3SI0A

Structure of glycosylated human glutaminyl cyclase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
324
structure length
314
Chain Sequence
EEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFNNRVFVGATDSAVPCAMMLELARALDKKLLSLKDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title Structures of Glycosylated Mammalian Glutaminyl Cyclases Reveal Conformational Variability near the Active Center.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 104
structure length 314
sequence length 324
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3si0A00
3CPXA 4NGSA 4DUKA 1ZG7A 2Q4ZA 3KQXA 4PXEA 1CPSA 4OIWA 1XMBA 4NFRA 2C6GA 3LWUA 1ELMP 3WC5A 5D8NA 2PJCA 1VGYA 5F09A 2ZEDA 3IEHA 1YW6A 2ZEOA 4TWEA 4EWTA 3QNVA 4AXVA 4OC3A 3D7GA 5JH9A 3IIBA 2PJ6A 3KZWA 2PRQA 3KI9A 3PEIA 2WZNA 3TX8A 5LRJA 4P4EA 1YLOA 3IWWA 1H8LA 5HVHA 2JBJA 4A38A 2PJ5A 2CTBA 2I3CA 3NH5A 2QJ8A 1CP7A 2PJ1A 2J9AA 4WJBA 5LYLA 2QVPA 2ZEMA 3JRUA 3KR5A 4K3NA 3PB6X 3L2NA 3PFOA 4UEEA 3RBUA 2AFOA 1YSJA 1VHEA 4FWUA 4TNUA 3WABA 2PJ2A 1YW4A 2JEWA 2RB7A 3WC6A 7CPAA 3BXMA 3PFEA 2IJZA 2ZEHA 2Q51A 2O4HA 2HC9A 1CBXA 5D29A 4F9VA 5K8PA 4FBEA 3V38A 3SJEA 4MHZA 4A39A 2PJBA 5HXDA 3H8EA 1CX8A 4WWVA 1CP6A 4ZX8A 2XEJA 2AFSA 4O23A 4W9YA 1BPNA 3GB0A 4OC4A 6CPAA 1HEEA 2V8DA 4H2KA 4PXBA 2EK8A 3B3VA 4X8IA 4MCSA 1BPMA 1HDQA 4P4BA 3KL9A 4DYOA 4IAVA 3CT9A 2GU2A 3D7DA 2PVVA 3PBBA 3VH9A 2PCUA 3FX6A 4OIDA 3BI1A 1IGBA 1ZLHA 4MHYA 3CPAA 3WC7A 4ZY1A 4PQAA 2PJAA 2IQ6A 4UEFA 4FUUA 4OP4A 3B7IA 3D7FA 2PJ8A 3PB4X 3IO1A 2ZELA 3BHXA 1VIXA 3K9TA 1ELLP 4X3RA 4PPZA 5K8MA 4MMOA 5I4MA 1KWMA 2BOAA 4UEZA 2G9DA 2PIYA 2V8VA 2PE3A 2ZOGA 4PXCA 1IY7A 5LYIA 3LMSA 3MRUA 3HLPA 2VL1A 4UIBA 1TF8A 2WYRA 1EE3P 2PJ3A 3KR4A 2PIZA 4YWYA 3B35A 1ZG9A 3SJXA 4OKOA 4NGNA 5JM6A 4R7MA 4X2TA 1XBUA 3VARA 1LAPA 1PCAA 3CDXA 3PB9X 3SI1A 2O53A 3VATA 3PB7X 2ANPA 4FAIA 3H8FA 2GREA 2PJ9A 4GM5A 4OC1A 2EK9A 3N5FA 2EWBA 2CF4A 3TC8A 4P10A 2DEAA 1FNOA 4IK2A 1Y0YA 2OR4A 4NGTA 3B3TA 1LAMA 1XJOA 4MHPA 2ZEEA 3ISXA 2NYQA 3PBEA 2AFUA 1LCPA 1DE4C 1BAVA 3GLJA 4ONWA 5K8NA 1LANA 4P44A 2V8GA 3S9LA 4R8FA 3D66A 2AFMA 4MRIA 2FVGA 3H8GA 3NA6A 2XEFA 1Y0RA 5CPAA 4ZX9A 3WT4A 2C6PA 2BCOA 3I1UA 4A94A 3S9NA 4OMEA 2AFWA 3DGVA 2CIJA 4YU9A 3FMCA 5K8OA 2RFHA 1F2PA 3T8WA 4EFDA 1TKJA 5LYDA 3RAMA 3BI0A 3KHXA 5ELYA 5J1QA 4OC2A 3SJFA 2V8HA 2CTCA 2AFXA 1XFOA 1ZG8A 3GUXA 1GYTA 3HUVA 1OBRA 4ZY2A 3FECA 4MCPA 4MCRA 2BO9A 4KSIA 1LOKA 3D67A 4P4FA 4ZI6A 1Z5RA 1FT7A 4LQGA 2AFZA 1Z8LA 1HDUA 3B3SA 3ISZA 3D4UA 8CPAA 3PRTA 4PXDA 3FEDA 4DJLA 3FH4A 2OOTA 1AMPA 3FVLA 5HVFA 3SI0A 2V77A 3NFZA 4NJRA 4ZYQA 5JGFA 2GLJA 2PVWA 1F2OA 4B6ZA 4NGPA 1R43A 2PJ0A 2HB6A 1R3NA 3MN8A 4UF4A 5LRKA 2ABZA 2ZEPA 4G1PA 3RZAA 4R76A 5LYFA 1PYTB 3KQZA 3DLJA 4A37A 1TKFA 2F7VA 3B3WA 1M4LA 5HVGA 4R6TA 2NSMA 1LFWA 4F8ZA 5THWA 4Z65A 4OC0A 4NGMA 2POKA 3B2YA 3PB8X 5DS0A 3FEEA 2ZEGA 4JZ0A 3KHZA 4ZY0A 1BLLE 4Q7AA 3FJUA 1UWYA 2GLFA 1TKHA 3D68A 1Y7EA 3V7ZA 4OC5A 1ZLIA 2ZOFA 1RTQA 4IHMA 2PJ4A 2C6CA 3KGQA 2QYVA 1VHOA 1JQGA 4NGRA 4MCQA 1AYEA 4EMEA 2XEGA 4F9UA 3K2KA 4MHNA 2IMOA 3S9MA 1TF9A 2ZEFA 1Z2LA 1NSAA 2C1CA 1Q7LA 3SJGA 4NGQA 2ZENA 1XRYA 4UIAA 5IB9A 3IC1A 1QMUA 2F8HA 1DTDA 2JBKA 3D7HA 4JYWA 3IFEA 4CPAA 3NH4A 1CG2A 1QQ9A 1TXRA 2XEIA 4RUHA 4BD9A 5LRGA 1F57A 2PJ7A 4P45A 3KASA 1ARLA 4MXUA 1CPXA 4P4IA 4NJQA 4P4JA 2Q43A 1YMEA 3FF3A 1ARMA 3NH8A 4P6YA 3SI2A 3B3CA 4P4DA 5CBMA 3IJ3A
chains in the Genus database with same CATH superfamily
2R1IA 3CPXA 4NGSA 4R57A 4DUKA 1NE9A 1ZG7A 2Q4ZA 3RO0A 3KQXA 4CGLA 3GIUA 4PXEA 3C26A 2FXFA 2JDCA 4KOTA 1CPSA 3D8PA 3SXOA 2A4NA 4R9MA 5KTAA 4OIWA 1XMBA 3N7ZA 3TTHA 4NFRA 2C6GA 3LWUA 1ELMP 4AB7A 3EXNA 2ZW4A 1R57A 1KUVA 3SXNA 3WC5A 5D8NA 2PJCA 1VGYA 4U5YA 5F09A 1KZFA 5G1ZA 2EO8A 3S6GA 2ZEDA 4CYPA 2D4OA 3IEHA 1YW6A 2ZEOA 2ZPAA 2QMLA 4UA3A 5FVJA 4B5PB 4TWEA 3DDDA 4EWTA 4ZGYB 3QNVA 4AXVA 4A95A 4KZTA 2PRBA 4OC3A 3D7GA 2YNDA 4IF5A 1IYKA 5JH9A 3IIBA 3R1KA 2PSWA 3NE7A 4A30A 2PJ6A 3KZWA 4CAXA 2PRQA 3KI9A 3PEIA 2WZNA 3TX8A 2EBJA 3OWCA 2P6GA 5LRJA 4P4EA 3G8WA 1YLOA 1XF8A 1H8LA 3IWWA 2ZW6A 5HVHA 2J8NA 2JBJA 4A38A 2F5IA 2PJ5A 2WSAA 2CTBA 1I21A 2I3CA 2YNCC 2CXAA 3NH5A 2QJ8A 3B8GA 1CP7A 2PJ1A 2VBQA 1XEBA 2J9AA 3QB8A 4H6ZA 4WJBA 3LD2A 5F46A 2Q4YA 5LYLA 4CAFA 2QVPA 3F0AA 2ZEMA 4AG9A 5AG4A 3LACA 3P2FA 3JRUA 3KR5A 2FE7A 3H5ZA 1M1DA 3PB6X 4H89A 4K3NA 3L2NA 3PFOA 4UEEA 4A2ZA 2FCKA 2OZUA 1MJAA 4C2ZA 1V0CA 3RBUA 2AFOA 3A9LA 5CNPA 4C2YA 1YSJA 4JJXA 1VHEA 4FWUA 2FT0A 4OAEA 4TNUA 3WABA 1MJBA 2PJ2A 1YW4A 2Q4VA 2R8VA 4II9A 4UCMA 2JEWA 2RB7A 3WC6A 7CPAA 4MBUA 3BXMA 3PFEA 1S7KA 2IJZA 2REFA 2J8MA 2ZEHA 2Q51A 2ZW5A 4BBHA 2O4HA 2HC9A 1CBXA 2ZW7A 3PGPA 4MFPA 5D29A 2CNMA 5AG7A 4MI4A 4F9VA 2VI7A 3ZZIA 1M44A 3BJ8A 5K8PA 2H5MA 4HKFA 3UY5A 2Z3OA 3V38A 3SJEA 4FBEA 4RN7A 3R9GA 4KUAA 2GIVA 4MHZA 3IU1A 4A39A 2PJBA 4HNWB 5HXDA 2QIRA 1Q2YA 5KTDA 3H8EA 1CX8A 4WWVA 3DSBA 1U6MA 1CP6A 4UBRA 4ZX8A 2I00A 2XEJA 2AFSA 4FD4A 4F6AA 2Q7SA 1MK4A 2B3UA 4O23A 1QSNA 1I1DA 4FD6A 3BLNA 1Z4EA 4A32A 4RS2A 4KVOE 1SQHA 3E0KA 1VKCA 4KOYA 4W9YA 3CXSA 2Z3KA 1BPNA 3GB0A 3TT2A 4OC4A 5C88A 2OB0A 4M6GA 6CPAA 1CM0A 1J4JA 1HEEA 2G3AA 2DPSA 2V8DA 1TIQA 4H2KA 4YRHA 4PXBA 2EK8A 1YVOA 3B3VA 4CAWA 3GY9A 1S7LA 1B6BA 2B5GB 3D3SA 4MFLA 5A27A 1AUGA 4X8IA 4XPKA 4MCSA 1BPMA 1KUYA 3GYAA 1HDQA 2R7HA 4P4BA 4UWJA 3KL9A 4R3LA 4DYOA 4IAVA 4PK2A 1BOBA 3CT9A 3JVNA 5I0CA 1GHEA 3F8KA 3W6XA 2GU2A 3T90A 3D7DA 2PVVA 3PBBA 3VH9A 2PCUA 2C27A 5DWNA 1ZO0A 3FIXA 3FX6A 3JTKA 3LODA 4MY0A 3TOBA 3IGRA 3BI1A 3CZXA 4OIDA 1IGBA 1ZLHA 4JWPA 4MHYA 3EO4A 3CPAA 3WC7A 4ZY1A 4PQAA 2PJAA 4HNYB 2FSRA 2IQ6A 4UEFA 4FUUA 4KOSA 4OP4A 3B7IA 3D7FA 2PJ8A 3PB4X 3SHPA 5A28A 3IO1A 1BO4A 2NMTA 2Z0ZA 4IUSA 1IICA 3CXQA 3I9SA 2ZELA 1NSLA 3BHXA 3TO9A 3VWEA 4C7HA 1VIXA 2BL1A 3K9TA 1ELLP 3FNCA 3TE4A 3DNSA 4X3RA 5IB0A 4PPZA 5K8MA 2B4DB 4OLLA 1FY7A 4MMOA 4PSWA 1KWMA 5I4MA 5IX3A 2OU2A 2BOAA 2PR8A 4HNXB 4KSAA 4UEZA 5HH1A 2G9DA 2PIYA 4L89A 1YQEA 2V8VA 2PE3A 2ZOGA 2VZZA 3R9FA 4PXCA 1IY7A 5LYIA 4UFWA 3LMSA 4KOVA 2PQ8A 3MRUA 3HLPA 2VL1A 4UIBA 4PV6A 4A31A 1TF8A 2WYRA 1EE3P 3TFYA 2PJ3A 3KR4A 4NCZA 5C82A 1IOFA 2PIZA 4I49A 4YWYA 4KLWA 3B35A 1ZG9A 3IU2A 2ATRA 3SJXA 4OKOA 3ZJ0A 4NGNA 5JM6A 4R7MA 4X2TA 1XBUA 2Z11A 3VARA 1LAPA 5F49A 4HPSA 1PCAA 3CDXA 2AE6A 2ARHA 5DWMA 2P0WA 3TO6A 1CJWA 3PB9X 3MGDA 3SI1A 2QECA 2O53A 3I3GA 3VATA 3PB7X 2ANPA 4FAIA 4QC6A 3H8FA 2GREA 2PJ9A 4GM5A 4OC1A 2EUIA 4AVCA 4C68A 2EK9A 2VZYA 1LRZA 2WPWA 4M6HA 5JQ4A 2GE3A 3PZJA 1Z8XA 3N5FA 2EWBA 4LUAA 2OZGA 2O28A 2CF4A 4R87A 3TC8A 3FBUA 4P10A 5GCNA 2DEAA 1FNOA 1JWQA 2VXKA 4IK2A 2CNSA 4NSQA 4AG7A 1Y0YA 1RO5A 4PSXA 4CGPA 4C2XA 2OR4A 3FB3A 4NGTA 3R95A 3B3TA 4ONUA 3K9UA 1Z9UA 4B14A 1QSRA 3FXTA 1K4JA 1RXTA 2CY2A 2FIWA 1M4DA 3RYOA 4CRYB 4R3KA 1LAMA 3V8IA 1XJOA 2DPTA 3DR6A 4MHPA 4CYNA 2ZEEA 2FIAA 3ISXA 2NYQA 4U9ZA 1M4IA 3PBEA 2AFUA 1LCPA 4JXQA 1IIDA 1YGHA 1NMTA 1DE4C 1XMTA 2Z3LA 3RNZA 1BAVA 1S7FA 3GLJA 4ONWA 5K8NA 1LANA 3S6KA 4P44A 2V8GA 1YREA 4R8FA 3S9LA 2VEZA 1Q2DA 1WWZA 2AFMA 3D66A 2I79A 4MRIA 2FVGA 4MFQA 3H8GA 4U9YA 3NA6A 2R98A 2XEFA 1Y0RA 5CPAA 4ZX9A 4CAEA 3WT4A 2C6PA 1VHSA 2BCOA 3I1UA 5EBVA 4F0XA 4NEXA 4A94A 4JLYA 2P6FA 4JXRA 2PDOA 3S9NA 4OMEA 3DR8A 4QB9A 2AFWA 2G3TA 4CGOA 2D4PA 3DGVA 3QAYA 3TO7A 2CIJA 2YGWA 3GKRA 3FMCA 4YU9A 2WPXA 5K8OA 2RFHA 1F2PA 3T8WA 4EFDA 1TKJA 4MJ8A 5LYDA 4B5PA 3RAMA 3BI0A 4KVME 4KSFA 4CS0B 3KHXA 2Q7BA 4CYQA 2RC4A 2REEA 1Y9KA 5ELYA 5J1QA 4OC2A 3SJFA 2V8HA 1X12A 2CTCA 3EC4A 5J8CA 2AFXA 3S6FA 1XFOA 4DNCA 1ZG8A 3GUXA 1GYTA 1UFHA 3FYNA 3HUVA 1OBRA 1Z8TA 4ZY2A 3VWDA 1MJ9A 2OZHA 3FECA 1Y7RA 2K5TA 2HQYA 4JD6A 4MCPA 4MCRA 2BO9A 3BJ7A 1B87A 3S6HA 3R9EA 4KSIA 1LOKA 1S60A 1S3ZA 1S7NA 4UFXA 3D67A 2BEIA 4M85A 4CGNA 2PR1A 1XIXA 4P4FA 4ZI6A 1Z5RA 2B3VA 1ON0A 1FT7A 2Q44A 4MFJA 4LQGA 1PU9A 1P4NA 2AFZA 1Z8LA 1HDUA 2JEVA 4Q36A 3P2HA 4KUBA 3B3SA 3ISZA 3D4UA 1YVKA 8CPAA 5F47A 3PRTA 4PXDA 5AG6A 3FEDA 4DJLA 4A33A 2ODFA 2IL4A 3FH4A 4CAVA 5F48A 1AMPA 1P0HA 2Z3PA 4MFKA 2OOTA 4MFZA 1A2ZA 4YFJA 4UCNA 4M3SA 3FVLA 4XPLA 5HVFA 1IYLA 1QSMA 3SI0A 5G22A 2V77A 3NFZA 4NJRA 4FD7A 1X10A 4ZYQA 2Y0MA 2GLJA 2PVWA 5H84A 5JGFA 1F2OA 4ZBGA 3H4QA 4B6ZA 4GXHA 4UCPA 2YNEA 4NGPA 1R43A 1IU8A 2PJ0A 2Z3MA 2HV2A 2HB6A 4CYOA 5IV0A 1R3NA 2J8RA 3MN8A 4B12A 2EVNA 4UF4A 5LRKA 5ISVA 2YNCA 4LX9A 2ABZA 1Z8WA 2ZEPA 4G1PA 3RZAA 4BMHA 4R76A 2WUUA 5LYFA 1PUAA 4XPDC 1PYTB 3FRMA 3KQZA 3DLJA 4A37A 2BUEA 1S5KA 1TKFA 2KCWA 2F7VA 3B3WA 1M4LA 4E0AA 5KTCA 5HVGA 4R6TA 1QSTA 2NSMA 4XNHC 3G3SA 4RI1A 1LFWA 2GANA 4F8ZA 5THWA 4Z65A 4Q38A 3T9YA 4MY3A 2VQYA 4OC0A 4X5KA 2P6EA 5BWAB 2BSWA 2FS5A 1OZPA 4QVTA 4CRZB 4C7IA 4F0YA 3QAHA 4NGMA 2POKA 3B2YA 3PB8X 4KS9A 4KVXA 5G20A 3EY5A 5DS0A 4AVBA 1YX0A 4B5OA 4E8OA 3FEEA 3W6SA 4M6IA 4MHDA 2ZEGA 4JZ0A 3KHZA 2JDDA 5H86A 4E2AA 4ZY0A 1BLLE 3CXPA 4Q7AA 3FJUA 1UWYA 2B5GA 2JLMA 4BINA 3R96A 2FL4A 2GLFA 3W91A 1TKHA 5J8FA 3D68A 4UFVA 1Y7EA 3V7ZA 4OC5A 1KUXA 1ZLIA 2ZOFA 1RTQA 5EC4A 4ORFA 1QSOA 4IHMA 2PJ4A 1YK3A 2C6CA 1M4GA 2HUZA 3KGQA 4Y49C 1Z4RA 4UWIA 4B11A 2PC1A 2QYVA 4KOUA 3TOAA 1VHOA 4XPDB 1JQGA 5E96A 4NGRA 4MCQA 1AYEA 2B4BA 3IWEA 4EMEA 4YGOA 2XEGA 4F9UA 3K2KA 1WK4A 2X7BA 4MHNA 2IMOA 3NE8A 4XNHB 3S9MA 4KOWA 2GFQA 1TF9A 2ZEFA 1YR0A 1NSAA 1Z2LA 1Q7LA 2C1CA 4OADA 4KORA 1XOVA 3SJGA 4NGQA 4AVAA 2ZENA 1IB1E 1XRYA 4UIAA 2ZXVA 5IB9A 3IC1A 4L8AA 2G0BA 1QMUA 2F8HA 1DTDA 2JBKA 3D7HA 3D2MA 4JYWA 2Z10A 4LQ6A 4KOXA 3IFEA 3TCVA 1IOIA 4CPAA 4PK3A 4B13A 1Y9WA 1I12A 3NH4A 5AG5A 1CG2A 1QQ9A 1TXRA 2B4DA 2Q04A 2B58A 3KKWA 1Q2CA 4K30A 4KLVA 2XEIA 4NXYA 4RUHA 1YLEA 4FD5A 3F5BA 3PP9A 5G21A 4GS4A 4BD9A 5HMNA 2DXQA 5LRGA 5JPHA 1F57A 2PJ7A 4P45A 1L0CA 2AJ6A 4Y49B 5AGEA 3EFAA 3KASA 1ARLA 4MXUA 1CPXA 4H6UA 3JUWA 4P4IA 3WR7A 5EMIA 4EVYA 4NJQA 4P4JA 2Q43A 3D2PA 4J3GA 4QUSA 4CGMA 1YMEA 3FF3A 1XE4A 3IWGA 2Z3NA 1ARMA 2OH1A 2Q0YA 3NH8A 4P6YA 4NF1A 2DF5A 3SI2A 3B3CA 4B10A 1N71A 2CNTA 4P4DA 4QBJA 5CBMA 3IJ3A
chains in the Genus database with same CATH topology
3CPXA 4NGSA 4DUKA 1ZG7A 2Q4ZA 3KQXA 4PXEA 1CPSA 4OIWA 1XMBA 4NFRA 2C6GA 3LWUA 1ELMP 3WC5A 5D8NA 2PJCA 1VGYA 5F09A 2ZEDA 3IEHA 1YW6A 2ZEOA 4TWEA 4EWTA 3QNVA 4AXVA 4OC3A 3D7GA 5JH9A 3IIBA 2PJ6A 3KZWA 2PRQA 3KI9A 3PEIA 2WZNA 3TX8A 5LRJA 4P4EA 1YLOA 3IWWA 1H8LA 5HVHA 2JBJA 4A38A 2PJ5A 2CTBA 2I3CA 3NH5A 2QJ8A 1CP7A 2PJ1A 2J9AA 4WJBA 5LYLA 2QVPA 2ZEMA 3JRUA 3KR5A 4K3NA 3PB6X 3L2NA 3PFOA 4UEEA 3RBUA 2AFOA 1YSJA 1VHEA 4FWUA 4TNUA 3WABA 2PJ2A 1YW4A 2JEWA 2RB7A 3WC6A 7CPAA 3BXMA 3PFEA 2IJZA 2ZEHA 2Q51A 2O4HA 2HC9A 1CBXA 5D29A 4F9VA 5K8PA 4FBEA 3V38A 3SJEA 4MHZA 4A39A 2PJBA 5HXDA 3H8EA 1CX8A 4WWVA 1CP6A 4ZX8A 2XEJA 2AFSA 4O23A 4W9YA 1BPNA 3GB0A 4OC4A 6CPAA 1HEEA 2V8DA 4H2KA 4PXBA 2EK8A 3B3VA 4X8IA 4MCSA 1BPMA 1HDQA 4P4BA 3KL9A 4DYOA 4IAVA 3CT9A 2GU2A 3D7DA 2PVVA 3PBBA 3VH9A 2PCUA 3FX6A 4OIDA 3BI1A 1IGBA 1ZLHA 4MHYA 3CPAA 3WC7A 4ZY1A 4PQAA 2PJAA 2IQ6A 4UEFA 4FUUA 4OP4A 3B7IA 3D7FA 2PJ8A 3PB4X 3IO1A 2ZELA 3BHXA 1VIXA 3K9TA 1ELLP 4X3RA 4PPZA 5K8MA 4MMOA 5I4MA 1KWMA 2BOAA 4UEZA 2G9DA 2PIYA 2V8VA 2PE3A 2ZOGA 4PXCA 1IY7A 5LYIA 3LMSA 3MRUA 3HLPA 2VL1A 4UIBA 1TF8A 2WYRA 1EE3P 2PJ3A 3KR4A 2PIZA 4YWYA 3B35A 1ZG9A 3SJXA 4OKOA 4NGNA 5JM6A 4R7MA 4X2TA 1XBUA 3VARA 1LAPA 1PCAA 3CDXA 3PB9X 3SI1A 2O53A 3VATA 3PB7X 2ANPA 4FAIA 3H8FA 2GREA 2PJ9A 4GM5A 4OC1A 2EK9A 3N5FA 2EWBA 2CF4A 3TC8A 4P10A 2DEAA 1FNOA 4IK2A 1Y0YA 2OR4A 4NGTA 3B3TA 1LAMA 1XJOA 4MHPA 2ZEEA 3ISXA 2NYQA 3PBEA 2AFUA 1LCPA 1DE4C 1BAVA 3GLJA 4ONWA 5K8NA 1LANA 4P44A 2V8GA 3S9LA 4R8FA 3D66A 2AFMA 4MRIA 2FVGA 3H8GA 3NA6A 2XEFA 1Y0RA 5CPAA 4ZX9A 3WT4A 2C6PA 2BCOA 3I1UA 4A94A 3S9NA 4OMEA 2AFWA 3DGVA 2CIJA 4YU9A 3FMCA 5K8OA 2RFHA 1F2PA 3T8WA 4EFDA 1TKJA 5LYDA 3RAMA 3BI0A 3KHXA 5ELYA 5J1QA 4OC2A 3SJFA 2V8HA 2CTCA 2AFXA 1XFOA 1ZG8A 3GUXA 1GYTA 3HUVA 1OBRA 4ZY2A 3FECA 4MCPA 4MCRA 2BO9A 4KSIA 1LOKA 3D67A 4P4FA 4ZI6A 1Z5RA 1FT7A 4LQGA 2AFZA 1Z8LA 1HDUA 3B3SA 3ISZA 3D4UA 8CPAA 3PRTA 4PXDA 3FEDA 4DJLA 3FH4A 2OOTA 1AMPA 3FVLA 5HVFA 3SI0A 2V77A 3NFZA 4NJRA 4ZYQA 5JGFA 2GLJA 2PVWA 1F2OA 4B6ZA 4NGPA 1R43A 2PJ0A 2HB6A 1R3NA 3MN8A 4UF4A 5LRKA 2ABZA 2ZEPA 4G1PA 3RZAA 4R76A 5LYFA 1PYTB 3KQZA 3DLJA 4A37A 1TKFA 2F7VA 3B3WA 1M4LA 5HVGA 4R6TA 2NSMA 1LFWA 4F8ZA 5THWA 4Z65A 4OC0A 4NGMA 2POKA 3B2YA 3PB8X 5DS0A 3FEEA 2ZEGA 4JZ0A 3KHZA 4ZY0A 1BLLE 4Q7AA 3FJUA 1UWYA 2GLFA 1TKHA 3D68A 1Y7EA 3V7ZA 4OC5A 1ZLIA 2ZOFA 1RTQA 4IHMA 2PJ4A 2C6CA 3KGQA 2QYVA 1VHOA 1JQGA 4NGRA 4MCQA 1AYEA 4EMEA 2XEGA 4F9UA 3K2KA 4MHNA 2IMOA 3S9MA 1TF9A 2ZEFA 1Z2LA 1NSAA 2C1CA 1Q7LA 3SJGA 4NGQA 2ZENA 1XRYA 4UIAA 5IB9A 3IC1A 1QMUA 2F8HA 1DTDA 2JBKA 3D7HA 4JYWA 3IFEA 4CPAA 3NH4A 1CG2A 1QQ9A 1TXRA 2XEIA 4RUHA 4BD9A 5LRGA 1F57A 2PJ7A 4P45A 3KASA 1ARLA 4MXUA 1CPXA 4P4IA 4NJQA 4P4JA 2Q43A 1YMEA 3FF3A 1ARMA 3NH8A 4P6YA 3SI2A 3B3CA 4P4DA 5CBMA 3IJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPX A;  4NGS A;  4DUK A;  1ZG7 A;  2Q4Z A;  3KQX A;  4PXE A;  1CPS A;  4OIW A;  1XMB A;  4NFR A;  2C6G A;  3LWU A;  1ELM P;  3WC5 A;  5D8N A;  2PJC A;  1VGY A;  5F09 A;  2ZED A;  3IEH A;  1YW6 A;  2ZEO A;  4TWE A;  4EWT A;  3QNV A;  4AXV A;  4OC3 A;  3D7G A;  5JH9 A;  3IIB A;  2PJ6 A;  3KZW A;  2PRQ A;  3KI9 A;  3PEI A;  2WZN A;  3TX8 A;  5LRJ A;  4P4E A;  1YLO A;  3IWW A;  1H8L A;  5HVH A;  2JBJ A;  4A38 A;  2PJ5 A;  2CTB A;  2I3C A;  3NH5 A;  2QJ8 A;  1CP7 A;  2PJ1 A;  2J9A A;  4WJB A;  5LYL A;  2QVP A;  2ZEM A;  3JRU A;  3KR5 A;  4K3N A;  3PB6 X;  3L2N A;  3PFO A;  4UEE A;  3RBU A;  2AFO A;  1YSJ A;  1VHE A;  4FWU A;  4TNU A;  3WAB A;  2PJ2 A;  1YW4 A;  2JEW A;  2RB7 A;  3WC6 A;  7CPA A;  3BXM A;  3PFE A;  2IJZ A;  2ZEH A;  2Q51 A;  2O4H A;  2HC9 A;  1CBX A;  5D29 A;  4F9V A;  5K8P A;  4FBE A;  3V38 A;  3SJE A;  4MHZ A;  4A39 A;  2PJB A;  5HXD A;  3H8E A;  1CX8 A;  4WWV A;  1CP6 A;  4ZX8 A;  2XEJ A;  2AFS A;  4O23 A;  4W9Y A;  1BPN A;  3GB0 A;  4OC4 A;  6CPA A;  1HEE A;  2V8D A;  4H2K A;  4PXB A;  2EK8 A;  3B3V A;  4X8I A;  4MCS A;  1BPM A;  1HDQ A;  4P4B A;  3KL9 A;  4DYO A;  4IAV A;  3CT9 A;  2GU2 A;  3D7D A;  2PVV A;  3PBB A;  3VH9 A;  2PCU A;  3FX6 A;  4OID A;  3BI1 A;  1IGB A;  1ZLH A;  4MHY A;  3CPA A;  3WC7 A;  4ZY1 A;  4PQA A;  2PJA A;  2IQ6 A;  4UEF A;  4FUU A;  4OP4 A;  3B7I A;  3D7F A;  2PJ8 A;  3PB4 X;  3IO1 A;  2ZEL A;  3BHX A;  1VIX A;  3K9T A;  1ELL P;  4X3R A;  4PPZ A;  5K8M A;  4MMO A;  5I4M A;  1KWM A;  2BOA A;  4UEZ A;  2G9D A;  2PIY A;  2V8V A;  2PE3 A;  2ZOG A;  4PXC A;  1IY7 A;  5LYI A;  3LMS A;  3MRU A;  3HLP A;  2VL1 A;  4UIB A;  1TF8 A;  2WYR A;  1EE3 P;  2PJ3 A;  3KR4 A;  2PIZ A;  4YWY A;  3B35 A;  1ZG9 A;  3SJX A;  4OKO A;  4NGN A;  5JM6 A;  4R7M A;  4X2T A;  1XBU A;  3VAR A;  1LAP A;  1PCA A;  3CDX A;  3PB9 X;  3SI1 A;  2O53 A;  3VAT A;  3PB7 X;  2ANP A;  4FAI A;  3H8F A;  2GRE A;  2PJ9 A;  4GM5 A;  4OC1 A;  2EK9 A;  3N5F A;  2EWB A;  2CF4 A;  3TC8 A;  4P10 A;  2DEA A;  1FNO A;  4IK2 A;  1Y0Y A;  2OR4 A;  4NGT A;  3B3T A;  1LAM A;  1XJO A;  4MHP A;  2ZEE A;  3ISX A;  2NYQ A;  3PBE A;  2AFU A;  1LCP A;  1DE4 C;  1BAV A;  3GLJ A;  4ONW A;  5K8N A;  1LAN A;  4P44 A;  2V8G A;  3S9L A;  4R8F A;  3D66 A;  2AFM A;  4MRI A;  2FVG A;  3H8G A;  3NA6 A;  2XEF A;  1Y0R A;  5CPA A;  4ZX9 A;  3WT4 A;  2C6P A;  2BCO A;  3I1U A;  4A94 A;  3S9N A;  4OME A;  2AFW A;  3DGV A;  2CIJ A;  4YU9 A;  3FMC A;  5K8O A;  2RFH A;  1F2P A;  3T8W A;  4EFD A;  1TKJ A;  5LYD A;  3RAM A;  3BI0 A;  3KHX A;  5ELY A;  5J1Q A;  4OC2 A;  3SJF A;  2V8H A;  2CTC A;  2AFX A;  1XFO A;  1ZG8 A;  3GUX A;  1GYT A;  3HUV A;  1OBR A;  4ZY2 A;  3FEC A;  4MCP A;  4MCR A;  2BO9 A;  4KSI A;  1LOK A;  3D67 A;  4P4F A;  4ZI6 A;  1Z5R A;  1FT7 A;  4LQG A;  2AFZ A;  1Z8L A;  1HDU A;  3B3S A;  3ISZ A;  3D4U A;  8CPA A;  3PRT A;  4PXD A;  3FED A;  4DJL A;  3FH4 A;  2OOT A;  1AMP A;  3FVL A;  5HVF A;  3SI0 A;  2V77 A;  3NFZ A;  4NJR A;  4ZYQ A;  5JGF A;  2GLJ A;  2PVW A;  1F2O A;  4B6Z A;  4NGP A;  1R43 A;  2PJ0 A;  2HB6 A;  1R3N A;  3MN8 A;  4UF4 A;  5LRK A;  2ABZ A;  2ZEP A;  4G1P A;  3RZA A;  4R76 A;  5LYF A;  1PYT B;  3KQZ A;  3DLJ A;  4A37 A;  1TKF A;  2F7V A;  3B3W A;  1M4L A;  5HVG A;  4R6T A;  2NSM A;  1LFW A;  4F8Z A;  5THW A;  4Z65 A;  4OC0 A;  4NGM A;  2POK A;  3B2Y A;  3PB8 X;  5DS0 A;  3FEE A;  2ZEG A;  4JZ0 A;  3KHZ A;  4ZY0 A;  1BLL E;  4Q7A A;  3FJU A;  1UWY A;  2GLF A;  1TKH A;  3D68 A;  1Y7E A;  3V7Z A;  4OC5 A;  1ZLI A;  2ZOF A;  1RTQ A;  4IHM A;  2PJ4 A;  2C6C A;  3KGQ A;  2QYV A;  1VHO A;  1JQG A;  4NGR A;  4MCQ A;  1AYE A;  4EME A;  2XEG A;  4F9U A;  3K2K A;  4MHN A;  2IMO A;  3S9M A;  1TF9 A;  2ZEF A;  1Z2L A;  1NSA A;  2C1C A;  1Q7L A;  3SJG A;  4NGQ A;  2ZEN A;  1XRY A;  4UIA A;  5IB9 A;  3IC1 A;  1QMU A;  2F8H A;  1DTD A;  2JBK A;  3D7H A;  4JYW A;  3IFE A;  4CPA A;  3NH4 A;  1CG2 A;  1QQ9 A;  1TXR A;  2XEI A;  4RUH A;  4BD9 A;  5LRG A;  1F57 A;  2PJ7 A;  4P45 A;  3KAS A;  1ARL A;  4MXU A;  1CPX A;  4P4I A;  4NJQ A;  4P4J A;  2Q43 A;  1YME A;  3FF3 A;  1ARM A;  3NH8 A;  4P6Y A;  3SI2 A;  3B3C A;  4P4D A;  5CBM A;  3IJ3 A; 
#chains in the Genus database with same CATH topology
 2R1I A;  3CPX A;  4NGS A;  4R57 A;  4DUK A;  1NE9 A;  1ZG7 A;  2Q4Z A;  3RO0 A;  3KQX A;  4CGL A;  3GIU A;  4PXE A;  3C26 A;  2FXF A;  2JDC A;  4KOT A;  1CPS A;  3D8P A;  3SXO A;  2A4N A;  4R9M A;  5KTA A;  4OIW A;  1XMB A;  3N7Z A;  3TTH A;  4NFR A;  2C6G A;  3LWU A;  1ELM P;  4AB7 A;  3EXN A;  2ZW4 A;  1R57 A;  1KUV A;  3SXN A;  3WC5 A;  5D8N A;  2PJC A;  1VGY A;  4U5Y A;  5F09 A;  1KZF A;  5G1Z A;  2EO8 A;  3S6G A;  2ZED A;  4CYP A;  2D4O A;  3IEH A;  1YW6 A;  2ZEO A;  2ZPA A;  2QML A;  4UA3 A;  5FVJ A;  4B5P B;  4TWE A;  3DDD A;  4EWT A;  4ZGY B;  3QNV A;  4AXV A;  4A95 A;  4KZT A;  2PRB A;  4OC3 A;  3D7G A;  2YND A;  4IF5 A;  1IYK A;  5JH9 A;  3IIB A;  3R1K A;  2PSW A;  3NE7 A;  4A30 A;  2PJ6 A;  3KZW A;  4CAX A;  2PRQ A;  3KI9 A;  3PEI A;  2WZN A;  3TX8 A;  2EBJ A;  3OWC A;  2P6G A;  5LRJ A;  4P4E A;  3G8W A;  1YLO A;  1XF8 A;  1H8L A;  3IWW A;  2ZW6 A;  5HVH A;  2J8N A;  2JBJ A;  4A38 A;  2F5I A;  2PJ5 A;  2WSA A;  2CTB A;  1I21 A;  2I3C A;  2YNC C;  2CXA A;  3NH5 A;  2QJ8 A;  3B8G A;  1CP7 A;  2PJ1 A;  2VBQ A;  1XEB A;  2J9A A;  3QB8 A;  4H6Z A;  4WJB A;  3LD2 A;  5F46 A;  2Q4Y A;  5LYL A;  4CAF A;  2QVP A;  3F0A A;  2ZEM A;  4AG9 A;  5AG4 A;  3LAC A;  3P2F A;  3JRU A;  3KR5 A;  2FE7 A;  3H5Z A;  1M1D A;  3PB6 X;  4H89 A;  4K3N A;  3L2N A;  3PFO A;  4UEE A;  4A2Z A;  2FCK A;  2OZU A;  1MJA A;  4C2Z A;  1V0C A;  3RBU A;  2AFO A;  3A9L A;  5CNP A;  4C2Y A;  1YSJ A;  4JJX A;  1VHE A;  4FWU A;  2FT0 A;  4OAE A;  4TNU A;  3WAB A;  1MJB A;  2PJ2 A;  1YW4 A;  2Q4V A;  2R8V A;  4II9 A;  4UCM A;  2JEW A;  2RB7 A;  3WC6 A;  7CPA A;  4MBU A;  3BXM A;  3PFE A;  1S7K A;  2IJZ A;  2REF A;  2J8M A;  2ZEH A;  2Q51 A;  2ZW5 A;  4BBH A;  2O4H A;  2HC9 A;  1CBX A;  2ZW7 A;  3PGP A;  4MFP A;  5D29 A;  2CNM A;  5AG7 A;  4MI4 A;  4F9V A;  2VI7 A;  3ZZI A;  1M44 A;  3BJ8 A;  5K8P A;  2H5M A;  4HKF A;  3UY5 A;  2Z3O A;  3V38 A;  3SJE A;  4FBE A;  4RN7 A;  3R9G A;  4KUA A;  2GIV A;  4MHZ A;  3IU1 A;  4A39 A;  2PJB A;  4HNW B;  5HXD A;  2QIR A;  1Q2Y A;  5KTD A;  3H8E A;  1CX8 A;  4WWV A;  3DSB A;  1U6M A;  1CP6 A;  4UBR A;  4ZX8 A;  2I00 A;  2XEJ A;  2AFS A;  4FD4 A;  4F6A A;  2Q7S A;  1MK4 A;  2B3U A;  4O23 A;  1QSN A;  1I1D A;  4FD6 A;  3BLN A;  1Z4E A;  4A32 A;  4RS2 A;  4KVO E;  1SQH A;  3E0K A;  1VKC A;  4KOY A;  4W9Y A;  3CXS A;  2Z3K A;  1BPN A;  3GB0 A;  3TT2 A;  4OC4 A;  5C88 A;  2OB0 A;  4M6G A;  6CPA A;  1CM0 A;  1J4J A;  1HEE A;  2G3A A;  2DPS A;  2V8D A;  1TIQ A;  4H2K A;  4YRH A;  4PXB A;  2EK8 A;  1YVO A;  3B3V A;  4CAW A;  3GY9 A;  1S7L A;  1B6B A;  2B5G B;  3D3S A;  4MFL A;  5A27 A;  1AUG A;  4X8I A;  4XPK A;  4MCS A;  1BPM A;  1KUY A;  3GYA A;  1HDQ A;  2R7H A;  4P4B A;  4UWJ A;  3KL9 A;  4R3L A;  4DYO A;  4IAV A;  4PK2 A;  1BOB A;  3CT9 A;  3JVN A;  5I0C A;  1GHE A;  3F8K A;  3W6X A;  2GU2 A;  3T90 A;  3D7D A;  2PVV A;  3PBB A;  3VH9 A;  2PCU A;  2C27 A;  5DWN A;  1ZO0 A;  3FIX A;  3FX6 A;  3JTK A;  3LOD A;  4MY0 A;  3TOB A;  3IGR A;  3BI1 A;  3CZX A;  4OID A;  1IGB A;  1ZLH A;  4JWP A;  4MHY A;  3EO4 A;  3CPA A;  3WC7 A;  4ZY1 A;  4PQA A;  2PJA A;  4HNY B;  2FSR A;  2IQ6 A;  4UEF A;  4FUU A;  4KOS A;  4OP4 A;  3B7I A;  3D7F A;  2PJ8 A;  3PB4 X;  3SHP A;  5A28 A;  3IO1 A;  1BO4 A;  2NMT A;  2Z0Z A;  4IUS A;  1IIC A;  3CXQ A;  3I9S A;  2ZEL A;  1NSL A;  3BHX A;  3TO9 A;  3VWE A;  4C7H A;  1VIX A;  2BL1 A;  3K9T A;  1ELL P;  3FNC A;  3TE4 A;  3DNS A;  4X3R A;  5IB0 A;  4PPZ A;  5K8M A;  2B4D B;  4OLL A;  1FY7 A;  4MMO A;  4PSW A;  1KWM A;  5I4M A;  5IX3 A;  2OU2 A;  2BOA A;  2PR8 A;  4HNX B;  4KSA A;  4UEZ A;  5HH1 A;  2G9D A;  2PIY A;  4L89 A;  1YQE A;  2V8V A;  2PE3 A;  2ZOG A;  2VZZ A;  3R9F A;  4PXC A;  1IY7 A;  5LYI A;  4UFW A;  3LMS A;  4KOV A;  2PQ8 A;  3MRU A;  3HLP A;  2VL1 A;  4UIB A;  4PV6 A;  4A31 A;  1TF8 A;  2WYR A;  1EE3 P;  3TFY A;  2PJ3 A;  3KR4 A;  4NCZ A;  5C82 A;  1IOF A;  2PIZ A;  4I49 A;  4YWY A;  4KLW A;  3B35 A;  1ZG9 A;  3IU2 A;  2ATR A;  3SJX A;  4OKO A;  3ZJ0 A;  4NGN A;  5JM6 A;  4R7M A;  4X2T A;  1XBU A;  2Z11 A;  3VAR A;  1LAP A;  5F49 A;  4HPS A;  1PCA A;  3CDX A;  2AE6 A;  2ARH A;  5DWM A;  2P0W A;  3TO6 A;  1CJW A;  3PB9 X;  3MGD A;  3SI1 A;  2QEC A;  2O53 A;  3I3G A;  3VAT A;  3PB7 X;  2ANP A;  4FAI A;  4QC6 A;  3H8F A;  2GRE A;  2PJ9 A;  4GM5 A;  4OC1 A;  2EUI A;  4AVC A;  4C68 A;  2EK9 A;  2VZY A;  1LRZ A;  2WPW A;  4M6H A;  5JQ4 A;  2GE3 A;  3PZJ A;  1Z8X A;  3N5F A;  2EWB A;  4LUA A;  2OZG A;  2O28 A;  2CF4 A;  4R87 A;  3TC8 A;  3FBU A;  4P10 A;  5GCN A;  2DEA A;  1FNO A;  1JWQ A;  2VXK A;  4IK2 A;  2CNS A;  4NSQ A;  4AG7 A;  1Y0Y A;  1RO5 A;  4PSX A;  4CGP A;  4C2X A;  2OR4 A;  3FB3 A;  4NGT A;  3R95 A;  3B3T A;  4ONU A;  3K9U A;  1Z9U A;  4B14 A;  1QSR A;  3FXT A;  1K4J A;  1RXT A;  2CY2 A;  2FIW A;  1M4D A;  3RYO A;  4CRY B;  4R3K A;  1LAM A;  3V8I A;  1XJO A;  2DPT A;  3DR6 A;  4MHP A;  4CYN A;  2ZEE A;  2FIA A;  3ISX A;  2NYQ A;  4U9Z A;  1M4I A;  3PBE A;  2AFU A;  1LCP A;  4JXQ A;  1IID A;  1YGH A;  1NMT A;  1DE4 C;  1XMT A;  2Z3L A;  3RNZ A;  1BAV A;  1S7F A;  3GLJ A;  4ONW A;  5K8N A;  1LAN A;  3S6K A;  4P44 A;  2V8G A;  1YRE A;  4R8F A;  3S9L A;  2VEZ A;  1Q2D A;  1WWZ A;  2AFM A;  3D66 A;  2I79 A;  4MRI A;  2FVG A;  4MFQ A;  3H8G A;  4U9Y A;  3NA6 A;  2R98 A;  2XEF A;  1Y0R A;  5CPA A;  4ZX9 A;  4CAE A;  3WT4 A;  2C6P A;  1VHS A;  2BCO A;  3I1U A;  5EBV A;  4F0X A;  4NEX A;  4A94 A;  4JLY A;  2P6F A;  4JXR A;  2PDO A;  3S9N A;  4OME A;  3DR8 A;  4QB9 A;  2AFW A;  2G3T A;  4CGO A;  2D4P A;  3DGV A;  3QAY A;  3TO7 A;  2CIJ A;  2YGW A;  3GKR A;  3FMC A;  4YU9 A;  2WPX A;  5K8O A;  2RFH A;  1F2P A;  3T8W A;  4EFD A;  1TKJ A;  4MJ8 A;  5LYD A;  4B5P A;  3RAM A;  3BI0 A;  4KVM E;  4KSF A;  4CS0 B;  3KHX A;  2Q7B A;  4CYQ A;  2RC4 A;  2REE A;  1Y9K A;  5ELY A;  5J1Q A;  4OC2 A;  3SJF A;  2V8H A;  1X12 A;  2CTC A;  3EC4 A;  5J8C A;  2AFX A;  3S6F A;  1XFO A;  4DNC A;  1ZG8 A;  3GUX A;  1GYT A;  1UFH A;  3FYN A;  3HUV A;  1OBR A;  1Z8T A;  4ZY2 A;  3VWD A;  1MJ9 A;  2OZH A;  3FEC A;  1Y7R A;  2K5T A;  2HQY A;  4JD6 A;  4MCP A;  4MCR A;  2BO9 A;  3BJ7 A;  1B87 A;  3S6H A;  3R9E A;  4KSI A;  1LOK A;  1S60 A;  1S3Z A;  1S7N A;  4UFX A;  3D67 A;  2BEI A;  4M85 A;  4CGN A;  2PR1 A;  1XIX A;  4P4F A;  4ZI6 A;  1Z5R A;  2B3V A;  1ON0 A;  1FT7 A;  2Q44 A;  4MFJ A;  4LQG A;  1PU9 A;  1P4N A;  2AFZ A;  1Z8L A;  1HDU A;  2JEV A;  4Q36 A;  3P2H A;  4KUB A;  3B3S A;  3ISZ A;  3D4U A;  1YVK A;  8CPA A;  5F47 A;  3PRT A;  4PXD A;  5AG6 A;  3FED A;  4DJL A;  4A33 A;  2ODF A;  2IL4 A;  3FH4 A;  4CAV A;  5F48 A;  1AMP A;  1P0H A;  2Z3P A;  4MFK A;  2OOT A;  4MFZ A;  1A2Z A;  4YFJ A;  4UCN A;  4M3S A;  3FVL A;  4XPL A;  5HVF A;  1IYL A;  1QSM A;  3SI0 A;  5G22 A;  2V77 A;  3NFZ A;  4NJR A;  4FD7 A;  1X10 A;  4ZYQ A;  2Y0M A;  2GLJ A;  2PVW A;  5H84 A;  5JGF A;  1F2O A;  4ZBG A;  3H4Q A;  4B6Z A;  4GXH A;  4UCP A;  2YNE A;  4NGP A;  1R43 A;  1IU8 A;  2PJ0 A;  2Z3M A;  2HV2 A;  2HB6 A;  4CYO A;  5IV0 A;  1R3N A;  2J8R A;  3MN8 A;  4B12 A;  2EVN A;  4UF4 A;  5LRK A;  5ISV A;  2YNC A;  4LX9 A;  2ABZ A;  1Z8W A;  2ZEP A;  4G1P A;  3RZA A;  4BMH A;  4R76 A;  2WUU A;  5LYF A;  1PUA A;  4XPD C;  1PYT B;  3FRM A;  3KQZ A;  3DLJ A;  4A37 A;  2BUE A;  1S5K A;  1TKF A;  2KCW A;  2F7V A;  3B3W A;  1M4L A;  4E0A A;  5KTC A;  5HVG A;  4R6T A;  1QST A;  2NSM A;  4XNH C;  3G3S A;  4RI1 A;  1LFW A;  2GAN A;  4F8Z A;  5THW A;  4Z65 A;  4Q38 A;  3T9Y A;  4MY3 A;  2VQY A;  4OC0 A;  4X5K A;  2P6E A;  5BWA B;  2BSW A;  2FS5 A;  1OZP A;  4QVT A;  4CRZ B;  4C7I A;  4F0Y A;  3QAH A;  4NGM A;  2POK A;  3B2Y A;  3PB8 X;  4KS9 A;  4KVX A;  5G20 A;  3EY5 A;  5DS0 A;  4AVB A;  1YX0 A;  4B5O A;  4E8O A;  3FEE A;  3W6S A;  4M6I A;  4MHD A;  2ZEG A;  4JZ0 A;  3KHZ A;  2JDD A;  5H86 A;  4E2A A;  4ZY0 A;  1BLL E;  3CXP A;  4Q7A A;  3FJU A;  1UWY A;  2B5G A;  2JLM A;  4BIN A;  3R96 A;  2FL4 A;  2GLF A;  3W91 A;  1TKH A;  5J8F A;  3D68 A;  4UFV A;  1Y7E A;  3V7Z A;  4OC5 A;  1KUX A;  1ZLI A;  2ZOF A;  1RTQ A;  5EC4 A;  4ORF A;  1QSO A;  4IHM A;  2PJ4 A;  1YK3 A;  2C6C A;  1M4G A;  2HUZ A;  3KGQ A;  4Y49 C;  1Z4R A;  4UWI A;  4B11 A;  2PC1 A;  2QYV A;  4KOU A;  3TOA A;  1VHO A;  4XPD B;  1JQG A;  5E96 A;  4NGR A;  4MCQ A;  1AYE A;  2B4B A;  3IWE A;  4EME A;  4YGO A;  2XEG A;  4F9U A;  3K2K A;  1WK4 A;  2X7B A;  4MHN A;  2IMO A;  3NE8 A;  4XNH B;  3S9M A;  4KOW A;  2GFQ A;  1TF9 A;  2ZEF A;  1YR0 A;  1NSA A;  1Z2L A;  1Q7L A;  2C1C A;  4OAD A;  4KOR A;  1XOV A;  3SJG A;  4NGQ A;  4AVA A;  2ZEN A;  1IB1 E;  1XRY A;  4UIA A;  2ZXV A;  5IB9 A;  3IC1 A;  4L8A A;  2G0B A;  1QMU A;  2F8H A;  1DTD A;  2JBK A;  3D7H A;  3D2M A;  4JYW A;  2Z10 A;  4LQ6 A;  4KOX A;  3IFE A;  3TCV A;  1IOI A;  4CPA A;  4PK3 A;  4B13 A;  1Y9W A;  1I12 A;  3NH4 A;  5AG5 A;  1CG2 A;  1QQ9 A;  1TXR A;  2B4D A;  2Q04 A;  2B58 A;  3KKW A;  1Q2C A;  4K30 A;  4KLV A;  2XEI A;  4NXY A;  4RUH A;  1YLE A;  4FD5 A;  3F5B A;  3PP9 A;  5G21 A;  4GS4 A;  4BD9 A;  5HMN A;  2DXQ A;  5LRG A;  5JPH A;  1F57 A;  2PJ7 A;  4P45 A;  1L0C A;  2AJ6 A;  4Y49 B;  5AGE A;  3EFA A;  3KAS A;  1ARL A;  4MXU A;  1CPX A;  4H6U A;  3JUW A;  4P4I A;  3WR7 A;  5EMI A;  4EVY A;  4NJQ A;  4P4J A;  2Q43 A;  3D2P A;  4J3G A;  4QUS A;  4CGM A;  1YME A;  3FF3 A;  1XE4 A;  3IWG A;  2Z3N A;  1ARM A;  2OH1 A;  2Q0Y A;  3NH8 A;  4P6Y A;  4NF1 A;  2DF5 A;  3SI2 A;  3B3C A;  4B10 A;  1N71 A;  2CNT A;  4P4D A;  4QBJ A;  5CBM A;  3IJ3 A; 
#chains in the Genus database with same CATH homology
 3CPX A;  4NGS A;  4DUK A;  1ZG7 A;  2Q4Z A;  3KQX A;  4PXE A;  1CPS A;  4OIW A;  1XMB A;  4NFR A;  2C6G A;  3LWU A;  1ELM P;  3WC5 A;  5D8N A;  2PJC A;  1VGY A;  5F09 A;  2ZED A;  3IEH A;  1YW6 A;  2ZEO A;  4TWE A;  4EWT A;  3QNV A;  4AXV A;  4OC3 A;  3D7G A;  5JH9 A;  3IIB A;  2PJ6 A;  3KZW A;  2PRQ A;  3KI9 A;  3PEI A;  2WZN A;  3TX8 A;  5LRJ A;  4P4E A;  1YLO A;  3IWW A;  1H8L A;  5HVH A;  2JBJ A;  4A38 A;  2PJ5 A;  2CTB A;  2I3C A;  3NH5 A;  2QJ8 A;  1CP7 A;  2PJ1 A;  2J9A A;  4WJB A;  5LYL A;  2QVP A;  2ZEM A;  3JRU A;  3KR5 A;  4K3N A;  3PB6 X;  3L2N A;  3PFO A;  4UEE A;  3RBU A;  2AFO A;  1YSJ A;  1VHE A;  4FWU A;  4TNU A;  3WAB A;  2PJ2 A;  1YW4 A;  2JEW A;  2RB7 A;  3WC6 A;  7CPA A;  3BXM A;  3PFE A;  2IJZ A;  2ZEH A;  2Q51 A;  2O4H A;  2HC9 A;  1CBX A;  5D29 A;  4F9V A;  5K8P A;  4FBE A;  3V38 A;  3SJE A;  4MHZ A;  4A39 A;  2PJB A;  5HXD A;  3H8E A;  1CX8 A;  4WWV A;  1CP6 A;  4ZX8 A;  2XEJ A;  2AFS A;  4O23 A;  4W9Y A;  1BPN A;  3GB0 A;  4OC4 A;  6CPA A;  1HEE A;  2V8D A;  4H2K A;  4PXB A;  2EK8 A;  3B3V A;  4X8I A;  4MCS A;  1BPM A;  1HDQ A;  4P4B A;  3KL9 A;  4DYO A;  4IAV A;  3CT9 A;  2GU2 A;  3D7D A;  2PVV A;  3PBB A;  3VH9 A;  2PCU A;  3FX6 A;  4OID A;  3BI1 A;  1IGB A;  1ZLH A;  4MHY A;  3CPA A;  3WC7 A;  4ZY1 A;  4PQA A;  2PJA A;  2IQ6 A;  4UEF A;  4FUU A;  4OP4 A;  3B7I A;  3D7F A;  2PJ8 A;  3PB4 X;  3IO1 A;  2ZEL A;  3BHX A;  1VIX A;  3K9T A;  1ELL P;  4X3R A;  4PPZ A;  5K8M A;  4MMO A;  5I4M A;  1KWM A;  2BOA A;  4UEZ A;  2G9D A;  2PIY A;  2V8V A;  2PE3 A;  2ZOG A;  4PXC A;  1IY7 A;  5LYI A;  3LMS A;  3MRU A;  3HLP A;  2VL1 A;  4UIB A;  1TF8 A;  2WYR A;  1EE3 P;  2PJ3 A;  3KR4 A;  2PIZ A;  4YWY A;  3B35 A;  1ZG9 A;  3SJX A;  4OKO A;  4NGN A;  5JM6 A;  4R7M A;  4X2T A;  1XBU A;  3VAR A;  1LAP A;  1PCA A;  3CDX A;  3PB9 X;  3SI1 A;  2O53 A;  3VAT A;  3PB7 X;  2ANP A;  4FAI A;  3H8F A;  2GRE A;  2PJ9 A;  4GM5 A;  4OC1 A;  2EK9 A;  3N5F A;  2EWB A;  2CF4 A;  3TC8 A;  4P10 A;  2DEA A;  1FNO A;  4IK2 A;  1Y0Y A;  2OR4 A;  4NGT A;  3B3T A;  1LAM A;  1XJO A;  4MHP A;  2ZEE A;  3ISX A;  2NYQ A;  3PBE A;  2AFU A;  1LCP A;  1DE4 C;  1BAV A;  3GLJ A;  4ONW A;  5K8N A;  1LAN A;  4P44 A;  2V8G A;  3S9L A;  4R8F A;  3D66 A;  2AFM A;  4MRI A;  2FVG A;  3H8G A;  3NA6 A;  2XEF A;  1Y0R A;  5CPA A;  4ZX9 A;  3WT4 A;  2C6P A;  2BCO A;  3I1U A;  4A94 A;  3S9N A;  4OME A;  2AFW A;  3DGV A;  2CIJ A;  4YU9 A;  3FMC A;  5K8O A;  2RFH A;  1F2P A;  3T8W A;  4EFD A;  1TKJ A;  5LYD A;  3RAM A;  3BI0 A;  3KHX A;  5ELY A;  5J1Q A;  4OC2 A;  3SJF A;  2V8H A;  2CTC A;  2AFX A;  1XFO A;  1ZG8 A;  3GUX A;  1GYT A;  3HUV A;  1OBR A;  4ZY2 A;  3FEC A;  4MCP A;  4MCR A;  2BO9 A;  4KSI A;  1LOK A;  3D67 A;  4P4F A;  4ZI6 A;  1Z5R A;  1FT7 A;  4LQG A;  2AFZ A;  1Z8L A;  1HDU A;  3B3S A;  3ISZ A;  3D4U A;  8CPA A;  3PRT A;  4PXD A;  3FED A;  4DJL A;  3FH4 A;  2OOT A;  1AMP A;  3FVL A;  5HVF A;  3SI0 A;  2V77 A;  3NFZ A;  4NJR A;  4ZYQ A;  5JGF A;  2GLJ A;  2PVW A;  1F2O A;  4B6Z A;  4NGP A;  1R43 A;  2PJ0 A;  2HB6 A;  1R3N A;  3MN8 A;  4UF4 A;  5LRK A;  2ABZ A;  2ZEP A;  4G1P A;  3RZA A;  4R76 A;  5LYF A;  1PYT B;  3KQZ A;  3DLJ A;  4A37 A;  1TKF A;  2F7V A;  3B3W A;  1M4L A;  5HVG A;  4R6T A;  2NSM A;  1LFW A;  4F8Z A;  5THW A;  4Z65 A;  4OC0 A;  4NGM A;  2POK A;  3B2Y A;  3PB8 X;  5DS0 A;  3FEE A;  2ZEG A;  4JZ0 A;  3KHZ A;  4ZY0 A;  1BLL E;  4Q7A A;  3FJU A;  1UWY A;  2GLF A;  1TKH A;  3D68 A;  1Y7E A;  3V7Z A;  4OC5 A;  1ZLI A;  2ZOF A;  1RTQ A;  4IHM A;  2PJ4 A;  2C6C A;  3KGQ A;  2QYV A;  1VHO A;  1JQG A;  4NGR A;  4MCQ A;  1AYE A;  4EME A;  2XEG A;  4F9U A;  3K2K A;  4MHN A;  2IMO A;  3S9M A;  1TF9 A;  2ZEF A;  1Z2L A;  1NSA A;  2C1C A;  1Q7L A;  3SJG A;  4NGQ A;  2ZEN A;  1XRY A;  4UIA A;  5IB9 A;  3IC1 A;  1QMU A;  2F8H A;  1DTD A;  2JBK A;  3D7H A;  4JYW A;  3IFE A;  4CPA A;  3NH4 A;  1CG2 A;  1QQ9 A;  1TXR A;  2XEI A;  4RUH A;  4BD9 A;  5LRG A;  1F57 A;  2PJ7 A;  4P45 A;  3KAS A;  1ARL A;  4MXU A;  1CPX A;  4P4I A;  4NJQ A;  4P4J A;  2Q43 A;  1YME A;  3FF3 A;  1ARM A;  3NH8 A;  4P6Y A;  3SI2 A;  3B3C A;  4P4D A;  5CBM A;  3IJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...