4G1PA

Structural and mechanistic basis of substrate recognition by novel di-peptidase dug1p from saccharomyces cerevisiae
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
480
structure length
479
Chain Sequence
MSHSLTSVFQKIDSLKPQFFSRLTKAIQIPAVSSDESLRSKVFDKAKFISEQLSQSGFHDIKMVDLGIQPPPSTPNLSLPPVILSRFGSDPSKKTVLVYGHYDVQPAQLEDGWDTEPFKLVIDEAKGIMKGRGVTDDTGPLLSWINVVDAFKASGQEFPVNLVTCFEGMEESGSLKLDELIKKEANGYFKGVDAVCISDNYWLGTKKPVLTYGLRGCNYYQTIIEGPSADLHSGIFGGVVAEPMIDLMQVLGSLVDSKGKILIDGIDEMVAPLTEKEKALYKDIEFSVEELNAATGSKTSLYDKKEDILMHRWRYPSLSIHGVEGAFSAQGAKTVIPAKVFGKFSIRTVPDMDSEKLTSLVQKHCDAKFKSLNSPNKCRTELIHDGAYWVSDPFNAQFTAAKKATKLVYGVDPDFTREGGSIPITLTFQDALNTSVLLLPMGRGDDGAHSINEKLDISNFVGGMKTMAAYLQYYSESPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cys-Gly metallodipeptidase DUG1
publication title Structural and Mechanistic Basis of Substrate Recognition by Novel Di-peptidase Dug1p From Saccromyces cerevesiae
rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 144
structure length 479
sequence length 480
ec nomenclature ec 3.4.13.-:
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1pA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4g1pA01
1YLOA 3NA6A 4A94A 4F9UA 1UWYA 2QYVA 2PJ1A 3JRUA 4MRIA 3PB8X 3KL9A 4P4DA 4UEFA 4X8IA 2PIZA 1Y0YA 1ZLIA 4PXDA 1BPMA 2V8HA 1JQGA 5LRKA 2IMOA 1YW4A 4NGTA 2IJZA 2XEIA 1DTDA 3NH8A 2ZEDA 1TF8A 2PE3A 1OBRA 4ONWA 5JH9A 4X3RA 2EWBA 4BD9A 2C6PA 5K8OA 2ZEOA 3MN8A 3VH9A 4Z65A 4NGNA 5JM6A 3KQZA 2ZEFA 1YW6A 3FF3A 3N5FA 4GM5A 2CIJA 4K3NA 2QJ8A 3BI1A 3KHXA 5J1QA 2HB6A 2Q43A 2PJ4A 2NSMA 4P4EA 3B3VA 2DEAA 2WYRA 2PIYA 3KGQA 3S9LA 2BCOA 3WC6A 1QMUA 5LYDA 2V77A 2RFHA 4H2KA 5ELYA 4EMEA 3BXMA 2JBKA 4ZY0A 5HVFA 3D7FA 1AYEA 3SI1A 3WT4A 4UEEA 1Z5RA 2AFWA 3KHZA 1CP7A 2PCUA 2PRQA 3D66A 3SI0A 1IGBA 1IY7A 1F2OA 4P10A 4OC5A 4NJQA 2EK8A 2C6CA 2XEGA 2ZELA 3KQXA 2ZEPA 3IEHA 3RAMA 2G9DA 4P4FA 3S9NA 4UIAA 4YU9A 4ZY2A 3WC5A 3PB9X 1BLLE 5CPAA 1R3NA 1KWMA 5HVHA 3NH4A 2ZEGA 1Q7LA 1LAMA 3GB0A 2PJ7A 3BI0A 4OC2A 2AFXA 2XEJA 3HLPA 3D4UA 1CX8A 4P44A 4MHYA 4PXEA 3IO1A 4FWUA 1VHEA 3GLJA 4NJRA 1TF9A 3PB6X 5HVGA 4R7MA 4MHPA 1F2PA 3VATA 4OC0A 1HDUA 3HUVA 2IQ6A 4IK2A 3B3TA 4EWTA 2ZEEA 3SJXA 1ELLP 3V7ZA 1FT7A 4FAIA 2OOTA 5D8NA 4OC1A 4NGQA 3FJUA 3WABA 3D7DA 1XJOA 1YMEA 4OIWA 2V8DA 4OMEA 3SJEA 3FECA 4F8ZA 2V8VA 4YWYA 4NGMA 2C6GA 1ARMA 3FEDA 3NFZA 4KSIA 3IC1A 1XFOA 5HXDA 4ZX8A 2PJ3A 1HEEA 2ZOGA 2AFZA 3CPAA 4DJLA 1PYTB 3KASA 4FBEA 3K9TA 5F09A 4PXBA 5K8MA 1LFWA 1ZG7A 2JEWA 1XBUA 2POKA 3T8WA 2EK9A 2AFMA 1FNOA 4MHNA 2XEFA 1ZLHA 1VHOA 4ZY1A 1RTQA 1ZG9A 4OC3A 3FH4A 4P4IA 3BHXA 2GREA 3S9MA 1BPNA 2F8HA 4MCQA 2HC9A 4CPAA 3KR5A 4W9YA 4NGRA 4B6ZA 1Y0RA 4DUKA 3KI9A 3D68A 1CG2A 1LOKA 2QVPA 2PJCA 4PPZA 4AXVA 1LCPA 3IIBA 4TWEA 1ZG8A 1H8LA 5LRGA 1ARLA 1LANA 1TKFA 2BOAA 3VARA 1TKJA 3NH5A 4F9VA 2BO9A 4RUHA 3H8EA 3H8GA 4R76A 1CPXA 6CPAA 1QQ9A 2PJ9A 3MRUA 3PBBA 2F7VA 3D7HA 3K2KA 3IJ3A 2RB7A 2ABZA 3IFEA 2J9AA 5IB9A 4WWVA 1CP6A 3B3WA 1LAPA 3FVLA 3PFOA 2O53A 2Q4ZA 4TNUA 2AFUA 2V8GA 2WZNA 3RZAA 5I4MA 2PJAA 1XMBA 5LRJA 3I1UA 5K8NA 4R8FA 2NYQA 4ZI6A 4EFDA 3QNVA 1VIXA 1Y7EA 3FX6A 4X2TA 2JBJA 1NSAA 2PJ6A 4R6TA 4P45A 1GYTA 3D7GA 3PB4X 2Q51A 4MMOA 4PXCA 2FVGA 3IWWA 4MHZA 2ZEMA 2GU2A 4G1PA 4OIDA 4A39A 4A37A 5LYFA 1YSJA 1CBXA 3SI2A 3LMSA 5THWA 4NGPA 2CTCA 3KR4A 4Q7AA 3B35A 3ISXA 1TXRA 1F57A 5DS0A 3D67A 5D29A 3LWUA 4PQAA 4MCPA 3GUXA 4IAVA 3V38A 4UIBA 5K8PA 4P6YA 7CPAA 2PJ0A 2PVVA 4MCRA 1PCAA 3DGVA 2ZENA 2PJ2A 4JYWA 3PRTA 4A38A 3FEEA 3B3CA 2ANPA 3TX8A 5LYIA 3B7IA 3H8FA 5JGFA 5LYLA 4DYOA 4O23A 4WJBA 3FMCA 2AFOA 2CF4A 2PVWA 1AMPA 1Z8LA 4LQGA 4NFRA 8CPAA 2VL1A 3WC7A 3CPXA 3RBUA 5CBMA 2ZOFA 1CPSA 4MXUA 2GLJA 4OKOA 2AFSA 4OC4A 1ELMP 4P4JA 2CTBA 4P4BA 1Z2LA 1XRYA 4IHMA 3PFEA 4FUUA 3PBEA 2PJ5A 4OP4A 3PB7X 1BAVA 3PEIA 3ISZA 1VGYA 2ZEHA 2GLFA 2PJBA 2C1CA 3TC8A 4ZX9A 4NGSA 3CDXA 3SJGA 2OR4A 4JZ0A 1HDQA 3KZWA 3L2NA 3B3SA 4MCSA 3DLJA 1DE4C 3CT9A 1TKHA 4UF4A 4UEZA 1M4LA 2O4HA 3SJFA 1R43A 4ZYQA 2I3CA 2PJ8A 1EE3P 3B2YA
chains in the Genus database with same CATH superfamily
3CD7A 2R7VA 4ZLJA 4HTIA 2Y1RI 3HKZD 3IM9A 3SEOA 1X12A 2PT0A 4HT5A 4AXJA 2BDPA 2Q0YA 5KAKA 3ZZTA 2ASYA 3L7UA 2KYZA 3RBDA 2QX0A 2ILZA 2E1PA 2W2QP 2C6PA 4WKYA 4FF4A 2EO8A 3MMCA 1LV5A 2YWEA 1FDBA 2OFGX 3BH7B 2JSXA 1VJQA 2JH3A 2OEKA 1FJEB 4WP8A 3CDUA 5ITHA 1R0BG 2KZMA 3DMJA 4LVNP 3PYEA 2BCOA 4HKFA 1H2TZ 5HLFA 4NRUA 1QMUA 2WSEC 4I2QB 3MUVP 4ECTA 1GTEA 4H4MB 4NLXA 1NE9A 1GK8A 3DHXA 3OXLA 1CP7A 2ZM6J 1GMVA 2D9PA 3CIMA 1OY9A 3UDLA 1RTHB 1AROP 1WEZA 2F5GA 2C6CA 3OTOJ 5KTDA 1CJVB 2XCAA 2VONA 4ELVA 2WSFC 5G0RA 3S9NA 2QIRA 1NZAA 1KLMA 3FZ2A 1N33J 3UCZP 4Y34A 4LJMA 1R27B 2REEA 3PIOQ 4N56A 2YBVA 3I96A 4K7QA 4ZJOA 4LFCJ 1NSPA 4NJRA 1JLFB 4ITSA 2ZBPA 1RA6A 1X8DA 3VATA 3GP9A 1U6BA 2ZZMA 2AT1B 4KH1B 1FXLA 1SJFA 1SIWB 4F8RA 3IWEA 4F02A 1TL1A 4EYHB 2VDIA 2KM8B 4A8YA 4DSKA 2MZ1A 5IZHA 4X4PA 2HWHA 4N47A 1R8CA 2B4PA 1RHMB 3D7DA 3DU6A 5J1NA 4IH5A 2DCUB 4W4MA 3R1LA 5D3GB 3HJFA 1ARMA 2CVIA 2ZFHA 3HVTB 1FRIA 4JD6A 5J2PA 2ABYA 3RW6A 2XZTB 3HZEA 3RNZA 1C1BB 4OAEA 3EJMA 4FBEA 2XB2D 3O44A 4QIEA 3F0AA 2V4JA 2N4CA 4LSNB 3TE4A 5C5JA 1Q8IA 3J7ZT 4KO0A 8AT1B 3C2PA 3OSNA 3Q83A 2F3JA 4DV6J 4WWSA 3GWCA 2B5GA 3TVKA 2FY1A 1V5IB 2K3IA 2GJ2A 1A0OB 3R96A 1UVMA 4DR6J 3WIUA 1C0UA 1T7PA 3M1VA 1UFKA 4J5OA 2QFJA 2KM8C 2EVNA 1BY9A 3CSKA 3QAUA 3SIPB 1VHSA 4IOAQ 5D4NA 2HS0A 2WOMA 4ZIVA 2JEJA 1UVKA 4JP8A 2VU5A 1Q78A 2DNLA 3HHLA 3Q8QB 4TWEA 3ULHA 1RTJA 4CDIA 4CLPA 2HQ3A 1CPXA 4K4XA 1KOOA 2CA9A 1EP4A 3PTWA 3K2KA 4CO2A 4KVXA 4WP9A 3B3WA 3T1HF 3I0RA 2BQRA 4MK9A 2RS8A 3Q23A 1RAEB 4TNUA 3P8BB 2XS7A 3GZ7A 4NCZA 3AJ1A 4HI1A 2Z30B 2X1GA 3H40A 2OH2A 1MROB 3TOAA 2P0WA 3I1UA 1I94F 2GC8A 2FE7A 2V50A 1M90T 1OZPA 5FDLA 3TT2A 3QNVA 1TAUA 1XNRF 4FPIA 1BLUA 1D9AA 3PB4X 2OU2A 1FF2A 4MMOA 3DDDA 2JFKA 1PUAA 4Q45A 5MLCV 4ZN1A 1QSTA 2ZE2A 4MYUA 1T9TA 1YQEA 3OXGA 4B3TJ 1JLEA 1UPPA 1DQ9A 2A2CA 2BZ2A 2CVEA 2CJQA 1VQ8S 4DR7F 3ISXA 2DR5A 4ZIWA 1KTQA 5EX3A 1H2VZ 1N6QA 2RQKA 2CJYB 2FHKA 2IDEA 2U2FA 3FBEA 1LRZA 5KFJA 3PRDA 4WE1B 5EDWA 3CCWA 4J91A 3TEHB 1ZZNA 4G65A 4DX6A 5LYLA 3R2CJ 4OZ3A 1GNKA 5JXSA 2CF4A 4ILMA 3CPXA 2PA3A 1WOOA 2FB0A 3GR0A 4O0IA 2MGZA 3G82A 4Z37A 4NXMF 2Z58B 2AEJA 3VQSA 4P7TA 1DFDA 2C3YA 1PC4A 2Z3LA 3C14A 3QFWA 2AU0A 1UMJA 2J0WA 4MY3A 4LT6A 4K30A 1W2IA 4ERDA 3HT3A 2DO4A 3RU0A 1MWYA 4GKKJ 4B9UA 1T03B 2RU3A 5ETKA 3C19A 4DL2A 3M8YA 2GAHC 5CZXA 1C4CA 2GVZB 2NREA 4UEZA 2KT2A 1NLKL 5E41A 1F60B 4JBCA 4X4NA 4ECUA 1FK9A 3OR2B 4TYAA 1QAXA 1VC0A 5B0BA 3QMQA 4A8KA 1CJTA 3JRUA 4OYZA 4ZVPB 1TR0A 3VAHA 3NGUA 4C8NA 1SH2A 3GIIA 1U2RA 4USIA 3KLHB 3OUYB 1JQGA 1RTIB 3M8QA 4OYBA 4RUBA 5B09A 3JB9k 1WEYA 3HI9A 3NH8A 1DTDA 4KAIA 4IYQA 3K17A 2BE2B 4J9PA 3EWGA 2IJFA 1MWQA 2RILA 5LM7E 5AGEA 1MJAA 2R3VA 4GVBA 4JI3F 3KQZA 4YR0A 2B0GA 4MFLA 1SV5A 2H5IB 3TAMB 1DLOA 5J1QA 3GQCA 1DTQB 1B87A 2ZW5A 1SKWA 3O2IA 1DAXA 2V69A 4CLKA 2AJFE 4DCOB 2PIYA 1UVJA 2E1CA 2IC3B 2YTCA 2LA4A 2QIFA 1Y11A 1K44A 3MEDB 3C15A 1UEKA 2M4MA 1RHUB 2JLEA 3G86A 3DDKA 2HHWA 4R87A 1EB0A 4PWWA 3D3BJ 4PKDB 3VWSA 4DSEA 2CPIA 2UUCF 1M44A 1X4AA 4L73A 2CQDA 1AZSA 4KKOB 3SFUA 1IYLA 5ETLA 1XTZA 2IM1A 1SBRA 4NCAA 2MZJA 1UP1A 4CYPA 3UD5A 3BS9A 3CO9A 2C1EB 4CI0B 2E5JA 3PB6X 1WOSA 3FMWA 2QL7B 2IQ6A 4IK2A 1RT6A 1S7FA 3GJQB 4R25A 5DM6Q 4NA1A 3IN5A 1LWCB 4KHPJ 2E5LJ 4OJ1A 5D8NA 5ETPA 1JLQA 4Y00A 1U0HA 1XMQF 5DDQC 3DRRA 1U6FA 1ZPWX 4EGLA 3KDNA 1ZM4A 1RKJA 1JKHA 3L95X 2C6GA 3NMAA 4JI4F 5K5MA 1IKXB 2DT9A 3QAYA 1NPKA 4USWA 2MKHA 2N7YA 3E01B 4PG8A 1PGZA 1L3SA 2HHVA 4MHDA 2B4UA 4JI7J 4XPDC 1IWAA 4QIGA 2LQBA 2FVQA 5F09A 4X4SA 3AOBA 4K8RA 5GAEI 5KT3A 4NPOA 5HP1A 2MY8A 3MECB 2DRDA 3GE9A 4H6ZA 1XBUA 4R3LA 3HSGA 2AFMA 2R98A 4BDPA 3TEGA 4OHXA 1SC3B 4FKYA 3FH4A 4M94A 3HHEA 1URNA 5H86A 2I2YA 4OZ5A 2IAJB 1T8EA 1RT7B 4X4OA 4DV2J 4DUKA 3CDBA 5GADI 5ADZA 4RNMA 2JEFA 2J8SA 4HYKA 4EBDA 2VFUA 4ECYA 1H8LA 3ZNJ1 3C46A 1YVOA 3UNGC 3BGOP 2HHQA 2BJEA 2VF3A 3IBWA 4F9VA 3F44A 5K9FA 4U8YA 4O3RA 2R8GA 2FLOA 3IJ3A 3AOAA 3V6KA 3MM9B 2ABZA 2HK3A 2W2NP 1GMWD 3QT7A 3ZJ0A 1YVKA 3M6XA 2V8GA 1Q86T 2F63A 5LRJA 2F8MA 5K8NA 2B3VA 2YNHB 3KHGA 1KFDA 2YKAA 1NJWA 2KH9A 3CD6S 1Y7EA 3BM7A 2YKOA 4DMZA 1N0VC 5C42A 4CAWA 3OBIA 4P45A 4NX9A 3NS7B 2E1RA 4C8YA 3D0IE 2FJDB 2JLMA 1M5PC 1X7VA 5KFOA 1Q8KA 3IS9B 4YEAA 2P5VA 1HA1A 2HFSA 5DO2A 2XMUA 1WOPA 3FYNA 2A4NA 4MIWA 2I0XA 3NOCA 3BJ8A 2DPJA 1TXRA 1RBOB 2KXHA 2PDAA 2P6EA 1YRTA 5A8WA 1GTHA 3GUXA 2M88A 3LP0A 2HNZA 3WDOA 4A8XA 1F5BA 3CWJA 2PJ0A 1NBEB 1IM4A 2PEBA 4A30A 4DU8A 2FT0A 1NKBA 4RBTA 1JK9B 4OYWA 2PVWA 1VQKS 2NQPA 3OFEA 1VYAA 4LFAF 4LF4F 1GFWB 3PEJA 2AYMA 2HWTA 3MGDA 1XMTA 1G6BA 2IBKA 1BGXT 5E2QA 2YNDA 3H0PA 2AKWB 2COLA 2KB2A 4B9VA 3MTJA 3C8YA 2W8KA 4KGMA 3PFEA 4KSFA 2IDLA 3OSPA 1URRA 3V6DB 2MQOA 4DSFA 3CC2S 2RRAA 2VPXB 2Q3PA 2L41A 5L9NA 1J27A 1MN9A 3GV8B 1HHTP 3SSSA 5C7PA 1IXKA 3EZ5A 1IQZA 4I1TA 3G8SA 1O5JA 1EE3P 1LWEA 2KU7A 3T5JA 2C2ZB 5HSPA 4OFZA 3KHHA 2LDYA 3CF5Q 1R0CB 4WK1A 3UW1A 6AT1B 2Q66A 4CZCA 1F2GA 1X9MA 4KGVB 3KJVA 2YGWA 4AYBD 2AEFA 3N0VA 5KG5A 5IM0B 2OPRB 2DPTA 4NEZA 2Z3OA 1X5OA 2ZEDA 3FSIA 3NNCA 1Y9KA 2AIRB 2BANA 2DNOA 2MJNA 3MTKA 3UQSA 1ZAVA 4CQ1A 4B9MA 3MD1A 4K3NA 2GFQA 1WELA 1I51B 5EUHA 5D4OA 4ZPDA 1RWWB 2RF2B 2VD3A 1U6MA 3PR5B 5F48A 4OZ0A 4ICLB 3S9LA 1WKKA 2IFXA 4UWIA 1S0MA 1EKSA 1Q95G 5ETQA 5HVFA 2D3OR 3H25A 3U02A 2J9EA 1PAUB 1Q2DA 4U6PA 3H2VE 2BKPA 1I3OB 1HPZB 3NWRA 2P9GA 1WHWA 4BLGA 3KQXA 1XWLA 1VIOA 5A0YA 2PN6A 2VG6B 1P4NA 2MKYA 1L0CA 1NK7A 3PB9X 2MTLA 1K9MT 1Q7LA 1HMVA 2ROGA 5KFKA 4Q43A 2QTWA 3MFHA 4Y6IA 4QPXA 1VHEA 2ZC3A 1QDUB 1ZM3A 2OJ3A 3JXOA 1JLAA 5IQQA 3KG0A 1S1UB 1T94A 5CD4H 2DGVA 4RW6B 2CAJA 3W1YC 3H7HB 2FVRA 1JXEA 3WABA 4K4VA 3ZZZA 2XNQA 1R8PA 3HVAA 4KHMA 4ZVRB 4RJVA 2HHHJ 3KXDA 5ETTA 2FSRA 4U7UK 4LRCA 4Y49B 2QLBB 4DX5A 2XZWA 1ZTWA 4DN0A 1FEHA 1KS2A 2BKNA 4ZLPA 4NLGA 3CPAA 2FC9A 2ALZA 1PYTB 2R7HA 2ZBIA 1N0UA 2V9WA 3MEKA 2ZNZA 1I5OB 2V2KA 2ZHBA 2DCLA 4J3GA 2J7KA 4DS4A 4RU9A 1NPRA 1LWXA 4USUA 3TJAA 3W2VA 4ZN3A 1LW0A 2O66A 2HRUA 4MCQA 1P0HA 4KJIA 3V8IA 1REVA 5IOLA 2VC1A 1V9OA 4PUOA 3KFWX 1CG2A 3ICLA 3NGTA 4X66F 2DPIA 5B0DA 3IIBA 2N3LA 2DXDA 3PW7A 3US5A 2VICA 4Y49C 5AG6A 2ZNYA 3NY0A 3NH5A 1KQSR 3H5XA 2Z3MA 2BL1A 1EQ0A 2Z3PA 4ZA1A 4FP9A 4C8LA 3IFEA 5LXYA 1BC6A 2M3DA 1K47A 1RTZA 3CC7S 1Z2ZA 2HQDA 1RO5A 1FY7A 1WJ9A 5KG7A 4CAVA 4DQIA 1ICEB 1XMBA 3M32A 4K4WA 3Q8YA 2BR0A 4Q0BB 2NYQA 2XI3A 1WACA 3PG9A 1YLXA 3PP9A 3RUBL 2EUIA 3DOKB 4TVAB 2FJEB 1HQUA 2O5DA 5HK4A 1HKAA 2VASA 4EVYA 2GU2A 2WONA 2DNMA 5KFHA 1XF8A 4U7UD 2Z0ZA 3E0KA 3SI2A 4MKVA 2R8JA 1RAOA 4B5PA 2LFVA 4NLPA 3D67A 4DV3J 3CCES 1F3VA 3KLIB 2V5HG 4KC5A 2JLFA 1MMLA 3BN7A 1NDLA 3PW4A 1IKWB 3CJ3A 5E5NA 1NNDA 3BGRB 1NK5A 2MLXA 5JGFA 4RW8A 1AMPA 3K5NA 4X4UA 1EIYB 4V19J 5L1IA 4KVOE 3W5XA 1HNVB 2UUBF 3OPKA 1VBZA 1SH3A 2HVDA 1HBMA 4TU7A 1ELOA 4UW2A 2BYCA 1RT2A 3V2UC 2IM0A 1A9NB 1NB7A 3KNGA 5KTQA 3PW0A 2HRYA 1ZS6A 2MEWA 1YVFA 2HMIB 2CKWA 1I6JA 4NYZA 3CW2C 5BR8F 3MR3A 2J8MA 3MPUB 1M0SA 1U1OA 2C2OB 3MM7A 1NDCA 1M4LA 4LRAA 3ZTPA 1IICA 1ZAWA 3BSAA 4ER8A 1KD1T 1UW9A 5HQLA 4F9UA 3A9LA 2DJWA 3PB8X 1PG5B 2YH1A 2QL5B 1QUVA 4USVA 1F6TA 1YX2A 3MGJA 2DGTA 5J2QA 1S3ZA 1S7KA 3QJPA 1YITS 4KOVA 1JLBB 3VGSA 4ID5B 2Z3NA 1AA1B 2RNEA 4LSNA 4LR7A 4PWUA 4L3NA 4ATNA 5I3QA 2PE3A 2F4FA 1DQ8A 3T1AA 1BE4A 2QL9B 5AXLA 3OL6A 2JEGA 3RJMB 4L6V3 3MAAB 5T7LA 1R0AB 4QIWD 2PIIA 4IDKA 4EO6A 3KHXA 3MCSA 1W25A 3DRPB 5DWMA 2R2SA 3CMES 1X0PA 2DH9A 3A3NB 4P4EA 2HVEA 2L48A 3KGQA 2BACA 1N36J 4UCMA 3J80U 4OV6A 3SCIE 2W8LA 4C97A 5KFYA 1HYSB 1WK4A 2F40A 1SQHA 1VRUB 2GS8A 3QB8A 3OTEA 4DCJB 1IBLF 4Y2MA 3NMRA 4OJGA 1GAOA 2MQNA 4OC5A 4JI0F 2W24A 3VWEA 1X5SA 4ID8A 5F41A 2KYXA 1KUXA 4YR3A 4M5KA 4MFBB 4UIAA 3WC5A 4PYDA 5F49A 2GV1A 3V5RA 1R6VA 3CMQA 2Z57B 3PVXA 1UVNA 4FWUA 2YNEA 4JYAF 1D3WA 3CJKA 2XBPA 3AY0A 2HFOA 2OMLA 3THTA 1F2PA 1YBAA 2LQ8A 1K1QA 5CAAA 2D3O1 2OIHA 2MDAA 1U4BA 1U45A 1DURA 2DHAA 3DN9A 3VZHA 4LBPA 3V7ZA 3JYTA 5CYJA 3OR1A 1WG4A 3MR6A 1AB8A 2G2OA 2ZHAA 2CADA 3ZZ0A 3MDFA 1KVJA 2LU2A 1AT1B 2ZBRA 4ED3A 3CNQP 5CXTA 4PQUB 4IG3B 4DUYF 3QT8A 2G0BA 3H8YA 5EC4A 5C25B 2NUHA 4CT9A 3DRYA 2YNFB 4M5DB 2FIUA 2YKNA 2NXEA 4OI2A 1VBKA 4NLUA 4DJLA 1HI8A 4MH8A 2AW0A 4QQBA 2MB0B 5GAGU 5FD1A 5MAOA 2FL4A 1YJRA 1APSA 1QVFR 1Y3KA 2WK4A 5KFBA 4LR8A 4OHWA 4NWBA 2WAQD 3IRXB 1FVSA 4FKXA 1Z4EA 5HMXA 1K4JA 3NS6A 5DDPC 2A2DA 3KK2B 4LF7F 1O6XA 3M2RA 4R0JA 2OTJS 4FD5A 4NGRA 1P6TA 1A6LA 4QBJA 3QLHB 1AW0A 3R9GA 1IBMF 3HMJG 5KG4A 4EU0A 4DJBA 4CO4A 2VV5A 3ET6A 5LSRA 2LEAA 1M1HA 3MD3A 4ZGYB 2YKPA 2KRBA 1WD6A 2HFUA 4QOTA 3TANA 4ENOA 4KOWA 3NG8A 3A8IA 2BJ7A 1RHKB 3D7HA 4WWVA 5HANA 3FVLA 3KKWA 2X1AA 1MNEA 2QLWA 4H4KC 1QAJA 3EGVA 2BRLA 2L9WA 3S6FA 4ZP9A 4ZPCA 5KFPA 3KWMA 2Z11A 2HVZA 4CAEA 3J7AN 3GFXA 1KQKA 2RKIB 1VIXA 2ZW6A 3FX6A 3PACA 3P96A 5HMYA 4R6TA 3IBFB 3T6JA 2QMLA 3T6BA 1NCLA 3WC0A 1HNZF 3W64A 2KTQA 4CRYB 4RW9A 2ZH1A 3BJYA 2XLKA 1UFHA 2OO4A 2FJBB 1KONA 3QJLA 1WDTA 4MI4A 2YPZA 4V19X 1OSCA 4Q7AA 2YNIA 4M85A 3ADAC 3HZGA 4OYPA 1I94J 5D29A 3LWUA 4PQAA 4A48A 2I8EA 5AT1B 2ZUGA 4UIBA 4CLLA 4NCGB 2HWIA 3IWGA 1UZDA 5F0UA 4C3KA 4TYBA 4IH6A 2OKQA 5KG6A 4NMXA 1QM9A 3QIPA 1J5OB 4KV8A 1VRTA 4M5NA 4CO3A 4F04B 3CVKA 1EARA 3G6VA 5HQMA 2UVRA 4DFKA 2AFSA 1U1PA 1WHYA 3J7A1 1PIEA 2E7VA 1IBCB 3BLNA 2DRBA 5IWAJ 2KFYA 4BC7A 4OMFG 3VHQA 3H4BA 1RACB 3Q2TC 2EG1A 4OP4A 4O3SA 4C2XA 2XS5A 4JOUA 5CD4A 3PW2A 2P9EA 5KFNA 4HH0A 2GLFA 2AYGA 2MSTA 3EC4A 4ZX9A 1OWXA 3CDXA 3B3SA 1A7GE 3CT9A 1FFGB 2ATRA 1M5VC 4UF4A 1JLGB 4NXMJ 1R43A 2FJXA 1RXTA 1FI4A 2BUNA 1IOIA 2OPPA 2VBXA 2ZH3A 5BYRA 2Z2LA 5E3PA 2BBEA 2FLNA 1U49A 1TK0A 1SUQA 3P6YC 4R0EA 2DXFA 4UZCA 3F56A 1XERA 3TI0A 1IJFB 4A8FA 2LMIA 5D4PA 1BQXA 3K5OA 1BPMA 3QQCD 3D1OA 5G20A 3OXFA 3NKYA 1R57A 3D3SA 3TWZA 4WFYA 2LP4A 5DS7A 4H4OB 1FDNA 1RWMB 4BS2A 2HHUA 1IJEB 2ZEOA 4OI6A 2J9DE 2VDHA 3EGWB 3RRHA 2YWFA 2AGPA 3K7RA 3X1LB 3SXNA 4IQXA 4CGOA 2PSWA 2PQ8A 3A1YG 1D9FA 3D0GE 3LP1A 3RGIA 2R8VA 3BF4A 2PC1A 3EX7B 4H54A 4KLVA 1MLAA 2ZXVA 4X2BA 1DZ5A 5HBMB 5A6PA 2CPHA 1Z1ZA 4ZY0A 3A3PB 4M5HA 4KB7A 3WT4A 2XWXA 3LGNA 3M6UA 5IQ6A 3KHZA 1CPZA 1X4BA 2ZD1A 2FZCB 1S9GB 4MBUA 3ZZPA 2CRLA 4IG0B 1R3NA 1S7NA 3BR8A 3JVNA 1S60A 2DNRA 4UWJA 4DV1J 4RWWA 1QSLA 5KG1A 4P44A 1S7IA 3LW5C 4OYOA 5L38A 1U7LA 1UETA 4E98A 3G6YA 3DGPB 2AJ1A 5B0GA 2B43A 2ADCA 3TZYA 2UUCJ 5B7WA 2DGSA 4J9OA 4O4GA 3K5PA 1HQ2A 2ZDOA 2P9CA 3B78A 2HNDB 2R2UA 3HFZB 1FEEA 1PBUA 3BYRA 3D5MA 2DR7A 1H73A 5F3TA 3BGFA 3PZPA 4K0KF 2JNJA 2AWZA 2Y3YA 1Y7RA 2R4FA 3NS5A 4OIWA 3B54A 3SJEA 1CQNA 2V8VA 1GT8A 1TMMA 3KMSA 3NFZA 5HAOA 2R7RA 4A8QA 2W4DA 1RJJA 1M5KC 3MUTP 1HL6A 5AE3A 4DV0J 4ZS6A 1L3KA 1VQYA 1SC6A 4EEYA 1DJ0A 4LF8F 1TFWA 4AVCA 3H20A 4RR5A 3C16A 2KHDA 5CCLA 2EK9A 3P4UB 1IKYA 2KT5A 3W5YA 2XEFA 3SDEB 1RAJA 2Z0GA 4E8UA 2QA4G 2YNCC 1XMQJ 4ELTA 1NKEA 2Q4VA 1HWIA 5KFLA 4F3OA 1BPNA 4QWDA 1PO6A 4JI4J 3CXCR 1I1DA 2HC9A 4W9YA 2V67A 4QWBA 5KG2A 4U5YA 1C1CA 4CYUA 3GYAA 1UJ4A 1ROFA 5IX3A 3JTNA 1R8BA 3SQGB 3ZZIA 2M8HA 2A6OA 1S1WB 2YY3A 4PK2A 2HGLA 4CS0B 3RBEA 5J1EB 3ENQA 3I9V9 1NHKL 1LEOA 8RUCA 3BDEA 3ILOA 2FVPA 2VZYA 1UW4A 1CP6A 1UEUA 1LAPA 2YX1A 2HEKA 4KUBA 4NA2A 1PKUA 2FZGB 5LMUJ 4WFAQ 2DXEA 3KHLA 2PJAA 4NXNF 1RT1B 4R8UB 4OYMA 4C0HA 3JSBA 3AH6A 5IT4A 1SC1B 3BSOA 2FCKA 5DZ6A 1HBOB 1RHRB 3KLFB 2GGPB 3D6HB 3TYTA 4LREA 4MKYA 1T05A 2DNKA 3KLGB 2MSSA 2A10A 1TUWA 1VLYA 1ZYQA 2BUEA 4DSLA 2O28A 2YNGB 5JMNA 1S9EB 1ZM9A 1KEKA 1HFEL 2WB4A 3PXGa 1WTBA 2C22A 1SXLA 2F4VF 3SSRA 5KFIA 3EUNA 1Z8XA 2PRBA 4C3MA 1I1GA 2V4RA 3IBCB 2GVDA 3THPA 3HX9A 3H4QA 2J76E 2WPXA 4M63A 2NMTA 4O0NA 3OQ2A 2XMAA 1N4LA 3OL7A 3N7ZA 3FEZA 2RAQA 5F0WA 3V4IB 1ZOTA 5JPHA 2CNLB 2N3OA 3I82A 2OPSB 4CT8A 4RO0A 4WIIA 2WVDA 4F2RA 1YTYA 4DFPA 3CCVS 3GG0A 1JB0C 4DWIA 1VLOA 2DBBA 1LXJA 3RB6A 3FNCA 4OI3A 5I0CA 4K4TA 3DXSX 4DV7F 5HL7Q 3G96A 1H7WA 1VGYA 3L7OA 2DEJA 3NGRA 4MIAA 1M5OC 4WFZA 2FJWA 3KUEA 3T9YA 4C7IA 5HJYA 4LF4J 2D3ZA 5J1PA 4LIWA 4N8NA 1H7XA 2HURA 1WC4A 4LF5J 3KTQA 2Q4YA 2VQYA 5J8CA 4N76A 3DHWC 1U1KA 4MRIA 1NRKA 4C0OC 3V81B 2B5JA 4CNYA 3KL9A 4UEFA 1QVGR 3HP6A 1YJTA 3MMJA 4YHHF 3DI6A 2EEYA 3PZJA 2JVRA 2CDRB 4AE5A 4Z2XA 5KFZA 2RHQB 3IG1A 3FZBA 4JV5F 2V2QA 4Z7CA 2R2TA 3KYLA 4ZITA 5L46A 2QRRA 1FE4A 2HRTA 1YW6A 2HZCA 5E3RA 4DX8H 5HROA 1N5TA 2HB6A 3SXLA 5DZ7A 2HQGA 5IV0A 4A33A 2L9DA 1PAEX 2QN6B 4DUZF 3DLGA 2ZBQA 1FRHA 3N01A 1Z8TA 3QPIA 3ZNUA 2ATLA 3W6SA 4P2SA 2RT3A 3TA0A 4R5PB 2DHGA 2HNYB 5KFFA 4C11A 2WTFA 1IGBA 4OV1A 3GYNA 5M2PA 1FVQA 3HO1A 2XEGA 4OQJA 1BD6A 3TRGA 4TQRA 2DGXA 2XHWA 3PHTA 3HD2A 4ANEA 4KSAA 2YVSA 5D77A 5F9NA 5GAHU 4ZHRB 4JB8B 5E3AA 2ASJA 1YDLA 1VQ4S 3W6XA 1HBUA 1K1SA 4F4YA 4R7MA 1SQGA 3RTVA 1NXIA 1MU2B 1TKTA 2XY7A 3F8KA 3M8RA 3EGNA 3GTYX 1Q53A 2JRSA 3TNVA 2ADBA 3DFEA 3QATA 2AE6A 3KHRA 2ZC4A 2DB1A 4URSA 1VISA 3BQ0A 1Q79A 4YWYA 4NGMA 2I00A 5IFMA 3VF0B 4LQ9A 1RAIB 2HQYA 4NSQA 1SL2A 4YRHA 2MXYA 1S7LA 3QRPA 3JUWA 2UXDJ 3TQ1A 2F65A 4RW4A 3W2WB 1IWGA 4BC9A 3D2WA 5FLXY 4HLBA 2XWYA 3M9MB 5KFVA 4C48A 2C2NA 1B7YB 2H54B 4LIRA 1S0NA 3QWPA 5B08A 1RAAB 4YB7A 5DLFA 2W4CA 3TO9A 4LBIA 5G21A 1RTQA 4QZVB 1N32J 1FKPA 4G1QB 3J7Z5 5I42B 2F8HA 4O3NA 3SZ2A 4F6AA 1Y0RA 4YB6A 4P2MA 1TL3A 2F1FA 2QVPA 3BPSP 3MM8B 2W9BB 4M5MA 1J2VA 1QTMA 1LANA 5IC6B 2FHMA 3OV7A 3HXMA 3X3UA 5LL6d 2G3AA 4RUHA 4R76A 4Q8FA 4CLWA 4GC7A 4LF2A 4NE9C 2K06A 3FCVA 2Q4ZA 1DY3A 5F3ZA 2HFZA 5B0CA 1GMUA 2DRAA 1HWKA 1QAIA 3MPVA 1N56A 2DHHA 4UFVA 2OI2A 2UXCJ 4C3LA 1JX4A 2ZEJA 2ZH8A 2NXUA 4QWEA 3M8PB 3GG1A 1HNWF 1CSJA 3AJ2A 1UCNA 2QMXA 2HBZB 2R7OA 3S7RA 5HN0A 5LYFA 4UT4A 1GXTA 3M8ZA 2CQBA 4PEOA 4BINA 3F73A 3A12A 4YOEA 1Y5IB 1PJ6A 1VJWA 4NCBA 5DS0A 5ETMA 2B3TB 1NK6A 4LF1A 2XSJA 1QD1A 3KJFB 2FIAA 3C6TA 4F4XA 3MR7A 2DNHA 2KI2A 3RBZA 1L5UA 4P71A 3FEEA 2V2ZA 2ZH2A 1LK5A 3M9OB 4K4SA 2BKOA 1RXOB 5A2QY 4BMHA 4YS2A 4G1IA 1TMJA 4MXUA 3M4XA 2XGPA 1PBAA 1U24A 3AXMA 3V6HA 1OS5A 3MMBB 4C2MA 2AJ4A 4IO1A 1IKVB 4CGMA 4DEZA 3MMAA 4X4VA 1OIAA 2I5JB 1JJ4A 1QSMA 9RUBA 4XNHB 1N5SA 2IA6A 2AJQA 4FXWA 4KFBA 2ZDPA 1VC5A 3DDNA 4ANCA 1G1XA 5LMNJ 2OPQB 2QEXS 4FYDA 3FGVA 5BXIA 4IFVB 2L08A 4Q44A 2PJ8A 3FFIA 4FF3A 2K1RB 3OTDA 4X65F 3I56S 3D2MA 1GXUA 5AG7A 4JI8F 4PV6A 1FRLA 1WNEA 1RWKB 3NGKA 1X5TA 2MKJA 2ZPAA 3W9JA 1YK3A 3HFKA 3MM6B 2J7UA 1NDKA 3DLKB 4BWJA 2NXJA 2V6AA 1S5ZA 2BV3A 2YQ0A 1PC5A 1YGHA 3UVJA 4EZ6A 1TU0B 3GFYA 1U09A 2PE8A 4Z65A 4F4ZA 1HWJA 4XNHC 4A8WA 3PKYA 3BI1A 1XNQF 1X10A 2KKHA 1KZFA 3M30A 2Q43A 3RYLA 1U25A 2MZTA 1TV6A 3QT5A 1HR0J 2ZKUA 3CD0A 4XPCA 5ELYA 3T41A 5DM7Q 2VODA 4OZNA 4RX6A 4AQYJ 2YKMA 2W9CA 1KC8T 3D66A 4NZ0A 4P10A 5C24A 5H84A 2FS5A 2IPOB 2EK8A 4NYPA 3SCLE 2ZBCA 3K5MA 3LP2B 3T3FA 1M1KT 4S0MA 1DTTA 3OLBA 3FUYA 1CJUB 1HBNA 4FYXB 4AFFA 1BLLE 1Y7PA 2MHEA 5LT5A 1ZH5A 4ZJQA 2FVSA 3CB4A 2XMTA 1S4FA 2JDJA 1NMEB 4PG7A 6FDRA 4WFNQ 4YB5A 4PXEA 5H1SV 5C88A 3IO1A 3JSRA 1LFPA 4TY8B 3R5DA 5A8RB 3RR7A 1S6QB 2CNTA 3QO9A 4B3RJ 1JLCB 2ZEEA 4URQU 3R5GA 2CJKA 4I6WA 3PJWA 4B9SA 4JI0J 3M8WA 1E6VA 4KH0B 4BCAA 4NLTA 3DM2B 2CNNB 5AJ3J 2M9KA 4QYRA 1XJOA 2HPUA 2PO4A 2FJVA 4F8ZA 3FECA 1RE1B 4XAKA 2BRKA 3VAKA 2IIHA 2OZGA 2ZM6F 2H4WB 4I7FB 4KSIA 1N34F 1VKCA 4JYAJ 4P9SA 4ZX8A 4P2XA 3OTOF 4ED2A 5DDRC 3VTIA 4DX7A 2QMWA 4FYYB 1RT3B 1HLWA 3KK3B 4DPXA 5L8RC 1AUGA 3I0SB 2FVCA 2HHXA 3NBPA 1YWXA 4K5RA 4IFYA 4O4RA 2POKA 2D1CA 4OLLA 1BUXA 3BBFA 1ZLHA 2CPJA 4ZY1A 4LFCF 4P4IA 3KG1A 4A95A 1IU8A 3GJSB 1XQIA 2ZHOA 4WU2A 4NLWA 2A18A 2OD6A 3DYAB 1TVRA 3VVTA 4DDFA 4G6VB 1RYRA 4PYAA 4EZ9A 2N4DA 2X3DA 2W25A 1JNZB 4PSWA 1RWPB 3IMQJ 2V4QA 3DLEA 1Y9WA 1RGVA 2KT3A 2ZWPA 2FZKB 1U48A 2H4YB 2KFZA 1TKJA 5D0GA 5D0HA 3H8EA 1QQ9A 4F26A 1Y0HA 5RUBA 2DGOA 2RB7A 3CMAS 1WDDA 2Q1LA 4F3QA 2DEIA 3EDRB 1RYSA 3UY5A 4K59A 1T9XA 2B8QA 3WX4A 3ZTRA 2GFFA 5JJBA 2Z2YB 1IBMJ 3A8EA 2CY2A 1ZBTA 4DR6F 1CLFA 3T9NA 3DSBA 3BREA 3TAQA 4F36A 2N7CA 3M6VA 2EKYA 1F9EB 4B13A 1RK8A 2UU9J 4B10A 1YSJA 1HQEA 3UN5A 2PR8A 2QLXA 1Q82T 3POTB 3R5AA 3L3CA 3G9CA 3BV8A 3OWCA 3TCVA 4OLOA 1YREA 3KLEA 2ATCB 2VB6A 1MMDA 3WHIA 3MMCB 2IRYA 1HNZJ 5F8LA 3MCMA 1BQNA 4CO0A 8CPAA 4CH0S 3DMJB 4QCLA 1BQMB 5IS2A 2B4OA 3KG4A 3PM9A 3IP0A 5DQIA 5HLFB 4FZVA 2B9YA 4IG0A 4F4WA 1AFIA 4N5SA 5E96A 3TP2A 4OKOA 3CXSA 1SB6A 3W8GA 3TJ8A 3VAMA 1ELMP 2J0QD 4LQ3A 4MFZA 3UCUP 2HS3A 3I5BA 4IHMA 1HI1A 3AXKA 2CG4A 4F0XA 3S8SA 4CGLA 2ROEA 3KOAA 4R57A 3UI3A 4CAFA 2CYYA 1RQ0A 4B9TA 2NYHA 4B3TF 3AQPA 5G0RB 3NRBA 2C1CA 1KLMB 4PZVA 1UJ6A 3FQLA 3RB3A 2EKNA 3UN2A 1U2CA 1PYOB 4WU3A 4O3QA 2I3CA 4ECWA 1S1XB 3HJVA 1Z4UA 1HHQA 1K0VA 3I31A 1VDHA 1U1QA 4CLYA 4USKA 1X9SA 2B6AA 3VR1A 1VQMS 2XHCA 3QT6A 3GCXP 1HHSA 1SCJB 3GPAA 2B7BB 1NK9A 1OQ6A 1WC5A 2KL8A 2FYXA 3AJDA 1TL1B 4OZLA 5GAGI 1E6YA 3K57A 2V8HA 4J9VA 3PRBA 1YW4A 2KJVA 4K2XA 4A32A 1S6PA 3EXYA 1JJ2R 1YJ9S 3Q89A 1QUPA 5JH9A 4X62F 3FF3A 3OT9A 3F0NA 5J2PB 1Z9UA 1SI9A 5J8FA 5LXRA 1S6UA 3TTHA 1UTAA 3B3VA 1CJWA 2WYRA 2DYAA 2V4JB 4QW8A 3OL8A 5GAEU 3SXOA 2XMWA 4KO0B 1RKIA 2WPWA 2FY8A 3KMQA 2B5GB 3CCZA 4OZJA 1GQEA 3EVMA 1BO4A 2NSCA 1KHWA 4ZVUB 1C0UB 1VC6A 3TOQA 3M1VB 3BSNA 4KY3A 4NEYA 3W9HA 3IAS9 3RBXA 2ZELA 3W61A 1SVDA 3S6EA 5GADU 4AL7A 4PG6A 2WOMB 4UOGA 2ZEGA 4J9NA 2PJ7A 3C6UA 5HMNA 3HHLB 4CM2A 2XEJA 1OPZA 2XULA 4CYQA 3I9ZA 3J7YU 1VMBA 5CYQA 2B4DA 3H42A 1EP4B 3NCRA 4OC0A 1RLCL 2VPWB 3LAMA 3WBZA 3HD1A 3I0RB 4F0HA 1LW2A 1KFSA 4DR3F 4KGZB 2DNQA 5AE1A 3CJ0A 4DXLA 3NXZA 3PDNA 2WVFA 5FDLB 1RDRA 4OHVA 1B64A 3L9ZA 4Y28C 4O44A 2HYIB 4UFXA 1Q8BA 2JHEA 4DR4J 4DR2J 2EK1A 5HXDA 4FVCA 2ZE2B 2QC3A 4F0MA 3DR6A 2ZOGA 1NJXA 3AHPA 3DRSA 2RQ4A 3HHLC 4FF2A 2REFA 1P9YA 1JLEB 4B12A 3MUMP 3FNNA 1UA1A 4EFAC 4QVTA 3M9NB 2G1HA 1B0TA 1K8AT 3AB4B 1AXQA 1N6QB 2H5EA 4MFQA 1N5YA 1P1LA 4GMKA 3BHXA 5F8JA 3PR4A 3FEXB 1QE1A 2VZZA 4GS4A 5KFEA 3AAWB 1Q1KA 2E5LF 2X1FA 3SV3A 2PJCA 3NLCA 2M5YA 4PSXA 2MGZB 3G82B 4LF8J 1QTNB 5KFRA 1S48A 3OFFA 4CRJA 2GIFA 2MZRA 2ZW7A 4QIFA 4A46A 3GCWP 1VS3A 5DQGA 3C14B 2ZW4A 4HACA 3HHNB 5LOQA 3UDCA 3HHDA 3GIUA 4YGOA 4L72B 2H5MA 2AQ4A 2EW9A 2BE7D 2WZNA 4FNHA 2MKIA 5J2MA 4LFBJ 2UVVA 4F0YA 4ZVSB 1UWAA 4DV5J 2DO0A 1LQ9A 3MEGA 5LSOA 4K50A 2PI5A 1WWZA 3TQEA 1GYTA 1S1VA 4LSLA 2IMWP 1FK9B 5IT9Y 1ZM2A 4GVLA 5ISVA 3I9SA 1CJTB 1VQ6S 2HZVA 4DV2F 2ROPA 1RCXB 4K4ZA 5IV4A 1Q2CA 4JV1A 3M8QB 1RT4A 2C28A 2Z4PA 3GJRB 3B35A 2NXNA 3KUGA 4NXNJ 3GIMA 2VI7A 2AF6A 4WXWA 5K8PA 4P6YA 1S1TA 4GVBB 2OEJA 5EWFA 4ZCLA 4MCRA 1HIYA 2QV6A 1SV5B 1DLOB 2PJ2A 1H6KX 3PRTA 4A38A 4NLVA 3CJ2A 4ED6A 3B7IA 2W9AA 4NFRA 3G8QA 2ASDA 2HAIA 4OHYA 2CJXB 1XBWA 2RSQA 2J6UA 1S5KA 4M3SA 3GSDA 3P2FA 4DLGA 1YZ7A 3C15B 3VVUA 3LWLA 2CQCA 2V68A 2E1MC 2APOA 2WVBA 1VQNS 1Q5VA 3OFHA 4RUCA 2XS2A 1N5QA 3R5BA 2UZAA 5G22A 2J7WA 4ZVTB 4RBVA 2JVOA 2BXJA 3DCAA 1AZSB 2E66A 3AOCA 2RDIA 4J9MA 2DR8A 2HLUA 2GZOA 2WZ1A 2WW8A 4KE5A 2JL9A 2VFVA 1RI7A 4WP3A 2DNZA 2R42A 3P5TL 2O4HA 1SKRA 1IQTA 2E7XA 4WFBQ 2EXUA 2ZITA 1M4DA 4NF1A 3R3TA 3AD7C 2DF5A 3I4HX 1W26A 2X7IA 3I5AA 1CULA 2PIZA 1RT6B 1YGYA 2C2DA 3VGVA 2LA6A 3DLBA 2IMOA 3N9UC 1JLQB 2LXFA 1TF8A 3ENVA 1U0HB 3UDEA 1CVJA 4C8KA 1CJKA 1JKHB 2EWBA 3I5CA 2H1YA 4BD9A 2Q6BA 1DARA 2NPIA 1FKOA 1WG5A 2OFHX 2ZZNA 3FB3A 2H51B 3TR5A 4JI6J 4N41A 2PJ4A 4TU9A 3KK1A 2NPFA 4WZMA 2QT7A 4OYXA 3DLLQ 1MSWD 2IVFB 2DEAA 3D2PA 1IM6A 1H2UX 2YWGA 2CWXA 1HW9A 2Y1IA 4HDHA 3MM8A 5HO4A 1FRXA 4CH1A 1EETA 2W9BA 3QFHA 3S6KA 4YHHJ 2LQ9A 1NHVA 2FIWA 4USHA 1NH7A 1AFJA 5KFXA 2P6FA 1U1MA 4NEXA 2NUUG 4IH7A 3DRXA 2B4BA 2LKZA 3MF5A 5K20B 1J4JA 3K89A 2ZEPA 2AGQA 2KHCA 4JI5J 4RW7A 2X1BA 3MEEA 4ZVHA 1T9WA 2CQIA 5HVHA 2DVIA 1LAMA 1XN9A 3GB0A 1TKZB 2Y8WA 2CXAA 2GAGC 3MOJB 4XTTA 4ECRA 3JTOA 1CX8A 2QSFA 3LOUA 2D9OA 1YZ6A 1SC4B 1U8SA 3SQOP 1JWQA 4DSIA 2C3PA 2HQCA 2EPIA 2EFPA 3CEDA 1WC6A 3DC2A 1UWBA 1WG1A 4EYIB 1SJRA 4V1Ak 2NR0A 1Y5LB 1FT7A 5DG7A 2KN4A 5FIIA 2QE5A 1RWOB 1SJ1A 3I32A 3GIJA 2J6TA 4YY3F 8ATCB 5KTAA 1NUEA 5HMWA 3BZQA 3AD8C 5I3UA 5C42B 4L3KA 2PMZD 4F25A 3EZUA 2EFGA 4XDCA 3IA0A 1OO0B 1LOUA 3JSMB 3KASA 4ZPVR 4IR1A 2EBJA 3TVYA 4F50A 1RZMA 1KUYA 2VH7A 4CAXA 1QSNA 2CQ4A 2CXEA 5CCMA 3MM5A 5A8WB 3QAHA 1VHOA 1IOFA 4OJ3A 3ITHA 5F8MA 3LP0B 1UEVA 4MT1A 4USJC 1FFSB 1MG7A 2GREA 3VQTA 1QLNA 3M7VA 4BBHA 2VG7B 1NSLA 2AZ3A 2GHPA 3E51A 4I49A 2C3MA 3T1YF 4IRCA 5EWEA 2B9XA 2O01C 4ECSA 4E0DA 3RG6A 1ZG8A 1D9DA 3UPFA 4I2PA 5F47A 3FKBA 2KXNB 2HV2A 4U96A 2MLYA 3TO7A 2HHHF 2JC0A 4LUAA 2LLZA 5CYMA 4TNOA 4ZPWR 9ATCB 4DZ6A 2HGMA 4UOFA 2J9CA 2VPZB 1K73T 3ENAA 4GRSA 3NCPA 4B11A 2UUAF 2DH8A 1TFYA 3RZAA 3UDVA 3CCLS 2V34A 2R1IA 4ALZA 3PYFA 2UV8G 5KT6A 2XC9A 4P6QA 4ZI6A 4A2ZA 2UXBJ 3V6JA 3AA9A 1T9VA 5BYSA 5CA5A 2BM1A 1RT5A 2E29A 4PXCA 2FVGA 1LWEB 2K3KA 3IWWA 1T95A 2LQ5A 4TQSA 2AX0A 2EC0A 1TKXA 3RRGA 3F41A 3FCWA 2M70A 2K7JA 3TARA 2V9KA 1XJWB 3LMSA 4C2YA 4DL4A 1PYSB 2EFQA 4OX9F 5ETRA 2ZVIA 1S0OA 4YR2A 1F57A 1R89A 3QNWB 2JDCA 1C0TA 4ILRA 2BANB 3GV7B 1RWUA 2IRUA 4JWPA 3ILJA 2VJVA 2KRRA 5AXNA 2ZENA 4Y0FA 3PV8A 4OIXA 4TKTA 3AT1B 2B56A 4FPRA 2ANPA 1HNWJ 5J2NA 1XMOF 4LQGA 4HI2A 3PYDA 2VHGA 5DGAA 2C2RA 4HNWB 4NMLA 4WTYA 3Q86A 2LYVA 1LWFA 2JEVA 2ZH9A 3N4WA 3EYZA 5FLXU 5A8KA 2M52A 5L1JA 4JI2F 2OELA 1RWVB 2BM0A 3CDEA 4ZPTR 3IR5B 2Q6CA 2D7SA 2PJ5A 3HFVA 4P73A 5A0YB 4U9RA 3UD4P 1CM0A 1HNIA 4PCQA 3SJGA 1Q7LB 3U1LA 3E8OA 1HMVB 4IF5A 4DV3F 1T3NA 5K14A 4JV2A 3SJFA 2KFNA 3CCUS 2HFNA 1JLAB 3ZO7A 1S72S 4UTGA 4F0KA 3EZOA 4NI2A 1MMNA 3UO0A 1W7WA 3DOLA 2GW8A 4PXDA 3CIZA 3DOMA 3IAM9 4NGTA 1F9HA 1TL4A 4ANDA 2GCFA 4XK8C 1KUVA 4P52A 4CTAA 2HK2A 4XO0A 2RS2A 3QRQA 2X3GA 4CLSA 1YG0A 1X4CA 3N79A 1QSSA 1IBKJ 4GM5A 3IRWP 1FO1A 3IXQA 2C27A 2GHVC 4AD6A 3TUZC 1OPIA 4X65J 2CQPA 5KFWA 1WSVA 4FBUA 3AODA 3CXPA 4LVOP 4ECQA 2H48B 4ZVGA 3DLHA 2W2PP 4WCEQ 4R9MA 3ETOA 4IKAA 1P1TA 2W7OA 3SI1A 1NK4A 3QYYA 4ETZA 3EY5A 1TIQA 4MJ8A 2A6MA 3SCKE 5KFGA 4GXHA 3R97A 3W2VB 2A0FB 1V5VA 3CJSA 4NRTA 1LW0B 4CP5A 2XYGB 3DDIA 4RNOA 4NJQA 1REVB 4TLQA 1XNQJ 1WEXA 4PUOB 2G9DA 3SFGA 2VG5A 2OLWA 4H89A 2F5IA 3T5LA 4DG1A 2VUGA 1NK8A 3H5YA 2Y0SD 4RLEA 5A2QU 4C8OA 3R27A 4J7CA 1RTDB 4KHRA 3VWDA 3LGHA 2FLPA 1YLEA 2EG2A 1PU9A 4CLTA 4FXVA 1N36F 1XEZA 3M32B 3POTA 2NZ4A 4M6HA 3HKWA 4NA3A 1YMEA 3Q24A 3W9IA 2IM3A 1P8GA 2ZVSA 3IGNA 4R3KA 4LF9J 4ED7A 1F5AA 1X0FA 1HQUB 3IC1A 4X4RA 2I9SA 4OZ2A 2PJ3A 4DS5A 2WONB 4YB1P 2HQFA 2KG0A 2RVJA 2BQUA 4AUKA 4I2QA 4DR1J 1RCOB 1BQMA 3CGIA 2JEWA 1S49A 2LEPA 4B5PB 2GO9A 1NB2A 4H4MA 2VQFJ 4MK8A 1OYDA 3P5BP 1VR6A 1V3ZA 2CUYA 3K8WA 2UVUA 4I67A 2NZCA 5M2UA 1C2PA 1RTHA 4KGXB 3LODA 1XR7A 1YJUA 5E3QA 4Y2AA 1VHFA 4I64A 1CJVA 1N34J 4J37A 1RSCA 3KLVA 4C7HA 4RW8B 1ZETA 4KYZA 4ZOSA 4N77A 4C8ZA 4W90B 2DNNA 5CABA 1UVLA 1T9YA 1VQLS 3R1HA 4QR0A 3NGDA 1KVKA 1B0PA 2H3EB 3H8GA 1JLFA 2F9JA 3O5TB 1HBMB 1S1XA 1XK8A 3BKFA 3W63A 1H74A 1NU4A 3BB5A 1RT2B 2K7KA 2ZH6A 4I68A 4QC6A 2R7WA 4U9YA 5KOXA 3DU5A 4OI4A 1Q0NA 2CPYA 2HSEB 4J9UE 3H4DA 4AXIA 4CIOA 1LNQA 3SI8A 4R8FA 4M5IA 1SIZA 4RBUA 4P2FA 3PIPQ 3OD2A 4JI1F 4Y2IA 5D3GA 1WKLA 1B7FA 3S01A 3MM7B 3HVTA 4FS1A 2QA2A 5E33A 2YXLA 4OI1A 2XO7A 1KP6A 1W2BR 4OIDA 1C1BA 4DPOA 4DLEA 3CTRA 1BXNA 1OQ3A 2ZZTA 2GMJA 5J2QB 1YI2S 1G7CB 4LR9A 5ETNA 3FMBA 2GMLA 4JV0A 4KR0B 3NE7A 4D3HA 2EI5A 3L09A 3R8YA 3CJQA 2I79A 1SKUB 4HNYB 2HHTA 4MCPA 1R31A 2H5JB 3BR9A 3U1NA 4ED1A 2OUGA 5T7LB 1PCAA 5DRKA 1N54B 4W92B 4IDKB 4DF4A 5DETA 4IR9A 2YWWA 1RWXB 3TX8A 5LYIA 1U1LA 3H8FA 2P8IA 3ZTOA 3RB0A 4O23A 1Q16B 3GFHA 2RU9A 4X64F 2Q7SA 4RL1A 1U47A 4J9QA 2HQIA 2NLWA 4OC4A 2RUGA 4AL5A 1OSDA 4A8SA 2PDOA 4ZCMA 2C42A 1Y3JA 5EMIA 5B0EA 1WC3A 3DNSA 1GHEA 2MY7A 2BW7A 4CYNA 4KQZA 3PBEA 5IB0A 1BAVA 4QIVA 2W7PA 4C98A 1MROA 5D0RA 3TC8A 1F0XA 4CRZB 1DE4C 3HULA 2KJWA 2FGCA 2XYPB 2J0SD 1VBXA 3CJKB 4EBEA 3A4TA 2XY6A 2QYVA 5AXKA 3W5ZA 4F7VA 4NXYA 3ILIA 2R7SA 4ECXA 1ZLIA 3NP5A 3I4PA 3JYTB 4A8OA 3OR1B 1KLNA 4IO9Q 4P75A 4GC6A 4K4YA 4ONWA 2N82B 1G4CA 2BW2A 3GILA 1V6HA 5DJBA 2RJZA 1FWPA 2VBWA 1S97A 2ILYA 4LRFA 4WE1A 2QJ8A 5IWAF 3R5JB 3KDOA 2DHXA 2R8HA 2YKNB 1NJZA 1FJGF 1Q5YA 3D0HE 2G3TA 2XLIA 1VRQC 2NXCA 2W4PA 1HWUA 1S76D 4P74A 4USTA 5A27A 3G8WA 4URGA 2HZAA 4ELUA 4DR5F 4Y65A 3D7FA 1AYEA 4WBFA 1XOVA 1Z5RA 4NL5A 2OZUA 1IR0A 1WHXA 3IM8A 1FWLA 1D8ZA 3TA1A 3SI0A 2VQEF 2BA9A 4W98A 4X62J 3FRMA 2H65B 3M2RB 3NAIA 2V8PA 3FSXA 1YJVA 3K0JA 3LANA 2K5TA 2C3UA 3IEHA 1RA7A 1T03A 1KNZA 2MQLA 2XG8A 3OTBA 2B7CB 3QAEA 4FNIA 2VEZA 1J5EF 1NJIT 4DL3A 2B8PA 2UV8A 3ET6B 2V63A 1O8BA 2GVZA 2AFXA 4AG7A 3T90A 1K0TA 2DXQA 3MXHP 2ODFA 1YHQS 3N6NA 3OR2A 3RR8A 2VBZA 2JLGA 5SUHA 4FS2A 4UOHA 4ORFA 1FESA 4QBUA 5LJ5Y 2M7SA 2XM3A 2UP1A 4NASA 2E9ZA 4UA3A 1VBYA 3W66A 4EWTA 1FFWB 1ELLP 3KLHA 2ASLA 1Q81T 3OUYA 1RTIA 3FCHA 4ZVFA 4ES3A 2IVMA 3BGUA 4X4TA 2BE2A 2JDDA 1XR5A 4CGPA 3SBMA 2CPZA 4UQGA 5JVGQ 3JAMY 1Q2YA 3W91A 3NE8A 3LH2S 4NLDA 4C4WA 5EGYA 3TAMA 4AT1B 2OGUA 3P3DA 4QU7A 1DTQA 1FTRA 3T1HJ 4RW9B 3CZXA 4UZBA 3M6WA 2WHOA 4Q38A 1N88A 2J8AA 2IC3A 3TOBA 4UUXA 4DR3J 2FDNA 3MEDA 3EE3A 4P7VA 4FBTA 4DV1F 4KT0C 4XIUA 2YNIB 2BJDA 3J81U 1WF1A 3TJ9A 1GH8A 3Q2SC 3EXCX 2DKOB 3NGSA 1XNRJ 1XEBA 2OAUA 2VFTA 1FRJA 1NAQA 1OMSA 3CO0P 4AG9A 5KFSA 1MK4A 4CPAA 4KKOA 2UUWA 3G3SA 4YFJA 2RRBA 3GR1A 2VXKA 5AG5A 1LOKA 3EMTA 1NJYA 4CLFA 3QIPB 4KV8B 3L7PA 2ERRA 1VCTA 1VRTB 3ELHA 1R6YA 4DR7J 3CC4S 4GKJF 3G6ES 3G6XA 4XPDB 2R7TA 1Y4ZB 4U7CA 1GXLA 1GX6A 4YDDB 2HHSA 1EX8A 3RAXA 2MPUA 2E5HA 6CPAA 4EBCA 3LGMA 3R2DJ 2F7VA 3HSDA 5CNPA 3VAIA 1LKZA 4DV0F 1RADB 1PJ7A 2F9DA 5FVJA 4A47A 1LWCA 4X4QA 2GE3A 2PR1A 5L1LA 5KFCA 4DCPB 3R9FA 3ZZRA 2HBYB 1H3DA 3CE8A 4XPKA 1IKXA 3WC2A 3D7GA 2UUTA 2OPPB 3E01A 1FJCA 2P6SA 4K4UA 4G1PA 1WF2A 4A37A 1SUQB 4OX7A 1EHWA 2G13A 1REGX 2X7BA 2LVWA 5H9EK 1F5CA 4TU8A 3HK2A 3C66A 2O67A 3MECA 4ZP6A 3MAHA 4DF8A 4H6UA 2B51A 1FHTA 3T5KA 3UN3A 1CBKA 2I1RA 4AVBA 1IR2A 2IAJA 2E5GA 3D6FB 3B4DA 2UVWA 3Q8SB 4JYWA 1RT7A 5LMUF 2B4VA 1U6ZA 4NZ6A 2MKSA 4GO7X 4HR2A 1I12A 3E3XA 1B99A 3LP1B 1KHVA 1QSOA 1S9FA 3F5BA 5CBMA 2YKQA 3LTOA 1ZPVA 2WBMA 5DLGA 2L9NA 1CPSA 1RBAA 1TKZA 2GLJA 2NS1B 3FSYA 4NLSA 2QZ8A 2OP5A 4ED0A 4QWAA 3J7YI 4DV4F 4AL6A 2V0NA 1N48A 4P4BA 4JI3J 3MM9A 2GIVA 2EWHA 2PSZA 2BJ9A 5KTCA 1NEEA 1RU2A 4WXOA 2WVEA 2ZD1B 2DR9A 4UOCA 2VPYB 3OVSA 2YNHA 1FRKA 4F67A 2CNSA 4DSJA 3TO6A 4E2FB 2O1PA 5L1KA 5SZTA 2CZVC 1TKHA 4DHVA 3ZXWA 1UZHA 2RQMA 4DZDA 1O0PA 3B2YA 1SL1A 2GJIA 2DD8S 5B0FA 1YRUA 3KKFA 1NKCA 3HM9A 2J6SA 3IS9A 5E0OA 4CYOA 4O4GB 1Y0YA 2WUUA 3JSMA 2CQGA 2PFFB 3Q8PB 3CJRA 5LRKA 1WTFA 2QMUB 5DG9A 3GJTB 5T14A 3TZWA 3DR8A 2XY5A 3VAJA 3VH9A 5JM6A 4HHHA 1X4DA 2ZEFA 1VK8A 3B8HA 4ED5A 2GX8A 1S4EA 2NSMA 2PFDA 2VG7A 4KS9A 2JEIA 2Y1LB 4HT7A 3J81j 5IT9U 1ZO0A 2V77A 3E2EA 4HHJA 3C16B 4IQMA 4EMEA 1RHQB 1CS4B 2HIQA 5HJXA 3D3CJ 3MFIA 1IKYB 2R9LA 2Z10A 4RWXA 2AFWA 2R8IA 4LF5F 5JUMA 5GCNA 1G2EA 4LBHA 3AB2B 3V6DA 4B5OA 1FKAF 1C1CB 4CYUB 4FYWB 5HATA 2I6WA 5DQHA 3NNHA 4OL8A 4PG5A 2CPDA 1AUDA 3P2HA 3HLPA 3T9ZA 3CJ4A 4QB9A 2QYGA 1TELA 2DNYA 3ENWA 1U2FA 4CM0A 2C2KB 4UY85 3I3GA 1TUGB 5HVGA 4WTOB 4MHPA 5F8IA 1HDUA 1FD8A 2MYFA 4Q5VA 4J9KA 4B14A 2G0JA 3VAFA 2ZUAA 1Q4RA 4KPYA 5IM0A 2HFVA 4E8OA 2OPRA 3EICA 2FC8A 4QW9A 4A8MP 1YJWS 2IBOA 2XO6A 3LAKA 4OX8A 2RDDA 5KG0A 1EQMA 2Y9HA 4AB7A 2G0IA 3UR3C 1KKHA 3P45B 1SQFA 1PILA 3OW2R 2ACYA 2KXFA 3QZ7A 4HHUA 1T05B 1B70B 1S0VA 3M2VB 4X84A 2RF2A 4B9LA 4ICLA 5KFQA 1S57A 4DI6A 5K8MA 1LFWA 1FE0A 1X31C 4MFJA 4QPTA 4YFUA 2B9WA 1FNOA 1FCAA 2IRXA 4YDXA 4CGNA 3VV2B 4YY3J 1ZG9A 1Z4RA 1SJ4P 2GQ2A 2Y1JA 2GVDB 1HPZA 2QA1A 1KTVA 4LQ6A 4TLRA 2Y0BB 3O6QA 4FF1A 3PW5A 1TQLA 1KN6A 2JFDA 2VG6A 3LUYA 3FBCA 3D4JA 3BO3A 1HW8A 2E44A 4AXVA 2FHJD 1QSYA 1YK9A 5D78A 3EPIA 1YQHA 4KORA 4ZLLA 3I55S 2F8EX 3MRUA 1I21A 6FD1A 3UE2A 3PO5A 4B02A 2UXDF 4NLYA 4RNHA 1S1UA 5H9EJ 1WI8A 3QZ8A 1Z8WA 4QJVA 3EVOA 4OLPA 4RW6A 1HD0A 3W62A 4KRWA 4KZTA 4LFAJ 1D09B 2CDQA 3T1YJ 1AUSL 4EFDA 2NYIA 2EC2A 5E3CA 2JBJA 2IA0A 3JSYA 3HVRA 1N32F 3CPWR 4QU6A 3HSJA 1RUSA 1YX0A 2ZEMA 2WSCC 2AJ2A 3PJXA 1PYTA 5C2CA 1QJHA 2B5JB 5KT4A 3KNAA 1QAYA 4HEA9 3AFGA 2PMWA 1RABB 3NL0A 4B3OB 2UUAJ 2W01A 1Y5NB 4DPUA 3KR4A 3DI6B 4LF6F 2DNGA 4TXSA 2MKKA 1NO8A 2AMCB 4Q8EA 2W1BA 1G3OA 4RUAA 3IG1B 4DQQA 3GMGA 1TZ0A 2HVIA 2V94A 3DGVA 4L74A 2VKRA 1CQMA 5HROB 5IXUA 3RW7A 2CG8A 2CQ0A 3LPYA 2BQ3A 3GIKA 3PGPA 1Z8LA 4PG4A 2EBGA 2G4BA 1XE4A 1VQ7S 4M6GA 3DLGB 4ZPBA 4OX9J 3D1HA 2UXCF 5KFAA 2SXLA 3TX0A 1WSRA 2VBYA 2MQPA 1RTDA 2CWKA 4B3SF 2DIVA 4C11B 1ZZFA 4PRFA 5F46A 2AJ0A 2G0CA 4RKUC 2BSWA 2CZ4A 4XPEA 3SV4A 2XQCA 3PB7X 1TAQA 4F4AA 1XMOJ 4Q0BA 3D7SB 4P72A 4Q36A 4JXRA 2QG9B 4YMEA 4HNXB 4I69A 2CJAA 3IWXA 3DOKA 3CXQA 1KSPA 1EAYC 3DXBA 4C68A 1YLOA 4A94A 2ZJPQ 1HBUB 1UAWA 4NOHA 2KDOA 4DL7A 3SHPA 4WIQA 2BJ1A 1TKTB 4JI2J 4LRDA 3R5CA 2FHOB 4WZQA 2YX4A 1IYKA 4N8OA 2IJZA 2CNKB 3MAQA 4RI1A 1VQ9S 3ZZUA 3MZIA 3OJSA 1T3OA 2Z8QA 3KLIA 1OBRA 4IUSA 5U47A 1FNMA 1X9WA 3PHEA 3MN8A 4GO5X 1F1BB 2PA8D 4BHQA 1IKWA 1PJ5A 3GY9A 3B82A 1D8YA 3BGRA 3C26A 3BYPA 3FVYA 4M5GA 4RW4B 2ZH7A 3N6MA 1WHVA 4OJHA 4Y3CA 2PC6A 4L89A 1S77D 1HNVA 4ZVOB 5LMNF 1KR4A 4WKRA 3BXMA 2E7WA 2CFXA 3FBUA 2CPFA 5KFUA 4KTQA 5CZVA 4MY0A 2AV5A 3NOGA 1FKPB 2VZ9A 2LXUA 1IY7A 5IV3A 3OJUA 2OHDA 1WC1A 3PY8A 2YWKA 2DGWA 2HMIA 2DK2A 3WQPA 3OVAA 3TO8A 1TL3B 4P4FA 2XMKA 1KWMA 4OHZA 5HH1A 1RAFB 4MHYA 2BABA 3FBFA 3HHLD 3GLJA 2AHOB 2DIUA 4CNZA 5LJ3Y 1HR0F 1JLBA 4ID5A 1T11A 2B3UA 5AXMA 4X66J 1WUUA 1H72C 1SH0A 4K2JA 4NGQA 1BOBA 1EJ7L 4C7QA 4ZVQB 5B0AA 2GJFA 5DG8A 2CPEA 4AQYF 2ZOMA 3MAAA 3FEDA 2HAFA 2IY5B 1R0AA 3EFAA 4AVAA 2R7QA 3DRPA 3PX4A 4WF9Q 4PPDA 1HEEA 2C2EA 1FWKA 1L3TA 3G4SS 4QR2A 2VKZG 4ZKAA 2HLTA 4J9LA 2KG1A 3T8WA 1HYSA 2Z2ZA 3HSZA 1VRUA 4OC3A 3FIXA 1IUJA 2XSJB 2J9DA 4DUTA 1M1GA 1MJ9A 3Q22A 3C6TB 4B3RF 4LSZB 3ZC4A 1FNXH 3RO0A 2G9OA 4OI0A 3D68A 4MFBA 2OH1A 4K5SA 1WC0A 1XR6A 3GYGA 4OYAA 1D1UA 4UFWA 3DKDA 2HVHA 4PPZA 2HHPA 5AJ3F 3W8PA 1FRMA 1LCPA 5D0EA 1L3UA 1ARLA 4MK7A 1GMWA 2BOAA 1XC9A 1RAHB 2BO9A 2GNKA 2Z2MA 3GV5B 4B17A 3LQVA 2XEXA 2VA3A 2GQQA 4E2AA 2J9AA 5IB9A 3K5LA 1F9FA 1MN7A 3AQOA 3MMAB 4F4KA 1TL7B 1LK7A 5DDOC 2IJNA 5HI7A 1UVIA 1ULRA 4KFBB 3S6HA 1MJBA 1NMTA 3CCMS 3HDSA 1P27B 2UUBJ 2BEIA 1NSAA 4PQUA 2FLLA 1WI6A 4ZVEA 4IG3A 1V3SA 3FFIB 5C25A 4N7TA 2YNFA 4M5DA 3H90A 2B58A 1HD1A 3ISND 3A13A 3HLUA 4A39A 4NZ7A 5G4DA 3MCOA 2J5AA 4ES1A 1HNXF 1CBXA 2RC4A 5BR8J 5HMZA 4NGPA 3D54A 4WK3A 2CTCA 2R2RA 1XIQA 4H4KA 3IRXA 3R7SB 3UVJB 3CCTA 2AYEA 2PGCA 4FN5A 4B3MF 4JI1J 7CPAA 3KK2A 4ZCIA 2Z56B 1YR0A 3R7NB 2CIMA 3CCRS 3R95A 4RS2A 5L9XA 2DHSA 4ONUA 3N28A 2G2ZA 3D6TB 3B3CA 3QLHA 3M30B 4DYOA 3FMCA 2AFOA 2YQ1A 1TV6B 4KGKA 4M5JA 3RBUA 4QYZK 4YUDA 1FJ7A 3IU2A 1FD2A 2BMBA 2DR6A 3IGRA 1XRYA 2YKMB 2W9CB 1EZZB 1TKDA 2OMOA 2UU9F 5C24B 4UY8T 3D8PA 4L8AA 4UUWA 4FVMA 1BHNA 3CJ5A 5HQ8A 4DL0C 3FQKA 2QECA 2Y8YA 2RDJA 3ILLA 2ZEHA 3L4BC 1DTTB 2JWNA 2GANA 1HBNB 3M2UB 4EO8A 1V3RA 4M95A 1FDDA 4JZ0A 3R7BB 2RKIA 3L2NA 4MCSA 2ZH5A 4X64J 4ZJLA 4ZYQA 4PWDB 1KRPA 3MR2A 3FDSA 4OZ1A 1P9QC 2MQ8A 2ARHA 1VHIA 1IBLJ 2VA2A 2XLJA 3QO9B 2BEFA 2OTLS 3SMZA 2BE9B 4KSEB 4ZP7A 3AA8A 2W2MP 2GA7A 4M1KA 4JUZA 4KOXA 1E6VB 2RUSA 1X4GA 2KO1A 3LPEA 1B4SA 1LXNA 4X3RA 4NCGA 1KDNA 3T5HA 3IWNC 3H59A 4NGNA 4CO1A 3N5FA 5KT5A 3D1QA 3GSIA 1WF0A 3B4MA 2RMLA 4KOUA 1N33F 3CCJS 1J5OA 2RD5C 1SKSA 3LA0A 1R8HA 2G1DA 2HBRB 3PYGA 5LYDA 4H2KA 3NBPB 4IFYB 1IVZA 1QSRA 2VC0A 1T02A 2MKCA 4ZBGA 2PCUA 4DUYJ 2PRQA 3G8TA 1HI0P 2PD1A 2XMMA 4NLQA 4KVME 1F2OA 5F8NA 1YBTA 1TP7A 1IR1A 1FJGJ 1TVRB 4HPSA 3SCJE 1VFJA 3BI0A 2D3UA 1RISA 3FRYA 4TN2A 1JLGA 4J9RA 3DLEB 3MPWA 3O1LA 1VQSA 1Q8LA 1KQFB 4I4BA 2IVYA 3EGZA 4DR5J 4M6IA 3EO4A 2MQQA 3A3OB 4LF7J 1NDPA 3M8SA 3W65A 2VQEJ 4Y2KA 1Y00A 3O8WA 1S12A 3SJXA 3UFCX 3UD3P 2OOTA 3ZFVA 2AYBA 4UCPA 4DV6F 3FJUA 1J5EJ 4DL5A 4H4OA 3PX0A 3R9EA 1RB0A 3Q8UA 3BBCA 2OEMA 4D3GA 4HL9A 4OX6A 4RNFA 4EMDA 1XFOA 2MHNA 1X4HA 2D69A 3MR5A 2IJRA 3BN4A 3TUPA 2R8KA 4MAKA 2XZDB 1HQEB 3BKUA 3FXTA 3BDPA 5HBMA 1SJQA 1ZG7A 3K8VA 2IHR1 7FDRA 4ILLA 1HWLA 1UKUA 1UL3A 2WW4A 3BO4A 4PK3A 4NYOA 2E9RX 1YJ7A 4HVZA 4QUSA 5GMKa 3UWTA 3KLEB 3WIVA 1B3TA 5D15A 3S9MA 4ETXA 2RE1A 1NZ8A 2R7UA 4ZCKA 4MFPA 2VOOA 3S6GA 3KI9A 1UA0A 3LD2A 1S9GA 2D74B 5KT2A 1BQNB 3G87A 3H2UB 5ETSA 5KFDA 4FYVB 2LDIA 5LRGA 3K9UA 1A2ZA 1TKFA 4ZDNA 3D28A 3FC9A 2PJ9A 4DR2F 4DR4F 3DGPA 4PABA 2YNCA 4U8VA 5D6GA 3JS9A 5H9FK 3A8JA 2JX2A 2HNDA 2AFUA 1DQAA 3R6LB 4O3PA 3JTPA 3O3LA 3U27A 5I3PA 3Q8VA 2BOPA 3VGTA 2PJ6A 3HVWA 1H0HB 1FX4A 4I56A 4GKJJ 1YJNS 2OB0A 3GKRA 1JNRB 4MHZA 2XMVA 2B6AB 3GFZA 4WFXA 3J81Y 3NWGA 4ED8A 1ZAXA 4QYZJ 2XI2A 2MJUA 3N5BA 3IGVA 1E6YB 1OYEA 3LO3A 1WKJA 3I87A 3OHBA 4UBRA 2XTJP 4DU7A 1S6PB 4PR6A 3SDEA 1KQGB 1CS4A 4IAVA 2DH7A 1X5PA 4EI2A 5KG3A 2VFRA 2DISA 2DY9A 3R1KA 1ZA2B 3GYXB 1VQOS 4GKKF 1FXRA 1FA0A 2NSBA 3JAMU 1YBUA 4NLRA 4LFBF 2Y0MA 2VL1A 3SQGA 2LEBA 3QGGA 2RHSB 2U1AA 1S1WA 3R9LA 4DV5F 2DNPA 2VJUA 4ZPAA 4CLZA 5J1EA 1NSKL 1M1DA 2CQ2A 4IOCQ 1RAGB 4CCHA 2WB1D 1Z2LA 1TK5A 3ZTSA 2FD2A 4M5LA 4C2ZA 1S79A 1TK8A 4IUFA 3CULA 1RT1A 2ZH4A 4R8UA 1F2HA 2CNOB 5AG4A 4USMA 3C6UB 1CC8A 1RTJB 3BBBA 1F3FA 1SL0A 2JOQA 2WSAA 3CDAA 1HBOA 3KLFA 2GGPA 2W7AA 5CYQB 3VGUA 3H98A 2B4DB 2OD4A 4DV4J 1T0TV 2KVQE 3KLGA 3QIDA 2C3OA 4P4DA 4HH1A 4II9A 1LW2B 3M2VA 4CLUA 3THVA 3W3SA 2YNGA 1S9EA 2XEIA 2Q44A 4DQRA 1BWVA 3IR7B 5GMEA 3OTCA 2FJAB 4C0BA 4IRDA 2XMJA 1S10A 5K8OA 3BJ7A 4O44B 3OLAA 5EHHA 3U7JA 2CJ9A 2WRMA 4LRBA 5F9LA 3PX6A 4KUAA 4DFJA 2AD9A 2MLZA 1N5VA 1H98A 3KJQB 3DRSB 2B9EA 2DY1A 1JIHA 3V4IA 2RFHA 1C4AA 4K0KJ 4Q2LA 2JBKA 2OPSA 4MTPA 4X5KA 1IN0A 4DFMA 5D8HB 4KOYA 4MKBA 3NEKA 1NPPA 3LF0A 4U9ZA 1N5YB 1M4IA 1FDAA 3H5ZA 4KHPF 4UQTA 5C82A 1QE1B 1R8AA 2DGQA 2DTJA 3EVWA 4JLYA 2FPHX 4U95A 4DQSA 3TAPA 3RAMA 4XPLA 3BO2A 1UPMB 2AX1A 3MOZA 4J90A 4DN9A 2G2YA 4JJXA 4OC2A 4QWCA 4C6AA 4WYWA 2MMYA 3TW0A 2O3DA 2WCXA 2XNRA 1TF9A 1ACMB 4JI7F 1RHJB 2OSQA 4HACB 5A76A 3V81A 3BGLA 4RU2A 1GEHA 4Q2MA 3K2YA 2K2PA 4PAAA 4JI6F 2RQCA 5G1ZA 7AT1B 1VI7A 1FX2A 4LUBA 3NCQA 2JC1A 3CCQS 4KOTA 1X4FA 3WX8A 5J2MB 4FAIA 3JQJA 2C2MB 4CH7A 4B3OA 3PEHA 2ZJRQ 2IYGA 3B8GA 3CD5A 3TA2A 4CWBA 2KVIA 3MEGB 3BQ2A 4OMEA 1NHUA 2DGUA 3IWLA 4BBYA 3UR0A 2JZ5A 1S1VB 4LSLB 4KLWA 3GIRA 1VQ5S 2KCWA 3FRZA 4A31A 2CQ3A 3V4MA 3TUJC 5EX0A 2E1AA 3QGIA 2ALYB 2AFZA 4JI5F 3K9TA 1VK3A 2PEHA 4FXDA 2EFVA 3EXNA 4WYLA 1RT4B 4RN7A 1JXLA 4MHNA 1HARA 3RRKA 2E5IA 4R5PA 2MZQA 2HNYA 5H9FJ 2MQMA 2QFIA 1S1TB 2DITA 2VFSA 1FXDA 4ECZA 5KFMA 2AGOA 5CH7B 1WWHA 3G71S 1U1NA 2LQJA 3QJJA 2HUZA 5GMDA 3ISNC 2HKEA 2P6GA 4C8MA 4L76A 3PCOB 2HS4A 3K58A 1S99A 4ZHRA 2H9ZA 2ZJQQ 5EBVA 2F4VJ 1UFWA 2CZ9A 3QGHA 7FD1A 3ETMA 3R6GB 1VQPS 3FBBA 1O51A 3GONA 1NSQA 2VBQA 3MWBA 4HTJA 1MU2A 4DBQA 3BSCA 4EK2A 3K59A 2A3JA 4FD4A 2AEMA 3VAGA 2D41A 1S7HA 3FK4A 3W7BA 3G2XA 1WORA 3MI7X 3T19A 5KT7A 3ZZOA 3TUIC 5EN1A 5A6WA 2Z3KA 2YPYA 3TVZA 5JVHQ 2WVCA 1SPBP 2Q51A 4MIBA 2GIRA 2BJ8A 3IR6B 1OY8A 1KBRA 3SYZA 3W2WA 3QSYB 2GHWA 3DNCA 3BQ1A 3S1TA 4WPAA 4DV7J 3MURP 4OYIA 1CULB 5D4LA 4O3OA 1EKRA 4TY9A 2PI4A 3DRRB 1QY7A 2D4OA 1DHMA 3CJ8A 3EPGA 1CJKB 4DQPA 5LSLA 4G1QA 4KOSA 5I42A 1TL5A 1B6BA 2W2OP 3D9BA 2D4PA 2P6TA 1X60A 4JXQA 1CC7A 1FKOB 3MHYA 2KZZA 4ZLNA 3KK1B 4WJBA 5HP1B 1Y9OA 1ZTTA 3WC7A 4RPFA 3PO4A 4LX9A 3UNYA 2ZOFA 3JQKA 4KIAA 2UXBF 2VIHA 3Q0AA 3BEGB 1EETB 2YH0A 2CNMA 4LF6J 4JV5J 4P4JA 3OL9A 4YQWA 2EVZA 2CTBA 3NAHA 4I6AA 2PMHA 2LXIA 2Q04A 3RYOA 2QLFB 2IL4A 4RW7B 3MEEB 3EM1A 2GQCA 4DUZJ 5GVQA 1Y10A 3M8PA 1ZA1B 4EUVA 3NA6A 1CEZA 1UWYA 2PJ1A 2QJ3A 2RH3A 4ZP8A 4CO5A 3MPYA 2R7XA 4B3SJ 4X8IA 4UCNA 4HDGA 2XCPA 1RBLA 1UWBB 2J8NA 3SSQA 1U26A 2P2CB 4KPCA 4NLOA 4G3IA 1NM2A 2OSRA 3PRVA 4DNCA 4IRKA 3W60A 2GO8A 5I3UB 3LACA 5FJ4A 1JXVA 3WR7A 2QYCA 2CIJA 2HW3A 2EFOA 4B9NA 2M8DB 4MFKA 4MJKA 2ACMA 4OADA 4DL6A 2FGOA 3WC6A 3BH6B 3KJNB 4RNNA 3HCXA 2JJ4D 4HKQA 2AP6A 1JWWA 3HT0A 5A28A 2BVZA 5IT0A 4F2SA 2HNZB 1YRXA 4Z7YA 4UEEA 3MM5B 4FDFA 2HIYA 3TZZA 3MMBA 2LECA 5E7OB 3ITHB 1IKVA 3U1MA 3TZXA 4U67Q 5KFTA 2I5JA 4FD7A 2EK6A 2FUG9 2RIJA 2M0GB 5M2RA 3M05A 3VALA 2E9TA 1XIXA 4YU9A 1TL7A 4ZY2A 5CPAA 3H5SA 3NH4A 1IIDA 5DGBA 2OPQA 5C2GA 2V2VA 3AD9C 3H5UA 4FD6A 4I2PB 3D4UA 2QGFB 4IFVA 4DOZA 3PKMA 2AZ1A 1RU1A 3OVBA 1Q7YT 1PSDA 2K1RA 1IBKF 2AJ6A 1N52B 3CJTA 3CCSS 3D6MB 1OY6A 5CYMB 3HPOA 3HUVA 2L3MA 3RAQA 1TTHB 3B3TA 1ITPA 3JTKA 2CPXA 3MM6A 1RWNB 4ZK7M 3DLKA 2FXFA 1FTCA 4BWMA 3WZ0A 4OC1A 3OHAA 1KVIA 4M8LA 1YKWA 2K8GA 2CQ1A 3QBCA 1N71A 3VZIA 1DBDA 2V8DA 4ZMMA 3QSIA 1H38A 1RP5A 2YWHA 4C9DA 1RT5B 5T41A 2BJ3A 2ZWOA 2LU1A 5JQ4A 3JQMA 2A1BA 3KJVB 1TKXB 5BYQA 1JMTA 4F3MA 1RLDA 1SJ3P 2HBQB 3LWMA 4A4JA 5F8HA 1NH8A 3VCDA 5BJRA 4XDDA 3I6PA 4PXBA 3A8KA 2BX6A 1UJ5A 5CHCB 3H2LA 1NK0A 1C0TB 2FQQB 3OFGA 4DPYA 1FERA 2J8RA 1X4EA 3KR5A 1M5HA 4B6ZA 4ECVA 2J0XA 5CQGA 3LALA 2X51A 3LP2A 5J2NB 1U0SA 1CJUA 1MW7A 3PJ9A 2QA4S 5GAHI 3M2UA 1MWZA 1VOMA 1LWFB 2QO3A 1R7IA 1JJHA 3MCNA 1M5SA 3VARA 4TY8A 2Q79A 1JJCB 4LF9F 5A8KB 5A8RA 4PWDA 4I0WA 3PBBA 2GMHA 1S6QA 3N6LA 4YN3B 2YX7A 2XSFA 1JLCA 3PFOA 5ETVA 2O53A 2MZSA 2CJBA 5AE2A 4LMZA 1BWEA 1S59A 4L75A 3PNIA 5I4MA 4RZRA 1V0CA 1U1RA 1GX5A 3Q8RB 3DM2A 4DR1F 1HNIB 3KUHA 5IC4B 2XGQA 4X2TA 3FJ2A 3IU1A 3B6BA 2VQFF 5K14B 1S6OA 3EDQB 5ETOA 2Q7BA 4I7FA 3ZTQA 2FTRA 3J80Y 3CUNA 1SQEA 5DWNA 4QR1A 3RB4A 4MKAA 4E0AA 1TUVA 3ZZYA 3UCGA 2VOPA 1RT3A 4NI2B 3KK3A 2HGNA 1ON0A 4Y2CA 4YP3A 3I0SA 3DOLB 3P49B 2GIQA 2M2BA 1IB1E 5THWA 3DOMB 1FT8A 3HF5A 4CTAB 3ONQA 2EFNA 2NCKL 3V38A 2YQ3A 2IM2A 2PVVA 4DPWA 1B0VA 3FEYB 1N8RT 2LCWA 3DYAA 4JI8J 2I38A 3QRRA 4IOBA 1D0EA 2FHJA 4I6YA 2HG4A 4KBIA 1HNXJ 3C3LA 3CDWA 2DPSA 5L39A 2RRNA 5BWAB 5EWGA 1U8WA 3BPDA 4ES2A 4B08A 2OZHA 2CQHA 1T9UA 3HHKA 1BMQB 4DPTA 2EBEA 4B3MJ 3QGPA 2IYIA 5KOWA 4FUUA 4J9SA 1M4GA 3TFYA 4MYTA 1OJ4A 3BKTA 3PEIA 3ISZA 3MPDA 2XYHB 3GU0A 1L3VA 2PJBA 2VG5B 3NNAA 4NGSA 2OR4A <