4G1PA

Structural and mechanistic basis of substrate recognition by novel di-peptidase dug1p from saccharomyces cerevisiae
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
480
structure length
479
Chain Sequence
MSHSLTSVFQKIDSLKPQFFSRLTKAIQIPAVSSDESLRSKVFDKAKFISEQLSQSGFHDIKMVDLGIQPPPSTPNLSLPPVILSRFGSDPSKKTVLVYGHYDVQPAQLEDGWDTEPFKLVIDEAKGIMKGRGVTDDTGPLLSWINVVDAFKASGQEFPVNLVTCFEGMEESGSLKLDELIKKEANGYFKGVDAVCISDNYWLGTKKPVLTYGLRGCNYYQTIIEGPSADLHSGIFGGVVAEPMIDLMQVLGSLVDSKGKILIDGIDEMVAPLTEKEKALYKDIEFSVEELNAATGSKTSLYDKKEDILMHRWRYPSLSIHGVEGAFSAQGAKTVIPAKVFGKFSIRTVPDMDSEKLTSLVQKHCDAKFKSLNSPNKCRTELIHDGAYWVSDPFNAQFTAAKKATKLVYGVDPDFTREGGSIPITLTFQDALNTSVLLLPMGRGDDGAHSINEKLDISNFVGGMKTMAAYLQYYSESPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Basis of Substrate Recognition by Novel Di-peptidase Dug1p From Saccromyces cerevesiae
rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Cys-Gly metallodipeptidase DUG1
total genus 144
structure length 479
sequence length 480
ec nomenclature ec 3.4.13.-:
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1pA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4g1pA01
3KASA 4ZY0A 3D7HA 3BHXA 4R76A 1CPXA 3CT9A 4MHYA 3KGQA 2BO9A 4YU9A 3K9TA 4KSIA 1ZG9A 3D7FA 1TXRA 3RZAA 4P4FA 4LQGA 5HVFA 8CPAA 3CPXA 1AMPA 4A39A 4NGPA 2ZOFA 4DJLA 4NGMA 1JQGA 1YSJA 1Y0YA 4P4BA 4UF4A 1ARMA 2WYRA 1IGBA 3KHXA 1VHOA 2VL1A 1F57A 3VARA 3SI1A 2GLJA 3NH4A 3NH5A 2XEIA 1H8LA 2PVVA 1FNOA 2PJ2A 5HXDA 4MCRA 3KHZA 4P45A 3PB6X 4ZI6A 2NSMA 1TKJA 3IC1A 4X8IA 2AFMA 4NFRA 2PJ1A 2ZEDA 2PJBA 3LMSA 3SJEA 4G1PA 2ZOGA 1F2OA 1EE3P 4TWEA 4UIBA 2ZEMA 3JRUA 2PVWA 1LFWA 1ZG8A 3KL9A 2GREA 1LANA 3GUXA 5DS0A 5THWA 2C6CA 1R3NA 4MHZA 2EK9A 2CIJA 4R8FA 3NA6A 2AFWA 4MHPA 4UEZA 1CP6A 2HC9A 3PFOA 1HEEA 4Z65A 2GU2A 2POKA 5LYLA 4UIAA 2OOTA 1XMBA 3ISXA 1YW6A 4OKOA 4F9VA 5K8OA 4MCQA 1UWYA 2CTCA 1XBUA 2CF4A 2ZEPA 2PIZA 3FMCA 4JZ0A 1YMEA 5D8NA 3IEHA 2V8DA 4P4DA 1XJOA 4NGNA 4TNUA 2XEFA 4F8ZA 3KR5A 4ZY1A 4UEFA 1HDUA 3HLPA 3PB7X 3DLJA 2AFXA 4NJQA 4H2KA 3ISZA 3SI0A 3V7ZA 4IK2A 4ONWA 2ABZA 5LYDA 3FEEA 3GLJA 2ZEHA 1ARLA 3BI0A 2AFUA 2JBKA 5J1QA 2C6PA 5LYIA 3S9MA 3B3WA 2G9DA 4A38A 4O23A 3SJGA 1VIXA 2O4HA 5JGFA 4ZYQA 2ZEOA 4OC5A 3H8GA 3KR4A 5D29A 1QMUA 4FWUA 1Z2LA 4X2TA 4ZY2A 2F7VA 3KQXA 4P4JA 2PJ6A 5LRGA 4IHMA 1TKHA 3VATA 5F09A 4PXCA 2IMOA 3WC6A 3KQZA 1CX8A 4UEEA 4OIDA 4WWVA 1LAMA 2Q43A 3BI1A 3H8FA 4GM5A 2PJCA 2C6GA 3D67A 3WT4A 2EWBA 1KWMA 3HUVA 1Y0RA 4MHNA 1XRYA 4A94A 1CP7A 1R43A 4P10A 1OBRA 3IO1A 3T8WA 1CBXA 2QVPA 1XFOA 2RFHA 3PFEA 3CDXA 5CPAA 3MN8A 2PJ3A 1VHEA 3WC5A 1HDQA 4OC0A 2ZENA 4P44A 3NH8A 1LAPA 3QNVA 3V38A 3MRUA 3TX8A 1VGYA 5JM6A 4PPZA 2PCUA 1LCPA 2PJAA 6CPAA 3PB9X 1DTDA 3D7GA 1FT7A 2CTBA 5K8NA 3DGVA 3TC8A 2ANPA 4EMEA 7CPAA 1M4LA 4IAVA 4OC1A 5I4MA 3WC7A 3PRTA 3B2YA 2V77A 4W9YA 4OC2A 3D68A 4NGRA 5JH9A 5IB9A 4CPAA 3PB8X 2IJZA 1BPMA 4OIWA 3KZWA 2PJ9A 3IWWA 2PJ5A 4K3NA 2PRQA 4MMOA 2F8HA 4F9UA 3S9LA 4MCPA 3B3CA 1RTQA 4PXBA 3SJXA 3LWUA 4P4EA 2JBJA 1Z5RA 4FUUA 4X3RA 4PXEA 1F2PA 4ZX8A 2ZEFA 3D4UA 4PQAA 2V8VA 2ZELA 4P6YA 2WZNA 3BXMA 2Q4ZA 2EK8A 4R7MA 2XEGA 2V8GA 1Z8LA 3PEIA 1YLOA 5ELYA 4EFDA 3B3VA 1TF9A 4NGSA 3VH9A 3WABA 1ELMP 5HVGA 3L2NA 5K8MA 2BOAA 3IIBA 2PJ8A 3FH4A 3SJFA 3FVLA 1PYTB 5LRKA 4AXVA 1NSAA 4B6ZA 2PJ7A 3N5FA 1ELLP 3D66A 2NYQA 3B3SA 1ZLHA 3CPAA 4BD9A 3B7IA 2GLFA 4DYOA 2BCOA 2DEAA 1QQ9A 3RBUA 4ZX9A 1CG2A 3PB4X 2AFOA 4YWYA 1TKFA 3RAMA 2C1CA 1BLLE 2AFSA 2ZEEA 5K8PA 3S9NA 2QJ8A 1BPNA 3NFZA 4R6TA 2XEJA 2JEWA 3H8EA 2QYVA 1DE4C 2PJ4A 3IJ3A 4FBEA 3PBBA 4Q7AA 4MCSA 2PE3A 3FX6A 4DUKA 4OMEA 5LRJA 1YW4A 2HB6A 2PJ0A 3FJUA 2RB7A 1IY7A 3B3TA 5CBMA 5LYFA 3KI9A 4OP4A 4WJBA 1Y7EA 4OC4A 2IQ6A 1TF8A 4NJRA 1ZG7A 1ZLIA 4P4IA 3FF3A 3PBEA 4NGTA 4RUHA 1GYTA 3K2KA 3FEDA 1Q7LA 2ZEGA 2Q51A 3D7DA 2J9AA 3SI2A 4JYWA 4PXDA 3FECA 4A37A 4OC3A 1BAVA 2V8HA 1AYEA 1LOKA 2PIYA 4MRIA 3GB0A 4EWTA 4MXUA 1PCAA 2FVGA 5HVHA 2I3CA 4FAIA 4NGQA 2AFZA 3IFEA 3I1UA 2OR4A 3B35A 1CPSA 2O53A
chains in the Genus database with same CATH superfamily
5C42A 3FXTA 1D3WA 1CPXA 1VFJA 4KT0C 2VV5A 1HLWA 3M8PA 1HBOA 3MPUB 4ZDNA 5EWEA 1S0VA 3RR8A 2BE2B 2GV1A 1RAIB 3G71S 4F0XA 1JQGA 4DLGA 2R7XA 1ARMA 3F44A 4LREA 1BOBA 3KLEA 3BEGB 3ZZPA 1DJ0A 2PJ2A 3E01A 2HNYB 1C1BB 1RWWB 1HQUB 3LP2A 3DGPA 1TR0A 3W5ZA 1UPPA 2BEIA 2B4DB 1U1LA 4OZ1A 3UDCA 5DDRC 4J9PA 2PJ1A 1HA1A 2BE2A 2ASDA 1AW0A 4QIEA 1TL7A 2IYGA 3FFIA 4DR7F 2YNHB 4FDFA 5A76A 5IB0A 3NLCA 1Q5VA 4IDKA 1SB6A 3HHLC 2JDDA 4TLQA 1KTQA 3EJMA 4QW8A 3A8KA 4LIRA 2DGQA 3ZNJ1 2HRTA 1FKOB 1BQNB 2ZH4A 3M32B 2VPWB 3I4PA 2ZM6J 3I5CA 3VAIA 4YGOA 5CAAA 5KT4A 2HHVA 2R3VA 3RRGA 1YQHA 1S99A 4OHZA 4PQUB 4TYBA 3TFYA 1C0UB 2MQNA 2CZ4A 1W26A 1GMWD 3SI0A 3OXFA 4F4WA 2ZC4A 2UV8G 4G1QB 3MOZA 3BI0A 5L9NA 2DY1A 2JBKA 5K9FA 4ECTA 2OEKA 1OJ4A 3C46A 2E1AA 3M2UA 3N5BA 4OC5A 4DR5J 1C2PA 1SJ3P 2PGCA 2C3MA 3KQXA 4LR7A 2NUUG 2GIFA 5EWGA 5B0GA 2VQFF 3VWEA 2AGPA 2IPOB 4PXCA 2IMOA 4C8NA 3FBUA 1Q8LA 1BXNA 4NX9A 4DG1B 2NXNA 2XI3A 1XR5A 4IG3B 4PABA 5J1NA 5DLGA 2PJCA 4ILMA 1VK8A 5ETTA 2KCWA 5ISVA 1K0VA 2R98A 4CGLA 4P10A 1KDNA 4KSEB 2OJ3A 3SI8A 3CCJS 3WIVA 3PFEA 2EFVA 3LGNA 1RB0A 1S97A 3ILLA 2XB2D 2BSWA 1D1UA 2XCAA 1HR0F 4LRBA 1HKAA 2D1CA 1RJJA 4KE5A 2BM1A 3O3LA 2FHMA 2QG9B 4H4KC 3OVBA 2QN6B 1F1BB 1FJGF 1XNRJ 4HYKA 3TC8A 1TAUA 2DNQA 1FJ7A 1XEBA 3ENWA 4YFJA 2G2YA 2HGMA 3VAFA 3CJRA 5JH9A 3LGHA 2FVCA 2OELA 3GJQB 1BPMA 4X66J 1FXLA 1YWXA 3VAHA 2CNNB 4LF2A 5E0OA 1RTHA 1QSLA 4I2QB 3SYZA 1KQSR 2YNDA 2JJ4D 2MY8A 4IH7A 4UFWA 2Q7SA 1Q95G 4K3NA 3E3XA 3T6JA 3TZWA 2OO4A 1E6YA 3MM6B 4LFAF 2JBJA 1FWPA 1WOOA 5KFTA 3GYGA 3QFWA 1WG1A 1WEXA 4NXNJ 1O6XA 3MM6A 3AOAA 4QB9A 4NLDA 4NZ7A 3MM7A 2DPIA 2HVIA 4WP9A 2GA7A 5T14A 2HLUA 5E3QA 2NZCA 4J9UE 2UUCF 1U1PA 2AV5A 2EWHA 4CLPA 1X7VA 1SUQB 3C26A 4B3OB 3H2UB 2PDAA 4NXMJ 2M3DA 5ETOA 3RBUA 4ZVOB 4DV4F 4LBIA 1WSRA 2HBQB 4YB7A 4LIWA 4ATNA 4QU6A 1WC3A 5G21A 4A30A 1CBKA 2XS2A 3GSDA 3H8EA 2QIFA 2DB1A 1TKDA 4OI0A 5F41A 4JI4J 1QSTA 3C14B 2N7YA 3K5PA 3B4DA 2JDCA 1AUSL 5F48A 3RYOA 3TARA 1HD1A 4DLEA 1WWZA 1ZLIA 2YWGA 3PYEA 1RTJA 5U47A 2V63A 2MGZB 4HVZA 5GMDA 4IFYB 1EARA 4FVCA 1NLKL 3UW1A 3NEKA 4CYOA 2FJVA 2N4DA 2G2ZA 3Q8PB 4DUZF 2C1EB 2BM0A 4II9A 5D77A 3QGPA 3DFEA 1Q78A 3WIUA 3MGJA 1SC6A 4TU7A 3LODA 4AVAA 2GVDB 5KT3A 4CAXA 1LFPA 2KT5A 3EICA 5CA5A 4F4XA 2FY1A 5KTDA 3QFHA 2W24A 8CPAA 3D7SB 3KDNA 4ES1A 3RB6A 1VQSA 2QMXA 2YKQA 1IBCB 1IKYB 2P9GA 3W9HA 5D4PA 3EUNA 2LEPA 4BWMA 4KC5A 4MK8A 3JTKA 5HXDA 5KFXA 2WCXA 2NXUA 1D0EA 4GKJF 4PUOA 4M5DB 4DS5A 3PY8A 3TAMB 2YNFB 4JB8B 2AFMA 2ZEDA 5J2PB 3EYZA 4LQ3A 3KLGB 1YJUA 2FZKB 3EM1A 4RNOA 3POTB 1RT6B 2YGWA 1M1HA 4I2PB 3KWMA 3M1VB 3KL9A 2VODA 3UN5A 2ZUGA 1J2VA 3EC4A 1DAXA 5HQMA 4K5RA 4DU7A 1X60A 2FHJD 3K5MA 5LYLA 1N0UA 1R8HA 1HQUA 4XNHC 1XTZA 2A0FB 3GIIA 4AL6A 4AFFA 4O3OA 2CTCA 2VFVA 2B5GB 5D8NA 5BR8F 2V8DA 1S6PA 2DF5A 4IF5A 2D69A 2EBGA 4RU9A 3GR0A 4F8ZA 3B8GA 2ZVIA 3ITHB 4NRTA 4UWIA 1MROA 2E9TA 3E0KA 4PG6A 5DZ7A 4R25A 3KUHA 4KOWA 3W61A 5KFNA 2N3OA 3KLHA 3I31A 2G9DA 1IBLJ 1NSKL 4X4VA 4CNZA 2O4HA 1N8RT 4C8LA 3Q8VA 1J5OA 4JI1J 3PM9A 1TL3A 4ANCA 1WORA 1TQLA 2GE3A 1N5SA 4LFBJ 3OFFA 4YR0A 3CCRS 3EGWB 1XBWA 3H2VE 5F09A 3CULA 2BJ1A 4CCHA 3WC6A 4R3LA 4OIDA 4H6UA 2IC3A 4F36A 3W2WA 1DZ5A 2MQPA 4JXQA 3CJ5A 4RW9A 2XSJA 4DUZJ 1HYSB 2FLLA 2R8GA 4HLBA 4KGZB 1WG5A 1N88A 4ILRA 5DQHA 3DI6A 1CBXA 4ZPBA 1IBKF 2H3EB 4WKRA 2DNOA 1HI0P 1QY7A 2O5DA 4ZHRB 4DFJA 1FKAF 3K59A 3H2LA 4M6HA 4OV1A 1U0SA 2PD1A 3NOGA 3CB4A 4KHMA 3D7GA 5D0RA 1QVGR 4MYTA 2QL9B 3GONA 3DOMB 4OC1A 2IJRA 1X31C 2EFOA 1WWHA 2YKNA 2N7CA 4DV0F 2WUUA 3QRQA 2BABA 3R7BB 2VEZA 1TFWA 2GJFA 2IFXA 5HJXA 1NHUA 1RBAA 1IWGA 4YMEA 1AUGA 2PRBA 1MN7A 1U6BA 2BRKA 2V2ZA 5D0GA 3OQ2A 1MMDA 1EQMA 2KFYA 3ISND 5A27A 1QTNB 3TUPA 3GJTB 2CJ9A 3IS9A 2F8HA 4F9UA 1TKTB 4C8ZA 5EWFA 2BR0A 2CPDA 2W9BA 1IKWB 2N82B 2CQ1A 1DQAA 1NRKA 1S5ZA 4M94A 4ZX8A 1JX4A 2L9NA 2W9AA 4MBUA 2V8VA 2HUZA 2QLBB 4OJ3A 5J2QB 1BO4A 4DWIA 4ZVPB 2R2SA 2VB6A 4OYZA 2B4UA 1QAJA 1IUJA 1NHKL 4OADA 4C2MA 1RCXB 3CJ0A 2XMVA 1CJWA 4F25A 4UOFA 1QSMA 1KLMA 4NLPA 2ZBPA 2M88A 3KFWX 5F0WA 5KTCA 2HMIA 2MJUA 2OHDA 1HNIA 2M52A 4HTIA 2RUGA 3KK2B 2OPQA 3ONQA 1Q79A 1L3SA 2KRBA 4BD9A 4JI8F 1BY9A 2GCFA 2FJWA 2V2VA 1X8DA 1VQMS 3DHWC 3R1HA 3FUYA 5AG5A 3A9LA 4DR3J 2FVQA 2E5JA 4QQBA 4UCPA 3RB0A 1X9WA 2Y1RI 3E2EA 1LW0A 3V81A 4UY85 2DR5A 4JI0F 4LFBF 1VQ7S 2QJ8A 2E1CA 4WFYA 3NFZA 5KFSA 1YREA 2JVRA 1YKWA 5D4NA 4Y28C 2COLA 2OPRA 3WX8A 2XY6A 2VG5A 2AJ2A 2PJ0A 3T3FA 3MXHP 2RB7A 1Y4ZB 4L75A 1R0AB 2BUEA 3KI9A 4W98A 1S6UA 4OC4A 2IQ6A 1TF8A 3DU5A 1YIJS 4JI7J 4CLSA 4WCEQ 1AFJA 5J1PA 2B3UA 1IM4A 3MAAA 4CNYA 4DR6F 3VAKA 4MKVA 2I0XA 4NA2A 5KFIA 3GB0A 5I0CA 4ZN3A 4NYOA 3GZ7A 1PCAA 1ZAVA 5HVHA 1CQNA 2LXIA 2NUHA 3M6VA 2CADA 1JLFA 1PC4A 4EK2A 2HAIA 1RWOB 3MD1A 4QVTA 4NMLA 3HZGA 5KFDA 3GIRA 4CGMA 1TL5A 1EAYC 3MD3A 1TV6B 1YLEA 2ZC3A 2ZOFA 3D2WA 3EZ5A 3M30B 3OTOJ 4KORA 4R0JA 2VZYA 3M2RB 1IJEB 2F9JA 2DGSA 3H8YA 5HROB 3KG1A 4OYBA 4K4XA 3KHZA 2WBRA 1RTIA 2NQPA 2JX2A 3ILJA 2NSMA 1XE4A 3BR9A 3ZTOA 1MG7A 4BC7A 3OL8A 4ZJQA 3CO0P 2HNDA 1AFIA 2B9YA 2ZOGA 4RWXA 2FVSA 1U2CA 1FVQA 1ZG8A 4DR1F 4RW7B 3R96A 1LQ9A 3QO9A 4DQPA 3GUXA 3D54A 5JPHA 4H4MB 2KI2A 2Z8QA 1NDPA 5EC4A 4OYWA 1W2BR 3RAQA 2HK2A 3PFOA 3N79A 4B02A 2O67A 3C6TB 2UUWA 2OEMA 1S7LA 1QSRA 5AXNA 4MY3A 3AB4B 4C4WA 1N5YA 1RSCA 2X1BA 2F63A 2CF4A 1NK4A 1WHYA 2PIZA 2DT9A 2YPZA 3GV8B 3MPWA 4B9VA 3TANA 2FGCA 3AQOA 1K8AT 2XWYA 3DKDA 3G9CA 2AFXA 3TO7A 4WBFA 3ISZA 2ATRA 1G7CB 2ZWPA 2ADBA 2ZE2B 2VKRA 3QT7A 3F0AA 1F3FA 4OI6A 5E3CA 4NLRA 2ZEHA 4XPEA 5AG6A 1IKXB 2C6PA 5D6GA 5I3QA 2DY9A 3BREA 3W6XA 1B4SA 4DSEA 4Y2CA 2FIWA 2I9SA 2R7HA 2MHEA 3KR4A 4X2TA 4NCGA 4N76A 3B78A 3IWLA 2XO6A 1NSQA 2Z56B 3LAKA 4IHMA 1N6QA 4OX9J 4Q36A 4E8UA 2ZKUA 1LXNA 1IQZA 1S1TB 3CJSA 4B9TA 4UEEA 5GCNA 2ATCB 1LAMA 4C8MA 3DDNA 1ACMB 5M2PA 4FYDA 2YKMA 1KWMA 3BPSP 2MZQA 3FRYA 3TA0A 1OBRA 5E3PA 1WC4A 4QWEA 4A4JA 2HHUA 5HATA 2LYVA 2GMJA 1C4AA 2F4VF 4ELTA 4QIFA 1UETA 3OTEA 5HANA 4B5PA 1ICEB 4Q0BA 3EGNA 1DBDA 3QNVA 3V38A 2UVVA 1GT8A 2QV6A 4PPZA 1YTYA 4EFAC 4HACA 4AYBD 3PKMA 1Y0HA 2R7RA 3JQMA 3MM5A 5HO4A 3D68A 4O0IA 1FRKA 4F8RA 3W66A 4AVBA 4M8LA 2M8HA 1FD2A 4ED3A 4ECYA 1U8WA 3GG0A 2DGUA 1FX2A 2KM8B 4KH1B 3UCGA 5E5NA 1RHJB 2V94A 5F8GA 2CQIA 1TL1B 4LUAA 3TUZC 2AGOA 1RHRB 4WTOB 1QUPA 3EGVA 5DWNA 4OLOA 5E41A 2J9DE 3WDOA 3IWGA 2HQFA 1B7YB 2KVQE 1HNVB 1CJUA 4HL9A 5H9EK 2ZW6A 1Z4UA 4UT4A 4DPXA 2GQCA 4MAKA 4KJIA 2GHPA 2BBEA 4A8OA 2LU2A 1N5YB 4C7QA 4A95A 4DV3J 3FMWA 3UD4P 3LGMA 5HVGA 2BOAA 4ERDA 3TAQA 2DEIA 2C2ZB 3FVLA 3THTA 3CCZA 3UD3P 4I6AA 1YK3A 2E7XA 1YR0A 1JLEB 1ZLHA 4IOBA 2MQ8A 5GVQA 3L95X 1QSNA 2DK2A 2XLKA 1N36F 4ZK7M 3NL0A 1T9VA 2HHPA 2RDIA 4PG7A 3AY0A 4ZX9A 3SSQA 1S77D 2B4OA 1M5KC 2WSFC 2C2OB 1F9EB 2HIYA 4IFVA 1N33J 3G96A 3BN4A 3Q8RB 5A28A 1T7PA 4U9ZA 3A13A 2XEJA 3Q8QB 1IICA 2E1RA 2YNGB 4DUKA 2B7BB 2LP4A 2FIAA 3G86A 3C6TA 3H5SA 3FK4A 5CBMA 3DOLA 4NCBA 1TV6A 4OL8A 2WBMA 4KTQA 4WJBA 3K8VA 5L38A 3SXLA 4NJRA 1ZG7A 4F0MA 2OU2A 4TQRA 4U8VA 4A31A 1I51B 1GX6A 2JNJA 3D7DA 4N8OA 5ADZA 3JSYA 2N4CA 4J9MA 2F3JA 4P2MA 5DWMA 4AG9A 3DOKA 1EETA 4KOTA 4ED7A 2B58A 1RWVB 2AFZA 4CDIA 5IV4A 2ROPA 1DLOB 1KKHA 2V9WA 4K2JA 2WB1D 2WVDA 3OTBA 2CJXB 1D9DA 3JTPA 1P6TA 4IG0A 4WPAA 4CT8A 1CC8A 1YBTA 5F8HA 5LOQA 4YHHF 1Y0YA 3LANA 3QT6A 2J7UA 1ON0A 3KHXA 1Q2YA 1VHOA 4QOTA 2UZAA 4RLEA 5T7LB 4X64J 2HIQA 4DPOA 3KKWA 5CXTA 2RRAA 1QJHA 3MMCA 1HBMA 3GMGA 4ZP7A 1IOFA 4GKKJ 1ZTWA 4MIAA 1X5SA 3TQEA 1SVDA 3P5BP 3DN9A 1S57A 1FD8A 2IM3A 2GFQA 2Y0MA 2J8NA 2B5GA 3WX4A 4HPSA 4DL5A 4YP3A 1ZAXA 1LWFB 3D1OA 3T41A 1B0TA 1J27A 3AJ1A 5BYSA 2KT3A 2HQYA 2XLJA 2OMOA 2DVIA 2C2DA 2XWXA 4MHZA 1CP6A 2G9OA 4JI2F 5F9NA 4BC9A 5HMXA 2VPYB 4O3PA 2PFDA 2QLWA 5KG7A 4C11B 2M8DB 5DJBA 2HPUA 2AJ1A 4MKYA 2IYIA 1HDUA 4OHWA 1PYTA 2FJBB 1ZETA 1Y7RA 2Z58B 4CRJA 5SZTA 4OYOA 5ETMA 2I5JA 3IWXA 3V6KA 2VQFJ 3FEEA 7AT1B 2MQMA 3RBDA 4CLKA 2WSEC 5CQGA 3C6UB 4WFNQ 2BJ7A 3ETOA 1FF2A 3L9ZA 3KJVA 3BSAA 1Q81T 4O4RA 3ET6B 4MK9A 2K5TA 1Z2LA 2DNMA 2VDIA 2XY5A 2JL9A 3CCTA 3EXCX 1YK9A 1VBXA 2BZ2A 2XS7A 5DS7A 1S76D 1UJ5A 2G1DA 1CX8A 1LW0B 1SI9A 1M44A 4J9LA 2VBZA 4KBIA 4DX6A 2MPUA 1VCTA 2VHGA 4Q2MA 1LKZA 3DRXA 1FE4A 2JWNA 3D67A 3K89A 3QQCD 3V5RA 1PBAA 1CC7A 1VQNS 2Y3YA 4A94A 3IO1A 2XMUA 4CH0S 5D78A 1O5JA 3FCWA 4N7TA 3OR1B 4DL3A 3IA0A 2XC9A 3ZC4A 1CJVB 3TX0A 3DMJB 3JXOA 2VIHA 4JOUA 4Y49C 2CJQA 1SL1A 1DY3A 2DXEA 4U7CA 5J1EB 4C2XA 5JM6A 1FTCA 1F60B 2PJAA 4NLTA 1DTDA 2IRXA 4P7VA 4ZPCA 4XPKA 2HBZB 2X3DA 3IN5A 1IKYA 3W63A 5KG5A 4OI1A 4PG8A 4EMEA 4IAVA 3QAUA 1SL0A 2AMCB 5I4MA 3RU0A 1NJWA 2ZEJA 2VG7B 4F4AA 4NGRA 1S9FA 3W2VB 4CPAA 3W62A 4WFXA 3MI7X 3FJ2A 3OTCA 3IS9B 3VQSA 3IWWA 2E7WA 3ZXWA 3FIXA 2GVDA 1OSCA 3K17A 4TQSA 3ZFVA 4TU9A 4IOCQ 2W2OP 3MEGA 2FVPA 2OZHA 4MFZA 3NNCA 1SC3B 4JV5J 3PXGa 3LWUA 3PW4A 4PG5A 4NLXA 4A8XA 3BR8A 4NEZA 2QA1A 3BO4A 2ZEFA 1UVNA 1X4EA 3MEEA 4X4QA 1W2IA 2DR9A 1HHQA 2ZDOA 4CLWA 4DUYF 1Z8LA 5KG4A 4KIAA 1X4DA 4BBYA 1L5UA 1ELMP 1VKCA 3R8YA 3TCVA 3HVTB 3MCMA 2RC4A 1MN9A 4C98A 4IR9A 1WOPA 1B0PA 4YRHA 4KGKA 5CNPA 1X5PA 2CQBA 1XNQJ 1FWKA 1VLYA 2IVMA 3B7IA 4KUAA 3NGSA 1ZAWA 5G0RB 1CG2A 2NR0A 1F2HA 3PIPQ 2DXDA 4I6WA 4LSNA 4DS4A 3MMBB 4LF9J 5FDLA 2XCPA 1KP6A 4LF8F 3VVUA 1RBLA 2H9ZA 4PPDA 1LK5A 2YWFA 4NYZA 5IX3A 1IXKA 2PR1A 3B4MA 2R7OA 5ETSA 3HHLA 3GIMA 3GYAA 3D3SA 5A0YA 2PI5A 3KLIB 3Q23A 5FLXY 2VQYA 4DV5J 1WDTA 4P2XA 3THPA 4YB1P 4BMHA 1NMTA 2H5MA 1HNWJ 4B9UA 3OFEA 2E5HA 2AF6A 1LW2B 3A3NB 1GX5A 2XYPB 1TTHB 4PUOB 2J8MA 2M70A 3H5UA 5F0UA 4HHJA 3IBFB 1IR0A 5B0CA 4Q8FA 1QAIA 1KVKA 4GVBA 2V4JA 1KQFB 1WEYA 1SJRA 2FIUA 4LQGA 4V1Ak 5C2GA 5KT2A 2RILA 4F3MA 1XEZA 4PCQA 3GE9A 1HYSA 1AMPA 4RL1A 1M4DA 4O44A 2WYRA 2GVZA 1YJVA 5LM7E 2SXLA 2HHXA 4NI2A 1RTZA 4USMA 4KLVA 4NE9C 2HYIB 2RQ4A 4HI2A 3ENVA 5IWAJ 3BBFA 1XERA 4C8YA 4XTTA 1VDHA 5K14A 3PHTA 3AD7C 2MLYA 3AA8A 3I0RB 2YNEA 4X4TA 4I7FA 1U1OA 2A6OA 1LWCA 2LDYA 5GMEA 4DFPA 4NI2B 4FD5A 1N71A 4DI6A 4F2RA 2J76E 3H4DA 2UUBF 2G1HA 2G0CA 3ZTPA 2YTCA 4X4PA 5E3RA 3M8QA 4NCZA 2GU2A 2POKA 1PO6A 1X9MA 3MR2A 1NK9A 5K8OA 3D8PA 1TMJA 2ZEPA 2GAGC 3BLNA 2EFQA 2DCUB 4TNUA 4ICLB 1XR7A 2OD4A 3Q0AA 4UFXA 3M9NB 3B54A 3RTVA 3DLKB 3NGDA 1K1QA 1G4CA 3UI3A 1VQKS 2HVEA 1Z8TA 3NGTA 4P73A 3CMES 8ATCB 3EZOA 4CTAB 5I42B 2PSWA 5F47A 5EX3A 5CYQB 1IR1A 4DR7J 3TA2A 1NB2A 3DYAB 1PBUA 4E0DA 3CJTA 2WZ1A 4WFAQ 3L7UA 3QIDA 2FJEB 4FWUA 5A0YB 4B9SA 3DXBA 1Q1KA 4C6AA 2ZW4A 4B3SJ 4ZCMA 2K1RB 1U8SA 5B0FA 4GO5X 4LFCF 2WOMA 4ZPWR 3VATA 4O3RA 2O01C 3KYLA 3GCWP 3C3LA 3ENAA 5ETNA 2UXCF 4E8OA 2Q43A 2E29A 3OFHA 3GFYA 3CMAS 5I3PA 4ECVA 1X4GA 4QIGA 1T11A 9ATCB 4KH0B 1R8CA 3F73A 2V50A 4K4ZA 2Q4VA 2ZH5A 4NCAA 2FJAB 4K4WA 1SJ1A 2QVPA 1HNZF 2YNIB 4PK2A 1QLNA 4RW6A 1HQ2A 3WC5A 5F8JA 3CE8A 1JNZB 1SQFA 3S6FA 4KY3A 2CJAA 2DGXA 5DDPC 5C82A 2QMWA 2CQ4A 2PMWA 5GAEI 2ZBQA 2KFZA 1Q2DA 4X62J 3JTNA 1LRZA 5A8WB 3CUNA 3SFUA 2V4RA 1Q0NA 2RDDA 4G6VB 1VQOS 1JJ2R 1Q82T 4RX6A 2ZBCA 2DPTA 5HN0A 1CJTB 4IH5A 2LEBA 4LSLA 3SZ2A 4PG4A 1JJ4A 2Z0ZA 1WEZA 3JYTB 4KZTA 2CPYA 5ETKA 2UUBJ 3N6MA 2Q0YA 2XSJB 3UR0A 2YNCC 4Y34A 4X3RA 4D3GA 2RHQB 4ICLA 2CQDA 2IC3B 2VKZG 1Y5NB 2HHHJ 1KFDA 1VQ4S 3EFAA 5CH7B 1T3OA 2BX6A 4FYWB 1JIHA 2ERRA 3M6WA 3QAYA 3S6HA 2AJ0A 4YHHJ 1JJCB 3MOJB 3BGRB 3HPOA 4B6ZA 2YPYA 3B3SA 2DGWA 2F8MA 4EUVA 2XZWA 4ZPDA 1L0CA 4MIWA 1OMSA 3G8WA 4J3GA 2I6WA 3A8EA 4K7QA 3U1LA 1CSJA 3G6ES 5IT9Y 3CJQA 3J80Y 3CCLS 3W2WB 3FB3A 4I1TA 4B3SF 4NWBA 2KL8A 4H4KA 4R6TA 3G3SA 4I64A 2XMTA 2JEWA 2VZ9A 4OZLA 2PJ4A 1F5BA 5ITHA 4W4MA 4OMEA 5HROA 1FY7A 4CLTA 3QLHB 4RZRA 5LT5A 1EQ0A 2HVDA 3PW0A 3B3TA 1UVIA 1DQ8A 3BS9A 3QGIA 1TL3B 4NCGB 2X1FA 1NNDA 1URRA 1S6OA 3TEGA 4LSNB 3EO4A 1FDNA 1MMLA 3KJVB 4C7HA 3BSCA 3BKTA 1Q7LA 4OYPA 4A37A 1QSYA 4DN0A 4Q44A 1NDCA 3UVJB 1AYEA 4L76A 5L46A 4C0BA 1S1WB 3R2CJ 4WZQA 1Q8BA 5BYQA 2VG6B 1TUGB 5KFUA 2GS8A 4EI2A 4KHRA 1ZZNA 4WFBQ 3O44A 4PSWA 3HJFA 3F8KA 4OJHA 3THVA 1RT3A 2IHR1 1T8EA 3CPXA 4WIQA 1H72C 1VRUA 4NGPA 3CXCR 1YSJA 2WW8A 3X1LB 2PSZA 2N3LA 1EP4B 4DPTA 4M5IA 1H6KX 2XMJA 4QPXA 1IU8A 5DGAA 3VGSA 2EVNA 3G82A 5BR8J 1VJQA 2DJWA 2FT0A 1HHSA 1SJ4P 3DLEB 3QJJA 2NLWA 4AL5A 1TKZA 4ZI6A 1OY6A 2IY5B 1P0HA 1HWIA 1BE4A 4C11A 4IRKA 1TMMA 4NPOA 1V0CA 2Z10A 4GMKA 4Z7CA 1NJZA 1ELOA 4TNOA 5JMNA 4EZ6A 1AZSA 4DX5A 1RTHB 2RE1A 2PVWA 2V2KA 3KK2A 3PTWA 1LEOA 2RD5C 3NA6A 2HWIA 2B5JA 3H7HB 2AFWA 3DLBA 2J0QD 1M0SA 3TAPA 2RS8A 4M5JA 3BQ1A 2LQ9A 3DRSB 1YW6A 3US5A 1OPIA 4JZ0A 3SCKE 2GHVC 1XJOA 2Y1IA 5C5JA 1RWNB 4GKJJ 2OIHA 1X5OA 1T9TA 3HM9A 1PJ6A 2FXFA 4CO4A 4U7UK 5AXKA 4L73A 2IIHA 2XI2A 3FMBA 3G6XA 4C9DA 2G13A 4USWA 5JVHQ 2R2TA 2PEBA 2BQRA 4KFBB 4ZITA 1FRHA 1X4AA 2FHJA 1HNIB 2FDNA 3TVKA 4IH6A 4RNHA 4QIVA 3DGPB 2RUSA 4K2XA 3EVWA 3KHHA 2RSQA 1U6ZA 2MKJA 2PJ6A 4C0OC 1TKHA 3T5JA 2XM3A 5E33A 1C0TB 4EMDA 4UA3A 5DG7A 2KTQA 1KQKA 2A2CA 4IUFA 1X4BA 4GVLA 3CC7S 1NDLA 4Z7YA 4ZA1A 3Q86A 4CGNA 1RABB 4B3MF 1R43A 2K7JA 2LMIA 4LRFA 3TUIC 1L3VA 3W91A 3DRPA 4JI6F 5C42B 3FBBA 1Y9KA 5CPAA 2EBJA 5HK4A 5C25B 1UZHA 3IBCB 4I2QA 1O0PA 3VALA 1FRIA 1KD1T 2J8RA 3D4JA 5J8CA 4Y65A 1LCPA 2AEJA 4WE1B 1HW9A 1LWEA 1XN9A 3QIPB 2YWKA 4LF7J 1M4LA 3GFXA 1V5IB 4KHPJ 3WC7A 3T19A 4ZIVA 4I56A 3MMAA 1X12A 3S01A 1JXEA 2DYAA 2IJZA 4QZVB 3I56S 4MFLA 1RT4B 2PJ9A 2DTJA 2MKSA 2Y0BB 2C3PA 3CD6S 1RTDA 1SV5A 4MTPA 5ETPA 5A6PA 1UKUA 1N32F 2V5HG 2HFNA 3DU6A 2Z3LA 1WC1A 4X66F 3BBCA 3I4HX 3IR7B 2YX4A 3D4UA 1F5AA 3UNGC 3SDEB 1BQMA 4M5LA 3T6BA 2R8HA 4R7MA 2V8GA 4UW2A 3S1TA 4B3RJ 1YBAA 4C97A 1VBKA 4MFKA 2ZZNA 2BQUA 4QWCA 4AXJA 1FEHA 2QLFB 2YH0A 1S1XB 1N33F 2HK3A 2C42A 3NY0A 2ZH8A 1PYTB 5H9EJ 2AEMA 4HTJA 3D0IE 2BYCA 1RYRA 3H20A 3FDSA 5B08A 2X1GA 3JS9A 1WHXA 4A8WA 3N7ZA 3H4BA 5IWAF 3KK1A 3IU2A 2QMUB 4P74A 3PB4X 2VOPA 1AT1B 1X4FA 4K4YA 2C1CA 2QFJA 4DR4F 4NA3A 5HP1B 5A8WA 3NOCA 4X4NA 4IG3A 3K8WA 2OFHX 2XYGB 1BPNA 1S6PB 1YHQS 3FSIA 2QLJB 3PEHA 1D09B 4MYUA 3R5DA 4MK7A 4FYVB 4W92B 1S7KA 1R0CB 4RR5A 1B0VA 3O5TB 3SCIE 1NKEA 4IRDA 1Y7EA 1NH8A 1RZMA 2R42A 2C3OA 3MEDA 4B3MJ 2HS0A 1CPZA 4H4MA 1GYTA 3LA0A 2E5LJ 2ILZA 2RRBA 3TYTA 2G2OA 4JYAF 2JRSA 1VOMA 3T9YA 3D6FB 2FQQB 3H0PA 3AQPA 1LOKA 4AQYF 3ZNUA 4RS2A 3ZZRA 2KJVA 2RNEA 1GAOA 4HKQA 1T05A 1BLUA 2YKMB 2FVGA 1R8AA 2AT1B 2JVOA 5EDWA 2JC0A 2MQQA 1I1GA 1UEVA 3BHXA 4OYAA 1TVRA 3SMZA 4EEYA 4KO0B 2GVZB 4P4FA 5LSLA 3K5NA 1JLGA 2UXBF 4FKYA 2PR8A 3A8IA 5KG1A 3C66A 4NGMA 3FVYA 3DOKB 2DHAA 1OY9A 3BF4A 4C7IA 3CXQA 3P45B 5LL6d 3QB8A 4CTAA 5I42A 2VL1A 1F57A 1VQPS 3SI1A 2YX7A 2GGPB 3BQ2A 2DNPA 2PA3A 3C16A 1M4GA 2FYXA 2BV3A 1JLQB 4B17A 4KSAA 4Y2AA 4TVAB 2GFFA 3OL9A 3F5BA 3PB6X 1WJ9A 2ZHAA 2W8LA 5M2UA 4FD6A 4NFRA 1N48A 2XYHB 2CJKA 1R31A 1Q7YT 4URSA 2LXUA 1UFWA 3PVXA 4ZP8A 2XSFA 2DHGA 3CJ3A 4R8FA 4DX8H 3RW6A 2PQ8A 1OS5A 1NJYA 3OHBA 3V6HA 2MKCA 1W7WA 4LQ6A 3GV5B 2U1AA 3BO2A 1R8BA 4OKOA 5B0AA 1Q8IA 5KAKA 1JLCA 1QSOA 4A33A 2D4OA 4CGPA 2L9WA 1HARA 2LKZA 4NL5A 4YUDA 2P6SA 1PU9A 4KV8A 3TUJC 1XIXA 4OI2A 3V7ZA 3G6VA 4QR1A 3UN2A 4WP8A 5F3TA 1ARLA 2Q44A 4DQRA 2Z0GA 4TKTA 4B3OA 5HMWA 4O44B 3KJFB 2P6TA 2APOA 2BJ3A 3EWGA 1FRLA 1FXDA 1RK8A 3BSOA 4QC6A 4YB6A 4RU2A 3G87A 4P4JA 2P6GA 3DLGA 1N52B 5JVGQ 2H4YB 1S1UA 1RGVA 3OWCA 1E6VB 5LRGA 2WK4A 4KPYA 2H5EA 1QE1A 4Y0FA 1XJWB 3KQZA 4DNCA 1FXRA 1KUVA 3VVTA 1JLFB 5BXIA 2VF3A 3DHXA 5HL7Q 3H8FA 1TUVA 1TFYA 3HUVA 2ZH2A 4MHNA 2CG8A 1XC9A 3MR5A 4ES2A 3MM5B 4ZVHA 2HAFA 1UMJA 3Q83A 3HZEA 4K30A 2XHWA 2KZZA 1K44A 4ZVUB 2UXBJ 1U49A 1T05B 2Z30B 1LAPA 4UTGA 1WTFA 1A0OB 2HQGA 3M8RA 1SL2A 4M63A 1F6TA 2P8IA 5E3AA 1WDDA 2DGVA 1IWAA 3OUYA 4TY8A 3H5XA 2BRLA 4ZLNA 5AJ3F 3I5BA 3NNHA 3MEDB 4RBTA 4ZKAA 4GXHA 5AG7A 3O2IA 1FK9B 1HIYA 4WTYA 4ECZA 3LD2A 3CMQA 1R0BG 3FZ2A 1UVJA 4M5GA 4JXRA 1FT8A 3R3TA 5K5MA 4DPYA 4DF8A 3UNYA 1S4FA 5AE1A 2VPZB 1KUXA 3SXOA 3RB3A 1MW7A 4FP9A 2GJIA 4DZDA 3MUMP 2H51B 1YJNS 1UWBA 5ELYA 1JB0C 3B3VA 3EMTA 3VH9A 2ASJA 4MFBA 1YRXA 3L2NA 5K8MA 3IIBA 1M5VC 3GP9A 2ZBIA 1QDUB 3SV3A 5KFFA 4ILLA 1NZAA 3I6PA 4LF8J 2YX1A 4UOGA 3PACA 4UQGA 3N5FA 1WKJA 4NRUA 3Q8SB 4NLSA 1Y7PA 4FZVA 3KJQB 4GO7X 3LP0B 1E6VA 2Z11A 3DM2B 4WK1A 4DJBA 4ZPAA 2ZD1B 2K3KA 3D0HE 4X65F 2FZGB 4ZP6A 3RAMA 2P6FA 3TTHA 2NXCA 4JD6A 4C2YA 2WSAA 2EBEA 3NWGA 5CZXA 3QNWB 4DL4A 2KHCA 1C1BA 1P1TA 5IT4A 2UVUA 4HT7A 3ULHA 4CLLA 1TKXB 3T5KA 1IBMF 2JDJA 2RF2B 4KOSA 1OZPA 1M1KT 3M9MB 2R8JA 1IJFB 1GQEA 4GS4A 3PV8A 3HT0A 1K4JA 1SIZA 2MYFA 2J8AA 4ZVGA 3UVJA 4ETZA 1PKUA 1MWZA 5DRKA 3W64A 4L74A 3J81Y 1QUVA 5G4DA 3FEDA 1UWBB 3V4IA 3M8PB 4BDPA 1QE1B 3FECA 4P71A 2XMWA 3A1YG 2KFNA 3ZJ0A 5M2RA 4WU2A 4GVBB 2HMIB 1RAOA 3TAMA 4NGQA 2J7KA 2DBBA 2VOOA 4KOUA 4A32A 2OR4A 3GCXP 3QJLA 5D15A 1CPSA 4JI7F 2Y0SD 5D3GB 2NYHA 5AJ3J 1S6QA 4IYQA 2J9DA 5DGBA 3HSJA 5LMUF 3KLVA 5IM0A 2RQKA 3MGDA 3SCJE 2M5YA 2UUAJ 4MFQA 3DLEA 4UCMA 2ZH7A 3GYXB 2LQ5A 2BE9B 2IM0A 1FA0A 6AT1B 5DETA 5LMNJ 4IO9Q 2QX0A 2PVVA 3J7A1 4OJGA 4OFZA 4FF3A 2O1PA 3I0SB 1SXLA 1MROB 4IKAA 4KO0A 4PWDB 4Q8EA 5KFYA 1R6VA 2MQLA 3HD1A 2BACA 3M6XA 4JI4F 5HBMA 3BJYA 3RAXA 4XDDA 2BOPA 2ZHOA 2EK9A 5G0RA 3RBXA 4PZVA 1V3ZA 4BCAA 5RUBA 1UA1A 3NG8A 1S0OA 3KTQA 2E1MC 1XMBA 3HMJG 1Y5LB 1PC5A 2W4PA 3Q24A 1IYKA 1YMEA 1OYEA 6FD1A 2BVZA 5HI7A 2OSQA 5C24B 1RE1B 3LPEA 3MEKA 4J7CA 3SFGA 1IIDA 5LYDA 3PIOQ 3HP6A 4CT9A 4ED2A 2JEFA 2W7PA 4F7VA 1RXOB 3CD5A 4A38A 1RDRA 5K20B 5H84A 1WG4A 3RB4A 5E2QA 1RAHB 3AAWB 1SUQA 3IP0A 3MM8A 5HJYA 3D2PA 4M85A 3MEGB 1XMQJ 4JI3J 1SPBP 4CLYA 3G82B 4XO0A 2HFVA 2LVWA 3K5OA 2DO4A 2YNIA 5LXYA 2ZVSA 4FXDA 3PDNA 4NLUA 4JI5F 3EPIA 3CDAA 4DHVA 3V4MA 1IYLA 5KG0A 2BJDA 1S1TA 2B3VA 2B51A 4ED6A 1NCLA 4YB5A 2HFSA 1VQ5S 3CDXA 3KHRA 2PC1A 1XOVA 4OZ3A 2E1PA 4CI0B 2ARHA 2JZ5A 1V5VA 1FCAA 3KXDA 3LACA 1CM0A 3TX8A 2RU3A 3HKZD 4ORFA 1VGYA 3CJ2A 2EEYA 1JLQA 3CDUA 4CWBA 1UW9A 3DRYA 2R8IA 2FHOB 1SC4B 1WC6A 4YQWA 1HBNB 3RGIA 3K2YA 1HMVB 3VTIA 5CD4A 2KU7A 2PMHA 2HWHA 2W8KA 5C2CA 2DCLA 2DNHA 1N0VC 2DHHA 2NYIA 4J91A 4C48A 2QSFA 4USKA 2RKIB 3TZYA 4MCPA 3B3CA 2V9KA 1EX8A 2VASA 1ZM4A 3SDEA 3VQTA 2AU0A 1LV5A 1R27B 2Y8WA 2I38A 4XPLA 2WONB 4UUWA 1X0FA 2LU1A 2HNZA 2X7BA 3QPIA 2HQCA 2XEGA 1RWXB 3FZBA 3JAMU 4EFDA 4RPFA 4C3KA 2EPIA 2BUNA 1GH8A 2Z3MA 3D28A 1ZA2B 3I87A 1DURA 3M1VA 4HH0A 5KFWA 2NYQA 4CM2A 1VRTA 1RAJA 1VC6A 4RUAA 2HKEA 4JP8A 1M5HA 3FRMA 1RWPB 5FJ4A 3MZIA 1HNWF 3D3BJ 3H98A 3NGKA 5GMKa 1DFDA 4HEA9 3VAJA 3KK1B 4QWBA 3FQLA 1XF8A 3W5XA 3IRXB 3HXMA 2C22A 3P96A 3QT5A 3PBBA 4EBEA 3CDBA 1YJWS 1KOOA 5J2PA 2ZPAA 1I21A 3SHPA 4ID5A 3ICLA 1TKZB 2G0IA 3MAAB 2M2BA 4RW7A 1RAEB 2P9CA 1IB1E 4L72B 1JJHA 4QYZK 3PBEA 3J7YU 1PJ5A 3JQJA 1XMTA 3NRBA 1FRXA 1I94F 3PYFA 1UVLA 4CYUA 3V6JA 2YNHA 5D4LA 3K7RA 4ANEA 1Y3KA 2QJ3A 5DG9A 5J8FA 1NAQA 1WF1A 3D0GE 1KSPA 1VQ8S 1GHEA 1D8ZA 2V2QA 1PYSB 1MJ9A 3BGOP 3S8SA 4ZY0A 1KHVA 3D7HA 1T9YA 1S72S 2WB4A 4MHYA 2H1YA 1UAWA 1U45A 1ZG9A 4NA1A 2FJDB 1T03B 1M5OC 3PCOB 5HVFA 4QWDA 1KQGB 1HQEA 1S1WA 3BYRA 4F02A 2VPXB 3LALA 2ZW5A 2ACMA 2FL4A 1U4BA 1TZ0A 4LUBA 4RW8A 2YXLA 3MTJA 2IJNA 2ZUAA 1PUAA 3CJKA 1SKSA 2K1RA 4I7FB 4R3KA 1FO1A 3O1LA 5CCLA 5IOLA 1RT3B 5H1SV 2DR7A 2DEJA 1S7NA 1VI7A 2LLZA 2Z3OA 2PJBA 3LQVA 4ECRA 1VK3A 1XMOF 2XNRA 3QAHA 4DEZA 3JVNA 3BM7A 4J90A 4LFAJ 4B10A 2GREA 5EN1A 4DX7A 3LWLA 1NH7A 1K9MT 3BZQA 4DCJB 4DCPB 2FZCB 4K4SA 5IV0A 1VHSA 1AROP 1IOIA 2VZZA 4JJXA 1NJIT 1KN6A 5KTAA 4DR2J 1R7IA 1SV5B 1KC8T 1YGYA 1J5EJ 4IDKB 4Q38A 4MCQA 3ZTQA 1TL7B 3FMCA 4DR6J 2DGTA 3TT2A 2OGUA 3KG4A 4G65A 3IG1A 4M5HA 4MJ8A 3KR5A 2D4PA 4ZS6A 2B4VA 2MJNA 3BJ8A 2XEXA 2BL1A 3VWDA 4EBDA 3OXGA 1FEEA 4AT1B 2QSWA 3MM7B 2JLEA 3B3WA 5ETRA 2HVHA 2AKWB 2NMTA 1R8PA 4ZYQA 2VBWA 2ZEOA 3L7OA 3PGPA 4DV4J 3DDIA 5CD4H 3D1QA 2G0JA 1C1CB 1U48A 3GY9A 3R95A 4YR3A 2Q04A 4I68A 3WC2A 1WELA 2UVRA 5F49A 1VQLS 4FXVA 2O66A 1KVJA 1YLXA 1Z9UA 5EHHA 2GNKA 2MB0B 1NE9A 1UFLA 2F40A 1SQGA 4A8MP 4IR1A 3OV7A 4V19J 5FDLB 2Z2ZA 2P2CB 1RUSA 3D6HB 5FLXU 4Z37A 1WHWA 4DL0C 5KFHA 3TJAA 4TY8B 3OUYB 1U0HB 1T9UA 1SIWB 3W5YA 2OZGA 4DSJA 3IAM9 2DKOB 5T7LA 3EVMA 4CYPA 3NH8A 3HVTA 4LF6J 2DNKA 3NMAA 4NZ6A 2OEJA 3DGVA 2ANPA 1MLAA 2Z4PA 2L3MA 1M4IA 4X4SA 4YR2A 4OC2A 1CJTA 2ZH3A 3UY5A 3KNGA 3EXYA 2Y8YA 4QUSA 2OPSA 3PB8X 1VRUB 4B5PB 3VGVA 3BKUA 3CW2C 2J6TA 2R2RA 2PJ5A 2MHNA 4B3RF 2ZHBA 4UUXA 3IRXA 4AUKA 2QL5B 1MSWD 1HPZB 1OY8A 2VG6A 4QPTA 4ONUA 2VBQA 4U7UD 3SJXA 4DSKA 4P4EA 3TA1A 2HQDA 1S0MA 2AZ1A 3I3GA 3P2HA 5J1EA 4O3NA 4E0AA 4ANDA 5IS2A 3C15A 3OTDA 2EK8A 3TEHB 3LO3A 4HT5A 3CXPA 4EO8A 2Q7BA 3WR7A 1CJVA 2YNGA 5IQQA 2OLWA 3UFCX 2HBYB 2C28A 1PJ7A 3DLLQ 4RWWA 1M1GA 4EYHB 2DXFA 4KVME 4AVCA 5IZHA 3MMCB 2VC1A 1ZOTA 1H7XA 2MXYA 3OSPA 3P8BB 2VFRA 2C27A 4NXYA 4OI4A 2FB0A 3I96A 2BKOA 5DQGA 5LMNF 1Q4RA 3AJDA 2OKQA 4KOVA 1R6YA 2AFOA 4YWYA 1RXTA 4B9LA 2C2NA 2J7WA 4DG1A 5GADI 3HSGA 1GK8A 2KJWA 4KKOB 1JLBB 2ZKTA 2XGPA 3PZJA 4H89A 4CIOA 1BQXA 4DL6A 3GV7B 1NDKA 1LWXA 4QJVA 2WVBA 2HZCA 4ZCIA 3HDSA 1VMBA 1EKSA 2AYGA 2CXAA 1JWWA 2BMBA 3JAMY 2UP1A 4DXLA 3LP2B 3KKFA 1GTEA 2FHKA 2W2NP 5C88A 4P4IA 4A2ZA 2NS1B 3MCNA 2H65B 2EKNA 2ZEGA 3J7ZT 4EO6A 3N4WA 4OC3A 3UCZP 3FCVA 3PP9A 1FHTA 3FYNA 3K0JA 1TVRB 3DOLB 3QZ8A 4AXIA 4I67A 3QMQA 4DMZA 4CAEA 2OMLA 1LXJA 1IBKJ 5KFZA 1PILA 1OSDA 1J4JA 2ZNZA 1FJGJ 3OR1A 3K9TA 4KSIA 4B9NA 5IFMA 1HW8A 5KFPA 5K14B 1REVA 3MMBA 4NLYA 1CJUB 2MQOA 1TK5A 1WK4A 1HBUA 3RO0A 2RQCA 3DC2A 4CO0A 1D9AA 5FD1A 4TLRA 4AL7A 1DQ9A 4KRWA 4ZCLA 2WVCA 1OYDA 3PX4A 3NH5A 2B4DA 1I6JA 4F6AA 2WSCC 3GQCA 2CFXA 2OZUA 4J9QA 1KHWA 3IGRA 1FK9A 3T5HA 1TKJA 3MM8B 1ZS6A 3M8QB 5LJ5Y 2W1BA 4DUTA 3RW7A 2I8EA 3DLGB 1ZPVA 1N4LA 3UPFA 3SJEA 5EBVA 2V0NA 3M6UA 1JXLA 3JSRA 1T3NA 4L6V3 3KHGA 2JSXA 3BPDA 2RIJA 1UFHA 2CNTA 2RS2A 2B6AA 1LANA 4DQIA 1R3NA 4WXWA 1MWQA 2CY2A 4DL7A 2E9ZA 2OFGX 4I6YA 2B7CB 5AGEA 2HFZA 5KFQA 4ZGYB 2QTWA 4XPDC 2PN6A 4W90B 2DNYA 4NGNA 5EMIA 2KM8C 5B0DA 4ZJOA 5D0HA 4UQTA 4UEFA 2IMWP 3N6LA 3G8TA 4NJQA 1P9QC 1VBZA 4IK2A 3W2VA 2LDIA 5KT5A 1KZFA 1S6QB 1HNXF 5A8KA 2JHEA 3OLBA 1HWJA 3KG0A 7FDRA 3CJ4A 2C2MB 1M5SA 5ETVA 3V6DB 4L3KA 2RHSB 3UDLA 3N0VA 3HSDA 2WAQD 2HHQA 5D29A 4ZY2A 3TJ8A 5F8LA 4C2ZA 1TIQA 3AT1B 1LW2A 2AYBA 3AD9C 2PFFB 1U47A 3FCHA 3BB5A 3V4IB 3DM2A 3PO4A 4CYUB 4LBPA 4BWJA 4KHPF 2GX8A 1EHWA 3PRDA 2HNZB 2WVEA 2HRUA 3CVKA 3DCAA 5DDOC 2B4BA 3QAEA 4EGLA 4F0YA 1V3SA 4P2SA 4FKXA 4LF5F 3RYLA 2VD3A 2NPIA 4FVMA 2MGZA 1UZDA 1RTJB 2NXJA 2KT2A 3HK2A 3OL6A 1N32J 1Y5IB 4MFPA 4F50A 2CUYA 3CWJA 1JLAA 3MRUA 4Y2IA 1YJ9S 1Z2ZA 5CYQA 4AD6A 4ED0A 1NKCA 3IRWP 2VONA 3CC4S 3B8HA 4ZLJA 1LWFA 4LVNP 5IB9A 2XO7A 4P9SA 2QMLA 1RWMB 3LF0A 3KHLA 5KTQA 3JSMA 1HPZA 1HD0A 4C8OA 2VQEJ 1RI7A 2PRQA 3Q89A 4MMOA 4QBJA 2Q4YA 2G4BA 3ISNC 3CTRA 2V68A 1RTQA 1R57A 3CCSS 2CIMA 3M8WA 3Q22A 3NXZA 2BJ9A 3M2VA 2F1FA 3T9NA 4ED8A 2Z3NA 4NLVA 3LTOA 2OPSB 4ENOA 3GR1A 2XMKA 4OYMA 3SCLE 4NYPA 4MT1A 5I3UB 3PEIA 4Y3CA 2IDLA 2ASLA 1OQ6A 4CH1A 3PKYA 2CDRB 2FLOA 2IBOA 1DLOA 2PJ8A 4U96A 1NSAA 3HFKA 2F4FA 2HS4A 1HWLA 1WACA 5IXUA 4CP5A 3H40A 1OO0B 2X7IA 3KLHB 1HBNA 2A1BA 4B11A 2BCOA 4DYOA 4NSQA 4HH1A 3LH2S 4GC6A 4WF9Q 1EIYB 3R9LA 3W9IA 2HVZA 2FPHX 2ZEEA 1RHUB 2QL7B 2CZVC 1S9EA 1WUUA 1CJKA 3BO3A 1GMWA 4B12A 1RHQB 2CRLA 4LF4J 1L3TA 1UFKA 4WIIA 2W01A 2BJ8A 2FLNA 3PO5A 3FSXA 4WXOA 2OPPA 2AYEA 1V6HA 1H73A 4ELUA 3T1AA 4QWAA 1J5EF 2VXKA 4RUHA 2AJ4A 4FNHA 2JLGA 2IA6A 1KUYA 3NBPB 2G0BA 3CEDA 2JC1A 5LMUJ 2PIYA 4JV5F 4ZPVR 4HR2A 3HHLB 2JEVA 3BYPA 1KFSA 2BKNA 4Q0BB 3VCDA 1ROFA 5CYMA 2I3CA 2M0GB 3DRRB 2ZZTA 2O53A 3KLEB 3IU1A 3RNZA 1YITS 4Y2MA 1ZO0A 4CRYB 4FF4A 4LT6A 4J9SA 4DN9A 4JWPA 4J37A 3HSZA 2XNQA 3PR5B 1P4NA 3ILIA 2KN4A 4KV8B 2W9BB 2MEWA 1UPMB 4R5PB 2GMLA 3F56A 4WKYA 3LPYA 2ZBRA 3L7PA 5KT6A 4HKFA 1WSVA 1Y9OA 2E5LF 3VARA 2GLJA 3JSBA 3ZZ0A 2DRDA 2GO9A 3T1YJ 4ZVQB 1G2EA 1FNOA 2BW2A 2FUG9 5AE2A 3HCXA 2VFSA 5J2MA 1WC5A 5B0BA 1ZZFA 2KH9A 3K58A 5KT7A 4BHQA 5DZ6A 3R7NB 3M2RA 3IGVA 4UIBA 2VDHA 3DNCA 1TU0B 1EETB 1MWYA 3IWEA 2C6CA 4UEZA 2QIRA 4IOAQ 2QO3A 1MJBA 3QSYB 1TELA 2OOTA 4MFJA 4P2FA 2W2MP 4F9VA 4E98A 1VBYA 2IJFA 4DV3F 5FIIA 3IWNC 5BWAB 4P4DA 1CJKB 1VIOA 2A6MA 3PR4A 5J2MB 1NMEB 2VG7A 4UOHA 1ZH5A 4ONWA 2YKPA 2HS3A 4B3TF 2WHOA 2D3O1 2Z2LA 2YY3A 3MWBA 3C8YA 3CF5Q 4FF1A 2WPXA 2Q1LA 4OQJA 4PWUA 1N36J 2E5IA 1AZSB 4O23A 2WPWA 4UOCA 2HSEB 2VUGA 3VHQA 4LF4F 1H7WA 5JGFA 2O3DA 2MZRA 4NEXA 2MKIA 2UVWA 3F0NA 1QMUA 3PYGA 4NLGA 2H5JB 3JYTA 3V81B 1YRUA 2H48B 3LP1A 4LSLB 4X84A 3UQSA 3GTYX 3G2XA 1PSDA 3KK3B 4CAFA 4PEOA 1QTMA 3GIJA 5I3UA 1T02A 3KLGA 5IQ6A 3WT4A 4F04B 2GANA 1UL3A 3KLIA 2QC3A 5AXMA 5HBMB 1B64A 3GJRB 4QYRA 2FSRA 4ECQA 2B8QA 5HSPA 3MN8A 1VHEA 3HHEA 3AOBA 1YZ6A 4OC0A 1KOHA 3G8QA 4UFVA 5F3ZA 2ZITA 4CGOA 4HHHA 3I9ZA 5FVJA 2HFUA 2QFIA 2R4FA 2CTBA 5K8NA 4JI6J 1RAAB 3TZXA 2CPZA 3FKBA 3WC0A 4F26A 3PRTA 3W8PA 2OTLS 4N8NA 1U1QA 1NU4A 5JJBA 4N5SA 3ZTSA 2R7WA 3PX0A 4FN5A 4U95A 1Q86T 2IM2A 3CNQP 5GAEU 5HH1A 3U27A 5HQLA 5KFKA 3MM9B 1XWLA 1B99A 2L41A 1F0XA 4ZIWA 3HVRA 4OLPA 4DFKA 4LF7F 4U5YA 2PC6A 2IBKA 4OHXA 3OVSA 1IKVB 4Q2LA 4GKKF 4DR1J 1W25A 4MIBA 4OX8A 3I0SA 3UWTA 4BS2A 4OZ0A 4NMXA 4EU0A 4OV6A 4Q45A 3FEXB 2PA8D 1CQMA 1AA1B 4M1KA 3OHAA 3BXMA 2RVJA 1Q5YA 3Q2SC 1RTDB 4M5KA 3GYNA 2UU9J 5IV3A 2RKIA 3L3CA 2HFOA 4M5NA 1TL1A 2R7UA 1NK7A 3DI6B 3A3PB 3M8SA 3M05A 2OAUA 2VJVA 3UE2A 2PJ7A 4JI2J 4PYAA 3FGVA 3H42A 3UCUP 2CVEA 1SH3A 5C7PA 4R87A 3R6LB 4GRSA 5IC6B 1S5KA 3HHNB 3I55S 2W7AA 2DEAA 2HG4A 2EKYA 1U02A 1DARA 2C2KB 3TO8A 5KOXA 1C0UA 5GAHI 2KRRA 3SEOA 4KUBA 4N77A 1MU2B 1Q53A 4ZP9A 2CPEA 2KG1A 3VGTA 1VJWA 4DV6F 4D3HA 2XTJP 1I94J 3IJ3A 2B3TB 3I0RA 3T90A 1KS2A 2HNDB 1NUEA 3QZ7A 3FJUA 5D0EA 1RLDA 2QA4G 4CLZA 3MCOA 3Q8YA 4OP4A 1B87A 4G1IA 1TKXA 1REGX 3L09A 4KB7A 4DCOB 4YY3F 3AB2B 4Y00A 3S7RA 3TQ1A 3K2KA 3OFGA 2Q51A 1A9NB 3I9V9 2GZOA 2F4VJ 4MHDA 4K4UA 1FJEB 1BAVA 1TL4A 1ZBTA 1VQ9S 1MK4A 2EK6A 1HI1A 2W2QP 4ER8A 2LA4A 1MNEA 2L08A 3LOUA 3FBCA 3HVWA 1R0AA 5EGYA 2K8GA 3FC9A 1S0NA 3PNIA 3NBPA 1HNXJ 2A18A 3HHLD 4O4GB 3EDRB 2P9EA 2HHHF 2M7SA 2BO9A 4YU9A 3JSMB 1B70B 3F41A 2P5VA 4R5PA 2FJXA 4HNYB 2F65A 4RBUA 3OT9A 1Z8WA 4O3QA 4JI1F 4A39A 2MKKA 3Q8UA 2YNFA 3OVAA 2EVZA 1U6FA 5KFCA 1IGBA 3CXSA 3CD7A 4KYZA 1KRPA 3W8GA 4U6PA 4F0KA 4ZBGA 1HWKA 1XMOJ 4IFYA 1REVB 2FLPA 1RT5B 4FXWA 4K50A 2EG2A 3KNAA 1RISA 4PRFA 3NH4A 1BUXA 1I1DA 3FRZA 4PKDB 1WI8A 2XZDB 3MFHA 3W6SA 2BANA 3ZZYA 4USIA 2E66A 2L9DA 5CZVA 2B56A 3P2FA 2K2PA 2DD8S 1S1XA 2VG5B 3J81U 1GXTA 2MZTA 3OR2B 1GTHA 1HI8A 4XDCA 4DF4A 2MZJA 4JBCA 1RT5A 2Z2MA 4KAIA 4RW8B 1RAGB 2PO4A 1EE3P 1YJ7A 3JRUA 4FS1A 3TOAA 2OH2A 2D74B 1U1RA 1U2RA 2MKYA 4A47A 2F5IA 5GADU 2HC9A 1XMQF 4JI3F 3HHKA 4QR0A 4UIAA 4KLWA 4QW9A 2Q6CA 3OR2A 1Q2CA 1WKLA 1UWYA 3IEHA 3FNCA 4DV0J 3BJ7A 4WP3A 1H38A 1S1UB 2EC2A 4LF1A 4ZY1A 3RUBL 4OHYA 3PB7X 4ALZA 1IM6A 5DG8A 1TP7A 4KFBA 4YDXA 2J6UA 2OTJS 3R5JB 2G3TA 1RQ0A 1S7HA 3GLJA 2UXDF 1XNQF 1C4CA 4PYDA 4DFMA 2DIUA 1QSSA 3DOMA 4FYXB 2HW3A 2F5GA 2Z3KA 2WW4A 2BQ3A 5JUMA 2K3IA 3EXNA 2AJFE 1YGHA 1L3KA 5KG2A 4USVA 3IM8A 4C0HA 2RMLA 2UV8A 2KXNB 3H8GA 4HNWB 3HVAA 1RT2B 2HV2A 3QSIA 1N5VA 4QR2A 1S4EA 3EPGA 3EE3A 1T94A 3R5BA 1VC0A 4K0KF 2FCKA 3MUTP 4QU7A 3GIKA 1S3ZA 3AJ2A 1JLAB 4GM5A 3IAS9 3ZO7A 3FNNA 2EWBA 3UDEA 3LAMA 3CC2S 1S10A 2LQ8A 3S6KA 3HO1A 2LECA 5KFLA 3T8WA 2YKNB 3HT3A 3P3DA 2PT0A 5KFEA 2E5GA 4A8YA 5ETLA 1C0TA 3MR7A 4JI8J 4OZ2A 4LBHA 2H5IB 3A4TA 1HDQA 3FEZA 2V6AA 4NLQA 1EB0A 4P44A 3V8IA 3UDVA 4WYWA 4I49A 1GMVA 1SCJB 1QAYA 4JI0J 4ITSA 1CEZA 1FT7A 2ATLA 1U09A 4J9VA 2DIVA 2V77A 1U7LA 1U6MA 2ILYA 1FESA 1P27B 4G1QA 3OBIA 2MY7A 3DNSA 4BBHA 1Y11A 3MPYA 4DSIA 2I00A 3NNAA 1WD6A 3VF0B 9RUBA 3ETMA 5IC4B 2DR6A 3QLHA 2XMMA 1QD1A 2QZ8A 4ID5B 5JQ4A 3UO0A 1SH2A 2J5AA 1AXQA 3HI9A 3PZPA 2CDQA 2YQ1A 2KVIA 3M32A 4OMFG 1BQNA 2VA2A 4R8UA 1Y00A 3M8YA 1BQMB 4OZJA 1FKPB 2ZZMA 4DPWA 3TI0A 4KGVB 2UUCJ 1JXVA 4PQAA 3DYAA 2P6EA 1HBOB 4NF1A 4M6IA 4H4OA 4RO0A 1HNVA 3DRPB 4YS2A 1U26A 1VR6A 2GHWA 2I5JB 4ZPTR 2RU9A 3HULA 3WABA 4R9MA 4K4TA 4CRZB 2HWTA 2QGFB 2GW8A 4DV2J 3SJFA 3J7Z5 1BWEA 1OQ3A 4DQQA 4AE5A 5KFMA 1KR4A 4XPDB 1WHVA 2UXDJ 3AH6A 4U9YA 3IM9A 4G3IA 3LW5C 2GLFA 5SUHA 3TZZA 1XR6A 3RJMB 2D3OR 2R7QA 3EDQB 5H9FJ 5A6WA 1J5OB 1TKFA 3H59A 2X51A 5K8PA 4OYIA 2Z2YB 2Y1JA 3I82A 1UCNA 3BBBA 3M4XA 4MCSA 3DLHA 2FGOA 3ITHA 4ZLLA 2HNYA 1RKJA 4M5DA 4DU8A 3NMRA 4EBCA 1V9OA 1QAXA 3AXKA 5J2NA 3QWUA 4PQUA 5CYJA 3GWCA 3SXNA 2OB0A 3MPDA 2IVFB 3IXQA 1SQHA 3MF5A 3GFHA 4ID8A 2V4QA 2XQCA 5A2QU 5J2NB 2KKHA 4O4GA 5KFVA 4EWTA 3R9GA 4J5OA 1FDBA 3ENQA 2XGQA 1TKTA 4B3TJ 4PK3A 2IRUA 4OI3A 1NK0A 3KASA 3I5AA 1UJ4A 2V67A 4RKUC 1HNZJ 2KYZA 3CJKB 2CG4A 2J9CA 4ECUA 2CA9A 2REFA 4NASA 4DV1F 3D7FA 2H4WB 4KS9A 4EVYA 4OIXA 4KSFA 2CQ2A 3RRHA 2R7TA 2DRAA 1UWAA 1N34J 4I69A 3KMQA 4OLLA 3GSIA 5DQIA 4F0HA 3MECA 3FFIB 1VQ6S 4YDDB 4USTA 3HJVA 4TYAA 4KKOA 4HDHA 3AXMA 1FDAA 3MHYA 2BA9A 1S1VA 2FTRA 1DTQB 3D3CJ 2UUTA 4LJMA 1X5TA 4MJKA 1RCOB 2BANB 5HQ8A 1F9FA 2AX1A 3BGUA 3IR5B 4CQ1A 3OPKA 3UD5A 1SBRA 3NE7A 5THWA 3MR6A 2CWXA 2MMYA 2CIJA 4DR5F 2BJEA 4MHPA 2HZVA 1HEEA 1RT2A 5KFRA 1SQEA 4N47A 2Z3PA 2GAHC 1KNZA 3ISXA 3TVZA 1ZM3A 2WOMB 2CWKA 4K5SA 2W9CB 3DDKA 1XBUA 1DHMA 2W4DA 1IBLF 3TO6A 3R9FA 2WTFA 2XY7A 1O8BA 4ZLPA 3CIZA 4LR8A 4WFZA 4ZVEA 2CQCA 2JH3A 4CAVA 3U02A 5AT1B 3M30A 1RP5A 4FD4A 1NK6A 3J81j 1T03A 3MDFA 2K7KA 2RH3A 1GNKA 1JLGB 5J1QA 5E96A 1G1XA 5LYIA 4FF2A 2XHCA 3O6QA 3MURP 3N01A 2CKWA 3MM9A 2VU5A 3IG1B 2Q66A 4P6QA 2OPPB 4LF5J 5GAGU 1SJQA 2FVRA 3DXSX 3NS6A 4L3NA 1E6YB 2XG8A 2ZM6F 2YKAA 2AIRB 1URNA 4WU3A 2P0WA 3DRRA 4Y2KA 2C3UA 2UU9F 2JFDA 4WWVA 1CULA 4DOZA 1RU2A 3GPAA 4ECXA 1K0TA 2KG0A 1XRYA 4LR9A 2IM1A 3E8OA 1CP7A 4KVOE 3MMJA 2HHWA 1P1LA 4M6GA 4FD7A 1XFOA 1YRTA 3NWRA 2NSBA 3VZHA 1PG5B 2ADCA 4DV1J 4P72A 3QRPA 1TUWA 2R2UA 2R7SA 4XK8C 1L3UA 3JTOA 2DH9A 4K8RA 2ZENA 1N34F 4DSLA 2FC8A 4LSZB 4LMZA 5L1IA 3W9JA 4PV6A 2EI5A 4W9YA 1F2GA 2AX0A 2CPFA 4Q5VA 1NPKA 2RJZA 1A2ZA 2LQJA 2EFPA 1VHIA 4KR0B 5KFGA 5IT0A 1LK7A 2GO8A 1P8GA 1S7IA 2D9PA 2Q79A 2I1RA 3O8WA 5D4OA 1GEHA 1IN0A 4R8UB 5G1ZA 5F8MA 4OAEA 2WRMA 4CAWA 4RN7A 4NXMF 2IA0A 1UP1A 4ZOSA 2JEGA 3R5AA 1H2TZ 4PXBA 4H6ZA 2HBRB 4N56A 2BEFA 2KZMA 2J0WA 4PXEA 4KVXA 1YX0A 2QEXS 1FVSA 2YNCA 4HI1A 1K47A 1XNRF 1N56A 2W9CA 1Q7LB 2PDOA 1X0PA 2NREA 4TU8A 1LOUA 1WI6A 4YFUA 4LRCA 4NOHA 1VISA 3TR5A 3PJWA 1Z4EA 3EY5A 3W3SA 2AQ4A 1MU2A 2F8EX 4AXVA 2QYGA 5T41A 4LRDA 3CIMA 3HFZB 1ELLP 1RWKB 3M9OB 4RW4B 5HLFB 4DSFA 2CQ0A 1FJCA 2MSTA 3ZZIA 4ELVA 2MTLA 2YWEA 1FKOA 2W4CA 4CO2A 2ALZA 1BLLE 2AFSA 4DV7J 5KG6A 1H2UX 4NXNF 3S9NA 2KHDA 2HEKA 2PEHA 4URGA 4AB7A 4LFCJ 3EGZA 2QYVA 1DE4C 4QIWD 2AE6A 2PE3A 3FX6A 1G3OA 3D5MA 2HB6A 1RT7A 4TXSA 2CZ9A 3T9ZA 3H5ZA 3QATA 3DR6A 3VZIA 5LYFA 3QGHA 1YZ7A 2FE7A 2G3AA 3TVYA 4KOYA 3KLFB 1QM9A 1M5PC 3T1HF 3PRVA 4NGTA 3B82A 5E7OB 1ZM9A 1H74A 4RNFA 3V2UC 2J9AA 4WZMA 4JYWA 1UTAA 5DO2A 3RRKA 5F8IA 4IQMA 1RT7B 1WNEA 4J9OA 1X9SA 4B14A 1NO8A 3PRBA 2BXJA 4ZN1A 3IR6B 5HMYA 4O3SA 3FBFA 2DR8A 2CPIA 1S49A 1LWCB 4CYQA 5HMZA 1NK5A 4R57A 1XK8A 3N9UC 3KGQA 2VJUA 3PX6A 4AG7A 2W25A 4H4OB 2BKPA 3L4BC 2CQ3A 2GIRA 3SSSA 3HLUA 1VC5A 3VGUA 1S79A 4P4BA 1ZA1B 4UF4A 1BWVA 2GIVA 2VI7A 5KG3A 4ETXA 2H54B 2B9WA 1RHMB 3VV2B 4A8QA 2QYCA 4FNIA 3MAHA 4IUSA 2RQMA 1DTQA 5D3GA 2XEIA 4ZVFA 4MCRA 4P45A 4X65J 4NEYA 2OH1A 3IC1A 3IGNA 2K06A 2QA2A 4IRCA 4PR6A 3LMSA 1FE0A 3NE8A 1I5OB 2VC0A 1F2OA 2HQ3A 3CDEA 1VRTB 3J80U 4TWEA 5F8NA 1IBMJ 1LFWA 4DPUA 1Y9WA 4PWDA 4E2FB 2AP6A 5LSRA 1ITPA 5DS0A 2D7SA 2CYYA 2DRBA 3CCQS 3KJNB 4MY0A 4Z65A 2QA4S 1T9XA 2ZH1A 3BKFA 1DTTA 2ZW7A 2RT3A 1PAUB 4FS2A 2Y9HA 3R9EA 2KYXA 4ZMMA 3TOBA 1S9EB 1Y3JA 1RADB 5B0EA 3CZXA 3WHIA 2AEFA 2D3ZA 3ET6A 3C19A 3HLPA 4LQ9A 2GQ2A 3DLJA 4H2KA 4RUBA 4DV7F 2ABZA 4RJVA 3ZZTA 1SKWA 2EUIA 3S6GA 2VH7A 1CVJA 1I12A 4HHUA 3S9MA 3PEJA 2AGQA 2B4PA 1NXIA 1N6QB 1VIXA 4DBQA 1YDLA 3R6GB 2V8PA 4PAAA 3BGLA 4RNMA 3KDOA 3OJSA 3DLKA 2R8VA 2UUAF 1HL6A 3DMJA 3T1HJ 2BDPA 4DUYJ 2OI2A 5LXRA 3J7YI 3EX7B 1IKXA 2EK1A 2DNRA 3G8SA 3SBMA 2XULA 2JFKA 2DXQA 4NLOA 1JWQA 3BI1A 4DDFA 1IR2A 4WE1A 1Y0RA 3M2VB 2D9OA 3EVOA 5L39A 3I32A 3JB9k 3OJUA 1RT1B 4A8KA 1U24A 5A8RB 1PIEA 4C68A 3X3UA 3C14A 5G20A 2XLIA 2J0XA 4UZBA 2PJ3A 3W60A 1F3VA 1UEUA 4QYZJ 3M2UB 1ULRA 2HHSA 2V34A 4USJC 2ALYB 1WF0A 1WF2A 4JUZA 4LF9F 3J7AN 5EUHA 3OSNA 4HNXB 3E01B 2PCUA 1I3OB 6CPAA 4L89A 2IAJB 4JV2A 3OL7A 2AZ3A 1NSLA 5KOWA 1NB7A 1S60A 4H54A 3MCSA 3IMQJ 1RA6A 3K57A 3CGIA 5IM0B 1HR0J 2ZJPQ 2JEJA 6FDRA 3KMSA 5B09A 3TW0A 1KTVA 3BGRA 1IKVA 2LA6A 2DNNA 1OWXA 2DH7A 3HX9A 2CQHA 3E51A 3K9UA 3GFZA 2ZNYA 4EZ9A 2IDEA 3D6TB 3JQKA 4TY9A 5A8KB 5DM7Q 3HHDA 3P49B 1Z5RA 2IVYA 5HP1A 2J6SA 1CULB 2DGOA 4MFBB 2VFUA 5DM6Q 3ELHA 2NCKL 2ROEA 1YQEA 1TF9A 1S1VB 5A2QY 2W7OA 3JUWA 1VLOA 2R1IA 2LEAA 1N5QA 1JKHB 3OD2A 1WKKA 1ZYQA 5L8RC 1Z1ZA 1D8YA 3FH4A 4CZCA 3BQ0A 4IO1A 3PYDA 4TN2A 1NZ8A 2V4JB 5MLCV 1H0HB 4DV6J 4P75A 4URQU 3SQGA 3ZTRA 2VQEF 1KLMB 3P4UB 4JLYA 1YBUA 3VAMA 1KBRA 1XQIA 3NCRA 4U67Q 2W2PP 2AW0A 1MMNA 3AA9A 3R1KA 1QQ9A 4F4KA 3I9SA 3SQGB 3AD8C 4Y6IA 2CNLB 1UEKA 2YWHA 4J9RA 2EFGA 2HZAA 3U1NA 1CLFA 2BE7D 1HWUA 2Z57B 5DDQC 1YJTA 1ZPWX 1JLEA 2IL4A 5GAGI 4MKAA 4ZVSB 1DTTB 4M95A 2R7VA 5CYMB 4YOEA 5HAOA 3RBZA 2ODFA 1F5CA 4LX9A 1PAEX 2I2YA 2B6AB 3OTOF 3FF3A 2BW7A 1U0HA 2HRYA 2PE8A 1JNRB 4X4OA 3H4QA 4USHA 3UN3A 5D8HB 4PXDA 1PYOB 1X4CA 1RHKB 4ECWA 2V8HA 3MEEB 4DR3F 1V3RA 4MRIA 4NLWA 4CO3A 2QLXA 2KB2A 3NGUA 3SQOP 2GC8A 4MXUA 2NSCA 5KFBA 4OX6A 3H25A 3TOQA 4A8SA 2MDAA 3KK3A 3BSNA 4R76A 4LVOP 3CT9A 3M8ZA 1C1CA 2RRNA 5KFOA 3LP1B 2ZDPA 3AODA 1KLNA 2HURA 3QRRA 2B5JB 1APSA 2JLFA 5ETQA 3MTKA 1FI4A 3VWSA 5IT9U 4O0NA 3R5CA 1AB8A 3PW7A 3ZZOA 1NJXA 4A46A 2UXCJ 1P9YA 3AOCA 1NEEA 3TNVA 4B9MA 2D41A 4X8IA 4IG0B 2KO1A 2M4MA 2DNLA 4F3OA 1YVKA 3QBCA 4FYYB 5CABA 2EO8A 4BINA 4G1PA 5JXSA 5L1KA 2X1AA 3C6UA 3MR3A 4PWWA 1EP4A 4OZNA 2B0GA 2R9LA 3NKYA 2IAJA 1FKPA 4P52A 1KVIA 3DSBA 2EFNA 8RUCA 1RTIB 3CCWA 3G6YA 2RF2A 1YG0A 2VBYA 4OX9F 3D2MA 3PJXA 1RACB 3V6DA 4C3MA 4X62F 2YKOA 1NPPA 3S6EA 4CS0B 2XEFA 4CO1A 2LXFA 1RU1A 3ADAC 5DLFA 2ZFHA 2OUGA 2NZ4A 3LWMA 5LSOA 3BGFA 2JOQA 1RYSA 2GGPA 4CM0A 3MPVA 4U8YA 2YH1A 4K0KJ 4OYXA 2M9KA 1KONA 2DNGA 2VFTA 1N54B 1VYAA 2LCWA 5AG4A 2AJ6A 2B8PA 2F7VA 4XNHB 1Z8XA 4S0MA 4M3SA 4Q43A 1IVZA 2J9EA 3QGGA 1YJRA 1MJAA 1U25A 2WVFA 3R1LA 4XPCA 1HHTP 1B7FA 2CXEA 1H3DA 2CPJA 3C15B 1RT1A 4ED5A 4AQYJ 3VAGA 5F9LA 2C6GA 3Q2TC 1A6LA 2D3UA 2DHXA 1H98A 2OPRB 1S7FA 4X4RA 4ZJLA 3QT8A 2EXUA 3C2PA 2C3YA 5GAHU 5C24A 4B13A 4BLGA 2AYMA 2Y1LB 4A8FA 4UBRA 4F3QA 1SH0A 4DR2F 1NSPA 1HBMB 4B08A 1VS3A 3PB9X 2ZOMA 4IFVB 2DO0A 2R8KA 4J9NA 4FBUA 1FTRA 3POTA 2U2FA 1S59A 3MFIA 2ZE2A 3QIPA 4MI4A 5AXLA 3CCES 1GXUA 4J9KA 4OIWA 2Q3PA 3WQPA 2PMZD 4F4ZA 3A8JA 4CLUA 1RO5A 4HACB 2PI4A 1T9WA 3D1HA 4XAKA 4YEAA 3D9BA 3HF5A 1WTBA 3BN7A 4K59A 2CJBA 1WOSA 4DV2F 1UA0A 2REEA 3OW2R 2HLTA 3ZZZA 4IQXA 4FUUA 1F2PA 3NP5A 3G4SS 2ZELA 1EZZB 2MLZA 2WZNA 2Q4ZA 2VICA 2DHSA 2Q6BA 3LP0A 3BV8A 4ZHRA 3NCPA 1SKRA 1GXLA 4I0WA 4YN3B 4LRAA 2L48A 5A8RA 2JEIA 4KGXB 2CNMA 1QVFR 3CCUS 5LRKA 2C2EA 3BDEA 2AHOB 3H90A 5BYRA 2ZJRQ 3B6BA 4YY3J 3D66A 3QYYA 2DPSA 1H2VZ 1RA7A 3SV4A 2CQGA 3CO9A 2F9DA 3KLFA 3R27A 3NS5A 2VA3A 2GIQA 1VQYA 1BHNA 4LF6F 3W7BA 1IQTA 2NXEA 1RKIA 2MLXA 3VR1A 5H86A 3KUGA 2YQ3A 1HFEL 3MMAB 1ZTTA 1A7GE 1YVFA 4DV5F 1GFWB 1BC6A 4ECSA 2XBPA 4FBEA 1UVKA 2KXHA 2DITA 4OJ1A 4M5MA 1YW4A 4U9RA 5CCMA 5G22A 2LQBA 1SC1B 4RW9B 2IRYA 1FX4A 3U1MA 1VHFA 1K73T 5H9FK 1NHVA 3FEYB 4RBVA 4WK3A 3SI2A 2DISA 3CSKA 1ZM2A 1KEKA 3DR8A 2CPHA 4DQSA 1DRZA 3QWPA 2CQPA 4QBUA 3TO9A 1S9GA 4FAIA 4FPRA 1JK9B 5B7WA 3IFEA 2C2RA 3GU0A 2QECA 4ES3A 1JKHA 7FD1A 5EX0A 4MH8A 1FFGB 3TRGA 4R0EA 3NCQA 4UWJA 1WC0A 2CAJA 4I2PA 4RW6B 2I79A 1TXRA 3RZAA 1U2FA 4JV0A 2B43A 3A3OB 2EG1A 4ED4A 4DJLA 3PW5A 2QRRA 1B3TA 1BD6A 1NM2A 1K1SA 2VBXA 2KXFA 2CVIA 4FPIA 3OXLA 4FBTA 3BDPA 1TAQA 4OZ5A 1H8LA 5CHCB 3SIPB 4OX7A 2A3JA 1OIAA 1FFSB 4A48A 4JV1A 3BH6B 1RAFB 2XMAA 3KUEA 3QJPA 2LFVA 1N5TA 1TK0A 3NGRA 3CDWA 1EJ7L 2ZEMA 4KOXA 2E44A 3T1YF 2ZJQQ 3K5LA 4F2SA 2XS5A 4N41A 2ROGA 2EW9A 1BMQB 1HQEB 2YWWA 2DH8A 1U1NA 1M90T 2MKHA 2HGLA 3GJSB 3U7JA 3WZ0A 3CCMS 4MKBA 3R2DJ 5HLFA 3FQKA 4RW4A 4X64F 2OSRA 3ILOA 3W1YC 4KQZA 3EZUA 1T0TV 3R97A 1FFWB 4CLFA 1RWUA 1Z4RA 4Y49B 4WYLA 2AFUA 2XZTB 1Q8KA 1UW4A 1UVMA 3SJGA 1T95A 4CH7A 2OD6A 4P7TA 4V19X 5LJ3Y 1O51A 1RBOB 5MAOA 1B6BA 4KPCA 3D6MB 3R7SB 2OP5A 2FY8A 3DDDA 3PW2A 1FDDA 1S9GB 3OLAA 3C16B 4CYNA 4RNNA 1CS4A 3DRSA 3TE4A 1SJFA 3N28A 2MZ1A 2B9XA 1R89A 4K4VA 2RAQA 4PSXA 1JLBA 3MAQA 2NPFA 2JLMA 4X4UA 2AWZA 4KGMA 2CPXA 1F9HA 5KFAA 5C25A 1TK8A 3NS7B 3GG1A 3TWZA 2V69A 5BJRA 1M1DA 2RFHA 5F46A 4X2BA 2CNKB 3LUYA 4UY8T 3BH7B 4ED1A 2YQ0A 3CD0A 3FBEA 3T5LA 3CJ8A 3MECB 1FRJA 4DZ6A 5HMNA 2J0SD 2MZSA 5L1LA 1X4HA 3NAHA 2ZWOA 2X3GA 4DR4J 3IBWA 2QT7A 2HHTA 1YI2S 1U1MA 1JLCB 1BGXT 1NBEB 2AJQA 7CPAA 4E2AA 3PJ9A 4L8AA 3B2YA 3ZZUA 4XIUA 3HFVA 2YBVA 2RDJA 3RR7A 2A4NA 2ZD1A 2AD9A 3N6NA 3QO9B 4F67A 4QCLA 2WONA 4ZVRB 1PGZA 1FNMA 3KZWA 3HKWA 1UJ6A 3GKRA 1U1KA 2O28A 1SKUB 2E9RX 5L1JA 2E7VA 3UR3C 1CS4B 2ASYA 1FNXH 4OHVA 2GJ2A 2CNSA 2J8SA 2HQIA 4JYAJ 3S9LA 2A10A 2ZH9A 2A2DA 2CJYB 1XIQA 5J2QA 3WBZA 3RBEA 2EC0A 3PHEA 1EKRA 4C8KA 4DL2A 1FERA 4USUA 3MUVP 1HMVA 3PG9A 3KOAA 1RLCL 4P6YA 1IKWA 2FS5A 3CCVS 4WWSA 4RI1A 1RT6A 1LNQA 1YLOA 3R5GA 1NKBA 3CPWR 3P6YC 4NGSA 2GQQA 4RUCA 4CO5A 2CNOB 2ZXVA 8AT1B 1AUDA 3FSYA 3A12A 2GMHA 5AE3A 2ACYA 3CPAA 4UZCA 2B9EA 1FRMA 3GIUA 4ZVTB 5L9XA 3NAIA 2PIIA 3AHPA 1FWLA 1S12A 4GC7A 1X10A 4B5OA 2MSSA 4F4YA 1GMUA 1YVOA 4I4BA 5KFJA 2OPQB 3RG6A 4Q7AA 5LRJA 4EYIB 2YVSA 4Z2XA 1Q16B 1RT4A 1S48A 4JI5J 1IY7A 2DPJA 1G6BA 2HGNA 2FD2A 1NK8A 3TP2A 1OPZA 4ZCKA 2QE5A 2DNZA 3HD2A 1JMTA 3P5TL 1Y10A 3SSRA 2FC9A 1LWEB 3TJ9A 3M7VA 3H5YA 1NPRA 1HBUB