3SI0A

Structure of glycosylated human glutaminyl cyclase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
324
structure length
314
Chain Sequence
EEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFNNRVFVGATDSAVPCAMMLELARALDKKLLSLKDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutaminyl-peptide cyclotransferase
publication title Structures of Glycosylated Mammalian Glutaminyl Cyclases Reveal Conformational Variability near the Active Center.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 314
sequence length 324
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3si0A00
3WC7A 3IO1A 2QVPA 1ZG9A 3GB0A 1JQGA 1ZLIA 1ZG8A 3SI0A 1CP6A 1TXRA 2V8DA 5JH9A 3IC1A 2JBJA 2FVGA 3LWUA 2GLJA 2JEWA 2GLFA 1PYTB 3PB6X 4PXEA 4EFDA 3JRUA 2AFWA 2AFMA 2PJ8A 2ZOGA 4UIBA 1M4LA 2PJCA 3SJXA 2RB7A 2Q51A 4UEZA 4W9YA 2PJ1A 1YSJA 2WYRA 3KHZA 2QJ8A 5K8PA 3D67A 2NYQA 1CPXA 4P4EA 1PCAA 1CPSA 3B3WA 3ISZA 2V8GA 2F7VA 3B3TA 5I4MA 4OP4A 5LYDA 2PRQA 4EMEA 3FVLA 3BI1A 3K9TA 4ZY1A 4P44A 1LOKA 1ARMA 5LRJA 1FT7A 1LAPA 3K2KA 4G1PA 1LANA 4MHPA 5K8OA 3N5FA 4NGMA 3B3VA 4IK2A 3KGQA 3FJUA 1AYEA 1Y7EA 3VH9A 2AFOA 1Y0YA 4EWTA 1BPNA 2HC9A 4MCPA 1QMUA 2IMOA 3PFEA 1F57A 1TKHA 2ZEFA 3TX8A 3D7FA 1VIXA 3CT9A 4GM5A 1ZLHA 2IJZA 2ZOFA 4TWEA 1F2PA 1GYTA 3NA6A 5J1QA 1ARLA 1ELLP 5DS0A 4F9UA 1H8LA 1CX8A 2CIJA 1F2OA 2O53A 4WWVA 3D7HA 1TKFA 3KR5A 2ZELA 4MCRA 4X2TA 5JM6A 3S9MA 3SI2A 2V77A 4PQAA 1TF9A 4TNUA 2QYVA 3I1UA 3KI9A 3D4UA 4MCSA 4CPAA 1OBRA 2XEGA 3PB8X 3VARA 3PFOA 1R43A 2JBKA 4PXDA 1YW4A 1LAMA 4OIDA 2C1CA 4MXUA 4DJLA 4Z65A 1FNOA 4A37A 2AFUA 4RUHA 3B3SA 1EE3P 2ZEMA 4FWUA 5HVFA 4OC0A 3FH4A 4DYOA 3VATA 1XFOA 2PJ3A 1NSAA 5LRGA 5IB9A 1BLLE 4OC3A 4PPZA 3CDXA 1YMEA 4IAVA 3S9LA 1ZG7A 2I3CA 4A94A 1XBUA 4MHZA 5HVGA 3H8FA 4NGTA 2IQ6A 2PIYA 3WABA 4MMOA 4FBEA 1IY7A 2PJBA 5LRKA 5CBMA 4NGPA 4R76A 3BI0A 2ZEOA 1Z5RA 5LYFA 4X8IA 1TKJA 4OKOA 4OC2A 4UF4A 3TC8A 1VGYA 4R6TA 2ZEHA 3B35A 3FX6A 4KSIA 2BO9A 3V7ZA 3KQXA 3GUXA 4ZX9A 1AMPA 2BCOA 4AXVA 3FMCA 1TF8A 4NGNA 2ZEEA 3IWWA 3T8WA 1YLOA 2CTBA 1Z8LA 5D8NA 4K3NA 4IHMA 4LQGA 4P6YA 2PJAA 1BAVA 4NJRA 2J9AA 3D68A 5CPAA 2EK9A 2DEAA 4ZY2A 3MRUA 4Q7AA 2WZNA 2PJ4A 2PJ7A 3L2NA 2ZEPA 4NGQA 2PJ2A 4OC4A 5K8NA 2XEFA 2O4HA 2HB6A 4A38A 4BD9A 3HLPA 3PB7X 3LMSA 4DUKA 1CP7A 2NSMA 1QQ9A 3KR4A 4P45A 1Y0RA 2C6PA 3HUVA 4PXBA 1HEEA 5K8MA 2C6GA 5LYIA 4OC1A 4F9VA 4O23A 4YU9A 3KQZA 2F8HA 3KHXA 1XRYA 4FUUA 4P10A 2GU2A 3B2YA 1R3NA 3SI1A 1UWYA 1Z2LA 1VHOA 2PIZA 1HDUA 1ELMP 3B7IA 2POKA 4X3RA 5HVHA 2ANPA 4NGRA 3RBUA 2Q43A 2V8HA 3PB9X 3KASA 3IEHA 3CPAA 1Q7LA 3D7GA 2Q4ZA 4A39A 1DE4C 3DLJA 2GREA 2V8VA 5HXDA 6CPAA 3RZAA 2BOAA 3PEIA 4NGSA 2EWBA 1YW6A 4NFRA 4R7MA 4P4JA 2PJ6A 3IIBA 4P4BA 4F8ZA 4ZX8A 3H8GA 4UEEA 2PVVA 3FEEA 4NJQA 2ZENA 2XEIA 4ONWA 3WC5A 4OC5A 4ZI6A 2PCUA 3WT4A 5LYLA 4B6ZA 2EK8A 4MRIA 4UIAA 1LFWA 3PRTA 4R8FA 2XEJA 2ZEDA 2PE3A 3QNVA 1IGBA 3KL9A 1DTDA 3SJGA 4ZYQA 3NH8A 2RFHA 1LCPA 3NH4A 4P4IA 4MCQA 3B3CA 3BXMA 8CPAA 4P4DA 1CBXA 1KWMA 5JGFA 2OR4A 3NH5A 3FECA 3FEDA 2G9DA 3D7DA 4UEFA 1CG2A 2ZEGA 2CF4A 5THWA 3ISXA 2CTCA 4ZY0A 4MHYA 3RAMA 4YWYA 5ELYA 3BHXA 4P4FA 3PBEA 3WC6A 3CPXA 4JYWA 3D66A 3DGVA 1RTQA 4PXCA 4JZ0A 1HDQA 4MHNA 2AFZA 1XMBA 3FF3A 3GLJA 2PJ9A 3SJEA 2OOTA 3KZWA 3IFEA 5D29A 4WJBA 3IJ3A 3V38A 1VHEA 1BPMA 2PVWA 4OIWA 3MN8A 3NFZA 3PBBA 4FAIA 4OMEA 2ABZA 2VL1A 3H8EA 5F09A 2C6CA 7CPAA 3PB4X 3SJFA 2AFSA 3S9NA 4H2KA 1XJOA 2AFXA 2PJ5A 2PJ0A
chains in the Genus database with same CATH superfamily
2Z11A 1IU8A 4FD6A 3WC7A 4MY0A 4AVAA 3IO1A 5C88A 2QVPA 3A9LA 1ZG9A 3GB0A 2WUUA 1JQGA 1ZLIA 3BJ8A 4J3GA 1ZG8A 4QVTA 3SI0A 1CP6A 2B4DA 1TXRA 2P0WA 2OU2A 2V8DA 3IWGA 4KOYA 2Q0YA 2REEA 4MFLA 5JH9A 1TIQA 3IC1A 2JBJA 1LRZA 2FVGA 2YNDA 3FB3A 4MFKA 4AVBA 4CYPA 3LWUA 2GLJA 2JEWA 1RO5A 2GLFA 1PYTB 3PB6X 4MY3A 4R3KA 4UA3A 1M4GA 4PXEA 3R9EA 4EFDA 5F48A 4H89A 3JRUA 4KS9A 4NEXA 2AFWA 2AFMA 5ISVA 2Z3NA 2PJ8A 1KUYA 2ZOGA 4CRYB 4UIBA 1M4LA 1IYKA 1Y9KA 1A2ZA 4U9YA 2YNCA 4NF1A 4AG9A 4XPDB 5G22A 2PJCA 2YNCC 3OWCA 3SJXA 4C2XA 2RB7A 1L0CA 2Q51A 3P2FA 4UEZA 4W9YA 4L8AA 5EBVA 4RS2A 2PJ1A 4CS0B 1YSJA 4EVYA 1OZPA 2WYRA 3KHZA 2VZYA 4OADA 4CAFA 3ZJ0A 2QJ8A 2BL1A 2RC4A 2CNMA 4QBJA 2Q4YA 5K8PA 3D67A 4CGOA 2NYQA 2PQ8A 3TE4A 2QMLA 1CPXA 1PUAA 4P4EA 1PCAA 4CAWA 1CPSA 3B3WA 3ISZA 1N71A 2V8GA 4CGNA 2F7VA 2OB0A 4U5YA 2Z3KA 5KTDA 5A28A 3B3TA 5I4MA 2Y0MA 4OP4A 1P4NA 3JTKA 4KVOE 1BOBA 1NE9A 4KLVA 4ORFA 4H6UA 4R3LA 4UFWA 4C68A 2R7HA 5LYDA 2PRQA 3F8KA 1YK3A 4EMEA 3FVLA 3BI1A 3D2MA 3JVNA 5E96A 2Z10A 3K9TA 1YX0A 4M3SA 4ZY1A 2IL4A 5KTCA 4E8OA 4P44A 1LOKA 1ARMA 2FL4A 3SXNA 4ZGYB 5LRJA 2BEIA 4XNHB 1M4IA 1FT7A 5J8FA 1LAPA 3K2KA 2K5TA 3FNCA 3G8WA 4G1PA 1LANA 2KCWA 4MHPA 5K8OA 1Q2YA 3DSBA 3N5FA 2HV2A 2WPXA 4NGMA 2FIAA 2GANA 3B3VA 1WWZA 4IK2A 3EFAA 3KGQA 3TO7A 3FJUA 4B13A 1AYEA 1Y7EA 3P2HA 3VH9A 1QSNA 2AFOA 1Y0YA 4EWTA 1GHEA 3KKWA 4AG7A 1BPNA 2HC9A 4MCPA 1QMUA 2ATRA 2IMOA 3PFEA 1F57A 1TKHA 3TOBA 4KLWA 2ZEFA 3S6HA 4UCPA 3D7FA 3TTHA 3EY5A 3TX8A 1VIXA 3CT9A 4GM5A 2G0BA 1CM0A 1ZLHA 2F5IA 1MJ9A 2IJZA 1YQEA 2ODFA 2ZOFA 4TWEA 1F2PA 1GYTA 2HUZA 3NA6A 2OZHA 5J1QA 1M4DA 4IUSA 1ARLA 1B6BA 1ELLP 2R1IA 1H8LA 5DS0A 1CX8A 4F9UA 2CIJA 1F2OA 4Q38A 5DWMA 1Z8TA 2O53A 4WWVA 1XOVA 1TKFA 3D7HA 3KR5A 4KOSA 4R87A 2ZELA 1ON0A 4MCRA 4X2TA 5JM6A 1V0CA 5F49A 4M85A 3S9MA 4A2ZA 3SI2A 3QB8A 2V77A 3BJ7A 4PQAA 3BLNA 3TT2A 1TF9A 1VKCA 2QYVA 3CXSA 2GE3A 1B87A 2OH1A 3I1UA 4TNUA 5AG6A 3ZZIA 1I1DA 2PR1A 3D4UA 3KI9A 1IIDA 4JWPA 4DNCA 4CGLA 4MCSA 4CPAA 1OBRA 1S7LA 2REFA 4U9ZA 2XEGA 4UFVA 1IOFA 2Z3OA 3PB8X 5IX3A 4XPDC 3VARA 3PFOA 1R43A 1YGHA 2JBKA 1QSMA 4PXDA 3T9YA 4BBHA 1AUGA 4ONUA 2FSRA 3SHPA 4L89A 1YW4A 3B8GA 1LAMA 4OIDA 2C1CA 4MXUA 4F0XA 4DJLA 4Z65A 1P0HA 1FNOA 1Z8XA 2C27A 1K4JA 1Q2CA 3DNSA 4A37A 2AFUA 4RUHA 4HNXB 4UCMA 5I0CA 2CNSA 4CYQA 3B3SA 1EE3P 3D8PA 3EC4A 2ZEMA 2OZUA 4GXHA 4FWUA 4M6GA 5HVFA 3VWEA 4CAVA 4OC0A 3F0AA 3FH4A 4DYOA 3VATA 1XFOA 4Y49B 5AG4A 5GCNA 5HMNA 2D4OA 2ZPAA 2B4BA 4B5OA 4Q36A 2PJ3A 1NSAA 4JD6A 4CAXA 1IB1E 3LODA 1XE4A 3QAHA 4CYOA 5LRGA 1XEBA 1R57A 2VQYA 3CXPA 1XF8A 2YNEA 2JDCA 2Z3MA 5IB9A 1BLLE 4OC3A 4PPZA 3CDXA 3IU1A 3S6FA 1YMEA 4KORA 4M6IA 4IAVA 1MJAA 3S9LA 2CXAA 3S6GA 4HPSA 1S5KA 1ZG7A 2EBJA 2I3CA 3FRMA 4JLYA 4XNHC 4A94A 4M6HA 1XBUA 1KUVA 1XMTA 3I9SA 2Q4VA 1FY7A 1MJBA 3IWEA 3H8FA 4HKFA 3TOAA 4B10A 1YREA 4NGTA 5HVGA 2IQ6A 4X5KA 2GIVA 2PIYA 3WABA 2DF5A 2VXKA 4MMOA 4FBEA 4MI4A 1IY7A 1QSTA 4NSQA 2PJBA 4JXQA 4B11A 4CRZB 5LRKA 5CBMA 4NGPA 4MHDA 4R76A 4IF5A 4C2YA 3BI0A 1UFHA 2ZEOA 3TFYA 1Z5RA 2J8RA 3FYNA 2JDDA 5LYFA 4X8IA 2FS5A 1TKJA 4B12A 4OKOA 4MFQA 4OC2A 4UF4A 3TC8A 1VGYA 3H5ZA 4R6TA 1X10A 2R8VA 2ZEHA 3B35A 1QSRA 1NSLA 3FX6A 4KSIA 2BO9A 2OZGA 2HQYA 3V7ZA 2J8MA 3GYAA 3KQXA 3GUXA 5EMIA 4ZX9A 1ZO0A 1AMPA 4YGOA 2I00A 3RNZA 4XPKA 4NCZA 2BCOA 3IU2A 3W6XA 3EXNA 3W6SA 4AXVA 3FMCA 1TF8A 4NGNA 2ZEEA 3IWWA 3T8WA 3CZXA 1YLOA 2CTBA 2NMTA 1Z8LA 5D8NA 4K3NA 3RYOA 2JEVA 4E0AA 3I3GA 1Y7RA 1S7FA 4IHMA 4LQGA 2FXFA 1IICA 4P6YA 4KSAA 2AJ6A 2PJAA 1BAVA 4KVXA 5HH1A 2BUEA 4NJRA 4AVCA 2J9AA 3PGPA 4F6AA 3D68A 5CPAA 3R9FA 2EK9A 2DEAA 4FD5A 4A95A 5JQ4A 4YRHA 1CJWA 4ZY2A 1I21A 3MRUA 4Q7AA 2YGWA 1IYLA 3K9UA 5CNPA 3TO9A 4BMHA 1YR0A 4R9MA 2WSAA 3CXQA 2WZNA 3LACA 4A32A 2PJ4A 2PJ7A 3L2NA 2ZEPA 4ZBGA 4NGQA 2PJ2A 3D2PA 4OC4A 2FT0A 2G3AA 5K8NA 2XEFA 2O4HA 2HB6A 4UBRA 4A38A 4KOVA 4BD9A 5H84A 3HLPA 3PB7X 4C2ZA 3LMSA 4DUKA 1CP7A 3FIXA 2NSMA 4MBUA 4YFJA 4HNWB 1QQ9A 4KOWA 3GKRA 4RN7A 3KR4A 3F5BA 1Z4RA 3R1KA 1YLEA 1YVKA 3JUWA 3TCVA 1RXTA 3FBUA 4KVME 4P45A 1Y0RA 1S3ZA 2C6PA 1X12A 1VHSA 4R57A 4C7HA 3HUVA 4Y49C 4MFZA 4PXBA 1HEEA 2Q7SA 5K8MA 5H86A 2Z3PA 2C6GA 4QUSA 4I49A 5LYIA 3DDDA 4OC1A 3W91A 4O23A 4YU9A 4F9VA 4QB9A 3KQZA 1NMTA 2F8HA 3E0KA 3KHXA 4GS4A 3S6KA 5A27A 1XRYA 4FUUA 2P6EA 4UWJA 5JPHA 4P10A 2GU2A 2QIRA 3B2YA 2P6GA 1R3NA 3SI1A 1UWYA 1SQHA 1Z2LA 1VHOA 2PIZA 1HDUA 1S7NA 2PDOA 4UWIA 4C7IA 1PU9A 2Z0ZA 1ELMP 3B7IA 5G20A 2GFQA 2POKA 4X3RA 5HVHA 5J8CA 4KOXA 2Q44A 2JLMA 2ANPA 1S60A 2Q43A 4NGRA 2CY2A 2V8HA 3KASA 3PB9X 3RBUA 4A31A 3IEHA 3CPAA 1Q7LA 2B3UA 3D7GA 2Q4ZA 2EVNA 4A39A 1DE4C 3DLJA 2GREA 2V8VA 2B5GB 5HXDA 6CPAA 3RZAA 5F46A 2BOAA 4KSFA 5IV0A 3PEIA 2B58A 4NGSA 4UCNA 2EWBA 1YW6A 2DPTA 4NFRA 4R7MA 3C26A 4B14A 4P4JA 2ZW6A 1MK4A 1Y9WA 2PJ6A 4H6ZA 4XPLA 2VI7A 3R96A 3IIBA 4CGMA 4P4BA 4F8ZA 4ZX8A 4PSWA 3H8GA 4UEEA 1Q2DA 2PVVA 3FEEA 4NJQA 4MFJA 2ZENA 2XEIA 2B3VA 4KOUA 3NE8A 4ONWA 4OC5A 2ARHA 2VBQA 2ZW7A 3WC5A 3RO0A 2DPSA 1M44A 2O28A 3EO4A 3TO6A 4ZI6A 4FD7A 1U6MA 3V8IA 2PCUA 2X7BA 3WT4A 1KZFA 4B5PB 5IB0A 4B6ZA 5LYLA 2EK8A 4II9A 4LX9A 4A30A 4MRIA 4NXYA 4UIAA 1LFWA 3PRTA 2ZW5A 5F47A 4R8FA 4AB7A 2XEJA 5AGEA 2B4DB 4KZTA 2BSWA 2ZEDA 2AE6A 2PE3A 3G3SA 3QNVA 4KUAA 1IGBA 3KL9A 1I12A 1DTDA 1Z8WA 3SJGA 4ZYQA 3NH8A 2RFHA 1LCPA 3NH4A 4P4IA 3NE7A 3B3CA 3BXMA 4LQ6A 4MCQA 3R9GA 4HNYB 3H4QA 2FCKA 5AG5A 8CPAA 1JWQA 2G3TA 4P4DA 1BO4A 1CBXA 1KWMA 3QAYA 5JGFA 5KTAA 4FD4A 2DXQA 2OR4A 3NH5A 4PSXA 3DR6A 3FECA 3IGRA 3PP9A 3FEDA 2A4NA 4CAEA 4K30A 2G9DA 3GIUA 3D7DA 4PV6A 4UEFA 1KUXA 1CG2A 2ZEGA 2CF4A 4QC6A 4JXRA 5THWA 4E2AA 5C82A 3ISXA 2CTCA 1Z4EA 2CNTA 4BINA 4ZY0A 3D3SA 2ZW4A 2FE7A 4MHYA 3RAMA 3WR7A 4RI1A 4YWYA 3FXTA 5EC4A 5ELYA 3BHXA 4P4FA 2QECA 2EO8A 3PBEA 1QSOA 3UY5A 3WC6A 3CPXA 3SXOA 3T90A 4JYWA 3GY9A 3D66A 1YVOA 1RTQA 3DGVA 2D4PA 4PXCA 4JZ0A 1HDQA 4MJ8A 2WPWA 2AFZA 4MHNA 1XMBA 1S7KA 4OLLA 5DWNA 1WK4A 3FF3A 3GLJA 5FVJA 4F0YA 3DR8A 2PC1A 2PRBA 4UFXA 2PJ9A 4CGPA 4CYNA 4B5PA 3SJEA 2VZZA 4KUBA 2OOTA 3KZWA 3IFEA 5AG7A 3R95A 2PSWA 5G1ZA 2B5GA 4OAEA 5D29A 2PR8A 4WJBA 3VWDA 3IJ3A 5G21A 3V38A 1VHEA 1BPMA 1Z9UA 2PVWA 4LUAA 4MFPA 4PK2A 4OIWA 2Q04A 3MN8A 4JJXA 3NFZA 1IOIA 1J4JA 2ZXVA 3N7ZA 2I79A 2P6FA 3PBBA 4FAIA 4OMEA 2ABZA 3LD2A 2EUIA 2H5MA 2VL1A 3H8EA 2Q7BA 4A33A 2FIWA 3PZJA 2J8NA 3MGDA 5F09A 2C6CA 7CPAA 3PB4X 2VEZA 3SJFA 2AFSA 3S9NA 1XIXA 4H2KA 2Z3LA 2R98A 5BWAB 1XJOA 1M1DA 4KOTA 2AFXA 4PK3A 4MHZA 2PJ5A 2PJ0A
chains in the Genus database with same CATH topology
3WC7A 3IO1A 2QVPA 1ZG9A 3GB0A 1JQGA 1ZLIA 1ZG8A 3SI0A 1CP6A 1TXRA 2V8DA 5JH9A 3IC1A 2JBJA 2FVGA 3LWUA 2GLJA 2JEWA 2GLFA 1PYTB 3PB6X 4PXEA 4EFDA 3JRUA 2AFWA 2AFMA 2PJ8A 2ZOGA 4UIBA 1M4LA 2PJCA 3SJXA 2RB7A 2Q51A 4UEZA 4W9YA 2PJ1A 1YSJA 2WYRA 3KHZA 2QJ8A 5K8PA 3D67A 2NYQA 1CPXA 4P4EA 1PCAA 1CPSA 3B3WA 3ISZA 2V8GA 2F7VA 3B3TA 5I4MA 4OP4A 5LYDA 2PRQA 4EMEA 3FVLA 3BI1A 3K9TA 4ZY1A 4P44A 1LOKA 1ARMA 5LRJA 1FT7A 1LAPA 3K2KA 4G1PA 1LANA 4MHPA 5K8OA 3N5FA 4NGMA 3B3VA 4IK2A 3KGQA 3FJUA 1AYEA 1Y7EA 3VH9A 2AFOA 1Y0YA 4EWTA 1BPNA 2HC9A 4MCPA 1QMUA 2IMOA 3PFEA 1F57A 1TKHA 2ZEFA 3TX8A 3D7FA 1VIXA 3CT9A 4GM5A 1ZLHA 2IJZA 2ZOFA 4TWEA 1F2PA 1GYTA 3NA6A 5J1QA 1ARLA 1ELLP 5DS0A 4F9UA 1H8LA 1CX8A 2CIJA 1F2OA 2O53A 4WWVA 3D7HA 1TKFA 3KR5A 2ZELA 4MCRA 4X2TA 5JM6A 3S9MA 3SI2A 2V77A 4PQAA 1TF9A 4TNUA 2QYVA 3I1UA 3KI9A 3D4UA 4MCSA 4CPAA 1OBRA 2XEGA 3PB8X 3VARA 3PFOA 1R43A 2JBKA 4PXDA 1YW4A 1LAMA 4OIDA 2C1CA 4MXUA 4DJLA 4Z65A 1FNOA 4A37A 2AFUA 4RUHA 3B3SA 1EE3P 2ZEMA 4FWUA 5HVFA 4OC0A 3FH4A 4DYOA 3VATA 1XFOA 2PJ3A 1NSAA 5LRGA 5IB9A 1BLLE 4OC3A 4PPZA 3CDXA 1YMEA 4IAVA 3S9LA 1ZG7A 2I3CA 4A94A 1XBUA 4MHZA 5HVGA 3H8FA 4NGTA 2IQ6A 2PIYA 3WABA 4MMOA 4FBEA 1IY7A 2PJBA 5LRKA 5CBMA 4NGPA 4R76A 3BI0A 2ZEOA 1Z5RA 5LYFA 4X8IA 1TKJA 4OKOA 4OC2A 4UF4A 3TC8A 1VGYA 4R6TA 2ZEHA 3B35A 3FX6A 4KSIA 2BO9A 3V7ZA 3KQXA 3GUXA 4ZX9A 1AMPA 2BCOA 4AXVA 3FMCA 1TF8A 4NGNA 2ZEEA 3IWWA 3T8WA 1YLOA 2CTBA 1Z8LA 5D8NA 4K3NA 4IHMA 4LQGA 4P6YA 2PJAA 1BAVA 4NJRA 2J9AA 3D68A 5CPAA 2EK9A 2DEAA 4ZY2A 3MRUA 4Q7AA 2WZNA 2PJ4A 2PJ7A 3L2NA 2ZEPA 4NGQA 2PJ2A 4OC4A 5K8NA 2XEFA 2O4HA 2HB6A 4A38A 4BD9A 3HLPA 3PB7X 3LMSA 4DUKA 1CP7A 2NSMA 1QQ9A 3KR4A 4P45A 1Y0RA 2C6PA 3HUVA 4PXBA 1HEEA 5K8MA 2C6GA 5LYIA 4OC1A 4F9VA 4O23A 4YU9A 3KQZA 2F8HA 3KHXA 1XRYA 4FUUA 4P10A 2GU2A 3B2YA 1R3NA 3SI1A 1UWYA 1Z2LA 1VHOA 2PIZA 1HDUA 1ELMP 3B7IA 2POKA 4X3RA 5HVHA 2ANPA 4NGRA 3RBUA 2Q43A 2V8HA 3PB9X 3KASA 3IEHA 3CPAA 1Q7LA 3D7GA 2Q4ZA 4A39A 1DE4C 3DLJA 2GREA 2V8VA 5HXDA 6CPAA 3RZAA 2BOAA 3PEIA 4NGSA 2EWBA 1YW6A 4NFRA 4R7MA 4P4JA 2PJ6A 3IIBA 4P4BA 4F8ZA 4ZX8A 3H8GA 4UEEA 2PVVA 3FEEA 4NJQA 2ZENA 2XEIA 4ONWA 3WC5A 4OC5A 4ZI6A 2PCUA 3WT4A 5LYLA 4B6ZA 2EK8A 4MRIA 4UIAA 1LFWA 3PRTA 4R8FA 2XEJA 2ZEDA 2PE3A 3QNVA 1IGBA 3KL9A 1DTDA 3SJGA 4ZYQA 3NH8A 2RFHA 1LCPA 3NH4A 4P4IA 4MCQA 3B3CA 3BXMA 8CPAA 4P4DA 1CBXA 1KWMA 5JGFA 2OR4A 3NH5A 3FECA 3FEDA 2G9DA 3D7DA 4UEFA 1CG2A 2ZEGA 2CF4A 5THWA 3ISXA 2CTCA 4ZY0A 4MHYA 3RAMA 4YWYA 5ELYA 3BHXA 4P4FA 3PBEA 3WC6A 3CPXA 4JYWA 3D66A 3DGVA 1RTQA 4PXCA 4JZ0A 1HDQA 4MHNA 2AFZA 1XMBA 3FF3A 3GLJA 2PJ9A 3SJEA 2OOTA 3KZWA 3IFEA 5D29A 4WJBA 3IJ3A 3V38A 1VHEA 1BPMA 2PVWA 4OIWA 3MN8A 3NFZA 3PBBA 4FAIA 4OMEA 2ABZA 2VL1A 3H8EA 5F09A 2C6CA 7CPAA 3PB4X 3SJFA 2AFSA 3S9NA 4H2KA 1XJOA 2AFXA 2PJ5A 2PJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WC7 A;  3IO1 A;  2QVP A;  1ZG9 A;  3GB0 A;  1JQG A;  1ZLI A;  1ZG8 A;  3SI0 A;  1CP6 A;  1TXR A;  2V8D A;  5JH9 A;  3IC1 A;  2JBJ A;  2FVG A;  3LWU A;  2GLJ A;  2JEW A;  2GLF A;  1PYT B;  3PB6 X;  4PXE A;  4EFD A;  3JRU A;  2AFW A;  2AFM A;  2PJ8 A;  2ZOG A;  4UIB A;  1M4L A;  2PJC A;  3SJX A;  2RB7 A;  2Q51 A;  4UEZ A;  4W9Y A;  2PJ1 A;  1YSJ A;  2WYR A;  3KHZ A;  2QJ8 A;  5K8P A;  3D67 A;  2NYQ A;  1CPX A;  4P4E A;  1PCA A;  1CPS A;  3B3W A;  3ISZ A;  2V8G A;  2F7V A;  3B3T A;  5I4M A;  4OP4 A;  5LYD A;  2PRQ A;  4EME A;  3FVL A;  3BI1 A;  3K9T A;  4ZY1 A;  4P44 A;  1LOK A;  1ARM A;  5LRJ A;  1FT7 A;  1LAP A;  3K2K A;  4G1P A;  1LAN A;  4MHP A;  5K8O A;  3N5F A;  4NGM A;  3B3V A;  4IK2 A;  3KGQ A;  3FJU A;  1AYE A;  1Y7E A;  3VH9 A;  2AFO A;  1Y0Y A;  4EWT A;  1BPN A;  2HC9 A;  4MCP A;  1QMU A;  2IMO A;  3PFE A;  1F57 A;  1TKH A;  2ZEF A;  3TX8 A;  3D7F A;  1VIX A;  3CT9 A;  4GM5 A;  1ZLH A;  2IJZ A;  2ZOF A;  4TWE A;  1F2P A;  1GYT A;  3NA6 A;  5J1Q A;  1ARL A;  1ELL P;  5DS0 A;  4F9U A;  1H8L A;  1CX8 A;  2CIJ A;  1F2O A;  2O53 A;  4WWV A;  3D7H A;  1TKF A;  3KR5 A;  2ZEL A;  4MCR A;  4X2T A;  5JM6 A;  3S9M A;  3SI2 A;  2V77 A;  4PQA A;  1TF9 A;  4TNU A;  2QYV A;  3I1U A;  3KI9 A;  3D4U A;  4MCS A;  4CPA A;  1OBR A;  2XEG A;  3PB8 X;  3VAR A;  3PFO A;  1R43 A;  2JBK A;  4PXD A;  1YW4 A;  1LAM A;  4OID A;  2C1C A;  4MXU A;  4DJL A;  4Z65 A;  1FNO A;  4A37 A;  2AFU A;  4RUH A;  3B3S A;  1EE3 P;  2ZEM A;  4FWU A;  5HVF A;  4OC0 A;  3FH4 A;  4DYO A;  3VAT A;  1XFO A;  2PJ3 A;  1NSA A;  5LRG A;  5IB9 A;  1BLL E;  4OC3 A;  4PPZ A;  3CDX A;  1YME A;  4IAV A;  3S9L A;  1ZG7 A;  2I3C A;  4A94 A;  1XBU A;  4MHZ A;  5HVG A;  3H8F A;  4NGT A;  2IQ6 A;  2PIY A;  3WAB A;  4MMO A;  4FBE A;  1IY7 A;  2PJB A;  5LRK A;  5CBM A;  4NGP A;  4R76 A;  3BI0 A;  2ZEO A;  1Z5R A;  5LYF A;  4X8I A;  1TKJ A;  4OKO A;  4OC2 A;  4UF4 A;  3TC8 A;  1VGY A;  4R6T A;  2ZEH A;  3B35 A;  3FX6 A;  4KSI A;  2BO9 A;  3V7Z A;  3KQX A;  3GUX A;  4ZX9 A;  1AMP A;  2BCO A;  4AXV A;  3FMC A;  1TF8 A;  4NGN A;  2ZEE A;  3IWW A;  3T8W A;  1YLO A;  2CTB A;  1Z8L A;  5D8N A;  4K3N A;  4IHM A;  4LQG A;  4P6Y A;  2PJA A;  1BAV A;  4NJR A;  2J9A A;  3D68 A;  5CPA A;  2EK9 A;  2DEA A;  4ZY2 A;  3MRU A;  4Q7A A;  2WZN A;  2PJ4 A;  2PJ7 A;  3L2N A;  2ZEP A;  4NGQ A;  2PJ2 A;  4OC4 A;  5K8N A;  2XEF A;  2O4H A;  2HB6 A;  4A38 A;  4BD9 A;  3HLP A;  3PB7 X;  3LMS A;  4DUK A;  1CP7 A;  2NSM A;  1QQ9 A;  3KR4 A;  4P45 A;  1Y0R A;  2C6P A;  3HUV A;  4PXB A;  1HEE A;  5K8M A;  2C6G A;  5LYI A;  4OC1 A;  4F9V A;  4O23 A;  4YU9 A;  3KQZ A;  2F8H A;  3KHX A;  1XRY A;  4FUU A;  4P10 A;  2GU2 A;  3B2Y A;  1R3N A;  3SI1 A;  1UWY A;  1Z2L A;  1VHO A;  2PIZ A;  1HDU A;  1ELM P;  3B7I A;  2POK A;  4X3R A;  5HVH A;  2ANP A;  4NGR A;  3RBU A;  2Q43 A;  2V8H A;  3PB9 X;  3KAS A;  3IEH A;  3CPA A;  1Q7L A;  3D7G A;  2Q4Z A;  4A39 A;  1DE4 C;  3DLJ A;  2GRE A;  2V8V A;  5HXD A;  6CPA A;  3RZA A;  2BOA A;  3PEI A;  4NGS A;  2EWB A;  1YW6 A;  4NFR A;  4R7M A;  4P4J A;  2PJ6 A;  3IIB A;  4P4B A;  4F8Z A;  4ZX8 A;  3H8G A;  4UEE A;  2PVV A;  3FEE A;  4NJQ A;  2ZEN A;  2XEI A;  4ONW A;  3WC5 A;  4OC5 A;  4ZI6 A;  2PCU A;  3WT4 A;  5LYL A;  4B6Z A;  2EK8 A;  4MRI A;  4UIA A;  1LFW A;  3PRT A;  4R8F A;  2XEJ A;  2ZED A;  2PE3 A;  3QNV A;  1IGB A;  3KL9 A;  1DTD A;  3SJG A;  4ZYQ A;  3NH8 A;  2RFH A;  1LCP A;  3NH4 A;  4P4I A;  4MCQ A;  3B3C A;  3BXM A;  8CPA A;  4P4D A;  1CBX A;  1KWM A;  5JGF A;  2OR4 A;  3NH5 A;  3FEC A;  3FED A;  2G9D A;  3D7D A;  4UEF A;  1CG2 A;  2ZEG A;  2CF4 A;  5THW A;  3ISX A;  2CTC A;  4ZY0 A;  4MHY A;  3RAM A;  4YWY A;  5ELY A;  3BHX A;  4P4F A;  3PBE A;  3WC6 A;  3CPX A;  4JYW A;  3D66 A;  3DGV A;  1RTQ A;  4PXC A;  4JZ0 A;  1HDQ A;  4MHN A;  2AFZ A;  1XMB A;  3FF3 A;  3GLJ A;  2PJ9 A;  3SJE A;  2OOT A;  3KZW A;  3IFE A;  5D29 A;  4WJB A;  3IJ3 A;  3V38 A;  1VHE A;  1BPM A;  2PVW A;  4OIW A;  3MN8 A;  3NFZ A;  3PBB A;  4FAI A;  4OME A;  2ABZ A;  2VL1 A;  3H8E A;  5F09 A;  2C6C A;  7CPA A;  3PB4 X;  3SJF A;  2AFS A;  3S9N A;  4H2K A;  1XJO A;  2AFX A;  2PJ5 A;  2PJ0 A; 
#chains in the Genus database with same CATH topology
 2Z11 A;  1IU8 A;  4FD6 A;  3WC7 A;  4MY0 A;  4AVA A;  3IO1 A;  5C88 A;  2QVP A;  3A9L A;  1ZG9 A;  3GB0 A;  2WUU A;  1JQG A;  1ZLI A;  3BJ8 A;  4J3G A;  1ZG8 A;  4QVT A;  3SI0 A;  1CP6 A;  2B4D A;  1TXR A;  2P0W A;  2OU2 A;  2V8D A;  3IWG A;  4KOY A;  2Q0Y A;  2REE A;  4MFL A;  5JH9 A;  1TIQ A;  3IC1 A;  2JBJ A;  1LRZ A;  2FVG A;  2YND A;  3FB3 A;  4MFK A;  4AVB A;  4CYP A;  3LWU A;  2GLJ A;  2JEW A;  1RO5 A;  2GLF A;  1PYT B;  3PB6 X;  4MY3 A;  4R3K A;  4UA3 A;  1M4G A;  4PXE A;  3R9E A;  4EFD A;  5F48 A;  4H89 A;  3JRU A;  4KS9 A;  4NEX A;  2AFW A;  2AFM A;  5ISV A;  2Z3N A;  2PJ8 A;  1KUY A;  2ZOG A;  4CRY B;  4UIB A;  1M4L A;  1IYK A;  1Y9K A;  1A2Z A;  4U9Y A;  2YNC A;  4NF1 A;  4AG9 A;  4XPD B;  5G22 A;  2PJC A;  2YNC C;  3OWC A;  3SJX A;  4C2X A;  2RB7 A;  1L0C A;  2Q51 A;  3P2F A;  4UEZ A;  4W9Y A;  4L8A A;  5EBV A;  4RS2 A;  2PJ1 A;  4CS0 B;  1YSJ A;  4EVY A;  1OZP A;  2WYR A;  3KHZ A;  2VZY A;  4OAD A;  4CAF A;  3ZJ0 A;  2QJ8 A;  2BL1 A;  2RC4 A;  2CNM A;  4QBJ A;  2Q4Y A;  5K8P A;  3D67 A;  4CGO A;  2NYQ A;  2PQ8 A;  3TE4 A;  2QML A;  1CPX A;  1PUA A;  4P4E A;  1PCA A;  4CAW A;  1CPS A;  3B3W A;  3ISZ A;  1N71 A;  2V8G A;  4CGN A;  2F7V A;  2OB0 A;  4U5Y A;  2Z3K A;  5KTD A;  5A28 A;  3B3T A;  5I4M A;  2Y0M A;  4OP4 A;  1P4N A;  3JTK A;  4KVO E;  1BOB A;  1NE9 A;  4KLV A;  4ORF A;  4H6U A;  4R3L A;  4UFW A;  4C68 A;  2R7H A;  5LYD A;  2PRQ A;  3F8K A;  1YK3 A;  4EME A;  3FVL A;  3BI1 A;  3D2M A;  3JVN A;  5E96 A;  2Z10 A;  3K9T A;  1YX0 A;  4M3S A;  4ZY1 A;  2IL4 A;  5KTC A;  4E8O A;  4P44 A;  1LOK A;  1ARM A;  2FL4 A;  3SXN A;  4ZGY B;  5LRJ A;  2BEI A;  4XNH B;  1M4I A;  1FT7 A;  5J8F A;  1LAP A;  3K2K A;  2K5T A;  3FNC A;  3G8W A;  4G1P A;  1LAN A;  2KCW A;  4MHP A;  5K8O A;  1Q2Y A;  3DSB A;  3N5F A;  2HV2 A;  2WPX A;  4NGM A;  2FIA A;  2GAN A;  3B3V A;  1WWZ A;  4IK2 A;  3EFA A;  3KGQ A;  3TO7 A;  3FJU A;  4B13 A;  1AYE A;  1Y7E A;  3P2H A;  3VH9 A;  1QSN A;  2AFO A;  1Y0Y A;  4EWT A;  1GHE A;  3KKW A;  4AG7 A;  1BPN A;  2HC9 A;  4MCP A;  1QMU A;  2ATR A;  2IMO A;  3PFE A;  1F57 A;  1TKH A;  3TOB A;  4KLW A;  2ZEF A;  3S6H A;  4UCP A;  3D7F A;  3TTH A;  3EY5 A;  3TX8 A;  1VIX A;  3CT9 A;  4GM5 A;  2G0B A;  1CM0 A;  1ZLH A;  2F5I A;  1MJ9 A;  2IJZ A;  1YQE A;  2ODF A;  2ZOF A;  4TWE A;  1F2P A;  1GYT A;  2HUZ A;  3NA6 A;  2OZH A;  5J1Q A;  1M4D A;  4IUS A;  1ARL A;  1B6B A;  1ELL P;  2R1I A;  1H8L A;  5DS0 A;  1CX8 A;  4F9U A;  2CIJ A;  1F2O A;  4Q38 A;  5DWM A;  1Z8T A;  2O53 A;  4WWV A;  1XOV A;  1TKF A;  3D7H A;  3KR5 A;  4KOS A;  4R87 A;  2ZEL A;  1ON0 A;  4MCR A;  4X2T A;  5JM6 A;  1V0C A;  5F49 A;  4M85 A;  3S9M A;  4A2Z A;  3SI2 A;  3QB8 A;  2V77 A;  3BJ7 A;  4PQA A;  3BLN A;  3TT2 A;  1TF9 A;  1VKC A;  2QYV A;  3CXS A;  2GE3 A;  1B87 A;  2OH1 A;  3I1U A;  4TNU A;  5AG6 A;  3ZZI A;  1I1D A;  2PR1 A;  3D4U A;  3KI9 A;  1IID A;  4JWP A;  4DNC A;  4CGL A;  4MCS A;  4CPA A;  1OBR A;  1S7L A;  2REF A;  4U9Z A;  2XEG A;  4UFV A;  1IOF A;  2Z3O A;  3PB8 X;  5IX3 A;  4XPD C;  3VAR A;  3PFO A;  1R43 A;  1YGH A;  2JBK A;  1QSM A;  4PXD A;  3T9Y A;  4BBH A;  1AUG A;  4ONU A;  2FSR A;  3SHP A;  4L89 A;  1YW4 A;  3B8G A;  1LAM A;  4OID A;  2C1C A;  4MXU A;  4F0X A;  4DJL A;  4Z65 A;  1P0H A;  1FNO A;  1Z8X A;  2C27 A;  1K4J A;  1Q2C A;  3DNS A;  4A37 A;  2AFU A;  4RUH A;  4HNX B;  4UCM A;  5I0C A;  2CNS A;  4CYQ A;  3B3S A;  1EE3 P;  3D8P A;  3EC4 A;  2ZEM A;  2OZU A;  4GXH A;  4FWU A;  4M6G A;  5HVF A;  3VWE A;  4CAV A;  4OC0 A;  3F0A A;  3FH4 A;  4DYO A;  3VAT A;  1XFO A;  4Y49 B;  5AG4 A;  5GCN A;  5HMN A;  2D4O A;  2ZPA A;  2B4B A;  4B5O A;  4Q36 A;  2PJ3 A;  1NSA A;  4JD6 A;  4CAX A;  1IB1 E;  3LOD A;  1XE4 A;  3QAH A;  4CYO A;  5LRG A;  1XEB A;  1R57 A;  2VQY A;  3CXP A;  1XF8 A;  2YNE A;  2JDC A;  2Z3M A;  5IB9 A;  1BLL E;  4OC3 A;  4PPZ A;  3CDX A;  3IU1 A;  3S6F A;  1YME A;  4KOR A;  4M6I A;  4IAV A;  1MJA A;  3S9L A;  2CXA A;  3S6G A;  4HPS A;  1S5K A;  1ZG7 A;  2EBJ A;  2I3C A;  3FRM A;  4JLY A;  4XNH C;  4A94 A;  4M6H A;  1XBU A;  1KUV A;  1XMT A;  3I9S A;  2Q4V A;  1FY7 A;  1MJB A;  3IWE A;  3H8F A;  4HKF A;  3TOA A;  4B10 A;  1YRE A;  4NGT A;  5HVG A;  2IQ6 A;  4X5K A;  2GIV A;  2PIY A;  3WAB A;  2DF5 A;  2VXK A;  4MMO A;  4FBE A;  4MI4 A;  1IY7 A;  1QST A;  4NSQ A;  2PJB A;  4JXQ A;  4B11 A;  4CRZ B;  5LRK A;  5CBM A;  4NGP A;  4MHD A;  4R76 A;  4IF5 A;  4C2Y A;  3BI0 A;  1UFH A;  2ZEO A;  3TFY A;  1Z5R A;  2J8R A;  3FYN A;  2JDD A;  5LYF A;  4X8I A;  2FS5 A;  1TKJ A;  4B12 A;  4OKO A;  4MFQ A;  4OC2 A;  4UF4 A;  3TC8 A;  1VGY A;  3H5Z A;  4R6T A;  1X10 A;  2R8V A;  2ZEH A;  3B35 A;  1QSR A;  1NSL A;  3FX6 A;  4KSI A;  2BO9 A;  2OZG A;  2HQY A;  3V7Z A;  2J8M A;  3GYA A;  3KQX A;  3GUX A;  5EMI A;  4ZX9 A;  1ZO0 A;  1AMP A;  4YGO A;  2I00 A;  3RNZ A;  4XPK A;  4NCZ A;  2BCO A;  3IU2 A;  3W6X A;  3EXN A;  3W6S A;  4AXV A;  3FMC A;  1TF8 A;  4NGN A;  2ZEE A;  3IWW A;  3T8W A;  3CZX A;  1YLO A;  2CTB A;  2NMT A;  1Z8L A;  5D8N A;  4K3N A;  3RYO A;  2JEV A;  4E0A A;  3I3G A;  1Y7R A;  1S7F A;  4IHM A;  4LQG A;  2FXF A;  1IIC A;  4P6Y A;  4KSA A;  2AJ6 A;  2PJA A;  1BAV A;  4KVX A;  5HH1 A;  2BUE A;  4NJR A;  4AVC A;  2J9A A;  3PGP A;  4F6A A;  3D68 A;  5CPA A;  3R9F A;  2EK9 A;  2DEA A;  4FD5 A;  4A95 A;  5JQ4 A;  4YRH A;  1CJW A;  4ZY2 A;  1I21 A;  3MRU A;  4Q7A A;  2YGW A;  1IYL A;  3K9U A;  5CNP A;  3TO9 A;  4BMH A;  1YR0 A;  4R9M A;  2WSA A;  3CXQ A;  2WZN A;  3LAC A;  4A32 A;  2PJ4 A;  2PJ7 A;  3L2N A;  2ZEP A;  4ZBG A;  4NGQ A;  2PJ2 A;  3D2P A;  4OC4 A;  2FT0 A;  2G3A A;  5K8N A;  2XEF A;  2O4H A;  2HB6 A;  4UBR A;  4A38 A;  4KOV A;  4BD9 A;  5H84 A;  3HLP A;  3PB7 X;  4C2Z A;  3LMS A;  4DUK A;  1CP7 A;  3FIX A;  2NSM A;  4MBU A;  4YFJ A;  4HNW B;  1QQ9 A;  4KOW A;  3GKR A;  4RN7 A;  3KR4 A;  3F5B A;  1Z4R A;  3R1K A;  1YLE A;  1YVK A;  3JUW A;  3TCV A;  1RXT A;  3FBU A;  4KVM E;  4P45 A;  1Y0R A;  1S3Z A;  2C6P A;  1X12 A;  1VHS A;  4R57 A;  4C7H A;  3HUV A;  4Y49 C;  4MFZ A;  4PXB A;  1HEE A;  2Q7S A;  5K8M A;  5H86 A;  2Z3P A;  2C6G A;  4QUS A;  4I49 A;  5LYI A;  3DDD A;  4OC1 A;  3W91 A;  4O23 A;  4YU9 A;  4F9V A;  4QB9 A;  3KQZ A;  1NMT A;  2F8H A;  3E0K A;  3KHX A;  4GS4 A;  3S6K A;  5A27 A;  1XRY A;  4FUU A;  2P6E A;  4UWJ A;  5JPH A;  4P10 A;  2GU2 A;  2QIR A;  3B2Y A;  2P6G A;  1R3N A;  3SI1 A;  1UWY A;  1SQH A;  1Z2L A;  1VHO A;  2PIZ A;  1HDU A;  1S7N A;  2PDO A;  4UWI A;  4C7I A;  1PU9 A;  2Z0Z A;  1ELM P;  3B7I A;  5G20 A;  2GFQ A;  2POK A;  4X3R A;  5HVH A;  5J8C A;  4KOX A;  2Q44 A;  2JLM A;  2ANP A;  1S60 A;  2Q43 A;  4NGR A;  2CY2 A;  2V8H A;  3KAS A;  3PB9 X;  3RBU A;  4A31 A;  3IEH A;  3CPA A;  1Q7L A;  2B3U A;  3D7G A;  2Q4Z A;  2EVN A;  4A39 A;  1DE4 C;  3DLJ A;  2GRE A;  2V8V A;  2B5G B;  5HXD A;  6CPA A;  3RZA A;  5F46 A;  2BOA A;  4KSF A;  5IV0 A;  3PEI A;  2B58 A;  4NGS A;  4UCN A;  2EWB A;  1YW6 A;  2DPT A;  4NFR A;  4R7M A;  3C26 A;  4B14 A;  4P4J A;  2ZW6 A;  1MK4 A;  1Y9W A;  2PJ6 A;  4H6Z A;  4XPL A;  2VI7 A;  3R96 A;  3IIB A;  4CGM A;  4P4B A;  4F8Z A;  4ZX8 A;  4PSW A;  3H8G A;  4UEE A;  1Q2D A;  2PVV A;  3FEE A;  4NJQ A;  4MFJ A;  2ZEN A;  2XEI A;  2B3V A;  4KOU A;  3NE8 A;  4ONW A;  4OC5 A;  2ARH A;  2VBQ A;  2ZW7 A;  3WC5 A;  3RO0 A;  2DPS A;  1M44 A;  2O28 A;  3EO4 A;  3TO6 A;  4ZI6 A;  4FD7 A;  1U6M A;  3V8I A;  2PCU A;  2X7B A;  3WT4 A;  1KZF A;  4B5P B;  5IB0 A;  4B6Z A;  5LYL A;  2EK8 A;  4II9 A;  4LX9 A;  4A30 A;  4MRI A;  4NXY A;  4UIA A;  1LFW A;  3PRT A;  2ZW5 A;  5F47 A;  4R8F A;  4AB7 A;  2XEJ A;  5AGE A;  2B4D B;  4KZT A;  2BSW A;  2ZED A;  2AE6 A;  2PE3 A;  3G3S A;  3QNV A;  4KUA A;  1IGB A;  3KL9 A;  1I12 A;  1DTD A;  1Z8W A;  3SJG A;  4ZYQ A;  3NH8 A;  2RFH A;  1LCP A;  3NH4 A;  4P4I A;  3NE7 A;  3B3C A;  3BXM A;  4LQ6 A;  4MCQ A;  3R9G A;  4HNY B;  3H4Q A;  2FCK A;  5AG5 A;  8CPA A;  1JWQ A;  2G3T A;  4P4D A;  1BO4 A;  1CBX A;  1KWM A;  3QAY A;  5JGF A;  5KTA A;  4FD4 A;  2DXQ A;  2OR4 A;  3NH5 A;  4PSX A;  3DR6 A;  3FEC A;  3IGR A;  3PP9 A;  3FED A;  2A4N A;  4CAE A;  4K30 A;  2G9D A;  3GIU A;  3D7D A;  4PV6 A;  4UEF A;  1KUX A;  1CG2 A;  2ZEG A;  2CF4 A;  4QC6 A;  4JXR A;  5THW A;  4E2A A;  5C82 A;  3ISX A;  2CTC A;  1Z4E A;  2CNT A;  4BIN A;  4ZY0 A;  3D3S A;  2ZW4 A;  2FE7 A;  4MHY A;  3RAM A;  3WR7 A;  4RI1 A;  4YWY A;  3FXT A;  5EC4 A;  5ELY A;  3BHX A;  4P4F A;  2QEC A;  2EO8 A;  3PBE A;  1QSO A;  3UY5 A;  3WC6 A;  3CPX A;  3SXO A;  3T90 A;  4JYW A;  3GY9 A;  3D66 A;  1YVO A;  1RTQ A;  3DGV A;  2D4P A;  4PXC A;  4JZ0 A;  1HDQ A;  4MJ8 A;  2WPW A;  2AFZ A;  4MHN A;  1XMB A;  1S7K A;  4OLL A;  5DWN A;  1WK4 A;  3FF3 A;  3GLJ A;  5FVJ A;  4F0Y A;  3DR8 A;  2PC1 A;  2PRB A;  4UFX A;  2PJ9 A;  4CGP A;  4CYN A;  4B5P A;  3SJE A;  2VZZ A;  4KUB A;  2OOT A;  3KZW A;  3IFE A;  5AG7 A;  3R95 A;  2PSW A;  5G1Z A;  2B5G A;  4OAE A;  5D29 A;  2PR8 A;  4WJB A;  3VWD A;  3IJ3 A;  5G21 A;  3V38 A;  1VHE A;  1BPM A;  1Z9U A;  2PVW A;  4LUA A;  4MFP A;  4PK2 A;  4OIW A;  2Q04 A;  3MN8 A;  4JJX A;  3NFZ A;  1IOI A;  1J4J A;  2ZXV A;  3N7Z A;  2I79 A;  2P6F A;  3PBB A;  4FAI A;  4OME A;  2ABZ A;  3LD2 A;  2EUI A;  2H5M A;  2VL1 A;  3H8E A;  2Q7B A;  4A33 A;  2FIW A;  3PZJ A;  2J8N A;  3MGD A;  5F09 A;  2C6C A;  7CPA A;  3PB4 X;  2VEZ A;  3SJF A;  2AFS A;  3S9N A;  1XIX A;  4H2K A;  2Z3L A;  2R98 A;  5BWA B;  1XJO A;  1M1D A;  4KOT A;  2AFX A;  4PK3 A;  4MHZ A;  2PJ5 A;  2PJ0 A; 
#chains in the Genus database with same CATH homology
 3WC7 A;  3IO1 A;  2QVP A;  1ZG9 A;  3GB0 A;  1JQG A;  1ZLI A;  1ZG8 A;  3SI0 A;  1CP6 A;  1TXR A;  2V8D A;  5JH9 A;  3IC1 A;  2JBJ A;  2FVG A;  3LWU A;  2GLJ A;  2JEW A;  2GLF A;  1PYT B;  3PB6 X;  4PXE A;  4EFD A;  3JRU A;  2AFW A;  2AFM A;  2PJ8 A;  2ZOG A;  4UIB A;  1M4L A;  2PJC A;  3SJX A;  2RB7 A;  2Q51 A;  4UEZ A;  4W9Y A;  2PJ1 A;  1YSJ A;  2WYR A;  3KHZ A;  2QJ8 A;  5K8P A;  3D67 A;  2NYQ A;  1CPX A;  4P4E A;  1PCA A;  1CPS A;  3B3W A;  3ISZ A;  2V8G A;  2F7V A;  3B3T A;  5I4M A;  4OP4 A;  5LYD A;  2PRQ A;  4EME A;  3FVL A;  3BI1 A;  3K9T A;  4ZY1 A;  4P44 A;  1LOK A;  1ARM A;  5LRJ A;  1FT7 A;  1LAP A;  3K2K A;  4G1P A;  1LAN A;  4MHP A;  5K8O A;  3N5F A;  4NGM A;  3B3V A;  4IK2 A;  3KGQ A;  3FJU A;  1AYE A;  1Y7E A;  3VH9 A;  2AFO A;  1Y0Y A;  4EWT A;  1BPN A;  2HC9 A;  4MCP A;  1QMU A;  2IMO A;  3PFE A;  1F57 A;  1TKH A;  2ZEF A;  3TX8 A;  3D7F A;  1VIX A;  3CT9 A;  4GM5 A;  1ZLH A;  2IJZ A;  2ZOF A;  4TWE A;  1F2P A;  1GYT A;  3NA6 A;  5J1Q A;  1ARL A;  1ELL P;  5DS0 A;  4F9U A;  1H8L A;  1CX8 A;  2CIJ A;  1F2O A;  2O53 A;  4WWV A;  3D7H A;  1TKF A;  3KR5 A;  2ZEL A;  4MCR A;  4X2T A;  5JM6 A;  3S9M A;  3SI2 A;  2V77 A;  4PQA A;  1TF9 A;  4TNU A;  2QYV A;  3I1U A;  3KI9 A;  3D4U A;  4MCS A;  4CPA A;  1OBR A;  2XEG A;  3PB8 X;  3VAR A;  3PFO A;  1R43 A;  2JBK A;  4PXD A;  1YW4 A;  1LAM A;  4OID A;  2C1C A;  4MXU A;  4DJL A;  4Z65 A;  1FNO A;  4A37 A;  2AFU A;  4RUH A;  3B3S A;  1EE3 P;  2ZEM A;  4FWU A;  5HVF A;  4OC0 A;  3FH4 A;  4DYO A;  3VAT A;  1XFO A;  2PJ3 A;  1NSA A;  5LRG A;  5IB9 A;  1BLL E;  4OC3 A;  4PPZ A;  3CDX A;  1YME A;  4IAV A;  3S9L A;  1ZG7 A;  2I3C A;  4A94 A;  1XBU A;  4MHZ A;  5HVG A;  3H8F A;  4NGT A;  2IQ6 A;  2PIY A;  3WAB A;  4MMO A;  4FBE A;  1IY7 A;  2PJB A;  5LRK A;  5CBM A;  4NGP A;  4R76 A;  3BI0 A;  2ZEO A;  1Z5R A;  5LYF A;  4X8I A;  1TKJ A;  4OKO A;  4OC2 A;  4UF4 A;  3TC8 A;  1VGY A;  4R6T A;  2ZEH A;  3B35 A;  3FX6 A;  4KSI A;  2BO9 A;  3V7Z A;  3KQX A;  3GUX A;  4ZX9 A;  1AMP A;  2BCO A;  4AXV A;  3FMC A;  1TF8 A;  4NGN A;  2ZEE A;  3IWW A;  3T8W A;  1YLO A;  2CTB A;  1Z8L A;  5D8N A;  4K3N A;  4IHM A;  4LQG A;  4P6Y A;  2PJA A;  1BAV A;  4NJR A;  2J9A A;  3D68 A;  5CPA A;  2EK9 A;  2DEA A;  4ZY2 A;  3MRU A;  4Q7A A;  2WZN A;  2PJ4 A;  2PJ7 A;  3L2N A;  2ZEP A;  4NGQ A;  2PJ2 A;  4OC4 A;  5K8N A;  2XEF A;  2O4H A;  2HB6 A;  4A38 A;  4BD9 A;  3HLP A;  3PB7 X;  3LMS A;  4DUK A;  1CP7 A;  2NSM A;  1QQ9 A;  3KR4 A;  4P45 A;  1Y0R A;  2C6P A;  3HUV A;  4PXB A;  1HEE A;  5K8M A;  2C6G A;  5LYI A;  4OC1 A;  4F9V A;  4O23 A;  4YU9 A;  3KQZ A;  2F8H A;  3KHX A;  1XRY A;  4FUU A;  4P10 A;  2GU2 A;  3B2Y A;  1R3N A;  3SI1 A;  1UWY A;  1Z2L A;  1VHO A;  2PIZ A;  1HDU A;  1ELM P;  3B7I A;  2POK A;  4X3R A;  5HVH A;  2ANP A;  4NGR A;  3RBU A;  2Q43 A;  2V8H A;  3PB9 X;  3KAS A;  3IEH A;  3CPA A;  1Q7L A;  3D7G A;  2Q4Z A;  4A39 A;  1DE4 C;  3DLJ A;  2GRE A;  2V8V A;  5HXD A;  6CPA A;  3RZA A;  2BOA A;  3PEI A;  4NGS A;  2EWB A;  1YW6 A;  4NFR A;  4R7M A;  4P4J A;  2PJ6 A;  3IIB A;  4P4B A;  4F8Z A;  4ZX8 A;  3H8G A;  4UEE A;  2PVV A;  3FEE A;  4NJQ A;  2ZEN A;  2XEI A;  4ONW A;  3WC5 A;  4OC5 A;  4ZI6 A;  2PCU A;  3WT4 A;  5LYL A;  4B6Z A;  2EK8 A;  4MRI A;  4UIA A;  1LFW A;  3PRT A;  4R8F A;  2XEJ A;  2ZED A;  2PE3 A;  3QNV A;  1IGB A;  3KL9 A;  1DTD A;  3SJG A;  4ZYQ A;  3NH8 A;  2RFH A;  1LCP A;  3NH4 A;  4P4I A;  4MCQ A;  3B3C A;  3BXM A;  8CPA A;  4P4D A;  1CBX A;  1KWM A;  5JGF A;  2OR4 A;  3NH5 A;  3FEC A;  3FED A;  2G9D A;  3D7D A;  4UEF A;  1CG2 A;  2ZEG A;  2CF4 A;  5THW A;  3ISX A;  2CTC A;  4ZY0 A;  4MHY A;  3RAM A;  4YWY A;  5ELY A;  3BHX A;  4P4F A;  3PBE A;  3WC6 A;  3CPX A;  4JYW A;  3D66 A;  3DGV A;  1RTQ A;  4PXC A;  4JZ0 A;  1HDQ A;  4MHN A;  2AFZ A;  1XMB A;  3FF3 A;  3GLJ A;  2PJ9 A;  3SJE A;  2OOT A;  3KZW A;  3IFE A;  5D29 A;  4WJB A;  3IJ3 A;  3V38 A;  1VHE A;  1BPM A;  2PVW A;  4OIW A;  3MN8 A;  3NFZ A;  3PBB A;  4FAI A;  4OME A;  2ABZ A;  2VL1 A;  3H8E A;  5F09 A;  2C6C A;  7CPA A;  3PB4 X;  3SJF A;  2AFS A;  3S9N A;  4H2K A;  1XJO A;  2AFX A;  2PJ5 A;  2PJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...