLJ A;  2AFM A;  2PJ6 A;  2PJ5 A;  3K2K A;  4NGR A;  4PXD A;  4ONW A;  3LWU A;  3VAT A;  1OBR A;  4DJL A;  4A39 A;  3DGV A;  2GU2 A;  1FNO A;  4MXU A;  3MRU A;  2AFX A;  2RFH A;  2J9A A;  3D68 A;  2AFZ A;  2PJ9 A;  3H8G A;  3WC6 A;  1YW4 A;  1KWM A;  2VL1 A;  3B3S A;  5K8O A;  1HDU A;  4BD9 A;  4NJR A;  4DYO A;  3BHX A;  3D7H A;  3FMC A;  3TC8 A;  5LRK A;  5HVH A;  4EFD A;  2PVW A;  2ABZ A;  2IMO A;  3NA6 A;  3PRT A;  2OR4 A;  5DS0 A;  3KQZ A;  4EME A;  5CPA A;  1VIX A;  1XMB A;  2PJC A;  4ZYQ A;  3V7Z A;  4NGM A;  5HVF A;  1UWY A;  1TKF A;  2JBJ A;  3IIB A;  1NSA A;  4FBE A;  2AFU A;  3S9M A;  2F7V A;  1ZG9 A;  3FED A;  4G1P A;  4R7M A;  4K3N A;  5CBM A;  4OC0 A;  3SI1 A;  3WAB A;  1YSJ A;  3RBU A;  2QVP A;  4P44 A;  8CPA A;  3LMS A;  4UF4 A;  1BPM A;  1PYT B;  3D67 A;  3B7I A;  3PB9 X;  3KL9 A;  1ARL A;  2I3C A;  1Z2L A;  2V8G A;  4MHN A;  4FUU A;  4WJB A;  2PJA A;  3QNV A;  4OC1 A;  3PB7 X;  2EK9 A;  3IEH A;  4B6Z A;  2ZEM A;  2ZEP A;  4F9U A;  2ZED A;  4R76 A;  1LCP A;  2Q43 A;  2C1C A;  3B3W A;  2XEJ A;  1XFO A;  3GUX A;  5K8P A;  4P10 A;  1F2O A;  4A38 A;  1TXR A;  2JBK A;  4ZX8 A;  2IJZ A;  1CX8 A;  2CF4 A;  5I4M A;  4TWE A;  3KR5 A;  4UEZ A;  2PCU A;  5JH9 A;  2DEA A;  1Y0Y A;  1IY7 A;  3JRU A;  4KSI A;  2PJ2 A;  2PRQ A;  3T8W A;  3S9L A;  1DTD A;  1F2P A;  4PXE A;  1CPX A;  2AFO A;  4P4F A;  5ELY A;  3H8F A;  2PJB A;  5F09 A;  6CPA A;  1LAN A;  4NGT A;  4P4E A;  2PJ4 A;  2O53 A;  1Y7E A;  4JYW A;  2WYR A;  3I1U A;  2PIZ A;  4A37 A;  7CPA A;  3FEC A;  3CPA A;  2V8H A;  1BAV A;  3PB4 X;  1YME A;  3TX8 A;  4AXV A;  3KAS A;  1DE4 C;  2ZEO A;  2FVG A;  2GLF A;  2PJ7 A;  3HUV A;  3D4U A;  2QJ8 A;  1ZLH A;  1CP7 A;  1FT7 A;  3GB0 A;  2PE3 A;  2NYQ A;  3KZW A;  4ZX9 A;  2EWB A;  4FAI A;  2XEG A;  3D7D A;  3KI9 A;  1YLO A;  4UIA A;  2C6C A;  3D7F A;  3FJU A;  2AFW A;  1BLL E;  1XJO A;  1XBU A;  1XRY A;  4OC3 A;  3ISZ A;  1Z5R A;  2ZOF A;  3SI2 A;  4Q7A A;  5LYD A;  4O23 A;  3PFE A;  4X8I A;  3WC7 A;  4ZY0 A;  3VH9 A;  1JQG A;  2V8D A;  2V8V A;  4OP4 A;  3PBE A;  2ZOG A;  5LRJ A;  3WC5 A;  2WZN A;  3KHZ A;  1PCA A;  3CT9 A;  3B3C A;  3KQX A;  1EE3 P;  1CP6 A;  5K8N A;  3BI1 A;  1QQ9 A;  4OID A;  2ZEL A;  4W9Y A;  1TKJ A;  3H8E A;  2BOA A;  1QMU A;  2PIY A;  3NH8 A;  2F8H A;  4P4D A;  1Y0R A;  1CPS A;  4UIB A;  3B2Y A;  3GLJ A;  3NFZ A;  4WWV A;  5K8M A;  4PXB A;  4TNU A;  1TF8 A;  2PJ3 A;  5HXD A;  3DLJ A;  4MCS A;  1LOK A;  4YU9 A;  3SI0 A;  1R3N A;  2XEI A;  3S9N A;  2Q51 A;  2PJ0 A;  3KR4 A;  4PXC A;  2XEF A;  4X3R A;  3IJ3 A;  3V38 A;  1LAM A;  3D7G A;  3IC1 A;  4OC2 A;  1VGY A;  2PJ8 A;  1Z8L A;  2Q4Z A;  3PB6 X;  4OKO A;  4MCP A;  3MN8 A;  4GM5 A;  1ARM A;  2ZEG A;  4MCQ A;  2AFS A;  1LAP A;  2ANP A;  5JM6 A;  5IB9 A;  1F57 A;  2QYV A;  3IFE A;  5THW A;  1VHO A;  4Z65 A;  4YWY A;  4NGS A;  3PB8 X;  3N5F A;  4NGP A;  1M4L A;  1R43 A;  3VAR A;  4IK2 A;  4CPA A;  2CTC A;  5J1Q A;  4PPZ A;  4MHP A;  2G9D A;  1ELL P;  1AMP A;  4MHY A;  4MCR A;  1Q7L A;  4UEE A;  4ZY2 A;  2ZEN A;  3PEI A;  1ZG7 A;  1LFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...