3SI0A

Structure of glycosylated human glutaminyl cyclase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
324
structure length
314
Chain Sequence
EEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFNNRVFVGATDSAVPCAMMLELARALDKKLLSLKDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Glycosylated Mammalian Glutaminyl Cyclases Reveal Conformational Variability near the Active Center.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Glutaminyl-peptide cyclotransferase
total genus 104
structure length 314
sequence length 324
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3si0A00
4O23A 1BAVA 3FVLA 3B2YA 2ZOFA 4NGQA 4JYWA 2ZEOA 4ZI6A 2EK9A 2CTBA 3GLJA 3ISXA 4X3RA 4CPAA 2V8VA 2AFMA 4ZX9A 3B3VA 1VGYA 2JBKA 5LRKA 4B6ZA 4FBEA 5LYLA 5LYIA 4MHNA 1AYEA 3IFEA 3FH4A 1FNOA 4YWYA 3IWWA 1PYTB 1Y7EA 1KWMA 3PFOA 2V8DA 3FMCA 5K8MA 3VH9A 3PEIA 3KR5A 1F2PA 3IJ3A 4NJRA 2AFWA 3WC6A 2C6PA 2BO9A 2ZEFA 2AFXA 2BOAA 3DGVA 3LWUA 4FWUA 5DS0A 2IMOA 4A37A 2NSMA 3BI0A 1YW4A 4P44A 3SJGA 2PVVA 3FF3A 4UEZA 3S9MA 3H8FA 5CPAA 2QJ8A 2OOTA 2ANPA 2PJ0A 4MMOA 3K2KA 4NGNA 2C1CA 5ELYA 1GYTA 5JGFA 4OC1A 4A94A 3PB6X 2ZELA 5CBMA 1IY7A 3HLPA 5K8PA 1DE4C 4UEEA 1CG2A 3NA6A 4ZX8A 5D29A 1CPXA 4GM5A 4IAVA 4H2KA 5LRGA 2OR4A 1ARMA 2ZOGA 3PBBA 3BXMA 4NGSA 4P10A 2ABZA 1LANA 2XEIA 2JEWA 6CPAA 3HUVA 4NGRA 2PIYA 3KQXA 4F9VA 2GLJA 4NGTA 1Z5RA 2AFSA 3PB8X 5IB9A 5JH9A 1ZG8A 3FX6A 4A39A 4P4DA 2EK8A 2PIZA 1BPMA 2AFOA 4WJBA 4OKOA 3CPAA 1CPSA 4P4BA 1HDQA 1XMBA 1CP6A 1HDUA 1TF8A 3PRTA 4UIAA 3RBUA 2WZNA 1LCPA 4JZ0A 2PJ6A 3BI1A 4OIDA 2PJ2A 1F57A 2Q4ZA 3NH5A 1LAPA 4OC0A 3N5FA 3L2NA 2V77A 4MXUA 3B3SA 8CPAA 4AXVA 4PXEA 4NFRA 3TX8A 2PJ8A 4MCSA 1CX8A 4R7MA 1Y0YA 4P45A 4G1PA 3D7FA 4PQAA 1TKJA 2XEJA 2CIJA 4PPZA 4PXBA 2PE3A 2PJ1A 2HC9A 4OMEA 4X2TA 2V8GA 3CT9A 1TF9A 3SI2A 2PJAA 4K3NA 4P4JA 2POKA 3GUXA 2PJ5A 5HXDA 2PJ9A 1BLLE 4R6TA 1OBRA 1QMUA 4F9UA 4UF4A 1H8LA 3QNVA 3FJUA 3FEDA 4IK2A 5HVHA 1XFOA 1ZLIA 2AFUA 1R43A 4F8ZA 3VATA 1UWYA 3KI9A 1YMEA 2O4HA 2C6GA 1Y0RA 3T8WA 3DLJA 3IO1A 1QQ9A 4MCRA 3B35A 3VARA 3D67A 4UEFA 3D4UA 4ZY2A 4R8FA 2HB6A 4RUHA 4TNUA 1JQGA 4X8IA 2ZEEA 3V38A 1XJOA 5HVFA 2DEAA 5LYFA 2PJ3A 3IC1A 3KQZA 4BD9A 3SI0A 4PXDA 2G9DA 3NFZA 4OC4A 1Q7LA 2V8HA 2ZENA 3KZWA 4EFDA 3SJFA 3D68A 4NJQA 4IHMA 3K9TA 4DJLA 1RTQA 3NH8A 3CDXA 4EWTA 3B3WA 2ZEGA 1YSJA 4NGPA 4MHZA 4LQGA 4A38A 2ZEHA 1CBXA 2Q43A 3V7ZA 3ISZA 1ELLP 1LFWA 3MRUA 3B3TA 1XRYA 1Z8LA 3TC8A 3NH4A 2GLFA 1DTDA 4FUUA 5K8NA 3H8GA 1ARLA 2VL1A 1ELMP 4OIWA 4P6YA 2IQ6A 3D7GA 2PJBA 2EWBA 7CPAA 4MCQA 1LOKA 3KR4A 1ZG7A 4WWVA 3I1UA 2BCOA 3MN8A 2FVGA 2Q51A 5LYDA 3PB4X 1ZLHA 1HEEA 5HVGA 4Q7AA 2O53A 3IEHA 1VHOA 3PB7X 4R76A 3PBEA 3GB0A 3WABA 1NSAA 3H8EA 1YLOA 2PJ7A 1XBUA 3WC5A 2RB7A 2IJZA 4NGMA 3WT4A 3CPXA 5THWA 3PFEA 4ONWA 1FT7A 1LAMA 4W9YA 2CF4A 2I3CA 5LRJA 4YU9A 3D66A 4FAIA 1TXRA 4TWEA 5J1QA 1F2OA 3SJXA 1PCAA 1M4LA 1EE3P 1VHEA 2RFHA 4P4EA 4KSIA 3B7IA 2PJ4A 2F8HA 2PRQA 2F7VA 4MHPA 2GU2A 3D7HA 4ZY1A 1ZG9A 1Z2LA 3FEEA 3KL9A 2C6CA 4EMEA 3IIBA 1YW6A 2ZEMA 4MCPA 1IGBA 1VIXA 1TKFA 3S9NA 3JRUA 2ZEPA 4P4FA 2PVWA 4OC5A 3KASA 4MRIA 3KGQA 4UIBA 4PXCA 5JM6A 2J9AA 4OP4A 1AMPA 2XEFA 3B3CA 2CTCA 4ZYQA 2PCUA 2PJCA 3D7DA 5D8NA 3S9LA 3WC7A 2AFZA 3FECA 2ZEDA 2JBJA 4ZY0A 4P4IA 3KHXA 3BHXA 5I4MA 3SI1A 1CP7A 2NYQA 5F09A 3SJEA 3RAMA 3PB9X 5K8OA 2GREA 4DUKA 2QYVA 4Z65A 4OC3A 1R3NA 1BPNA 4DYOA 4OC2A 2XEGA 4MHYA 3KHZA 2QVPA 2WYRA 3LMSA 3RZAA 1TKHA
chains in the Genus database with same CATH superfamily
4O23A 2FT0A 1BAVA 3R9GA 2VEZA 3FVLA 2GE3A 4KVOE 4C7HA 3B2YA 4IF5A 1Z4EA 2ZOFA 3RYOA 2CY2A 4JYWA 4NGQA 2REEA 3FXTA 1S7NA 2ZEOA 5CNPA 1I12A 4ZI6A 2EK9A 2CTBA 3GLJA 3ISXA 4X3RA 3W91A 4C68A 4CPAA 2V8VA 4CYOA 4H6ZA 2AFMA 4ZX9A 2REFA 4CYNA 3TO7A 3B3VA 2EO8A 1VGYA 2JBKA 1ON0A 4CAEA 3RNZA 2FL4A 5LRKA 2ZPAA 4U5YA 2J8NA 4B6ZA 3S6HA 3IU1A 4FBEA 5LYLA 5LYIA 4MHNA 1N71A 1AYEA 4E8OA 3IFEA 1P4NA 2R98A 3FH4A 1FNOA 3NE7A 3OWCA 4OAEA 4YWYA 5I0CA 1XEBA 3IWWA 1PYTB 1Y7EA 1KWMA 2OZUA 3PFOA 2V8DA 3FMCA 1KUYA 5DWMA 3S6GA 4A30A 4CRYB 2FE7A 5K8MA 4LUAA 3VH9A 2ZXVA 4XPLA 1QSOA 3PEIA 3KR5A 1F2PA 2I79A 3IJ3A 4NJRA 4YRHA 2AFWA 4H89A 3WC6A 2C6PA 2BO9A 3EXNA 1LRZA 2ZEFA 2AFXA 2BOAA 3DGVA 3LWUA 4ZGYB 4FWUA 2AJ6A 2IMOA 5DS0A 1IYLA 4KLWA 4A37A 2YNDA 2NSMA 3BI0A 1RO5A 1YW4A 1YLEA 4P44A 3SJGA 2PVVA 4XNHC 1Y9KA 3FF3A 4HKFA 4UEZA 3S9MA 3H8FA 5CPAA 3TOBA 2QJ8A 2OOTA 5DWNA 2ANPA 2DPSA 2PJ0A 4MMOA 3T90A 3V8IA 1IOIA 1Z8XA 3K2KA 4UCNA 4NGNA 2C1CA 4M6HA 3W6XA 3F0AA 4JXQA 4RN7A 4B5PB 4PK2A 5IV0A 5ELYA 1GYTA 4KLVA 5JGFA 4A2ZA 1M1DA 4OC1A 3FNCA 3PB6X 4A94A 2ZELA 2YNCC 2PR1A 4OLLA 1IY7A 2Q7SA 5CBMA 2QECA 1CJWA 3HLPA 5K8PA 2Z10A 1DE4C 4UEEA 4AG9A 5FVJA 1CG2A 3NA6A 2Q04A 5F46A 4ZX8A 2FCKA 5D29A 5E96A 3CXQA 1CPXA 4GM5A 4IAVA 4H2KA 1IYKA 5LRGA 3D8PA 2OR4A 4PSWA 2EBJA 1ARMA 1QSNA 4E2AA 2ZOGA 3FYNA 4R57A 1X12A 2Z3PA 3PBBA 4CGPA 1YVOA 3BXMA 3PP9A 1KZFA 1M4GA 4GXHA 4NGSA 4P10A 2ABZA 1LANA 2PDOA 2FS5A 2JEWA 2XEIA 4X5KA 4IUSA 6CPAA 3HUVA 2KCWA 2QIRA 3GYAA 4NGRA 2PIYA 4U9YA 3UY5A 3KQXA 3FRMA 4F9VA 3JVNA 4EVYA 2GLJA 3P2HA 4NGTA 5JQ4A 1Z5RA 1A2ZA 4F0YA 2AFSA 3F5BA 2GIVA 2GFQA 2O28A 3PB8X 4NEXA 1NSLA 5IB9A 5JH9A 1MJ9A 2P0WA 4UWJA 1IU8A 1ZG8A 4L89A 4MHDA 4MY3A 3SXOA 4QBJA 3FX6A 4MFJA 4A39A 4P4DA 2EK8A 1XMTA 2B4DA 1BOBA 2P6EA 2DXQA 2PIZA 4R87A 1BPMA 4KSAA 4M6IA 3R9EA 2AFOA 5H84A 4WJBA 3IU2A 3TFYA 3W6SA 4OKOA 2DF5A 3CPAA 5EMIA 2B5GB 1S5KA 4YFJA 1U6MA 1CPSA 3R1KA 4P4BA 4CGNA 4HNWB 1HDQA 1XMBA 1CP6A 4CS0B 1HDUA 1M4DA 1TF8A 3PRTA 4HPSA 4UIAA 3RBUA 4BINA 3FBUA 2WZNA 1LCPA 4JZ0A 2OB0A 2PJ6A 3BI1A 4OIDA 4XPDB 4B11A 4ORFA 2PJ2A 1F57A 2Q4ZA 3LACA 3NH5A 4JXRA 4DNCA 1LAPA 3DSBA 4ONUA 1Q2CA 3CXSA 3N5FA 3L2NA 4OC0A 2V77A 4MXUA 1YREA 2D4PA 1XF8A 3B3SA 8CPAA 3NE8A 4AXVA 3TCVA 5G21A 4PXEA 5KTDA 4NFRA 1B6BA 3TX8A 3S6FA 3ZZIA 5IB0A 2PJ8A 3IWEA 4Q36A 5EBVA 2P6GA 4MCSA 1CX8A 4R7MA 1Y0YA 4P45A 3TT2A 3TTHA 2VI7A 1Y7RA 4G1PA 2BSWA 3GY9A 3D7FA 4PQAA 1TKJA 2XEJA 3ZJ0A 4CGLA 1S3ZA 2CIJA 3SHPA 2FSRA 3MGDA 4NCZA 4BBHA 1Q2YA 2Z11A 4UCPA 5HH1A 4PPZA 1UFHA 3WR7A 1OZPA 3EY5A 3FB3A 4PXBA 1YQEA 2B4BA 3TO9A 2PE3A 2GANA 2PJ1A 5J8CA 2HC9A 1KUXA 1QSMA 4MI4A 4R3KA 4OMEA 4X2TA 2B58A 2V8GA 3BLNA 3CT9A 5AGEA 1TF9A 2K5TA 2H5MA 3SI2A 2PJAA 2R7HA 2CNMA 4K3NA 4P4JA 2RC4A 1AUGA 4E0AA 2POKA 5HMNA 4MBUA 3GUXA 2PJ5A 2G3AA 2JDCA 4KOUA 4B5PA 4MY0A 4C7IA 1BO4A 1Z9UA 2HUZA 2B4DB 5HXDA 2B3UA 4CRZB 2PJ9A 3TO6A 5G1ZA 1BLLE 1WK4A 2Z3LA 4R6TA 1OBRA 1MJBA 1QMUA 4YGOA 4H6UA 4PSXA 4F9UA 4KVME 2I00A 4UF4A 4C2YA 3TE4A 5AG7A 3LD2A 3JTKA 1H8LA 1JWQA 3QNVA 1YK3A 3N7ZA 1P0HA 3FJUA 3FEDA 2IL4A 4IK2A 2Q7BA 5HVHA 1XFOA 1ZLIA 4CAVA 2AFUA 2PRBA 4M3SA 1R43A 4F8ZA 3VATA 5F48A 1IICA 3EO4A 2Y0MA 4QB9A 4QC6A 3RO0A 1UWYA 4I49A 3KI9A 1YMEA 2O4HA 2C6GA 3CZXA 1Y0RA 2P6FA 3T8WA 2WPWA 1IB1E 3DLJA 4CYQA 2ZW7A 3IO1A 4UCMA 1S7KA 1QQ9A 4U9ZA 5J8FA 1QSRA 1B87A 4MCRA 3B35A 1PUAA 1ZO0A 3VARA 3D67A 4KUAA 3A9LA 3D4UA 4UEFA 3I3GA 4KOVA 4ZY2A 1Z4RA 1YR0A 2BEIA 3DR6A 2DPTA 4R8FA 2HB6A 4J3GA 4RUHA 4TNUA 1JQGA 2VXKA 2OH1A 2Z0ZA 2ZEEA 1XJOA 4R9MA 4X8IA 4UWIA 3V38A 3VWDA 4AVCA 5HVFA 1YVKA 2PSWA 4KOXA 2FIAA 2DEAA 4KUBA 5H86A 4AB7A 5LYFA 1FY7A 2VQYA 2PJ3A 3IC1A 3KQZA 2OZHA 3E0KA 5AG6A 4BD9A 2Q44A 3B8GA 3H4QA 2Z3NA 3PGPA 3SI0A 5IX3A 4PXDA 2CNTA 2G9DA 2FXFA 3NFZA 2Q4YA 4OC4A 4AG7A 1Q7LA 1VKCA 2HQYA 3K9UA 3P2FA 2V8HA 5AG5A 2ZENA 3KZWA 4F0XA 4LQ6A 4XPDC 3SJFA 4EFDA 1IOFA 3D68A 4K30A 2OU2A 3DR8A 3H5ZA 3K9TA 4IHMA 3F8KA 4NJQA 1RTQA 4DJLA 2BUEA 4B10A 3NH8A 3CDXA 1YGHA 4EWTA 4CGMA 3B3WA 2PC1A 5A28A 4HNXB 2ZEGA 4HNYB 1YSJA 4M6GA 4NGPA 4MHZA 4LQGA 1M4IA 2HV2A 3QAYA 3T9YA 4UFXA 2ZEHA 4A33A 1CBXA 4A38A 4KOTA 4ZBGA 5F49A 2Q43A 3V7ZA 3ISZA 4CAWA 1I1DA 5GCNA 2FIWA 1ELLP 1LFWA 3MRUA 4GS4A 4C2XA 4CGOA 5JPHA 4PK3A 2Q0YA 2EVNA 1TIQA 3EC4A 4JLYA 3B3TA 2VZYA 1Q2DA 1XRYA 1S60A 1Z8LA 2WSAA 3TC8A 3NH4A 2PQ8A 2GLFA 1DTDA 4FUUA 4A32A 3H8GA 5K8NA 1ARLA 3D3SA 2VL1A 1ELMP 1WWZA 2EUIA 4UFWA 4OIWA 4P6YA 2IQ6A 3D7GA 5A27A 3G3SA 3R9FA 3CXPA 2PJBA 1NMTA 4C2ZA 2EWBA 2CXAA 2JDDA 7CPAA 2ATRA 2G0BA 4KOWA 1LOKA 2D4OA 3KR4A 1ZG7A 4JWPA 4MCQA 3I1UA 2BCOA 3MN8A 4WWVA 5KTAA 2FVGA 2Q51A 5LYDA 3PB4X 1HEEA 1ZLHA 1QSTA 1RXTA 1SQHA 2Q4VA 4KSFA 3FIXA 2J8RA 5HVGA 2X7BA 1KUVA 4Q7AA 4B5OA 2YGWA 4UFVA 2O53A 3IEHA 5C88A 1VHOA 3PB7X 4R76A 1XIXA 2AE6A 3PBEA 3GB0A 4UBRA 3WABA 1NSAA 4B12A 4KOSA 1YLOA 3H8EA 2PJ7A 4PV6A 3D2PA 1XBUA 3C26A 1K4JA 3WC5A 2RB7A 3VWEA 4CAXA 2IJZA 4NGMA 1XOVA 3EFAA 3R95A 3G8WA 3WT4A 2NMTA 3QB8A 3CPXA 5THWA 3PFEA 4ONWA 1FT7A 1LAMA 4W9YA 2CF4A 2I3CA 3D2MA 5LRJA 4YU9A 3D66A 4Y49C 4FAIA 1TXRA 4TWEA 3R96A 5KTCA 4XNHB 2F5IA 5J1QA 2CNSA 1F2OA 1VHSA 4MFPA 3SJXA 4L8AA 1PCAA 1M4LA 1NE9A 1EE3P 1CM0A 1VHEA 2RFHA 4XPKA 4P4EA 4KSIA 3S6KA 3B7IA 2PJ4A 2F8HA 2PRQA 2F7VA 2G3TA 2GU2A 3D7HA 4KVXA 4KOYA 4MHPA 5F47A 4ZY1A 3JUWA 1MK4A 3I9SA 1MJAA 2Z3KA 1XE4A 1X10A 2OZGA 3GKRA 1S7FA 1ZG9A 2BL1A 4Y49B 4RI1A 5EC4A 3BJ7A 1Z2LA 3QAHA 4MFZA 3LODA 3FEEA 3IWGA 3KL9A 2B5GA 2ZW6A 5G20A 4QVTA 4MFKA 4A95A 2C6CA 2JEVA 4B14A 2QMLA 2Z3OA 2WUUA 4EMEA 3IIBA 4MFLA 1PU9A 2R1IA 4FD7A 1YW6A 1L0CA 2ZEMA 3PZJA 4MCPA 4R3LA 1IGBA 1VIXA 1GHEA 1TKFA 4CAFA 4AVBA 4NSQA 3S9NA 1R57A 3JRUA 2ZEPA 4P4FA 2ODFA 2R8VA 2PVWA 2ZW5A 4F6AA 4JD6A 4OC5A 2B3VA 2ZW4A 2A4NA 3KASA 4MFQA 4MRIA 5G22A 4JJXA 3KGQA 4UIBA 4II9A 4PXCA 1Y9WA 4M85A 5JM6A 4BMHA 2J9AA 4OP4A 4NF1A 1AMPA 2XEFA 1IIDA 5C82A 3B3CA 3GIUA 4KS9A 2CTCA 3DNSA 4ZYQA 2PCUA 5ISVA 1J4JA 2PJCA 3D7DA 1I21A 2VZZA 4Q38A 4FD6A 5D8NA 3S9LA 2JLMA 3WC7A 2AFZA 2PR8A 2ARHA 4FD5A 3IGRA 3FECA 2YNCA 2J8MA 2ZEDA 1Z8TA 2C27A 2JBJA 2YNEA 1YX0A 2VBQA 4A31A 4ZY0A 4P4IA 4RS2A 4LX9A 4QUSA 3KHXA 3BHXA 5I4MA 3SI1A 3DDDA 1CP7A 2NYQA 5F09A 3SJEA 3RAMA 2WPXA 3PB9X 5AG4A 5K8OA 3BJ8A 1V0CA 2Z3MA 4KORA 2GREA 4DUKA 2QYVA 4UA3A 4MJ8A 4B13A 4Z65A 1R3NA 1BPNA 4OADA 4OC3A 1Z8WA 4OC2A 4DYOA 2XEGA 4MHYA 3KKWA 3KHZA 4CYPA 2QVPA 3TOAA 4FD4A 1S7LA 3SXNA 4AVAA 4NXYA 5BWAB 1M44A 2WYRA 3LMSA 3RZAA 1TKHA 4KZTA
chains in the Genus database with same CATH topology
4O23A 1BAVA 3FVLA 3B2YA 2ZOFA 4NGQA 4JYWA 2ZEOA 4ZI6A 2EK9A 2CTBA 3GLJA 3ISXA 4X3RA 4CPAA 2V8VA 2AFMA 4ZX9A 3B3VA 1VGYA 2JBKA 5LRKA 4B6ZA 4FBEA 5LYLA 5LYIA 4MHNA 1AYEA 3IFEA 3FH4A 1FNOA 4YWYA 3IWWA 1PYTB 1Y7EA 1KWMA 3PFOA 2V8DA 3FMCA 5K8MA 3VH9A 3PEIA 3KR5A 1F2PA 3IJ3A 4NJRA 2AFWA 3WC6A 2C6PA 2BO9A 2ZEFA 2AFXA 2BOAA 3DGVA 3LWUA 4FWUA 5DS0A 2IMOA 4A37A 2NSMA 3BI0A 1YW4A 4P44A 3SJGA 2PVVA 3FF3A 4UEZA 3S9MA 3H8FA 5CPAA 2QJ8A 2OOTA 2ANPA 2PJ0A 4MMOA 3K2KA 4NGNA 2C1CA 5ELYA 1GYTA 5JGFA 4OC1A 4A94A 3PB6X 2ZELA 5CBMA 1IY7A 3HLPA 5K8PA 1DE4C 4UEEA 1CG2A 3NA6A 4ZX8A 5D29A 1CPXA 4GM5A 4IAVA 4H2KA 5LRGA 2OR4A 1ARMA 2ZOGA 3PBBA 3BXMA 4NGSA 4P10A 2ABZA 1LANA 2XEIA 2JEWA 6CPAA 3HUVA 4NGRA 2PIYA 3KQXA 4F9VA 2GLJA 4NGTA 1Z5RA 2AFSA 3PB8X 5IB9A 5JH9A 1ZG8A 3FX6A 4A39A 4P4DA 2EK8A 2PIZA 1BPMA 2AFOA 4WJBA 4OKOA 3CPAA 1CPSA 4P4BA 1HDQA 1XMBA 1CP6A 1HDUA 1TF8A 3PRTA 4UIAA 3RBUA 2WZNA 1LCPA 4JZ0A 2PJ6A 3BI1A 4OIDA 2PJ2A 1F57A 2Q4ZA 3NH5A 1LAPA 4OC0A 3N5FA 3L2NA 2V77A 4MXUA 3B3SA 8CPAA 4AXVA 4PXEA 4NFRA 3TX8A 2PJ8A 4MCSA 1CX8A 4R7MA 1Y0YA 4P45A 4G1PA 3D7FA 4PQAA 1TKJA 2XEJA 2CIJA 4PPZA 4PXBA 2PE3A 2PJ1A 2HC9A 4OMEA 4X2TA 2V8GA 3CT9A 1TF9A 3SI2A 2PJAA 4K3NA 4P4JA 2POKA 3GUXA 2PJ5A 5HXDA 2PJ9A 1BLLE 4R6TA 1OBRA 1QMUA 4F9UA 4UF4A 1H8LA 3QNVA 3FJUA 3FEDA 4IK2A 5HVHA 1XFOA 1ZLIA 2AFUA 1R43A 4F8ZA 3VATA 1UWYA 3KI9A 1YMEA 2O4HA 2C6GA 1Y0RA 3T8WA 3DLJA 3IO1A 1QQ9A 4MCRA 3B35A 3VARA 3D67A 4UEFA 3D4UA 4ZY2A 4R8FA 2HB6A 4RUHA 4TNUA 1JQGA 4X8IA 2ZEEA 3V38A 1XJOA 5HVFA 2DEAA 5LYFA 2PJ3A 3IC1A 3KQZA 4BD9A 3SI0A 4PXDA 2G9DA 3NFZA 4OC4A 1Q7LA 2V8HA 2ZENA 3KZWA 4EFDA 3SJFA 3D68A 4NJQA 4IHMA 3K9TA 4DJLA 1RTQA 3NH8A 3CDXA 4EWTA 3B3WA 2ZEGA 1YSJA 4NGPA 4MHZA 4LQGA 4A38A 2ZEHA 1CBXA 2Q43A 3V7ZA 3ISZA 1ELLP 1LFWA 3MRUA 3B3TA 1XRYA 1Z8LA 3TC8A 3NH4A 2GLFA 1DTDA 4FUUA 5K8NA 3H8GA 1ARLA 2VL1A 1ELMP 4OIWA 4P6YA 2IQ6A 3D7GA 2PJBA 2EWBA 7CPAA 4MCQA 1LOKA 3KR4A 1ZG7A 4WWVA 3I1UA 2BCOA 3MN8A 2FVGA 2Q51A 5LYDA 3PB4X 1ZLHA 1HEEA 5HVGA 4Q7AA 2O53A 3IEHA 1VHOA 3PB7X 4R76A 3PBEA 3GB0A 3WABA 1NSAA 3H8EA 1YLOA 2PJ7A 1XBUA 3WC5A 2RB7A 2IJZA 4NGMA 3WT4A 3CPXA 5THWA 3PFEA 4ONWA 1FT7A 1LAMA 4W9YA 2CF4A 2I3CA 5LRJA 4YU9A 3D66A 4FAIA 1TXRA 4TWEA 5J1QA 1F2OA 3SJXA 1PCAA 1M4LA 1EE3P 1VHEA 2RFHA 4P4EA 4KSIA 3B7IA 2PJ4A 2F8HA 2PRQA 2F7VA 4MHPA 2GU2A 3D7HA 4ZY1A 1ZG9A 1Z2LA 3FEEA 3KL9A 2C6CA 4EMEA 3IIBA 1YW6A 2ZEMA 4MCPA 1IGBA 1VIXA 1TKFA 3S9NA 3JRUA 2ZEPA 4P4FA 2PVWA 4OC5A 3KASA 4MRIA 3KGQA 4UIBA 4PXCA 5JM6A 2J9AA 4OP4A 1AMPA 2XEFA 3B3CA 2CTCA 4ZYQA 2PCUA 2PJCA 3D7DA 5D8NA 3S9LA 3WC7A 2AFZA 3FECA 2ZEDA 2JBJA 4ZY0A 4P4IA 3KHXA 3BHXA 5I4MA 3SI1A 1CP7A 2NYQA 5F09A 3SJEA 3RAMA 3PB9X 5K8OA 2GREA 4DUKA 2QYVA 4Z65A 4OC3A 1R3NA 1BPNA 4DYOA 4OC2A 2XEGA 4MHYA 3KHZA 2QVPA 2WYRA 3LMSA 3RZAA 1TKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O23 A;  1BAV A;  3FVL A;  3B2Y A;  2ZOF A;  4NGQ A;  4JYW A;  2ZEO A;  4ZI6 A;  2EK9 A;  2CTB A;  3GLJ A;  3ISX A;  4X3R A;  4CPA A;  2V8V A;  2AFM A;  4ZX9 A;  3B3V A;  1VGY A;  2JBK A;  5LRK A;  4B6Z A;  4FBE A;  5LYL A;  5LYI A;  4MHN A;  1AYE A;  3IFE A;  3FH4 A;  1FNO A;  4YWY A;  3IWW A;  1PYT B;  1Y7E A;  1KWM A;  3PFO A;  2V8D A;  3FMC A;  5K8M A;  3VH9 A;  3PEI A;  3KR5 A;  1F2P A;  3IJ3 A;  4NJR A;  2AFW A;  3WC6 A;  2C6P A;  2BO9 A;  2ZEF A;  2AFX A;  2BOA A;  3DGV A;  3LWU A;  4FWU A;  5DS0 A;  2IMO A;  4A37 A;  2NSM A;  3BI0 A;  1YW4 A;  4P44 A;  3SJG A;  2PVV A;  3FF3 A;  4UEZ A;  3S9M A;  3H8F A;  5CPA A;  2QJ8 A;  2OOT A;  2ANP A;  2PJ0 A;  4MMO A;  3K2K A;  4NGN A;  2C1C A;  5ELY A;  1GYT A;  5JGF A;  4OC1 A;  4A94 A;  3PB6 X;  2ZEL A;  5CBM A;  1IY7 A;  3HLP A;  5K8P A;  1DE4 C;  4UEE A;  1CG2 A;  3NA6 A;  4ZX8 A;  5D29 A;  1CPX A;  4GM5 A;  4IAV A;  4H2K A;  5LRG A;  2OR4 A;  1ARM A;  2ZOG A;  3PBB A;  3BXM A;  4NGS A;  4P10 A;  2ABZ A;  1LAN A;  2XEI A;  2JEW A;  6CPA A;  3HUV A;  4NGR A;  2PIY A;  3KQX A;  4F9V A;  2GLJ A;  4NGT A;  1Z5R A;  2AFS A;  3PB8 X;  5IB9 A;  5JH9 A;  1ZG8 A;  3FX6 A;  4A39 A;  4P4D A;  2EK8 A;  2PIZ A;  1BPM A;  2AFO A;  4WJB A;  4OKO A;  3CPA A;  1CPS A;  4P4B A;  1HDQ A;  1XMB A;  1CP6 A;  1HDU A;  1TF8 A;  3PRT A;  4UIA A;  3RBU A;  2WZN A;  1LCP A;  4JZ0 A;  2PJ6 A;  3BI1 A;  4OID A;  2PJ2 A;  1F57 A;  2Q4Z A;  3NH5 A;  1LAP A;  4OC0 A;  3N5F A;  3L2N A;  2V77 A;  4MXU A;  3B3S A;  8CPA A;  4AXV A;  4PXE A;  4NFR A;  3TX8 A;  2PJ8 A;  4MCS A;  1CX8 A;  4R7M A;  1Y0Y A;  4P45 A;  4G1P A;  3D7F A;  4PQA A;  1TKJ A;  2XEJ A;  2CIJ A;  4PPZ A;  4PXB A;  2PE3 A;  2PJ1 A;  2HC9 A;  4OME A;  4X2T A;  2V8G A;  3CT9 A;  1TF9 A;  3SI2 A;  2PJA A;  4K3N A;  4P4J A;  2POK A;  3GUX A;  2PJ5 A;  5HXD A;  2PJ9 A;  1BLL E;  4R6T A;  1OBR A;  1QMU A;  4F9U A;  4UF4 A;  1H8L A;  3QNV A;  3FJU A;  3FED A;  4IK2 A;  5HVH A;  1XFO A;  1ZLI A;  2AFU A;  1R43 A;  4F8Z A;  3VAT A;  1UWY A;  3KI9 A;  1YME A;  2O4H A;  2C6G A;  1Y0R A;  3T8W A;  3DLJ A;  3IO1 A;  1QQ9 A;  4MCR A;  3B35 A;  3VAR A;  3D67 A;  4UEF A;  3D4U A;  4ZY2 A;  4R8F A;  2HB6 A;  4RUH A;  4TNU A;  1JQG A;  4X8I A;  2ZEE A;  3V38 A;  1XJO A;  5HVF A;  2DEA A;  5LYF A;  2PJ3 A;  3IC1 A;  3KQZ A;  4BD9 A;  3SI0 A;  4PXD A;  2G9D A;  3NFZ A;  4OC4 A;  1Q7L A;  2V8H A;  2ZEN A;  3KZW A;  4EFD A;  3SJF A;  3D68 A;  4NJQ A;  4IHM A;  3K9T A;  4DJL A;  1RTQ A;  3NH8 A;  3CDX A;  4EWT A;  3B3W A;  2ZEG A;  1YSJ A;  4NGP A;  4MHZ A;  4LQG A;  4A38 A;  2ZEH A;  1CBX A;  2Q43 A;  3V7Z A;  3ISZ A;  1ELL P;  1LFW A;  3MRU A;  3B3T A;  1XRY A;  1Z8L A;  3TC8 A;  3NH4 A;  2GLF A;  1DTD A;  4FUU A;  5K8N A;  3H8G A;  1ARL A;  2VL1 A;  1ELM P;  4OIW A;  4P6Y A;  2IQ6 A;  3D7G A;  2PJB A;  2EWB A;  7CPA A;  4MCQ A;  1LOK A;  3KR4 A;  1ZG7 A;  4WWV A;  3I1U A;  2BCO A;  3MN8 A;  2FVG A;  2Q51 A;  5LYD A;  3PB4 X;  1ZLH A;  1HEE A;  5HVG A;  4Q7A A;  2O53 A;  3IEH A;  1VHO A;  3PB7 X;  4R76 A;  3PBE A;  3GB0 A;  3WAB A;  1NSA A;  3H8E A;  1YLO A;  2PJ7 A;  1XBU A;  3WC5 A;  2RB7 A;  2IJZ A;  4NGM A;  3WT4 A;  3CPX A;  5THW A;  3PFE A;  4ONW A;  1FT7 A;  1LAM A;  4W9Y A;  2CF4 A;  2I3C A;  5LRJ A;  4YU9 A;  3D66 A;  4FAI A;  1TXR A;  4TWE A;  5J1Q A;  1F2O A;  3SJX A;  1PCA A;  1M4L A;  1EE3 P;  1VHE A;  2RFH A;  4P4E A;  4KSI A;  3B7I A;  2PJ4 A;  2F8H A;  2PRQ A;  2F7V A;  4MHP A;  2GU2 A;  3D7H A;  4ZY1 A;  1ZG9 A;  1Z2L A;  3FEE A;  3KL9 A;  2C6C A;  4EME A;  3IIB A;  1YW6 A;  2ZEM A;  4MCP A;  1IGB A;  1VIX A;  1TKF A;  3S9N A;  3JRU A;  2ZEP A;  4P4F A;  2PVW A;  4OC5 A;  3KAS A;  4MRI A;  3KGQ A;  4UIB A;  4PXC A;  5JM6 A;  2J9A A;  4OP4 A;  1AMP A;  2XEF A;  3B3C A;  2CTC A;  4ZYQ A;  2PCU A;  2PJC A;  3D7D A;  5D8N A;  3S9L A;  3WC7 A;  2AFZ A;  3FEC A;  2ZED A;  2JBJ A;  4ZY0 A;  4P4I A;  3KHX A;  3BHX A;  5I4M A;  3SI1 A;  1CP7 A;  2NYQ A;  5F09 A;  3SJE A;  3RAM A;  3PB9 X;  5K8O A;  2GRE A;  4DUK A;  2QYV A;  4Z65 A;  4OC3 A;  1R3N A;  1BPN A;  4DYO A;  4OC2 A;  2XEG A;  4MHY A;  3KHZ A;  2QVP A;  2WYR A;  3LMS A;  3RZA A;  1TKH A; 
#chains in the Genus database with same CATH topology
 4O23 A;  2FT0 A;  1BAV A;  3R9G A;  2VEZ A;  3FVL A;  2GE3 A;  4KVO E;  4C7H A;  3B2Y A;  4IF5 A;  1Z4E A;  2ZOF A;  3RYO A;  2CY2 A;  4JYW A;  4NGQ A;  2REE A;  3FXT A;  1S7N A;  2ZEO A;  5CNP A;  1I12 A;  4ZI6 A;  2EK9 A;  2CTB A;  3GLJ A;  3ISX A;  4X3R A;  3W91 A;  4C68 A;  4CPA A;  2V8V A;  4CYO A;  4H6Z A;  2AFM A;  4ZX9 A;  2REF A;  4CYN A;  3TO7 A;  3B3V A;  2EO8 A;  1VGY A;  2JBK A;  1ON0 A;  4CAE A;  3RNZ A;  2FL4 A;  5LRK A;  2ZPA A;  4U5Y A;  2J8N A;  4B6Z A;  3S6H A;  3IU1 A;  4FBE A;  5LYL A;  5LYI A;  4MHN A;  1N71 A;  1AYE A;  4E8O A;  3IFE A;  1P4N A;  2R98 A;  3FH4 A;  1FNO A;  3NE7 A;  3OWC A;  4OAE A;  4YWY A;  5I0C A;  1XEB A;  3IWW A;  1PYT B;  1Y7E A;  1KWM A;  2OZU A;  3PFO A;  2V8D A;  3FMC A;  1KUY A;  5DWM A;  3S6G A;  4A30 A;  4CRY B;  2FE7 A;  5K8M A;  4LUA A;  3VH9 A;  2ZXV A;  4XPL A;  1QSO A;  3PEI A;  3KR5 A;  1F2P A;  2I79 A;  3IJ3 A;  4NJR A;  4YRH A;  2AFW A;  4H89 A;  3WC6 A;  2C6P A;  2BO9 A;  3EXN A;  1LRZ A;  2ZEF A;  2AFX A;  2BOA A;  3DGV A;  3LWU A;  4ZGY B;  4FWU A;  2AJ6 A;  2IMO A;  5DS0 A;  1IYL A;  4KLW A;  4A37 A;  2YND A;  2NSM A;  3BI0 A;  1RO5 A;  1YW4 A;  1YLE A;  4P44 A;  3SJG A;  2PVV A;  4XNH C;  1Y9K A;  3FF3 A;  4HKF A;  4UEZ A;  3S9M A;  3H8F A;  5CPA A;  3TOB A;  2QJ8 A;  2OOT A;  5DWN A;  2ANP A;  2DPS A;  2PJ0 A;  4MMO A;  3T90 A;  3V8I A;  1IOI A;  1Z8X A;  3K2K A;  4UCN A;  4NGN A;  2C1C A;  4M6H A;  3W6X A;  3F0A A;  4JXQ A;  4RN7 A;  4B5P B;  4PK2 A;  5IV0 A;  5ELY A;  1GYT A;  4KLV A;  5JGF A;  4A2Z A;  1M1D A;  4OC1 A;  3FNC A;  3PB6 X;  4A94 A;  2ZEL A;  2YNC C;  2PR1 A;  4OLL A;  1IY7 A;  2Q7S A;  5CBM A;  2QEC A;  1CJW A;  3HLP A;  5K8P A;  2Z10 A;  1DE4 C;  4UEE A;  4AG9 A;  5FVJ A;  1CG2 A;  3NA6 A;  2Q04 A;  5F46 A;  4ZX8 A;  2FCK A;  5D29 A;  5E96 A;  3CXQ A;  1CPX A;  4GM5 A;  4IAV A;  4H2K A;  1IYK A;  5LRG A;  3D8P A;  2OR4 A;  4PSW A;  2EBJ A;  1ARM A;  1QSN A;  4E2A A;  2ZOG A;  3FYN A;  4R57 A;  1X12 A;  2Z3P A;  3PBB A;  4CGP A;  1YVO A;  3BXM A;  3PP9 A;  1KZF A;  1M4G A;  4GXH A;  4NGS A;  4P10 A;  2ABZ A;  1LAN A;  2PDO A;  2FS5 A;  2JEW A;  2XEI A;  4X5K A;  4IUS A;  6CPA A;  3HUV A;  2KCW A;  2QIR A;  3GYA A;  4NGR A;  2PIY A;  4U9Y A;  3UY5 A;  3KQX A;  3FRM A;  4F9V A;  3JVN A;  4EVY A;  2GLJ A;  3P2H A;  4NGT A;  5JQ4 A;  1Z5R A;  1A2Z A;  4F0Y A;  2AFS A;  3F5B A;  2GIV A;  2GFQ A;  2O28 A;  3PB8 X;  4NEX A;  1NSL A;  5IB9 A;  5JH9 A;  1MJ9 A;  2P0W A;  4UWJ A;  1IU8 A;  1ZG8 A;  4L89 A;  4MHD A;  4MY3 A;  3SXO A;  4QBJ A;  3FX6 A;  4MFJ A;  4A39 A;  4P4D A;  2EK8 A;  1XMT A;  2B4D A;  1BOB A;  2P6E A;  2DXQ A;  2PIZ A;  4R87 A;  1BPM A;  4KSA A;  4M6I A;  3R9E A;  2AFO A;  5H84 A;  4WJB A;  3IU2 A;  3TFY A;  3W6S A;  4OKO A;  2DF5 A;  3CPA A;  5EMI A;  2B5G B;  1S5K A;  4YFJ A;  1U6M A;  1CPS A;  3R1K A;  4P4B A;  4CGN A;  4HNW B;  1HDQ A;  1XMB A;  1CP6 A;  4CS0 B;  1HDU A;  1M4D A;  1TF8 A;  3PRT A;  4HPS A;  4UIA A;  3RBU A;  4BIN A;  3FBU A;  2WZN A;  1LCP A;  4JZ0 A;  2OB0 A;  2PJ6 A;  3BI1 A;  4OID A;  4XPD B;  4B11 A;  4ORF A;  2PJ2 A;  1F57 A;  2Q4Z A;  3LAC A;  3NH5 A;  4JXR A;  4DNC A;  1LAP A;  3DSB A;  4ONU A;  1Q2C A;  3CXS A;  3N5F A;  3L2N A;  4OC0 A;  2V77 A;  4MXU A;  1YRE A;  2D4P A;  1XF8 A;  3B3S A;  8CPA A;  3NE8 A;  4AXV A;  3TCV A;  5G21 A;  4PXE A;  5KTD A;  4NFR A;  1B6B A;  3TX8 A;  3S6F A;  3ZZI A;  5IB0 A;  2PJ8 A;  3IWE A;  4Q36 A;  5EBV A;  2P6G A;  4MCS A;  1CX8 A;  4R7M A;  1Y0Y A;  4P45 A;  3TT2 A;  3TTH A;  2VI7 A;  1Y7R A;  4G1P A;  2BSW A;  3GY9 A;  3D7F A;  4PQA A;  1TKJ A;  2XEJ A;  3ZJ0 A;  4CGL A;  1S3Z A;  2CIJ A;  3SHP A;  2FSR A;  3MGD A;  4NCZ A;  4BBH A;  1Q2Y A;  2Z11 A;  4UCP A;  5HH1 A;  4PPZ A;  1UFH A;  3WR7 A;  1OZP A;  3EY5 A;  3FB3 A;  4PXB A;  1YQE A;  2B4B A;  3TO9 A;  2PE3 A;  2GAN A;  2PJ1 A;  5J8C A;  2HC9 A;  1KUX A;  1QSM A;  4MI4 A;  4R3K A;  4OME A;  4X2T A;  2B58 A;  2V8G A;  3BLN A;  3CT9 A;  5AGE A;  1TF9 A;  2K5T A;  2H5M A;  3SI2 A;  2PJA A;  2R7H A;  2CNM A;  4K3N A;  4P4J A;  2RC4 A;  1AUG A;  4E0A A;  2POK A;  5HMN A;  4MBU A;  3GUX A;  2PJ5 A;  2G3A A;  2JDC A;  4KOU A;  4B5P A;  4MY0 A;  4C7I A;  1BO4 A;  1Z9U A;  2HUZ A;  2B4D B;  5HXD A;  2B3U A;  4CRZ B;  2PJ9 A;  3TO6 A;  5G1Z A;  1BLL E;  1WK4 A;  2Z3L A;  4R6T A;  1OBR A;  1MJB A;  1QMU A;  4YGO A;  4H6U A;  4PSX A;  4F9U A;  4KVM E;  2I00 A;  4UF4 A;  4C2Y A;  3TE4 A;  5AG7 A;  3LD2 A;  3JTK A;  1H8L A;  1JWQ A;  3QNV A;  1YK3 A;  3N7Z A;  1P0H A;  3FJU A;  3FED A;  2IL4 A;  4IK2 A;  2Q7B A;  5HVH A;  1XFO A;  1ZLI A;  4CAV A;  2AFU A;  2PRB A;  4M3S A;  1R43 A;  4F8Z A;  3VAT A;  5F48 A;  1IIC A;  3EO4 A;  2Y0M A;  4QB9 A;  4QC6 A;  3RO0 A;  1UWY A;  4I49 A;  3KI9 A;  1YME A;  2O4H A;  2C6G A;  3CZX A;  1Y0R A;  2P6F A;  3T8W A;  2WPW A;  1IB1 E;  3DLJ A;  4CYQ A;  2ZW7 A;  3IO1 A;  4UCM A;  1S7K A;  1QQ9 A;  4U9Z A;  5J8F A;  1QSR A;  1B87 A;  4MCR A;  3B35 A;  1PUA A;  1ZO0 A;  3VAR A;  3D67 A;  4KUA A;  3A9L A;  3D4U A;  4UEF A;  3I3G A;  4KOV A;  4ZY2 A;  1Z4R A;  1YR0 A;  2BEI A;  3DR6 A;  2DPT A;  4R8F A;  2HB6 A;  4J3G A;  4RUH A;  4TNU A;  1JQG A;  2VXK A;  2OH1 A;  2Z0Z A;  2ZEE A;  1XJO A;  4R9M A;  4X8I A;  4UWI A;  3V38 A;  3VWD A;  4AVC A;  5HVF A;  1YVK A;  2PSW A;  4KOX A;  2FIA A;  2DEA A;  4KUB A;  5H86 A;  4AB7 A;  5LYF A;  1FY7 A;  2VQY A;  2PJ3 A;  3IC1 A;  3KQZ A;  2OZH A;  3E0K A;  5AG6 A;  4BD9 A;  2Q44 A;  3B8G A;  3H4Q A;  2Z3N A;  3PGP A;  3SI0 A;  5IX3 A;  4PXD A;  2CNT A;  2G9D A;  2FXF A;  3NFZ A;  2Q4Y A;  4OC4 A;  4AG7 A;  1Q7L A;  1VKC A;  2HQY A;  3K9U A;  3P2F A;  2V8H A;  5AG5 A;  2ZEN A;  3KZW A;  4F0X A;  4LQ6 A;  4XPD C;  3SJF A;  4EFD A;  1IOF A;  3D68 A;  4K30 A;  2OU2 A;  3DR8 A;  3H5Z A;  3K9T A;  4IHM A;  3F8K A;  4NJQ A;  1RTQ A;  4DJL A;  2BUE A;  4B10 A;  3NH8 A;  3CDX A;  1YGH A;  4EWT A;  4CGM A;  3B3W A;  2PC1 A;  5A28 A;  4HNX B;  2ZEG A;  4HNY B;  1YSJ A;  4M6G A;  4NGP A;  4MHZ A;  4LQG A;  1M4I A;  2HV2 A;  3QAY A;  3T9Y A;  4UFX A;  2ZEH A;  4A33 A;  1CBX A;  4A38 A;  4KOT A;  4ZBG A;  5F49 A;  2Q43 A;  3V7Z A;  3ISZ A;  4CAW A;  1I1D A;  5GCN A;  2FIW A;  1ELL P;  1LFW A;  3MRU A;  4GS4 A;  4C2X A;  4CGO A;  5JPH A;  4PK3 A;  2Q0Y A;  2EVN A;  1TIQ A;  3EC4 A;  4JLY A;  3B3T A;  2VZY A;  1Q2D A;  1XRY A;  1S60 A;  1Z8L A;  2WSA A;  3TC8 A;  3NH4 A;  2PQ8 A;  2GLF A;  1DTD A;  4FUU A;  4A32 A;  3H8G A;  5K8N A;  1ARL A;  3D3S A;  2VL1 A;  1ELM P;  1WWZ A;  2EUI A;  4UFW A;  4OIW A;  4P6Y A;  2IQ6 A;  3D7G A;  5A27 A;  3G3S A;  3R9F A;  3CXP A;  2PJB A;  1NMT A;  4C2Z A;  2EWB A;  2CXA A;  2JDD A;  7CPA A;  2ATR A;  2G0B A;  4KOW A;  1LOK A;  2D4O A;  3KR4 A;  1ZG7 A;  4JWP A;  4MCQ A;  3I1U A;  2BCO A;  3MN8 A;  4WWV A;  5KTA A;  2FVG A;  2Q51 A;  5LYD A;  3PB4 X;  1HEE A;  1ZLH A;  1QST A;  1RXT A;  1SQH A;  2Q4V A;  4KSF A;  3FIX A;  2J8R A;  5HVG A;  2X7B A;  1KUV A;  4Q7A A;  4B5O A;  2YGW A;  4UFV A;  2O53 A;  3IEH A;  5C88 A;  1VHO A;  3PB7 X;  4R76 A;  1XIX A;  2AE6 A;  3PBE A;  3GB0 A;  4UBR A;  3WAB A;  1NSA A;  4B12 A;  4KOS A;  1YLO A;  3H8E A;  2PJ7 A;  4PV6 A;  3D2P A;  1XBU A;  3C26 A;  1K4J A;  3WC5 A;  2RB7 A;  3VWE A;  4CAX A;  2IJZ A;  4NGM A;  1XOV A;  3EFA A;  3R95 A;  3G8W A;  3WT4 A;  2NMT A;  3QB8 A;  3CPX A;  5THW A;  3PFE A;  4ONW A;  1FT7 A;  1LAM A;  4W9Y A;  2CF4 A;  2I3C A;  3D2M A;  5LRJ A;  4YU9 A;  3D66 A;  4Y49 C;  4FAI A;  1TXR A;  4TWE A;  3R96 A;  5KTC A;  4XNH B;  2F5I A;  5J1Q A;  2CNS A;  1F2O A;  1VHS A;  4MFP A;  3SJX A;  4L8A A;  1PCA A;  1M4L A;  1NE9 A;  1EE3 P;  1CM0 A;  1VHE A;  2RFH A;  4XPK A;  4P4E A;  4KSI A;  3S6K A;  3B7I A;  2PJ4 A;  2F8H A;  2PRQ A;  2F7V A;  2G3T A;  2GU2 A;  3D7H A;  4KVX A;  4KOY A;  4MHP A;  5F47 A;  4ZY1 A;  3JUW A;  1MK4 A;  3I9S A;  1MJA A;  2Z3K A;  1XE4 A;  1X10 A;  2OZG A;  3GKR A;  1S7F A;  1ZG9 A;  2BL1 A;  4Y49 B;  4RI1 A;  5EC4 A;  3BJ7 A;  1Z2L A;  3QAH A;  4MFZ A;  3LOD A;  3FEE A;  3IWG A;  3KL9 A;  2B5G A;  2ZW6 A;  5G20 A;  4QVT A;  4MFK A;  4A95 A;  2C6C A;  2JEV A;  4B14 A;  2QML A;  2Z3O A;  2WUU A;  4EME A;  3IIB A;  4MFL A;  1PU9 A;  2R1I A;  4FD7 A;  1YW6 A;  1L0C A;  2ZEM A;  3PZJ A;  4MCP A;  4R3L A;  1IGB A;  1VIX A;  1GHE A;  1TKF A;  4CAF A;  4AVB A;  4NSQ A;  3S9N A;  1R57 A;  3JRU A;  2ZEP A;  4P4F A;  2ODF A;  2R8V A;  2PVW A;  2ZW5 A;  4F6A A;  4JD6 A;  4OC5 A;  2B3V A;  2ZW4 A;  2A4N A;  3KAS A;  4MFQ A;  4MRI A;  5G22 A;  4JJX A;  3KGQ A;  4UIB A;  4II9 A;  4PXC A;  1Y9W A;  4M85 A;  5JM6 A;  4BMH A;  2J9A A;  4OP4 A;  4NF1 A;  1AMP A;  2XEF A;  1IID A;  5C82 A;  3B3C A;  3GIU A;  4KS9 A;  2CTC A;  3DNS A;  4ZYQ A;  2PCU A;  5ISV A;  1J4J A;  2PJC A;  3D7D A;  1I21 A;  2VZZ A;  4Q38 A;  4FD6 A;  5D8N A;  3S9L A;  2JLM A;  3WC7 A;  2AFZ A;  2PR8 A;  2ARH A;  4FD5 A;  3IGR A;  3FEC A;  2YNC A;  2J8M A;  2ZED A;  1Z8T A;  2C27 A;  2JBJ A;  2YNE A;  1YX0 A;  2VBQ A;  4A31 A;  4ZY0 A;  4P4I A;  4RS2 A;  4LX9 A;  4QUS A;  3KHX A;  3BHX A;  5I4M A;  3SI1 A;  3DDD A;  1CP7 A;  2NYQ A;  5F09 A;  3SJE A;  3RAM A;  2WPX A;  3PB9 X;  5AG4 A;  5K8O A;  3BJ8 A;  1V0C A;  2Z3M A;  4KOR A;  2GRE A;  4DUK A;  2QYV A;  4UA3 A;  4MJ8 A;  4B13 A;  4Z65 A;  1R3N A;  1BPN A;  4OAD A;  4OC3 A;  1Z8W A;  4OC2 A;  4DYO A;  2XEG A;  4MHY A;  3KKW A;  3KHZ A;  4CYP A;  2QVP A;  3TOA A;  4FD4 A;  1S7L A;  3SXN A;  4AVA A;  4NXY A;  5BWA B;  1M44 A;  2WYR A;  3LMS A;  3RZA A;  1TKH A;  4KZT A; 
#chains in the Genus database with same CATH homology
 4O23 A;  1BAV A;  3FVL A;  3B2Y A;  2ZOF A;  4NGQ A;  4JYW A;  2ZEO A;  4ZI6 A;  2EK9 A;  2CTB A;  3GLJ A;  3ISX A;  4X3R A;  4CPA A;  2V8V A;  2AFM A;  4ZX9 A;  3B3V A;  1VGY A;  2JBK A;  5LRK A;  4B6Z A;  4FBE A;  5LYL A;  5LYI A;  4MHN A;  1AYE A;  3IFE A;  3FH4 A;  1FNO A;  4YWY A;  3IWW A;  1PYT B;  1Y7E A;  1KWM A;  3PFO A;  2V8D A;  3FMC A;  5K8M A;  3VH9 A;  3PEI A;  3KR5 A;  1F2P A;  3IJ3 A;  4NJR A;  2AFW A;  3WC6 A;  2C6P A;  2BO9 A;  2ZEF A;  2AFX A;  2BOA A;  3DGV A;  3LWU A;  4FWU A;  5DS0 A;  2IMO A;  4A37 A;  2NSM A;  3BI0 A;  1YW4 A;  4P44 A;  3SJG A;  2PVV A;  3FF3 A;  4UEZ A;  3S9M A;  3H8F A;  5CPA A;  2QJ8 A;  2OOT A;  2ANP A;  2PJ0 A;  4MMO A;  3K2K A;  4NGN A;  2C1C A;  5ELY A;  1GYT A;  5JGF A;  4OC1 A;  4A94 A;  3PB6 X;  2ZEL A;  5CBM A;  1IY7 A;  3HLP A;  5K8P A;  1DE4 C;  4UEE A;  1CG2 A;  3NA6 A;  4ZX8 A;  5D29 A;  1CPX A;  4GM5 A;  4IAV A;  4H2K A;  5LRG A;  2OR4 A;  1ARM A;  2ZOG A;  3PBB A;  3BXM A;  4NGS A;  4P10 A;  2ABZ A;  1LAN A;  2XEI A;  2JEW A;  6CPA A;  3HUV A;  4NGR A;  2PIY A;  3KQX A;  4F9V A;  2GLJ A;  4NGT A;  1Z5R A;  2AFS A;  3PB8 X;  5IB9 A;  5JH9 A;  1ZG8 A;  3FX6 A;  4A39 A;  4P4D A;  2EK8 A;  2PIZ A;  1BPM A;  2AFO A;  4WJB A;  4OKO A;  3CPA A;  1CPS A;  4P4B A;  1HDQ A;  1XMB A;  1CP6 A;  1HDU A;  1TF8 A;  3PRT A;  4UIA A;  3RBU A;  2WZN A;  1LCP A;  4JZ0 A;  2PJ6 A;  3BI1 A;  4OID A;  2PJ2 A;  1F57 A;  2Q4Z A;  3NH5 A;  1LAP A;  4OC0 A;  3N5F A;  3L2N A;  2V77 A;  4MXU A;  3B3S A;  8CPA A;  4AXV A;  4PXE A;  4NFR A;  3TX8 A;  2PJ8 A;  4MCS A;  1CX8 A;  4R7M A;  1Y0Y A;  4P45 A;  4G1P A;  3D7F A;  4PQA A;  1TKJ A;  2XEJ A;  2CIJ A;  4PPZ A;  4PXB A;  2PE3 A;  2PJ1 A;  2HC9 A;  4OME A;  4X2T A;  2V8G A;  3CT9 A;  1TF9 A;  3SI2 A;  2PJA A;  4K3N A;  4P4J A;  2POK A;  3GUX A;  2PJ5 A;  5HXD A;  2PJ9 A;  1BLL E;  4R6T A;  1OBR A;  1QMU A;  4F9U A;  4UF4 A;  1H8L A;  3QNV A;  3FJU A;  3FED A;  4IK2 A;  5HVH A;  1XFO A;  1ZLI A;  2AFU A;  1R43 A;  4F8Z A;  3VAT A;  1UWY A;  3KI9 A;  1YME A;  2O4H A;  2C6G A;  1Y0R A;  3T8W A;  3DLJ A;  3IO1 A;  1QQ9 A;  4MCR A;  3B35 A;  3VAR A;  3D67 A;  4UEF A;  3D4U A;  4ZY2 A;  4R8F A;  2HB6 A;  4RUH A;  4TNU A;  1JQG A;  4X8I A;  2ZEE A;  3V38 A;  1XJO A;  5HVF A;  2DEA A;  5LYF A;  2PJ3 A;  3IC1 A;  3KQZ A;  4BD9 A;  3SI0 A;  4PXD A;  2G9D A;  3NFZ A;  4OC4 A;  1Q7L A;  2V8H A;  2ZEN A;  3KZW A;  4EFD A;  3SJF A;  3D68 A;  4NJQ A;  4IHM A;  3K9T A;  4DJL A;  1RTQ A;  3NH8 A;  3CDX A;  4EWT A;  3B3W A;  2ZEG A;  1YSJ A;  4NGP A;  4MHZ A;  4LQG A;  4A38 A;  2ZEH A;  1CBX A;  2Q43 A;  3V7Z A;  3ISZ A;  1ELL P;  1LFW A;  3MRU A;  3B3T A;  1XRY A;  1Z8L A;  3TC8 A;  3NH4 A;  2GLF A;  1DTD A;  4FUU A;  5K8N A;  3H8G A;  1ARL A;  2VL1 A;  1ELM P;  4OIW A;  4P6Y A;  2IQ6 A;  3D7G A;  2PJB A;  2EWB A;  7CPA A;  4MCQ A;  1LOK A;  3KR4 A;  1ZG7 A;  4WWV A;  3I1U A;  2BCO A;  3MN8 A;  2FVG A;  2Q51 A;  5LYD A;  3PB4 X;  1ZLH A;  1HEE A;  5HVG A;  4Q7A A;  2O53 A;  3IEH A;  1VHO A;  3PB7 X;  4R76 A;  3PBE A;  3GB0 A;  3WAB A;  1NSA A;  3H8E A;  1YLO A;  2PJ7 A;  1XBU A;  3WC5 A;  2RB7 A;  2IJZ A;  4NGM A;  3WT4 A;  3CPX A;  5THW A;  3PFE A;  4ONW A;  1FT7 A;  1LAM A;  4W9Y A;  2CF4 A;  2I3C A;  5LRJ A;  4YU9 A;  3D66 A;  4FAI A;  1TXR A;  4TWE A;  5J1Q A;  1F2O A;  3SJX A;  1PCA A;  1M4L A;  1EE3 P;  1VHE A;  2RFH A;  4P4E A;  4KSI A;  3B7I A;  2PJ4 A;  2F8H A;  2PRQ A;  2F7V A;  4MHP A;  2GU2 A;  3D7H A;  4ZY1 A;  1ZG9 A;  1Z2L A;  3FEE A;  3KL9 A;  2C6C A;  4EME A;  3IIB A;  1YW6 A;  2ZEM A;  4MCP A;  1IGB A;  1VIX A;  1TKF A;  3S9N A;  3JRU A;  2ZEP A;  4P4F A;  2PVW A;  4OC5 A;  3KAS A;  4MRI A;  3KGQ A;  4UIB A;  4PXC A;  5JM6 A;  2J9A A;  4OP4 A;  1AMP A;  2XEF A;  3B3C A;  2CTC A;  4ZYQ A;  2PCU A;  2PJC A;  3D7D A;  5D8N A;  3S9L A;  3WC7 A;  2AFZ A;  3FEC A;  2ZED A;  2JBJ A;  4ZY0 A;  4P4I A;  3KHX A;  3BHX A;  5I4M A;  3SI1 A;  1CP7 A;  2NYQ A;  5F09 A;  3SJE A;  3RAM A;  3PB9 X;  5K8O A;  2GRE A;  4DUK A;  2QYV A;  4Z65 A;  4OC3 A;  1R3N A;  1BPN A;  4DYO A;  4OC2 A;  2XEG A;  4MHY A;  3KHZ A;  2QVP A;  2WYR A;  3LMS A;  3RZA A;  1TKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...