4G1PA

Structural and mechanistic basis of substrate recognition by novel di-peptidase dug1p from saccharomyces cerevisiae
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
480
structure length
479
Chain Sequence
MSHSLTSVFQKIDSLKPQFFSRLTKAIQIPAVSSDESLRSKVFDKAKFISEQLSQSGFHDIKMVDLGIQPPPSTPNLSLPPVILSRFGSDPSKKTVLVYGHYDVQPAQLEDGWDTEPFKLVIDEAKGIMKGRGVTDDTGPLLSWINVVDAFKASGQEFPVNLVTCFEGMEESGSLKLDELIKKEANGYFKGVDAVCISDNYWLGTKKPVLTYGLRGCNYYQTIIEGPSADLHSGIFGGVVAEPMIDLMQVLGSLVDSKGKILIDGIDEMVAPLTEKEKALYKDIEFSVEELNAATGSKTSLYDKKEDILMHRWRYPSLSIHGVEGAFSAQGAKTVIPAKVFGKFSIRTVPDMDSEKLTSLVQKHCDAKFKSLNSPNKCRTELIHDGAYWVSDPFNAQFTAAKKATKLVYGVDPDFTREGGSIPITLTFQDALNTSVLLLPMGRGDDGAHSINEKLDISNFVGGMKTMAAYLQYYSESPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Basis of Substrate Recognition by Novel Di-peptidase Dug1p From Saccromyces cerevesiae
rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Cys-Gly metallodipeptidase DUG1
total genus 144
structure length 479
sequence length 480
ec nomenclature ec 3.4.13.-:
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1pA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4g1pA01
3SJXA 5CPAA 5I4MA 6CPAA 2ZEFA 3RBUA 4TWEA 4RUHA 2ZEDA 2PJBA 3FMCA 4MCQA 4A39A 2PJ1A 3KQZA 1QQ9A 1Z5RA 4P4EA 4A38A 3V38A 1FT7A 3BXMA 3B3WA 2BO9A 3KHXA 5JH9A 2NYQA 3T8WA 4OC1A 2ZELA 2HB6A 5LYDA 4PXBA 1TXRA 5LYLA 3B3TA 1XMBA 3LMSA 3CPXA 2V8DA 4OC4A 3QNVA 1TF9A 2ZEGA 4X2TA 5LYIA 2PJ3A 3NH5A 3KI9A 3H8FA 5J1QA 5LRGA 3CT9A 2EWBA 4MXUA 3KGQA 1CP7A 4UF4A 1HDUA 1RTQA 5K8MA 1VHOA 2O4HA 2OR4A 2AFXA 3SI1A 4MHZA 4F8ZA 1CPSA 2F7VA 4ZYQA 2PVVA 4WJBA 3SJGA 4MHNA 1XRYA 2PVWA 2IJZA 4P10A 4EMEA 1BAVA 1R43A 4DJLA 3IWWA 5THWA 5HXDA 5IB9A 4NJRA 4AXVA 1LCPA 5DS0A 4OKOA 3FEDA 1VHEA 1LAMA 2BOAA 3S9MA 4WWVA 3KL9A 4P4BA 1DE4C 3D66A 4BD9A 3PBEA 3KZWA 4YWYA 1H8LA 2PRQA 1TKHA 4NGQA 3B2YA 3D68A 4MCSA 4P6YA 1JQGA 2XEGA 4DUKA 2PJAA 3FECA 4NGPA 1AMPA 1BPMA 1BPNA 3KR5A 1Q7LA 2GLJA 3D7GA 4FWUA 3CPAA 4X3RA 3GLJA 5JGFA 1YW6A 4F9UA 3PB4X 4NFRA 2PCUA 2AFSA 3FX6A 2IQ6A 2PJ0A 1ZLHA 2CIJA 2ZENA 3WC7A 1Z2LA 1ZLIA 4UIBA 1UWYA 4ZI6A 2EK8A 4MCRA 4A37A 2GREA 4UEZA 1TF8A 5D29A 2CF4A 2C6CA 1LANA 2PJ7A 3IC1A 3ISZA 4Q7AA 2NSMA 3D7HA 3V7ZA 5HVGA 3S9NA 3DGVA 3IEHA 3L2NA 1EE3P 2GLFA 2QVPA 2AFOA 3FH4A 3D4UA 4FBEA 2F8HA 4OC5A 5K8PA 3B3SA 4PXDA 2ZEOA 3B3CA 3NH4A 2FVGA 1ARMA 1F2OA 1YMEA 3IIBA 4OC0A 1ELLP 1XJOA 1CX8A 3D7FA 2ZEEA 2PIZA 3S9LA 2ABZA 3FVLA 3BI1A 4TNUA 1F2PA 4IHMA 3KHZA 2PJ6A 4MMOA 4PQAA 3PFEA 2PJ5A 4OC3A 4NJQA 1CPXA 3FJUA 3B35A 1Y0RA 1ARLA 2JEWA 5HVHA 4PPZA 3KQXA 3JRUA 1PCAA 2RB7A 1PYTB 4DYOA 2HC9A 4LQGA 3TC8A 2JBKA 1HDQA 4MCPA 3D67A 2CTCA 3MRUA 1CG2A 1XFOA 4JZ0A 4R6TA 4G1PA 4OMEA 5D8NA 2V8GA 5JM6A 4NGSA 1YW4A 2BCOA 1TKFA 2DEAA 4FUUA 4ZX8A 1Y7EA 3WABA 1F57A 3D7DA 1GYTA 2QYVA 4YU9A 3KASA 4OIWA 1TKJA 3N5FA 4R8FA 2PJ9A 4UEFA 1CP6A 3K9TA 4R7MA 2G9DA 1FNOA 3VARA 2ZOFA 1XBUA 3RZAA 1ZG9A 3B7IA 2WZNA 4EWTA 3VH9A 3MN8A 3FEEA 4P45A 3H8EA 5K8OA 1Y0YA 2V8VA 2XEIA 3CDXA 1LOKA 4KSIA 3BI0A 4NGMA 4ZY2A 2EK9A 1M4LA 3PBBA 1NSAA 2ZEMA 1IY7A 5ELYA 4ZX9A 2PJ2A 3HUVA 3KR4A 5LYFA 2OOTA 4K3NA 2C1CA 4IAVA 3H8GA 4Z65A 1LAPA 2PJCA 5LRKA 4O23A 4R76A 2PE3A 3WT4A 5CBMA 2XEFA 3SJEA 4NGRA 4FAIA 1ZG7A 1DTDA 7CPAA 3GUXA 3I1UA 2AFUA 2VL1A 3PFOA 1ELMP 2Q51A 4PXCA 3RAMA 2Q4ZA 2CTBA 3WC5A 3WC6A 2C6GA 3NH8A 2V8HA 4GM5A 3SI2A 4ZY1A 3VATA 1KWMA 4W9YA 4ONWA 2POKA 2O53A 3PB6X 3GB0A 2PJ8A 4OC2A 4P4DA 4ZY0A 2JBJA 2PIYA 3IJ3A 2ZOGA 3B3VA 1VGYA 3NA6A 4PXEA 2AFZA 2ZEPA 3SI0A 1AYEA 4OIDA 1R3NA 2PJ4A 1LFWA 4MHYA 4NGNA 3K2KA 3PB8X 4JYWA 5K8NA 3BHXA 4X8IA 3PB7X 2WYRA 3NFZA 5LRJA 3PEIA 1CBXA 4P4IA 4CPAA 1BLLE 4OP4A 4IK2A 1IGBA 4P4JA 8CPAA 1OBRA 1QMUA 4NGTA 2GU2A 3SJFA 3TX8A 2RFHA 2V77A 2AFWA 5F09A 1HEEA 3PB9X 3IFEA 3HLPA 3DLJA 3IO1A 2AFMA 4P44A 3LWUA 2Q43A 1Z8LA 4UIAA 4B6ZA 4F9VA 2IMOA 3PRTA 5HVFA 2QJ8A 1ZG8A 2C6PA 4P4FA 2I3CA 4UEEA 4MRIA 2ANPA 1VIXA 3FF3A 2XEJA 3ISXA 4A94A 2ZEHA 4EFDA 1YSJA 4MHPA 1YLOA 4H2KA 2J9AA
chains in the Genus database with same CATH superfamily
3PNIA 3KJQB 4N8NA 4JI4F 4IKAA 3MURP 3CZXA 1P27B 1RAJA 3PX4A 4DR1F 2P9EA 4AT1B 3GQCA 3W2WA 2ZH8A 4RUCA 4B3SF 4HR2A 2E66A 1W26A 3LP0A 2C22A 2REFA 3CDAA 5M2RA 2AYBA 3DDDA 2JVRA 1LFPA 4NMLA 1HQEA 2PEHA 3ISND 2Z30B 2R2UA 3CJSA 3UDVA 3ITHB 4MAKA 2CPDA 3PX6A 3TFYA 4ZITA 4Q43A 1MMLA 4MXUA 4DL6A 4JYAF 4YOEA 1X9MA 4TQRA 2ZZNA 4DL5A 4DN9A 3BBBA 3LQVA 2RH3A 5K8MA 2AGPA 1VHOA 2AZ1A 1LKZA 1NJIT 2LA4A 2JEGA 4JI5J 3M1VB 4W90B 2VODA 4OI4A 4CO5A 1RAAB 1S1WA 2YX1A 1Z4RA 1SI9A 2Q1LA 2UUTA 3V6DA 4QB9A 4G1IA 5DJBA 3AFGA 1BLUA 1MK4A 4KOSA 3RAQA 4DF4A 1FWPA 2KXNB 2BACA 4OKOA 4X65F 1KQFB 2GW8A 2HPUA 3PM9A 2O5DA 4WWVA 2W4DA 1OSDA 3PJWA 3VZIA 3RGIA 1KVKA 3KG4A 4I1TA 1X4BA 2J76E 3CTRA 4QQBA 4DUZJ 1PILA 4DS4A 1K4JA 5KT7A 5A6WA 2V6AA 2ASDA 3I56S 2BM1A 4CGMA 3RU0A 4CYUB 3SXOA 3IGRA 4XDCA 3DXSX 4RUBA 1YREA 1AUDA 2JEVA 3BDPA 4USTA 4FF3A 3BQ2A 4X4QA 3OXGA 3J81j 5LT5A 1Y3KA 2AT1B 3QYYA 4Y49C 5IC4B 4D3HA 4LSNB 3Q8SB 4CNYA 4DU7A 5KG3A 5KG2A 3S9NA 3NWGA 4OHZA 4J9UE 3ISNC 1RTHB 4EBCA 2FZKB 4J9PA 3VAMA 3D0GE 4GVBB 5BJRA 1X5SA 4LFBF 1B87A 4LFBJ 4P75A 1X4EA 4B3MJ 1NK0A 1RTIB 4OLOA 4JI8J 1GK8A 4OI3A 3NE7A 1RI7A 3BEGB 4F0MA 1VC0A 2Q4YA 2ZEEA 4X84A 3NGKA 5HMZA 3D5MA 2CNSA 2J6UA 3KHZA 1HBNB 4IFYB 1HWUA 4DQQA 2G1HA 1ELOA 2EFPA 2J0QD 4LF6F 3KJNB 4TU8A 1ON0A 1N36F 1FVQA 4DBQA 2NREA 2H4YB 2RC4A 1QSLA 1PYTB 1ACMB 5C42A 3TW0A 4J9NA 1PBUA 3SXLA 4O4GA 3D67A 2FHMA 3D6HB 1T9TA 2IRYA 3SI8A 1QE1A 1UA0A 1U24A 3X1LB 1QY7A 3HHLB 4GKJF 2M4MA 4H4KC 3H20A 2ZKUA 4U9ZA 4UBRA 1QUPA 3I5AA 1DAXA 1S1XB 5E3QA 2G9DA 4AXJA 2DGXA 2XMUA 3QT8A 1S57A 1UJ4A 3HPOA 1KOHA 3KNGA 2VJUA 3J7Z5 2E1RA 3MD3A 5L46A 5J2MB 4CLLA 1M5HA 4OLPA 4NGMA 4X64J 2YNFB 3KTQA 2Z3PA 1CJTA 2MTLA 3I0RA 2FIUA 2P5VA 3S8SA 4ZHRB 1BE4A 1Z4EA 4M6IA 4Z7YA 2HMIB 1KZFA 1S0OA 3EPIA 3W9IA 1P6TA 4Q44A 2D3UA 3WT4A 1TV6A 2OPRB 1QLNA 3CJQA 2K8GA 3K7RA 5L9NA 1NZ8A 4ATNA 1X5OA 3QMQA 2OD4A 1VQ9S 3V4IB 2QYGA 2VL1A 3PFOA 1N5QA 4PG6A 3O44A 3IBFB 3DLLQ 4P7VA 2AYGA 4OYAA 4K7QA 3RW6A 2W7PA 3MHYA 4KGXB 5F3TA 4KPYA 2O53A 2PSWA 4TYAA 1UZHA 2UVVA 4ZY0A 2B6AA 1VGYA 3PO4A 2Z2MA 3WZ0A 4BBHA 4J9OA 2HWHA 1U45A 4KFBB 2GVZB 3MUVP 2DY9A 2W8LA 1VLYA 1P4NA 1VK8A 3S6EA 1FKPB 4U6PA 2LQ9A 2V2QA 2GMLA 3SCIE 1VQMS 4DLEA 5F3ZA 1IGBA 3G6XA 3DI6B 5KFEA 4YQWA 2DEIA 5HO4A 2Q66A 1WELA 2AFWA 3L95X 3HLPA 2GIFA 5MAOA 5L1IA 4XPDC 2E5LJ 5D3GB 3IRXA 2EWHA 2L3MA 2FJAB 3FRZA 3PRTA 1C0TB 2Q04A 2EBJA 2AQ4A 3CJKB 4PQUB 4ZVRB 4UEEA 2BDPA 2G0CA 4ZS6A 3FF3A 3ELHA 2DNHA 5D4PA 5KTAA 1MROA 2G9OA 4EFDA 3DU5A 3CNQP 1IM6A 4BCAA 1RT7B 2DH7A 3D7SB 3HFVA 3NEKA 3ICLA 4DF8A 4BWJA 4CAVA 2EBGA 1U1PA 1T9WA 1RAHB 1Y9WA 1N5TA 1Q1KA 3M2UB 2V0NA 2DR9A 3DRPB 3SSRA 2AEMA 4LSNA 3KQZA 4PAAA 2BOPA 2JX2A 2DHSA 2HNDA 4ED3A 3OVSA 2VB6A 3JSYA 5DZ6A 2BO9A 2X1BA 2KH9A 3WHIA 1OQ6A 3PJXA 1U49A 1GMVA 4OC1A 3PKYA 2KJVA 3G8SA 5CNPA 2XLIA 3TO6A 2E9ZA 2ZEGA 5C2CA 3S6FA 5LRGA 2EWBA 1HBMA 5HMYA 4EGLA 1PAEX 2HRYA 3M7VA 2C3UA 2A0FB 5E7OB 3QSIA 2Y0MA 4WFBQ 1AB8A 2ARHA 2O4HA 5DG7A 2GO8A 1FESA 4DV0F 4MFPA 2B4UA 4CH0S 3P5TL 5CZXA 1NSQA 1PG5B 2GHWA 3ETMA 3TJAA 4X4NA 4EEYA 3P49B 1R43A 5KG0A 4DJLA 5THWA 3QZ8A 1HHTP 3SXNA 3HD2A 3FSXA 3R6LB 4U8YA 2IYIA 1U8SA 2V9WA 4HT7A 3FEDA 1M0SA 3JUWA 3HXMA 1I3OB 1NU4A 2CQDA 5IM0B 2HSEB 5JXSA 3OBIA 4DR2J 2V2KA 1VBYA 4NGQA 2HHPA 4RW6A 1RT6A 3HX9A 4YMEA 1AMPA 3JS9A 3KR5A 1Q7LA 3MPUB 4LF4J 1N88A 3I0SB 4B3MF 1HBOB 3KKFA 2WVDA 1B6BA 4KS9A 2CIJA 4DPYA 1PIEA 4HI1A 2YKMA 3C26A 4ZPAA 2B6AB 3SCKE 2XULA 3HHKA 3BJ8A 2EK8A 3BV8A 5BYRA 3LGMA 3V4IA 4RPFA 2BRLA 4B12A 3M6XA 2QVPA 5AE3A 1SH0A 4OC5A 1RLCL 3PKMA 1L5UA 1SJ4P 4GS4A 2VONA 3H42A 4ZJQA 2KO1A 4DPOA 4Y2IA 4Y00A 2MJUA 1HI1A 1HBUB 3DC2A 3TAPA 3GFHA 1CLFA 4Q0BB 1NDKA 4OC3A 4X4SA 2JLEA 4OZNA 2D7SA 4ZCIA 3M30B 5GAEI 2BJ1A 4CDIA 4P71A 4AL6A 1MJ9A 2MZTA 3D8PA 3AJDA 1TKDA 3TC8A 1WF2A 1TKTB 4JZ0A 2W2OP 3DLGA 1HIYA 1S6PB 2U1AA 4MFZA 1DY3A 1FX2A 3CCRS 3TZWA 2QYVA 1NSKL 3MUTP 3NLCA 4R8FA 2KM8C 1IIDA 3UVJA 1KLNA 3MGDA 1FNOA 4DPXA 3BPDA 2YNCA 1REGX 4WFYA 5F8GA 1Y5NB 1ZTTA 2VBQA 1O6XA 2DD8S 2ZBPA 3ENWA 4ZN3A 1M90T 4DL7A 3FEEA 2QFJA 3NAIA 5EX3A 1ZPWX 4MIBA 2VKRA 2YKPA 1S0VA 4ZX9A 1O8BA 1S6OA 2Z57B 4KOXA 2XSJB 3MECA 4KGMA 3R1KA 1U1QA 4DCJB 5HK4A 1KQSR 4HACB 2B43A 1LAPA 2HAIA 4DV1F 4IOBA 2AJ6A 2IMWP 1C1CB 3PG9A 4USUA 2B8QA 1GTHA 2RQMA 4OJGA 3WX4A 4CM2A 4NPOA 4YR2A 4ZVGA 4NRTA 1EKSA 3B54A 2Z8QA 2CQ1A 4TN2A 4UOGA 4DSLA 1SUQA 3R5BA 2GQ2A 1Y4ZB 1NK6A 5F46A 3FBEA 4IFYA 1BC6A 3WX8A 1H7XA 3A8IA 3I6PA 4NI2B 2EG2A 4DZ6A 4CAWA 1R3NA 3AXKA 1D9FA 1LFWA 5H84A 3GWCA 5GCNA 4JV5F 1TK0A 2VBWA 4PSWA 4JYWA 4I69A 4I6AA 3BHXA 5IT9U 1LWXA 5J1EB 2BBEA 4HHJA 2MKKA 2YNGB 4CH7A 3LTOA 8CPAA 4DSIA 1TELA 3THTA 2GVZA 3ZZPA 1RSCA 2PQ8A 3PB9X 4DV6J 3CJ4A 3LWUA 3E51A 5CXTA 3LP1B 4M5JA 2B5JB 1UMJA 2EXUA 1GMUA 2WBMA 4RUAA 2Z3OA 1P8GA 1RT3A 4JI8F 2BKNA 3L7UA 1HBOA 3M4XA 3BO4A 4MHPA 1V3RA 2J9AA 3R7NB 2GA7A 1TMMA 1UPPA 1UPMB 1JB0C 2XB2D 3CCSS 4O3RA 2IIHA 1TQLA 1VMBA 3QT5A 3FMCA 4KGKA 3UCGA 5E3RA 1YDLA 4F26A 4NYOA 1TL1A 3R97A 5KFJA 2GV1A 2A10A 1NO8A 4PYDA 4DI6A 1TXRA 4DR7F 1RLDA 4UZCA 4B9TA 3FQKA 1HI8A 2UVWA 4QCLA 1PBAA 4CQ1A 4DXLA 3FK4A 1S5ZA 2ZH2A 4DL3A 2MZ1A 2CNLB 1NUEA 3VAJA 1WNEA 2NXJA 1CP7A 1JLQB 4B9VA 1FFWB 2DXDA 2FXFA 3Q83A 2B0GA 1M1KT 3KUEA 4F8ZA 1FNXH 4YDDB 1CPSA 3CUNA 3MDFA 3OSNA 4KV8B 2MKHA 2HHHF 2YVSA 3MTKA 2MKSA 3HSGA 5IQ6A 4O44A 2RAQA 2R8HA 2BW7A 4Q8FA 1AUSL 5B0CA 4OV6A 3NKYA 1S7NA 2DR6A 2W8KA 2C28A 2OH1A 4CRJA 4OL8A 3N79A 2A18A 1IJFB 4LR8A 4JI1J 2W7OA 1JXLA 4QR0A 3MUMP 2GLJA 1B3TA 1HPZA 1RK8A 4UFXA 2R2TA 3QWPA 1SV5A 2GCFA 4Q38A 2AFSA 3ET6A 3ZZYA 2IQ6A 5KFGA 2CZ4A 4DR5F 1Z2LA 1EQ0A 2OP5A 1KEKA 4OYBA 1K44A 1O51A 2CNKB 1S72S 1LANA 4PK3A 5B7WA 4DV3F 2NSMA 3BZQA 1VQ4S 2FE7A 4DL2A 2I38A 1R0AA 1ZETA 1URNA 3F41A 2IVYA 1UEKA 4H4MA 1IKWA 4NLYA 4RS2A 1RE1B 1UCNA 2Y0BB 1P0HA 3SV3A 2WTFA 5F8LA 3EGZA 2E44A 2JHEA 4RW9B 1ZA1B 1T7PA 1NDLA 1M4DA 5KFRA 3PFEA 4LRAA 4WCEQ 3TUZC 2LP4A 5HROB 3Q8YA 2ZKTA 2ZH7A 2CQ0A 4PPZA 5KT6A 9ATCB 5C24A 5CYQB 3GIMA 3MFIA 4Q2LA 2J9EA 2V2ZA 3CE8A 5DO2A 4LQ9A 2YKMB 5LMUF 4Q5VA 1OY8A 4CYPA 1SXLA 4A47A 2Y1LB 5D8NA 1YZ7A 4DQPA 2FLOA 1DBDA 5JMNA 1RT1A 2CWKA 3Q2SC 4ZIVA 3HT3A 1UP1A 4HDHA 3KASA 5CD4H 5B0AA 3N5FA 1SL0A 4CTAA 1WC6A 3CMQA 5ISVA 1U26A 2MGZB 2DK2A 5LSOA 2PC6A 1N4LA 4J9KA 4K4UA 1YBAA 5GMDA 4F02A 1BD6A 1S12A 3AJ1A 3EY5A 3IP0A 1LOKA 2BKOA 2VBZA 3DGPA 2DBBA 2J8RA 1E6YA 3UVJB 3CDEA 2ZEMA 2HVHA 4G3IA 3R9FA 2LFVA 1S1UA 3TVZA 3G4SS 1FT8A 3IAS9 4R25A 3IRWP 4L72B 4R76A 5CBMA 2VXKA 2WZ1A 4JXRA 1FDBA 2FJEB 4LBPA 3R2DJ 5CYMB 1Y00A 4JJXA 3PGPA 4RU2A 3WC5A 1XJWB 1T3OA 4NLQA 1HLWA 3NNCA 7FDRA 2BYCA 4WFAQ 1JNRB 3QPIA 3BKFA 3H40A 1JLGA 5KFLA 2UUWA 1DQ8A 1PAUB 4Y34A 5HROA 1IXKA 3LWMA 2IM1A 4XK8C 3GCXP 4OI6A 1IYLA 1WC3A 2LQ8A 2VOOA 5CD4A 1TFYA 3KG1A 1F5CA 4FYVB 4TKTA 2VI7A 4CZCA 2HNDB 4JI3F 3DRSB 1X7VA 2V4QA 2DRAA 4NLSA 2DHXA 2D3OR 1TK8A 4II9A 1QSSA 4U9YA 2AV5A 1VRUA 1EJ7L 2DXFA 1KBRA 2V94A 4O4GB 3CDWA 3HSJA 2F5IA 2IM3A 1IWGA 2KT3A 4CYOA 2GE3A 2YNIB 3TCVA 2R2SA 5ETMA 4WFZA 1YX0A 1WTFA 1UEVA 4UFVA 2WUUA 4HEA9 4YEAA 2EUIA 3JSBA 2NXUA 2QJ8A 1DHMA 4P4FA 2I3CA 4OZ2A 3D2PA 2WW8A 4AE5A 4U7UK 5A76A 3GTYX 1HNWF 1VQYA 5GVQA 4CT9A 4NLRA 2ZJRQ 3BGRA 4FKXA 1VKCA 1WTBA 1QDUB 2GFQA 1FKAF 4LRBA 4B9MA 1UW9A 4IUFA 3DOMA 3TX0A 2ATRA 5A2QY 3QO9B 2J8NA 3RB4A 2PN6A 5IV4A 2HHHJ 3MEDB 2AEJA 5FLXU 3A13A 1EQMA 4FN5A 2BV3A 4NRUA 3W63A 2M52A 5JH9A 4DV4J 3LAKA 2X51A 3IR7B 2UXBF 5EN1A 4B02A 4IUSA 3A3PB 4Q0BA 5LYLA 4WZQA 4I64A 4MHDA 1U1KA 1U6ZA 3L4BC 4U7UD 3CXCR 4X2TA 3TA1A 2HBZB 3LP1A 2XI3A 3UDCA 1YHQS 2IM2A 2OTJS 3KGQA 1OYDA 1B0VA 2HEKA 2FGCA 5DDPC 4U5YA 2HNZB 4LFCF 1S1TB 6FD1A 2XY6A 4ED8A 5MLCV 3L09A 2MLZA 1YKWA 3OJUA 3JXOA 2AFXA 2PR1A 3ENAA 3MGJA 3BJYA 3QAEA 2IJNA 3GMGA 4KUBA 3SJGA 2HK3A 4P10A 2Z10A 3U1MA 4CLKA 3UD3P 4ELUA 3LW5C 1N34F 4MJ8A 4BMHA 2PFDA 1EARA 4BD9A 3KJFB 2Y0SD 2L9NA 1FRXA 2A2DA 2QMXA 4Y49B 3NRBA 3W8PA 2R98A 4FWUA 2G13A 1FDNA 2P8IA 2ZE2B 1SQFA 4UOCA 3PZJA 2ZH6A 3C3LA 3PB4X 1X4FA 3IS9A 3LF0A 4UUWA 4CO0A 3MOZA 1RWVB 3W6SA 4C8YA 2LXFA 1N33J 2VG5A 1K0VA 1FRJA 3B8GA 5H1SV 2P6TA 2JC0A 2CF4A 2UVRA 2K1RB 1OZPA 1IBLF 1OS5A 4Q7AA 5HN0A 1SKRA 1MJBA 4ECUA 4KV8A 4ICLA 3DOLB 2W25A 2OPQB 1XIXA 3OL9A 2DNQA 5I42B 1M1GA 2C42A 2HKEA 3M6VA 2X1AA 2AMCB 1S6UA 1QTNB 4KVXA 1BHNA 3RB3A 4MK7A 3BI1A 1Q8LA 3AJ2A 3QGGA 1RTDA 2ZBQA 4KKOA 2H51B 3AQPA 1Q8BA 1S77D 2KL8A 1I94J 3LODA 2O67A 1LK7A 1LNQA 2P9GA 1PCAA 4ANEA 3L3CA 2VFSA 2QMWA 3FDSA 4QZVB 2OSRA 1WG1A 4OMEA 1B99A 1Q78A 2LEAA 2BZ2A 4DL0C 4TNOA 2CXAA 2HQFA 4IRDA 4ZX8A 2NSBA 5G20A 2XO6A 1X9SA 2G3TA 4YU9A 2SXLA 1RWMB 2Y3YA 4M6GA 2HNZA 4ED5A 3KLIA 2YKOA 1XEBA 3K5MA 1OO0B 1X0FA 3UCZP 3FRMA 1KHWA 3MECB 4ECRA 4R8UB 1XC9A 2IDLA 2FVRA 3HULA 2B8PA 2RD5C 1FO1A 2XHWA 3W60A 3BI0A 4RKUC 5E0OA 4EZ9A 5GMKa 3UDEA 1Q79A 4DR5J 3JTNA 3KLHB 5DG9A 4LF8J 1FWKA 2YNEA 2QLWA 3PTWA 2HHVA 4WWSA 1S1XA 1YTYA 1NH7A 1S9EB 1NB7A 1DTDA 4UA3A 4B3RJ 4F4XA 2AFUA 5J2PB 5D4LA 3RAMA 2CTBA 1Y11A 3D3BJ 2C6GA 1YGYA 1YK3A 3H4BA 3M2RB 4K5SA 4IH7A 2HVDA 3GYNA 3A4TA 3HJVA 2HWIA 3SI2A 2FT0A 5CCLA 2XM3A 4DV3J 2POKA 3HO1A 3LP2A 1SQHA 1YGHA 1DURA 4A4JA 4WKRA 2AJ2A 2XMMA 3SCLE 3RBZA 3SI0A 3CJ8A 1TAUA 2HQCA 5E41A 5KFZA 3BLNA 4NGNA 2N3LA 4OAEA 3DHXA 5D8HB 2AJ4A 2AGQA 3R96A 1Y7RA 4K4SA 4X8IA 2JL9A 3NGRA 2FCKA 2ATLA 1RO5A 4O3PA 4OP4A 1HNIB 4QVTA 4YFJA 2KT2A 2DPSA 3E01A 4ELVA 3NBPA 3P5BP 2W4PA 4UY8T 5DM6Q 4CO4A 5B0GA 1M5PC 4X66F 1LWEA 2BQUA 2CYYA 3OUYA 1H6KX 5DLFA 3M32A 4ID8A 2K1RA 4B6ZA 4LQ6A 5J2MA 2LLZA 2F4VJ 5HVFA 1YIJS 2YWEA 3FSYA 1OJ4A 3GU0A 2DH8A 2V67A 1NB2A 2AP6A 4URSA 3J7YI 2JVOA 1IR1A 2KU7A 1FK9B 4BC9A 5KG1A 3NOGA 4NX9A 4NCGA 1HQ2A 3I3GA 4E8OA 2YWKA 2GIQA 5ETQA 2WRMA 1JXEA 3K17A 4PRFA 2LYVA 1RHMB 1AFJA 4C3LA 2PJ1A 2FVPA 3NCRA 2ALZA 4ZLPA 2C2DA 1G3OA 4PQUA 5AG6A 2DGTA 4LBHA 3X3UA 2KB2A 5E3PA 4M5DA 3ZNJ1 2NXEA 2YNHB 4PKDB 3MF5A 1GX5A 5KFPA 2R4FA 2J7KA 4W98A 3BB5A 1TMJA 5KFIA 1UFLA 4J7CA 1EIYB 2JJ4D 1S10A 3VVUA 4V19J 5KTQA 4M5HA 1HI0P 2UVUA 1GT8A 2M0GB 1R27B 3FBUA 1M1HA 3J7AN 2KRBA 2OPPA 2CPXA 2O1PA 2B9EA 4OZ3A 1REVB 4I7FB 2R7UA 4MHNA 3CC2S 2DNOA 1S59A 3KHRA 4O4RA 1IUJA 5IQQA 2WVEA 2JRSA 3AA8A 5FIIA 4RBTA 4ECXA 3VGVA 3PEJA 2B4PA 1R8AA 2HQGA 1M44A 1VK3A 1HARA 2LCWA 1GX6A 5I42A 2I00A 5DRKA 4KVME 3D68A 2XEGA 5BYQA 2F3JA 1RA6A 3CSKA 3FJ2A 5HJXA 1YW6A 1U7LA 3BGUA 1NKBA 1VQOS 1NPRA 1EP4B 1YG0A 3SBMA 5IV3A 3MWBA 2F8MA 4HTJA 3B8HA 1N0VC 3AY0A 4JI7F 4MFLA 4CRZB 4W4MA 3GJSB 4LF5F 3LGNA 2ZVIA 3ISZA 2IL4A 1WEXA 4L6V3 3E3XA 3L2NA 2GS8A 1GTEA 2NQPA 5KFYA 1BY9A 2ZWPA 3B3SA 3NWRA 2JDJA 3U1LA 1RHRB 1UWBA 3PIOQ 4CLWA 1BMQB 3NGUA 3QJJA 3S6KA 4OJHA 1JJCB 3D7FA 1YR0A 2O3DA 2ABZA 2GIRA 4ED1A 3CCTA 1D8YA 2XY5A 4MMOA 1HNVB 1RP5A 2BEIA 3FEYB 4OIXA 3IU1A 2WCXA 4DSEA 4N8OA 4U8VA 2FUG9 2HGMA 4FYDA 5D3GA 4DYOA 4HT5A 1GMWD 2X3DA 2I79A 2DYAA 2CQIA 1KFSA 3Q8QB 5K14B 4NGSA 2I6WA 5A28A 2DEAA 1TUVA 1YBUA 3QT6A 2XLKA 2JEIA 4ZP6A 3AB2B 3JSRA 1TKXB 4IFVB 4OYOA 2PMZD 1HNVA 1TKJA 4LF9J 1RTIA 4MYTA 5HSPA 1G1XA 5EBVA 1SPBP 1LOUA 3TYTA 2HVEA 1GH8A 1M5SA 2ZH5A 3VH9A 3OL8A 3HDSA 5K8OA 2BJ8A 4CLPA 5DGAA 2ACMA 5IT4A 3CWJA 3CDXA 4EBEA 3CIMA 2B9XA 3KK1B 4TYBA 5CYQA 2PJ2A 3HUVA 1BUXA 7FD1A 1RKIA 2OKQA 1HYSA 3IGNA 1V5IB 4C3KA 1YLEA 4GXHA 3FNNA 2N82B 1RB0A 1RAEB 4P52A 5HL7Q 1T03A 1FNMA 4LMZA 3R5AA 3I1UA 4YGOA 1ELMP 3BKUA 1NHVA 4M63A 5JPHA 2CJQA 2J6SA 3PW5A 1Z4UA 4HKFA 3GR1A 1LXJA 3PIPQ 2VA3A 5L38A 3CPWR 1SCJB 5F49A 1ITPA 5LMUJ 4C7IA 3UY5A 4MFQA 1N8RT 3B3VA 1RCOB 1Q2YA 3C16B 1KLMB 3GV8B 2OEKA 1WK4A 1IQTA 3VCDA 4WXWA 2GJIA 4YHHJ 4MHYA 3U1NA 2RILA 3A8KA 4QWDA 5AG7A 3KUGA 4LSZB 4TXSA 3SV4A 2NYHA 1Q2CA 1UWAA 1SL2A 2Z58B 3KDNA 1PO6A 3DRYA 1AUGA 2FJDB 2R7XA 3MMCB 3C6TA 4OI0A 3MEGA 4C2XA 3TX8A 1YBTA 2E29A 1ZO0A 3ITHA 2Y9HA 1IKXA 2Z0ZA 3WIVA 3U7JA 2F9JA 2DF5A 1Z8LA 5A8KB 1C0UB 2CQCA 3D54A 2QIRA 3BGFA 2R7SA 3ZZZA 5K5MA 4L8AA 3M2UA 3O5TB 2XEJA 5IV0A 2E7VA 3MM9B 3P6YC 2FZCB 1Z8WA 3CJ3A 2DR5A 4UY85 2GO9A 1IKXB 1TKZB 3ILIA 1R8PA 4A39A 4PYAA 2CG4A 4A38A 5KFKA 3VWEA 2DGQA 2DNPA 3VV2B 6AT1B 4I68A 3T8WA 1SH2A 4LSLB 3D0HE 1UTAA 3PW4A 2R8JA 4KTQA 7AT1B 2HHWA 3LMSA 5K14A 2ODFA 1U6FA 3IS9B 4DFPA 4ES1A 5IB0A 1ULRA 2CAJA 3GG1A 3FRYA 3EXYA 2DKOB 2DXQA 4UWIA 3N6NA 3ZZUA 1N56A 2H1YA 3BH6B 2XMTA 1NE9A 3K2YA 1HNIA 2IHR1 3OFEA 4LF8F 4I2QB 3VQSA 3JTKA 3KK2B 4B9UA 4KFBA 5KOWA 1NHUA 4C2YA 3T19A 2DGUA 1U6BA 2PVWA 1DZ5A 5G22A 4PWWA 1RT5B 5HANA 4ZVSB 4JI3J 1Y5LB 3W2VA 5IB9A 1SC1B 3DDIA 2BX6A 3MMAB 4I7FA 3L7OA 2KG0A 1S0NA 3OSPA 5J8FA 2JWNA 4PCQA 1NK4A 3SYZA 1YJRA 1NMTA 3VVTA 5GMEA 5E3AA 4NGPA 1VFJA 1BPNA 3OPKA 3HSDA 4NA3A 5LJ3Y 2VH7A 3MEGB 4F9UA 1RWWB 5KFHA 1X12A 2PJ0A 4YHHF 1WHVA 1LW2A 1XERA 1HNXJ 2MQNA 5G1ZA 3R5DA 2FJXA 3NGSA 5L9XA 3QGPA 2HBRB 4L75A 4P73A 4E0AA 1K73T 1QTMA 1I51B 3CCQS 3M2VB 3R2CJ 2I5JA 3W2WB 1X4CA 3H98A 2RKIB 4ZVHA 3QBCA 3FH4A 3PVXA 1HPZB 5BWAB 4LF9F 4K4XA 3CJRA 4UOHA 2MZQA 3IR5B 4ZVEA 2L9DA 4GVLA 4CIOA 3D1HA 2OI2A 2RU3A 2B3TB 2EPIA 5DDRC 3IM8A 4C98A 2XS7A 1UWBB 1S97A 4M3SA 1T05A 2FIWA 4F36A 1ARLA 3NMRA 3LO3A 5F8IA 4R3LA 4C68A 1VLOA 1VQNS 4ZVQB 4ZP8A 1W2BR 3RBXA 1XNQJ 4R6TA 1KDNA 2E9RX 2FY1A 1CULB 4JI2J 4EMDA 5DDQC 3SMZA 3CD5A 3EM1A 4FYWB 5J2NA 4OIWA 2NXNA 2WHOA 2PJ9A 1YJUA 4LFAJ 2CPEA 1L3KA 2HURA 4R7MA 3P3DA 3LH2S 2DIVA 2ZZTA 1KUVA 3A1YG 1U2FA 1N34J 3LD2A 1SJRA 1IYKA 2EC0A 3UR3C 1Q95G 2CQBA 1VQ5S 3KOAA 3HFZB 3HD1A 4LIRA 3PBBA 2WPXA 4WBFA 2OOTA 4FP9A 3T9NA 4NYZA 2EFQA 3IG1A 4J9MA 1M5VC 3T9YA 5IWAJ 1JKHA 4DUZF 4A8WA 4E2FB 3NOCA 1WACA 2OAUA 2I8EA 4ZPTR 3W5YA 3IWNC 2CJKA 3LANA 2ASJA 3JVNA 2YBVA 4MYUA 3C19A 2MY8A 3DDNA 2HLUA 3UO0A 2DTJA 2QN6B 4ONWA 1FRHA 4CGPA 2VKZG 2JOQA 1WC5A 2GAGC 4DSJA 1QUVA 2VG6A 2ZOGA 2BVZA 5FD1A 4CGOA 1IVZA 3R5JB 2AJ1A 2RIJA 3MM9A 2HS3A 3D1OA 5F0UA 3HHNB 3OVAA 1QVFR 5AE1A 1HQUB 2J0XA 1GHEA 4YFUA 1R6VA 4XTTA 1RADB 4LF4F 3IR6B 3FMBA 3FSIA 2B9WA 4QW9A 1MWQA 1H73A 4BDPA 2P0WA 1HBUA 3HHEA 1HR0F 3A3OB 4I2PB 4DR2F 1S9GA 2FY8A 2ZDPA 5GAEU 2V68A 2PI4A 1KRPA 3WR7A 2CPIA 1LEOA 2P6EA 4X65J 4RBUA 3D28A 4Z7CA 4PEOA 3T9ZA 2IMOA 2FZGB 1N5YB 1S4EA 2MLYA 2W9BB 5L1KA 1S48A 4M5KA 1SV5B 1WSRA 4N7TA 3OTDA 2E1CA 2RSQA 4DSFA 2FHOB 4O3SA 2Z0GA 3C14B 5KFBA 2AEFA 1N48A 3JAMU 4NYPA 4FBTA 1CBKA 2X3GA 4IO9Q 4NXNF 4RUHA 2PJBA 1VIOA 2MKYA 3E2EA 4LF5J 3R6GB 3FEXB 4HACA 1XN9A 1ZZNA 3CC7S 2B4DA 1FT7A 2HFSA 5EMIA 4HH1A 5F47A 4RX6A 2MHEA 4NCZA 3NAHA 5ETKA 4MI4A 2CWXA 3I4PA 4R3KA 3CPXA 1GXTA 1TUWA 3OTCA 3DLHA 2VG7A 3H8FA 5I3UB 1RTDB 2J8MA 3LP2B 2ZBRA 2ZD1B 2RQ4A 3J7A1 4UCMA 1CQNA 4KOWA 1J4JA 4XPLA 3N7ZA 2K06A 4ES2A 1RDRA 5CH7B 2ZBIA 4WYWA 4JI1F 1U48A 3GE9A 4V1Ak 4CGNA 3RJMB 3G96A 4F4WA 2IJFA 5I3QA 4DCOB 4AXIA 1VC5A 4KSAA 2ZC4A 1JLAA 1LCPA 1K47A 2ZD1A 1IICA 3MM6B 2BOAA 1MWYA 3EGWB 3D0IE 3PHTA 3ZTOA 2VHGA 3M32B 1Y9KA 4LUBA 3TA0A 2EK6A 4MK8A 4MCSA 1Z8XA 3KXDA 3H2LA 2ZM6F 2A6MA 4KZTA 3IU2A 2EVNA 4R5PA 2ZFHA 3IBWA 4IO1A 4BS2A 4NFRA 3NBPB 4OZ0A 5KG5A 3IAM9 2Z56B 2D4PA 1KVJA 3DLEB 5C25A 4ER8A 1NAQA 3P4UB 5D29A 4WE1A 1VHSA 4FPRA 5DQIA 1J5OB 2CXEA 3GYXB 3AODA 3RRKA 1Y7PA 3V6DB 3CJ5A 3D4UA 2MB0B 4RW9A 4KSEB 2PE8A 4LQ3A 3POTA 3B3CA 2OZGA 2NCKL 2EKYA 2R8IA 4MK9A 4QOTA 2B58A 2R3VA 3O6QA 4EBDA 2JNJA 3BSAA 3BN4A 3CC4S 3PY8A 3I4HX 3QT7A 4ID5A 3E8OA 2YQ0A 1QAXA 3K0JA 4TNUA 1XOVA 4LFAF 5HMNA 1TKXA 4IFVA 1SJ1A 3VAKA 1XWLA 1Y0RA 3BR9A 1TP7A 3HVTB 1IR0A 1WI6A 2OEJA 4ZLNA 2ILZA 3POTB 2JLFA 2JBKA 2IBKA 2MKCA 4NXMJ 3MTJA 4NF1A 4WK3A 2V8GA 5KFFA 1K0TA 3VAIA 2R42A 3QFHA 2KM8B 3GP9A 3W64A 4QPXA 3WABA 2DO0A 3GYAA 3D7DA 4MBUA 2B7CB 3FNCA 4DWIA 2ZNYA 2G1DA 4FD7A 1DQAA 4LRFA 3RZAA 1S1UB 4ILMA 3DOMB 2XYGB 1RAIB 1TL5A 5J2NB 4ES3A 1C2PA 3CXSA 2HZAA 3D3SA 4NA2A 3LOUA 5HBMB 4WFXA 2VG5B 2E9TA 3KR4A 2CJAA 4G1QA 1IN0A 3SZ2A 4Z65A 4J9LA 4Y28C 3BJ7A 1UVNA 2PE3A 4IRCA 4OYWA 1M5KC 3LALA 1VJQA 3CJ2A 3CJ0A 2DPIA 3ET6B 3IWGA 3SQGA 3BBFA 2DNMA 3UWTA 3K5PA 2ROPA 2M3DA 5G0RB 4GM5A 1QVGR 1RCXB 1F6TA 3KLHA 1VR6A 2L48A 4OC2A 5JVHQ 1WHYA 4AVAA 5EWEA 4B9LA 4Y3CA 4DLGA 3CD0A 2A4NA 5IT0A 1VHFA 3T41A 2AHOB 2OPSB 4OX8A 2ZEPA 3KUHA 4R8UA 2Z3LA 2B5JA 4C8OA 3EGVA 5K20B 1T8EA 2XCPA 1RWXB 2JFDA 4ED4A 1FCAA 3PO5A 2OELA 3TR5A 4USKA 5LRJA 1KR4A 3GG0A 2R7RA 2VQEJ 4E2AA 2HGLA 5A8KA 2W1BA 1H2VZ 2VPXB 1NK9A 2M8DB 2W9AA 5EHHA 2B51A 3H8YA 2CPHA 5DG8A 4I6WA 4OHVA 4ED0A 4P44A 2Q43A 3VZHA 3FQLA 4D3GA 4X4TA 4A33A 2GGPB 4MFJA 3OR1B 1TL7B 3VHQA 2QL7B 1OQ3A 1J5EF 4UQGA 4TVAB 2RQKA 3W66A 2XYPB 4DU8A 3HHDA 3MFHA 2MYFA 2GQCA 1LWFA 4X5KA 1T0TV 3D2WA 4DL4A 3HMJG 3T1AA 4DV7J 4LF2A 2RMLA 1X4AA 3UD5A 1B70B 5I4MA 6CPAA 1IKWB 2OPQA 5HI7A 4YRHA 4AG7A 3MMBA 2J9DE 5EDWA 4YY3J 1QD1A 1S9GB 2UU9J 1HW8A 4F3OA 1U0HA 1X4DA 4MIAA 2D41A 4YN3B 4PG4A 4EO6A 3MR7A 3B4MA 4FXDA 4EZ6A 2HHSA 4F0YA 4ZN1A 1RT2A 2PT0A 3QNVA 1TF9A 3QQCD 2WSEC 5LYIA 3KI9A 4UQTA 3UI3A 1V3SA 5KOXA 3OR1A 4DR7J 3TJ8A 2YY3A 3AHPA 4KIAA 2YGWA 2FC9A 4FF1A 1CC8A 4R5PB 1S0MA 5HMXA 4NLPA 4QC6A 4IQXA 2KHDA 2ASLA 3G86A 3W5ZA 1NK8A 3VAFA 1C1BB 4K30A 4KY3A 1K8AT 2HNYB 1NJXA 1EETA 2RUSA 3DMJB 8ATCB 5B0DA 1TVRB 3GONA 3QRQA 2MQ8A 3FIXA 4IR1A 5DWNA 4AQYJ 1QSYA 4OFZA 2PRQA 1YWXA 3M6UA 5LXRA 2RS8A 4A8MP 4GMKA 2FHJD 3P8BB 1I5OB 1RBAA 2YPYA 1L0CA 4IG0B 1UVMA 2WK4A 2ZC3A 2VF3A 3HK2A 2CUYA 4A8QA 2FSRA 2IAJA 4UEZA 4J91A 4PWUA 1UVLA 4NOHA 1TKTA 2GMHA 5AXLA 2GLFA 3BQ0A 4CLFA 4F4KA 2LXUA 3EC4A 1RWOB 4C8LA 1FRMA 1KQKA 2EVZA 4B3OB 3TVKA 5EGYA 2VC0A 1SIWB 1RT1B 5LSLA 3FVLA 3FEZA 1EHWA 1CPXA 2OO4A 4QYRA 3ILJA 3D9BA 2MQPA 5I0CA 2R2RA 3OR2A 1I6JA 4QIWD 4LBIA 1EZZB 4NCBA 4UTGA 1N5YA 4Y0FA 5JM6A 1H38A 2AYMA 2Q3PA 4RW7B 3HVWA 3FBFA 1R8CA 1R0CB 5ETSA 2OZUA 4LX9A 3M30A 3HZEA 3BM7A 5HQMA 1UKUA 1W2IA 4OHYA 1F1BB 2VUGA 3H5XA 1F60B 1YJ9S 5FJ4A 4WYLA 2UXCF 3ZC4A 4DQSA 3BREA 1Q7LB 1WOOA 1ZG9A 1T03B 3BH7B 3M9MB 3EYZA 4HNYB 1WKKA 1RACB 1NKEA 2DR7A 1FTRA 3RW7A 3T6BA 4IH5A 1HQUA 2CFXA 1M4LA 4C11B 5IM0A 1YVOA 1OPIA 4OHWA 5LYFA 2CNMA 2PRBA 3J80Y 3H8GA 1J5OA 3FKBA 5HP1B 2XLJA 3V6HA 2UXCJ 3GUXA 3MR5A 1RHUB 4F4ZA 4QIFA 2A2CA 2ADBA 2H9ZA 2Q51A 3QIDA 5AXMA 2HZVA 4CRYB 2RVJA 2VPYB 1D8ZA 3K9UA 2VFVA 4C11A 1PJ7A 1MJAA 3C2PA 3BYRA 1SKUB 2HYIB 4IF5A 3C46A 4EI2A 5F0WA 3QJPA 2D4OA 2PIYA 2G0JA 2D69A 2YNFA 2EFNA 3US5A 3PRBA 3BSCA 5AXNA 1ROFA 2W2NP 2HRUA 2HMIA 2M9KA 5KFCA 4DV0J 2R7QA 1L3VA 1RQ0A 3PB8X 1RT4B 3CW2C 3KK1A 3CCZA 2YKNB 4XPEA 4JB8B 2BKPA 2PI5A 4RJVA 5HBMA 4P4IA 2V34A 1HHQA 1GEHA 4GVBA 2MMYA 1XK8A 2H65B 5GAHU 2APOA 2QA2A 1YRXA 4W92B 3SJFA 3D4JA 2M2BA 2XNRA 1RTJB 1RISA 5L1LA 2MXYA 1HEEA 3IFEA 2COLA 4X4RA 2F40A 1KN6A 4UIAA 4DUYJ 3PEHA 2DISA 1GXLA 1NSPA 4NCGB 4F9VA 3KK3B 4OYPA 2IM0A 5GADI 2FL4A 1WSVA 1FX4A 4WU2A 2CVIA 1YJ7A 2BANB 1GMWA 4JYAJ 4B14A 1V5VA 3HKZD 1CQMA 1Y5IB 2DNZA 3EMTA 4ZVPB 3CCWA 1B7YB 2CJBA 3KHGA 1FD2A 3Q8UA 2HLTA 3FBBA 3ONQA 4ZKAA 1BOBA 5F8MA 5BR8J 8RUCA 3CIZA 4HYKA 2QYCA 1XNRJ 3JYTB 2XI2A 1G4CA 1S7FA 2MLXA 3W9JA 4P74A 3PRDA 2IC3B 1P1LA 5KG6A 4DDFA 3EZ5A 1BGXT 2WB4A 2BEFA 2RQCA 3CJKA 2E5LF 1G7CB 1FJGJ 5CCMA 1NZAA 1FDAA 4JI7J 3K89A 2V8DA 3MR6A 3CD7A 1RBOB 3I87A 4JOUA 3I0SA 1TL1B 2QG9B 3N9UC 2F4VF 2XEXA 1Q86T 2JEFA 1DRZA 2HVZA 1ZZFA 3M2RA 4ONUA 3V2UC 3ZTPA 1RTZA 4Y6IA 4N77A 4JV5J 4GO5X 4QWCA 2RHQB 3GSDA 3LWLA 2RDJA 3W9HA 3MPDA 4WJBA 3T6JA 4ECWA 2XY7A 4EK2A 2IFXA 1RWPB 3GJTB 3QAYA 1T3NA 4C8KA 3SQOP 3SHPA 2DRBA 1PUAA 5F9NA 2MKIA 5D4NA 1LAMA 5F41A 3VAGA 2YX7A 2RNEA 5T41A 2B5GA 3D3CJ 3OVBA 3PBEA 1F3FA 2LA6A 3Q8RB 3T1YF 3WC2A 4RN7A 3VWDA 3SDEB 2RRAA 3NS6A 3CPAA 3HCXA 1C1CA 4RW4B 2LEBA 1HWIA 2OPPB 2PDOA 4NLXA 3N4WA 1N71A 1RWNB 5IFMA 1NDPA 3N5BA 4NASA 3WC7A 4DQRA 3OFHA 1SC3B 4UIBA 2FLNA 1UWYA 4QWEA 1I21A 3R9EA 2ZUGA 4URQU 4ZHRA 2OMOA 2VV5A 2C6CA 3DRRA 2NS1B 1N6QA 2OB0A 1P9YA 5M2PA 2HHQA 4RO0A 4NXYA 4X62J 4C6AA 2R9LA 3QFWA 1IR2A 1DTQA 4DN0A 4JV0A 3V6KA 2Q0YA 2OHDA 3ZZIA 5KFXA 2ZH1A 3QSYB 1IBCB 5A2QU 2DH9A 2ILYA 1W25A 4DX8H 2GVDA 4F0HA 2B3UA 2QLXA 1C4AA 2PIZA 3S9LA 9RUBA 2PJ6A 2KN4A 2BJEA 2FHJA 4P2FA 1QAIA 2XMVA 4PR6A 3JSMA 2RKIA 2RDDA 2UU9F 2Q44A 3G8WA 2IY5B 1LW0A 1HDQA 1RYRA 4P2SA 4C2MA 1D1UA 1WD6A 5HP1A 1BO4A 4FUUA 1RZMA 3G8TA 2B5GB 2V5HG 5ETNA 3DRRB 1PU9A 2NXCA 2AJFE 4NWBA 5E33A 3OXFA 4TU9A 2OIHA 4QR1A 2WSFC 1KTQA 4ZOSA 2B4DB 3K9TA 3Q0AA 1V3ZA 2XSFA 1S4FA 4AYBD 4BLGA 1WEZA 3S7RA 5AG4A 4EWTA 1KP6A 3MN8A 4P45A 2D1CA 1R8HA 1WWZA 3DM2A 2XEIA 3KLEB 2DEJA 2R8GA 2RT3A 2QE5A 2DHHA 1IY7A 2E1AA 3NMAA 1MROB 2CG8A 2DNKA 5J1NA 2DVIA 1MN9A 1U02A 1S79A 1IKYB 2XEFA 4FDFA 2VA2A 3NCQA 4L3KA 3H5ZA 1JNZB 5D0GA 1FXRA 1TZ0A 4CM0A 1P9QC 3TAMA 3DOKB 3EDRB 4OHXA 1WOSA 2CNOB 2ZUAA 1R7IA 2FQQB 5D0RA 1NPPA 5HLFB 4S0MA 2RE1A 5IT9Y 3Q86A 1FKPA 2WVBA 2W2MP 3BS9A 4LF6J 2FC8A 4O3NA 1LXNA 3OTBA 3DI6A 1R0BG 3PB6X 3I9SA 3OV7A 4DPUA 5U47A 3TEHB 1A7GE 2UUCJ 4ZJLA 2EO8A 3GIIA 4IH6A 2DY1A 1YK9A 3DXBA 2PGCA 4HHUA 3EGNA 3TO7A 1CC7A 2NUHA 4TQSA 2HIQA 5T7LA 1YX2A 1CPZA 4C3MA 3W8GA 3NNHA 1X4GA 2MKJA 4R87A 1N52B 1OBRA 4QIVA 3W2VB 4NMXA 1XR6A 1U8WA 3D1QA 1KQGB 2O66A 3UNGC 1M4GA 1FKOB 5EUHA 4AD6A 3IO1A 1WKJA 1VYAA 1Y0HA 1WG4A 4CLUA 3DR8A 5AE2A 3G82B 3MM8A 4J9QA 3UQSA 3UDLA 1NNDA 3A12A 5KFTA 4U67Q 2FTRA 1TUGB 4C0HA 2QFIA 2AGOA 1ZG8A 4GKKJ 2ZW4A 4KH0B 2YQ3A 4KH1B 2UUCF 4LT6A 2MHNA 1L3SA 1C0UA 4AFFA 4M5DB 2UUBJ 2V69A 1AZSA 2FPHX 4E8UA 3IBCB 5CPAA 1LRZA 2J8AA 3ZO7A 4AL7A 3GFXA 4ZCMA 4LSLA 2UUBF 2BE9B 5A8RA 1D9DA 4Q8EA 1EP4A 2MZJA 1Z5RA 4EU0A 4CT8A 4OX6A 4NEYA 3CGIA 1YVKA 2RHSB 4C8NA 1ZBTA 1TKZA 4IG3B 2CQ2A 2NYQA 4YB5A 2R8KA 4PG8A 4KRWA 2HB6A 3CEDA 3TZZA 4DX6A 3DM2B 2KVQE 2G2YA 3B3TA 5HMWA 3GFYA 4WP3A 3G71S 3C66A 1F3VA 4PG7A 1J5EJ 1FFGB 3TQEA 2CPZA 5LL6d 1HNWJ 4JV1A 3EFAA 3NXZA 4K59A 1R31A 4F7VA 4E98A 1NRKA 2BMBA 3M9NB 1HDUA 1JLEB 4Y65A 3AOCA 3NNAA 2Y8YA 4KOTA 1ZM2A 1JXVA 3H2UB 3M6WA 1S76D 2IBOA 1FXLA 2QT7A 1XRYA 2IJZA 1R0AB 1VS3A 3CXQA 4J9RA 2AKWB 3CD6S 2EBEA 1V6HA 3R7BB 3JB9k 3DHWC 3SDEA 1Y3JA 2XWXA 2I5JB 2CQGA 4M1KA 4ITSA 3GPAA 3AXMA 4P4BA 1XR5A 4ZPDA 2ZM6J 3HLUA 1Q81T 5KFQA 2OFHX 4CI0B 3R7SB 4B5OA 1FXDA 4KT0C 1JQGA 1PSDA 2BABA 2VPWB 4X3RA 4RNHA 2D3O1 2E5HA 3M1VA 1HBMB 4UOFA 3F44A 1JKHB 4URGA 2GHPA 2RRBA 3MMJA 2ZENA 5BYSA 3PACA 2KYXA 1DFDA 1X31C 1S9EA 3ENVA 2HHXA 1UFWA 4BHQA 3DLKB 5IX3A 3R8YA 3H5YA 3I31A 2BM0A 4BINA 3TAQA 3JTPA 2WOMB 3PX0A 4ZVUB 2Y1JA 2EG1A 5L8RC 2DRDA 1O0PA 3T90A 4C0OC 2F8HA 2BL1A 4KUAA 4I4BA 2OJ3A 4OZ5A 1A9NB 5C88A 5ETOA 3PYGA 4ZPCA 3I9V9 1JIHA 2ZEJA 2H54B 1F2OA 1XMOF 4RBVA 1XJOA 2F1FA 3BYPA 1F2PA 2HHUA 4CO1A 3NGDA 4PQAA 1IKVB 4Z2XA 5DS7A 2LVWA 3KG0A 2HZCA 5CABA 4NLDA 3GILA 1I94F 4MH8A 3AOBA 2W2QP 3VTIA 1RUSA 2D9OA 3MRUA 5A0YA 4B3RF 4X2BA 3FFIB 1LK5A 4ZPBA 1N32F 3CMES 1YW4A 2BCOA 4ECQA 2PFFB 3BSNA 1VQLS 1D3WA 1BWVA 2KT5A 3QJLA 2YWFA 2ZW6A 1FTCA 4AVBA 1RAGB 1WF0A 2N7CA 1CP6A 3EZOA 1I1DA 1AT1B 2BJ9A 2VBXA 3R27A 1IBKF 4LF7F 2WW4A 2DPJA 3HHLA 5D77A 3HJFA 3J81Y 4DV2F 2LQJA 3E0KA 1NH8A 5D78A 3AD7C 3DLGB 5AJ3J 4HPSA 4ZY2A 5G0RA 4DSKA 4Y2AA 2XGPA 1J27A 1U4BA 2UXDJ 1PYTA 3VQTA 4K3NA 3QAUA 3H5SA 2ZJPQ 5FVJA 4JUZA 5KFSA 1LWCA 4FAIA 1KNZA 2VDHA 7CPAA 4B3SJ 2OMLA 1UZDA 2AW0A 1DTQB 2ZBCA 4AQYF 1H7WA 2EC2A 4IYQA 3WC6A 1DTTB 2E5JA 3NH8A 4UWJA 2MZRA 1VJWA 3H90A 4H6ZA 2Y8WA 3C6TB 1WJ9A 5CYMA 3UN3A 2LQ5A 4QIEA 3TE4A 2VBYA 4NZ7A 4WU3A 2YNDA 3RO0A 2YX4A 1X5TA 2IVMA 5H9EJ 4FD6A 2C2OB 2KTQA 2MQLA 4OIDA 1V9OA 2PJ4A 1HD1A 2QEXS 1WDDA 3N0VA 3K2KA 5F8JA 4H6UA 4CO3A 1OSCA 3IN5A 1H72C 5JQ4A 3CCJS 2XZDB 2B4BA 4N41A 2C3MA 4FVMA 3BPSP 5KFAA 2V77A 1H2TZ 5F09A 4DPWA 1VISA 3EE3A 2P6FA 4ORFA 4KBIA 2LDIA 5C42B 4A95A 1H2UX 3BGRB 3W5XA 2ROGA 5F48A 2H5JB 2QO3A 4XNHB 3RG6A 5ADZA 4ZVOB 4QWAA 3DKDA 1FDDA 1MU2B 2UUAF 1VIXA 1T94A 2ZEHA 3A9LA 2J7WA 1EAYC 3P2HA 1WHXA 5DGBA 4I56A 1DLOB 3Q8VA 1Q5YA 3M8QB 2ERRA 3CO0P 4B5PA 5LMNJ 3MCMA 5LJ5Y 5RUBA 1AW0A 3FC9A 1JLCB 3VF0B 2GVDB 2W9CB 2HQYA 3CO9A 4KHPF 3ULHA 4H89A 1N5SA 1HKAA 1UJ5A 2YTCA 1QSOA 3N28A 4TLRA 2R1IA 1W7WA 4YS2A 4O44B 3W6XA 1K1SA 5KAKA 3S6HA 3NE8A 2BQRA 2B9YA 3QGHA 4EO8A 5C82A 2XYHB 3AOAA 3B78A 3SI1A 1IB1E 3JQMA 3FGVA 4ED2A 4I49A 1OIAA 3DLEA 3FCWA 3IWWA 2X1FA 1JLBB 3BO2A 2CDQA 3M8ZA 3OTEA 3ILOA 5JVGQ 1PJ5A 3S9MA 4X4UA 5T7LB 3TEGA 4NE9C 4XPDB 2RJZA 4ZGYB 2OSQA 1BQMB 3JQJA 4U96A 4YWYA 4TY9A 2HAFA 3M2VA 3QIPA 1NHKL 1WORA 1YI2S 1FEEA 4QU7A 3UPFA 3HKWA 3TUPA 3ENQA 3P2FA 2CQ3A 3K5OA 5IWAF 4GKJJ 5E3CA 5KFMA 2IRUA 2P6SA 1JLFB 4MCRA 2GREA 2HHTA 4MKBA 2QIFA 1WOPA 3PJ9A 2WB1D 2HQIA 2VASA 2ZPAA 3B4DA 3IEHA 3I9ZA 4EUVA 1S6PA 1VQ7S 3QLHA 1MLAA 1EX8A 3TAMB 4U7CA 4PXDA 3MCOA 1CS4A 2QX0A 1B4SA 1AA1B 4K4WA 1Q2DA 1G2EA 1U6MA 2WOMA 3TNVA 4N5SA 1ELLP 1IJEB 2N3OA 3GKRA 1APSA 5M2UA 2CJYB 1CX8A 1LQ9A 3HZGA 3C15A 1U0HB 2C2MB 4MFKA 4WF9Q 3OLBA 4IDKA 3TZYA 2QMUB 2V4RA 4DUYF 4NJQA 1REVA 1KUXA 2AX0A 4WP9A 4ZP9A 1S7IA 2DO4A 3JRUA 4ENOA 2AZ3A 5KFUA 2NYIA 4LQGA 2KZMA 1CG2A 2E1PA 3T5KA 1XFOA 1FRKA 2DNLA 3SIPB 2A3JA 4CWBA 4PG5A 1JLEA 1TKFA 4ZIWA 5IXUA 1GYTA 5L1JA 3K57A 5B0FA 1UVKA 4MFBB 3RYOA 3MEDA 5HQ8A 4UT4A 2KFNA 1MU2A 4FF2A 1HHSA 4QUSA 1SUQB 2AJ0A 3B7IA 2LKZA 4PUOB 4KO0B 4KOUA 3FXTA 1NLKL 2YPZA 3L9ZA 3TJ9A 1TTHB 4YR0A 4KSIA 5B08A 2CNTA 1VBXA 4USWA 5A6PA 4UCPA 1FK9A 4KOVA 2C3YA 2M8HA 5HAOA 3CCLS 5KT2A 5ETTA 3LA0A 4PPDA 3TZXA 1MNEA 1U09A 4JP8A 1FRIA 4OZ1A 3AA9A 2AX1A 4KQZA 2E1MC 4PXCA 2M7SA 4G1QB 4AUKA 2V2VA 1RABB 3UW1A 4QYZJ 2ROEA 4A8OA 2ZE2A 2B3VA 3MR2A 4K2XA 4JD6A 4BWMA 3VATA 2NMTA 1KWMA 2KI2A 2FS5A 4DV1J 1XNQF 2J0WA 4ECTA 1UA1A 2NSCA 2VIHA 4LF1A 1G6BA 2NLWA 1IKVA 3R9LA 1Q8IA 4DOZA 3WIUA 2MZSA 1SJFA 5I3UA 3MOJB 1MW7A 3Q2TC 1T95A 2JZ5A 2GHVC 2NPFA 4RL1A 2XS2A 5H9EK 4C7HA 1Q4RA 4J90A 3OT9A 2Q6CA 3F73A 3T3FA 5CZVA 3PEIA 1CBXA 1BLLE 4IRKA 1XNRF 3CCES 1X0PA 2W24A 4ECYA 2IA6A 4FXVA 1MSWD 4NZ6A 2WONB 1T9VA 3MPWA 3HSZA 2ADCA 2F65A 1KUYA 3DFEA 4QBJA 1S1TA 2DGOA 1ZOTA 4JI0F 1NPKA 4QBUA 2JEJA 3MMCA 4Y2KA 1UVIA 2KFYA 3ISXA 4YB6A 2EK1A 4WTOB 4PV6A 4FS2A 2NUUG 1RTJA 1Y9OA 1Q16B 4NLVA 3QZ7A 1UEUA 1QSNA 4C8MA 4F50A 3TOBA 2DNYA 4RWWA 3PW7A 4ECZA 2ALYB 1RT4A 3PYEA 4UZBA 2OLWA 3EUNA 3OW2R 4XPKA 2KXFA 3MM5B 4JLYA 4MY3A 3EX7B 5KFDA 5LYDA 3AT1B 3THVA 1NJZA 3G9CA 1BQXA 4M95A 3N6LA 5E2QA 1N5VA 1ZM9A 2IRXA 4OC4A 2IYGA 4ANCA 2GAHC 2R7WA 3MM7A 4F3MA 3G6YA 5BR8F 2YNHA 4F8RA 2QECA 1IKYA 2XMKA 5CAAA 2HV2A 3SEOA 1RTQA 3MCSA 2OR4A 3DOKA 2OPSA 3MPYA 1PJ6A 1I1GA 2OTLS 4IG0A 2QV6A 5C2GA 2BRKA 3K58A 1RT6B 4DG1A 1U0SA 3FVYA 4A8FA 2CRLA 2PD1A 1U1LA 1U47A 1SJQA 5HXDA 4AXVA 4JI6J 4DS5A 3AQOA 3KMQA 1CJKA 2ATCB 3DSBA 3SSQA 1YJNS 4P9SA 2XSJA 1FJEB 1RXOB 2HQDA 2M5YA 3GJRB 4QPTA 2UUAJ 5HLFA 1J2VA 3R5CA 5DWMA 1D09B 1BPMA 1FEHA 3HVAA 2ZNZA 4U9RA 2CPYA 3D7GA 2RDIA 3MM7B 1Q8KA 1CVJA 3VAHA 3KLFB 4ZDNA 2MSSA 2LMIA 2FJBB 4F0XA 2UXBJ 5A8WA 1ZLIA 1BQNB 2M70A 2F8EX 2VPZB 3Q23A 4CYQA 3RYLA 2FD2A 3IXQA 3PRVA 3IC1A 3KMSA 3CDUA 2GJFA 1N0UA 3S6GA 3D7HA 4QYZK 3DCAA 3PW2A 2PO4A 3W7BA 3M8SA 3M8QA 4FBEA 4X66J 3FYNA 3T5HA 2EEYA 3C6UB 4MTPA 1ARMA 3BBCA 1ZAWA 4DNCA 4OC0A 2VJVA 4X64F 1PGZA 5EWFA 2DT9A 1CM0A 1S49A 1WC0A 1CJVA 1CSJA 3IM9A 3SFUA 1S6QA 2MY7A 4P7TA 2GZOA 3OLAA 3HVRA 2CPJA 2UP1A 3ZXWA 4X4VA 3FJUA 1WKLA 5CHCB 3V81B 1HMVB 1B0TA 2QTWA 4ZLJA 4M5IA 2FJWA 1DJ0A 2KDOA 2HIYA 3MXHP 3OFGA 1TK5A 4USJC 5IS2A 2KFZA 1NBEB 4MCPA 4F4YA 4F3QA 2QMLA 3RTVA 1FJCA 3JQKA 3RUBL 1N33F 3RR7A 5KFWA 4LR7A 1Y7EA 1XMOJ 4PUOA 3EVOA 1Q7YT 4RNFA 4A46A 1YZ6A 4KKOB 3Q89A 2JC1A 5J2QB 3W65A 2XMJA 4CNZA 4A32A 1X5PA 4KC5A 1FHTA 4OZLA 1CJUB 2FVCA 3WBZA 4DR3J 4ZCKA 2VDIA 1FD8A 1DARA 2PSZA 3MAAB 2CZ9A 1HL6A 3KJVB 3EO4A 1A2ZA 1ZH5A 1U25A 1JLFA 1TAQA 1TL4A 3QATA 1NK5A 2XTJP 1N54B 4L73A 4KHPJ 2VQFF 2BUNA 1NSLA 2PDAA 3KWMA 4RW7A 4FD5A 4NGRA 5C24B 1ZG7A 1CJUA 3VR1A 2DCLA 5LMNF 3QRRA 2HUZA 5KG7A 2V8HA 4OYIA 1RXTA 4ETZA 1SJ3P 2CY2A 2C2KB 1QJHA 3OD2A 3O8WA 4HLBA 4OI2A 2DB1A 1UVJA 2PMWA 3DRSA 3MAQA 4P4DA 2XHCA 2X7BA 3V81A 4B3OA 3NG8A 4Z37A 1FRLA 5EC4A 4EYIB 4KO0A 3G6ES 4OQJA 5KFNA 4M5MA 1R57A 1KONA 3PB7X 3NFZA 1TVRA 3D6TB 4KHMA 2OZHA 4P4JA 2HFVA 1WG5A 3DYAA 4HI2A 3SSSA 1S1VB 4F0KA 1HR0J 1GXUA 1AZSB 2CIMA 1OY6A 1QAYA 4M8LA 1XTZA 1C1BA 2AF6A 3DLJA 3CCMS 1X9WA 2HNYA 3CB4A 4MIWA 4MT1A 4B11A 2H5IB 2R7HA 4OJ3A 4JI6F 3V5RA 4KB7A 4DR6J 2C6PA 1JLQA 3ZTRA 2O01C 2W9CA 2HGNA 1QAJA 2JFKA 3PYFA 2RUGA 2YH0A 1FJGF 1JK9B 5B0EA 3WQPA 1YSJA 2XMWA 1F5BA 2DGWA 1BQNA 4TU7A 4J37A 1YITS 5GADU 2ASYA 5C7PA 5DLGA 2ZEFA 2OUGA 2ZHAA 3IRXB 5KFOA 3T1YJ 2N4CA 1N6QB 3MEKA 1KS2A 3ETOA 4GC7A 1QQ9A 5GAGU 1Z2ZA 1NMEB 2J9CA 1JJ4A 1I12A 3DMJA 5JJBA 1WWHA 2B4OA 4GKKF 2JDDA 1MG7A 3EPGA 4JXQA 2ZELA 2QSWA 1HNZF 3E01B 2Q7SA 4L89A 3MAAA 1FI4A 3A3NB 4R0JA 5LOQA 2KZZA 3CMAS 1XMBA 1VQKS 4ANDA 2VC1A 5KT3A 2HVIA 2PJ3A 3NH5A 3Q24A 1S99A 5J1QA 3CT9A 3OWCA 5D0EA 3TO9A 4E0DA 1XMQF 2EFOA 4J9SA 2GC8A 4ZA1A 5LSRA 2KVIA 2G2OA 3M8PA 2W9BA 3H5UA 4UF4A 2HBQB 1QSMA 2H4WB 5G4DA 3EXCX 1C4CA 3PYDA 3GIJA 5E96A 4AG9A 4WFNQ 2XC9A 4C2ZA 2F7VA 3I55S 2DCUB 1BAVA 1PYOB 4NLUA 3M8RA 2X7IA 2Z3NA 4K4ZA 2HWTA 3K5LA 1NEEA 4TY8A 2FB0A 3H4DA 3EVWA 3KL9A 1DE4C 2WSCC 3S01A 3J7ZT 3C8YA 4KORA 3D66A 3LUYA 2CQPA 3M8WA 4UUXA 1F0XA 3H59A 4ELTA 1H8LA 3B2YA 3K5NA 1OWXA 3FECA 4RI1A 1SBRA 4JI4J 4B08A 3FBCA 3GLJA 5DZ7A 2BANA 3FUYA 2QRRA 3M8YA 4OADA 2MQMA 4A31A 2V50A 3KLVA 3FX6A 1RHJB 3MEEA 4ECVA 4LJMA 3EVMA 3UNYA 4JI0J 4OX9J 1MMDA 4HHHA 3G2XA 3CCUS 3RBDA 2XWYA 4ZVFA 5L39A 4H4OA 2NR0A 3QAHA 4FYYB 2Z2YB 1UFHA 3NGTA 5KT4A 5AGEA 4B3TJ 3TRGA 4HVZA 1VQ8S 2PIIA 1HNXF 1MN7A 4FYXB 3UN2A 2ZEOA 1A6LA 4DMZA 4F2SA 4LIWA 2PR8A 4DR4F 3UCUP 4F67A 3MM6A 4USHA 1AXQA 3IIBA 1DLOA 1Q82T 1U1NA 4GRSA 4NI2A 5DQHA 1PYSB 4DFMA 2IDEA 1A0OB 2MQOA 2N7YA 1LW0B 4A48A 4FPIA 4CLZA 2Q4VA 4ERDA 2P6GA 2EW9A 3TP2A 3T1HF 4KAIA 4CP5A 3FMWA 5HVHA 3KQXA 4EYHB 2HC9A 1X8DA 2FLPA 4PZVA 2QA4G 4MFBA 4HDGA 2HK2A 1NJWA 3SFGA 1VQ6S 3OL7A 1ICEB 1M1DA 5CYJA 4BBYA 1OY9A 3H2VE 3TUIC 5AG5A 4J9VA 4M5LA 2ZH4A 3QB8A 3NP5A 2QL5B 1UAWA 3I82A 3VARA 4QWBA 4KPCA 4YB1P 1Y0YA 3OHBA 1KKHA 2XQCA 3CJTA 2EK9A 4QIGA 3RNZA 4ZJOA 4H4OB 5EX0A 2HW3A 1F9HA 2H48B 1WUUA 3U02A 4ZPWR 4DR3F 4YB7A 5JUMA 2PJCA 5B0BA 4OYZA 3H0PA 4DPTA 3N6MA 2CDRB 2DHGA 1K9MT 2I0XA 2ZVSA 3HM9A 3MAHA 1IBLJ 1U2RA 3JAMY 2CJ9A 2Q4ZA 4P72A 2XGQA 4F2RA 2BW2A 4GC6A 1JJ2R 2UXDF 1VC6A 4JV2A 5E5NA 2D3ZA 1IWAA 2ZITA 1N36J 2KHCA 3P96A 4ZY1A 1H98A 4W9YA 4TLQA 5LXYA 2CNNB 3DN9A 3GB0A 2PJ8A 1NDCA 4MJKA 3TARA 5D6GA 2E5GA 3IJ3A 2I1RA 3DRXA 2HBYB 2QLBB 3GIKA 3D6MB 1SKWA 4OV1A 1WF1A 5K8NA 3UE2A 3MR3A 1R8BA 1CJWA 3OFFA 3IG1B 2E5IA 3LP0B 4A8YA 4IK2A 4EFAC 2V9KA 1KTVA 3ZNUA 5J1PA 5GAGI 1X4HA 1S3ZA 2DR8A 4LRDA 2ZW5A 1LWCB 3PDNA 2H5MA 1VI7A 1RYSA 4ED7A 4OX9F 1Q53A 4K0KJ 2WBRA 5FDLA 2XG8A 1F9EB 4LFCJ 4UCNA 4KHRA 2M88A 2OD6A 2VOPA 2BE2B 3KLGA 5DQGA 4K50A 4DFJA 3W1YC 1T11A 3JYTA 1ZM3A 5ETRA 1RHQB 2HRTA 2ANPA 3MM5A 4KSFA 3ADAC 1HQEB 5KTDA 3GV5B 1VRQC 1XMTA 1RU2A 4A30A 3PV8A 2V4JB 4ICLB 4XPCA 1VHIA 2DNRA 3BGOP 4K5RA 4MCQA 5SUHA 2DJWA 4L74A 4PWDB 4CLTA 4Q36A 3F8KA 2RS2A 4P2XA 3I32A 3BXMA 3B3WA 4JI5F 1RHKB 1R89A 5C25B 3R9GA 3HHLD 3KHXA 3VGUA 4MKVA 4OZJA 3DRPA 1IU8A 1XMQJ 2GQQA 2J9DA 4ZVTB 1S7KA 2BA9A 8AT1B 1RAFB 4F25A 4B5PB 3FCVA 4RU9A 2ZHOA 2Z3MA 1IOIA 4ED6A 1MMNA 1UFKA 5C5JA 3C14A 4M6HA 2EI5A 1RT3B 4QJVA 5A8WB 4I6YA 1T9UA 5AXKA 3ZJ0A 1FVSA 3CF5Q 2WVCA 1HBNA 4MHZA 2PMHA 5BXIA 1NCLA 1XR7A 4ZYQA 2MJNA 1WI8A 4Y2MA 3Q22A 4XIUA 2Z2LA 1Q5VA 1XF8A 2FGOA 2VD3A 2V63A 3PR5B 4OX7A 4Y2CA 2CA9A 3LAMA 1S7HA 4A2ZA 2ABYA 5DS0A 4N47A 3D6FB 4WZMA 1VHEA 2OGUA 5J1EA 2VU5A 2OFGX 3G8QA 2VFTA 3GZ7A 4LR9A 4YY3F 5AJ3F 3KNAA 4YUDA 1LWFB 2BR0A 3KHHA 2AJQA 1O5JA 1GFWB 4P6YA 4OJ1A 2I2YA 1E6YB 2CQ4A 2GMJA 4DX7A 3QLHB 4HNXB 5JGFA 3GYGA 4FS1A 5H86A 2PCUA 2MSTA 1PC4A 1RWKB 3GFZA 2H3EB 1F9FA 1UJ6A 4RW6B 4A8KA 3H4QA 4JI2F 2JLGA 1M4IA 3DR6A 3KK2A 1OMSA 2UV8G 3ZFVA 1DTTA 2R7TA 3V7ZA 1HA1A 1EE3P 1QSRA 4TY8B 4K4VA 4NLTA 3THPA 1AFIA 1CJVB 5EWGA 3ZTSA 2WPWA 5A8RB 3Q8PB 3AB4B 2FVGA 4KGZB 1SIZA 1HW9A 3RBEA 2N4DA 2BXJA 3MMAA 1YMEA 2J8SA 2C2EA 4C7QA 4CAFA 1KLMA 2KCWA 2IAJB 3EJMA 4NEZA 1B64A 5F8HA 1F2GA 1TL3B 1JJHA 4XO0A 4A8XA 4O0IA 4LVNP 2MQQA 4CS0B 4ZBGA 3DLKA 1SQEA 5KFVA 1NXIA 2DPTA 5F8NA 2FVQA 4WPAA 2CTCA 4WTYA 1LW2B 1IM4A 1KHVA 3P45B 3F0AA 1ZAXA 5HATA 3OXLA 2QLFB 4KJIA 1CJTB 3I0RB 2JSXA 2F9DA 3C15B 2J6TA 3DYAB 2AD9A 1V0CA 1TL3A 3EWGA 1KC8T 4K8RA 3V6JA 5A0YB 3IWEA 2VQEF 2ZOFA 4CAEA 3MPVA 2WZNA 1VRTB 3H8EA 2YKAA 3IMQJ 5K9FA 1T9XA 1F5AA 4KVOE 1QM9A 1VBZA 3JTOA 4IOAQ 1RT5A 1NSAA 5ELYA 1JMTA 4RW4A 4IG3A 4NCAA 2EFGA 4H54A 4P2MA 2HFOA 2Q79A 3TI0A 1UL3A 1XIQA 4IAVA 1HNZJ 3IWXA 1U1OA 4ECSA 5ETVA 2L08A 5DM7Q 1FJ7A 1XQIA 2FVSA 4L76A 1YRTA 4V19X 4L3NA 1KSPA 4QU6A 4AVCA 3EXNA 2LXIA 4A8SA 2ACYA 1CULA 1JX4A 4HKQA 1RU1A 4CYNA 4FD4A 4F4AA 4J5OA 3S1TA 2C2NA 4K4YA 1UW4A 2QGFB 3KK3A 4DV4F 2MGZA 3UFCX 2FLLA 4ID5B 2K7JA 5ITHA 2YNGA 3OUYB 5CA5A 1JLBA 1HWLA 2B56A 2CVEA 1DQ9A 2DGSA 4CCHA 4FF4A 5KT5A 2HFZA 4ZMMA 1D0EA 4IR9A 1NM2A 2Z11A 2WYRA 1L3TA 3W61A 2KG1A 4DQIA 1QMUA 4NGTA 3GCWP 2KRRA 1HFEL 2BE7D 4R57A 1YJVA 2QJ3A 1ZTWA 2RFHA 4CGLA 1YJTA 3KKWA 1YLXA 3NS7B 2OEMA 4U95A 1IBMJ 2VG7B 5T14A 3RRHA 1HWJA 1X10A 2C3PA 2HQ3A 2RRNA 2F5GA 4ETXA 3KLIB 1TR0A 3JSMB 4KGVB 4MRIA 2ZDOA 3DOLA 2VZ9A 3GIRA 4N56A 4B10A 1YVFA 4RNNA 2Y1IA 1OYEA 4FNIA 5J8CA 1QSTA 4USIA 1HYSB 3DU6A 3I96A 3KJVA 3SJXA 2CJXB 4RW8B 3R3TA 2DIUA 4B3TF 1L3UA 4DEZA 4R9MA 4CLYA 4UFWA 6FDRA 3ILLA 1S1VA 4RNOA 1ZM4A 1SVDA 2F4FA 5DDOC 1FFSB 3V38A 5HJYA 3DDKA 5AT1B 2X1GA 2J7UA 4AB7A 2Q6BA 2V4JA 4X4OA 3RAXA 4PABA 1S7LA 4PXBA 3RR8A 3KLEA 2QSFA 5ETLA 2QZ8A 2BJ3A 4O0NA 2K3IA 1S9FA 4OYXA 1SC4B 4I2QA 2IC3A 3TWZA 2MEWA 3BDEA 2FDNA 3TTHA 3I5CA 4RNMA 3TUJC 2ZZMA 4XAKA 3HFKA 1S60A 1BXNA 1EETB 2Q7BA 3ZZ0A 2FYXA 2C3OA 1WEYA 4XNHC 2ZH9A 3N01A 4DV6F 4UW2A 4EMEA 3OR2B 2UZAA 1EKRA 1FE0A 2KXHA 2YWHA 2OU2A 3PP9A 2UV8A 3OTOF 2V8PA 3F56A 3O3LA 4NZ0A 3HHLC 4ILRA 2AE6A 4GO7X 2VG6B 4CTAB 1WC4A 1U1RA 1EB0A 4ZPVR 1M5OC 2GNKA 5F9LA 2Z3KA 1VRTA 5HH1A 3EDQB 4C0BA 1Z9UA 3RB0A 3DGPB 2AWZA 2NPIA 5FDLB 4EVYA 3FZBA 4B9SA 4RWXA 4LUAA 2VQYA 2CZVC 2XZTB 1YRUA 1ZPVA 4USMA 3M9OB 4QR2A 3MI7X 2Z2ZA 1CJKB 1LWEB 4ZI6A 2R7VA 4A37A 2QA1A 2DXEA 1TF8A 3DNCA 3PHEA 2PJ7A 3GY9A 4DR1J 1E6VB 5H9FJ 3AD8C 4CLSA 5KG4A 3DGVA 4RR5A 5SZTA 4K2JA 2VFRA 4K0KF 3PZPA 2O28A 1LV5A 1NJYA 5K8PA 3TA2A 3NH4A 4YP3A 2GFFA 1RT7A 3I5BA 1ZYQA 4KLVA 4J3GA 2G3AA 2Z4PA 2R7OA 3G6VA 4YR3A 3WC0A 2HS4A 5D4OA 1RJJA 3LPYA 2LU1A 4IHMA 3SCJE 2RF2A 3MD1A 2BJ7A 2GGPA 2A1BA 4C8ZA 1R6YA 1OPZA 3B35A 2LQBA 3M8PB 2AU0A 4Q2MA 3HT0A 2JEWA 2YNIA 2ZH3A 3F5BA 4X62F 3CXPA 4KR0B 4WIIA 3DLBA 1KFDA 3K8VA 1XE4A 1FWLA 2IJRA 4KE5A 2DHAA 1B0PA 4WIQA 4G1PA 3PCOB 3WDOA 1TV6B 2OPRA 1VQSA 3R95A 3HF5A 4ZLLA 4C4WA 2QA4S 1F57A 4IOCQ 4OI1A 1VBKA 3VGSA 1VQPS 3IA0A 1ZS6A 2DNNA 2G0BA 3GV7B 2YH1A 2XZWA 5G21A 4ALZA 3UD4P 2OH2A 2WVFA 3C16A 2GJ2A 1XBUA 3BO3A 3F0NA 2FHKA 4ZK7M 3L7PA 3AAWB 3J7YU 3RB6A 2XNQA 2KKHA 2V8VA 2YKQA 3ZTQA 4DJBA 1MWZA 2XMAA 2YXLA 2EKNA 4NLGA 2C1CA 3QO9A 1HMVA 4O23A 2CQHA 4OYMA 3HP6A 2LEPA 4JBCA 4LRCA 1BWEA 3LACA 2VQFJ 4WP8A 2YNCC 4LREA 2GX8A 1YQEA 2PA8D 1VOMA 4FVCA 3BKTA 2BUEA 1FE4A 3T5JA 2NZCA 4DCPB 1RAOA 1K1QA 4O3QA 3VALA 3ZZTA 1RBLA 1KOOA 2IPOB 5H9FK 2JBJA 5FLXY 1HWKA 3R1HA 2JH3A 2PC1A 1YJWS 3MZIA 2LU2A 2AFZA 3VGTA 3K8WA 2XO7A 1AYEA 4OLLA 1NKCA 2W01A 4CO2A 2REEA 5J2PA 2E7XA 3OQ2A 3TANA 4MKAA 3M05A 3DNSA 5D0HA 2DNGA 1PKUA 3B82A 2XBPA 5D15A 4YDXA 3OJSA 2GU2A 3A8EA 2E7WA 4DR4J 5KTCA 2C2RA 3MEEB 2CADA 1T9YA 3B6BA 3FB3A 2AFMA 2YKNA 2R8VA 1H0HB 4WK1A 4WE1B 4KOYA 2LECA 1IQZA 4DUTA 3KFWX 4I2PA 3R1LA 2JDCA 4F04B 3BGLA 5I3PA 3LGHA 1SKSA 4I0WA 2BQ3A 4DR6F 4A94A 1CEZA 2VICA 4HNWB 3ZZRA 2K2PA 1URRA 1YLOA 3A8JA 2VEZA 1SC6A 1X60A 4DV5J 1PC5A 4DV5F 4PSXA 2QLJB 2IA0A 3RBUA 4FBUA 3KHLA 4TWEA 3C6UA 2ZEDA 3V8IA 4N76A 4P4EA 1S1WB 2MDAA 1TL7A 3K59A 1T02A 1P1TA 2K5TA 4RW8A 4NSQA 2WAQD 3FZ2A 3KYLA 3BSOA 3QWUA 3EZUA 1U2CA 3GJQB 1GQEA 2ZOMA 4NLWA 3PXGa 2D74B 4H4MB 1SH3A 3W3SA 1JWQA 1S6QB 4C9DA 5CQGA 1GAOA 1KVIA 2ZXVA 2MPUA 1WC1A 4NL5A 2NZ4A 3NL0A 4M5NA 4M5GA 1RWUA 2Y1RI 4DV7F 4R0EA 2XCAA 2FIAA 4IDKB 1JLAB 4I67A 4PWDA 2HFNA 2DGVA 2PVVA 1S5KA 2L41A 4NXNJ 1SL1A 3U27A 1FERA 1VDHA 2W4CA 1Y10A 1RKJA 2LDYA 5IOLA 2VZYA 4NXMF 3H7HB 5HQLA 1VRUB 1CS4B 2D9PA 4NJRA 4ZP7A 2VFUA 4FZVA 2PA3A 4CH1A 2BJDA 4DX5A 1RTHA 4C97A 3NS5A 3D2MA 2B7BB 3KDOA 1FA0A 2KYZA 3BN7A 3KZWA 1F2HA 1IOFA 2BE2A 3KLGB 4LVOP 1TKHA 3SQGB 2L9WA 1Q0NA 4DUKA 3R5GA 2PJAA 1VCTA 1D9AA 3TQ1A 3AH6A 3PR4A 2ZHBA 4B13A 2C1EB 4HTIA 4RLEA 4G65A 5DETA 2IVFB 1ZLHA 1B7FA 1ZAVA 1IBMF 2YWGA 1H3DA 2J0SD 2H5EA 2I9SA 1H74A 2CKWA 2W2PP 1RGVA 2B4VA 3MCNA 3QRPA 3V4MA 4DFKA 1JLGB 4ZCLA 4QW8A 1T05B 2G0IA 5HVGA 4DHVA 1JLCA 1SB6A 4MY0A 5ETPA 1RA7A 2AFOA 5IZHA 2K7KA 1XBWA 3NY0A 3GR0A 2EFVA 4O3OA 4B17A 2PEBA 4NEXA 3W62A 3CCVS 4P6QA 2DITA 4ILLA 2G4BA 4CAXA 1YQHA 4CYUA 1FY7A 2QC3A 2ZJQQ 3PW0A 3CULA 4RZRA 2W7AA 2C27A 4JWPA 2PJ5A 4PK2A 3O2IA 1GNKA 4KLWA 2RB7A 3TT2A 1UETA 3G82A 2K3KA 3MM8B 3FCHA 3TVYA 2A6OA 3QGIA 2GANA 2HFUA 3NCPA 2G2ZA 3T1HJ 2F63A 4HH0A 4UEFA 3O1LA 4HL9A 1TU0B 4DG1B 3J81U 2J5AA 4DZDA 2ZW7A 3T5LA 4FXWA 2RF2B 4DV2J 2XS5A 2HS0A 1IBKJ 4LF7J 3BR8A 1RT2B 2P9CA 4KYZA 5IC6B 3J80U 4M94A 3AD9C 4AL5A 4X4PA 3UN5A 2GIVA 1N32J 1KD1T 1E6VA 3MMBB 4FNHA 4Q45A 3HVTA 5LRKA 4MKYA 3SJEA 2P2CB 4USVA 1QE1B 1TIQA 2FJVA 3LPEA 4IQMA 4M85A 3OHAA 2AIRB 2BSWA 2WONA 4G6VB 3EICA 2WSAA 3KLFA 2HG4A 3VWSA 3QIPB 2VZZA 4WKYA 3IWLA 4XDDA 5J2QA 2KJWA 3TO8A 3W91A 4K4TA 1Z8TA 4WXOA 2YQ1A 3BF4A 3BQ1A 4H4KA 3UR0A 3HI9A 1JWWA 2QL9B 2ZWOA 3IGVA 1WHWA 1Z1ZA 4BC7A 4PXEA 3NA6A 2U2FA 3GIUA 1WDTA 1HD0A 4B9NA 5LM7E 1FF2A 3CVKA 3H25A 1U1MA 2CPFA 1FKOA 2YWWA 4CPAA 3TOQA 1NK7A 3ZZOA 2C2ZB 1C0TA 1ZA2B 3CDBA 5B09A 5A27A 4FKYA 3RRGA 3QNWB 1AROP 4F6AA 3G87A 1BQMA 2JLMA 1XEZA