1Q7LA

Zn-binding domain of the t347g mutant of human aminoacylase-i
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
192
structure length
192
Chain Sequence
EEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoacylase-1
publication title Essential roles of zinc ligation and enzyme dimerization for catalysis in the aminoacylase-1/M20 family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 58
structure length 192
sequence length 192
chains with identical sequence C
ec nomenclature ec 3.5.1.14: N-acyl-aliphatic-L-amino acid amidohydrolase.
pdb deposition date 2003-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1q7lA00
1XRYA 2AFOA 2EWBA 1ZLHA 2XEFA 1QMUA 2ABZA 2V8DA 3PB6X 1CPXA 4PQAA 4MCQA 2HB6A 1YW6A 1IGBA 3HLPA 3S9MA 3IJ3A 1IY7A 3TC8A 4W9YA 4A37A 4X8IA 5LYLA 2PJ3A 2C6CA 3D67A 3JRUA 4F9UA 1XJOA 2NSMA 3S9LA 5LYFA 4NFRA 4G1PA 5LYIA 2HC9A 3FX6A 1HDQA 4O23A 2RB7A 4JZ0A 4A94A 1ELLP 2AFMA 4NJQA 3DLJA 3DGVA 4OC4A 1LCPA 3GLJA 4F8ZA 2CTCA 3GUXA 3B35A 3PFEA 3PB4X 1DTDA 1AYEA 4ZY2A 5LRGA 5K8OA 2PJ9A 3H8FA 3BI0A 2PIZA 4MHPA 4OKOA 4R6TA 3B3SA 2ZELA 1TKFA 1H8LA 3KASA 1Q7LA 4P4IA 4ZYQA 4X2TA 3KHZA 4EFDA 3IIBA 3CT9A 4F9VA 2Q4ZA 5LRJA 4UF4A 1HEEA 4OIWA 5JH9A 3D66A 4JYWA 4MCPA 3VATA 4AXVA 3NFZA 3CPXA 4MHNA 1JQGA 3GB0A 5D29A 2O4HA 2PJ5A 2PJ1A 4CPAA 4NGSA 6CPAA 3SJEA 3FECA 4UIBA 1ZG7A 1PCAA 1CPSA 2V8VA 1ELMP 2QVPA 3IEHA 3PB8X 1VGYA 3IWWA 4NGTA 2OOTA 3WABA 4ZI6A 4P4FA 3RZAA 4R76A 4FAIA 3ISZA 1EE3P 1Y7EA 3TX8A 3B3WA 1F2OA 3B7IA 2O53A 3IC1A 5HVGA 4OC3A 1CX8A 1KWMA 3PB9X 1LANA 2ZEOA 3KGQA 2QJ8A 4OIDA 1YLOA 1CP7A 4DJLA 1TF8A 4Z65A 4FBEA 3B2YA 4NGMA 4NGRA 4DUKA 4BD9A 4IHMA 3K9TA 2PVVA 4ZY0A 2RFHA 4P4BA 2EK9A 4R8FA 4H2KA 4B6ZA 4OC1A 4A38A 3BI1A 2FVGA 3WC7A 3PEIA 4WWVA 1XBUA 1CG2A 4OC2A 4A39A 1FNOA 2I3CA 2GLFA 4MHYA 2POKA 3KZWA 4UIAA 2C6GA 1Z8LA 2CIJA 4P4JA 1R43A 3CDXA 1ZG9A 2BCOA 3FEDA 2J9AA 4NGQA 4OC0A 1F57A 3FH4A 3KR4A 2Q51A 2V8GA 3PB7X 3KQXA 3KR5A 1F2PA 3PRTA 2XEIA 3SJGA 1LAPA 3PBBA 3L2NA 3B3TA 5K8NA 4MRIA 1BLLE 4PXEA 1LAMA 5HVFA 4Q7AA 4K3NA 2F7VA 2BO9A 3PBEA 2EK8A 3LWUA 2PVWA 3T8WA 4PPZA 2VL1A 2IJZA 4WJBA 1FT7A 2ZEPA 3H8GA 4TNUA 3NH5A 2PRQA 4MCRA 5LYDA 4MMOA 5K8MA 2CF4A 1QQ9A 5HVHA 1HDUA 2BOAA 3VH9A 1XFOA 1BAVA 3ISXA 1BPNA 1R3NA 1VIXA 4FUUA 4IK2A 4PXBA 1ZLIA 1XMBA 3SJFA 1TF9A 2PCUA 3VARA 1CBXA 2F8HA 1PYTB 3FMCA 3CPAA 4UEFA 3WC6A 1YW4A 3MN8A 5D8NA 3SI0A 1OBRA 3PFOA 2AFZA 3D7FA 2PJBA 3K2KA 1M4LA 1ARMA 2PJ8A 3B3VA 2AFSA 2ZOGA 5HXDA 4NGNA 4ZX9A 1BPMA 2GU2A 3SJXA 3D7HA 3WT4A 1GYTA 5JGFA 4P4EA 5I4MA 4KSIA 1Z5RA 2ZEHA 4P4DA 1NSAA 2QYVA 2ZOFA 5LRKA 4GM5A 2DEAA 2ZEEA 2AFXA 2PJAA 1ZG8A 5ELYA 3KI9A 5K8PA 1DE4C 1LFWA 2AFWA 3LMSA 3NH8A 2PJ6A 2XEGA 4ZY1A 1YMEA 2G9DA 3FF3A 4OC5A 5F09A 3S9NA 3SI1A 4P10A 3V38A 4PXCA 3KL9A 2V77A 3FVLA 3QNVA 1VHOA 1RTQA 1YSJA 3BXMA 4YU9A 2Q43A 2ZENA 3FJUA 2ZEGA 1TKJA 3D68A 4TWEA 1TXRA 2GLJA 2ANPA 3H8EA 2PJ4A 2PJ2A 3MRUA 5CBMA 4RUHA 4EWTA 2XEJA 3D7GA 4EMEA 4UEZA 4P45A 2AFUA 4ZX8A 3RAMA 2C6PA 2PJ7A 3V7ZA 1CP6A 3N5FA 4MXUA 2IQ6A 1AMPA 3I1UA 2JEWA 4IAVA 3D4UA 4YWYA 4OP4A 4R7MA 2ZEMA 2PIYA 2ZEDA 2ZEFA 4FWUA 3KHXA 4ONWA 5THWA 2C1CA 1ARLA 4UEEA 1VHEA 5JM6A 3SI2A 2V8HA 4P44A 5DS0A 1LOKA 3IFEA 5IB9A 3KQZA 2IMOA 4X3RA 2PJCA 2GREA 2WZNA 3NA6A 1Y0RA 3NH4A 2OR4A 4NGPA 1Z2LA 7CPAA 4MCSA 3IO1A 1TKHA 3D7DA 3FEEA 2WYRA 3B3CA 3HUVA 4OMEA 2PE3A 1Y0YA 5CPAA 4PXDA 5J1QA 4MHZA 4P6YA 1UWYA 2NYQA 3BHXA 4DYOA 3RBUA 2JBJA 4LQGA 4NJRA 3WC5A 8CPAA 2PJ0A 2CTBA 2JBKA
chains in the Genus database with same CATH superfamily
1XRYA 1XMTA 4RN7A 4MJ8A 2AFOA 2EWBA 1ZLHA 4UWIA 2XEFA 2ZPAA 2Q7BA 1QMUA 2ABZA 2BEIA 4M85A 3UY5A 5F46A 2FIAA 2P6GA 2EUIA 2V8DA 3A9LA 3PB6X 4JLYA 4KOVA 3R9EA 1CPXA 1S7FA 1ZO0A 4F6AA 1M4IA 2R7HA 4PQAA 5AG7A 2Q4VA 4LQ6A 2HB6A 4MCQA 1U6MA 2J8NA 3F0AA 1YW6A 2ZW6A 4C2XA 4B10A 4AG9A 5KTAA 3D2PA 1IGBA 4UBRA 3HLPA 3S9MA 3W91A 3IJ3A 1IY7A 2G3TA 3TC8A 3PGPA 4W9YA 4KSFA 4J3GA 4OADA 3FB3A 4A37A 4UFVA 4X8IA 3W6SA 5LYLA 2ODFA 2PJ3A 2R98A 4CGPA 2C6CA 3D67A 3JRUA 2VI7A 3LD2A 2D4OA 4F9UA 1XJOA 2NSMA 5FVJA 3S9LA 5LYFA 4NFRA 2Z3NA 4G1PA 4NF1A 5LYIA 3E0KA 2HC9A 3B8GA 1HDQA 3FX6A 4KSAA 1QSNA 4O23A 4CYNA 2X7BA 2PSWA 4CYOA 4BMHA 2A4NA 3RNZA 2RB7A 3FRMA 4JZ0A 4NXYA 2CY2A 4PK2A 1ELLP 4A94A 4QC6A 2AFMA 3K9UA 4NJQA 2DPSA 3DLJA 3DGVA 3QAHA 4OC4A 1LCPA 3GLJA 3IU1A 2YGWA 1RXTA 1WWZA 1Z8WA 3PP9A 4LX9A 2CTCA 4AB7A 3GUXA 4F8ZA 2AE6A 2B5GA 1Z9UA 3B35A 3PFEA 3PB4X 1DTDA 1AYEA 4KVME 4ZY2A 1Y7RA 5LRGA 5K8OA 2PJ9A 4KLWA 3H8FA 1TIQA 5EMIA 1KUVA 3EY5A 1IU8A 5AGEA 3N7ZA 2HV2A 2WSAA 3EO4A 3BI0A 3JTKA 2PIZA 4MHPA 2Q4YA 4OKOA 3TE4A 1X10A 4R57A 4H6ZA 4R6TA 4KZTA 5KTDA 3B3SA 2ZELA 3S6HA 4HNYB 1S7KA 3TTHA 1TKFA 1H8LA 3KASA 5GCNA 3H4QA 1YK3A 3DSBA 1Q7LA 2IL4A 4P4IA 2PDOA 2PR1A 4ZYQA 1I12A 3FIXA 4X2TA 2F5IA 2REFA 2GANA 3KHZA 2ARHA 4U5YA 4EFDA 1BO4A 3IIBA 5F47A 1QSRA 4MY3A 3CT9A 4F9VA 3F8KA 2Q4ZA 5LRJA 3I9SA 2Y0MA 4UF4A 4RS2A 4L8AA 1HEEA 2FT0A 4OIWA 5JH9A 3D66A 4R9MA 4JYWA 1N71A 4MCPA 3VATA 3VWEA 1Z8XA 4AXVA 3SHPA 1S5KA 2DPTA 3NFZA 3CPXA 4E2AA 4MHNA 4KLVA 1JQGA 2BUEA 3GB0A 2O4HA 2PJ5A 5D29A 2PJ1A 4UFWA 4CPAA 3ZZIA 4NGSA 6CPAA 4JD6A 3SJEA 1NMTA 3FECA 2VEZA 4UIBA 4KS9A 5F49A 1ZG7A 1PCAA 1CPSA 4IF5A 2V8VA 4GXHA 2OZHA 1XIXA 2QECA 5CNPA 3MGDA 1ELMP 2QVPA 3IEHA 1CJWA 3PB8X 3S6FA 1VGYA 5JPHA 4H89A 2GFQA 3IWWA 4NGTA 2OOTA 5BWAB 2PQ8A 3WABA 4ZI6A 3TOBA 4A30A 2B58A 4P4FA 3TO9A 4BINA 2FCKA 2VZZA 1Z8TA 1V0CA 3RZAA 4R76A 4FAIA 3DR8A 3FYNA 3ISZA 1EE3P 1Y7EA 2FIWA 3TX8A 2PRBA 1J4JA 3B3WA 2FL4A 1F2OA 4M6GA 2B5GB 4AVAA 2Q0YA 3B7IA 5H84A 2O53A 3IC1A 1IYLA 5HVGA 2YNCC 2I00A 4OC3A 1CX8A 1KWMA 3PB9X 4A33A 4EVYA 1LANA 3RYOA 2ZEOA 3KGQA 5EC4A 2OH1A 4R3KA 3EFAA 2QJ8A 2G3AA 4OIDA 1YLOA 1CP7A 1YVOA 2REEA 1TF8A 4DJLA 4Z65A 4KOWA 5I0CA 3LACA 4FBEA 1BOBA 2FS5A 4KOTA 3B2YA 4NGMA 4NGRA 4DUKA 4BD9A 4IHMA 3K9TA 2PVVA 4II9A 3TT2A 3QAYA 4JXRA 4ZY0A 2RFHA 4P4BA 5C88A 2EK9A 4XPKA 3R95A 2Z3LA 4R8FA 1K4JA 3RO0A 4ZGYB 4H2KA 4B6ZA 4OC1A 4A38A 3BI1A 2OB0A 2FVGA 1YREA 1FY7A 1S7LA 2VQYA 3T90A 3R9GA 3WC7A 4MFLA 4PSWA 3PEIA 4WWVA 1OZPA 3DR6A 4QB9A 4Q36A 3IWEA 1XBUA 1CG2A 2NMTA 2QMLA 3R9FA 4OC2A 3QB8A 4A39A 1FNOA 2WPWA 2YNEA 2FE7A 4U9YA 4MFQA 2I3CA 1QSTA 2GLFA 3D2MA 3NE8A 2POKA 4KOSA 2Z3MA 4MHYA 3KZWA 4UIAA 2YNCA 2FSRA 2C6GA 2J8MA 4KUAA 4B11A 1Q2DA 1Z8LA 2BSWA 4CGNA 4AVCA 2P0WA 2CIJA 4P4JA 1R43A 3CDXA 4A95A 1ZG9A 4F0YA 2BCOA 2CXAA 3FEDA 3VWDA 2J9AA 4NGQA 1A2ZA 3C26A 4OC0A 1F57A 3FH4A 3KR4A 4UWJA 2B4BA 1MJ9A 1S7NA 1L0CA 2Q51A 2V8GA 5JQ4A 3PB7X 1S60A 3KQXA 3KR5A 1IOFA 1F2PA 3PRTA 4M6IA 2XEIA 3I3GA 5AG6A 1LAPA 4XPDB 3SJGA 4AG7A 3PBBA 4CYPA 2JDDA 3L2NA 3B3TA 2HUZA 4CRZB 5K8NA 2GE3A 4L89A 4MRIA 1BLLE 4A31A 2I79A 4PXEA 1LAMA 4MHDA 5HVFA 4Q7AA 3JUWA 2GIVA 4K3NA 4H6UA 4MFKA 2DXQA 2F7VA 2BO9A 3PBEA 2EK8A 3LWUA 2KCWA 2PVWA 4MBUA 4A2ZA 4C7IA 4JXQA 1M44A 3T8WA 2Z0ZA 4UA3A 2Z11A 4DNCA 4PPZA 1QSMA 2VL1A 2IJZA 2ZW7A 2DF5A 4E8OA 5AG4A 4WJBA 3TFYA 1FT7A 3LODA 4C2YA 2ZEPA 1MJBA 1SQHA 3H8GA 4TNUA 3NH5A 3SXOA 2H5MA 2PRQA 4YFJA 4JWPA 4MCRA 5LYDA 5J8FA 4MMOA 5K8MA 3D3SA 3GY9A 2CF4A 2Z3PA 3KKWA 2HQYA 4Y49B 1QQ9A 5HVHA 1NSLA 1HDUA 2Q04A 2BOAA 3VH9A 2YNDA 1XFOA 4HNXB 1I1DA 1X12A 1BAVA 3ISXA 1BPNA 3DNSA 4B5PA 1R3NA 1VIXA 1VHSA 2VBQA 4FD6A 4FUUA 4IK2A 4PXBA 4QVTA 4PV6A 1ZLIA 1XMBA 3SJFA 1TF9A 2PCUA 4KOXA 3VARA 1CBXA 1Z4EA 2F8HA 4YRHA 1PYTB 3FMCA 3CPAA 4MFZA 4UCMA 4KORA 4UEFA 3WC6A 1QSOA 1YW4A 3MN8A 1Y9KA 5D8NA 3SI0A 1OBRA 3PFOA 2AFZA 2ZW5A 1M1DA 4CS0B 3R96A 1IYKA 3D7FA 2PJBA 4XNHB 1YR0A 5H86A 3K2KA 1M4LA 1ARMA 2PJ8A 1M4GA 2AFSA 2B3UA 3B3VA 2ATRA 2ZOGA 4CYQA 5HXDA 4NGNA 5E96A 3F5BA 4ZX9A 2R8VA 1BPMA 2GU2A 4JJXA 2JLMA 2Z3OA 3SJXA 3D7HA 4E0AA 3WT4A 1GYTA 3CXSA 2B4DB 3TCVA 5ISVA 3BLNA 4RI1A 3D8PA 4K30A 3ZJ0A 5JGFA 4P4EA 5I4MA 3IWGA 3TO6A 2B3VA 2ZW4A 4XNHC 4KSIA 5A27A 1Z5RA 2ZEHA 4P4DA 5G22A 1NSAA 1IIDA 4B14A 2Z10A 1KZFA 2QYVA 3W6XA 1Q2YA 3S6GA 2ZOFA 1GHEA 5LRKA 4Q38A 2OU2A 4GM5A 3CXQA 2DEAA 2ZEEA 4B5OA 1PUAA 1MK4A 4CGOA 2AFXA 1MJAA 2PJAA 1ZG8A 5ELYA 1YX0A 4MY0A 1Z4RA 3KI9A 5K8PA 1DE4C 1LFWA 1B6BA 1I21A 2AFWA 3LMSA 2G0BA 4ZBGA 3NH8A 5EBVA 2R1IA 2PJ6A 2XEGA 1XF8A 1YVKA 4ZY1A 1YMEA 3WR7A 2G9DA 3FF3A 4OC5A 5F09A 3S9NA 3SI1A 4KVXA 3G3SA 3SXNA 4P10A 3EXNA 1R57A 5G1ZA 2RC4A 3V38A 4PXCA 3KL9A 4OAEA 1XE4A 2V77A 5KTCA 3FVLA 3QNVA 3V8IA 1VHOA 1RTQA 1YSJA 4B5PB 3BXMA 4NCZA 4YU9A 4A32A 1P0HA 4R87A 2Q43A 3T9YA 1YQEA 5F48A 4U9ZA 2ZENA 3JVNA 3CXPA 3FJUA 2ZEGA 4C7HA 1P4NA 3IU2A 4HNWB 3H5ZA 2OZUA 1TKJA 3D68A 2ZXVA 4TWEA 4QUSA 1TXRA 2GLJA 5IX3A 2ANPA 4CAVA 3H8EA 2PJ4A 5HH1A 1XOVA 3GIUA 2PJ2A 1ON0A 2B4DA 4HPSA 4MFJA 3MRUA 5CBMA 4FD5A 1AUGA 4RUHA 1KUXA 3FNCA 1UFHA 4M3SA 1NE9A 1VKCA 4HKFA 2CNTA 2XEJA 3D7GA 4KOUA 4ONUA 4EMEA 4EWTA 3TO7A 2EBJA 4KVOE 3BJ8A 4F0XA 3BJ7A 4UEZA 2WUUA 2EVNA 4IUSA 4P45A 2AFUA 4MFPA 4ZX8A 1S3ZA 3RAMA 1WK4A 2C6PA 2PJ7A 3V7ZA 4UCPA 1CP6A 3N5FA 4MXUA 2IQ6A 1AMPA 3I1UA 1IICA 2Q44A 5A28A 3GKRA 2JEWA 4IAVA 4XPDC 2JEVA 1LRZA 3D4UA 3IGRA 3GYAA 4NEXA 2Z3KA 3G8WA 4YWYA 4OP4A 4R7MA 2K5TA 2ZEMA 4R3LA 4QBJA 5J8CA 5G20A 2PIYA 4FD4A 2ZEDA 2PC1A 2ZEFA 1Q2CA 4YGOA 3FBUA 4OLLA 4UFXA 4CAFA 4FWUA 1KUYA 3P2FA 1IB1E 2JDCA 3KHXA 2EO8A 4B13A 4ONWA 5THWA 2C1CA 2D4PA 2QIRA 1ARLA 2Q7SA 4UEEA 5IB0A 1VHEA 5JM6A 2O28A 3SI2A 2V8HA 4B12A 4P44A 4BBHA 4NSQA 4C2ZA 3EC4A 5DS0A 4X5KA 1LOKA 3IFEA 1RO5A 5HMNA 5IB9A 1IOIA 5G21A 3KQZA 5DWMA 3OWCA 1YGHA 2IMOA 4X3RA 2VXKA 2PJCA 2FXFA 2GREA 4I49A 2WZNA 3NA6A 4PSXA 1Y0RA 4KOYA 4C68A 2WPXA 5IV0A 4Y49C 3NH4A 2OR4A 2CNSA 4NGPA 1Z2LA 7CPAA 4MCSA 3IO1A 1JWQA 3PZJA 1TKHA 3D7DA 3FEEA 2WYRA 2C27A 2J8RA 2PR8A 3B3CA 3DDDA 2CNMA 4CAEA 3HUVA 4OMEA 1PU9A 5AG5A 1B87A 2AJ6A 2PE3A 1Y0YA 4CAWA 5CPAA 3FXTA 3R1KA 4PK3A 1YLEA 4PXDA 4CGLA 3NE7A 4XPLA 4AVBA 4FD7A 2P6FA 4KUBA 4GS4A 3TOAA 4CAXA 5J1QA 2P6EA 4MHZA 4P6YA 1UWYA 2NYQA 1XEBA 3BHXA 1CM0A 4MI4A 4DYOA 2VZYA 4UCNA 3RBUA 4LUAA 2JBJA 4LQGA 4NJRA 3P2HA 3WC5A 8CPAA 3S6KA 4M6HA 4CRYB 2PJ0A 5C82A 3CZXA 2OZGA 1Y9WA 4ORFA 5DWNA 4CGMA 2CTBA 1M4DA 2BL1A 2JBKA
chains in the Genus database with same CATH topology
1XRYA 2AFOA 2EWBA 1ZLHA 2XEFA 1QMUA 2ABZA 2V8DA 3PB6X 1CPXA 4PQAA 4MCQA 2HB6A 1YW6A 1IGBA 3HLPA 3S9MA 3IJ3A 1IY7A 3TC8A 4W9YA 4A37A 4X8IA 5LYLA 2PJ3A 2C6CA 3D67A 3JRUA 4F9UA 1XJOA 2NSMA 3S9LA 5LYFA 4NFRA 4G1PA 5LYIA 2HC9A 3FX6A 1HDQA 4O23A 2RB7A 4JZ0A 4A94A 1ELLP 2AFMA 4NJQA 3DLJA 3DGVA 4OC4A 1LCPA 3GLJA 4F8ZA 2CTCA 3GUXA 3B35A 3PFEA 3PB4X 1DTDA 1AYEA 4ZY2A 5LRGA 5K8OA 2PJ9A 3H8FA 3BI0A 2PIZA 4MHPA 4OKOA 4R6TA 3B3SA 2ZELA 1TKFA 1H8LA 3KASA 1Q7LA 4P4IA 4ZYQA 4X2TA 3KHZA 4EFDA 3IIBA 3CT9A 4F9VA 2Q4ZA 5LRJA 4UF4A 1HEEA 4OIWA 5JH9A 3D66A 4JYWA 4MCPA 3VATA 4AXVA 3NFZA 3CPXA 4MHNA 1JQGA 3GB0A 5D29A 2O4HA 2PJ5A 2PJ1A 4CPAA 4NGSA 6CPAA 3SJEA 3FECA 4UIBA 1ZG7A 1PCAA 1CPSA 2V8VA 1ELMP 2QVPA 3IEHA 3PB8X 1VGYA 3IWWA 4NGTA 2OOTA 3WABA 4ZI6A 4P4FA 3RZAA 4R76A 4FAIA 3ISZA 1EE3P 1Y7EA 3TX8A 3B3WA 1F2OA 3B7IA 2O53A 3IC1A 5HVGA 4OC3A 1CX8A 1KWMA 3PB9X 1LANA 2ZEOA 3KGQA 2QJ8A 4OIDA 1YLOA 1CP7A 4DJLA 1TF8A 4Z65A 4FBEA 3B2YA 4NGMA 4NGRA 4DUKA 4BD9A 4IHMA 3K9TA 2PVVA 4ZY0A 2RFHA 4P4BA 2EK9A 4R8FA 4H2KA 4B6ZA 4OC1A 4A38A 3BI1A 2FVGA 3WC7A 3PEIA 4WWVA 1XBUA 1CG2A 4OC2A 4A39A 1FNOA 2I3CA 2GLFA 4MHYA 2POKA 3KZWA 4UIAA 2C6GA 1Z8LA 2CIJA 4P4JA 1R43A 3CDXA 1ZG9A 2BCOA 3FEDA 2J9AA 4NGQA 4OC0A 1F57A 3FH4A 3KR4A 2Q51A 2V8GA 3PB7X 3KQXA 3KR5A 1F2PA 3PRTA 2XEIA 3SJGA 1LAPA 3PBBA 3L2NA 3B3TA 5K8NA 4MRIA 1BLLE 4PXEA 1LAMA 5HVFA 4Q7AA 4K3NA 2F7VA 2BO9A 3PBEA 2EK8A 3LWUA 2PVWA 3T8WA 4PPZA 2VL1A 2IJZA 4WJBA 1FT7A 2ZEPA 3H8GA 4TNUA 3NH5A 2PRQA 4MCRA 5LYDA 4MMOA 5K8MA 2CF4A 1QQ9A 5HVHA 1HDUA 2BOAA 3VH9A 1XFOA 1BAVA 3ISXA 1BPNA 1R3NA 1VIXA 4FUUA 4IK2A 4PXBA 1ZLIA 1XMBA 3SJFA 1TF9A 2PCUA 3VARA 1CBXA 2F8HA 1PYTB 3FMCA 3CPAA 4UEFA 3WC6A 1YW4A 3MN8A 5D8NA 3SI0A 1OBRA 3PFOA 2AFZA 3D7FA 2PJBA 3K2KA 1M4LA 1ARMA 2PJ8A 3B3VA 2AFSA 2ZOGA 5HXDA 4NGNA 4ZX9A 1BPMA 2GU2A 3SJXA 3D7HA 3WT4A 1GYTA 5JGFA 4P4EA 5I4MA 4KSIA 1Z5RA 2ZEHA 4P4DA 1NSAA 2QYVA 2ZOFA 5LRKA 4GM5A 2DEAA 2ZEEA 2AFXA 2PJAA 1ZG8A 5ELYA 3KI9A 5K8PA 1DE4C 1LFWA 2AFWA 3LMSA 3NH8A 2PJ6A 2XEGA 4ZY1A 1YMEA 2G9DA 3FF3A 4OC5A 5F09A 3S9NA 3SI1A 4P10A 3V38A 4PXCA 3KL9A 2V77A 3FVLA 3QNVA 1VHOA 1RTQA 1YSJA 3BXMA 4YU9A 2Q43A 2ZENA 3FJUA 2ZEGA 1TKJA 3D68A 4TWEA 1TXRA 2GLJA 2ANPA 3H8EA 2PJ4A 2PJ2A 3MRUA 5CBMA 4RUHA 4EWTA 2XEJA 3D7GA 4EMEA 4UEZA 4P45A 2AFUA 4ZX8A 3RAMA 2C6PA 2PJ7A 3V7ZA 1CP6A 3N5FA 4MXUA 2IQ6A 1AMPA 3I1UA 2JEWA 4IAVA 3D4UA 4YWYA 4OP4A 4R7MA 2ZEMA 2PIYA 2ZEDA 2ZEFA 4FWUA 3KHXA 4ONWA 5THWA 2C1CA 1ARLA 4UEEA 1VHEA 5JM6A 3SI2A 2V8HA 4P44A 5DS0A 1LOKA 3IFEA 5IB9A 3KQZA 2IMOA 4X3RA 2PJCA 2GREA 2WZNA 3NA6A 1Y0RA 3NH4A 2OR4A 4NGPA 1Z2LA 7CPAA 4MCSA 3IO1A 1TKHA 3D7DA 3FEEA 2WYRA 3B3CA 3HUVA 4OMEA 2PE3A 1Y0YA 5CPAA 4PXDA 5J1QA 4MHZA 4P6YA 1UWYA 2NYQA 3BHXA 4DYOA 3RBUA 2JBJA 4LQGA 4NJRA 3WC5A 8CPAA 2PJ0A 2CTBA 2JBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XRY A;  2AFO A;  2EWB A;  1ZLH A;  2XEF A;  1QMU A;  2ABZ A;  2V8D A;  3PB6 X;  1CPX A;  4PQA A;  4MCQ A;  2HB6 A;  1YW6 A;  1IGB A;  3HLP A;  3S9M A;  3IJ3 A;  1IY7 A;  3TC8 A;  4W9Y A;  4A37 A;  4X8I A;  5LYL A;  2PJ3 A;  2C6C A;  3D67 A;  3JRU A;  4F9U A;  1XJO A;  2NSM A;  3S9L A;  5LYF A;  4NFR A;  4G1P A;  5LYI A;  2HC9 A;  3FX6 A;  1HDQ A;  4O23 A;  2RB7 A;  4JZ0 A;  4A94 A;  1ELL P;  2AFM A;  4NJQ A;  3DLJ A;  3DGV A;  4OC4 A;  1LCP A;  3GLJ A;  4F8Z A;  2CTC A;  3GUX A;  3B35 A;  3PFE A;  3PB4 X;  1DTD A;  1AYE A;  4ZY2 A;  5LRG A;  5K8O A;  2PJ9 A;  3H8F A;  3BI0 A;  2PIZ A;  4MHP A;  4OKO A;  4R6T A;  3B3S A;  2ZEL A;  1TKF A;  1H8L A;  3KAS A;  1Q7L A;  4P4I A;  4ZYQ A;  4X2T A;  3KHZ A;  4EFD A;  3IIB A;  3CT9 A;  4F9V A;  2Q4Z A;  5LRJ A;  4UF4 A;  1HEE A;  4OIW A;  5JH9 A;  3D66 A;  4JYW A;  4MCP A;  3VAT A;  4AXV A;  3NFZ A;  3CPX A;  4MHN A;  1JQG A;  3GB0 A;  5D29 A;  2O4H A;  2PJ5 A;  2PJ1 A;  4CPA A;  4NGS A;  6CPA A;  3SJE A;  3FEC A;  4UIB A;  1ZG7 A;  1PCA A;  1CPS A;  2V8V A;  1ELM P;  2QVP A;  3IEH A;  3PB8 X;  1VGY A;  3IWW A;  4NGT A;  2OOT A;  3WAB A;  4ZI6 A;  4P4F A;  3RZA A;  4R76 A;  4FAI A;  3ISZ A;  1EE3 P;  1Y7E A;  3TX8 A;  3B3W A;  1F2O A;  3B7I A;  2O53 A;  3IC1 A;  5HVG A;  4OC3 A;  1CX8 A;  1KWM A;  3PB9 X;  1LAN A;  2ZEO A;  3KGQ A;  2QJ8 A;  4OID A;  1YLO A;  1CP7 A;  4DJL A;  1TF8 A;  4Z65 A;  4FBE A;  3B2Y A;  4NGM A;  4NGR A;  4DUK A;  4BD9 A;  4IHM A;  3K9T A;  2PVV A;  4ZY0 A;  2RFH A;  4P4B A;  2EK9 A;  4R8F A;  4H2K A;  4B6Z A;  4OC1 A;  4A38 A;  3BI1 A;  2FVG A;  3WC7 A;  3PEI A;  4WWV A;  1XBU A;  1CG2 A;  4OC2 A;  4A39 A;  1FNO A;  2I3C A;  2GLF A;  4MHY A;  2POK A;  3KZW A;  4UIA A;  2C6G A;  1Z8L A;  2CIJ A;  4P4J A;  1R43 A;  3CDX A;  1ZG9 A;  2BCO A;  3FED A;  2J9A A;  4NGQ A;  4OC0 A;  1F57 A;  3FH4 A;  3KR4 A;  2Q51 A;  2V8G A;  3PB7 X;  3KQX A;  3KR5 A;  1F2P A;  3PRT A;  2XEI A;  3SJG A;  1LAP A;  3PBB A;  3L2N A;  3B3T A;  5K8N A;  4MRI A;  1BLL E;  4PXE A;  1LAM A;  5HVF A;  4Q7A A;  4K3N A;  2F7V A;  2BO9 A;  3PBE A;  2EK8 A;  3LWU A;  2PVW A;  3T8W A;  4PPZ A;  2VL1 A;  2IJZ A;  4WJB A;  1FT7 A;  2ZEP A;  3H8G A;  4TNU A;  3NH5 A;  2PRQ A;  4MCR A;  5LYD A;  4MMO A;  5K8M A;  2CF4 A;  1QQ9 A;  5HVH A;  1HDU A;  2BOA A;  3VH9 A;  1XFO A;  1BAV A;  3ISX A;  1BPN A;  1R3N A;  1VIX A;  4FUU A;  4IK2 A;  4PXB A;  1ZLI A;  1XMB A;  3SJF A;  1TF9 A;  2PCU A;  3VAR A;  1CBX A;  2F8H A;  1PYT B;  3FMC A;  3CPA A;  4UEF A;  3WC6 A;  1YW4 A;  3MN8 A;  5D8N A;  3SI0 A;  1OBR A;  3PFO A;  2AFZ A;  3D7F A;  2PJB A;  3K2K A;  1M4L A;  1ARM A;  2PJ8 A;  3B3V A;  2AFS A;  2ZOG A;  5HXD A;  4NGN A;  4ZX9 A;  1BPM A;  2GU2 A;  3SJX A;  3D7H A;  3WT4 A;  1GYT A;  5JGF A;  4P4E A;  5I4M A;  4KSI A;  1Z5R A;  2ZEH A;  4P4D A;  1NSA A;  2QYV A;  2ZOF A;  5LRK A;  4GM5 A;  2DEA A;  2ZEE A;  2AFX A;  2PJA A;  1ZG8 A;  5ELY A;  3KI9 A;  5K8P A;  1DE4 C;  1LFW A;  2AFW A;  3LMS A;  3NH8 A;  2PJ6 A;  2XEG A;  4ZY1 A;  1YME A;  2G9D A;  3FF3 A;  4OC5 A;  5F09 A;  3S9N A;  3SI1 A;  4P10 A;  3V38 A;  4PXC A;  3KL9 A;  2V77 A;  3FVL A;  3QNV A;  1VHO A;  1RTQ A;  1YSJ A;  3BXM A;  4YU9 A;  2Q43 A;  2ZEN A;  3FJU A;  2ZEG A;  1TKJ A;  3D68 A;  4TWE A;  1TXR A;  2GLJ A;  2ANP A;  3H8E A;  2PJ4 A;  2PJ2 A;  3MRU A;  5CBM A;  4RUH A;  4EWT A;  2XEJ A;  3D7G A;  4EME A;  4UEZ A;  4P45 A;  2AFU A;  4ZX8 A;  3RAM A;  2C6P A;  2PJ7 A;  3V7Z A;  1CP6 A;  3N5F A;  4MXU A;  2IQ6 A;  1AMP A;  3I1U A;  2JEW A;  4IAV A;  3D4U A;  4YWY A;  4OP4 A;  4R7M A;  2ZEM A;  2PIY A;  2ZED A;  2ZEF A;  4FWU A;  3KHX A;  4ONW A;  5THW A;  2C1C A;  1ARL A;  4UEE A;  1VHE A;  5JM6 A;  3SI2 A;  2V8H A;  4P44 A;  5DS0 A;  1LOK A;  3IFE A;  5IB9 A;  3KQZ A;  2IMO A;  4X3R A;  2PJC A;  2GRE A;  2WZN A;  3NA6 A;  1Y0R A;  3NH4 A;  2OR4 A;  4NGP A;  1Z2L A;  7CPA A;  4MCS A;  3IO1 A;  1TKH A;  3D7D A;  3FEE A;  2WYR A;  3B3C A;  3HUV A;  4OME A;  2PE3 A;  1Y0Y A;  5CPA A;  4PXD A;  5J1Q A;  4MHZ A;  4P6Y A;  1UWY A;  2NYQ A;  3BHX A;  4DYO A;  3RBU A;  2JBJ A;  4LQG A;  4NJR A;  3WC5 A;  8CPA A;  2PJ0 A;  2CTB A;  2JBK A; 
#chains in the Genus database with same CATH topology
 1XRY A;  1XMT A;  4RN7 A;  4MJ8 A;  2AFO A;  2EWB A;  1ZLH A;  4UWI A;  2XEF A;  2ZPA A;  2Q7B A;  1QMU A;  2ABZ A;  2BEI A;  4M85 A;  3UY5 A;  5F46 A;  2FIA A;  2P6G A;  2EUI A;  2V8D A;  3A9L A;  3PB6 X;  4JLY A;  4KOV A;  3R9E A;  1CPX A;  1S7F A;  1ZO0 A;  4F6A A;  1M4I A;  2R7H A;  4PQA A;  5AG7 A;  2Q4V A;  4LQ6 A;  2HB6 A;  4MCQ A;  1U6M A;  2J8N A;  3F0A A;  1YW6 A;  2ZW6 A;  4C2X A;  4B10 A;  4AG9 A;  5KTA A;  3D2P A;  1IGB A;  4UBR A;  3HLP A;  3S9M A;  3W91 A;  3IJ3 A;  1IY7 A;  2G3T A;  3TC8 A;  3PGP A;  4W9Y A;  4KSF A;  4J3G A;  4OAD A;  3FB3 A;  4A37 A;  4UFV A;  4X8I A;  3W6S A;  5LYL A;  2ODF A;  2PJ3 A;  2R98 A;  4CGP A;  2C6C A;  3D67 A;  3JRU A;  2VI7 A;  3LD2 A;  2D4O A;  4F9U A;  1XJO A;  2NSM A;  5FVJ A;  3S9L A;  5LYF A;  4NFR A;  2Z3N A;  4G1P A;  4NF1 A;  5LYI A;  3E0K A;  2HC9 A;  3B8G A;  1HDQ A;  3FX6 A;  4KSA A;  1QSN A;  4O23 A;  4CYN A;  2X7B A;  2PSW A;  4CYO A;  4BMH A;  2A4N A;  3RNZ A;  2RB7 A;  3FRM A;  4JZ0 A;  4NXY A;  2CY2 A;  4PK2 A;  1ELL P;  4A94 A;  4QC6 A;  2AFM A;  3K9U A;  4NJQ A;  2DPS A;  3DLJ A;  3DGV A;  3QAH A;  4OC4 A;  1LCP A;  3GLJ A;  3IU1 A;  2YGW A;  1RXT A;  1WWZ A;  1Z8W A;  3PP9 A;  4LX9 A;  2CTC A;  4AB7 A;  3GUX A;  4F8Z A;  2AE6 A;  2B5G A;  1Z9U A;  3B35 A;  3PFE A;  3PB4 X;  1DTD A;  1AYE A;  4KVM E;  4ZY2 A;  1Y7R A;  5LRG A;  5K8O A;  2PJ9 A;  4KLW A;  3H8F A;  1TIQ A;  5EMI A;  1KUV A;  3EY5 A;  1IU8 A;  5AGE A;  3N7Z A;  2HV2 A;  2WSA A;  3EO4 A;  3BI0 A;  3JTK A;  2PIZ A;  4MHP A;  2Q4Y A;  4OKO A;  3TE4 A;  1X10 A;  4R57 A;  4H6Z A;  4R6T A;  4KZT A;  5KTD A;  3B3S A;  2ZEL A;  3S6H A;  4HNY B;  1S7K A;  3TTH A;  1TKF A;  1H8L A;  3KAS A;  5GCN A;  3H4Q A;  1YK3 A;  3DSB A;  1Q7L A;  2IL4 A;  4P4I A;  2PDO A;  2PR1 A;  4ZYQ A;  1I12 A;  3FIX A;  4X2T A;  2F5I A;  2REF A;  2GAN A;  3KHZ A;  2ARH A;  4U5Y A;  4EFD A;  1BO4 A;  3IIB A;  5F47 A;  1QSR A;  4MY3 A;  3CT9 A;  4F9V A;  3F8K A;  2Q4Z A;  5LRJ A;  3I9S A;  2Y0M A;  4UF4 A;  4RS2 A;  4L8A A;  1HEE A;  2FT0 A;  4OIW A;  5JH9 A;  3D66 A;  4R9M A;  4JYW A;  1N71 A;  4MCP A;  3VAT A;  3VWE A;  1Z8X A;  4AXV A;  3SHP A;  1S5K A;  2DPT A;  3NFZ A;  3CPX A;  4E2A A;  4MHN A;  4KLV A;  1JQG A;  2BUE A;  3GB0 A;  2O4H A;  2PJ5 A;  5D29 A;  2PJ1 A;  4UFW A;  4CPA A;  3ZZI A;  4NGS A;  6CPA A;  4JD6 A;  3SJE A;  1NMT A;  3FEC A;  2VEZ A;  4UIB A;  4KS9 A;  5F49 A;  1ZG7 A;  1PCA A;  1CPS A;  4IF5 A;  2V8V A;  4GXH A;  2OZH A;  1XIX A;  2QEC A;  5CNP A;  3MGD A;  1ELM P;  2QVP A;  3IEH A;  1CJW A;  3PB8 X;  3S6F A;  1VGY A;  5JPH A;  4H89 A;  2GFQ A;  3IWW A;  4NGT A;  2OOT A;  5BWA B;  2PQ8 A;  3WAB A;  4ZI6 A;  3TOB A;  4A30 A;  2B58 A;  4P4F A;  3TO9 A;  4BIN A;  2FCK A;  2VZZ A;  1Z8T A;  1V0C A;  3RZA A;  4R76 A;  4FAI A;  3DR8 A;  3FYN A;  3ISZ A;  1EE3 P;  1Y7E A;  2FIW A;  3TX8 A;  2PRB A;  1J4J A;  3B3W A;  2FL4 A;  1F2O A;  4M6G A;  2B5G B;  4AVA A;  2Q0Y A;  3B7I A;  5H84 A;  2O53 A;  3IC1 A;  1IYL A;  5HVG A;  2YNC C;  2I00 A;  4OC3 A;  1CX8 A;  1KWM A;  3PB9 X;  4A33 A;  4EVY A;  1LAN A;  3RYO A;  2ZEO A;  3KGQ A;  5EC4 A;  2OH1 A;  4R3K A;  3EFA A;  2QJ8 A;  2G3A A;  4OID A;  1YLO A;  1CP7 A;  1YVO A;  2REE A;  1TF8 A;  4DJL A;  4Z65 A;  4KOW A;  5I0C A;  3LAC A;  4FBE A;  1BOB A;  2FS5 A;  4KOT A;  3B2Y A;  4NGM A;  4NGR A;  4DUK A;  4BD9 A;  4IHM A;  3K9T A;  2PVV A;  4II9 A;  3TT2 A;  3QAY A;  4JXR A;  4ZY0 A;  2RFH A;  4P4B A;  5C88 A;  2EK9 A;  4XPK A;  3R95 A;  2Z3L A;  4R8F A;  1K4J A;  3RO0 A;  4ZGY B;  4H2K A;  4B6Z A;  4OC1 A;  4A38 A;  3BI1 A;  2OB0 A;  2FVG A;  1YRE A;  1FY7 A;  1S7L A;  2VQY A;  3T90 A;  3R9G A;  3WC7 A;  4MFL A;  4PSW A;  3PEI A;  4WWV A;  1OZP A;  3DR6 A;  4QB9 A;  4Q36 A;  3IWE A;  1XBU A;  1CG2 A;  2NMT A;  2QML A;  3R9F A;  4OC2 A;  3QB8 A;  4A39 A;  1FNO A;  2WPW A;  2YNE A;  2FE7 A;  4U9Y A;  4MFQ A;  2I3C A;  1QST A;  2GLF A;  3D2M A;  3NE8 A;  2POK A;  4KOS A;  2Z3M A;  4MHY A;  3KZW A;  4UIA A;  2YNC A;  2FSR A;  2C6G A;  2J8M A;  4KUA A;  4B11 A;  1Q2D A;  1Z8L A;  2BSW A;  4CGN A;  4AVC A;  2P0W A;  2CIJ A;  4P4J A;  1R43 A;  3CDX A;  4A95 A;  1ZG9 A;  4F0Y A;  2BCO A;  2CXA A;  3FED A;  3VWD A;  2J9A A;  4NGQ A;  1A2Z A;  3C26 A;  4OC0 A;  1F57 A;  3FH4 A;  3KR4 A;  4UWJ A;  2B4B A;  1MJ9 A;  1S7N A;  1L0C A;  2Q51 A;  2V8G A;  5JQ4 A;  3PB7 X;  1S60 A;  3KQX A;  3KR5 A;  1IOF A;  1F2P A;  3PRT A;  4M6I A;  2XEI A;  3I3G A;  5AG6 A;  1LAP A;  4XPD B;  3SJG A;  4AG7 A;  3PBB A;  4CYP A;  2JDD A;  3L2N A;  3B3T A;  2HUZ A;  4CRZ B;  5K8N A;  2GE3 A;  4L89 A;  4MRI A;  1BLL E;  4A31 A;  2I79 A;  4PXE A;  1LAM A;  4MHD A;  5HVF A;  4Q7A A;  3JUW A;  2GIV A;  4K3N A;  4H6U A;  4MFK A;  2DXQ A;  2F7V A;  2BO9 A;  3PBE A;  2EK8 A;  3LWU A;  2KCW A;  2PVW A;  4MBU A;  4A2Z A;  4C7I A;  4JXQ A;  1M44 A;  3T8W A;  2Z0Z A;  4UA3 A;  2Z11 A;  4DNC A;  4PPZ A;  1QSM A;  2VL1 A;  2IJZ A;  2ZW7 A;  2DF5 A;  4E8O A;  5AG4 A;  4WJB A;  3TFY A;  1FT7 A;  3LOD A;  4C2Y A;  2ZEP A;  1MJB A;  1SQH A;  3H8G A;  4TNU A;  3NH5 A;  3SXO A;  2H5M A;  2PRQ A;  4YFJ A;  4JWP A;  4MCR A;  5LYD A;  5J8F A;  4MMO A;  5K8M A;  3D3S A;  3GY9 A;  2CF4 A;  2Z3P A;  3KKW A;  2HQY A;  4Y49 B;  1QQ9 A;  5HVH A;  1NSL A;  1HDU A;  2Q04 A;  2BOA A;  3VH9 A;  2YND A;  1XFO A;  4HNX B;  1I1D A;  1X12 A;  1BAV A;  3ISX A;  1BPN A;  3DNS A;  4B5P A;  1R3N A;  1VIX A;  1VHS A;  2VBQ A;  4FD6 A;  4FUU A;  4IK2 A;  4PXB A;  4QVT A;  4PV6 A;  1ZLI A;  1XMB A;  3SJF A;  1TF9 A;  2PCU A;  4KOX A;  3VAR A;  1CBX A;  1Z4E A;  2F8H A;  4YRH A;  1PYT B;  3FMC A;  3CPA A;  4MFZ A;  4UCM A;  4KOR A;  4UEF A;  3WC6 A;  1QSO A;  1YW4 A;  3MN8 A;  1Y9K A;  5D8N A;  3SI0 A;  1OBR A;  3PFO A;  2AFZ A;  2ZW5 A;  1M1D A;  4CS0 B;  3R96 A;  1IYK A;  3D7F A;  2PJB A;  4XNH B;  1YR0 A;  5H86 A;  3K2K A;  1M4L A;  1ARM A;  2PJ8 A;  1M4G A;  2AFS A;  2B3U A;  3B3V A;  2ATR A;  2ZOG A;  4CYQ A;  5HXD A;  4NGN A;  5E96 A;  3F5B A;  4ZX9 A;  2R8V A;  1BPM A;  2GU2 A;  4JJX A;  2JLM A;  2Z3O A;  3SJX A;  3D7H A;  4E0A A;  3WT4 A;  1GYT A;  3CXS A;  2B4D B;  3TCV A;  5ISV A;  3BLN A;  4RI1 A;  3D8P A;  4K30 A;  3ZJ0 A;  5JGF A;  4P4E A;  5I4M A;  3IWG A;  3TO6 A;  2B3V A;  2ZW4 A;  4XNH C;  4KSI A;  5A27 A;  1Z5R A;  2ZEH A;  4P4D A;  5G22 A;  1NSA A;  1IID A;  4B14 A;  2Z10 A;  1KZF A;  2QYV A;  3W6X A;  1Q2Y A;  3S6G A;  2ZOF A;  1GHE A;  5LRK A;  4Q38 A;  2OU2 A;  4GM5 A;  3CXQ A;  2DEA A;  2ZEE A;  4B5O A;  1PUA A;  1MK4 A;  4CGO A;  2AFX A;  1MJA A;  2PJA A;  1ZG8 A;  5ELY A;  1YX0 A;  4MY0 A;  1Z4R A;  3KI9 A;  5K8P A;  1DE4 C;  1LFW A;  1B6B A;  1I21 A;  2AFW A;  3LMS A;  2G0B A;  4ZBG A;  3NH8 A;  5EBV A;  2R1I A;  2PJ6 A;  2XEG A;  1XF8 A;  1YVK A;  4ZY1 A;  1YME A;  3WR7 A;  2G9D A;  3FF3 A;  4OC5 A;  5F09 A;  3S9N A;  3SI1 A;  4KVX A;  3G3S A;  3SXN A;  4P10 A;  3EXN A;  1R57 A;  5G1Z A;  2RC4 A;  3V38 A;  4PXC A;  3KL9 A;  4OAE A;  1XE4 A;  2V77 A;  5KTC A;  3FVL A;  3QNV A;  3V8I A;  1VHO A;  1RTQ A;  1YSJ A;  4B5P B;  3BXM A;  4NCZ A;  4YU9 A;  4A32 A;  1P0H A;  4R87 A;  2Q43 A;  3T9Y A;  1YQE A;  5F48 A;  4U9Z A;  2ZEN A;  3JVN A;  3CXP A;  3FJU A;  2ZEG A;  4C7H A;  1P4N A;  3IU2 A;  4HNW B;  3H5Z A;  2OZU A;  1TKJ A;  3D68 A;  2ZXV A;  4TWE A;  4QUS A;  1TXR A;  2GLJ A;  5IX3 A;  2ANP A;  4CAV A;  3H8E A;  2PJ4 A;  5HH1 A;  1XOV A;  3GIU A;  2PJ2 A;  1ON0 A;  2B4D A;  4HPS A;  4MFJ A;  3MRU A;  5CBM A;  4FD5 A;  1AUG A;  4RUH A;  1KUX A;  3FNC A;  1UFH A;  4M3S A;  1NE9 A;  1VKC A;  4HKF A;  2CNT A;  2XEJ A;  3D7G A;  4KOU A;  4ONU A;  4EME A;  4EWT A;  3TO7 A;  2EBJ A;  4KVO E;  3BJ8 A;  4F0X A;  3BJ7 A;  4UEZ A;  2WUU A;  2EVN A;  4IUS A;  4P45 A;  2AFU A;  4MFP A;  4ZX8 A;  1S3Z A;  3RAM A;  1WK4 A;  2C6P A;  2PJ7 A;  3V7Z A;  4UCP A;  1CP6 A;  3N5F A;  4MXU A;  2IQ6 A;  1AMP A;  3I1U A;  1IIC A;  2Q44 A;  5A28 A;  3GKR A;  2JEW A;  4IAV A;  4XPD C;  2JEV A;  1LRZ A;  3D4U A;  3IGR A;  3GYA A;  4NEX A;  2Z3K A;  3G8W A;  4YWY A;  4OP4 A;  4R7M A;  2K5T A;  2ZEM A;  4R3L A;  4QBJ A;  5J8C A;  5G20 A;  2PIY A;  4FD4 A;  2ZED A;  2PC1 A;  2ZEF A;  1Q2C A;  4YGO A;  3FBU A;  4OLL A;  4UFX A;  4CAF A;  4FWU A;  1KUY A;  3P2F A;  1IB1 E;  2JDC A;  3KHX A;  2EO8 A;  4B13 A;  4ONW A;  5THW A;  2C1C A;  2D4P A;  2QIR A;  1ARL A;  2Q7S A;  4UEE A;  5IB0 A;  1VHE A;  5JM6 A;  2O28 A;  3SI2 A;  2V8H A;  4B12 A;  4P44 A;  4BBH A;  4NSQ A;  4C2Z A;  3EC4 A;  5DS0 A;  4X5K A;  1LOK A;  3IFE A;  1RO5 A;  5HMN A;  5IB9 A;  1IOI A;  5G21 A;  3KQZ A;  5DWM A;  3OWC A;  1YGH A;  2IMO A;  4X3R A;  2VXK A;  2PJC A;  2FXF A;  2GRE A;  4I49 A;  2WZN A;  3NA6 A;  4PSX A;  1Y0R A;  4KOY A;  4C68 A;  2WPX A;  5IV0 A;  4Y49 C;  3NH4 A;  2OR4 A;  2CNS A;  4NGP A;  1Z2L A;  7CPA A;  4MCS A;  3IO1 A;  1JWQ A;  3PZJ A;  1TKH A;  3D7D A;  3FEE A;  2WYR A;  2C27 A;  2J8R A;  2PR8 A;  3B3C A;  3DDD A;  2CNM A;  4CAE A;  3HUV A;  4OME A;  1PU9 A;  5AG5 A;  1B87 A;  2AJ6 A;  2PE3 A;  1Y0Y A;  4CAW A;  5CPA A;  3FXT A;  3R1K A;  4PK3 A;  1YLE A;  4PXD A;  4CGL A;  3NE7 A;  4XPL A;  4AVB A;  4FD7 A;  2P6F A;  4KUB A;  4GS4 A;  3TOA A;  4CAX A;  5J1Q A;  2P6E A;  4MHZ A;  4P6Y A;  1UWY A;  2NYQ A;  1XEB A;  3BHX A;  1CM0 A;  4MI4 A;  4DYO A;  2VZY A;  4UCN A;  3RBU A;  4LUA A;  2JBJ A;  4LQG A;  4NJR A;  3P2H A;  3WC5 A;  8CPA A;  3S6K A;  4M6H A;  4CRY B;  2PJ0 A;  5C82 A;  3CZX A;  2OZG A;  1Y9W A;  4ORF A;  5DWN A;  4CGM A;  2CTB A;  1M4D A;  2BL1 A;  2JBK A; 
#chains in the Genus database with same CATH homology
 1XRY A;  2AFO A;  2EWB A;  1ZLH A;  2XEF A;  1QMU A;  2ABZ A;  2V8D A;  3PB6 X;  1CPX A;  4PQA A;  4MCQ A;  2HB6 A;  1YW6 A;  1IGB A;  3HLP A;  3S9M A;  3IJ3 A;  1IY7 A;  3TC8 A;  4W9Y A;  4A37 A;  4X8I A;  5LYL A;  2PJ3 A;  2C6C A;  3D67 A;  3JRU A;  4F9U A;  1XJO A;  2NSM A;  3S9L A;  5LYF A;  4NFR A;  4G1P A;  5LYI A;  2HC9 A;  3FX6 A;  1HDQ A;  4O23 A;  2RB7 A;  4JZ0 A;  4A94 A;  1ELL P;  2AFM A;  4NJQ A;  3DLJ A;  3DGV A;  4OC4 A;  1LCP A;  3GLJ A;  4F8Z A;  2CTC A;  3GUX A;  3B35 A;  3PFE A;  3PB4 X;  1DTD A;  1AYE A;  4ZY2 A;  5LRG A;  5K8O A;  2PJ9 A;  3H8F A;  3BI0 A;  2PIZ A;  4MHP A;  4OKO A;  4R6T A;  3B3S A;  2ZEL A;  1TKF A;  1H8L A;  3KAS A;  1Q7L A;  4P4I A;  4ZYQ A;  4X2T A;  3KHZ A;  4EFD A;  3IIB A;  3CT9 A;  4F9V A;  2Q4Z A;  5LRJ A;  4UF4 A;  1HEE A;  4OIW A;  5JH9 A;  3D66 A;  4JYW A;  4MCP A;  3VAT A;  4AXV A;  3NFZ A;  3CPX A;  4MHN A;  1JQG A;  3GB0 A;  5D29 A;  2O4H A;  2PJ5 A;  2PJ1 A;  4CPA A;  4NGS A;  6CPA A;  3SJE A;  3FEC A;  4UIB A;  1ZG7 A;  1PCA A;  1CPS A;  2V8V A;  1ELM P;  2QVP A;  3IEH A;  3PB8 X;  1VGY A;  3IWW A;  4NGT A;  2OOT A;  3WAB A;  4ZI6 A;  4P4F A;  3RZA A;  4R76 A;  4FAI A;  3ISZ A;  1EE3 P;  1Y7E A;  3TX8 A;  3B3W A;  1F2O A;  3B7I A;  2O53 A;  3IC1 A;  5HVG A;  4OC3 A;  1CX8 A;  1KWM A;  3PB9 X;  1LAN A;  2ZEO A;  3KGQ A;  2QJ8 A;  4OID A;  1YLO A;  1CP7 A;  4DJL A;  1TF8 A;  4Z65 A;  4FBE A;  3B2Y A;  4NGM A;  4NGR A;  4DUK A;  4BD9 A;  4IHM A;  3K9T A;  2PVV A;  4ZY0 A;  2RFH A;  4P4B A;  2EK9 A;  4R8F A;  4H2K A;  4B6Z A;  4OC1 A;  4A38 A;  3BI1 A;  2FVG A;  3WC7 A;  3PEI A;  4WWV A;  1XBU A;  1CG2 A;  4OC2 A;  4A39 A;  1FNO A;  2I3C A;  2GLF A;  4MHY A;  2POK A;  3KZW A;  4UIA A;  2C6G A;  1Z8L A;  2CIJ A;  4P4J A;  1R43 A;  3CDX A;  1ZG9 A;  2BCO A;  3FED A;  2J9A A;  4NGQ A;  4OC0 A;  1F57 A;  3FH4 A;  3KR4 A;  2Q51 A;  2V8G A;  3PB7 X;  3KQX A;  3KR5 A;  1F2P A;  3PRT A;  2XEI A;  3SJG A;  1LAP A;  3PBB A;  3L2N A;  3B3T A;  5K8N A;  4MRI A;  1BLL E;  4PXE A;  1LAM A;  5HVF A;  4Q7A A;  4K3N A;  2F7V A;  2BO9 A;  3PBE A;  2EK8 A;  3LWU A;  2PVW A;  3T8W A;  4PPZ A;  2VL1 A;  2IJZ A;  4WJB A;  1FT7 A;  2ZEP A;  3H8G A;  4TNU A;  3NH5 A;  2PRQ A;  4MCR A;  5LYD A;  4MMO A;  5K8M A;  2CF4 A;  1QQ9 A;  5HVH A;  1HDU A;  2BOA A;  3VH9 A;  1XFO A;  1BAV A;  3ISX A;  1BPN A;  1R3N A;  1VIX A;  4FUU A;  4IK2 A;  4PXB A;  1ZLI A;  1XMB A;  3SJF A;  1TF9 A;  2PCU A;  3VAR A;  1CBX A;  2F8H A;  1PYT B;  3FMC A;  3CPA A;  4UEF A;  3WC6 A;  1YW4 A;  3MN8 A;  5D8N A;  3SI0 A;  1OBR A;  3PFO A;  2AFZ A;  3D7F A;  2PJB A;  3K2K A;  1M4L A;  1ARM A;  2PJ8 A;  3B3V A;  2AFS A;  2ZOG A;  5HXD A;  4NGN A;  4ZX9 A;  1BPM A;  2GU2 A;  3SJX A;  3D7H A;  3WT4 A;  1GYT A;  5JGF A;  4P4E A;  5I4M A;  4KSI A;  1Z5R A;  2ZEH A;  4P4D A;  1NSA A;  2QYV A;  2ZOF A;  5LRK A;  4GM5 A;  2DEA A;  2ZEE A;  2AFX A;  2PJA A;  1ZG8 A;  5ELY A;  3KI9 A;  5K8P A;  1DE4 C;  1LFW A;  2AFW A;  3LMS A;  3NH8 A;  2PJ6 A;  2XEG A;  4ZY1 A;  1YME A;  2G9D A;  3FF3 A;  4OC5 A;  5F09 A;  3S9N A;  3SI1 A;  4P10 A;  3V38 A;  4PXC A;  3KL9 A;  2V77 A;  3FVL A;  3QNV A;  1VHO A;  1RTQ A;  1YSJ A;  3BXM A;  4YU9 A;  2Q43 A;  2ZEN A;  3FJU A;  2ZEG A;  1TKJ A;  3D68 A;  4TWE A;  1TXR A;  2GLJ A;  2ANP A;  3H8E A;  2PJ4 A;  2PJ2 A;  3MRU A;  5CBM A;  4RUH A;  4EWT A;  2XEJ A;  3D7G A;  4EME A;  4UEZ A;  4P45 A;  2AFU A;  4ZX8 A;  3RAM A;  2C6P A;  2PJ7 A;  3V7Z A;  1CP6 A;  3N5F A;  4MXU A;  2IQ6 A;  1AMP A;  3I1U A;  2JEW A;  4IAV A;  3D4U A;  4YWY A;  4OP4 A;  4R7M A;  2ZEM A;  2PIY A;  2ZED A;  2ZEF A;  4FWU A;  3KHX A;  4ONW A;  5THW A;  2C1C A;  1ARL A;  4UEE A;  1VHE A;  5JM6 A;  3SI2 A;  2V8H A;  4P44 A;  5DS0 A;  1LOK A;  3IFE A;  5IB9 A;  3KQZ A;  2IMO A;  4X3R A;  2PJC A;  2GRE A;  2WZN A;  3NA6 A;  1Y0R A;  3NH4 A;  2OR4 A;  4NGP A;  1Z2L A;  7CPA A;  4MCS A;  3IO1 A;  1TKH A;  3D7D A;  3FEE A;  2WYR A;  3B3C A;  3HUV A;  4OME A;  2PE3 A;  1Y0Y A;  5CPA A;  4PXD A;  5J1Q A;  4MHZ A;  4P6Y A;  1UWY A;  2NYQ A;  3BHX A;  4DYO A;  3RBU A;  2JBJ A;  4LQG A;  4NJR A;  3WC5 A;  8CPA A;  2PJ0 A;  2CTB A;  2JBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...