4G1PA

Structural and mechanistic basis of substrate recognition by novel di-peptidase dug1p from saccharomyces cerevisiae
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
480
structure length
479
Chain Sequence
b'MSHSLTSVFQKIDSLKPQFFSRLTKAIQIPAVSSDESLRSKVFDKAKFISEQLSQSGFHDIKMVDLGIQPPPSTPNLSLPPVILSRFGSDPSKKTVLVYGHYDVQPAQLEDGWDTEPFKLVIDEAKGIMKGRGVTDDTGPLLSWINVVDAFKASGQEFPVNLVTCFEGMEESGSLKLDELIKKEANGYFKGVDAVCISDNYWLGTKKPVLTYGLRGCNYYQTIIEGPSADLHSGIFGGVVAEPMIDLMQVLGSLVDSKGKILIDGIDEMVAPLTEKEKALYKDIEFSVEELNAATGSKTSLYDKKEDILMHRWRYPSLSIHGVEGAFSAQGAKTVIPAKVFGKFSIRTVPDMDSEKLTSLVQKHCDAKFKSLNSPNKCRTELIHDGAYWVSDPFNAQFTAAKKATKLVYGVDPDFTREGGSIPITLTFQDALNTSVLLLPMGRGDDGAHSINEKLDISNFVGGMKTMAAYLQYYSESPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cys-Gly metallodipeptidase DUG1
publication title Structural and Mechanistic Basis of Substrate Recognition by Novel Di-peptidase Dug1p From Saccromyces cerevesiae
rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 144
structure length 479
sequence length 480
ec nomenclature ec 3.4.13.-:
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1pA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4g1pA01
1ZG9A 2PJ5A 1LANA 1H8LA 3B3CA 4OC5A 2JBJA 2XEIA 4RUHA 1CPSA 4ZY0A 5CBMA 1DE4C 1ZG8A 2ZEPA 4MXUA 3FX6A 3ISXA 4X8IA 1ZG7A 4P4IA 4ZYQA 2Q43A 3PB9X 4IK2A 1IY7A 3WC7A 3JRUA 2PJAA 4DJLA 1QMUA 1R3NA 1FNOA 3KR4A 5HXDA 5D8NA 1KWMA 4Q7AA 3WABA 3TX8A 1VHOA 2PJ3A 3MRUA 4P10A 4OIWA 3S9NA 3SJXA 3I1UA 4P4DA 2ZOFA 1TXRA 4F9UA 2ABZA 1BAVA 4W9YA 4AXVA 1BPMA 2C6PA 2F8HA 4ONWA 3HLPA 1Z8LA 4MCRA 5D29A 5THWA 2PCUA 2XEFA 1F2OA 3IO1A 2AFZA 4ZY2A 4X3RA 1VHEA 1HDUA 4MCPA 3CPXA 4UF4A 1Y0YA 2PJ8A 3NH4A 1LOKA 3LMSA 1LAMA 4UEEA 1UWYA 1FT7A 2V8HA 5ELYA 4PXDA 3B2YA 4A39A 4MCQA 1GYTA 1TKHA 3LWUA 3RBUA 1TF8A 1M4LA 1NSAA 2ZEFA 4WJBA 2NYQA 1XFOA 3IWWA 5J1QA 2ZEDA 3B7IA 2ZEHA 3WT4A 4PXBA 4PPZA 5CPAA 3KI9A 1CP6A 3WC6A 2GU2A 4NGNA 2ZELA 3H8FA 4FBEA 4ZX9A 4FWUA 5LRJA 2AFUA 2QVPA 3NH8A 4OIDA 2PJ1A 4BD9A 3DLJA 3D7FA 2VL1A 4GM5A 4LQGA 2QYVA 3GUXA 2FVGA 4MHZA 1RTQA 1TKFA 2ZEGA 4UIAA 4MRIA 4MMOA 3H8EA 4NGQA 2CIJA 5HVFA 3QNVA 4OKOA 4R7MA 1EE3P 2HC9A 1XMBA 2PVVA 4MCSA 3BXMA 1ARLA 4PXCA 5K8MA 5I4MA 5LYFA 1XJOA 3FEEA 5JM6A 2C1CA 1LCPA 3IJ3A 3V7ZA 4P45A 4NJRA 5LYDA 1XRYA 4OC0A 1F57A 3RAMA 3NFZA 1Q7LA 3FH4A 2F7VA 2QJ8A 4IAVA 1BPNA 3D7HA 2IMOA 3B35A 4NGPA 4A37A 2EK8A 4H2KA 3SJGA 2O53A 3CT9A 2PVWA 2V8GA 4P4JA 1Y7EA 3PB6X 2AFMA 4K3NA 1AMPA 4EFDA 2PJCA 3K2KA 5K8OA 5LRKA 2Q51A 3FVLA 5LRGA 2EK9A 3IFEA 3B3TA 1Y0RA 3PEIA 4P4BA 4ZY1A 1DTDA 2GLJA 3PRTA 1HEEA 1F2PA 2ZEEA 4OC4A 3D68A 2J9AA 5K8PA 3CPAA 4F8ZA 4EWTA 2G9DA 3KL9A 2XEJA 3IC1A 2JBKA 1IGBA 4EMEA 2PE3A 4G1PA 3KGQA 4TWEA 4IHMA 2CTBA 4NGMA 2ANPA 2IQ6A 4ZI6A 1ARMA 4UEFA 2DEAA 4NGRA 2XEGA 1TKJA 5HVHA 2WZNA 1ZLIA 3SI1A 4NGTA 1Z2LA 2PIYA 3D4UA 1TF9A 2V8VA 4A38A 4MHYA 2ZENA 2GREA 1PYTB 4JYWA 3K9TA 2RB7A 3FMCA 1CBXA 3SI2A 4P6YA 2BO9A 1BLLE 3PBBA 4OC2A 2BOAA 4P4FA 2BCOA 2ZEMA 4MHNA 1VIXA 2C6CA 3VH9A 2PRQA 3CDXA 3ISZA 1AYEA 4F9VA 4Z65A 2I3CA 6CPAA 3GB0A 4JZ0A 3T8WA 4ZX8A 3PB4X 3RZAA 4P4EA 1ELMP 4DUKA 2V77A 3KQZA 2PJ2A 3SI0A 2V8DA 3B3VA 2PJ6A 4WWVA 2CF4A 5LYLA 3B3SA 2POKA 1PCAA 4FUUA 1YLOA 2WYRA 2NSMA 1HDQA 3B3WA 5DS0A 4CPAA 4NFRA 2AFWA 3FF3A 4P44A 3BHXA 2PJ4A 2HB6A 5F09A 4FAIA 5IB9A 4UIBA 3VARA 7CPAA 2AFXA 2ZOGA 2ZEOA 1ZLHA 3S9LA 4OC3A 2AFOA 1LAPA 4KSIA 3PFEA 3PBEA 3PB7X 8CPAA 3FEDA 3BI1A 4YWYA 4OMEA 1CX8A 4OC1A 3S9MA 4TNUA 1YSJA 5K8NA 3D7DA 2PJ7A 3HUVA 3DGVA 4NGSA 1XBUA 1YW4A 3D66A 3VATA 1LFWA 2C6GA 2OR4A 4OP4A 4B6ZA 3GLJA 2OOTA 3MN8A 3PFOA 4R6TA 4MHPA 4DYOA 3PB8X 4NJQA 4UEZA 2PJ0A 1CP7A 2Q4ZA 3N5FA 3NH5A 1JQGA 2JEWA 4R76A 1OBRA 1QQ9A 3D7GA 3BI0A 2RFHA 5HVGA 4O23A 3FECA 4R8FA 3KZWA 1CG2A 3KHXA 1Z5RA 3SJEA 2CTCA 1YW6A 3KASA 3TC8A 1ELLP 4PQAA 2GLFA 4X2TA 3KR5A 3IEHA 3KQXA 2PJ9A 3KHZA 3V38A 5LYIA 3SJFA 4PXEA 2IJZA 4YU9A 1R43A 1YMEA 3IIBA 3WC5A 2PJBA 3H8GA 2PIZA 3FJUA 4A94A 5JGFA 3D67A 2EWBA 3L2NA 3NA6A 2O4HA 5JH9A 2AFSA 1CPXA 1VGYA
chains in the Genus database with same CATH superfamily
1FA0A 2Z58B 4OC5A 1H8LA 4OADA 4IG3A 1VR6A 3M8SA 3D54A 2BL1A 3FZBA 3UDLA 4LQ9A 4CO2A 3QRRA 1IOIA 2R7HA 3FSYA 4C97A 2Y8YA 2VFRA 2V2KA 3TA0A 1PC4A 3PKMA 4TY8B 3KLGA 4CAEA 1S48A 4LIRA 9RUBA 2VPYB 1M5HA 3TJ8A 3P2FA 2DITA 1IBKF 2BXJA 3RBDA 1DJ0A 1X60A 3MCOA 2DXEA 1KR4A 2NLWA 1NCLA 2CWXA 3MRUA 4BDPA 3OTEA 3CJSA 4MI4A 4F9UA 2ABZA 5F3ZA 4B3MJ 4DL2A 3IU2A 2HUZA 5EDWA 5B0BA 1JLQA 4ONWA 3HLPA 2DH9A 1Y0HA 4ED8A 2B5GA 2PCUA 4CWBA 1P9QC 3O1LA 4LFBJ 3W64A 1CVJA 3AQOA 1CLFA 4A48A 3VALA 5K14B 3UNGC 2F1FA 4X3RA 2HHQA 1U1QA 4MCPA 5G4DA 4ILLA 1H98A 2LEPA 4II9A 3ILJA 1FT7A 2OD4A 2W01A 3FRYA 4A39A 3KG4A 3MF5A 5A8RA 2FHKA 1D9FA 1NSAA 3OL9A 1Q2YA 3K57A 1VHFA 4G6VB 4MYTA 1UWBA 4HT5A 5EBVA 2D74B 5CPAA 1MMNA 5JJBA 1RHQB 4LFAJ 3R5JB 1SC1B 3GU0A 1C1BA 1KQFB 3L3CA 1DRZA 4HLBA 2VL1A 4F6AA 3CD0A 3NBPB 2VIHA 2QYVA 1S7LA 1WC0A 3VR1A 2Y0SD 3W9JA 3QT7A 1NJIT 1M1KT 2RAQA 1HA1A 1RT1B 2YGWA 2VEZA 2AKWB 1K47A 4QYZJ 4GRSA 3G8TA 2CIJA 4OKOA 2BJDA 1KTVA 2PVVA 1TL4A 4WCEQ 2JEJA 3LP2A 4DL6A 5T7LB 3R5DA 3TUPA 3D3BJ 3TANA 4K5RA 4O4GB 4B9SA 1F57A 3GJTB 3DYAB 1N0UA 3G9CA 5B0GA 3NFZA 3UNYA 4HH1A 3FH4A 5C7PA 2OFHX 2KT5A 2HYIB 3MMCA 1NE9A 2L3MA 4C2MA 4ES2A 5IOLA 1V3RA 2OPPB 3DLGB 2MKSA 4DV0F 1FTCA 4LF5F 2UUBJ 5AXMA 5LXYA 4WFBQ 1CQMA 3SQOP 4A8YA 2YKMA 2IA6A 3PRTA 4HEA9 4CGMA 4AE5A 4A8WA 1BWVA 5L38A 3NLCA 2BW7A 3MEKA 1IU8A 2XEJA 3MTKA 3PR5B 4EZ9A 4EMEA 4AXIA 3RR7A 2HS0A 1EQ0A 3W66A 1VKCA 4HHJA 1WI8A 2X3GA 1JKHB 5CXTA 1IKWB 2J0SD 3CZXA 3SZ2A 3ZZOA 3FBCA 4H6ZA 5LL6d 2ZFHA 3BQ2A 4MFPA 4OQJA 4DV2J 3K9TA 5D4OA 1TK0A 3OFEA 5DG9A 4GKJJ 5F0WA 1R8AA 3AOBA 1GX5A 4ZOSA 1PUAA 2REEA 1K44A 1JLAB 4AT1B 4MHNA 1VRTB 1Q1KA 4C0BA 3H2LA 3P49B 3SBMA 4H4MA 3HVTB 3VF0B 4RNMA 3GB0A 1T8EA 2ZH6A 2QTWA 1V3SA 4ZX8A 3R5AA 4NLPA 2LA6A 2GFQA 2BOPA 2EK6A 2YX4A 3AJ2A 5L1IA 4ZIVA 4K4VA 1UA0A 2DR8A 3VAIA 2HS4A 2IJRA 1S4EA 1M1HA 2XZTB 2CNTA 4RNOA 2CRLA 4NWBA 1DTQA 2HHSA 3SSSA 1RWKB 4U9YA 4OX6A 2AP6A 5H9FJ 3ULHA 2YWEA 1TFWA 2XMWA 1M1GA 2IJNA 2CJYB 4DQPA 2ZOGA 3G86A 2OFGX 1OWXA 4J91A 4GKKJ 2LU2A 1RT3A 4CYQA 1ZM9A 1M5OC 1NHKL 2N3LA 2VQEF 4OMEA 2BRLA 5K8NA 3SSRA 4FS1A 1S10A 4A8SA 1RT4A 2CG4A 3W63A 2VZ9A 3ILLA 1JLBA 2EO8A 4OP4A 4WYWA 1JJCB 4B3SJ 3GQCA 2HHWA 2MQOA 3AB2B 2FLPA 4WFNQ 4FN5A 4RS2A 3DRPB 4MT1A 1LW2A 4OI3A 2PDOA 3A13A 1D09B 1CULA 2QZ8A 1ZZFA 4EBCA 2V63A 3OT9A 3KHXA 1RK8A 4PYAA 1RISA 2PI5A 3TC8A 3U7JA 2GLFA 2V50A 2CPHA 1N6QA 3WDOA 1Q78A 2ZDPA 1WC6A 1SC6A 1U0HB 2CPIA 2J8SA 1KEKA 1X8DA 3M30B 2XSJA 4M5MA 2LQJA 4A94A 3MPWA 4AD6A 1FRKA 3MM5B 1FFGB 4DR5J 4B9LA 2O4HA 1NHUA 2AFSA 4ZDNA 3ETMA 3G6YA 5IFMA 2JBJA 2XEIA 4RUHA 1R8CA 3TAPA 2UUAJ 4B9VA 2X1FA 2FLLA 4AQYF 5LM7E 5IQQA 2DJWA 4WIQA 4CM2A 5D4NA 9ATCB 2KXNB 4LF6J 1XMOJ 5D0HA 2J8NA 3HLUA 2I5JA 2IVYA 3TZWA 3BSAA 1S1TB 3MWBA 4DBQA 3ENWA 3DU5A 3NNAA 1WF2A 2JEVA 2HVDA 3MMBA 3SQGB 2FPHX 2C28A 1VS3A 4KBIA 3BKUA 1UA1A 2APOA 2A10A 2ZOFA 3LGHA 1U49A 3LPYA 4J9QA 1Z4EA 2XMUA 4ZVEA 4F25A 3BEGB 1CJTB 3DDNA 3DRRB 4FD5A 5J2QA 5F8LA 1EETA 2BDPA 4OAEA 3KLHB 4WF9Q 1X5PA 1T3NA 4YN3B 1RTDB 3EGWB 4RI1A 3EPGA 1X4BA 2H4WB 4TN2A 1V3ZA 3GV5B 4WFZA 3B2YA 2CXEA 5KG3A 2AJ1A 2XWYA 2Z30B 3M8ZA 4ECWA 1CJWA 2BANB 1ZH5A 3WT4A 1RLDA 4LF8F 2E29A 4DX7A 4K59A 2NYIA 2NR0A 3C16B 4LR7A 5A8KB 3CGIA 4BD9A 4CLZA 3H8YA 4MJKA 4OLLA 2O5DA 1RHJB 4YOEA 4UCMA 2Y1IA 8RUCA 1UP1A 1TKFA 2V9KA 2V2VA 3RAQA 4ZPAA 1R57A 5L1LA 4PEOA 1FVQA 4CH0S 4Z7YA 2QT7A 2VG6B 3GIRA 3MDFA 3BN7A 2CQ2A 3ISNC 2HC9A 4YB7A 4RO0A 4MCSA 4HI1A 3ICLA 5CAAA 2CJQA 5A28A 5LYFA 3IWLA 3NL0A 1ZA2B 4J3GA 3DOMA 4LSZB 3AOCA 3HMJG 1W7WA 4DSLA 4R5PB 1ON0A 1FRIA 4H2KA 5L9NA 3SJGA 2O53A 3CT9A 4W4MA 3KHGA 2NCKL 1N5SA 1B6BA 3CO0P 2V68A 2HVHA 1VHSA 1IBLF 1NJWA 4CRYB 3IBFB 4L6V3 3R3TA 2IAJB 2I1RA 4P4BA 3KK3A 3B6BA 4F3OA 3TA2A 2WBMA 2OTLS 2XSFA 1CSJA 3ILOA 5DS7A 3MURP 2YQ0A 4IHMA 4RW9B 4M5GA 3LQVA 3C6TB 2XMKA 1N33J 4AL6A 4L89A 3Q8VA 1Q5VA 4FKXA 3JSBA 1NK9A 1Z2LA 4R9MA 4DSIA 4QWAA 1R31A 1RKJA 3S6HA 4V1Ak 4KHPF 2RILA 3H42A 4YHHJ 2A2DA 3A8KA 3PO4A 2CUYA 1S6PB 3CCZA 1CS4A 4NLOA 3SIPB 4IDKB 4CLYA 5CABA 2MLYA 1WKJA 2R8JA 4M5KA 1S7IA 2LYVA 3PNIA 1K9MT 3P4UB 3VH9A 4BC9A 1FK9B 3CDXA 1CJUB 4XO0A 2IJFA 4ILRA 3OW2R 2IC3B 4KR0B 2G0BA 1CJKA 1RAAB 4J9UE 1RB0A 1QSTA 4HACB 4WBFA 2QN6B 4CZCA 4DUZF 2OH2A 3NS5A 4WFXA 1S6UA 2WYRA 3NY0A 4HHUA 4CPAA 4CLSA 2R8GA 1BMQB 1GNKA 2OKQA 2DNYA 3IGVA 1CM0A 2WVFA 3EXYA 4CO0A 4J9LA 1RHRB 4BINA 2Z3MA 3IM8A 1Z4UA 3Q8RB 4PG7A 1O6XA 2VBYA 3DGVA 1AA1B 4Q2LA 1S72S 1KTQA 4JI2F 1R0AB 3Q83A 3Q89A 3I4HX 4USHA 3IWXA 3NRBA 3ZO7A 3D0HE 2WBRA 3DC2A 3OR2A 4NZ6A 2VOPA 2M0GB 1O5JA 1TKZA 3D0GE 3FMBA 3KHLA 1BQMB 3M8PB 1TL7A 1LW0B 4O23A 4CYOA 3V6JA 4ECUA 3OWCA 3CXCR 3AY0A 5CYJA 3O3LA 2GS8A 2OP5A 4DZ6A 3KHZA 4NCGB 2IJZA 3C3LA 4FNIA 4KH1B 4BC7A 2DYAA 4DQQA 2KYZA 4Y2AA 5DRKA 2ZKUA 1I1GA 4ZVHA 1HWKA 3DRSA 2PGCA 4EUVA 2G2YA 2ABYA 4JYAF 2GIVA 3CMAS 2W2MP 4WXOA 3JQMA 3TAMB 1WC3A 2ASLA 4YY3J 2D41A 4QVTA 4F67A 3BJYA 1L3SA 4M6IA 1VQOS 4RLEA 1SQFA 5DQGA 1UJ6A 2H54B 1MJ9A 4ZYQA 2KHDA 3KG0A 2EFOA 3FFIA 2BJ1A 5DQIA 1XIQA 3DHWC 4DS4A 4S0MA 3POTA 2XYPB 4DV7J 1R3NA 3IRXB 1TUGB 3EVMA 3T5LA 5IWAJ 2XO6A 1MWQA 3WABA 4LSLA 2D1CA 3WR7A 2PJ3A 2B8QA 5C24B 4IQMA 3GZ7A 2BX6A 4OV6A 1HWJA 3G8SA 2A3JA 3MUTP 1HBMA 4UCPA 2J9DE 3CEDA 3A8EA 3VAFA 3KLFB 1VC6A 2VBZA 3UCZP 2V5HG 4EFAC 1S1XB 2BRKA 4K4SA 1RAFB 1X4DA 1BC6A 2HBQB 1REVA 4OYPA 3SCKE 2NSBA 2PE8A 3IP0A 4F4ZA 2A4NA 1F3VA 4JI6J 1HW9A 3BGRA 1TKHA 1Q8KA 3G6ES 3W2VA 5KOWA 4WJBA 4M6GA 1RCXB 3CVKA 3I0SA 1C0UB 2CDRB 2QMXA 3CULA 1M0SA 1MN7A 3EGZA 2BSWA 1RO5A 4IRCA 3E8OA 1TP7A 3MCMA 2PJ1A 3X1LB 2R7VA 3A9LA 1I12A 4UOGA 2NXNA 3FIXA 1XJWB 1ZPVA 3KLEA 3K5OA 3FCWA 4PR6A 1N5YA 4A46A 1BUXA 4J5OA 1H2TZ 4FF2A 1BHNA 4URQU 1Y7RA 1YRXA 2OEJA 1IR1A 2QMUB 1TVRA 4CGNA 1YI2S 4WZQA 1BQNA 1TL1B 1WDDA 1VI7A 4NJRA 1TAQA 2WW4A 4QWCA 3NCRA 2PR8A 2W7OA 3HZEA 3GCXP 1Q7LA 5AG5A 3EUNA 3OR1A 4GVBA 3D6HB 3MMAA 2GO8A 2MMYA 2PSZA 5KFOA 1A6LA 2FGCA 4KPYA 5C5JA 2XLJA 4R25A 4BBYA 1Z1ZA 4RW6A 4CYUB 4L8AA 3JSMA 2Q51A 1S9GA 1RHMB 2KRBA 3IFEA 2MB0B 3RR8A 3HKZD 2YQ3A 3PHEA 4OYIA 4XDCA 4B3TJ 3I9ZA 3QWUA 3TOQA 1QVFR 1FKPA 3CJKA 5KG5A 2R7WA 2FGOA 2BE9B 1IYLA 2G13A 4G1PA 2J6UA 1N36F 5E3CA 2HMIA 2WVBA 2ATRA 2MXYA 1Q8IA 1TKJA 3QAYA 3SI1A 1ZYQA 2QLBB 3M2RB 4ECQA 1C2PA 4UQTA 5F8GA 3PX0A 3LP1A 2CQ4A 5GMKa 4YP3A 2CQIA 2RB7A 3LALA 3DM2B 3IWNC 1N4LA 2FIAA 1I6JA 5D4LA 4ENOA 2A18A 2WSEC 2E9ZA 2LECA 2CKWA 1OSCA 3IG1A 3EC4A 4C7HA 1H3DA 5H9FK 1JXVA 4Z65A 3UR3C 4MKBA 3M9NB 5M2UA 4DF4A 1S59A 1SV5B 2PSWA 1C0TA 2W25A 1FX4A 3UN3A 3GR0A 1FDNA 2M3DA 1XOVA 2MHNA 2NSMA 1HDQA 4C2ZA 5IC4B 2PT0A 3VVTA 4V19X 3BHXA 4Y2CA 2DHHA 7CPAA 2FCKA 1S57A 4ZPVR 1S76D 4A8OA 4TYBA 4C8YA 3NGRA 1ZLHA 4OC3A 2QA1A 1TR0A 4O3QA 4ICLA 2ZNZA 3ZZ0A 5LJ5Y 2Q44A 4Y2KA 3PBEA 5LSRA 4LRDA 3EDRB 1YSJA 3R97A 4KHMA 2ZDOA 4A2ZA 2CQGA 3BYRA 1FD2A 2MSTA 3GLJA 3HP6A 1RTIB 3DDIA 4IG0A 3A4TA 1I3OB 1ZM2A 1M90T 4ZMMA 3FC9A 3H25A 4HHHA 2OAUA 2HURA 3OFFA 5LMUJ 5SZTA 1SJRA 4ETXA 1XIXA 4NJQA 4U96A 1KZFA 1RWNB 3TZZA 2KT3A 4NLTA 4W90B 3CD6S 3AA8A 2FUG9 2RFHA 3C6UB 1F2HA 4IFYA 1SH3A 4HTJA 4M5NA 4G1IA 2E9RX 4PG6A 1FHTA 2MQQA 3HHLD 1QAYA 1AW0A 3P5BP 2RRNA 1QTMA 4JXQA 1EZZB 4LMZA 1VK8A 1X9SA 3NAIA 3NE7A 1NHVA 1HARA 4UBRA 5AXKA 2IRYA 3UY5A 1APSA 4DV4F 1CPZA 4NCBA 1UL3A 4LR8A 2AHOB 2PJ5A 4Q45A 4USTA 5AJ3J 2VC0A 3M6WA 3KJVA 2B4VA 1DE4C 3QT5A 4H4KA 4DL7A 3DN9A 2UVWA 1S1VB 3JRUA 3BGFA 2K3KA 4NLXA 2LP4A 3O8WA 2LQ9A 1VQ9S 2V69A 4RUAA 1WHVA 2F4VJ 1H6KX 4XPCA 4FXDA 3IN5A 1SKUB 4OIWA 5HJXA 3I1UA 1IQTA 5J2MB 5KTQA 5CYMB 1BAVA 4W9YA 1A0OB 5EWGA 3HHLC 2F8HA 3QGPA 2HW3A 3SFUA 3UDEA 1BOBA 1HIYA 3CJ4A 1OYEA 4USVA 2HNZB 3CPXA 3EICA 4ZVPB 2W4CA 1XNRF 1T9WA 2ZBPA 3O6QA 2RF2B 3ENQA 1KLNA 2QFJA 4Q0BB 1Q79A 2YNHA 1S1UA 2ZH5A 3LWUA 2UUWA 4NL5A 2YKPA 5KFHA 5IZHA 4O0NA 3W7BA 2ZVIA 2J6TA 3B7IA 2ZEHA 4DR6F 2C22A 4ZHRA 4DR3J 4PWUA 2XNRA 2W4PA 3HHKA 3SV3A 2JWNA 2CQPA 2P0WA 3LP0B 2CJAA 5LSLA 4JI8F 2XWXA 3D28A 1RI7A 7AT1B 4Q44A 2DO0A 1RLCL 3HHLB 2FT0A 4B3RJ 1BD6A 1TAUA 3R27A 3UW1A 5FLXU 1CBKA 1VCTA 1M4IA 1EE3P 1IM4A 1HD0A 1QE1A 3HZGA 2HFOA 1SKWA 3R9EA 1IB1E 2HNDA 2C1CA 2BJ3A 4N77A 1V9OA 2XTJP 1OO0B 1VHIA 2VB6A 1LWFA 1UJ4A 1QTNB 3Q0AA 4P52A 2YNIB 1GAOA 3SCIE 1EB0A 2IY5B 2HPUA 2FY8A 3IU1A 2JC0A 3ONQA 4ZJOA 2VHGA 1YZ7A 4ZPCA 3WHIA 4F3MA 3K2KA 4NF1A 1WHWA 3BGLA 3WX8A 4IG3B 1JJ2R 4ZY1A 2R3VA 4DUYF 4C0OC 3W9IA 4EWTA 3KLGB 2EWHA 4J9MA 2C2ZB 3D5MA 3CWJA 3A12A 4UEFA 4NGRA 2WZNA 3I82A 1R8PA 4DX5A 4ED6A 5KFZA 1HKAA 5C82A 3H5UA 2PIYA 4ERDA 3JTPA 4A38A 1D8ZA 4TLQA 2B0GA 1Q0NA 3SYZA 3VVUA 3WQPA 4DU7A 3PO5A 2FHJA 4DV3J 1BLLE 3HX9A 4UFXA 3T5KA 5DJBA 1QSOA 3BQ0A 4RKUC 5A8RB 3UD3P 1JJ4A 6CPAA 2I3CA 1OJ4A 1NPKA 4X84A 5KFBA 3GPAA 1U26A 4CLUA 3R7NB 2NYHA 4Y6IA 3P45B 1UWBB 4OZ0A 3SI0A 1Q16B 1EQMA 2V8DA 2RC4A 4WWVA 2CF4A 1H72C 1C1BB 1PCAA 3ZTPA 5LSOA 3GY9A 3PX6A 2YNDA 5AE3A 1A9NB 1WK4A 4YRHA 3K8VA 5IB9A 1NK7A 1S60A 2ZEJA 2UVUA 3M9OB 3H2VE 3QZ7A 1YVOA 1HNIA 2AMCB 1RQ0A 4DHVA 1SQGA 4OC1A 4DFPA 2VPZB 4KKOA 2HBRB 1RDRA 2QJ3A 3AJDA 3LP2B 3IXQA 1S0VA 2VBQA 1AZSB 3W91A 1UWAA 1R0CB 3PZPA 3D1OA 1NM2A 5LJ3Y 3PB8X 2MKKA 1O8BA 3UO0A 4Y49C 4BWMA 1NDLA 2Z57B 2OGUA 1VJQA 3GIMA 3P8BB 4JI6F 3R1HA 1GHEA 3MMCB 3RG6A 4A8FA 3E01A 1QAXA 3M2UA 1TTHB 1CG2A 3TR5A 2LKZA 5AG7A 2KU7A 5LOQA 2AZ3A 3EZOA 3I5CA 3M8QA 4U9RA 2AEFA 3THPA 1MG7A 2YKMB 2Q4YA 3SJFA 2MQPA 1SJ3P 4NI2A 1TELA 1SJQA 2RRAA 2Z4PA 4X65J 2NXCA 3MFIA 2NPIA 2A0FB 3LA0A 1HI0P 1YK3A 2ZH4A 1HR0J 1NH8A 1FJGJ 2C3UA 3JTKA 2B3VA 1WC5A 1HYSB 3MR7A 1SL2A 2H1YA 2ZBRA 5HBMA 4C2YA 4ZY0A 2QLWA 4Y49B 4KVME 4IF5A 4C0HA 1YJVA 5HLFA 3WC7A 3PTWA 4WXWA 1QMUA 5HXDA 1YQEA 3ADAC 3I55S 2B4BA 3TNVA 1NJYA 1A7GE 2JLEA 4QR1A 4H4MB 5KFGA 2PMHA 1YRUA 2RU3A 2AJ4A 1FWLA 1XTZA 3QPIA 2J7KA 2BJEA 1LNQA 4HTIA 3RB6A 4PUOB 1WC4A 4X62J 4JI1F 4OJGA 2W8LA 2PJ8A 2AX1A 5DZ6A 1NSKL 1DTQB 2MZTA 2J76E 4I1TA 2JFDA 1UCNA 2FJBB 3CJRA 5I3PA 1I21A 4KPCA 4NX9A 1NPPA 2RDJA 2GFFA 4EU0A 1RT3B 3A8JA 5KFLA 4PRFA 2CJBA 4PXBA 2FYXA 1N56A 2B9WA 3CMES 2ILZA 3THTA 1S0NA 3TFYA 5KG1A 1IIDA 4QWEA 1RT4B 2NXEA 3QSYB 4DCPB 3SFGA 2DRAA 1S99A 1NLKL 1HL6A 1FNMA 1IJEB 2J9EA 3GUXA 3RW6A 1L3VA 2XEXA 4G3IA 1HQEA 4ZBGA 2VFUA 2H5IB 1KN6A 3SXNA 2G0IA 1LW2B 3OSPA 5L39A 4MMOA 4B9NA 2M9KA 2R8IA 3IR6B 4OZNA 2DNPA 3T3FA 1GMWA 1CULB 1FE4A 2LXUA 1D8YA 1NO8A 2RUSA 1Z8XA 3MAAA 4UUWA 1LCPA 4P45A 4DMZA 4QB9A 4DR1J 1N6QB 4OC0A 2F5GA 1N5VA 4C8ZA 4GXHA 4X4NA 3V4IA 2QECA 5ETOA 1YBAA 4J90A 4KFBB 3LO3A 1YX0A 5HI7A 2AGQA 3C15A 1Y7EA 1IKYA 3CJTA 2PJCA 2ZW4A 1XQIA 4EYIB 2OEMA 1GFWB 3QAUA 1MJBA 3VQSA 2P6TA 3H90A 5JMNA 1MU2A 3J7YU 2I79A 2QYCA 2DNRA 2IM1A 3QIDA 2EI5A 3D68A 1PYOB 2J9AA 2M7SA 1F9FA 5HAOA 4OYZA 4ZJQA 1TUVA 4W98A 2E5LF 2QL7B 2QO3A 3WZ0A 2V4QA 2XEGA 4NZ7A 4R87A 1ZLIA 4OI0A 1QVGR 4ETZA 5KFAA 2DGSA 4ZS6A 1XN9A 3GJQB 3U02A 1RAHB 4Y34A 3WC2A 2MQNA 2ZENA 1H74A 1RT5A 4WFYA 5J2QB 2GREA 1PYTB 1X0PA 2R8KA 3IAS9 2R7RA 3ZJ0A 4KSAA 4ZLNA 1BQXA 4I2QA 1KOOA 3ITHA 2VFSA 3EX7B 2OHDA 1LK5A 4E98A 1T94A 3A3PB 4JI7F 1K1QA 5DQHA 4ATNA 1RT2A 4JZ0A 2V8PA 2BYCA 4D3GA 2PEHA 2VV5A 2K3IA 2Y9HA 3QZ8A 1JWQA 3IS9A 3LH2S 2LU1A 4I6WA 4MKVA 4C2XA 3PY8A 3V81A 3VTIA 3FNNA 4K7QA 1RWPB 3R9FA 4NA1A 3ET6A 4PG4A 4L3NA 4DPXA 4FD7A 3D4JA 2WSAA 2EC0A 1J5EJ 3CPWR 1OS5A 2WVDA 3AOAA 3RGIA 2P2CB 1FRHA 2XYGB 3NP5A 2MHEA 3DOMB 4MHPA 4LVNP 2B9YA 2B8PA 4MTPA 1RE1B 1CP7A 3OFGA 2R4FA 2PRBA 3N5FA 3DLBA 3HHDA 4AXJA 3NH5A 3KLIB 1OBRA 3S1TA 1FEEA 5L46A 4NYZA 4B5PA 1YZ6A 1L3KA 3K9UA 4CLKA 4DPYA 1VLYA 3S6KA 1KHWA 4YB6A 3LODA 3BS9A 3F0AA 2JDDA 2I2YA 4NA3A 3KK3B 1DAXA 3T1AA 5E3PA 1KBRA 2QSWA 2YX7A 4LF2A 1YMEA 2CPZA 1WORA 4N8OA 3D67A 1I94F 2HEKA 1IR2A 4NXMJ 4K0KJ 1FVSA 1WTFA 5M2PA 2XS2A 2XQCA 3M8RA 3AH6A 2CVEA 3I0RA 2ZW5A 3MEDA 4F0XA 1FX2A 2HZCA 5F8NA 1UFLA 2FVPA 4MKYA 5KFJA 2P9EA 3UD4P 1FNOA 4LUAA 1OY9A 4UZBA 3OXFA 2I9SA 5KFNA 2W2NP 4MBUA 3SSQA 2HHTA 5IT9Y 4TKTA 1B70B 4V19J 1CJKB 2KG0A 3QJLA 1F2OA 1VBYA 4F50A 2O1PA 3NEKA 2G9OA 4KGXB 1TK8A 2DGXA 2VG5B 1FT8A 1EJ7L 1Z4RA 3G3SA 2E44A 1EHWA 1XNQJ 2J9DA 1LAMA 3SXOA 2SXLA 5A2QY 3JYTB 2A6OA 4ED4A 3MZIA 2GC8A 1DZ5A 4PSWA 2J0QD 2VKZG 1TF8A 2YQ1A 4P7VA 2ZEFA 2E1RA 3ZXWA 5E96A 3KKFA 3DSBA 2F65A 1Q95G 3PRVA 3W8GA 4NRTA 4E8UA 1HWLA 1E6YB 3KK2B 1C1CB 2K1RA 4OX9J 3UCGA 1B0TA 1JJHA 1VRUA 1SL0A 3NH8A 1WG5A 3C14A 5HMZA 1UFHA 2ADBA 2GHVC 2ZZNA 1UETA 3OR2B 5LXRA 1TU0B 1RWVB 1TKZB 2XY6A 2MQMA 3DFEA 4ECTA 2RSQA 3PRBA 5DGAA 3DRYA 3TEHB 2ZBIA 3F8KA 3QGGA 4X66J 5G1ZA 3BXMA 2QLJB 1OY8A 4M5HA 5C88A 1FNXH 2UZAA 3QO9B 2QFIA 3KJNB 2FE7A 1QSYA 5HMNA 3G2XA 2Y8WA 1QSRA 1HBNA 3GWCA 1NKEA 2EKYA 2HLTA 3RAMA 1P1LA 3E51A 5KFQA 2QJ8A 1HBOA 2H48B 4CP5A 2EK8A 1RT6A 3UD5A 4KB7A 1VQNS 4P2SA 4USKA 2CVIA 4CNZA 4A8MP 2MY7A 4G1QA 4DSKA 3DRSB 3HFKA 3HVRA 3PB6X 3I5BA 1YIJS 2BM0A 1T9YA 4B3OB 4AL5A 1B0VA 4ZN1A 4USJC 1GK8A 4WU3A 1SL1A 1OPZA 2DHXA 2R7XA 1EX8A 1QJHA 3AD9C 4TYAA 3TJ9A 2MQLA 4TVAB 3FFIB 4L3KA 5E3AA 1J4JA 3AB4B 2CTBA 2ANPA 1L5UA 3PRDA 2QV6A 4QIVA 4LSLB 4P2MA 3GFXA 2E5GA 2FLNA 2E9TA 2VJVA 1YG0A 5CCMA 4JV5F 3NMRA 5D0EA 1HBMB 5J1PA 3E2EA 4LSNA 1VLOA 4A32A 1WF0A 4K2JA 2NUHA 2FHOB 4UCNA 4WKYA 1Y5NB 2ZH7A 1REVB 3IGRA 3LW5C 2NMTA 2EPIA 5D3GA 2R7SA 2ZEMA 2VA2A 3J7YI 4NA2A 2GA7A 1G7CB 3OD2A 2K06A 4ID5B 4B02A 2HRUA 4RR5A 3FVYA 4URGA 5DM7Q 4OX7A 2R2RA 3I0SB 4K4XA 3PYFA 1UVNA 4ECSA 3B3VA 1T3OA 3R8YA 3B3SA 2DIVA 3HCXA 3CCES 3D7SB 3IRWP 1U1KA 1IWAA 4G65A 5G21A 4N41A 3T90A 3VAHA 1SQHA 2KZMA 5IM0A 1IBMF 2F8MA 1URRA 3KKWA 1IXKA 1LWCA 3KLEB 4PKDB 1IYKA 2AFOA 2LDIA 3HKWA 4U8VA 1N5YB 3PB7X 3LANA 4Q5VA 4LF7J 4IO9Q 4NYPA 2Z0ZA 2PJ7A 2ZXVA 2AV5A 2C6GA 3B82A 3FYNA 4Q2MA 1YDLA 1VDHA 4QW8A 1DURA 4UY8T 1BQNB 4NLVA 4X62F 1HNZJ 1Q7LB 1PKUA 3OR1B 4YR2A 3EO4A 4TU9A 1M5SA 3MMAB 4M95A 2OMOA 4LUBA 3KG1A 3SMZA 2FIUA 1S3ZA 1MK4A 4R8FA 4IOAQ 1OY6A 1YR0A 1RCOB 3MTJA 4QOTA 2Q6CA 4RW6B 4GC6A 3MEGB 1JLGA 5D0GA 3JSMB 1NZ8A 3BPSP 1S9GB 2MKHA 1Z9UA 2RJZA 2IA0A 2CPJA 2XMAA 4QCLA 1OYDA 5B0EA 4C3MA 1FKPB 4FKYA 2Q4VA 2PIZA 3CJKB 3K5NA 4AB7A 3TUIC 1N34J 2FLOA 3RBXA 3L2NA 5F3TA 3NA6A 4YFUA 2LQBA 2ZH3A 1LQ9A 2HMIB 2UXBF 3CB4A 1ZG9A 2JFKA 5FDLA 4WIIA 1M4DA 3M32B 2RHQB 3KNGA 2MKIA 1G3OA 3RB3A 1B7YB 4JP8A 2UXCJ 1U1OA 4WTOB 2E66A 4DQIA 1NB7A 2ATCB 3ILIA 4DU8A 3MEEB 3N9UC 2PFFB 4PWDA 1VHOA 3H2UB 5BJRA 2GAGC 3OHAA 3IG1B 2JLMA 1C4AA 1U2RA 1EP4A 4IO1A 3IBCB 4ZP9A 3Q86A 4KV8A 4ZVFA 1C0TB 5KFWA 5HP1A 2BJ7A 3JAMU 1T02A 5GCNA 2HQFA 2GV1A 4OI4A 5DLGA 1LEOA 4OFZA 2UV8G 1S7KA 1BXNA 2XY5A 4CQ1A 3CJ0A 2NXJA 4ZP7A 3OTOF 5T7LA 4FF4A 1RGVA 3EZ5A 1RAOA 1RXOB 2HLUA 4ICLB 2MYFA 5EGYA 2RQKA 4PPZA 4C8KA 3KI9A 1VJWA 4KOYA 3DYAA 2KM8C 4PABA 1UZHA 2V4RA 4NLGA 3NE8A 4RX6A 3KJQB 3QJPA 1EAYC 5BR8F 1JIHA 4IG0B 4DQRA 1RTQA 2W9AA 3PIOQ 2OPPA 3DLGA 1GX6A 5KT2A 5A6WA 4RWXA 5JVGQ 4MRIA 1U6FA 4DR7F 2E5IA 3H8EA 4H4KC 4DCJB 4LF4F 2J8MA 2DY1A 2XULA 2HNYB 1XF8A 4C11A 4O44A 4B13A 3CCMS 2VA3A 4OYXA 4OHVA 1Z8TA 4DV1J 4DV6J 5EHHA 3RO0A 3QMQA 4IFYB 1UMJA 1ZAWA 4F26A 2QGFB 1FJ7A 3MHYA 1Z8WA 4KRWA 4C9DA 4FYVB 3QJJA 1YVKA 1DQ9A 3BSNA 1RWXB 2F7VA 1H0HB 1IKWA 1GTHA 4QIEA 4A37A 3MOZA 4NSQA 1RYSA 3HT0A 2ATLA 1U8SA 2JRSA 3C8YA 2V8GA 5HH1A 1RU2A 1R8BA 2E7XA 2Z2MA 4KLWA 1Y4ZB 3FVLA 8ATCB 1SH2A 4XPKA 4ZVSB 3M4XA 2EK9A 2NREA 3B3TA 3PEIA 1DTDA 3KJVB 1HEEA 5GVQA 2YKNB 3UWTA 2C1EB 3TTHA 3AXMA 5K8PA 1Y11A 3TYTA 3I9SA 4DOZA 5F0UA 1HQ2A 2HKEA 4I6AA 3R2DJ 5DDQC 3EJMA 2DXDA 2DHSA 2IQ6A 2D4OA 2AJ6A 1L3UA 3DXSX 4YR0A 2VG7B 4UZCA 1LWEA 4NRUA 3D6FB 2R1IA 2WW8A 2KJVA 2Q6BA 4NLWA 1VQ6S 1FEHA 3DOKA 3G4SS 4MK7A 2L41A 5KFDA 3QQCD 4MY3A 5E33A 3T41A 4FF3A 1XEBA 2NSCA 1JXLA 4HH0A 4F0YA 2PRQA 5KFSA 1S1UB 5HMWA 3OTDA 3CXQA 3HJFA 4CRJA 1DFDA 5KG6A 3R7BB 2R2SA 4Q38A 1MJAA 4XTTA 4E8OA 4O3NA 4ZHRB 4CCHA 3E3XA 1K0TA 3Q2SC 3BBFA 2FHJD 2DCUB 4QPTA 4ZIWA 1KVJA 1S79A 4EVYA 1YTYA 2IRXA 3P96A 2K2PA 3FF3A 2Y1RI 5B0FA 5H1SV 3GIJA 5F8JA 2CQ0A 2YWFA 1FERA 2D7SA 3HPOA 5F8HA 5ETVA 2QIFA 2Z0GA 1X10A 8CPAA 2XM3A 3KDOA 3BI1A 3PP9A 1O0PA 1R6YA 1NRKA 3HUVA 3MCSA 2V2QA 1U6ZA 3GKRA 4FYWB 2B7BB 3VATA 2WOMA 3DHXA 2HNDB 2XMJA 3N6LA 2KL8A 3MN8A 2LQ8A 2JSXA 1TL3B 3KXDA 4DYOA 1S6QA 2ODFA 4XK8C 3HD2A 2PD1A 3MPVA 4U6PA 1Z2ZA 4N47A 4X64F 4NLYA 2VPXB 2DR5A 1F9HA 1FCAA 4RZRA 1U48A 2KFNA 2F3JA 3KZWA 4GS4A 2RRBA 1N0VC 1VOMA 3W9HA 3EWGA 2E1MC 4PQAA 1F2GA 2H4YB 3KR5A 4OX9F 3GV8B 1RBLA 2QL9B 3IEHA 5LYIA 3GJSB 3H20A 4LRBA 1NPRA 4QPXA 2EEYA 2XNQA 1AXQA 3M8YA 1QSLA 4YB5A 5H9EK 2PJBA 3NGDA 4FF1A 1CJTA 1TK5A 3DRRA 3VAGA 5JH9A 1N32F 3RNZA 3N79A 3K58A 5EMIA 4CRZB 2HFNA 2B9XA 4LFCF 1CPSA 2V6AA 2OJ3A 2BUEA 1RTDA 2DNNA 1Y9WA 1JLCB 1ZG7A 3DOLB 2BEIA 4ED7A 2DR9A 3QSIA 1FKOB 2OELA 2RH3A 3NS7B 2YH0A 2EVZA 3G82B 2XI2A 2P6FA 4B14A 5B0CA 2KKHA 3CUNA 3GFYA 3QIPB 3RB4A 1U09A 2ZH1A 1YLXA 2PR1A 3TW0A 4OZLA 1HI8A 5KT3A 2DPTA 1R27B 3DLEB 2PMWA 1X0FA 4MFLA 1X4AA 1PJ7A 1U1NA 3T1YJ 4OJ1A 1JX4A 3OL6A 3NH4A 2UUCF 3EPIA 1GXUA 3KK1B 1M4LA 2LCWA 2ZH8A 5EWFA 2DNKA 4A33A 1WUUA 1N5TA 2QL5B 1HNIB 3T5HA 4CAVA 4NGNA 4JB8B 1NU4A 4QBUA 4HI2A 1XMTA 4FWUA 4X4TA 4HKFA 4KKOB 4IQXA 4EBDA 4JI5J 1XMQJ 5A6PA 4MK9A 3FDSA 3H98A 1MWZA 4RBUA 2FVGA 1FRMA 3R7SB 1UFWA 3NWGA 2B4DB 1Y5IB 5GAEU 4UIAA 4ZK7M 2XZWA 5CA5A 1KFSA 4PPDA 5J2PB 4NCAA 3M2UB 3NGUA 1N52B 2UU9F 2AJQA 1KUXA 1F1BB 1TKXB 1M5PC 1VFJA 1YQHA 4QR2A 4R8UA 4QW9A 3M8QB 2IL4A 2M2BA 1KC8T 2YWKA 4IH5A 4NI2B 1DTTA 1L0CA 1RYRA 3LOUA 1W25A 4I2PB 3I31A 5A8WB 5KT7A 2QG9B 3OLAA 2VF3A 2CY2A 1GMWD 2BBEA 4P4JA 2ZHAA 1RAJA 2R98A 2AFMA 2DCLA 1T11A 5FIIA 2HFVA 6AT1B 2XMMA 5HBMB 2X7IA 1Y0RA 1S6PA 3R2CJ 4DR2J 3R6GB 1U25A 4N7TA 4FPRA 3CCWA 4F8ZA 3C26A 1RKIA 3IR7B 4XIUA 3A8IA 1CJUA 5B09A 4NYOA 3IC1A 2JBKA 2COLA 3OUYB 3I4PA 2IC3A 2C3PA 4USIA 5IX3A 4CGOA 1NK4A 2YX1A 2CNMA 4MYUA 4KGKA 2IVMA 3CIZA 1WC1A 2K8GA 1JMTA 2AF6A 2W24A 2BE2A 4AL7A 4MHYA 2DGTA 4QWBA 1NZAA 3GE9A 2JX2A 1SB6A 5KG2A 3FMCA 4IOCQ 2J8AA 2IDLA 4P6YA 4DFKA 2ACYA 5AT1B 3L7UA 1KVKA 3Q24A 3J81U 2HAIA 2CYYA 2DH7A 3OXGA 2HBZB 3QAHA 2ZUGA 2J0XA 4KVXA 1N34F 1VQ4S 4QUSA 4J9NA 4ANEA 5D4PA 3RZAA 1RWWB 1R0AA 1N88A 4LBHA 2PJ6A 2IVFB 5KTCA 4FS2A 1IBKJ 4F4YA 4KGZB 5DS0A 1AFJA 2VU5A 4P44A 2YKQA 4QC6A 2W2QP 5IV3A 4Z2XA 2XHCA 3HT3A 4FBTA 1QD1A 3AD7C 3BYPA 3TOBA 3ELHA 1NSPA 4EEYA 3FXTA 4LF9F 2ZE2A 3TZXA 3AJ1A 1UW4A 2VI7A 1PIEA 2EC2A 4YWYA 2PI4A 2JLFA 4MIBA 4LF1A 2ZD1A 2FZKB 3MAAB 3D66A 1YW4A 3B54A 3ZC4A 4HKQA 2B5JA 1Y3KA 1QUVA 3ISND 5J2NB 3CC7S 3V4IB 2X1BA 2UXDF 1GTEA 3W60A 2BJ9A 1QQ9A 2E5JA 4KVOE 3OXLA 3C15B 3ENVA 4NLDA 2PDAA 1Z5RA 1IKYB 2WUUA 2ZC3A 1KONA 3DNSA 3O5TB 3BPDA 4X5KA 1T0TV 4H89A 3IRXA 5IS2A 4C8NA 4ES1A 4F2RA 2ADCA 3MM6A 1Y00A 4B9UA 5KG4A 3P5TL 2RVJA 2KI2A 2LVWA 3GYXB 3JVNA 4C3KA 4KOUA 3QNWB 4DDFA 2R7QA 4M5DA 2EWBA 2IBOA 2X3DA 3N6MA 3J7A1 3VGTA 1VGYA 1Q7YT 3P6YC 1E6VA 1ULRA 4JI0F 1OQ6A 1JB0C 2YNFB 2OUGA 3D2WA 1U1MA 1MROB 4GO7X 4KY3A 1RTJA 2AYMA 4RUBA 1RT5B 5E3RA 3JS9A 4ED0A 4ZVOB 1B4SA 3UVJB 4I2QB 5JVHQ 5D8NA 2R7OA 3DMJB 4Q7AA 1C0UA 3L95X 5K20B 4DV0J 4LF5J 2Y1JA 2WAQD 1NDPA 1Q2DA 3OHBA 4UW2A 4DS5A 2HIQA 5E41A 2IM2A 5DO2A 1RT2B 1NK6A 5JQ4A 3Q8QB 5D29A 4TNOA 1RT7A 3W8PA 5CZXA 3IO1A 4ZY2A 5HQMA 1F0XA 3QLHA 1D9AA 1IJFB 2F63A 1PG5B 4Q8EA 2ZJRQ 1QAJA 1CC7A 3IS9B 1RHUB 1GYTA 2DO4A 4AUKA 4ELTA 1VIOA 3CDWA 5ETNA 5KT5A 1PILA 3ET6B 2ZEDA 1U6BA 1TL1A 1LRZA 3CCUS 2KVQE 2CXAA 4MY0A 3OSNA 1T9UA 2QVPA 5ETTA 3GYAA 4KTQA 4K4YA 3PKYA 3JUWA 2AWZA 2OU2A 5C42A 3X3UA 2HG4A 3DLHA 4USWA 2XLKA 1H2VZ 4CAWA 1JLEB 2B56A 3MM7B 1ITPA 2DNGA 2FQQB 3PIPQ 3BB5A 3ZZZA 3T1HF 4RW4B 1HNWF 4X4SA 3PZJA 5DWMA 4B5PB 3MECB 4DV5J 1RU1A 4DL4A 3V7ZA 4AVAA 4PQUB 2E5HA 2JJ4D 4Y28C 2RQMA 1NB2A 4DLEA 3K7RA 1IOFA 1U24A 2FJAB 1BPNA 3D7HA 5AE2A 1M5KC 4YDDB 1ELOA 1WJ9A 1B3TA 2VQEJ 1AB8A 2HQ3A 5DG8A 3DDDA 3NS6A 1YHQS 2VQFJ 3EFAA 2J6SA 2FD2A 2GMJA 1W2IA 2MPUA 2KJWA 2V4JA 1AMPA 1IKVB 2K5TA 5GAEI 1S1WA 4RW8A 3PHTA 3QGHA 5IT9U 1K8AT 3I0RB 4B3MF 4A30A 3HHEA 3MEDB 2IYGA 1S5ZA 4OC4A 1WKLA 2B4OA 2REFA 3PG9A 2KDOA 4DWIA 1KQSR 2G9DA 3N7ZA 4X4UA 4LFBF 3HDSA 3PYDA 4B17A 1WACA 4KJIA 2IYIA 1YRTA 4ZI6A 1SV5A 2Z3LA 1UVIA 2AEJA 2DGWA 2M88A 3BKFA 7FDRA 3NNCA 4R3KA 2W7PA 3GYNA 4AVCA 2FC9A 4XPEA 1FE0A 3H40A 4I69A 3IMQJ 2HFSA 2QX0A 4UUXA 2IMWP 3H4BA 1CBXA 3BDPA 2O67A 4LFAF 3AD8C 4DFMA 2BOAA 3OQ2A 5CYQB 2ROGA 4O4RA 5EN1A 3LWMA 2R8HA 2HWHA 1D9DA 1YBUA 1R7IA 4AQYJ 4F9VA 4R0EA 5HMXA 5DGBA 5JXSA 4OZ2A 3H0PA 4K4UA 2V77A 3BO4A 4DG1A 5DDPC 5F46A 1YKWA 2I6WA 2K1RB 1D0EA 2DR6A 3V2UC 1T05A 4F04B 4XPDC 1VRUB 4USMA 3G6XA 1RHKB 1HBUA 3PYEA 1SKRA 3OJUA 3V6DA 3JTOA 1R6VA 3QT6A 5J8FA 2PJ4A 2HB6A 1FKAF 1FRXA 4FAIA 3VARA 2OPSA 2L9DA 4YUDA 1RTZA 1BWEA 4DSEA 2GQQA 1LAPA 4CO1A 2ZZTA 3LGMA 1PJ5A 4IR9A 3CJ8A 4PG5A 2QYGA 1WWZA 2QIRA 3ZTOA 3KJFB 2D3ZA 3TA1A 1LWXA 5L9XA 3KHRA 3CJ5A 1REGX 2UUBF 2LFVA 1IBCB 2WCXA 2G0CA 1Q53A 5RUBA 2CPDA 2NZCA 2DTJA 3TEGA 4OZJA 4RN7A 5I0CA 5BYQA 4M8LA 4LVOP 4FD6A 1HBOB 2IIHA 4LF8J 2EVNA 4F0HA 2DVIA 3EM1A 3PEJA 4XPDB 1I51B 3D3CJ 1MNEA 4Z7CA 4G1QB 1KDNA 4I4BA 4K4ZA 1HWUA 3SJEA 3DNCA 4M5JA 3R95A 4ZP8A 4OMFG 2OO4A 1X4CA 1S1VA 5HMYA 1WDTA 3BO3A 4QYZK 1RABB 5I3UA 2HZVA 3M9MB 5AGEA 4C48A 4CNYA 3G96A 1LFPA 2DKOB 3N6NA 5JPHA 4DV2F 5CYMA 3IR5B 4RWWA 5J8CA 3PV8A 2DRDA 5A76A 4GKJF 4PWWA 2XG8A 4ZVUB 1NMEB 1YJNS 4B9TA 1CPXA 3SXLA 3HHNB 4KC5A 2Z8QA 1D1UA 1VQLS 5ADZA 2MJUA 1ACMB 4IH6A 1YK9A 4I6YA 2HNZA 3V5RA 3HSZA 5IT4A 4MXUA 1LXJA 3FX6A 3TI0A 1WOSA 2Y0BB 4MFBB 2RF2A 4LSNB 4JV0A 4ITSA 4JUZA 1W2BR 3F5BA 1YWXA 4QJVA 2PJAA 1PC5A 1PAEX 1GEHA 4OJ3A 5B08A 3JB9k 1KWMA 3DR8A 3GILA 1I1DA 1IBLJ 4B12A 3TX8A 2A6MA 2WRMA 2ALYB 1VC0A 3KYLA 3I3GA 3BR8A 4LBIA 4AXVA 5CQGA 2W8KA 1ZM4A 4R3LA 3B4MA 4AFFA 1Z8LA 3W6XA 4GKKF 3CW2C 3RTVA 1P1TA 3M1VB 2P9GA 3MD1A 1NSQA 2FHMA 1SUQA 1Y0YA 4PYDA 4L72B 3VAJA 1VQKS 2DNZA 5HQLA 2P8IA 2FSRA 1V6HA 5IM0B 1W26A 2D4PA 4B3SF 4BBHA 3RU0A 1VQ5S 4NLRA 1T9XA 2C2RA 4KORA 3BSCA 1LWCB 3PW7A 2OZGA 1HNVB 2KG1A 3NCPA 1Y5LB 2ZC4A 1CP6A 4F36A 3PR4A 3PGPA 2GU2A 1DY3A 3CCSS 3RRGA 2HQGA 3BZQA 3MM9A 4F4WA 5F41A 2YNIA 4ED5A 5KOXA 2CQHA 2Q3PA 2VZYA 3DLJA 3KUHA 2EFVA 4B9MA 3BJ8A 4MHZA 2ZUAA 4BCAA 4F4AA 1U47A 2WHOA 2DY9A 3KTQA 2JL9A 4OYBA 1PSDA 3IBWA 3DDKA 3D0IE 2XGPA 1RUSA 4DUZJ 3DU6A 4WYLA 3EZUA 2HBYB 3GMGA 4DR5F 3A3OB 2CNNB 5K8MA 2QEXS 1H73A 3AFGA 4EZ6A 1JLGB 2AJ2A 1WEYA 2D3O1 1K1SA 2UUAF 3M6XA 4DUTA 2DXQA 3KWMA 4C6AA 5I3QA 1G1XA 4NGPA 4AG9A 3I9V9 4LF6F 2MGZA 1ZBTA 4YR3A 1XMOF 5KFEA 2J0WA 2XGQA 2ZH9A 2BQRA 3QRQA 2OTJS 4JI2J 4Y2MA 2HHXA 2HV2A 5FDLB 3M8WA 4YEAA 1RADB 2EK1A 2GVZB 1DQ8A 2R2UA 4ELVA 1RZMA 3PW0A 1VQMS 1S9FA 5H86A 1D3WA 1WHYA 4RU9A 1HHQA 2CPEA 2VH7A 4WE1A 1S9EB 4IRKA 1MSWD 5ETQA 4P6QA 3MR6A 4ZPWR 1PGZA 4PWDB 1XWLA 3CDAA 2MZSA 3MGDA 5KFFA 2U2FA 3D4UA 3MPUB 1EP4B 2C3YA 2DD8S 5HROB 4KO0B 4OYWA 3L9ZA 4M5LA 1J5OA 4FDFA 4ZITA 4KV8B 1X4FA 2ZVSA 3DI6A 1BY9A 5HP1B 4JYAJ 2C2KB 3GR1A 3C66A 2BEFA 2P9CA 3HJVA 4UT4A 4X4VA 2VFVA 3L7OA 2EG1A 1SKSA 2FJWA 3CDUA 3AHPA 2PA8D 2I00A 4H4OB 5KFPA 2GGPA 3Q8PB 1TV6A 1U0SA 1AZSA 2DGQA 2V9WA 1X7VA 4X2BA 3ENAA 4DXLA 1YLOA 1IN0A 5EX3A 1QSNA 2VJUA 5GADU 2WSCC 4QZVB 1KNZA 3OJSA 4C3LA 2UUTA 4OHZA 3DRXA 2AYBA 1FD8A 1OIAA 3PFEA 2YPYA 1QY7A 2AU0A 2ZM6J 3S9MA 1HQUA 3CD7A 5G0RA 2IM3A 4C11B 4O44B 4NGSA 2VBXA 1H2UX 4J9RA 4RUCA 2OOTA 8AT1B 4DR4J 3B8HA 1WWHA 3J81j 5CD4A 3FEYB 2AIRB 1HYSA 5J1EB 3VGUA 1JLFA 1JQGA 3EMTA 2HQIA 1U1LA 2GANA 4FVMA 3GG0A 3MPYA 3BI0A 5HVGA 3BREA 2E7WA 2CDQA 3LGNA 2BACA 1SJ1A 4UOCA 1YW6A 1N33F 4RJVA 5ETSA 2JEFA 3P3DA 3EDQB 2Q79A 1UPMB 3GSIA 4YU9A 1RSCA 1R43A 3F41A 4CO3A 4C68A 4Z37A 3VGSA 3WC5A 3BR9A 2CNLB 1NJXA 1F5CA 4YHHF 2ROPA 3S6GA 2YNGA 2DNOA 1VQSA 4PUOA 2D3OR 1EKRA 5L1JA 5KTAA 4KQZA 3S7RA 1RTHA 1ZPWX 1LWEB 4Q8FA 4ZVTB 1FY7A 2ILYA 4DN9A 3ZNJ1 4DV5F 4X8IA 3D1HA 2VODA 3BQ1A 5I42A 3DOKB 4UWJA 1ZOTA 3BM7A 1IY7A 4LJMA 3DKDA 3R5GA 4DJLA 3W5YA 2FTRA 2VQYA 4N8NA 3PXGa 1S49A 1PBUA 2FXFA 5EC4A 1VBZA 3N5BA 1P9YA 4WKRA 1IQZA 2VQFF 3ZTSA 1ZAXA 1BPMA 2WVCA 4YB1P 4EO6A 4RW7A 4NLSA 2R8VA 2NUUG 1PU9A 4DL0C 3NMAA 1NK8A 1XR5A 2ZBQA 4DN0A 1N36J 4B5OA 1KLMA 4CO4A 1LK7A 1IVZA 1IUJA 1T9TA 1MMLA 3RRKA 2KO1A 4O3SA 4TQSA 4BHQA 2EXUA 5DWNA 2NYQA 1I5OB 2IPOB 4GC7A 5J1QA 5KG7A 2YWHA 2XHWA 1K73T 3WC0A 4HDGA 2EFPA 2B3TB 3K17A 4Q36A 4KFBA 1SJFA 3D3SA 1JLQB 2QMLA 2CQ3A 2WOMB 2Z3KA 3FB3A 2B5GB 4RPFA 1Q8BA 2CWKA 3CC4S 5IV4A 2H5JB 2W9CA 3ZNUA 2KVIA 3BF4A 1S6QB 3SDEA 3MGJA 3ZZUA 5KFCA 3OVAA 4AVBA 3W2WA 4ZPBA 4NGQA 4EO8A 3QNVA 5M2RA 4R7MA 3FBUA 2JHEA 3OPKA 2H3EB 1ZM3A 3BBBA 1X9MA 2V94A 2ZHBA 5I4MA 4KUAA 4W92B 3HFVA 2H5EA 3IAM9 5HSPA 1UVMA 3K2YA 4YY3F 1XRYA 4ZCKA 5CD4H 4JI3J 3FMWA 4MHDA 2XI3A 4PSXA 2IMOA 4EBEA 2G3AA 3B35A 1QAIA 2MLZA 2EG2A 4DV7F 2B58A 1PAUB 5IWAF 1PYTA 3BV8A 5K8OA 2FY1A 4CAFA 2CA9A 2CQDA 2YVSA 3HSDA 3H4DA 1XC9A 1AROP 2Z2YB 3CCJS 5KFXA 4DPUA 2KYXA 1SI9A 4LX9A 5D77A 5F48A 5U47A 5IT0A 2AGPA 2PE3A 4M85A 4QIFA 5FVJA 1GT8A 2IM0A 4ELUA 3KGQA 2O01C 1JNZB 1Q4RA 1R8HA 2D3UA 5DDRC 2MDAA 2DGOA 1UVJA 1SC3B 4FVCA 3LAMA 5F8IA 1UJ5A 4ANDA 1WI6A 2HFUA 3OVSA 5KG0A 3TCVA 3EVOA 2BA9A 1NK0A 4JYWA 2RE1A 1GMVA 4WPAA 2HIYA 3RRHA 1RACB 3SI2A 2BO9A 4DV4J 5KFKA 1H38A 2MZJA 4I64A 1PO6A 2EFQA 2FIWA 2J7UA 3W62A 4ID8A 1HD1A 3OV7A 3N28A 4J7CA 1AYEA 1DQAA 4C8LA 4EI2A 2A2CA 3OL8A 3EGNA 2KFYA 1NAQA 2IDEA 1VK3A 5ETKA 4B11A 3PB4X 4P4EA 2V2ZA 4KH0B 1F60B 3QB8A 2WB4A 3RYOA 2QA2A 4DSFA 4FUUA 3OLBA 2J8RA 2RHSB 2F40A 3PJWA 3KLIA 3TP2A 3OL7A 3UPFA 1X4GA 3S6EA 2ZOMA 3S9LA 4I0WA 1DLOA 4AYBD 4IRDA 4N5SA 5LT5A 4WU2A 2B4PA 2XBPA 2EBGA 3M2VA 3DGPA 1ZZNA 4NLQA 4TNUA 2CZVC 2XMTA 2XZDB 1XNRJ 2ZJPQ 5BYRA 1LFWA 1LKZA 3PW2A 2DEIA 4R8UB 5SUHA 3T9YA 4ED3A 4WP3A 2AX0A 3UN2A 4UEZA 2Q4ZA 2HHPA 1FRJA 4B3TF 4DR6J 1DTTB 2CJKA 2OSQA 1KS2A 4HT7A 2RQ4A 1AFIA 3T6JA 4IKAA 5T14A 4JI8J 3G71S 2BR0A 5DETA 5GADI 3PDNA 3KASA 2GE3A 2VD3A 4X2TA 2BUNA 4LQ3A 2YWWA 3VAKA 3VHQA 2PJ9A 3B8GA 1RWMB 1K0VA 2N4CA 4QR0A 1SIWB 2DXFA 1JLBB 5ETMA 1Y7PA 2X1GA 3N0VA 1KRPA 5E0OA 4XAKA 3QBCA 4LREA 1YITS 4DCOB 1SPBP 2VG5A 2BE2B 1ZG8A 4K8RA 4NLUA 1P8GA 3ISXA 2DF5A 3JYTA 2VUGA 3PB9X 4C7IA 1KQGB 1NMTA 2W9BA 5F9NA 3TQ1A 3EXCX 3MCNA 2JC1A 2ALZA 4MFJA 4HR2A 4LQ6A 1E6YA 3KK2A 1C1CA 2WPXA 3SJXA 1S4FA 1OQ3A 2XSJB 5EWEA 4URSA 3KFWX 3I6PA 1MN9A 3OBIA 2C6PA 4ANCA 1JXEA 3BH6B 1S12A 1M5VC 5HANA 1NNDA 4DUYJ 1H7WA 2BV3A 4UTGA 1HNXJ 2LQ5A 1EIYB 2ZWOA 1B0PA 4NASA 1S7NA 3AT1B 2JDCA 3MM8A 2Q0YA 2H9ZA 3TO8A 4OI2A 4U7CA 4OL8A 3UCUP 4PXDA 2HHUA 2I5JB 1G6BA 5LMUF 1XFOA 3MMBB 3QO9A 4LBPA 2DGVA 5KFIA 2AEMA 2ZE2B 2J5AA 3UDCA 1BLUA 1HWIA 2B43A 1PJ6A 2FL4A 4M63A 2JVRA 1V0CA 5LRJA 1VC5A 3TARA 2ZD1B 3FQKA 4OIDA 2LA4A 3TVZA 4A4JA 4K4WA 4KYZA 4EMDA 4RNFA 1EETB 2B5JB 3LUYA 3KLVA 2HVEA 4X4PA 3C19A 2GAHC 4H54A 4B3OA 3FRZA 4U5YA 2ZW7A 5HVFA 1OPIA 2LXIA 2CQCA 2XCPA 4P7TA 4HPSA 2AD9A 3SI8A 1X4HA 1GXLA 3FEEA 5DM6Q 2YNCA 5JM6A 3D6MB 5HATA 5AJ3F 4DPOA 3J80Y 2JLGA 4ZA1A 1HMVA 3MM6B 1SJ4P 3D8PA 4GO5X 5BYSA 3GIKA 2QLXA 2F8EX 1TMJA 4DF8A 4KUBA 3QFWA 2CQ1A 4M5DB 4FD4A 1NUEA 2RD5C 4K4TA 2F4VF 1Q8LA 1QLNA 1YJUA 5L8RC 2XYHB 3EGVA 3FEXB 1E6VB 3GSDA 3W1YC 3R1LA 2ZM6F 5KFYA 4LR9A 2JVOA 2B51A 1HPZA 2GCFA 1WD6A 5E3QA 2C27A 2ZEEA 1RTJB 2DHAA 3CPAA 3EYZA 5GAHU 3RW7A 4U8YA 3KL9A 2C42A 3PACA 2Q66A 2R9LA 1TZ0A 4ID5A 4DR4F 2KFZA 2BM1A 2GJ2A 2LXFA 2AJ0A 4D3HA 3HFZB 2DPIA 5HO4A 2FVSA 3IGNA 1WG4A 3KUEA 1UVKA 3ZFVA 4ED2A 1WG1A 1NJZA 1H7XA 1KOHA 3PYGA 3K5LA 3KUGA 1NEEA 2MZRA 5E7OB 2GMLA 1RT7B 1S0OA 4DR3F 4JV2A 4GVLA 2UVRA 3J7AN 1ZTTA 5ETPA 3CJ2A 3QLHB 2WONA 4Y65A 3RYLA 2DNMA 5DZ7A 1UZDA 2OZHA 4KHRA 1TIQA 4TXSA 4ECYA 2YKOA 4I7FA 4CH7A 1IM6A 2CPYA 3LPEA 2MSSA 1CJVA 2GJFA 1AT1B 4NEXA 2D9PA 4B3RF 4HVZA 3A1YG 1TL5A 2BJ8A 2V67A 4Q43A 2PJ2A 4KIAA 4NZ0A 2CJ9A 2FS5A 2GMHA 3FSXA 4KOWA 4CT9A 4NFRA 2L9NA 4NEZA 2Q7SA 4XPLA 2KB2A 1YBTA 3C2PA 1TMMA 4MFKA 5C42B 3IWGA 1CS4B 3MEGA 2MY8A 4R57A 1FJEB 4P2FA 2Z3PA 3MXHP 4LRAA 2LDYA 2MKYA 1NXIA 3U1NA 4CLFA 4JI1J 2BKOA 5A0YA 1URNA 2OIHA 3QATA 4N76A 1N48A 1VQ7S 3HSJA 4M3SA 1T03A 2BQUA 3PFOA 3Q8UA 4RBTA 1GQEA 1L3TA 4C8OA 2ROEA 3K8WA 1JWWA 4KS9A 3MPDA 2JEWA 3M32A 4C4WA 2EFNA 4OLOA 2FC8A 5IXUA 4B08A 2R42A 4OHWA 3FCVA 1RWOB 1KFDA 4PAAA 2V4JB 4KE5A 1ELLP 4QIWD 4OZ3A 1S1WB 4RW8B 3Q2TC 4QU7A 5KAKA 3GV7B 2VZZA 3VCDA 4M1KA 3MEEA 2P6GA 2KHCA 3M05A 3HD1A 4UWIA 5C25A 2PMZD 3MUMP 3BO2A 2GHWA 4ALZA 4EK2A 3H8GA 1IKXA 2GW8A 3QFHA 3SEOA 4DV3F 1BGXT 1U1RA 1S7FA 2E1AA 2F9JA 1RAEB 1U4BA 2KN4A 4ECRA 1Q81T 1LANA 2RKIA 1TL7B 2HGLA 2HHHJ 2B3UA 4IFVA 5KT6A 2YY3A 3Q23A 2Q1LA 2Q43A 1IICA 2RMLA 4L74A 4IK2A 3THVA 1FWPA 1KQKA 3VAMA 4JI3F 1G4CA 2R7TA 3U1LA 5HN0A 3TZYA 3TVKA 3J7ZT 4FXVA 3DLKA 4P4DA 1RA7A 1ZAVA 3WIUA 3W5ZA 4CTAA 4WK1A 2BW2A 2HWTA 3JAMY 3NNHA 2WVEA 4MCRA 4TU7A 2RS2A 3N01A 3L09A 4P75A 4DG1B 2E5LJ 3TVYA 4DJBA 4C8MA 1T05B 4TLRA 3M7VA 4UEEA 1UWYA 1HBUB 4KAIA 3V6DB 2OPRA 4CGPA 3RUBL 2DEJA 1HFEL 3FBFA 1WELA 2DPSA 1Y3JA 3POTB 1WTBA 2HNYA 3PX4A 3HO1A 2OPSB 2IBKA 3IWWA 3V8IA 1SH0A 2VDIA 3WC6A 1U2FA 1UTAA 3H8FA 3R9LA 4FBEA 1U2CA 3JTNA 5DLFA 5D8HB 1X9WA 2ERRA 3JQJA 4JI7J 2CZ4A 5F9LA 2HVIA 2H65B 3T9ZA 2HZAA 2N4DA 2HGMA 3NWRA 4L76A 3TO7A 4X65F 5E2QA 3BGRB 1T9VA 4OYMA 1HR0F 2YKNA 1FJGF 3L7PA 3W2VB 1ZO0A 1TKTA 2C3OA 1Y9KA 1Q82T 3LWLA 4ONUA 2JEIA 2GVDA 2ZKTA 1XR7A 3IM9A 3VV2B 5I3UB 2OPQA 5LYDA 1ZTWA 4PCQA 4IAVA 3MUVP 3ZZYA 3MR3A 1RAGB 2K7KA 2VG7A 2DISA 5K5MA 4UOHA 3WIVA 1Y10A 4K3NA 2C2NA 4K5SA 4L75A 1RJJA 1GMUA 4U67Q 3GFZA 2M70A 5AG6A 3TO9A 1M1DA 2MTLA 5IQ6A 4ZPTR 2B6AA 2YKAA 3HM9A 1VBXA 2FZCB 1TVRB 2X51A 2ASJA 4E2AA 4F4XA 1RXTA 4ZLLA 1RAIB 5D0RA 1ZETA 4UA3A 3AA9A 5HVHA 4GVBB 2G2ZA 2KXFA 1ZA1B 3EVWA 3U1MA 4ILMA 4NGTA 4QIGA 5KFVA 4QBJA 4U95A 2JNJA 2EKNA 4HDHA 4CLLA 4Y00A 4CLTA 2ZNYA 2VICA 1VQ8S 3R1KA 4TY8A 3TE4A 1YX2A 2W7AA 2PN6A 2Z3NA 3CCLS 3MI7X 3UI3A 2WPWA 1I94J 1N54B 3R9GA 1SXLA 3EXNA 1SUQB 4ZLPA 4PG8A 3CNQP 4WP9A 4FXWA 3I5AA 2C6CA 5DG7A 3CDEA 2I8EA 4ZCIA 2AT1B 1WHXA 2HHVA 3R5CA 5GAHI 4ZVQB 4GMKA 5F49A 4JJXA 1ELMP 1X12A 3KQZA 2XS7A 5K14A 1TL3A 4ER8A 1YLEA 1R89A 4YGOA 2GNKA 3MM9B 2POKA 2W2PP 4K2XA 3LD2A 2AFWA 3D9BA 2M52A 3LP1B 4FYDA 2PC6A 2GIRA 1U02A 4R0JA 4DR1F 4A95A 1EKSA 1NSLA 1VRQC 4WZMA 2OZUA 3RJMB 1WEZA 3FSIA 3FEDA 2L08A 2P6EA 3NKYA 1YJRA 3CE8A 1HNXF 3NBPA 4B6ZA 5JUMA 2M4MA 3N4WA 3W61A 3RBEA 2AYGA 4K50A 4R6TA 1NKBA 5ITHA 4CYPA 1OSDA 1QDUB 2RDIA 3NG8A 1RT1A 3C46A 5HL7Q 3H59A 1OZPA 3FZ2A 4CLPA 2BE7D 2PQ8A 2MGZB 3HXMA 2QA4G 1JLCA 3DOLA 4CH1A 2RQCA 4NXNJ 5GMDA 1FKOA 1N8RT 3IWEA 1WF1A 4JOUA 3PM9A 3G82A 5EX0A 4O4GA 1F5BA 3US5A 4F0MA 4IUSA 3H5ZA 1SC4B 3O44A 3QIPA 6FD1A 1YJWS 4F0KA 2ASYA 3IIBA 2N3OA 3FJUA 3BGUA 3W6SA 3GYGA 2MLXA 4WE1B 2DPJA 3DLEA 4P73A 2HQYA 3PCOB 2HVZA 1PYSB 1S0MA 2GJIA 1FF2A 3S8SA 5BXIA 2ZHOA 5GAGU 1P4NA 3FKBA 4DNCA 3SCJE 1VYAA 4BMHA 2AJFE 4P4IA 1IWGA 4YFJA 1MLAA 3KK1A 1J5OB 3UN5A 3VZIA 3HSGA 3BLNA 3I87A 2C3MA 4DLGA 1FWKA 2VPWB 4PV6A 1CQNA 3DI6B 4YS2A 3T19A 3NGKA 1S7HA 1P27B 1WEXA 3DLLQ 3HULA 1JKHA 3MOJB 3R96A 2X7BA 1X5OA 2KM8B 3GIIA 2FDNA 2JOQA 4MJ8A 2O66A 1YJ7A 3GFHA 3KHHA 2KRRA 5THWA 2GGPB 1CEZA 1TV6B 2XEFA 2Z3OA 4HL9A 1J5EF 2B4DA 1HDUA 4DL3A 1HI1A 2E7VA 4RU2A 1JLAA 1VRTA 2WTFA 2V8HA 3H5XA 2BVZA 5J2PA 4JV5J 4LT6A 3CIMA 3HVTA 3HVWA 2Z2ZA 1HHTP 1TKXA 3HF5A 1DARA 3AQPA 4P9SA 1J27A 2ZH2A 3FQLA 1O51A 3LACA 2W1BA 2ZPAA 3W65A 4TQRA 2ZELA 1HQUB 5G0RB 3H5YA 4I56A 3D7FA 4I2PA 5A8WA 5FJ4A 1KUYA 2JDJA 1ROFA 4LIWA 2CJXB 1M4GA 4OZ1A 4NOHA 3ZZRA 1QSSA 3KDNA 4YQWA 1RA6A 2O28A 3TRGA 1UEVA 1JLFB 4OLPA 3FNCA 2MKCA 2YNHB 3V6HA 2LLZA 2YNEA 1ARLA 3K5MA 3Q8SB 4NXMF 1XJOA 4K0KF 4I68A 5EUHA 1IBMJ 3GCWP 3OUYA 1EARA 2E1PA 5LMNJ 4YDXA 4O3OA 2HGNA 2VXKA 3DRPA 4DFJA 3BSOA 2VASA 3V4MA 4JLYA 2JZ5A 3MR2A 1J2VA 2CIMA 2L48A 4USUA 2Q7BA 2YNGB 1UEUA 1FTRA 1QUPA 4JWPA 2G4BA 2WK4A 5G22A 1NH7A 5IC6B 1X5SA 5HQ8A 4JI4J 2GO9A 1RTHB 2N7YA 4DPWA 2XC9A 1F9EB 1QE1B 5ISVA 2C2EA 2OH1A 1U0HA 1GH8A 1SVDA 1M44A 3KOAA 3M30A 5I42B 2XS5A 4FPIA 2V0NA 4NCZA 1F3FA 4ES3A 1A2ZA 1YJTA 1LOUA 1UVLA 3MM5A 1LWFB 1XNQF 3H5SA 4F4KA 1LV5A 2DIUA 5B0AA 3VZHA 4DEZA 4ZKAA 5GMEA 1RP5A 1T95A 2JEGA 2XY7A 1TF9A 4J9OA 4ZCLA 1U45A 3OVBA 2MEWA 4PK2A 4JBCA 3J81Y 4QQBA 4RW7B 3I96A 2LEAA 2KH9A 3H4QA 2QLFB 2NXUA 2UP1A 3CTRA 1HHSA 2YBVA 1S1TA 2ZWPA 4OC2A 1KLMB 3SQGA 1NKCA 2UXBJ 4P4FA 2BCOA 3OTCA 2VFTA 2Y0MA 4CAXA 3GIUA 3G8WA 2D69A 3K5PA 3TOAA 4NPOA 3R5BA 1XEZA 1AUSL 1HLWA 3KLHA 4OYAA 2HHHF 1V5VA 5J2NA 2Y3YA 3M6VA 4DZDA 1Q2CA 2CG8A 3D1QA 4NE9C 1AUGA 4X66F 2XMVA 5A27A 3RAXA 4OI6A 2YH1A 5F09A 1WOOA 4ZP6A 1FESA 4EGLA 2W9CB 5IB0A 2GHPA 2ZEOA 2BANA 3SDEB 3T9NA 4CDIA 3W2WB 2IRUA 4F02A 3CMQA 5AG4A 4NEYA 3C16A 2B7CB 1TUWA 3PVXA 3S01A 1CX8A 5A8KA 2HSEB 4KT0C 2WZ1A 3CDBA 2OR4A 3SV4A 2ZW6A 2K7JA 2DNLA 2G0JA 4UFVA 3OTOJ 4AG7A 2PJ0A 5CZVA 1B99A 2CPFA 2PA3A 3FBEA 4X4RA 4Y0FA 1SQEA 5CCLA 5B0DA 2MQ8A 2VG6A 2YNFA 3D7GA 2RS8A 1LXNA 1DHMA 1MROA 2CTCA 2P5VA 3QAEA 2UV8A 1MWYA 5BR8J 2HWIA 5C2GA 2HFZA 4IOBA 3UVJA 3FJ2A 2ZZMA 2I38A 3V38A 3DMJA 1FXDA 4DX8H 4FBUA 2NS1B 3AAWB 4DR7J 2QC3A 4R5PA 4DSJA 5AE1A 1CC8A 1V5IB 2NPFA 1Q86T 4BLGA 4LF4J 1SBRA 4P2XA 3BH7B 2BABA 3UFCX 4ZN3A 1YREA 4O3RA 4CO5A 2P6SA 3ZTRA 4KSEB 2O3DA 3O2IA 3ZZTA 2U1AA 3LF0A 4DQSA 3B3CA 5KFMA 2IAJA 4KGMA 2LEBA 5CBMA 2QA4S 5L1KA 3UE2A 3E01B 2ZEPA 2DT9A 2OEKA 4HNXB 3Q8YA 1WNEA 3KMQA 4ED1A 3VQTA 2EW9A 4RW9A 2Z10A 1XR6A 3C6TA 2PO4A 4BWJA 2GQCA 4P10A 2GZOA 4OHYA 4JV1A 2AE6A 4A8XA 3F56A 3JSYA 4Y3CA 4KOVA 1FO1A 2BKNA 3AODA 1G2EA 3CJQA 1FDDA 2AFZA 3CCQS 3A3NB 4KLVA 4LF7F 3G6VA 4IDKA 5GAGI 4ZGYB 4UOFA 4KOTA 1LOKA 2X1AA 1JLEA 3LMSA 2WSFC 3CXPA 3MM7A 5ELYA 3I56S 1FK9A 5HLFB 4MCQA 1FFWB 2FJEB 4RW4A 4ORFA 3RBUA 3MFHA 3MECA 3ZZIA 4CYNA 1HNZF 5D15A 3VGVA 4DPTA 4KZTA 1S77D 1DLOB 2AYEA 2QE5A 4PQUA 2YTCA 3M2VB 4YMEA 3DGPB 2G1HA 4HACA 2I0XA 4IH7A 2GX8A 2HS3A 3QRPA 2H51B 3G87A 1FJCA 4CT8A 2AFUA 1IR0A 3ETOA 3ZZPA 3MAQA 4GM5A 3AXKA 3T5JA 2FJDB 2CQBA 2G1DA 3VWDA 1KUVA 2DNQA 3MMJA 3LAKA 2ZEGA 4CLWA 2HRTA 1FFSB 4L73A 4MH8A 1IKVA 3D2PA 3I32A 1P6TA 3R6LB 3SCLE 3WBZA 3FGVA 4WWSA 4U9ZA 4CM0A 2XLIA 2RU9A 5H9EJ 2VC1A 4OHXA 1YGHA 3E0KA 3TT2A 1FRLA 4J9SA 3K89A 2Z2LA 1RBOB 2UXCF 3DR6A 2KZZA 4F3QA 2FZGB 1BQMA 3M8PA 3TWZA 2A1BA 4KOSA 1X4EA 4ZJLA 4HNWB 4I67A 1LW0A 2ZITA 5AXLA 4WFAQ 4ECVA 4F8RA 1HQEB 1UPPA 2HQDA 4NXYA 4C98A 1OMSA 1SIZA 4MFZA 5LRKA 4I49A 5LRGA 3JSRA 4NCGA 4J37A 5CYQA 1F2PA 4IR1A 4K30A 1QSMA 4J9VA 4WTYA 1ICEB 2W9BB 4X64J 1TFYA 3D6TB 1FDAA 4M94A 4TWEA 4NGMA 2W2OP 4P71A 1UW9A 2DRBA 3NGSA 2C2MB 2L9WA 3TAMA 4FYXB 4IYQA 5D78A 2Z11A 4FYYB 5E5NA 2AW0A 1MW7A 4KSFA 1BE4A 5KFTA 4NXNF 4RNHA 2CFXA 2VBWA 4CS0B 1U8WA 4RL1A 5H84A 3J7Z5 4HYKA 3TX0A 2GQ2A 3LTOA 1MU2B 2OB0A 1N32J 2ACMA 3B4DA 3MM8B 2AGOA 2CNKB 1HW8A 3WX4A 3RB0A 1RWUA 2RNEA 4LFCJ 5C24A 4M5IA 4C7QA 4DI6A 2CPXA 3ISZA 4JD6A 2YNCC 2F4FA 1JNRB 3KLFA 3BGOP 3T8WA 1KSPA 5J1NA 1S1XA 4DUKA 3F0NA 2ZBCA 5LYLA 2GIFA 1S97A 5CNPA 5CHCB 2Q04A 3PJ9A 4X4QA 3B3WA 4DV1F 4DV6F 2PIIA 4ZVGA 3J80U 4F7VA 4FNHA 4O0IA 1C4CA 3TAQA 3ITHB 2DHGA 2ARHA 1MMDA 4QYRA 3HI9A 2V34A 2MKJA 3D7DA 1RBAA 1PBAA 1DBDA 4J9PA 1NK5A 3GTYX 1XBUA 3BJ7A 1U1PA 2UUCJ 3F44A 5BWAB 3FK4A 2G2OA 2VKRA 3V6KA 2PC1A 1HMVB 2KXHA 4P72A 4FZVA 3TUZC 4WK3A 2OD6A 4E0AA 3V81B 1R0BG 4NMLA 4WP8A 3FECA 4OYOA 4MFBA 1KHVA 1VBKA 1B7FA 3GG1A 3D2MA 2E1CA 2CAJA 3CCTA 1GXTA 1HPZB 3PEHA 4MIAA 1WKKA 4A47A 3DCAA 5ETRA 2FVRA 2G3TA 4MKAA 3KMSA 4DX6A 2UU9J 3B78A 4QWDA 2WB1D 4CYUA 2FVCA 4TU8A 1SCJB 1X5TA 2VDHA 2H5MA 4HNYB 3M1VA 1X31C 2HK2A 2BKPA 2CADA 3GP9A 2R7UA 2AZ1A 3FBBA 2XO7A 4OV1A 4UY85 3W3SA 3EE3A 3CF5Q 2EBEA 1XE4A 2KTQA 2CNSA 3QT8A 2BQ3A 1U7LA 4B10A 5LMNF 3KR4A 2HK3A 1K4JA 2WONB 1HNVA 2AQ4A 3NAHA 4KOXA 3CSKA 2Y1LB 2Z56B 4I7FB 3S9NA 1TXRA 3M2RA 4LRCA 4ZPDA 2DGUA 1CJVB 1QM9A 5ETLA 7FD1A 2LMIA 3NGTA 4ECZA 2MJNA 3FRMA 4X4OA 1VQYA 3FUYA 1NDKA 1AUDA 3DM2A 4JI4F 4PK3A 4P74A 1VHEA 2OLWA 2MZ1A 3BKTA 2N82B 4UF4A 1TKDA 2VONA 4CI0B 4QU6A 4BS2A 2RT3A 2RUGA 1B64A 5HJYA 3FCHA 4CGLA 3TQEA 2QRRA 5A2QU 2OI2A 2J9CA 4EYHB 5DDOC 4N56A 3ZTQA 3FEZA 2M8DB 4OX8A 2EUIA 2MZQA 4ZX9A 3MD3A 1ZS6A 3MAHA 5AXNA 5A0YB 2CNOB 2RIJA 1JK9B 5KT4A 4OJHA 1WSRA 1P0HA 3NCQA 4LQGA 1F6TA 2DH8A 3BDEA 3S6FA 4MFQA 3JQKA 3NOGA 5T41A 4ZVRB 1T03B 2OMLA 3IA0A 5KFUA 6FDRA 3K59A 2FVQA 4UFWA 4MIWA 4E2FB 3TJAA 1Q5YA 2N7CA 2RDDA 4PZVA 3CCVS 3HK2A 2GVZA 1XMBA 4M6HA 1UFKA 4PXCA 4LRFA 3U27A 1RTIA 3IJ3A 1WOPA 5FD1A 2F9DA 2FJVA 1UAWA 1S9EA 1TQLA 1Y9OA 2UVVA 4OI1A 2J7WA 1U6MA 1FI4A 2B9EA 3TUJC 3KNAA 4U7UD 4LF9J 5C25B 3QYYA 4OIXA 3C14B 1UEKA 1IKXB 1NDCA 2PVWA 3F73A 3EY5A 2EFGA 3C6UA 4FP9A 4EFDA 5HROA 1S6OA 2YXLA 2HRYA 4KO0A 2C2DA 5D6GA 2XB2D 1YVFA 2RKIB 1UKUA 4IFVB 2ZJQQ 2GLJA 3L4BC 1VQPS 2W4DA 3PJXA 2EBJA 3VWEA 3SHPA 4RBVA 2UXDJ 3GJRB 2XCAA 4MK8A 2QSFA 2FJXA 1IGBA 3T1YF 3CJ3A 1HBNB 3JXOA 4NMXA 4H4OA 4KGVB 2ASDA 1ARMA 2YPZA 2DEAA 2YWGA 3DLKB 2BMBA 1FDBA 4ZLJA 1RT6B 2HQCA 3H7HB 2PFDA 2V8VA 4CTAB 4U7UK 4XNHC 4A8KA 1S5KA 3BN4A 4A31A 1FXRA 5HK4A 3NXZA 1XERA 3VWSA 3W5XA 3PW5A 1NBEB 2D9OA 4XDDA 3PBBA 3GONA 3CXSA 2OSRA 4JI5F 5K9FA 1WSVA 4UQGA 1XMQF 1VIXA 3UR0A 4Y2IA 5J2MA 1N71A 4JI0J 2OPRB 4DL5A 4IUFA 4ZCMA 5KTDA 5MAOA 4O3PA 5CH7B 3RBZA 1KP6A 4ECXA 4E0DA 2BZ2A 2KT2A 3CO9A 2DB1A 5F47A 2IHR1 5G20A 5J1EA 4H6UA 3QWPA 5F8MA 2JH3A 5C2CA 3BBCA 3M6UA 4Q0BA 2HAFA 1XBWA 1B87A 4UIBA 2PEBA 4JXRA 3UDVA 4XNHB 5IV0A 2AFXA 3HVAA 2GIQA 5B7WA 4CIOA 4KSIA 5D3GB 4TY9A 2F5IA 2B4UA 3LP0A 2NQPA 3OTBA 2DR7A 1TKTB 1T7PA 4A8QA 1BO4A 3HHLA 2GVDB 2OPQB 2QMWA 1VMBA 2VOOA 3CCRS 4F2SA 1F5AA 3CD5A 2M8HA 3QGIA 1YJ9S 4DR2F 4R76A 2IFXA 3UQSA 1KVIA 2R2TA 2M5YA 2KCWA 5MLCV 3MR5A 3TO6A 1XK8A 2DNHA 4RNNA 3PW4A 4KHPJ 3G8QA 5KFRA 1KKHA 1YGYA 3KQXA 1KD1T 3DXBA 2NZ4A 4PXEA 2DBBA 2B6AB 3NOCA 2FB0A 4OZ5A 3OFHA 4MAKA