4G1PA

Structural and mechanistic basis of substrate recognition by novel di-peptidase dug1p from saccharomyces cerevisiae
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
480
structure length
479
Chain Sequence
MSHSLTSVFQKIDSLKPQFFSRLTKAIQIPAVSSDESLRSKVFDKAKFISEQLSQSGFHDIKMVDLGIQPPPSTPNLSLPPVILSRFGSDPSKKTVLVYGHYDVQPAQLEDGWDTEPFKLVIDEAKGIMKGRGVTDDTGPLLSWINVVDAFKASGQEFPVNLVTCFEGMEESGSLKLDELIKKEANGYFKGVDAVCISDNYWLGTKKPVLTYGLRGCNYYQTIIEGPSADLHSGIFGGVVAEPMIDLMQVLGSLVDSKGKILIDGIDEMVAPLTEKEKALYKDIEFSVEELNAATGSKTSLYDKKEDILMHRWRYPSLSIHGVEGAFSAQGAKTVIPAKVFGKFSIRTVPDMDSEKLTSLVQKHCDAKFKSLNSPNKCRTELIHDGAYWVSDPFNAQFTAAKKATKLVYGVDPDFTREGGSIPITLTFQDALNTSVLLLPMGRGDDGAHSINEKLDISNFVGGMKTMAAYLQYYSESPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cys-Gly metallodipeptidase DUG1
publication title Structural and Mechanistic Basis of Substrate Recognition by Novel Di-peptidase Dug1p From Saccromyces cerevesiae
rcsb
source organism Saccharomyces cerevisiae
total genus 144
structure length 479
sequence length 480
ec nomenclature ec 3.4.13.-:
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1pA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4g1pA01
1AYEA 4R6TA 2PRQA 4F9UA 3KGQA 2POKA 2FVGA 3SI2A 3FH4A 1VIXA 3SJGA 1NSAA 4AXVA 2C1CA 4DYOA 1ARLA 3GUXA 1Y0YA 4BD9A 1TKJA 1CBXA 4NGTA 4G1PA 2BOAA 4ONWA 3WT4A 4Z65A 3BI1A 4P4DA 3KHZA 4ZY1A 4JZ0A 2ZEMA 2I3CA 1F2OA 4IK2A 2XEFA 5K8OA 4A94A 3KZWA 3K9TA 1M4LA 3PBEA 4MCQA 5D29A 1JQGA 5I4MA 4NGPA 1YW6A 2XEIA 4UEFA 2GLFA 3B2YA 3KR5A 3D4UA 1LFWA 2V8GA 3D7FA 2ZOFA 2PJ2A 3SI1A 1HEEA 4FWUA 4R7MA 3B35A 3KHXA 3D7HA 3S9LA 1UWYA 2PIZA 2GLJA 3ISZA 2VL1A 4CPAA 3WC6A 3FX6A 1HDQA 3BHXA 1TF8A 2IJZA 4PXBA 3IWWA 5LYDA 3MN8A 5DS0A 1XMBA 3CT9A 4OMEA 3SJFA 4ZI6A 4TNUA 2HB6A 2C6GA 2NYQA 5K8MA 1CPXA 2IQ6A 4OC3A 1Y7EA 6CPAA 4EFDA 1F57A 4B6ZA 5LYFA 3KQXA 4MHNA 1VGYA 4MCRA 4MXUA 1IY7A 3NH4A 5F09A 1PCAA 1CG2A 5JH9A 1LOKA 2Q4ZA 4OC0A 4LQGA 1F2PA 4TWEA 3D7GA 3KL9A 2C6PA 5HVGA 2BO9A 4IAVA 1BPMA 2AFMA 2Q43A 3FEEA 4Q7AA 1HDUA 3GLJA 3V7ZA 4WWVA 2F8HA 4A39A 3IIBA 4P4JA 3WC7A 3FECA 1QMUA 3IC1A 3ISXA 1KWMA 2NSMA 1ZG8A 1ZLIA 2ZEPA 2G9DA 4OP4A 3B3VA 3SI0A 1LAMA 3KQZA 2ZEDA 2C6CA 2QYVA 4ZY2A 4FBEA 5CBMA 5J1QA 3IFEA 4YU9A 2J9AA 3FJUA 4MMOA 2PJBA 3B3WA 1CX8A 7CPAA 4MHYA 3S9NA 4R76A 2PJ6A 4OC4A 1Z8LA 5K8NA 4NGSA 2ZEHA 3T8WA 3B7IA 1IGBA 2PE3A 4RUHA 1FT7A 3HUVA 2V8HA 1CP7A 1Z5RA 3DGVA 2PVWA 2DEAA 2OR4A 4ZX8A 3FVLA 3PB4X 5THWA 5LRGA 3I1UA 1ARMA 1YW4A 2PCUA 5HVFA 3RAMA 2ZEEA 2RB7A 2EK8A 2QVPA 1GYTA 4F9VA 1R3NA 5LRKA 2WYRA 3TX8A 2AFSA 4DJLA 3NH5A 4X3RA 1LANA 2EK9A 1TKFA 3PB8X 1XBUA 3NH8A 2ZEGA 3DLJA 4PXCA 4KSIA 4F8ZA 4X2TA 2V8DA 2PJ4A 5K8PA 4X8IA 1XJOA 2QJ8A 5IB9A 2PJCA 3BI0A 1BPNA 5CPAA 1ZG7A 1H8LA 4O23A 2PIYA 1EE3P 1LCPA 3RZAA 1Y0RA 1BAVA 4MHZA 2ZENA 2XEJA 3KR4A 4H2KA 2ZELA 2AFOA 1LAPA 4NFRA 4PQAA 4OC1A 1AMPA 4IHMA 3NA6A 1PYTB 2GU2A 2JBKA 4NGRA 4ZYQA 3VH9A 4PXDA 4OIWA 1FNOA 4UF4A 2OOTA 3LMSA 2AFZA 2JBJA 4OC5A 4P4BA 1XFOA 2V77A 2XEGA 4YWYA 3WC5A 2CF4A 4WJBA 2PJ0A 2ANPA 3H8GA 1YMEA 3JRUA 2PJ7A 4MCSA 2CIJA 2AFUA 4OIDA 1TF9A 3CPXA 5LRJA 3GB0A 2ZEFA 4OKOA 1ZLHA 3FMCA 3B3TA 3D68A 2WZNA 4EWTA 4NJRA 1R43A 4A37A 2CTBA 3SJXA 3L2NA 4NGNA 2EWBA 3K2KA 3CPAA 2CTCA 1DE4C 1CPSA 3RBUA 3VATA 3H8FA 2IMOA 3PB7X 1YLOA 3H8EA 3IJ3A 4W9YA 5JM6A 4EMEA 1RTQA 4P4IA 2ZOGA 5ELYA 5HVHA 4P6YA 1ELMP 4P45A 3FEDA 4P44A 2PJAA 1QQ9A 3VARA 4MHPA 4R8FA 2ZEOA 4UIAA 3CDXA 1ELLP 3PFEA 2V8VA 3PBBA 5JGFA 4NGQA 4FAIA 2AFXA 3PRTA 4P4FA 2GREA 1TKHA 4DUKA 1Z2LA 3IO1A 4FUUA 1DTDA 4MRIA 3NFZA 2JEWA 3WABA 4PXEA 3N5FA 4PPZA 2PVVA 3KI9A 3B3SA 1OBRA 3D67A 3PB9X 2BCOA 3HLPA 3S9MA 5HXDA 3D7DA 4JYWA 1VHEA 1TXRA 5LYIA 3KASA 4P4EA 3B3CA 3TC8A 1BLLE 2O53A 2PJ1A 3FF3A 4UIBA 2F7VA 3V38A 3QNVA 4OC2A 3LWUA 3PB6X 4K3NA 4GM5A 2RFHA 3PEIA 2HC9A 2PJ8A 4A38A 5LYLA 3IEHA 1YSJA 1XRYA 2O4HA 4P10A 3BXMA 4ZY0A 1CP6A 2AFWA 3PFOA 4UEZA 2Q51A 4NJQA 1ZG9A 4ZX9A 4MCPA 3MRUA 1VHOA 1Q7LA 2PJ5A 2PJ3A 5D8NA 2ABZA 3SJEA 4UEEA 3D66A 8CPAA 2PJ9A 4NGMA
chains in the Genus database with same CATH superfamily
1GFWB 2L9NA 3UD5A 4B17A 1D9FA 4TU8A 1HNVA 1UEUA 2AF6A 2POKA 2NYIA 3QIPB 2K8GA 3HVWA 3HSJA 3SCJE 3ZNJ1 3GUXA 3F0NA 3JTPA 1HNWJ 3FRZA 1RDRA 1S7IA 1UTAA 2AU0A 2UXCF 5F41A 4F04B 2ASDA 3M8WA 3SFUA 2VDIA 4UY85 1N0UA 3HXMA 3PJXA 4LQ9A 4J9PA 4Y0FA 2C28A 4E8UA 5KT3A 2C42A 3M8PA 4F0XA 3JAMU 1N5YA 3HHLD 3BLNA 4U7CA 5F8JA 1SKRA 4Q2LA 3DRYA 4FD6A 4RKUC 4PSWA 2PJ2A 1RWNB 3B35A 2HQYA 3I55S 3ICLA 3P2HA 3VAGA 3BHXA 4DR2J 1SJ1A 2NCKL 2CNSA 3JSRA 5HJXA 1RLCL 2AWZA 2AGQA 5L8RC 5BXIA 4DXLA 3N4WA 2IPOB 1CQNA 3BKTA 3TFYA 3D1OA 1J5EJ 1BQMA 1CPXA 1KUVA 1M1DA 3HJFA 3CDUA 5G1ZA 1VJWA 2WCXA 5LYFA 2HW3A 1S0OA 4MHNA 1VGYA 3QNWB 2HK2A 2PC1A 4C2ZA 1RT2B 4ED4A 2WAQD 4LSNA 3CE8A 1C0UB 4RNFA 2HHXA 2H5JB 4P2XA 4IQMA 1N88A 3GCWP 3NMRA 1R6VA 2Z2LA 1UZDA 2YKMB 3K5LA 4AVBA 4P75A 2ZW7A 2GGPB 2VQEF 3ISXA 1RLDA 3EJMA 3FBBA 3CC2S 2VQFJ 2B9XA 4OX8A 1VQSA 2ADBA 4AQYJ 3K0JA 4X2BA 2B9EA 4FF4A 4H4OA 2HEKA 5D0RA 4ZJQA 2QC3A 3MOJB 2YNCA 1F1BB 2N7YA 1U1QA 2HVDA 1SKUB 1U45A 2KZMA 3KJVB 1T05B 3T8WA 1VBXA 1ZTTA 1S1UB 3R7SB 3T6JA 2QLJB 2XZTB 4DX7A 3L9ZA 2PFDA 3LPYA 1R8CA 2XLJA 2LQJA 1HI0P 3LPEA 3G82B 2M9KA 2DH9A 3MF5A 4CAEA 4ZLLA 4EO8A 4KHPJ 3KLGB 2YX7A 1KVIA 3BJ8A 4Y28C 1OY8A 4ZVRB 3VAJA 4F3MA 3FYNA 1YJTA 4DR3F 2CPHA 1VC6A 1TL5A 4Y49C 4ZPAA 5ETTA 2NYHA 3PX6A 1TKDA 4ECQA 2V2KA 4KFBA 3HVTA 3IGNA 3TX0A 1R0AA 4NCBA 1Y0RA 4MHZA 1NDCA 2BE2B 3UQSA 3H0PA 1BO4A 5HO4A 1KP6A 2OJ3A 5KFVA 2AQ4A 3N6NA 1Z8WA 2FTRA 3VVUA 2LEBA 1UVJA 2LXFA 5C25B 4PK3A 4OYOA 2VIHA 4XNHB 2OOTA 3N9UC 3LMSA 2AFZA 4HR2A 4P4BA 3WIVA 2FHJA 2PR8A 1BQNA 2PJ0A 4UFVA 4X4OA 5GAHU 1PU9A 4Y2MA 2Z2ZA 5C5JA 2VG7B 4KH0B 4I6AA 1RCOB 3FDSA 3KKFA 1AZSB 3DOKA 2JVOA 4WFNQ 2OD6A 2MQLA 3B3TA 1A0OB 4U7UK 1KN6A 1HR0F 3CCTA 3JQJA 4X84A 2DRAA 3JVNA 5DM6Q 4II9A 4NLWA 4AL5A 4OX6A 1VC0A 5ETOA 1RBAA 3MMCA 1GEHA 4JI7F 3DXBA 4HHHA 3VGSA 4IFYA 2VFVA 2X3DA 4C0BA 5HVHA 2IJFA 2NPFA 3H20A 4RX6A 4CGOA 4ILLA 1Q78A 5FDLB 1ELLP 2DF5A 3IG1A 1FF2A 1FFSB 1MMLA 2GNKA 4MAKA 1NH7A 4DMZA 2JLGA 3PX0A 2Z3LA 1RWMB 4JBCA 3UPFA 3LWLA 1Z4EA 4G65A 3MR3A 2R8IA 5J2QA 1YVOA 4ZP8A 4K5RA 5KFOA 1ZYQA 1FXLA 3NAIA 4DV2F 4OZLA 3QO9A 3BS9A 2MKCA 3HKZD 4P4EA 2VF3A 3B3CA 1VFJA 2V0NA 3F73A 2QA4S 5HH1A 5HROB 1V3ZA 2LP4A 3JSMA 2UU9F 3PXGa 1E6YA 4F7VA 1GTHA 2WW4A 2RFHA 1QVGR 2VKRA 1N5VA 1X4EA 2WTFA 2PA3A 1K8AT 4TNOA 1P27B 1VHSA 4B3TJ 3PYDA 1AXQA 4DQSA 2JH3A 8CPAA 5E33A 4J5OA 4RW4A 1OYEA 1RBLA 4F8RA 2BYCA 4DUZJ 3G8WA 3CD5A 3DRPA 4MY0A 5AXNA 4PSXA 2BA9A 4MIAA 1TKJA 1RAGB 4OV6A 4UOGA 4G1PA 5LMNJ 1CULB 3K5NA 2ACYA 4DV7F 4KOXA 3Q2SC 2ZE2B 5J1EB 3MEEB 2E7WA 4ECRA 1G3OA 3SHPA 1ZAWA 1X60A 3W62A 2XO6A 3KMQA 3QGGA 3RR7A 3GONA 2KM8B 5I4MA 2BKNA 1TK8A 2QJ3A 3CD0A 2XEIA 2R7XA 5AT1B 2QL9B 1FD8A 3LTOA 4CLZA 3G9CA 1TQLA 1RADB 2XMVA 3OJUA 1QSMA 3NAHA 2V8GA 4KSFA 4OIXA 3POTB 2HNZB 3CDEA 3KUHA 3OQ2A 1KTVA 3J7AN 2GZOA 2W9BA 1FJGJ 3OFEA 4LF9F 4L6V3 4QIFA 1IKYA 2RRAA 4F0KA 3HHEA 3KUEA 4IRDA 3CCJS 1IVZA 2YBVA 1XMBA 4J9VA 2HFOA 3RAXA 5KFCA 1WDTA 4TN2A 3O8WA 4YR2A 2CG4A 4YDXA 4NYZA 4PYAA 3QLHA 4CM2A 1VQOS 3PTWA 5JH9A 4TXSA 2QT7A 2VH7A 4NLOA 1VJQA 3MR7A 1RWKB 3P5TL 4DR4F 1HBUB 3MECB 5HQ8A 3FEEA 1EKRA 1HHSA 3FK4A 5EWEA 4H89A 4ED1A 2W2MP 1XTZA 3DC2A 2YKAA 3GR0A 1DY3A 2GJIA 3TARA 1JJ4A 2PEBA 3I0SA 1RYSA 2FZKB 5JJBA 2LEAA 2R2UA 2KXHA 5A2QU 2GV1A 1NCLA 1RKJA 4QYRA 2HFSA 3OV7A 3DLLQ 3KDNA 4MT1A 1U1NA 2C2DA 3S9NA 3IR6B 2JFDA 1X4DA 2KYZA 1MU2B 3W3SA 3I4HX 2C2OB 5ETSA 5KTAA 4KLVA 4NF1A 4JI6F 1EKSA 2DR7A 1HKAA 5AXKA 3Q8PB 2YWHA 2GQ2A 3R9LA 5HVFA 3M32B 3CXCR 1ZM3A 2BVZA 1Q79A 2AFSA 1LW0A 2FLOA 2QTWA 2R42A 2LU1A 1HWKA 1P4NA 2D3ZA 3UY5A 2ZUGA 5H9FK 5H1SV 1AUGA 4KZTA 5G20A 4A46A 3UCZP 2CJAA 4EBCA 2WB1D 2J8MA 3SFGA 3PYGA 4B3OA 2EKYA 2K7KA 4IOAQ 2BE7D 4J9QA 2JL9A 1GXLA 1ZAVA 1NPRA 2Z0GA 3BH6B 4USKA 4X62J 5H84A 3J7ZT 4ECUA 3BSCA 2XC9A 2QECA 3PDNA 3C66A 5HN0A 2C3YA 4I49A 1RQ0A 2O3DA 4OYXA 2DJWA 1GK8A 3LAKA 3TAMB 2OLWA 3V6DA 5LMUJ 4I69A 1HWUA 2L9WA 3L7UA 2OPQA 1QTMA 2QG9B 3M30A 4DPXA 3ZZIA 1EIYB 4KV8A 1W7WA 4UUWA 4CI0B 3ZTPA 2ERRA 1ELOA 2I0XA 2IIHA 3B82A 3DMJB 3B4DA 3CZXA 3CJKA 3BKUA 5ETKA 3IU2A 3VATA 1I1GA 3R5AA 1IKVA 2KN4A 5E3PA 1YLOA 4TY8A 4WFXA 4RWWA 1DLOB 3FXTA 1JNZB 2JFKA 1KBRA 5M2UA 1JLQA 2UXCJ 4NL5A 1VRUA 2HS4A 4C7HA 2APOA 2BL1A 3PFEA 3IAS9 1X5SA 3V81B 3J81Y 3BPSP 3PRTA 4IUFA 4ZLNA 3W2WA 2QX0A 2FUG9 1HHQA 2VA3A 3NFZA 3TOAA 2IY5B 2X3GA 1F6TA 3CDBA 3CJ5A 2XMTA 2O01C 4I68A 4B13A 3KUGA 3R96A 2E1RA 4TU9A 2ATRA 4BCAA 4ZVEA 3C14A 1L5UA 2LXUA 2PMWA 1WEYA 5C42A 1T9UA 1BLLE 4B5PA 1Q81T 3G4SS 3PZPA 1XC9A 3L09A 1IQZA 1OPZA 1P9YA 2V8PA 5A0YB 1YITS 1HMVB 4A38A 5AXLA 1WHVA 2DITA 3GY9A 1IOIA 4Q0BB 3MEGB 4DFKA 1ZAXA 1CP6A 4UBRA 1Z9UA 3OR1B 4OLOA 4N41A 4WE1A 4B9VA 3MRUA 1SC3B 4IH7A 3CJSA 1S76D 2EC2A 2V68A 2KXFA 1FRMA 5E2QA 3CJ8A 3VWDA 1M5SA 4I7FB 2B58A 1Q1KA 4BINA 5B0BA 2C1CA 3RRHA 2IRUA 1KQKA 2AJFE 3D3CJ 4ONWA 5F8LA 5J2MA 4MKYA 8RUCA 3CCZA 4OADA 4MKVA 4JZ0A 4OZ2A 5KFMA 3ZZOA 3OHBA 2V4JB 2CVIA 3BDEA 5KT6A 3PX4A 1M4IA 1YW6A 1U0HA 1R89A 3TQ1A 2HBYB 3A8JA 5GMDA 2WVFA 3Q8SB 4ES3A 2P9GA 1JLFA 2R7OA 3IGRA 4NI2A 2HS0A 3JSYA 5D8HB 2ZW6A 2ZXVA 4KBIA 1FDNA 4F4WA 3R8YA 2N4CA 1KQGB 3AJ2A 2BW2A 4ZVUB 3ADAC 1I51B 2I00A 1HI8A 1U25A 1VQYA 4BBHA 3VGVA 1W2IA 3WIUA 2DHAA 2HNYA 2I2YA 1EX8A 2ASYA 2ZVIA 2YNGA 3DRRB 4QW8A 1RO5A 2XHWA 2Q7SA 2E1CA 4DR3J 1URNA 4EFDA 1IUJA 3CC7S 1DTQA 3CDWA 5IC6B 2DXQA 3LW5C 1CG2A 2ILYA 2MLYA 4C98A 2JEJA 2HFNA 1AROP 1NBEB 3U1LA 4LQ6A 1X4GA 3I5BA 3DM2B 2KL8A 3D4JA 1U24A 3GU0A 5D4PA 4I67A 3OSNA 3IIBA 2J9CA 2AE6A 3SIPB 1X4HA 3GTYX 1WHXA 2P6SA 4DFJA 2ZPAA 2Q0YA 5C24B 4EBEA 4ECZA 1T9TA 4A8QA 3GQCA 2CPDA 5CBMA 1KKHA 3OT9A 4FS1A 1FY7A 4JI0F 4YU9A 2O67A 3CCSS 2FJXA 2PJBA 1DQ8A 5KFNA 3R97A 4M5DA 2A18A 1IBKF 4RW7B 4F36A 2IMWP 1A7GE 1WEZA 2V8HA 3HFVA 1F3FA 1HR0J 1TTHB 3IRXA 1XERA 2X7IA 2BRLA 1RABB 3FKBA 3U27A 2RC4A 1P8GA 3FVLA 4WIIA 2ZH7A 1FD2A 2DTJA 5H9EJ 3T3FA 3TUJC 4ZPVR 4C8NA 1F5BA 2OGUA 1KOHA 3SBMA 4RZRA 1I5OB 4YHHJ 4JI7J 4PUOB 1I6JA 3T5KA 2PIIA 3K2YA 4Y6IA 2FVQA 1XMQF 2FC8A 3BGFA 2P6GA 2A10A 5HAOA 2NSBA 2M8DB 1SQHA 5HP1A 2A6MA 3LP1A 1L3UA 3MEKA 4KS9A 1SV5A 2MZJA 3R5DA 5BYSA 4J9KA 4CYUA 3S6KA 1M90T 3T1YF 3JYTA 1H8LA 2ZFHA 3P5BP 1DARA 1FNXH 2FJWA 1NEEA 4LRAA 1XN9A 3H8YA 4MBUA 4NFRA 1S6QA 2D7SA 2R4FA 2Z3OA 2JBKA 1SH2A 5KT4A 4DV2J 4KO0A 1MLAA 4OIWA 4P2MA 4UF4A 4YP3A 1I3OB 2JBJA 2RHQB 2DEJA 3JQMA 2CZ4A 3PKMA 3BQ1A 1RCXB 2M0GB 2ZJQQ 4LIWA 3UVJB 3W8GA 3ULHA 1VR6A 3RO0A 2UU9J 3GJQB 3GSIA 2CQDA 1T03B 2RDJA 1ZBTA 2HVEA 1Q95G 2ZM6J 3KK3A 2BQRA 1JLAB 3D6TB 2GJ2A 3KLIB 1W2BR 1IBLF 2UUBF 5CYMA 3W2VA 3NGKA 3H8FA 3TE4A 5KFEA 4MY3A 2D9OA 3AH6A 4A33A 3QGIA 5B0CA 1VRTA 4DV7J 3LUYA 3I9SA 1RAJA 4DFPA 4UQGA 2YPZA 1YREA 4FKYA 3TOBA 3UD4P 2AZ1A 1O51A 3HHLA 3ISND 4DR1F 5MAOA 1NSQA 2AFXA 1DZ5A 4AL7A 4ZIWA 4W92B 3PW0A 2Z2MA 2D3UA 5K14A 3ZTQA 2YPYA 3N5FA 4LBIA 3GWCA 2CJXB 3B3SA 4AVCA 3TA1A 1KUYA 3PIOQ 1M1GA 1OO0B 4OZNA 4UFXA 3M6UA 5IFMA 4QCLA 2IVMA 4LF9J 4KHRA 3EDRB 1DURA 3KG0A 4GKJF 4O3NA 3V6HA 4NXMF 3D2PA 2R2TA 3T19A 3BQ2A 2ZDPA 1EETB 1RWWB 5D4OA 2HQIA 3EYZA 2Z10A 4J9LA 4ZP9A 1ZG9A 3HMJG 3PRBA 4RW6A 2MY8A 5AG7A 4RU9A 4UEEA 2R8GA 1WORA 4DR4J 2OI2A 4P72A 2CPJA 5G4DA 2DHHA 4TYAA 2OIHA 3UNYA 3MFHA 4A2ZA 3G3SA 5CYQB 2RS8A 2J0WA 4DYOA 4X65J 3M2RA 2CDQA 5HMYA 4IH6A 1QJHA 5KT2A 1UFKA 2X1BA 1FK9B 2E5JA 1U09A 1IQTA 4DLGA 4ZY1A 2ZBPA 1M4LA 2RS2A 3PBEA 4V19J 2VG5B 1OWXA 1HWLA 2XS2A 4Q2MA 3GV5B 1R31A 2BQUA 1REVB 4NA1A 2J7WA 2DNKA 4I6WA 1KLMA 5B09A 4HKQA 3VCDA 3IBFB 3D4UA 2JOQA 2XEXA 2FD2A 4JI6J 3G2XA 4CLWA 2O5DA 2CJBA 4ETXA 4C8ZA 4F26A 3PZJA 3QT6A 1R8BA 2VB6A 4LRFA 4FF1A 2YQ3A 2XY6A 3FX6A 2B5JA 4DL3A 4C3KA 5A8RB 2I6WA 3MUVP 4NCGA 2HQDA 4YFJA 2XSJA 3FQKA 2RU3A 4Y49B 3S6HA 2LQ5A 4P6QA 1N36J 3BREA 2P9CA 3CJQA 4JI1F 4WYWA 5IZHA 2PN6A 4WCEQ 2GVDA 1U2RA 4ED0A 1MG7A 1R8AA 2CQ2A 2CZ9A 2BEFA 2FHMA 4JI8F 5F8NA 3CXQA 1HD0A 2EC0A 2JLFA 1N33F 3BN4A 1T3OA 4JI4F 4ZPWR 3QT5A 2B43A 3VWEA 5BJRA 3CCWA 1FVSA 4NWBA 3QAYA 1HYSB 1SPBP 4NPOA 2Y1JA 5CH7B 5DQIA 4X4RA 3W65A 1JLCA 2BANB 4WWVA 2V67A 8ATCB 1E6VB 1VQPS 1RWPB 1TV6B 4LRBA 4RN7A 4IFVB 2C27A 2AGPA 4DL2A 1WF0A 2HWHA 1U1MA 1ZH5A 1H2VZ 4FBEA 3OFFA 4X5KA 2MGZB 2FZGB 4OZ5A 3CIZA 2RF2B 1NK9A 4AG9A 1ACMB 2O66A 1R0CB 2QYGA 2B7CB 4RNHA 3MOZA 5G0RA 3TVKA 4ELUA 2MZ1A 2ZH3A 4EI2A 2L3MA 9RUBA 1DQAA 2DEIA 2CPZA 2K7JA 1RYRA 4ZX8A 1JB0C 3TANA 1FWLA 2YX1A 2ZJPQ 5AXMA 4QYZJ 3P8BB 2QVPA 4K0KF 1R3NA 2KFNA 1WNEA 3CGIA 2IHR1 4X3RA 3MCMA 4BHQA 5U47A 3NH8A 3QZ8A 4G1IA 3GIIA 3ET6A 1SC4B 3BI0A 3V6KA 4WU3A 4FNHA 2CJQA 5D0HA 4CYPA 2M7SA 4Z2XA 1BAVA 4M5MA 1IM6A 4H2KA 2Z4PA 4DBQA 1LAPA 5CD4A 1HNVB 4PQAA 4CNYA 3G8SA 1YK3A 2DIUA 1Z2ZA 1RHRB 4LQ3A 1MNEA 3EFAA 1UZHA 1B7FA 1I1DA 1VQ4S 1K0TA 4DN0A 2DCLA 2VG6A 3BO2A 3O3LA 5DWMA 2BABA 3OBIA 4WJBA 2J76E 5GADU 1B7YB 2JLEA 3H8GA 2J9DE 3CMES 2YNFA 3M8PB 1N5YB 5KAKA 3E3XA 5T14A 4YMEA 1RWUA 4LSLA 4I6YA 4Q45A 3US5A 3FMCA 4PZVA 4U5YA 2NLWA 5L46A 2DIVA 4C7QA 1RHUB 4F4ZA 4QWDA 1HNIA 3MPUB 2XB2D 2EFVA 2B9WA 4UFWA 1GH8A 5JM6A 4K2XA 1BQMB 1ELMP 2LQ8A 3S01A 2X1FA 1NHVA 1SQEA 2GW8A 4MFJA 3VARA 3JQKA 5KFGA 1VQ5S 2DNLA 4A31A 4OI0A 1X12A 1GMWD 1LRZA 4JI2F 2BOPA 3CJ4A 1TIQA 4LSNB 1FRLA 3IO1A 2DH8A 2C22A 2OMLA 4ZPCA 3RAQA 2MHEA 4KE5A 4PXEA 3DRSA 2B8PA 4PPZA 2FQQB 3KYLA 2MKIA 2Y1RI 4N56A 2KJVA 4A8WA 1T9YA 1OQ6A 2OFHX 2GA7A 4ZCIA 2R7SA 1JXLA 1MSWD 4H4OB 4NCAA 1VQ9S 5AJ3F 2P6FA 4DX5A 3SYZA 3ILLA 2H5IB 2HHWA 3K5PA 4DUTA 2QYCA 1QD1A 4AYBD 4UTGA 5L39A 4OJGA 4KGZB 1ZO0A 4ZY0A 3W5XA 2PI5A 3BBBA 5DGBA 2YWEA 2CXAA 1X4BA 2PJ3A 2WPWA 4RPFA 5DWNA 1KVJA 4F9UA 4ID8A 4RJVA 3DCAA 3T90A 3JAMY 3EM1A 4M6IA 5DZ6A 1VLOA 2Y0MA 4Q5VA 3RYOA 2LCWA 4PPDA 1CBXA 3EXCX 2M70A 2BOAA 1GTEA 5HMZA 1RAEB 2HAIA 5EX0A 3MR6A 1WF2A 1FDBA 4JI0J 4MCQA 4KFBB 1U1KA 3W6SA 5KFFA 3HVTB 2E7XA 3R6LB 4UEFA 2HGNA 4DQQA 4CS0B 1IBKJ 1ROFA 1R0AB 3RB0A 3KR5A 1N56A 5HL7Q 4R7MA 2OEMA 5J8CA 2ZWPA 4KORA 1TF8A 4GKKF 5KOWA 1WC5A 2FS5A 3GYGA 4C97A 3R27A 5BYRA 4H4KC 1NUEA 2B51A 4UWJA 1N32F 1RAHB 4E2FB 3Q8RB 4OC3A 4PCQA 1BQNB 1XMQJ 1IIDA 2OEKA 4ILRA 4ANCA 5JQ4A 4FD4A 3TQEA 1YLEA 2W8LA 5T41A 3FMBA 3DOKB 2HLTA 3GP9A 3CF5Q 3D7GA 1WG4A 3T1YJ 2DXDA 2L48A 1K73T 2BJEA 4H4MA 3HHKA 3GIUA 1IWAA 4ECSA 3HKWA 3I31A 6FDRA 1PGZA 4P4JA 4EO6A 2VBZA 4GVBA 3MMCB 2BW7A 3TT2A 3G6XA 4IFYB 1R8HA 2DGTA 2EFGA 3SMZA 3FEZA 3SI0A 4EVYA 1AUDA 4RNOA 3RR8A 4ZA1A 2MKKA 2YWGA 1TUVA 2J0XA 1Y00A 4Q38A 3HI9A 2VOOA 3IG1B 4MFLA 3RBEA 4FF3A 4HYKA 2WSFC 3C26A 3PR4A 3T5LA 3V2UC 3QWPA 1CC7A 2PEHA 3TJAA 3HHDA 1QSLA 1FT7A 2W24A 1UJ5A 5J2QB 2HURA 1WG5A 2ZBQA 2NMTA 1IBLJ 4TLQA 1VKCA 2UUBJ 3BR9A 1JKHA 4FZVA 4O3OA 3QO9B 1U6FA 3NH5A 5D0EA 1ZPVA 3JSMB 5KFDA 4LMZA 2ZD1A 1E6YB 3GMGA 2PJ4A 2DGUA 3UDEA 4CP5A 1FTCA 2H51B 6FD1A 3M7VA 4DR1J 3A3PB 3EC4A 4FPIA 2ZW4A 1LOUA 1XR5A 3R5JB 1QUVA 4AFFA 4KJIA 1T8EA 3KR4A 4JD6A 2YTCA 4LR7A 1RP5A 3OXGA 3K89A 3ENAA 2KYXA 2XZDB 4RW4B 1F9EB 3V6JA 1KHVA 1JXVA 3DRPB 2EBGA 4HPSA 3GG0A 3QT8A 2XCAA 4X64F 1UPMB 2BV3A 4EZ6A 2FHJD 3NGDA 3T5HA 1P1LA 2EW9A 2J8NA 2IM3A 1RWVB 2XEGA 3FBUA 3PIPQ 1PILA 5D78A 4NXMJ 2KT3A 3JRUA 3OR2A 4X4QA 4F0HA 2KHDA 4MK8A 1YX0A 5EC4A 4F50A 1RBOB 3NLCA 2C2ZB 5B0AA 3BZQA 4E0DA 1TF9A 3EUNA 4A32A 4L3NA 1XOVA 2DXFA 3TVYA 1NXIA 1QSSA 2FYXA 4ZP6A 4PWDA 3MI7X 2HQGA 4CNZA 1IKWA 2W9BB 4A8MP 1DE4C 1X4CA 4K4VA 1IKYB 4CLTA 4YB5A 1NDKA 3F56A 2ZH8A 5FLXU 3QSYB 3K5MA 3RYLA 4DQIA 2AW0A 1LEOA 1S9GA 2IBKA 4FD5A 2CZVC 3UN5A 2KU7A 3N7ZA 2VBWA 1T9WA 2G0CA 3QLHB 2AIRB 2MJNA 2YX4A 2Z30B 2IA6A 4F02A 5IC4B 4K4ZA 4PG6A 4KT0C 1HL6A 2X1GA 4DUKA 4K4UA 3ILIA 2JJ4D 1WELA 5FVJA 4LF1A 4I64A 3IR7B 4FYXB 5K20B 2GC8A 5LYIA 1S6OA 2JRSA 4B3RF 4OI1A 2OAUA 3AJ1A 3M8YA 2O53A 3HVAA 3WZ0A 3O6QA 3I0SB 4DL6A 3LWUA 3M6WA 1SIWB 1I21A 3UW1A 5CCMA 3W9IA 1JJCB 4LBPA 4DOZA 1HBMA 4WFZA 4JI1J 3J7YI 2XHCA 3ETMA 3QPIA 3PFOA 4JI8J 1Z8TA 3D54A 1N33J 4JI4J 1HQEA 1S97A 2Y8WA 4PK2A 1NSLA 3HD1A 4R6TA 1EQMA 1TVRA 5DDPC 1NNDA 3SI2A 4LF6F 3FC9A 4HI1A 5D3GA 4U95A 1AW0A 2EI5A 2DR5A 2WSAA 1CQMA 3D8PA 1LW0B 2AD9A 5F9NA 3UDVA 4NGTA 1PYSB 5KFJA 1BMQB 4MI4A 3QGHA 2F5IA 3NOGA 1VBKA 4HH0A 1IR0A 4QU6A 3LD2A 4M5JA 7AT1B 2V6AA 1JQGA 2KM8C 4IG0A 3TNVA 4KOUA 1R6YA 2GLFA 5L1LA 3D0HE 1LQ9A 3B2YA 5CYJA 4DR2F 3D7FA 3GV7B 4B3OB 2IM2A 5LSRA 1S1XA 2XYHB 2H9ZA 2RE1A 3EE3A 4E98A 4HTJA 5LYDA 2BJDA 3EGVA 1UFHA 4K0KJ 4PYDA 1XIXA 4AB7A 3VVTA 4JV1A 2XI3A 1HNZF 2CNOB 5KFIA 4ZOSA 2EO8A 3GFHA 2P0WA 1FXRA 3V6DB 1N4LA 1YRUA 1FFGB 4A8FA 2OPQB 1LXJA 3MM6A 1F2PA 1OSDA 2OD4A 3M30B 4YGOA 2YXLA 4KV8B 3PACA 1O0PA 2DGOA 1PIEA 3K57A 3J7A1 4TY9A 5A2QY 1CJKA 3CW2C 1WC3A 2AJ6A 1M5HA 3CJKB 4ZVTB 3WC7A 3FECA 1IKVB 3I87A 1B64A 4TY8B 1ZG8A 4CLUA 1H73A 2QLXA 4EMDA 2C6CA 4YS2A 1JLQB 1VRUB 5DDRC 1BC6A 1ZM4A 1FRHA 2AZ3A 6AT1B 5F9LA 1GNKA 3W2WB 3THTA 1ZA2B 1WOSA 2W2OP 3GV8B 2PCUA 3Q89A 4WPAA 3C14B 4F9VA 5C42B 2R9LA 4B5PB 4PKDB 3NGSA 3BBFA 4NLSA 5H9EK 2XLIA 1RJJA 3ITHA 3H2LA 4FBUA 4DHVA 2IAJA 4X8IA 4QWAA 5HMXA 4J9UE 1VBYA 2WB4A 1JMTA 1NHUA 4JI2J 2HAFA 4DEZA 1ZG7A 4WE1B 3A12A 3DOMA 4N8OA 4M6GA 1Q53A 4WFYA 2Q3PA 5KFKA 4OC1A 2BQ3A 4I56A 2WW8A 2Q7BA 3D9BA 4P52A 4QPTA 4JP8A 3QJLA 3MEDA 4LREA 5A6WA 5J2MB 4GC7A 2ILZA 5AJ3J 4M5GA 5IB0A 2OPRA 1YMEA 1UEKA 3NWRA 3CO0P 2AFUA 3FB3A 2KKHA 1U0HB 4PR6A 1UL3A 2EFNA 2ZNZA 3A1YG 2KFZA 3CMAS 4P9SA 1JLFB 3E2EA 4NI2B 2ZBCA 3IN5A 1RI7A 1N5TA 3W7BA 1XMTA 2QLBB 1CPSA 1Y10A 3OL9A 4PWWA 1SUQA 1Y3JA 2HBQB 2HNYB 4P4IA 4R3KA 4PWUA 2YNGB 1UPPA 2CY2A 4P6YA 1LFPA 3H90A 3SSRA 5GCNA 3DYAA 3SSQA 4P44A 2JLMA 5DM7Q 1M5PC 1WUUA 3GIKA 2F65A 4MHPA 1KEKA 1DTQB 4B9LA 2VBYA 1FJCA 1WACA 3AOBA 2OB0A 1YVKA 1K9MT 4CDIA 2DCUB 4DJBA 4JI5F 4DI6A 2WSCC 1S6UA 3NS6A 2G3TA 1EARA 4GKKJ 2D1CA 4CLSA 4CGMA 5KG5A 3M2VA 2ZH2A 2REEA 2Z58B 5A8KA 5LSLA 1RA6A 1S1WA 2PJ1A 5AE3A 1N54B 1RT1A 2C2KB 1EB0A 3VAHA 1Q82T 1Q5YA 3O44A 2VJVA 1N32J 2MQQA 4A30A 1ITPA 4DV4F 1T94A 4ZK7M 2R8VA 1VC5A 4OJHA 4B3TF 2I1RA 2PJ8A 1RU1A 2HRYA 3TUIC 4M5DB 4DSEA 2MQOA 1RAOA 2C3MA 2Q51A 4NJQA 4ZX9A 3TZXA 2Z57B 1BWEA 3IRXB 1WOOA 3TI0A 4QC6A 1AFIA 1AYEA 4J90A 5EX3A 2A2DA 1D9AA 3FH4A 4CAXA 3K58A 1NSAA 1SQFA 5B08A 2BDPA 4R8UA 4J9MA 2REFA 4UA3A 5L1JA 2V50A 2LA4A 3G8QA 3LP1B 5HP1B 2I3CA 2OU2A 1SV5B 2Y0BB 2FC9A 1VYAA 4DPYA 2RQKA 4CYUB 4NZ7A 3VZHA 3JYTB 4KOVA 4D3GA 2F40A 3GCXP 1HEEA 2HIYA 3KJFB 1S6QB 4MFKA 2QA2A 3S9LA 4OI3A 4L8AA 3BPDA 3TA2A 3M8ZA 2LXIA 3EXYA 4KO0B 2K2PA 3KLHA 1BHNA 2J9DA 4WYLA 5BR8F 5A76A 5K8MA 1YX2A 2B3TB 1F2GA 3MFIA 4M5IA 1FJEB 2H5EA 3T1HF 6CPAA 5J2NA 2FZCB 3D6FB 4LVNP 4RW8A 4G1QA 4ONUA 1LOKA 2EFQA 5KG0A 4Y34A 1UVLA 2FL4A 1P6TA 2HVZA 3KK3B 2R8HA 3HDSA 5CQGA 4HDGA 4XO0A 2AFMA 5LJ5Y 2B4DA 2B4PA 5IQ6A 3J80Y 2AJQA 1FRJA 5CYMB 3F0AA 3W2VB 4FP9A 1NB7A 3IC1A 4ED3A 4QPXA 1IM4A 2R8JA 1FRIA 4X64J 3Q8UA 1VRTB 2OPPA 3FFIB 3W1YC 4P74A 1RB0A 3T9YA 3JTKA 5J1QA 4L72B 2P9EA 1B99A 3HHLB 4ED2A 2I9SA 1I94F 4ECXA 2LMIA 3ISNC 1CX8A 5M2PA 4OL8A 5CXTA 4R5PA 3WX8A 1IGBA 3IS9A 4YDDB 5K14B 4JV0A 1PC4A 5GAGI 1MK4A 5KTDA 3SV4A 3FEYB 2K1RA 2XI2A 2VUGA 3A3NB 2DY9A 2VC1A 3Q86A 5DQHA 4KKOA 1KR4A 3JS9A 1S0MA 5LRKA 4DJLA 2F4VF 1NJZA 2PMZD 1G4CA 3MD3A 5A28A 1X9SA 1IBMF 4KSIA 3MM5A 1SQGA 3OPKA 2B4VA 3CCMS 3K8WA 3EVMA 4JXQA 2V5HG 2UXBF 2HZVA 1BPNA 4WP9A 4RW6B 2JEIA 2VODA 1FJ7A 5DS7A 1QY7A 3RZAA 5C88A 2ZENA 1NK8A 4ITSA 4KH1B 1KVKA 3MGJA 2AFOA 2J6SA 4C8KA 4DLEA 3FNNA 2OMOA 1RAAB 3ZZYA 2CRLA 4M5LA 3RTVA 3M2RB 4B3RJ 1ZA1B 2D3O1 4E8OA 2RHSB 1RHMB 2DY1A 1FCAA 1VLYA 1CVJA 4YWYA 3L3CA 2CF4A 1Y0HA 1CJVA 1S1TA 4CO0A 2YNEA 5M2RA 2CNMA 2QMUB 3N6LA 1LK5A 2NUHA 1DAXA 4ZBGA 1YGYA 1KLMB 3HP6A 4HT7A 1U49A 4KVXA 1B6BA 4USJC 3K8VA 5IM0A 2KHCA 3OFGA 3N0VA 2LKZA 2A1BA 1WSRA 4NLYA 2XMMA 2Q44A 3DDIA 1RAIB 4LF6J 2B5JB 4KGMA 4NCGB 3H8EA 4ELTA 2XSJB 4B12A 1UA1A 5JPHA 5ELYA 2OFGX 2DHGA 5ITHA 3HVRA 2PJAA 2I79A 4KSAA 3CCRS 3QATA 3LWMA 3PVXA 2GVDB 5ETQA 4K8RA 4CZCA 3WX4A 2EG1A 3ZZ0A 4WWSA 4UOFA 4FUUA 1FWKA 2XG8A 4LBHA 5KG4A 4KAIA 2FGCA 4N5SA 2PDAA 1JLCB 2IRXA 1RTHA 2XMJA 1WF1A 3S9MA 4M94A 3T1AA 2OSQA 3TC8A 4QW9A 2GO9A 3BO4A 1TL1A 2D41A 1HNZJ 1N5QA 4XPDB 1VS3A 4NA3A 5CABA 2B3VA 5G0RB 2HQ3A 5SUHA 2YNIA 1ICEB 1V5IB 1OZPA 2J7KA 5D8NA 1YLXA 3SJEA 4Q43A 2EBJA 2QFIA 4OQJA 1X8DA 2QMLA 3KGQA 4ZCKA 1RT6A 1HNXF 4HKFA 5JXSA 1GMUA 4DX8H 1MW7A 3IA0A 4ZJLA 3ZTSA 1ARLA 4C2XA 1FE4A 3DRXA 1KUXA 1TL7A 1LK7A 2J5AA 1O6XA 1V5VA 3R3TA 4FYYB 2MQ8A 3PHEA 3ZC4A 2Z3KA 1TKXA 3ET6B 2J8AA 1F2OA 3SXNA 3O5TB 2E9TA 1Y5IB 2EWHA 3B78A 1KTQA 4OYMA 4NGPA 4URSA 2UZAA 4KVME 2KCWA 1HA1A 4O3PA 3JXOA 5J2PA 5IV0A 3M8RA 2PE8A 3OTEA 3DN9A 1JLGA 3RRKA 3EVOA 4I2QA 5B0EA 2N3OA 1UETA 2HIQA 5B7WA 4MIWA 1NPKA 4ZI6A 2F8MA 5DZ7A 3IAM9 2NYQA 2VG6B 3HZGA 4ZCMA 4R25A 2K06A 1Y7EA 4B6ZA 2AJ0A 1FXDA 3LALA 2YNFB 4Q36A 2VFRA 2M3DA 3FBEA 3D6MB 4LSLB 1FX2A 4JUZA 4ZLJA 2RUSA 2BEIA 4LQGA 4BWJA 4QIEA 4ZVQB 4TWEA 3UO0A 4R87A 4YRHA 3BSNA 2D4PA 1VBZA 3KKWA 3GLJA 1T9XA 1HNIB 2RILA 1ZPWX 3VQTA 2JVRA 4UOCA 1RK8A 4Y2IA 5IWAF 1NMEB 1EQ0A 4UZCA 1S7FA 4OYIA 1T7PA 3PM9A 1XF8A 1CJTA 1RT7A 1TAUA 1CBKA 3R9FA 4ES2A 4YQWA 2YY3A 4A47A 2JC0A 3FJUA 3AAWB 4LFBF 1Z8LA 5K8NA 2HHVA 2QSFA 2L41A 2ZEHA 2E7VA 3I82A 4YUDA 4W90B 3DRSB 3MAAA 1CP7A 3MTJA 2DEAA 1DTTA 2R98A 4YHHF 2Y0SD 3G8TA 3FVYA 2HHHF 2XNRA 4QR0A 2B8QA 2W9CA 2EK8A 2SXLA 2CNNB 1LWFA 3W60A 3IWGA 3QRQA 5AE1A 1C4CA 4OYWA 1WKJA 1PAUB 4TQSA 3BO3A 3KHHA 5J8FA 4OZ0A 4U67Q 3B4MA 2B4OA 4EEYA 4C68A 2J0SD 2FVRA 4HNWB 1P1TA 4I1TA 5CNPA 2CPYA 1IXKA 1LNQA 2DPIA 4FXDA 3D3BJ 4I4BA 2VDHA 1SJRA 1OY6A 1JLEA 4WK3A 3W5ZA 4JI5J 1HI1A 2R7UA 1I12A 4NGRA 2NXNA 1SB6A 1FHTA 1OJ4A 1S59A 3CCES 3PHTA 2J7UA 2VPYB 1UAWA 2QZ8A 4X4UA 4USMA 4FYWB 3WC5A 2DNNA 2R2RA 4DV4J 2ZM6F 1RZMA 4URGA 3NE7A 3QB8A 2ZHBA 3MM8A 4LF2A 2ZH6A 1REGX 4RBVA 3THVA 2IFXA 3TZZA 3OL6A 4WP3A 1ZLHA 3DNCA 3P3DA 1N5SA 1C1CA 3UR0A 1LKZA 3MM7A 3MHYA 5B0GA 2ASJA 2GAGC 1XJWB 4OI6A 3SJXA 2ZC3A 3LGNA 5LM7E 1S7HA 2IMOA 1OYDA 1M0SA 4KLWA 1QSNA 2HK3A 4IKAA 1Z4RA 2AJ1A 3IMQJ 2N7CA 4X4PA 4DQPA 5CZVA 2XO7A 3VAIA 3H5SA 2DO4A 2H48B 3KLFA 1MWZA 4FAIA 2FY8A 3QYYA 2P8IA 3FBFA 2GREA 1C2PA 1TKHA 3T41A 4ZPDA 1Z2LA 3CPWR 3TA0A 2GAHC 3WABA 3ZZRA 4H4MB 2PVVA 1YBUA 4WKYA 2BCOA 3PW4A 1U1PA 1FX4A 1HQUA 4JYWA 4GVBB 1TXRA 4YB7A 1NK0A 2DNOA 2G2ZA 3BGRA 4DF4A 3CJTA 3NCPA 3VQSA 5BR8J 1NPPA 5KFWA 4JYAF 3FRYA 3V38A 3QNVA 2YNCC 3HFKA 2B3UA 4USHA 2HKEA 3T1HJ 1J4JA 5LYLA 4ID5A 5ISVA 4LFAF 1Y9WA 2BUNA 4LF4F 3QQCD 4UY8T 3O1LA 1D3WA 3W5YA 4USVA 1RTIA 4KIAA 5I3PA 4J9NA 4MK7A 1UVNA 2G0JA 3ETOA 4X65F 4K50A 2MQPA 2MZTA 1FEEA 2ZW5A 3NCRA 4DZDA 2ROEA 2J8RA 2YWFA 4NLRA 4C6AA 1JKHB 4A8OA 2XTJP 1K4JA 1PYTA 3MR5A 3C15A 3KLEA 3RRGA 1BD6A 5ETVA 3NNCA 1IB1E 2DNQA 1OMSA 4F6AA 2DO0A 4P4DA 2ZD1B 2EG2A 3U1MA 3KHZA 4CH0S 1U8WA 2VPXB 2PFFB 2O28A 4DUYF 3OWCA 1YR0A 1OY9A 1Q8LA 1I94J 3KLVA 2RH3A 1M1KT 1Q8BA 3G6ES 1S57A 3KG4A 2HHPA 4HNYB 3WC2A 1RWOB 3F8KA 4GVLA 1PKUA 1IICA 4CRJA 4FWUA 3MPWA 2XCPA 2B0GA 2VV5A 1U26A 3KHXA 1QTNB 4DNCA 3EZUA 3TW0A 3V4IA 4CPAA 3WC6A 1N36F 1DRZA 3OHAA 2OKQA 3SJFA 3HJVA 1S5ZA 1O5JA 4DCOB 1S4FA 2F4VJ 1ZZFA 2FJBB 4D3HA 2DNPA 3MM9A 4DSFA 2V63A 4NASA 3M1VA 1IBMJ 3D1QA 3NBPA 4FYDA 1CEZA 2UXBJ 2DGWA 4U8YA 3MPVA 1XNQF 1D9DA 2MPUA 1Z4UA 1B0PA 2R3VA 2WHOA 2UUWA 4N47A 4Q7AA 4J9RA 1IKWB 4CAVA 3NP5A 5D0GA 3D0IE 5KT5A 4GRSA 3LQVA 1LWXA 1Q5VA 2XNQA 2G9DA 4OP4A 3R9GA 4Q44A 4DR5F 1S9GB 2V4RA 3PYFA 2B5GA 1FVQA 1SJFA 2FHKA 2G13A 5EHHA 3IFEA 2G9OA 4JJXA 1IKXA 2LQ9A 2CQ3A 1AFJA 5D6GA 1VQ7S 3BYRA 4IRKA 5BWAB 1S99A 4C2YA 3W61A 4KB7A 3KFWX 3NKYA 5LXYA 2PE3A 4FS2A 1CPZA 1P0HA 4C0HA 1SC1B 4KPYA 4IG3A 5D4NA 2GHVC 1WD6A 1J27A 2ALZA 2FLNA 3R9EA 2IM0A 2YGWA 1UW4A 5G22A 3PO4A 4F2RA 1SJQA 2RB7A 4ZHRA 3RB3A 3OUYA 1GYTA 4DR6F 3VR1A 3BKFA 4NRTA 2M88A 4IQXA 3H2VE 1X4FA 3LO3A 2PA8D 2ZUAA 4MFBB 2CQHA 4HVZA 1G7CB 1XJOA 4FKXA 1HBMB 1MWQA 5DGAA 2MZSA 1HFEL 3J7YU 2BJ1A 3SCLE 2CDRB 2K3KA 4OHZA 4RBTA 4KRWA 1BOBA 4ZVOB 4K5SA 4G6VB 2KTQA 1HQEB 3SQGA 3L7PA 1H3DA 2H4YB 1TVRB 1KS2A 2ZELA 1M5OC 2DPTA 4P7VA 1QM9A 1SH3A 4WBFA 3R5BA 3I9V9 5LJ3Y 2VZZA 2MKYA 3TUPA 1S7NA 1ZETA 4M5HA 1D8YA 4OC5A 4BS2A 1XFOA 2V77A 2QV6A 2PO4A 4V1Ak 4KGXB 1B70B 1VMBA 2ANPA 2OH1A 2EVZA 2MMYA 4IG0B 3C3LA 5FLXY 4AL6A 3CPXA 1JLBA 4K7QA 3GB0A 5GMEA 3CUNA 3VGTA 1F3VA 4PEOA 2WZNA 1TKTA 1S1XB 1SBRA 2HNDA 3L2NA 5LT5A 3CPAA 2YH1A 2OPSA 2W1BA 2CTCA 4ZLPA 4C3MA 1HNXJ 1WG1A 4IO1A 3HT0A 2B4UA 4W9YA 4USUA 5FIIA 4R3LA 1Q0NA 3JTNA 5E3RA 1UEVA 3SDEA 2MKJA 1Y9KA 1QQ9A 2EXUA 3FUYA 5KFBA 4YEAA 2MLZA 2ZDOA 2V8VA 3ZZUA 3OL7A 2I5JA 3D5MA 5HBMA 3MM6B 4WZMA 4NLPA 2F1FA 1F9FA 5K5MA 3B6BA 1S1VA 3UNGC 4OHYA 2RDDA 3TWZA 2ZKUA 1CJKB 5CD4H 3IWLA 5JUMA 3W66A 2VFUA 1NSKL 3R7NB 1HBOA 4XPEA 2LVWA 3MZIA 2MDAA 1GAOA 2XM3A 2E5IA 4QR1A 4LF8J 4ZVSB 1HIYA 4OX7A 2QMXA 5LOQA 4NSQA 5I42A 1QDUB 4F4YA 3N28A 2F5GA 4GM5A 3T9NA 1RGVA 2VHGA 1OS5A 1YHQS 2CG8A 1T0TV 5KFHA 2DPSA 4P10A 3BXMA 3MCOA 3HFZB 4UEZA 1G6BA 4NEXA 2PJ5A 1VDHA 4AD6A 4NGMA 4P73A 3KG1A 2E5GA 3BSOA 4KC5A 5KOXA 4CRZB 2NXEA 5F0UA 3EO4A 4P7TA 3TO6A 1MJBA 5IWAJ 4YFUA 4CAWA 3AXKA 2I38A 2IYIA 3ITHB 5FJ4A 4KOYA 4MKAA 2IAJB 2GCFA 3KZWA 3LP0A 3GIRA 2LLZA 4AXIA 4LFBJ 3M8SA 3N5BA 2EUIA 2FLLA 4URQU 2W4DA 3DOMB 2KXNB 1XWLA 3D2MA 1Q16B 1U6BA 1R8PA 3U7JA 2UV8A 3H4BA 2JX2A 1PAEX 4NE9C 2M2BA 3ZZZA 1UWYA 2CQPA 2PIZA 4L73A 4H54A 2KT5A 4OX9J 2HHHJ 5MLCV 1TL3A 2RQCA 3PJWA 3CT9A 3HK2A 3MEDB 3A8KA 4AVAA 2FIAA 2IQ6A 4HI2A 3GYNA 3F41A 2OPRB 2QO3A 3KQXA 1YJ7A 1IY7A 4JV5F 2XSFA 4FNIA 3WBZA 4GS4A 5ETPA 4Y65A 2EKNA 4ILMA 5KFAA 1HHTP 2PMHA 2CWXA 3HT3A 3TEGA 3I56S 4A39A 1QAXA 2E5LF 2G1DA 3VGUA 5I0CA 1SUQB 3VHQA 2CPEA 4KHMA 2H5MA 4ZPTR 3RG6A 1VQKS 2IA0A 1TFWA 4ZY2A 3DYAB 3ZTOA 3HD2A 5IT9Y 2ODFA 3VTIA 4XPCA 5D15A 1UP1A 5DDQC 3DXSX 4CGLA 4ECYA 3QT7A 4WIQA 1MMDA 5GADI 3M05A 1BQXA 5C2CA 3CIMA 4OFZA 1TR0A 1Z5RA 2W7AA 3FCVA 4TU7A 2GANA 2YNHA 3I1UA 2DR9A 4Y3CA 2IJRA 4JLYA 4ZPBA 4RU2A 4F25A 1RTDA 3M2VB 4QIVA 5A8KB 4CLYA 1S1WB 1QSYA 1RT1B 3QFWA 3M6XA 2ZEGA 3GKRA 1S9EA 5ETLA 1WJ9A 4YB6A 5B0DA 1R0BG 3KOAA 1QSRA 5RUBA 5K8PA 3VF0B 5F47A 2PJCA 3K7RA 5HMWA 2C2EA 1YBTA 3H5ZA 3UI3A 4I0WA 1FERA 1H72C 2YVSA 1VHIA 2NSCA 2DISA 5KFRA 3W63A 4EBDA 1QAIA 2KJWA 3PCOB 1BXNA 1TFYA 5JVHQ 2GU2A 5DLFA 3LF0A 4ZKAA 4ETZA 4R8UB 1RHJB 5EBVA 4PXDA 2OUGA 3W8PA 1PYOB 5ETMA 1FKAF 5D4LA 4DV5F 1J5OA 3V5RA 4JYAJ 2EFOA 3S7RA 4WKRA 4F0MA 1KHWA 2XYPB 1YZ7A 3CMQA 2PJ7A 4DPUA 1YJ9S 4NX9A 1T11A 1SH0A 3SXLA 1KQSR 2CIJA 3L95X 3I6PA 4LFAJ 1NJXA 4K30A 4LF4J 5KG7A 4ICLA 2ZEFA 3C8YA 4OKOA 2V9WA 2HG4A 5H86A 3BB5A 2FDNA 3TJ9A 3I3GA 1AA1B 3QJPA 5F8GA 2JSXA 4A37A 1M4DA 3J7Z5 1RAFB 3A4TA 2EEYA 3K2KA 1KSPA 1IYLA 2R7TA 1Q86T 3PB7X 5J1NA 2Q79A 3KLHB 1B3TA 1K0VA 1QE1A 2IVFB 4U9ZA 4WXOA 4QZVB 4B9UA 4OYBA 5J2NB 2GS8A 4R8FA 1S5KA 4RW8B 1U8SA 4X66F 4DUYJ 4G1QB 4S0MA 1NK5A 3O2IA 2GVZA 4NGQA 2DNZA 2LDYA 1Q2DA 5LXRA 4MJKA 1RT4A 2MYFA 2BJ8A 1MMNA 2Y1IA 4DSJA 4NA2A 2MSSA 1VOMA 4ZP7A 2JEWA 2B4DB 5DRKA 4MYUA 3I9ZA 4B9NA 3ILJA 2DT9A 3LOUA 3IR5B 1EZZB 2MB0B 3KK1A 2HHUA 1M44A 2ATCB 2QLWA 1N48A 3LP2A 3NGUA 2OPPB 1UJ4A 2DHSA 2A2CA 4O3QA 1QAYA 2GIQA 1TP7A 2VXKA 5IV3A 1RTZA 4V19X 4GO5X 3GYXB 3EPIA 3PEJA 4CIOA 5KFQA 2N4DA 1X7VA 4R5PB 2DGQA 4PV6A 4RBUA 3IS9B 1XNQJ 3CJ0A 2RU9A 2ZBIA 2FJVA 5GAGU 2HGLA 3AD7C 2K1RB 1F60B 3NGRA 4Y2KA 3KK2A 3Q24A 2FT0A 1BUXA 4NLDA 3GSDA 1S6PA 5C7PA 1WTFA 4KKOB 5KFXA 4K59A 2KB2A 4F4XA 2F4FA 4NLTA 4J91A 3W91A 4CO3A 4WZQA 1NHKL 4DR5J 1SL0A 2WUUA 3WT4A 1ULRA 1RT5A 5K9FA 2JEGA 2KZZA 3MM5B 2BKOA 1NKBA 2VFTA 2HQFA 5K8OA 1LWCA 2Z11A 2FIUA 3GFXA 5KTQA 4YN3B 4R0JA 4N8NA 1YI2S 1HBNA 2KO1A 2JWNA 2M4MA 4H6UA 1YJUA 4IRCA 2IL4A 1BE4A 3LAMA 3ISZA 3AJDA 1G1XA 2Y1LB 4DR7F 5DS0A 4KQZA 3NXZA 1IBCB 1WC6A 4DR6J 2FVSA 5F48A 3AA8A 3IRWP 5C2GA 4ORFA 4DU7A 1CJVB 1Y4ZB 3C6UA 1S1TB 2ZHAA 1B0VA 1C1BA 2HZCA 3IWNC 1YJRA 4DQRA 1T9VA 2BM0A 1T02A 4YR3A 4B3SF 2D9PA 4YY3F 4PQUA 1FKPA 3HSZA 1LWEA 3H5YA 5IM0B 2UUCF 3G86A 1S72S 3MDFA 3C19A 4FF2A 2AKWB 1Q8KA 1Q4RA 3GIMA 2ZEJA 3BEGB 4LSZB 5GAEI 3RNZA 3MMAA 3I32A 5AG5A 2ZEDA 2AHOB 2B4BA 2FVCA 3OTCA 7FD1A 1HPZA 3KTQA 3C2PA 1Q8IA 2XYGB 4M63A 3HHLC 2DNGA 4NXNF 4OI4A 3QIDA 3MAQA 4NYOA 2GFFA 3M2UA 3CCUS 1YJVA 4K4XA 2QIRA 2WOMA 3ZNUA 3R5GA 1JK9B 1RTHB 4LUBA 4ZCLA 5THWA 1P9QC 4KOSA 3UCUP 2ZEEA 4CTAA 3MAHA 2HMIA 4Z7YA 4ZS6A 5E3CA 3NEKA 2AT1B 3L4BC 1DHMA 3DLBA 2AYBA 4IO9Q 1S12A 1TL1B 3QAUA 3MCSA 5KFPA 1WI8A 2R7RA 1WC1A 1TMMA 2MEWA 4P2SA 3OVAA 2QEXS 4OZJA 3F5BA 4ERDA 2FGOA 1YQHA 3RBXA 1RHQB 4QWCA 2YNIB 5LL6d 4FVCA 4O23A 1EE3P 1LCPA 3CTRA 3W6XA 1PJ6A 2K3IA 3BSAA 1RT6B 2PI4A 4LFCF 3NA6A 4O0IA 4AG7A 3VH9A 1CJUA 1TL7B 1UCNA 3C6TA 1R7IA 4KPCA 3UWTA 3PKYA 1OPIA 2HHSA 3NCQA 1IJEB 1NRKA 1TKXB 2HWIA 4ZVFA 5DJBA 1K1SA 3GPAA 2W2PP 3AT1B 2OELA 1VK3A 3DHXA 2U1AA 1XMOF 3FMWA 3S6GA 4A4JA 1U48A 2R7VA 5J2PB 3CSKA 3FGVA 1YRXA 1AB8A 2CTBA 4NGNA 1JLGB 4EK2A 3ZZTA 4I2QB 1QUPA 2DKOB 1SC6A 2XQCA 2M5YA 1R27B 1RTJA 4RUAA 2OO4A 3I5CA 5L38A 4DN9A 4P45A 2G3AA 2V2QA 1UWBA 4BC7A 7FDRA 1YG0A 1TELA 3NNAA 2MY7A 3PRDA 4HHUA 4X4NA 2UVWA 4CH7A 1B87A 5E41A 1D8ZA 3HO1A 1LV5A 1EP4A 2GFQA 1SIZA 2GQCA 4GXHA 3FNCA 4XAKA 3KI9A 2V9KA 3M8QA 3D1HA 3CCVS 2LEPA 4M5NA 2MKSA 1JIHA 3IWEA 1JXEA 3MMBA 1TUWA 1VHEA 4UW2A 3A9LA 2RKIA 4KOTA 3DGPA 1U1LA 2EBEA 4NLVA 4TLRA 4O4RA 3R95A 2ZITA 1QSTA 3TYTA 4ZJOA 2WBRA 1FEHA 2CXEA 4DS4A 1V9OA 5KFUA 2BRKA 4PABA 1CJTB 1RT7B 3FRMA 4XPDC 4HACA 2HHQA 1TK0A 3IEHA 2C2RA 2W9AA 2ZOMA 3AD9C 3KWMA 4JV5J 3DDKA 3B54A 4Z37A 2VONA 1F0XA 2XGQA 2BE9B 4B9MA 2R2SA 1YKWA 1Q7LA 3BGOP 3MAAB 4WU2A 1DTTB 2Q4VA 4C48A 3KXDA 3E51A 3D66A 4OV1A 1S0VA 4EYIB 2ATLA 2PRQA 2UV8G 4AE5A 2HRUA 4QBJA 2RUGA 2DRBA 1VIXA 5DG9A 5E5NA 3MUTP 4O44A 2W9CB 2E5LJ 2ZVSA 3DFEA 4ATNA 1LWFB 4K4WA 1RXTA 4FYVB 5IV4A 2RDIA 5HQMA 4BD9A 1GX6A 2QL7B 1H74A 3D6HB 3K59A 2VJUA 1IR2A 4Z65A 4ZN3A 4XPKA 1MN9A 2DNMA 3KHLA 2AV5A 2ZEMA 4JOUA 4RUBA 2VA2A 1H0HB 3MPYA 4GMKA 4CO1A 3FZ2A 4OJ3A 5D29A 3HPOA 2XY5A 3PJ9A 2DD8S 3X1LB 2YQ1A 3PO5A 4Q8FA 3TO8A 2ZH9A 1UVKA 4LX9A 1UKUA 1RT3A 1JLEB 5L9XA 4FD7A 4DZ6A 1S48A 3D7HA 4YB1P 2GLJA 3TTHA 4CM0A 1NDPA 2RMLA 1HDQA 2K5TA 4Y2CA 5IOLA 3MN8A 2DRDA 2ZH1A 2CJKA 2HB6A 3CNQP 3I0RA 3NMAA 2OP5A 4MHDA 2WONA 4H6ZA 2MZRA 4U96A 1WWZA 3ZZPA 4C8LA 2VEZA 4WTOB 2E1PA 1WHYA 3MM8B 3DLEA 4MCRA 3OVBA 3MTKA 3GYAA 1WC0A 4N7TA 1CM0A 3K9UA 2WPXA 2QN6B 1MROA 1C1CB 4PG5A 3MM7B 5CHCB 5HVGA 3AB2B 4KGKA 5EGYA 2FXFA 1DJ0A 4KY3A 4C9DA 3I4PA 1RXOB 2F8HA 3G6YA 3UN3A 3UR3C 4U7UD 4USIA 4IOCQ 1TKZA 4HEA9 1F2HA 4LF7F 3RUBL 2ZEPA 3QBCA 3C16A 3B3VA 1NLKL 1LAMA 2DR8A 3DOLA 2VQEJ 1HLWA 2I8EA 4DV5J 2CQ0A 1UVMA 2YKNA 4C8MA 2J9AA 1L3VA 4U6PA 3KLFB 2W2NP 4CGNA 3PGPA 2DYAA 2HVHA 3FSYA 2JHEA 4Y00A 4DL0C 3MPDA 2AEJA 2HS3A 2J8SA 3B7IA 3Q22A 3AQPA 3DGVA 3GE9A 3PB4X 1CS4A 4PAAA 1HQUB 1U1OA 4OZ1A 2YKOA 3BGRB 3QMQA 2AYGA 3CXSA 1EHWA 3FIXA 2GIRA 1TKFA 2RSQA 3P96A 4C3LA 2XLKA 1J2VA 2V8DA 4GO7X 2KVQE 1TUGB 3EICA 4ID5B 1IR1A 5CZXA 2QJ8A 1NJYA 4X66J 1SL1A 2F9JA 1XBWA 3M9NB 5EUHA 1FKOA 2G2OA 4HNXB 4DL4A 1RTIB 3BH7B 1EJ7L 3HULA 4JI3F 4HL9A 1F9HA 1A9NB 2IC3A 1UW9A 5E96A 3DLGA 1U6MA 2XMWA 2ZWOA 2J9EA 1PYTB 3C15B 2F63A 2KI2A 2MKHA 3KLEB 1GXTA 1SI9A 2MSTA 4BDPA 1TZ0A 2PD1A 5ADZA 2DB1A 3IP0A 3DR6A 1Q2YA 2ZH5A 2NXJA 2LFVA 1GXUA 2HFZA 4YOEA 4RW9A 2CJ9A 4FPRA 4NRUA 4OIDA 2CQIA 2Q04A 3J80U 1K1QA 4ES1A 2D4OA 4J9SA 5CCLA 4HLBA 3TAPA 4NJRA 1K47A 2HVIA 1SXLA 2P6TA 3ILOA 1ZOTA 5I3UA 2J6UA 2EWBA 2H3EB 4I2PA 2Q6CA 4QB9A 4M8LA 3V4IB 1KFDA 3UN2A 5IXUA 4UZBA 1U02A 4U9YA 1N6QA 4UQTA 2IM1A 1NZAA 2C3UA 4NYPA 3IJ3A 2FJAB 1RTQA 5HLFA 2ZOGA 2VZYA 2NR0A 3ZFVA 1NB2A 3MM9B 4QOTA 5A8WA 2Z3PA 1W25A 3M1VB 2IVYA 2ZEOA 1FT8A 3NBPB 2XMUA 3PBBA 3D2WA 4P4FA 2XGPA 3TZWA 2F8EX 4WP8A 1T3NA 2Z3NA 3AHPA 1NJIT 1N52B 4TVAB 4OAEA 3ZXWA 2FVPA 2E9ZA 2LYVA 2MJUA 2Z2YB 3W9HA 5IT4A 3GR1A 3HLPA 1YJWS 1H38A 3FCWA 3NRBA 1Y7PA 4ANDA 3PP9A 1N0VC 1QSOA 3EGWB 4A48A 1URRA 4DG1A 4DR7J 1IN0A 4B3MF 3QSIA 4LRDA 2B5GB 3DHWC 2OHDA 3WQPA 1LW2A 1X0PA 3AOCA 2NXUA 3GFZA 5FD1A 3WR7A 3TO7A 1TAQA 1IKXB 1S60A 1S49A 2DPJA 1ZS6A 2OZGA 2BSWA 3W64A 1NSPA 5EWGA 1FDDA 4ENOA 4B3SJ 4YY3J 1HW8A 2MQNA 3TOQA 2GIFA 4IG3B 4CT8A 3LGMA 2UUCJ 1S3ZA 4K4TA 4WFAQ 4FDFA 1O8BA 4LVOP 4AXVA 2F3JA 2ROGA 4ZHRB 3OUYB 5AG4A 4C0OC 4DX6A 4KTQA 1KZFA 4MFPA 4B11A 1B0TA 2PR1A 2ZZNA 3QRPA 4TQRA 1BGXT 4ELVA 2MHNA 2F9DA 1H2TZ 4MFQA 4IK2A 4CO2A 1C4AA 4OHVA 3FFIA 2UVVA 4NXNJ 2C2MB 3OL8A 2HYIB 1UWAA 3EVWA 3I5AA 1NMTA 3OLBA 2YKQA 3SQGB 4IR9A 3BQ0A 2CJYB 1KONA 4EZ9A 1DBDA 4BC9A 4X4VA 1BWVA 4MKBA 5DETA 1S4EA 2RT3A 3IWWA 2XWYA 2OTLS 1HWJA 2JDDA 2CQ4A 2KVIA 4TNUA 2B6AA 3R1LA 4EYHB 3IBWA 4CO4A 1YGHA 4OYZA 1C0TA 3WHIA 2BJ3A 1U47A 5T7LA 4HH1A 3A8EA 3AD8C 2Q4ZA 1JLBB 4OC0A 1YDLA 2VBQA 4BLGA 3EY5A 2WRMA 3UCGA 3SXOA 2R1IA 5EDWA 3JSBA 1YWXA 2Q43A 4ZGYB 1TKTB 2HNDB 3A8IA 4C11A 4O4GA 2BZ2A 3RBDA 3NOCA 2OPSB 4LFCJ 5HATA 3E01A 2M52A 1KWMA 4UWIA 3DLKA 1S10A 3KNGA 2Z56B 3KHGA 3PYEA 4M6HA 3BGUA 3SDEB 1NM2A 1PG5B 1NKEA 4DFMA 3DI6A 4DV3F 2VC0A 2GMJA 4DWIA 5DG7A 2I5JB 4R0EA 7CPAA 5HBMB 2RAQA 4R76A 4IDKA 2WVBA 1XMOJ 4OLLA 1ZM2A 5L9NA 3H4DA 1S1VB 4CCHA 2OEJA 2DHXA 3EXNA 2PVWA 4M3SA 4JB8B 1HBOB 3HM9A 2ZH4A 1BY9A 3H5UA 4HT5A 2ABYA 1ARMA 2HWTA 3QIPA 1APSA 1M5VC 2GX8A 1NDLA 2CAJA 2WYRA 3E0KA 5G21A 4A8SA 4ER8A 4RWXA 5I42B 2FY1A 5BYQA 3OLAA 3P6YC 4F8ZA 2CFXA 1L3SA 4RS2A 1CLFA 1IJFB 4ZVHA 2RQMA 3CVKA 4FXWA 1XR7A 1BLUA 3UDLA 5CPAA 1GQEA 1N71A 2CWKA 1WTBA 3A3OB 2NZCA 3NNHA 3JTOA 3Q83A 4G3IA 2XEJA 3NGTA 2J6TA 2N3LA 4F4AA 1AMPA 3K17A 2BM1A 4OI2A 4USTA 3VAMA 4NXYA 1H6KX 2W01A 4DSIA 9ATCB 4H4KA 3HSDA 2HSEB 3TR5A 5HMNA 1QVFR 1GMVA 2U2FA 4DPOA 5IQQA 1VQMS 3PNIA 2XS7A 3LP0B 3CWJA 2B9YA 3JB9k 2JEVA 2WVCA 1RT2A 3BN7A 4BBYA 4DV0F 2KT2A 2CQ1A 1C0UA 3S8SA 1VQ8S 3DDDA 2AMCB 1WOPA 4CYNA 4N77A 1YJNS 3TAQA 1RWXB 3Q23A 3TZYA 1N34F 2YKMA 1VHFA 3QAHA 3NG8A 3QAEA 2YWKA 2GGPA 3OVSA 1TL3B 2QA4G 4NLGA 4EMEA 3P49B 3DNSA 2OTJS 1MN7A 2EPIA 3IM8A 1UA0A 3EMTA 3T6BA 3TUZC 1UFLA 1H7WA 4W4MA 2AP6A 2CQBA 1U2CA 1QLNA 2L9DA 4CLKA 3H98A 4F67A 3KNAA 5A6PA 3F44A 4DV6F 4K4SA 3RB6A 2GQQA 4LUAA 3DSBA 5C82A 3KJVA 1T05A 2UVUA 1S1UA 2DK2A 2DNYA 2IYGA 4USWA 1OBRA 4J3GA 3G82A 1XEBA 3PEHA 4L74A 5HXDA 3D7DA 1L3TA 2BX6A 2FLPA 3P45B 3KLGA 4RR5A 1SKWA 5F0WA 4EUVA 1W26A 3B8HA 3D28A 2CYYA 2LU2A 3Q8VA 2E44A 2AJ4A 4EU0A 2ARHA 2W2QP 4ZVPB 4QWEA 3G6VA 3RB4A 5KFZA 4C7IA 2MTLA 3MUMP 3DR8A 2BE2A 2ASLA 1T95A 2YNHB 4R9MA 4A8KA 2FVGA 3EGZA 1WC4A 4NEZA 3SJGA 4EGLA 2W7PA 1RTDB 3E8OA 5C25A 5KT7A 1Y0YA 3KJQB 4LF7J 1Y9OA 4CAFA 4WFBQ 2Z8QA 1S9EB 1UMJA 4XTTA 2CPIA 1FRKA 2MZQA 3TO9A 3SI8A 3WC0A 4KVOE 5GAHI 3K9TA 5IX3A 3CC4S 1FE0A 1RE1B 2VG7A 1AZSA 3H40A 4NEYA 4O3RA 4F3OA 4ZITA 1LFWA 1UJ6A 2YNDA 4F0YA 4O3SA 4RLEA 2AEFA 4AXJA 3H59A 3CULA 3KDOA 4MIBA 3PW7A 4XIUA 3CO9A 4O0NA 4QYZK 3NS5A 1J5OB 3EZ5A 4ZIVA 1GHEA 4OHWA 4CO5A 3DU5A 1SVDA 1JJHA 4WXWA 2AYMA 2Q4YA 2CNKB 1L3KA 5FDLA 5F09A 2BJ7A 3B8GA 1PCAA 3N01A 2V94A 4Z7CA 2CA9A 3EDQB 3BR8A 2A4NA 4ICLB 4DL5A 2PDOA 5F46A 2D3OR 1PJ7A 4QIWD 3KL9A 2VI7A 4XPLA 4ED7A 1ZZNA 4J7CA 4IAVA 1LXNA 2Q1LA 4JI3J 2FPHX 3AFGA 1HDUA 1AUSL 3V7ZA 3OTOF 3KMSA 4DU8A 2UP1A 1QE1B 4PG8A 2VZ9A 1ZM9A 3KQZA 5B0FA 5HROA 2NUUG 1XEZA 2FJDB 3FEXB 3HHNB 4CH1A 3P2FA 3H42A 2ZKTA 4P2FA 2GVZB 3B3WA 1WK4A 5HQLA 4MHYA 1IU8A 1RT4B 2PJ6A 2FJEB 2RVJA 5KG3A 5KG1A 2UXDF 5EN1A 4AUKA 2UUAF 4RUHA 4DCJB 4DV1F 2JEFA 5LRGA 5DDOC 3BYPA 1N8RT 3RAMA 3KK1B 1Y5NB 1X5TA 2BBEA 3LP2B 4MFZA 3OW2R 5E0OA 1OSCA 4M1KA 1LANA 4KR0B 4CQ1A 5CAAA 2XY7A 4QUSA 2KG0A 2EK9A 1WEXA 1CULA 1XBUA 2JC1A 1SJ3P 2ZE2A 4A8XA 4PXCA 5J1EA 3TP2A 4X2TA 4CT9A 2V69A 4K2JA 5F3TA 3MEEA 5EMIA 3A13A 2BXJA 1EAYC 3RU0A 1NK6A 4CYQA 4DSKA 2VKZG 1YBAA 3THPA 1HWIA 1PBUA 2ZC4A 2P2CB 2VICA 4LT6A 1FESA 5E3AA 2Z0ZA 2YWWA 1KC8T 3HF5A 3POTA 2HNZA 3KK2B 3LODA 3RW7A 4PRFA 1VQ6S 2DGXA 5KFTA 1S6PB 1TU0B 2KRRA 4OMFG 5DG8A 3EWGA 1FNOA 3SEOA 2KH9A 4B3MJ 1SCJB 2G0BA 5F8HA 1GT8A 2BR0A 1ON0A 1RT5B 3AXMA 4ED8A 2BMBA 3CEDA 2GMLA 3VWSA 3QRRA 1LWCB 1WKKA 2Q6BA 4HTIA 1L0CA 4LF5F 4MK9A 1A2ZA 3X3UA 2NPIA 1HARA 1HBNB 1X0FA 2KG1A 4FVMA 1R57A 3CJ2A 1Q7YT 1FO1A 3KHRA 2H65B 4OHXA 4EWTA 1HBUA 2RJZA 3MECA 3H4QA 1AT1B 1FDAA 3DU6A 3QZ7A 2OH2A 2COLA 2HBZB 4B10A 2CUYA 1D1UA 3K5OA 1WKLA 3M9OB 4L3KA 4A8YA 4C8YA 1XR6A 2VPZB 4L89A 2AEMA 3FEDA 2BJ9A 5E3QA 3C6UB 3PW2A 4QWBA 5D77A 4XDDA 1C1BB 2EVNA 3IU1A 2W25A 3OXLA 3S6EA 2XZWA 3VAKA 3RGIA 2YQ0A 2GJFA 3L7OA 3QWUA 4PQUB 1FKPB 1RSCA 1DTDA 2Y3YA 1MU2A 1WI6A 3Q0AA 1S9FA 5KTCA 1LWEB 5E7OB 4DSLA 3ENVA 1NK7A 1V0CA 3HZEA 2EK6A 3EPGA 2XMAA 3CJRA 1HW9A 4LF8F 1Y11A 4TKTA 3M32A 4QIGA 3J81U 2DR6A 5GAEU 1FA0A 3MMAB 2DNRA 3G96A 2MXYA 2DH7A 3LH2S 3FBCA 3MGDA 4KUAA 2WVDA 2F7VA 4OC2A 1HPZB 4XNHC 1HQ2A 4QQBA 3PEIA 1V3RA 5SZTA 1U2FA 1XNRF 3ELHA 4GKJJ 2O4HA 3M2UB 5J1PA 4ZN1A 4NCZA 3Q8YA 4NLXA 5AG6A 1NU4A 2QFJA 1VHOA 2DXEA 4KUBA 2WOMB 2DNHA 3VALA 2ABZA 2Y8YA 5KFYA 2PJ9A 3HCXA 3SSSA 4YR0A 4UCNA 3I96A 3V8IA 3TJ8A 2C3PA 5DLGA 2CNLB 3FQLA 1KRPA 3PW5A 2C1EB 3FZBA 4CTAB 2HMIB 2VQYA 1RHKB 1WHWA 1TK5A 4N76A 2P6EA 4FXVA 3HX9A 3U02A 3BI1A 3OFHA 1QAJA 1KFSA 1X5PA 4ECWA 3GFYA 1D0EA 4LRCA 2XEFA 2A6OA 4DV3J 1NE9A 4A94A 2MLXA 3TAMA 3TRGA 2HZAA 2ZZTA 1F5CA 1Q2CA 4ZVGA 1X4AA 4KOWA 1GX5A 4OX9F 3OD2A 2ZOFA 3SI1A 2C2NA 4QVTA 4B5OA 3GJSB 3DMJA 1H98A 2KRBA 2VL1A 2HLUA 2IJZA 4PXBA 4XDCA 3CD7A 1KOOA 4U8VA 1KLNA 4ECTA 4OMEA 1CJUB 2G1HA 2HGMA 1UFWA 3H5XA 1DLOA 3C6TB 1S0NA 2C6GA 1VK8A 2L08A 3MWBA 4DF8A 4K4YA 4GC6A 3ENWA 4KYZA 1Y7RA 2X51A 4MXUA 1S7LA 1NAQA 5DQGA 3V81A 3T5JA 1VQLS 5AE2A 1X10A 3M4XA 4MFBA 1FNMA 3OTBA 2XBPA 3MR2A 2IJNA 3R1HA 1IOFA 1VI7A 2G2YA 3MCNA 1FI4A 2B7BB 2W8KA 4MH8A 2NZ4A 1MWYA 1K44A 1S77D 2NSMA 5GMKa 2HUZA 1RTJB 1HNWF 3R1KA 1S7KA 2QYVA 4L76A 5F8MA 1JWQA 4DL7A 4C4WA 1UWBB 3OSPA 1OQ3A 2JDJA 5ETRA 5A0YA 1HMVA 3MD1A 3EZOA 4Q0BA 3MEGA 4F2SA 1EP4B 4OC4A 4B14A 1RUSA 2CQGA 4HHJA 3OR1A 1Y5LB 3SV3A 2Q66A 2D69A 3HSGA 4DV0J 3IM9A 3HUVA 4L75A 3AY0A 4OLPA 2OR4A 3M8QB 4ALZA 2QE5A 3W9JA 3MMBB 1N34J 1YW4A 3EX7B 5AGEA 4A95A 2RKIB 3IBCB 3DGPB 3Q2TC 5H9FJ 4I7FA 3AQOA 1CC8A 3TX8A 1Y3KA 8AT1B 4ED6A 1J5EF 4NLQA 2HHTA 1VISA 4BMHA 5HJYA 4AT1B 4UOHA 1WWHA 3DLJA 3CCQS 1DQ9A 4HACB 2QLFB 1FTRA 4UT4A 2GHPA 2V4JA 4DS5A 3CXPA 3ZTRA 4DV6J 1JNRB 3PY8A 1Q7LB 2RIJA 3SCKE 1VRQC 3OJSA 4Q8EA 4KSEB 3QJJA 2W4PA 5HI7A 4IHMA 4O44B 1NK4A 4C2MA 2VQFF 4KGVB 2WSEC 4E2AA 2AJ2A 2V2ZA 2E5HA 4AQYF 1PUAA 1SJ4P 2XS5A 3R2DJ 3DRRA 4ECVA 2PSZA 3H25A 2R7HA 4NLUA 4M85A 2FHOB 1IWGA 2WK4A 3D7SB 3JUWA 3GJTB 2NQPA 1XK8A 1H2UX 2R7WA 2E1AA 3SQOP 4WTYA 3CDAA 5LRJA 1JJ2R 2EFPA 4RNMA 1YZ6A 1RT3B 3D68A 4ZMMA 3C46A 3BJ7A 2CKWA 2NREA 2FE7A 4CLPA 3H2UB 3DM2A 1R43A 3H7HB 2UVRA 1F5AA 1X5OA 4OYPA 1TL4A 1VIOA 2KFYA 3BDPA 4KHPF 1KNZA 4UUXA 3J81j 3HLUA 5IT9U 1B4SA 5F8IA 2H4WB 3R7BB 5C24A 3I0RB 4NMXA 5L1IA 2ALYB 2WONB 3QGPA 4B9TA 1NO8A 2X7BA 1H7XA 3AB4B 2AYEA 3OXFA 1M1HA 2V34A 4UIAA 1V6HA 3DLEB 3WDOA 1RU2A 4M95A 2O1PA 1Z1ZA 1WDDA 4CRYB 1MROB 2FSRA 3G71S 4RW7A 1PO6A 4MRIA 4NZ0A 2R8KA 4LR9A 4DCPB 3BJYA 2ZHOA 3PB9X 2QA1A 3VV2B 1TKZB 1NKCA 1U6ZA 3KASA 3C16B 4PUOA 3OR2B 2ZJRQ 4CLFA 3DOLB 4X4SA 4UIBA 1M5KC 1D09B 4IYQA 3PB6X 4K3NA 4QR2A 1FFWB 2CPXA 2YKNB 2W4CA 3TCVA 3FJ2A 3M6VA 1XE4A 1RKIA 4P71A 4RI1A 4RNNA 5JVGQ 1XRYA 4ZDNA 4PWDB 4MCPA 4QJVA 5ETNA 1YTYA 3V4MA 4NOHA 2E1MC 1PSDA 3ZO7A 3GG1A 1CS4B 3KJNB 3BF4A 3R5CA 5IT0A 4RUCA 2A3JA 3OTOJ 3PR5B 3P4UB 3CB4A 4JWPA 4B02A 4Y2AA 2YH0A 2OZUA 2GMHA 3OTDA 3RJMB 3DKDA 3UVJA 1XIQA 2Z3MA 2VBXA 1YQEA 3PG9A 2HQCA 1FRXA 2ROPA 1T03A 4RO0A 4CWBA 4LIRA 1IYKA 1FKOB 3TEHB 1X9WA 2BUEA 3FSIA 2E29A 1NJWA 2UXDJ 1JLAA 2UUAJ 3NL0A 2PRBA 5KFSA 2IC3B 3KLIA 2VPWB 2B56A 3DLGB 3FSXA 4NZ6A 4DV1J 2QIFA 2HBRB 1PJ5A 1S79A 3R6GB 2G4BA 1U0SA 1MJAA 3N79A 5DO2A 1X9MA 4UCMA 1YVFA 4JV2A 2BACA 1F57A 5IS2A 3GZ7A 2X1AA 4WK1A 3NH4A 4RW9B 2PGCA 1NH8A 3D3SA 4QU7A 5HK4A 3R2CJ 2RNEA 2WVEA 3ONQA 1MJ9A 2QL5B 4OYAA 5L1KA 1YIJS 3PRVA 4WF9Q 5I3QA 2C6PA 3NY0A 2BO9A 3G87A 3N6MA 1BPMA 4TYBA 2E9RX 2KDOA 2XMKA 5D3GB 3LGHA 2IBOA 5I3UB 5KG6A 4UCPA 4X4TA 3GILA 4DPTA 4I2PB 2PQ8A 1KD1T 3ZJ0A 3NS7B 3AODA 4DUZF 1OIAA 4FN5A 1QMUA 3VZIA 3SZ2A 1N6QB 3RBZA 1U7LA 3Q8QB 4ANEA 1ZLIA 2CIMA 5HLFB 5LMNF 1X31C 4NMLA 2PC6A 2IRYA 5A8WB 5F3ZA 5HSPA 2XWXA 1CJWA 3IWXA 2ZZMA 3UE2A 1DFDA 3DLHA 2PT0A 2GHWA 1WSVA 1Z8XA 2G0IA 4MMOA 4XK8C 1EETA 4IH5A 2CPFA 4LF5J 2D74B 2GE3A 2V4QA 2ZNYA 4LR8A 4NGSA 2HRTA 2VD3A 5A27A 4MTPA 1FJGF 2H1YA 2VFSA 4HDHA 3CJ3A 1UVIA 3LANA 1VCTA 4RL1A 5KFLA 2RD5C 5CA5A 5CYQA 3LA0A 4DG1B 3UD3P 4LJMA 3MXHP 1NZ8A 1XQIA 2W7OA 1PC5A 3PB8X 1FK9A 4IOBA 1LW2B 2H54B 3CCLS 3CD6S 3BGLA 2AX0A 1RISA 5IB9A 1RA7A 2CQCA 2VG5A 2IDLA 3PV8A 1V3SA 2CNTA 4E0AA 2WBMA 2ZBRA 3SCIE 2Y9HA 1REVA 1KQFB 3MURP 2P5VA 4B9SA 2PIYA 1YRTA 1ZTWA 2R7QA 2WZ1A 3RW6A 3EGNA 2CADA 2RQ4A 2PSWA 2HPUA 2JNJA 4ZYQA 4MJ8A 4DDFA 1PBAA 5A8RA 5KG2A 4W98A 4C8OA 4DPWA 3QFHA 2OSRA 2JDCA 4CGPA 2C3OA 1M4GA 4EFAC 3AA9A 3T9ZA 3BBCA 4MCSA 2V2VA 4U9RA 3GIJA 1XNRJ 3D0GE 4IF5A 2FCKA 5HANA 4JXRA 3MMJA 4B08A 3NWGA 2IDEA 1FWPA 5LSOA 4IR1A 2AX1A 3ENQA 1HYSA 1JX4A 2LQBA 3DDNA 3BM7A 4CLLA 2DVIA 3AOAA 2BANA 1E6VA 2HFVA 2E66A 3RBUA 1TV6A 1JWWA 4IFVA 3UFCX 2UUTA 2NS1B 2CVEA 2QSWA 2NXCA 4BWMA 2DGSA 3GJRB 4IUSA 2B6AB 5EWFA 2HFUA 2HV2A 5JMNA 4PG4A 3LACA 3FCHA 2VOPA 4ED5A 4OJ1A 4PG7A 2MGZA 2BKPA 2YKPA 2MQMA 2RF2A 1C0TB 4F3QA 3CDXA 5T7LB 2J0QD 4M5KA 5JGFA 2LECA 2ADCA 2LDIA 1GMWA 1KDNA 1RACB 4J37A 2OZHA 1U4BA 4J9OA 4CYOA 2DBBA 4R57A 4C11B 1SKSA 4O4GB 3D67A 3M9MB 2AGOA 2JZ5A 2DGVA 2ACMA 3E01B 3NE8A 4X62F 3DLKB 4MYTA 2A0FB 2GO8A 3TVZA 1HD1A 2QRRA 1U1RA 3IGVA 3S1TA 1TMJA 3FF3A 2LA6A 3DI6B 5GVQA 4FBTA 2VU5A 4QBUA 3S6FA 2HC9A 1VQNS 5LMUF 1A6LA 3UDCA 1YSJA 4OZ3A 2RRNA 5F49A 3BV8A 4IDKB 1SL2A 3U1NA 2AFWA 3IXQA