3SI0A

Structure of glycosylated human glutaminyl cyclase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
324
structure length
314
Chain Sequence
EEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFNNRVFVGATDSAVPCAMMLELARALDKKLLSLKDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Glycosylated Mammalian Glutaminyl Cyclases Reveal Conformational Variability near the Active Center.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Glutaminyl-peptide cyclotransferase
total genus 104
structure length 314
sequence length 324
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3si0A00
2PJAA 1LANA 1LOKA 2NYQA 4FUUA 2PJ7A 4X3RA 1HEEA 2PJ1A 3NH4A 4PXDA 1DE4C 3B3SA 3WC7A 4YWYA 2AFMA 4G1PA 5HXDA 4TWEA 3BI1A 3CDXA 1YW6A 2OR4A 2ZEPA 3IIBA 3GLJA 2JEWA 3D68A 5J1QA 2OOTA 4MCRA 5K8MA 4MHYA 3D7DA 2POKA 1TKHA 3RBUA 4OMEA 1BPNA 4P4BA 4P45A 1ZG7A 2J9AA 2C6PA 4MCPA 2ZEHA 4F8ZA 1BLLE 3L2NA 4F9VA 4NGMA 3GUXA 1ZLIA 3IFEA 4P4JA 3IWWA 4DYOA 1F57A 3FX6A 2JBKA 5LYLA 4CPAA 1BPMA 2HB6A 5LYDA 4GM5A 5I4MA 2PIYA 1ZG9A 1YMEA 2FVGA 3DGVA 4OIWA 2AFOA 4ZYQA 2V77A 1VHEA 5K8PA 3NH5A 3B7IA 1XMBA 4JZ0A 4LQGA 5LRGA 4PXCA 3KQZA 1QQ9A 4NGNA 5F09A 4UIAA 2Q51A 1R3NA 3NA6A 3D7GA 4ZI6A 3JRUA 2ZEFA 2ZEOA 4OC4A 1TF9A 1KWMA 3B3VA 3KR4A 3B3CA 4A39A 1Z2LA 4MCSA 1LFWA 4ONWA 2CTBA 2WYRA 4R8FA 2XEJA 3PB4X 1IY7A 1PCAA 3KQXA 2V8HA 3PEIA 5CPAA 4ZX8A 2RB7A 3I1UA 4ZY0A 1PYTB 1JQGA 2PJ6A 3PRTA 1EE3P 5K8OA 5HVHA 1H8LA 2ZELA 4UEZA 2EWBA 4YU9A 3KZWA 2V8DA 4A94A 2PVVA 5THWA 4WWVA 4MRIA 3K2KA 3MRUA 3BI0A 3V7ZA 1QMUA 5HVGA 2ABZA 4FBEA 4PXBA 2PVWA 2IMOA 5IB9A 2DEAA 2AFWA 1HDUA 1UWYA 4MHPA 4NFRA 3KGQA 3S9MA 2BO9A 2CTCA 4PPZA 3CPAA 5JGFA 2PJ4A 3D4UA 2PIZA 4NGSA 4OC2A 3K9TA 4P4DA 4ZY2A 3PB9X 2XEFA 2PE3A 4WJBA 3BHXA 4MXUA 5LRKA 3LWUA 4Z65A 1CG2A 3B3TA 1FT7A 3D7FA 1TF8A 1M4LA 1Y7EA 3D66A 3WC6A 3H8EA 4OKOA 2BOAA 3HUVA 4IAVA 4R7MA 2ZENA 5JM6A 2GU2A 3D7HA 1LAPA 4FWUA 2XEGA 3B2YA 5K8NA 3FMCA 2F7VA 3ISXA 2ZEDA 1ZLHA 4KSIA 4R76A 7CPAA 1XJOA 4MMOA 1ARLA 3D67A 1CX8A 2ZOFA 5LYIA 5LYFA 4EMEA 3SJGA 2PJ3A 3TX8A 2IQ6A 3BXMA 4IK2A 2O53A 5ELYA 2GLJA 3TC8A 2AFUA 4NGTA 3PFOA 4NGQA 4Q7AA 4NGPA 1ELLP 2PJ9A 2ZEGA 4UEEA 3SI0A 3VARA 3IO1A 4PXEA 3CPXA 4P4FA 4PQAA 1ELMP 3S9NA 1YLOA 1Z5RA 2AFSA 4A38A 3PBBA 1TXRA 4UF4A 4OIDA 4O23A 4FAIA 1AYEA 2NSMA 1GYTA 1Y0YA 3H8GA 3NH8A 3KHXA 2PJ0A 4ZX9A 3T8WA 1CP6A 2ANPA 2IJZA 1CPXA 1AMPA 3V38A 3KL9A 2ZEEA 4UEFA 3WC5A 4A37A 3N5FA 2PJ8A 3H8FA 4ZY1A 4NJQA 2C6CA 4OC1A 4AXVA 4F9UA 2AFXA 3FJUA 4TNUA 2JBJA 1VGYA 3B3WA 1Y0RA 3HLPA 2ZEMA 2PJ2A 4DUKA 1R43A 4MCQA 2C6GA 3PB7X 3SI1A 1ZG8A 8CPAA 2PJ5A 3CT9A 3KR5A 3PFEA 3WT4A 4P44A 3WABA 1IGBA 1TKFA 3NFZA 4IHMA 1BAVA 2RFHA 3IEHA 2PCUA 2CF4A 3FF3A 2QYVA 2VL1A 3S9LA 3VATA 5HVFA 1YSJA 4DJLA 1ARMA 3SJFA 3RZAA 1Z8LA 4P10A 1CP7A 1TKJA 4MHNA 1DTDA 1LAMA 3FVLA 4NJRA 2GREA 3KI9A 4EFDA 1XBUA 2G9DA 3KHZA 3DLJA 3IJ3A 6CPAA 4RUHA 2PRQA 2QJ8A 3B35A 2PJBA 4X2TA 2WZNA 1OBRA 3GB0A 4H2KA 1LCPA 5D29A 2HC9A 3PB8X 2I3CA 2GLFA 1CPSA 1NSAA 2EK9A 4P4EA 4P6YA 2EK8A 2C1CA 5D8NA 1XRYA 2Q4ZA 2O4HA 2CIJA 4OC0A 3VH9A 4K3NA 1VHOA 3RAMA 1CBXA 4EWTA 1XFOA 2F8HA 1YW4A 3LMSA 4X8IA 1HDQA 5CBMA 3PB6X 4NGRA 3SJEA 4OC5A 5JH9A 4B6ZA 1F2OA 3MN8A 4OC3A 4UIBA 2PJCA 3ISZA 4P4IA 3FEEA 2ZOGA 4R6TA 1RTQA 2QVPA 1Q7LA 5LRJA 1VIXA 3SJXA 2BCOA 2XEIA 1F2PA 3QNVA 3FECA 5DS0A 4MHZA 2V8VA 4W9YA 3FH4A 3SI2A 4BD9A 2AFZA 3IC1A 4JYWA 3KASA 2Q43A 2V8GA 1FNOA 3FEDA 4OP4A 3PBEA
chains in the Genus database with same CATH superfamily
2FS5A 2PJAA 1LANA 1LOKA 2NYQA 3FNCA 2PJ7A 1Z8WA 3PZJA 4FUUA 4KVME 4X3RA 4PSXA 1Z8XA 1HEEA 2PJ1A 2VQYA 2OU2A 3NH4A 4PXDA 1U6MA 1BOBA 1XIXA 1DE4C 5G22A 5AG4A 5FVJA 3B3SA 3WC7A 3JVNA 4YWYA 2AFMA 4G1PA 5HXDA 4TWEA 3BI1A 5F49A 1VKCA 2PR1A 3CDXA 4E8OA 4H6ZA 2DPTA 1YW6A 2OR4A 2ZEPA 3EY5A 1S7NA 1Y9KA 3IIBA 3GLJA 2JEWA 4C2YA 3D68A 3NE8A 1Q2CA 2AJ6A 4CAFA 5J1QA 2OOTA 4GXHA 1S5KA 4MCRA 5K8MA 3FIXA 2B4DB 4MHYA 4CYPA 2R7HA 4Q38A 2FCKA 5KTDA 2VI7A 3D7DA 2RC4A 2POKA 1IYKA 1TKHA 4Y49C 3RBUA 2JDCA 4OMEA 1BPNA 2FIAA 4L8AA 4P4BA 4P45A 1ZG7A 3S6HA 2J9AA 4CAVA 2C6PA 2YNCA 4MCPA 3ZJ0A 2PDOA 2ZEHA 1BLLE 3L2NA 3OWCA 4FD6A 4KOSA 4NGMA 4F8ZA 4F9VA 3GUXA 1ZLIA 4R57A 2Z11A 1QSRA 3IFEA 1GHEA 4P4JA 4AVAA 3TFYA 3IWWA 2JDDA 2P6GA 4DYOA 3MGDA 1F57A 3FX6A 2JBKA 3UY5A 5LYLA 4AB7A 2VEZA 5JPHA 4UWJA 4CPAA 1BPMA 4KOWA 2HB6A 4KUBA 4QB9A 5LYDA 2YNEA 4GM5A 4XPLA 5I4MA 2PIYA 1ZG9A 1YMEA 3RO0A 2FVGA 3DGVA 3H4QA 2G3AA 2AFOA 4OIWA 4B13A 4ZYQA 2V77A 1Z9UA 4HPSA 2VBQA 1VHEA 2FIWA 4AG7A 1I21A 2CXAA 3SXNA 2WSAA 1QSTA 4JWPA 5K8PA 5H84A 3NH5A 1RO5A 3B7IA 4KUAA 5EC4A 1XMBA 1B6BA 1YQEA 4JZ0A 4PSWA 5AG6A 4UFVA 3IWEA 2REFA 4KLVA 2YNDA 4CYOA 4FD7A 4LQGA 5LRGA 4PXCA 2PSWA 3KQZA 1QQ9A 2ZW6A 4NGNA 3LD2A 2BL1A 4RN7A 4B12A 2QECA 4UCMA 5F09A 4UIAA 4BINA 2Q51A 3A9LA 2O28A 1R3NA 3NA6A 2ODFA 2I79A 2B4DA 3RNZA 3D7GA 4CGPA 4ZI6A 1TIQA 3JRUA 2B4BA 4R9MA 2ZEFA 2ZEOA 3F0AA 4OC4A 4MFJA 5H86A 4A31A 1SQHA 1RXTA 4F0XA 1TF9A 1KWMA 1KZFA 2FXFA 1MJAA 2ATRA 2Z3KA 3B3VA 3BJ8A 4CGMA 3KR4A 3B3CA 2AE6A 4A39A 1Z2LA 4MCSA 1LFWA 4ONWA 1S7KA 4B10A 3F5BA 2CTBA 2WYRA 1MJBA 3G3SA 4R8FA 2XEJA 3PB4X 1IY7A 1PCAA 3I9SA 3KQXA 2VXKA 4A33A 2V8HA 4OAEA 3H5ZA 1A2ZA 3PEIA 4ORFA 5CPAA 2RB7A 3I1UA 4ZX8A 2ARHA 4ZY0A 4CRYB 2JLMA 1IU8A 1PYTB 1B87A 1JQGA 4KOVA 4QVTA 4GS4A 2PJ6A 5C88A 1WK4A 3PRTA 2EBJA 1EE3P 5K8OA 3FXTA 4I49A 5J8CA 5HVHA 1H8LA 2ZELA 4OP4A 1XOVA 3E0KA 2Z3LA 4E0AA 2WPXA 3LACA 1NSLA 4UEZA 2EWBA 1YLEA 1X12A 4YU9A 3WR7A 3KZWA 2V8DA 1CM0A 4YRHA 4A94A 2PVVA 5THWA 4CGNA 4WWVA 4MRIA 4M6HA 3EXNA 3K2KA 3MRUA 3BI0A 1S7FA 4H89A 2Q7BA 3V7ZA 4KOTA 4C2XA 5JQ4A 1QMUA 1MJ9A 2ABZA 2OB0A 2EVNA 4PXBA 4FBEA 5HVGA 2PVWA 4ZGYB 3GY9A 2IMOA 4NCZA 5IB9A 2HV2A 2DEAA 2AFWA 4UCPA 1HDUA 1UWYA 4MHPA 2P6FA 5G20A 4NFRA 3KGQA 4KORA 4CAEA 4CGOA 5IV0A 1M4DA 4A95A 3S9MA 2BO9A 2CTCA 4XPKA 4PPZA 3CPAA 5JGFA 2PJ4A 2EUIA 3D4UA 2PIZA 4NGSA 4OC2A 3K9TA 4XNHB 4KVOE 2QIRA 4UWIA 4P4DA 3S6FA 4ZY2A 3TO7A 3PB9X 3V8IA 1L0CA 4U5YA 2Z3MA 2XEFA 4M6GA 5KTCA 2ZW4A 2BEIA 4JLYA 1NE9A 2PE3A 4WJBA 1BO4A 3TO6A 3BHXA 3EC4A 4C2ZA 4NF1A 4MXUA 1Z4RA 4MFKA 1XEBA 3GIUA 2Q0YA 5LRKA 1XMTA 2BUEA 3LWUA 4Z65A 1CG2A 3B3TA 1FT7A 3D7FA 4LQ6A 3W6SA 5G1ZA 1TF8A 1M4LA 1Y7EA 3D66A 4E2AA 3F8KA 2Q4VA 5EBVA 2H5MA 3WC6A 3S6KA 3H8EA 4OKOA 4CYNA 3QAHA 2BOAA 3HUVA 3T9YA 4Q36A 3TOBA 4CAXA 1K4JA 4IAVA 3D2MA 3R9GA 3B8GA 1M1DA 4HNXB 1YREA 4R7MA 2ZENA 3CXPA 1KUXA 3W91A 4X5KA 2GU2A 5JM6A 3D7HA 1LAPA 2Z3OA 4B14A 4FWUA 3W6XA 3JTKA 2I00A 1AUGA 4DNCA 3VWDA 2XEGA 1KUYA 3B2YA 5K8NA 3IU1A 3FMCA 4MI4A 2PRBA 2F7VA 3ISXA 1FY7A 2VZZA 2ZEDA 1ZLHA 5IX3A 3PGPA 4KSFA 4KSIA 2GANA 4R76A 7CPAA 1Q2YA 1XJOA 4MMOA 4UA3A 5EMIA 1ARLA 3D67A 3D3SA 2B5GA 4JJXA 4MY3A 4QC6A 4AVCA 2CY2A 3DR8A 1CX8A 2ZOFA 2Y0MA 2QMLA 4FD4A 4JXRA 5LYIA 4EMEA 5LYFA 2CNSA 2Z3NA 3SJGA 2PJ3A 3TX8A 1YVKA 4QBJA 2IQ6A 3BXMA 3G8WA 4IK2A 2O53A 5E96A 5ELYA 2GLJA 1KUVA 2PC1A 3TC8A 2KCWA 2AFUA 2G3TA 2ZXVA 4NGTA 3PFOA 2IL4A 2FSRA 1OZPA 4NGQA 3TTHA 4MFQA 4Q7AA 4MY0A 3QAYA 4NGPA 1ELLP 2PJ9A 5AGEA 1YGHA 2WPWA 2ZEGA 3IGRA 3KKWA 3EO4A 4UEEA 5I0CA 5G21A 3SI0A 4R3KA 3VARA 3IO1A 3ZZIA 5A27A 3FBUA 4MBUA 2A4NA 3CPXA 4P4FA 4PXEA 3R95A 4H6UA 4PQAA 1ELMP 1ON0A 3S9NA 3I3GA 1YLOA 1Z5RA 2FL4A 2F5IA 4RI1A 2OZHA 5BWAB 2J8RA 2AFSA 1R57A 4A38A 3PBBA 4KS9A 1TXRA 4UF4A 4OIDA 4O23A 4FAIA 1AYEA 4B5PA 2NSMA 2D4PA 2D4OA 4KOUA 1GYTA 4HNWB 5HMNA 1IICA 1YVOA 1Y0YA 1X10A 4L89A 4AG9A 5J8FA 3H8GA 4KVXA 1YR0A 3NH8A 3KHXA 2PJ0A 4ZX9A 4MJ8A 5AG7A 3T8WA 5AG5A 3VWEA 3DDDA 1IIDA 1CP6A 2ANPA 2IJZA 3CZXA 3R9FA 1CPXA 1Y9WA 1AMPA 4UBRA 3V38A 3IWGA 3KL9A 4CS0B 2ZEEA 1QSOA 4UEFA 3WC5A 2HQYA 4A37A 3QB8A 2K5TA 4JD6A 3N5FA 4F6AA 5F47A 1Z4EA 1P4NA 2ZPAA 4PV6A 3DNSA 4OLLA 2PJ8A 4KZTA 3H8FA 4KLWA 4ZY1A 4NJQA 2C6CA 4OC1A 3FB3A 4AXVA 4F9UA 3DR6A 1QSMA 2AFXA 3FJUA 4TNUA 4XNHC 4U9ZA 2JBJA 3SHPA 3CXSA 1VGYA 2R8VA 3B3WA 3P2FA 1Y0RA 3HLPA 4KOXA 5DWMA 2ZEMA 4NSQA 2Q7SA 4KSAA 3N7ZA 2DF5A 5C82A 2PJ2A 4DUKA 1R43A 4MCQA 2C6GA 1N71A 5IB0A 3CXQA 4BMHA 3PB7X 3SI1A 1ZG8A 2YGWA 2PJ5A 8CPAA 2NMTA 3CT9A 3KR5A 4QUSA 1NMTA 3PFEA 3BJ7A 3WT4A 3EFAA 1YX0A 4P44A 1IGBA 1PUAA 3WABA 4XPDC 4II9A 2P0WA 1TKFA 2C27A 3NFZA 4CGLA 4IHMA 1BAVA 2RFHA 4R3LA 4R87A 3IEHA 2PCUA 1J4JA 4NXYA 2CF4A 1P0HA 3RYOA 2R98A 2Q4YA 1M4IA 3FF3A 2FT0A 2QYVA 4A2ZA 2Z0ZA 2VL1A 3S9LA 3VATA 4MHDA 5HVFA 4MFPA 1YSJA 5DWNA 4MFZA 4CYQA 4A32A 4DJLA 1ARMA 3SJFA 2OZGA 2Z10A 4ZBGA 4C7IA 3RZAA 5KTAA 2J8NA 1Z8LA 4U9YA 4P10A 2BSWA 1CP7A 1TKJA 4MHNA 4XPDB 2OH1A 4MFLA 1DTDA 2B3VA 1LAMA 1WWZA 2B3UA 1Y7RA 3NE7A 3FVLA 3P2HA 5F48A 4YFJA 4NJRA 2GREA 4UFWA 4UFXA 5GCNA 3KI9A 1M44A 3GYAA 4EFDA 4FD5A 4C68A 1XBUA 2G9DA 3LODA 4IF5A 1Z8TA 3DLJA 3IJ3A 3KHZA 2HUZA 5HH1A 4B11A 2J8MA 4RUHA 6CPAA 3PP9A 4BBHA 2PRQA 2QJ8A 3B35A 2PJBA 3TE4A 4CRZB 4X2TA 2WZNA 4F0YA 4YGOA 1IOIA 1OBRA 1UFHA 2FE7A 3GB0A 4H2KA 1LCPA 5D29A 4PK2A 5A28A 4LUAA 2CNMA 2HC9A 2X7BA 2I3CA 3PB8X 1ZO0A 2GLFA 4KOYA 2GE3A 1CPSA 1NSAA 2B5GB 3D8PA 4B5PB 2EK9A 4P4EA 4P6YA 2EK8A 3FYNA 2C1CA 2WUUA 3D2PA 5D8NA 1VHSA 3SXOA 2JEVA 1XRYA 3S6GA 1QSNA 2Q4ZA 1S7LA 2OZUA 2DPSA 2O4HA 2ZW7A 5F46A 2CIJA 3BLNA 3GKRA 2VZYA 2Q04A 4OC0A 3R9EA 3VH9A 4M6IA 4K3NA 1VHOA 1XF8A 3RAMA 1JWQA 1CBXA 2P6EA 4EWTA 3IU2A 2EO8A 4C7HA 1I1DA 1XFOA 4K30A 1S60A 3TCVA 2F8HA 2GIVA 4M85A 4CAWA 4AVBA 1YW4A 3LMSA 3FRMA 2GFQA 3C26A 3JUWA 4ONUA 1IOFA 4X8IA 3TT2A 2DXQA 1HDQA 1LRZA 5CBMA 4EVYA 3PB6X 4NGRA 3SJEA 1Q2DA 4OC5A 5JH9A 4B6ZA 1F2OA 2Z3PA 2Q44A 3TOAA 3MN8A 4OC3A 4UIBA 2PJCA 2ZW5A 3ISZA 4P4IA 3T90A 3FEEA 5ISVA 1V0CA 2ZOGA 4R6TA 1RTQA 2QVPA 1Q7LA 4UCNA 4HKFA 5LRJA 3TO9A 1VIXA 1M4GA 2G0BA 1IB1E 2YNCC 1CJWA 3SJXA 2PQ8A 1S3ZA 2BCOA 2R1IA 2XEIA 1F2PA 3QNVA 1PU9A 3FECA 4Y49B 4OADA 5DS0A 4NEXA 3R96A 4MHZA 2V8VA 1MK4A 1I12A 4JXQA 4A30A 4W9YA 1IYLA 3FH4A 2CNTA 2B58A 3SI2A 3DSBA 4BD9A 1XE4A 2AFZA 4PK3A 3IC1A 4JYWA 4B5OA 3R1KA 4IUSA 4M3SA 4J3GA 4HNYB 3KASA 2Q43A 5CNPA 2V8GA 1FNOA 1YK3A 2REEA 3FEDA 4LX9A 3K9UA 3PBEA 2PR8A 4RS2A
chains in the Genus database with same CATH topology
2PJAA 1LANA 1LOKA 2NYQA 4FUUA 2PJ7A 4X3RA 1HEEA 2PJ1A 3NH4A 4PXDA 1DE4C 3B3SA 3WC7A 4YWYA 2AFMA 4G1PA 5HXDA 4TWEA 3BI1A 3CDXA 1YW6A 2OR4A 2ZEPA 3IIBA 3GLJA 2JEWA 3D68A 5J1QA 2OOTA 4MCRA 5K8MA 4MHYA 3D7DA 2POKA 1TKHA 3RBUA 4OMEA 1BPNA 4P4BA 4P45A 1ZG7A 2J9AA 2C6PA 4MCPA 2ZEHA 4F8ZA 1BLLE 3L2NA 4F9VA 4NGMA 3GUXA 1ZLIA 3IFEA 4P4JA 3IWWA 4DYOA 1F57A 3FX6A 2JBKA 5LYLA 4CPAA 1BPMA 2HB6A 5LYDA 4GM5A 5I4MA 2PIYA 1ZG9A 1YMEA 2FVGA 3DGVA 4OIWA 2AFOA 4ZYQA 2V77A 1VHEA 5K8PA 3NH5A 3B7IA 1XMBA 4JZ0A 4LQGA 5LRGA 4PXCA 3KQZA 1QQ9A 4NGNA 5F09A 4UIAA 2Q51A 1R3NA 3NA6A 3D7GA 4ZI6A 3JRUA 2ZEFA 2ZEOA 4OC4A 1TF9A 1KWMA 3B3VA 3KR4A 3B3CA 4A39A 1Z2LA 4MCSA 1LFWA 4ONWA 2CTBA 2WYRA 4R8FA 2XEJA 3PB4X 1IY7A 1PCAA 3KQXA 2V8HA 3PEIA 5CPAA 4ZX8A 2RB7A 3I1UA 4ZY0A 1PYTB 1JQGA 2PJ6A 3PRTA 1EE3P 5K8OA 5HVHA 1H8LA 2ZELA 4UEZA 2EWBA 4YU9A 3KZWA 2V8DA 4A94A 2PVVA 5THWA 4WWVA 4MRIA 3K2KA 3MRUA 3BI0A 3V7ZA 1QMUA 5HVGA 2ABZA 4FBEA 4PXBA 2PVWA 2IMOA 5IB9A 2DEAA 2AFWA 1HDUA 1UWYA 4MHPA 4NFRA 3KGQA 3S9MA 2BO9A 2CTCA 4PPZA 3CPAA 5JGFA 2PJ4A 3D4UA 2PIZA 4NGSA 4OC2A 3K9TA 4P4DA 4ZY2A 3PB9X 2XEFA 2PE3A 4WJBA 3BHXA 4MXUA 5LRKA 3LWUA 4Z65A 1CG2A 3B3TA 1FT7A 3D7FA 1TF8A 1M4LA 1Y7EA 3D66A 3WC6A 3H8EA 4OKOA 2BOAA 3HUVA 4IAVA 4R7MA 2ZENA 5JM6A 2GU2A 3D7HA 1LAPA 4FWUA 2XEGA 3B2YA 5K8NA 3FMCA 2F7VA 3ISXA 2ZEDA 1ZLHA 4KSIA 4R76A 7CPAA 1XJOA 4MMOA 1ARLA 3D67A 1CX8A 2ZOFA 5LYIA 5LYFA 4EMEA 3SJGA 2PJ3A 3TX8A 2IQ6A 3BXMA 4IK2A 2O53A 5ELYA 2GLJA 3TC8A 2AFUA 4NGTA 3PFOA 4NGQA 4Q7AA 4NGPA 1ELLP 2PJ9A 2ZEGA 4UEEA 3SI0A 3VARA 3IO1A 4PXEA 3CPXA 4P4FA 4PQAA 1ELMP 3S9NA 1YLOA 1Z5RA 2AFSA 4A38A 3PBBA 1TXRA 4UF4A 4OIDA 4O23A 4FAIA 1AYEA 2NSMA 1GYTA 1Y0YA 3H8GA 3NH8A 3KHXA 2PJ0A 4ZX9A 3T8WA 1CP6A 2ANPA 2IJZA 1CPXA 1AMPA 3V38A 3KL9A 2ZEEA 4UEFA 3WC5A 4A37A 3N5FA 2PJ8A 3H8FA 4ZY1A 4NJQA 2C6CA 4OC1A 4AXVA 4F9UA 2AFXA 3FJUA 4TNUA 2JBJA 1VGYA 3B3WA 1Y0RA 3HLPA 2ZEMA 2PJ2A 4DUKA 1R43A 4MCQA 2C6GA 3PB7X 3SI1A 1ZG8A 8CPAA 2PJ5A 3CT9A 3KR5A 3PFEA 3WT4A 4P44A 3WABA 1IGBA 1TKFA 3NFZA 4IHMA 1BAVA 2RFHA 3IEHA 2PCUA 2CF4A 3FF3A 2QYVA 2VL1A 3S9LA 3VATA 5HVFA 1YSJA 4DJLA 1ARMA 3SJFA 3RZAA 1Z8LA 4P10A 1CP7A 1TKJA 4MHNA 1DTDA 1LAMA 3FVLA 4NJRA 2GREA 3KI9A 4EFDA 1XBUA 2G9DA 3KHZA 3DLJA 3IJ3A 6CPAA 4RUHA 2PRQA 2QJ8A 3B35A 2PJBA 4X2TA 2WZNA 1OBRA 3GB0A 4H2KA 1LCPA 5D29A 2HC9A 3PB8X 2I3CA 2GLFA 1CPSA 1NSAA 2EK9A 4P4EA 4P6YA 2EK8A 2C1CA 5D8NA 1XRYA 2Q4ZA 2O4HA 2CIJA 4OC0A 3VH9A 4K3NA 1VHOA 3RAMA 1CBXA 4EWTA 1XFOA 2F8HA 1YW4A 3LMSA 4X8IA 1HDQA 5CBMA 3PB6X 4NGRA 3SJEA 4OC5A 5JH9A 4B6ZA 1F2OA 3MN8A 4OC3A 4UIBA 2PJCA 3ISZA 4P4IA 3FEEA 2ZOGA 4R6TA 1RTQA 2QVPA 1Q7LA 5LRJA 1VIXA 3SJXA 2BCOA 2XEIA 1F2PA 3QNVA 3FECA 5DS0A 4MHZA 2V8VA 4W9YA 3FH4A 3SI2A 4BD9A 2AFZA 3IC1A 4JYWA 3KASA 2Q43A 2V8GA 1FNOA 3FEDA 4OP4A 3PBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJA A;  1LAN A;  1LOK A;  2NYQ A;  4FUU A;  2PJ7 A;  4X3R A;  1HEE A;  2PJ1 A;  3NH4 A;  4PXD A;  1DE4 C;  3B3S A;  3WC7 A;  4YWY A;  2AFM A;  4G1P A;  5HXD A;  4TWE A;  3BI1 A;  3CDX A;  1YW6 A;  2OR4 A;  2ZEP A;  3IIB A;  3GLJ A;  2JEW A;  3D68 A;  5J1Q A;  2OOT A;  4MCR A;  5K8M A;  4MHY A;  3D7D A;  2POK A;  1TKH A;  3RBU A;  4OME A;  1BPN A;  4P4B A;  4P45 A;  1ZG7 A;  2J9A A;  2C6P A;  4MCP A;  2ZEH A;  4F8Z A;  1BLL E;  3L2N A;  4F9V A;  4NGM A;  3GUX A;  1ZLI A;  3IFE A;  4P4J A;  3IWW A;  4DYO A;  1F57 A;  3FX6 A;  2JBK A;  5LYL A;  4CPA A;  1BPM A;  2HB6 A;  5LYD A;  4GM5 A;  5I4M A;  2PIY A;  1ZG9 A;  1YME A;  2FVG A;  3DGV A;  4OIW A;  2AFO A;  4ZYQ A;  2V77 A;  1VHE A;  5K8P A;  3NH5 A;  3B7I A;  1XMB A;  4JZ0 A;  4LQG A;  5LRG A;  4PXC A;  3KQZ A;  1QQ9 A;  4NGN A;  5F09 A;  4UIA A;  2Q51 A;  1R3N A;  3NA6 A;  3D7G A;  4ZI6 A;  3JRU A;  2ZEF A;  2ZEO A;  4OC4 A;  1TF9 A;  1KWM A;  3B3V A;  3KR4 A;  3B3C A;  4A39 A;  1Z2L A;  4MCS A;  1LFW A;  4ONW A;  2CTB A;  2WYR A;  4R8F A;  2XEJ A;  3PB4 X;  1IY7 A;  1PCA A;  3KQX A;  2V8H A;  3PEI A;  5CPA A;  4ZX8 A;  2RB7 A;  3I1U A;  4ZY0 A;  1PYT B;  1JQG A;  2PJ6 A;  3PRT A;  1EE3 P;  5K8O A;  5HVH A;  1H8L A;  2ZEL A;  4UEZ A;  2EWB A;  4YU9 A;  3KZW A;  2V8D A;  4A94 A;  2PVV A;  5THW A;  4WWV A;  4MRI A;  3K2K A;  3MRU A;  3BI0 A;  3V7Z A;  1QMU A;  5HVG A;  2ABZ A;  4FBE A;  4PXB A;  2PVW A;  2IMO A;  5IB9 A;  2DEA A;  2AFW A;  1HDU A;  1UWY A;  4MHP A;  4NFR A;  3KGQ A;  3S9M A;  2BO9 A;  2CTC A;  4PPZ A;  3CPA A;  5JGF A;  2PJ4 A;  3D4U A;  2PIZ A;  4NGS A;  4OC2 A;  3K9T A;  4P4D A;  4ZY2 A;  3PB9 X;  2XEF A;  2PE3 A;  4WJB A;  3BHX A;  4MXU A;  5LRK A;  3LWU A;  4Z65 A;  1CG2 A;  3B3T A;  1FT7 A;  3D7F A;  1TF8 A;  1M4L A;  1Y7E A;  3D66 A;  3WC6 A;  3H8E A;  4OKO A;  2BOA A;  3HUV A;  4IAV A;  4R7M A;  2ZEN A;  5JM6 A;  2GU2 A;  3D7H A;  1LAP A;  4FWU A;  2XEG A;  3B2Y A;  5K8N A;  3FMC A;  2F7V A;  3ISX A;  2ZED A;  1ZLH A;  4KSI A;  4R76 A;  7CPA A;  1XJO A;  4MMO A;  1ARL A;  3D67 A;  1CX8 A;  2ZOF A;  5LYI A;  5LYF A;  4EME A;  3SJG A;  2PJ3 A;  3TX8 A;  2IQ6 A;  3BXM A;  4IK2 A;  2O53 A;  5ELY A;  2GLJ A;  3TC8 A;  2AFU A;  4NGT A;  3PFO A;  4NGQ A;  4Q7A A;  4NGP A;  1ELL P;  2PJ9 A;  2ZEG A;  4UEE A;  3SI0 A;  3VAR A;  3IO1 A;  4PXE A;  3CPX A;  4P4F A;  4PQA A;  1ELM P;  3S9N A;  1YLO A;  1Z5R A;  2AFS A;  4A38 A;  3PBB A;  1TXR A;  4UF4 A;  4OID A;  4O23 A;  4FAI A;  1AYE A;  2NSM A;  1GYT A;  1Y0Y A;  3H8G A;  3NH8 A;  3KHX A;  2PJ0 A;  4ZX9 A;  3T8W A;  1CP6 A;  2ANP A;  2IJZ A;  1CPX A;  1AMP A;  3V38 A;  3KL9 A;  2ZEE A;  4UEF A;  3WC5 A;  4A37 A;  3N5F A;  2PJ8 A;  3H8F A;  4ZY1 A;  4NJQ A;  2C6C A;  4OC1 A;  4AXV A;  4F9U A;  2AFX A;  3FJU A;  4TNU A;  2JBJ A;  1VGY A;  3B3W A;  1Y0R A;  3HLP A;  2ZEM A;  2PJ2 A;  4DUK A;  1R43 A;  4MCQ A;  2C6G A;  3PB7 X;  3SI1 A;  1ZG8 A;  8CPA A;  2PJ5 A;  3CT9 A;  3KR5 A;  3PFE A;  3WT4 A;  4P44 A;  3WAB A;  1IGB A;  1TKF A;  3NFZ A;  4IHM A;  1BAV A;  2RFH A;  3IEH A;  2PCU A;  2CF4 A;  3FF3 A;  2QYV A;  2VL1 A;  3S9L A;  3VAT A;  5HVF A;  1YSJ A;  4DJL A;  1ARM A;  3SJF A;  3RZA A;  1Z8L A;  4P10 A;  1CP7 A;  1TKJ A;  4MHN A;  1DTD A;  1LAM A;  3FVL A;  4NJR A;  2GRE A;  3KI9 A;  4EFD A;  1XBU A;  2G9D A;  3KHZ A;  3DLJ A;  3IJ3 A;  6CPA A;  4RUH A;  2PRQ A;  2QJ8 A;  3B35 A;  2PJB A;  4X2T A;  2WZN A;  1OBR A;  3GB0 A;  4H2K A;  1LCP A;  5D29 A;  2HC9 A;  3PB8 X;  2I3C A;  2GLF A;  1CPS A;  1NSA A;  2EK9 A;  4P4E A;  4P6Y A;  2EK8 A;  2C1C A;  5D8N A;  1XRY A;  2Q4Z A;  2O4H A;  2CIJ A;  4OC0 A;  3VH9 A;  4K3N A;  1VHO A;  3RAM A;  1CBX A;  4EWT A;  1XFO A;  2F8H A;  1YW4 A;  3LMS A;  4X8I A;  1HDQ A;  5CBM A;  3PB6 X;  4NGR A;  3SJE A;  4OC5 A;  5JH9 A;  4B6Z A;  1F2O A;  3MN8 A;  4OC3 A;  4UIB A;  2PJC A;  3ISZ A;  4P4I A;  3FEE A;  2ZOG A;  4R6T A;  1RTQ A;  2QVP A;  1Q7L A;  5LRJ A;  1VIX A;  3SJX A;  2BCO A;  2XEI A;  1F2P A;  3QNV A;  3FEC A;  5DS0 A;  4MHZ A;  2V8V A;  4W9Y A;  3FH4 A;  3SI2 A;  4BD9 A;  2AFZ A;  3IC1 A;  4JYW A;  3KAS A;  2Q43 A;  2V8G A;  1FNO A;  3FED A;  4OP4 A;  3PBE A; 
#chains in the Genus database with same CATH topology
 2FS5 A;  2PJA A;  1LAN A;  1LOK A;  2NYQ A;  3FNC A;  2PJ7 A;  1Z8W A;  3PZJ A;  4FUU A;  4KVM E;  4X3R A;  4PSX A;  1Z8X A;  1HEE A;  2PJ1 A;  2VQY A;  2OU2 A;  3NH4 A;  4PXD A;  1U6M A;  1BOB A;  1XIX A;  1DE4 C;  5G22 A;  5AG4 A;  5FVJ A;  3B3S A;  3WC7 A;  3JVN A;  4YWY A;  2AFM A;  4G1P A;  5HXD A;  4TWE A;  3BI1 A;  5F49 A;  1VKC A;  2PR1 A;  3CDX A;  4E8O A;  4H6Z A;  2DPT A;  1YW6 A;  2OR4 A;  2ZEP A;  3EY5 A;  1S7N A;  1Y9K A;  3IIB A;  3GLJ A;  2JEW A;  4C2Y A;  3D68 A;  3NE8 A;  1Q2C A;  2AJ6 A;  4CAF A;  5J1Q A;  2OOT A;  4GXH A;  1S5K A;  4MCR A;  5K8M A;  3FIX A;  2B4D B;  4MHY A;  4CYP A;  2R7H A;  4Q38 A;  2FCK A;  5KTD A;  2VI7 A;  3D7D A;  2RC4 A;  2POK A;  1IYK A;  1TKH A;  4Y49 C;  3RBU A;  2JDC A;  4OME A;  1BPN A;  2FIA A;  4L8A A;  4P4B A;  4P45 A;  1ZG7 A;  3S6H A;  2J9A A;  4CAV A;  2C6P A;  2YNC A;  4MCP A;  3ZJ0 A;  2PDO A;  2ZEH A;  1BLL E;  3L2N A;  3OWC A;  4FD6 A;  4KOS A;  4NGM A;  4F8Z A;  4F9V A;  3GUX A;  1ZLI A;  4R57 A;  2Z11 A;  1QSR A;  3IFE A;  1GHE A;  4P4J A;  4AVA A;  3TFY A;  3IWW A;  2JDD A;  2P6G A;  4DYO A;  3MGD A;  1F57 A;  3FX6 A;  2JBK A;  3UY5 A;  5LYL A;  4AB7 A;  2VEZ A;  5JPH A;  4UWJ A;  4CPA A;  1BPM A;  4KOW A;  2HB6 A;  4KUB A;  4QB9 A;  5LYD A;  2YNE A;  4GM5 A;  4XPL A;  5I4M A;  2PIY A;  1ZG9 A;  1YME A;  3RO0 A;  2FVG A;  3DGV A;  3H4Q A;  2G3A A;  2AFO A;  4OIW A;  4B13 A;  4ZYQ A;  2V77 A;  1Z9U A;  4HPS A;  2VBQ A;  1VHE A;  2FIW A;  4AG7 A;  1I21 A;  2CXA A;  3SXN A;  2WSA A;  1QST A;  4JWP A;  5K8P A;  5H84 A;  3NH5 A;  1RO5 A;  3B7I A;  4KUA A;  5EC4 A;  1XMB A;  1B6B A;  1YQE A;  4JZ0 A;  4PSW A;  5AG6 A;  4UFV A;  3IWE A;  2REF A;  4KLV A;  2YND A;  4CYO A;  4FD7 A;  4LQG A;  5LRG A;  4PXC A;  2PSW A;  3KQZ A;  1QQ9 A;  2ZW6 A;  4NGN A;  3LD2 A;  2BL1 A;  4RN7 A;  4B12 A;  2QEC A;  4UCM A;  5F09 A;  4UIA A;  4BIN A;  2Q51 A;  3A9L A;  2O28 A;  1R3N A;  3NA6 A;  2ODF A;  2I79 A;  2B4D A;  3RNZ A;  3D7G A;  4CGP A;  4ZI6 A;  1TIQ A;  3JRU A;  2B4B A;  4R9M A;  2ZEF A;  2ZEO A;  3F0A A;  4OC4 A;  4MFJ A;  5H86 A;  4A31 A;  1SQH A;  1RXT A;  4F0X A;  1TF9 A;  1KWM A;  1KZF A;  2FXF A;  1MJA A;  2ATR A;  2Z3K A;  3B3V A;  3BJ8 A;  4CGM A;  3KR4 A;  3B3C A;  2AE6 A;  4A39 A;  1Z2L A;  4MCS A;  1LFW A;  4ONW A;  1S7K A;  4B10 A;  3F5B A;  2CTB A;  2WYR A;  1MJB A;  3G3S A;  4R8F A;  2XEJ A;  3PB4 X;  1IY7 A;  1PCA A;  3I9S A;  3KQX A;  2VXK A;  4A33 A;  2V8H A;  4OAE A;  3H5Z A;  1A2Z A;  3PEI A;  4ORF A;  5CPA A;  2RB7 A;  3I1U A;  4ZX8 A;  2ARH A;  4ZY0 A;  4CRY B;  2JLM A;  1IU8 A;  1PYT B;  1B87 A;  1JQG A;  4KOV A;  4QVT A;  4GS4 A;  2PJ6 A;  5C88 A;  1WK4 A;  3PRT A;  2EBJ A;  1EE3 P;  5K8O A;  3FXT A;  4I49 A;  5J8C A;  5HVH A;  1H8L A;  2ZEL A;  4OP4 A;  1XOV A;  3E0K A;  2Z3L A;  4E0A A;  2WPX A;  3LAC A;  1NSL A;  4UEZ A;  2EWB A;  1YLE A;  1X12 A;  4YU9 A;  3WR7 A;  3KZW A;  2V8D A;  1CM0 A;  4YRH A;  4A94 A;  2PVV A;  5THW A;  4CGN A;  4WWV A;  4MRI A;  4M6H A;  3EXN A;  3K2K A;  3MRU A;  3BI0 A;  1S7F A;  4H89 A;  2Q7B A;  3V7Z A;  4KOT A;  4C2X A;  5JQ4 A;  1QMU A;  1MJ9 A;  2ABZ A;  2OB0 A;  2EVN A;  4PXB A;  4FBE A;  5HVG A;  2PVW A;  4ZGY B;  3GY9 A;  2IMO A;  4NCZ A;  5IB9 A;  2HV2 A;  2DEA A;  2AFW A;  4UCP A;  1HDU A;  1UWY A;  4MHP A;  2P6F A;  5G20 A;  4NFR A;  3KGQ A;  4KOR A;  4CAE A;  4CGO A;  5IV0 A;  1M4D A;  4A95 A;  3S9M A;  2BO9 A;  2CTC A;  4XPK A;  4PPZ A;  3CPA A;  5JGF A;  2PJ4 A;  2EUI A;  3D4U A;  2PIZ A;  4NGS A;  4OC2 A;  3K9T A;  4XNH B;  4KVO E;  2QIR A;  4UWI A;  4P4D A;  3S6F A;  4ZY2 A;  3TO7 A;  3PB9 X;  3V8I A;  1L0C A;  4U5Y A;  2Z3M A;  2XEF A;  4M6G A;  5KTC A;  2ZW4 A;  2BEI A;  4JLY A;  1NE9 A;  2PE3 A;  4WJB A;  1BO4 A;  3TO6 A;  3BHX A;  3EC4 A;  4C2Z A;  4NF1 A;  4MXU A;  1Z4R A;  4MFK A;  1XEB A;  3GIU A;  2Q0Y A;  5LRK A;  1XMT A;  2BUE A;  3LWU A;  4Z65 A;  1CG2 A;  3B3T A;  1FT7 A;  3D7F A;  4LQ6 A;  3W6S A;  5G1Z A;  1TF8 A;  1M4L A;  1Y7E A;  3D66 A;  4E2A A;  3F8K A;  2Q4V A;  5EBV A;  2H5M A;  3WC6 A;  3S6K A;  3H8E A;  4OKO A;  4CYN A;  3QAH A;  2BOA A;  3HUV A;  3T9Y A;  4Q36 A;  3TOB A;  4CAX A;  1K4J A;  4IAV A;  3D2M A;  3R9G A;  3B8G A;  1M1D A;  4HNX B;  1YRE A;  4R7M A;  2ZEN A;  3CXP A;  1KUX A;  3W91 A;  4X5K A;  2GU2 A;  5JM6 A;  3D7H A;  1LAP A;  2Z3O A;  4B14 A;  4FWU A;  3W6X A;  3JTK A;  2I00 A;  1AUG A;  4DNC A;  3VWD A;  2XEG A;  1KUY A;  3B2Y A;  5K8N A;  3IU1 A;  3FMC A;  4MI4 A;  2PRB A;  2F7V A;  3ISX A;  1FY7 A;  2VZZ A;  2ZED A;  1ZLH A;  5IX3 A;  3PGP A;  4KSF A;  4KSI A;  2GAN A;  4R76 A;  7CPA A;  1Q2Y A;  1XJO A;  4MMO A;  4UA3 A;  5EMI A;  1ARL A;  3D67 A;  3D3S A;  2B5G A;  4JJX A;  4MY3 A;  4QC6 A;  4AVC A;  2CY2 A;  3DR8 A;  1CX8 A;  2ZOF A;  2Y0M A;  2QML A;  4FD4 A;  4JXR A;  5LYI A;  4EME A;  5LYF A;  2CNS A;  2Z3N A;  3SJG A;  2PJ3 A;  3TX8 A;  1YVK A;  4QBJ A;  2IQ6 A;  3BXM A;  3G8W A;  4IK2 A;  2O53 A;  5E96 A;  5ELY A;  2GLJ A;  1KUV A;  2PC1 A;  3TC8 A;  2KCW A;  2AFU A;  2G3T A;  2ZXV A;  4NGT A;  3PFO A;  2IL4 A;  2FSR A;  1OZP A;  4NGQ A;  3TTH A;  4MFQ A;  4Q7A A;  4MY0 A;  3QAY A;  4NGP A;  1ELL P;  2PJ9 A;  5AGE A;  1YGH A;  2WPW A;  2ZEG A;  3IGR A;  3KKW A;  3EO4 A;  4UEE A;  5I0C A;  5G21 A;  3SI0 A;  4R3K A;  3VAR A;  3IO1 A;  3ZZI A;  5A27 A;  3FBU A;  4MBU A;  2A4N A;  3CPX A;  4P4F A;  4PXE A;  3R95 A;  4H6U A;  4PQA A;  1ELM P;  1ON0 A;  3S9N A;  3I3G A;  1YLO A;  1Z5R A;  2FL4 A;  2F5I A;  4RI1 A;  2OZH A;  5BWA B;  2J8R A;  2AFS A;  1R57 A;  4A38 A;  3PBB A;  4KS9 A;  1TXR A;  4UF4 A;  4OID A;  4O23 A;  4FAI A;  1AYE A;  4B5P A;  2NSM A;  2D4P A;  2D4O A;  4KOU A;  1GYT A;  4HNW B;  5HMN A;  1IIC A;  1YVO A;  1Y0Y A;  1X10 A;  4L89 A;  4AG9 A;  5J8F A;  3H8G A;  4KVX A;  1YR0 A;  3NH8 A;  3KHX A;  2PJ0 A;  4ZX9 A;  4MJ8 A;  5AG7 A;  3T8W A;  5AG5 A;  3VWE A;  3DDD A;  1IID A;  1CP6 A;  2ANP A;  2IJZ A;  3CZX A;  3R9F A;  1CPX A;  1Y9W A;  1AMP A;  4UBR A;  3V38 A;  3IWG A;  3KL9 A;  4CS0 B;  2ZEE A;  1QSO A;  4UEF A;  3WC5 A;  2HQY A;  4A37 A;  3QB8 A;  2K5T A;  4JD6 A;  3N5F A;  4F6A A;  5F47 A;  1Z4E A;  1P4N A;  2ZPA A;  4PV6 A;  3DNS A;  4OLL A;  2PJ8 A;  4KZT A;  3H8F A;  4KLW A;  4ZY1 A;  4NJQ A;  2C6C A;  4OC1 A;  3FB3 A;  4AXV A;  4F9U A;  3DR6 A;  1QSM A;  2AFX A;  3FJU A;  4TNU A;  4XNH C;  4U9Z A;  2JBJ A;  3SHP A;  3CXS A;  1VGY A;  2R8V A;  3B3W A;  3P2F A;  1Y0R A;  3HLP A;  4KOX A;  5DWM A;  2ZEM A;  4NSQ A;  2Q7S A;  4KSA A;  3N7Z A;  2DF5 A;  5C82 A;  2PJ2 A;  4DUK A;  1R43 A;  4MCQ A;  2C6G A;  1N71 A;  5IB0 A;  3CXQ A;  4BMH A;  3PB7 X;  3SI1 A;  1ZG8 A;  2YGW A;  2PJ5 A;  8CPA A;  2NMT A;  3CT9 A;  3KR5 A;  4QUS A;  1NMT A;  3PFE A;  3BJ7 A;  3WT4 A;  3EFA A;  1YX0 A;  4P44 A;  1IGB A;  1PUA A;  3WAB A;  4XPD C;  4II9 A;  2P0W A;  1TKF A;  2C27 A;  3NFZ A;  4CGL A;  4IHM A;  1BAV A;  2RFH A;  4R3L A;  4R87 A;  3IEH A;  2PCU A;  1J4J A;  4NXY A;  2CF4 A;  1P0H A;  3RYO A;  2R98 A;  2Q4Y A;  1M4I A;  3FF3 A;  2FT0 A;  2QYV A;  4A2Z A;  2Z0Z A;  2VL1 A;  3S9L A;  3VAT A;  4MHD A;  5HVF A;  4MFP A;  1YSJ A;  5DWN A;  4MFZ A;  4CYQ A;  4A32 A;  4DJL A;  1ARM A;  3SJF A;  2OZG A;  2Z10 A;  4ZBG A;  4C7I A;  3RZA A;  5KTA A;  2J8N A;  1Z8L A;  4U9Y A;  4P10 A;  2BSW A;  1CP7 A;  1TKJ A;  4MHN A;  4XPD B;  2OH1 A;  4MFL A;  1DTD A;  2B3V A;  1LAM A;  1WWZ A;  2B3U A;  1Y7R A;  3NE7 A;  3FVL A;  3P2H A;  5F48 A;  4YFJ A;  4NJR A;  2GRE A;  4UFW A;  4UFX A;  5GCN A;  3KI9 A;  1M44 A;  3GYA A;  4EFD A;  4FD5 A;  4C68 A;  1XBU A;  2G9D A;  3LOD A;  4IF5 A;  1Z8T A;  3DLJ A;  3IJ3 A;  3KHZ A;  2HUZ A;  5HH1 A;  4B11 A;  2J8M A;  4RUH A;  6CPA A;  3PP9 A;  4BBH A;  2PRQ A;  2QJ8 A;  3B35 A;  2PJB A;  3TE4 A;  4CRZ B;  4X2T A;  2WZN A;  4F0Y A;  4YGO A;  1IOI A;  1OBR A;  1UFH A;  2FE7 A;  3GB0 A;  4H2K A;  1LCP A;  5D29 A;  4PK2 A;  5A28 A;  4LUA A;  2CNM A;  2HC9 A;  2X7B A;  2I3C A;  3PB8 X;  1ZO0 A;  2GLF A;  4KOY A;  2GE3 A;  1CPS A;  1NSA A;  2B5G B;  3D8P A;  4B5P B;  2EK9 A;  4P4E A;  4P6Y A;  2EK8 A;  3FYN A;  2C1C A;  2WUU A;  3D2P A;  5D8N A;  1VHS A;  3SXO A;  2JEV A;  1XRY A;  3S6G A;  1QSN A;  2Q4Z A;  1S7L A;  2OZU A;  2DPS A;  2O4H A;  2ZW7 A;  5F46 A;  2CIJ A;  3BLN A;  3GKR A;  2VZY A;  2Q04 A;  4OC0 A;  3R9E A;  3VH9 A;  4M6I A;  4K3N A;  1VHO A;  1XF8 A;  3RAM A;  1JWQ A;  1CBX A;  2P6E A;  4EWT A;  3IU2 A;  2EO8 A;  4C7H A;  1I1D A;  1XFO A;  4K30 A;  1S60 A;  3TCV A;  2F8H A;  2GIV A;  4M85 A;  4CAW A;  4AVB A;  1YW4 A;  3LMS A;  3FRM A;  2GFQ A;  3C26 A;  3JUW A;  4ONU A;  1IOF A;  4X8I A;  3TT2 A;  2DXQ A;  1HDQ A;  1LRZ A;  5CBM A;  4EVY A;  3PB6 X;  4NGR A;  3SJE A;  1Q2D A;  4OC5 A;  5JH9 A;  4B6Z A;  1F2O A;  2Z3P A;  2Q44 A;  3TOA A;  3MN8 A;  4OC3 A;  4UIB A;  2PJC A;  2ZW5 A;  3ISZ A;  4P4I A;  3T90 A;  3FEE A;  5ISV A;  1V0C A;  2ZOG A;  4R6T A;  1RTQ A;  2QVP A;  1Q7L A;  4UCN A;  4HKF A;  5LRJ A;  3TO9 A;  1VIX A;  1M4G A;  2G0B A;  1IB1 E;  2YNC C;  1CJW A;  3SJX A;  2PQ8 A;  1S3Z A;  2BCO A;  2R1I A;  2XEI A;  1F2P A;  3QNV A;  1PU9 A;  3FEC A;  4Y49 B;  4OAD A;  5DS0 A;  4NEX A;  3R96 A;  4MHZ A;  2V8V A;  1MK4 A;  1I12 A;  4JXQ A;  4A30 A;  4W9Y A;  1IYL A;  3FH4 A;  2CNT A;  2B58 A;  3SI2 A;  3DSB A;  4BD9 A;  1XE4 A;  2AFZ A;  4PK3 A;  3IC1 A;  4JYW A;  4B5O A;  3R1K A;  4IUS A;  4M3S A;  4J3G A;  4HNY B;  3KAS A;  2Q43 A;  5CNP A;  2V8G A;  1FNO A;  1YK3 A;  2REE A;  3FED A;  4LX9 A;  3K9U A;  3PBE A;  2PR8 A;  4RS2 A; 
#chains in the Genus database with same CATH homology
 2PJA A;  1LAN A;  1LOK A;  2NYQ A;  4FUU A;  2PJ7 A;  4X3R A;  1HEE A;  2PJ1 A;  3NH4 A;  4PXD A;  1DE4 C;  3B3S A;  3WC7 A;  4YWY A;  2AFM A;  4G1P A;  5HXD A;  4TWE A;  3BI1 A;  3CDX A;  1YW6 A;  2OR4 A;  2ZEP A;  3IIB A;  3GLJ A;  2JEW A;  3D68 A;  5J1Q A;  2OOT A;  4MCR A;  5K8M A;  4MHY A;  3D7D A;  2POK A;  1TKH A;  3RBU A;  4OME A;  1BPN A;  4P4B A;  4P45 A;  1ZG7 A;  2J9A A;  2C6P A;  4MCP A;  2ZEH A;  4F8Z A;  1BLL E;  3L2N A;  4F9V A;  4NGM A;  3GUX A;  1ZLI A;  3IFE A;  4P4J A;  3IWW A;  4DYO A;  1F57 A;  3FX6 A;  2JBK A;  5LYL A;  4CPA A;  1BPM A;  2HB6 A;  5LYD A;  4GM5 A;  5I4M A;  2PIY A;  1ZG9 A;  1YME A;  2FVG A;  3DGV A;  4OIW A;  2AFO A;  4ZYQ A;  2V77 A;  1VHE A;  5K8P A;  3NH5 A;  3B7I A;  1XMB A;  4JZ0 A;  4LQG A;  5LRG A;  4PXC A;  3KQZ A;  1QQ9 A;  4NGN A;  5F09 A;  4UIA A;  2Q51 A;  1R3N A;  3NA6 A;  3D7G A;  4ZI6 A;  3JRU A;  2ZEF A;  2ZEO A;  4OC4 A;  1TF9 A;  1KWM A;  3B3V A;  3KR4 A;  3B3C A;  4A39 A;  1Z2L A;  4MCS A;  1LFW A;  4ONW A;  2CTB A;  2WYR A;  4R8F A;  2XEJ A;  3PB4 X;  1IY7 A;  1PCA A;  3KQX A;  2V8H A;  3PEI A;  5CPA A;  4ZX8 A;  2RB7 A;  3I1U A;  4ZY0 A;  1PYT B;  1JQG A;  2PJ6 A;  3PRT A;  1EE3 P;  5K8O A;  5HVH A;  1H8L A;  2ZEL A;  4UEZ A;  2EWB A;  4YU9 A;  3KZW A;  2V8D A;  4A94 A;  2PVV A;  5THW A;  4WWV A;  4MRI A;  3K2K A;  3MRU A;  3BI0 A;  3V7Z A;  1QMU A;  5HVG A;  2ABZ A;  4FBE A;  4PXB A;  2PVW A;  2IMO A;  5IB9 A;  2DEA A;  2AFW A;  1HDU A;  1UWY A;  4MHP A;  4NFR A;  3KGQ A;  3S9M A;  2BO9 A;  2CTC A;  4PPZ A;  3CPA A;  5JGF A;  2PJ4 A;  3D4U A;  2PIZ A;  4NGS A;  4OC2 A;  3K9T A;  4P4D A;  4ZY2 A;  3PB9 X;  2XEF A;  2PE3 A;  4WJB A;  3BHX A;  4MXU A;  5LRK A;  3LWU A;  4Z65 A;  1CG2 A;  3B3T A;  1FT7 A;  3D7F A;  1TF8 A;  1M4L A;  1Y7E A;  3D66 A;  3WC6 A;  3H8E A;  4OKO A;  2BOA A;  3HUV A;  4IAV A;  4R7M A;  2ZEN A;  5JM6 A;  2GU2 A;  3D7H A;  1LAP A;  4FWU A;  2XEG A;  3B2Y A;  5K8N A;  3FMC A;  2F7V A;  3ISX A;  2ZED A;  1ZLH A;  4KSI A;  4R76 A;  7CPA A;  1XJO A;  4MMO A;  1ARL A;  3D67 A;  1CX8 A;  2ZOF A;  5LYI A;  5LYF A;  4EME A;  3SJG A;  2PJ3 A;  3TX8 A;  2IQ6 A;  3BXM A;  4IK2 A;  2O53 A;  5ELY A;  2GLJ A;  3TC8 A;  2AFU A;  4NGT A;  3PFO A;  4NGQ A;  4Q7A A;  4NGP A;  1ELL P;  2PJ9 A;  2ZEG A;  4UEE A;  3SI0 A;  3VAR A;  3IO1 A;  4PXE A;  3CPX A;  4P4F A;  4PQA A;  1ELM P;  3S9N A;  1YLO A;  1Z5R A;  2AFS A;  4A38 A;  3PBB A;  1TXR A;  4UF4 A;  4OID A;  4O23 A;  4FAI A;  1AYE A;  2NSM A;  1GYT A;  1Y0Y A;  3H8G A;  3NH8 A;  3KHX A;  2PJ0 A;  4ZX9 A;  3T8W A;  1CP6 A;  2ANP A;  2IJZ A;  1CPX A;  1AMP A;  3V38 A;  3KL9 A;  2ZEE A;  4UEF A;  3WC5 A;  4A37 A;  3N5F A;  2PJ8 A;  3H8F A;  4ZY1 A;  4NJQ A;  2C6C A;  4OC1 A;  4AXV A;  4F9U A;  2AFX A;  3FJU A;  4TNU A;  2JBJ A;  1VGY A;  3B3W A;  1Y0R A;  3HLP A;  2ZEM A;  2PJ2 A;  4DUK A;  1R43 A;  4MCQ A;  2C6G A;  3PB7 X;  3SI1 A;  1ZG8 A;  8CPA A;  2PJ5 A;  3CT9 A;  3KR5 A;  3PFE A;  3WT4 A;  4P44 A;  3WAB A;  1IGB A;  1TKF A;  3NFZ A;  4IHM A;  1BAV A;  2RFH A;  3IEH A;  2PCU A;  2CF4 A;  3FF3 A;  2QYV A;  2VL1 A;  3S9L A;  3VAT A;  5HVF A;  1YSJ A;  4DJL A;  1ARM A;  3SJF A;  3RZA A;  1Z8L A;  4P10 A;  1CP7 A;  1TKJ A;  4MHN A;  1DTD A;  1LAM A;  3FVL A;  4NJR A;  2GRE A;  3KI9 A;  4EFD A;  1XBU A;  2G9D A;  3KHZ A;  3DLJ A;  3IJ3 A;  6CPA A;  4RUH A;  2PRQ A;  2QJ8 A;  3B35 A;  2PJB A;  4X2T A;  2WZN A;  1OBR A;  3GB0 A;  4H2K A;  1LCP A;  5D29 A;  2HC9 A;  3PB8 X;  2I3C A;  2GLF A;  1CPS A;  1NSA A;  2EK9 A;  4P4E A;  4P6Y A;  2EK8 A;  2C1C A;  5D8N A;  1XRY A;  2Q4Z A;  2O4H A;  2CIJ A;  4OC0 A;  3VH9 A;  4K3N A;  1VHO A;  3RAM A;  1CBX A;  4EWT A;  1XFO A;  2F8H A;  1YW4 A;  3LMS A;  4X8I A;  1HDQ A;  5CBM A;  3PB6 X;  4NGR A;  3SJE A;  4OC5 A;  5JH9 A;  4B6Z A;  1F2O A;  3MN8 A;  4OC3 A;  4UIB A;  2PJC A;  3ISZ A;  4P4I A;  3FEE A;  2ZOG A;  4R6T A;  1RTQ A;  2QVP A;  1Q7L A;  5LRJ A;  1VIX A;  3SJX A;  2BCO A;  2XEI A;  1F2P A;  3QNV A;  3FEC A;  5DS0 A;  4MHZ A;  2V8V A;  4W9Y A;  3FH4 A;  3SI2 A;  4BD9 A;  2AFZ A;  3IC1 A;  4JYW A;  3KAS A;  2Q43 A;  2V8G A;  1FNO A;  3FED A;  4OP4 A;  3PBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...