1Q7LA

Zn-binding domain of the t347g mutant of human aminoacylase-i
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
192
structure length
192
Chain Sequence
EEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoacylase-1
publication title Essential roles of zinc ligation and enzyme dimerization for catalysis in the aminoacylase-1/M20 family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 58
structure length 192
sequence length 192
chains with identical sequence C
ec nomenclature ec 3.5.1.14: N-acyl-aliphatic-L-amino acid amidohydrolase.
pdb deposition date 2003-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1q7lA00
3H8GA 4NGNA 1R43A 4EFDA 2WZNA 3D7FA 1LAMA 5D8NA 3PB8X 3DLJA 3IEHA 2BCOA 4NGTA 4P4IA 4A37A 2ZENA 2AFMA 4P4EA 1TF9A 2V8DA 3SJGA 3B3VA 2ANPA 2EK8A 4G1PA 4MHPA 4ZX8A 2O4HA 1CBXA 2PRQA 4DJLA 4UF4A 4P44A 1XBUA 4PXBA 3NA6A 4P45A 1M4LA 4X2TA 4OC3A 3WT4A 4JZ0A 7CPAA 4MRIA 2V8GA 2GLFA 4UEZA 3VARA 6CPAA 1UWYA 4F8ZA 2C6CA 2RB7A 2HB6A 1CP6A 1AMPA 2GU2A 3B3SA 5ELYA 1NSAA 4X3RA 3T8WA 2NSMA 3BHXA 1IY7A 1LCPA 1HDQA 3IJ3A 1YMEA 4OC4A 4ZX9A 4EMEA 2PJ2A 4K3NA 2AFWA 3DGVA 3ISZA 1YSJA 2NYQA 3KL9A 2POKA 1LOKA 2C1CA 2HC9A 1Y0RA 3TX8A 3FEEA 1TKFA 2PJ7A 2PJCA 5CBMA 3S9LA 4O23A 3WC6A 4F9UA 3RZAA 3NH5A 2IQ6A 2XEIA 4NGRA 4FBEA 4LQGA 4OP4A 5K8NA 5LYFA 2G9DA 3B3WA 2CF4A 1KWMA 5LYIA 3K2KA 1CG2A 3TC8A 1YW4A 4FWUA 2ZEMA 1ZG9A 2PJ0A 3PB6X 3SI2A 4DUKA 5D29A 4YWYA 5JGFA 3D7DA 1IGBA 3KASA 3BXMA 1QQ9A 3KI9A 4MMOA 4R8FA 4F9VA 3PEIA 3FVLA 3B35A 3FX6A 3FF3A 1XRYA 4MHYA 2PJ6A 1CP7A 5LRKA 3S9MA 4OC1A 4NJQA 3D7GA 3PRTA 3LMSA 1VGYA 2ZEPA 4ZI6A 5LRJA 4NJRA 2VL1A 4ZY1A 1Z5RA 3B7IA 2F7VA 4NGQA 4UEFA 5J1QA 1BPMA 1YW6A 1Q7LA 4TWEA 2AFSA 3N5FA 4PQAA 2ZEOA 2FVGA 1PCAA 5LYLA 2DEAA 3WC7A 3MRUA 5LYDA 5K8OA 4OC2A 3L2NA 4NGPA 2XEFA 2BOAA 1EE3P 1ELLP 2PJAA 3D66A 3SI0A 3ISXA 3B2YA 1Z8LA 2ZEDA 1XMBA 1Y7EA 1GYTA 3I1UA 4MXUA 2ABZA 1VHOA 3H8EA 3IO1A 2QVPA 3SJEA 2GREA 3SJXA 5HVHA 5HXDA 2ZEFA 4MHNA 1F57A 4P4DA 4Q7AA 4X8IA 3KR4A 3FH4A 1BAVA 4UIAA 1QMUA 2EWBA 3WABA 3FJUA 1F2OA 1DE4C 3D67A 4WJBA 4A39A 3D68A 2ZOFA 1ZG8A 5LRGA 1ZG7A 5DS0A 2F8HA 3CDXA 3MN8A 5F09A 4PXDA 3CPAA 5IB9A 2IMOA 4OIWA 4IK2A 4P4BA 2V8VA 2QYVA 3GB0A 4OKOA 2AFXA 4P6YA 4BD9A 4H2KA 5I4MA 1XJOA 1LANA 2V77A 3NH4A 1TKJA 5HVGA 1H8LA 3IIBA 3IFEA 3KQZA 1LAPA 4WWVA 2V8HA 1HDUA 2ZOGA 4MCPA 3H8FA 2J9AA 3PFEA 2WYRA 1HEEA 2ZEGA 3CPXA 2PE3A 4NGSA 4R7MA 3PB9X 4GM5A 1Y0YA 3PBEA 4YU9A 3KHZA 2PJBA 4W9YA 2IJZA 5JM6A 3PB4X 4UIBA 3RBUA 1RTQA 3HUVA 4OC0A 1ARLA 2C6PA 3KR5A 4KSIA 2PJ5A 3D7HA 3CT9A 2JBJA 2AFUA 3KZWA 2XEGA 3S9NA 2PJ8A 2GLJA 1ZLHA 2O53A 4MCSA 3VH9A 3FECA 5THWA 2ZEEA 2PIZA 1XFOA 2Q4ZA 4CPAA 4OIDA 3KHXA 2XEJA 5HVFA 2ZELA 2OOTA 4ZY0A 2RFHA 2JEWA 4PXEA 1BPNA 1TXRA 3GUXA 5CPAA 3V7ZA 2AFOA 2CTCA 3LWUA 4MHZA 3QNVA 1CPSA 3SI1A 3NFZA 5JH9A 4AXVA 1DTDA 4JYWA 1CPXA 2PJ3A 4NGMA 3RAMA 2BO9A 4DYOA 3PFOA 4OMEA 2OR4A 1ARMA 4IAVA 1TF8A 4P4FA 2Q51A 2PIYA 4R76A 4RUHA 3FEDA 1F2PA 3WC5A 3IC1A 1VHEA 4ZY2A 4A94A 4PPZA 4OC5A 4Z65A 3VATA 2C6GA 4P4JA 4PXCA 1JQGA 1YLOA 4R6TA 1PYTB 1ZLIA 2AFZA 3BI1A 4P10A 4UEEA 2EK9A 2ZEHA 4B6ZA 4ZYQA 3IWWA 4NFRA 2PJ1A 1CX8A 2PCUA 1BLLE 5K8MA 1Z2LA 3GLJA 3D4UA 4IHMA 1TKHA 2QJ8A 1R3NA 3BI0A 3PBBA 3FMCA 3KQXA 2I3CA 4ONWA 2JBKA 3V38A 8CPAA 4FAIA 3K9TA 3KGQA 4MCRA 5K8PA 4MCQA 3B3CA 4EWTA 2CTBA 2PVWA 1AYEA 1FNOA 2PVVA 3JRUA 1VIXA 3SJFA 3B3TA 1FT7A 4FUUA 2PJ4A 1ELMP 2PJ9A 3HLPA 1OBRA 1LFWA 2Q43A 4A38A 2CIJA 3PB7X 4TNUA 3NH8A
chains in the Genus database with same CATH superfamily
3H8GA 1V0CA 3F0AA 1R43A 4NGNA 4EFDA 4B11A 2B4DA 2PR8A 2WZNA 3TFYA 2WPWA 3D7FA 1LAMA 5D8NA 3PB8X 4CGPA 3DLJA 3IEHA 3P2FA 2BCOA 1S7LA 1YQEA 4H89A 4NGTA 4NCZA 4P4IA 4A37A 4KOVA 4CRZB 2ZENA 2AFMA 1KUVA 4P4EA 1TF9A 1MJBA 2V8DA 5HH1A 2AE6A 2P6EA 4EVYA 2HUZA 4JXRA 3PZJA 3B3VA 4NF1A 2ANPA 2BL1A 2EO8A 3SJGA 4A33A 2EK8A 4KUAA 5E96A 3A9LA 1U6MA 4G1PA 4MHPA 2WUUA 1QSNA 3RNZA 4ZX8A 2YNDA 2O4HA 1CBXA 2PRQA 5EMIA 3GYAA 2CY2A 3VWDA 4AVAA 4DJLA 4YGOA 4F0XA 4UF4A 4P44A 1XBUA 4PXBA 4U5YA 1SQHA 2Z3KA 3NA6A 1Z8XA 4JWPA 4UA3A 4P45A 4UCMA 4XPDB 1M4LA 4X2TA 4OC3A 3WT4A 1IYKA 3I9SA 4JZ0A 2VBQA 7CPAA 1PU9A 1OZPA 4MRIA 2V8GA 4QB9A 3JTKA 4B10A 2GLFA 4QUSA 4UEZA 1Z4RA 4UWJA 3VARA 4F0YA 4ZGYB 1UWYA 3NE7A 4F8ZA 2ZW5A 6CPAA 2C6CA 2RB7A 1P0HA 2HB6A 4MI4A 2J8MA 1QSTA 3IWEA 1CP6A 1AMPA 5JPHA 2GU2A 3B3SA 3NE8A 5ELYA 1NSAA 3T90A 3WR7A 4X3RA 1Z8WA 3N7ZA 2NSMA 3BHXA 3SHPA 3T8WA 2OZHA 4HNXB 2R7HA 1IY7A 1LCPA 1HDQA 3IJ3A 2EBJA 4IF5A 2R98A 4ONUA 4RI1A 1YMEA 4OC4A 4ZX9A 4EMEA 4MY3A 2PJ2A 4CAWA 4K3NA 4KOTA 2AFWA 3DGVA 1MJ9A 3ISZA 4CGLA 1YSJA 2NYQA 3FXTA 3KL9A 2QMLA 2B58A 3S6GA 2DPSA 2POKA 4UFWA 1LOKA 2C1CA 2HC9A 1Y0RA 2D4OA 3TX8A 3FEEA 3IWGA 4U9ZA 1TKFA 4XNHC 4AG7A 4KOSA 3ZZIA 1XOVA 2PJ7A 2PJCA 5CBMA 3S9LA 2HV2A 4O23A 2CXAA 3FBUA 2Z3LA 3WC6A 2Z3PA 4F9UA 4HNYB 3RZAA 3NH5A 2IQ6A 2XEIA 3FRMA 4FD4A 4NGRA 4FBEA 4GS4A 2VZZA 4LQGA 4OP4A 3S6KA 2OB0A 2ZW6A 2ZW7A 4M85A 4CYOA 1Y9KA 1J4JA 1ON0A 3SXNA 5K8NA 1QSMA 2FIWA 2G9DA 4L89A 5LYFA 3B3WA 2YNCC 5G1ZA 2CF4A 1KWMA 5LYIA 3H4QA 4A30A 1JWQA 1I21A 3TO9A 3K2KA 2GE3A 1CG2A 1Y9WA 3PGPA 1Q2DA 1YX0A 1S60A 1YREA 3TC8A 4NXYA 4UWIA 1YW4A 2ZEMA 4FWUA 1ZG9A 2BUEA 2PJ0A 3PB6X 2GFQA 3SI2A 4B12A 1M4DA 4L8AA 4DUKA 2P0WA 4R3KA 4MBUA 3EXNA 5D29A 4YWYA 5JGFA 2B3UA 4E2AA 3TOAA 3D7DA 4QBJA 1IGBA 3KASA 4JJXA 4YRHA 5F47A 5HMNA 5JQ4A 1IIDA 3BXMA 1QQ9A 4KORA 3KI9A 2R1IA 4C68A 4MMOA 5KTAA 1LRZA 1QSRA 4R8FA 4F9VA 3PEIA 3FVLA 5H86A 3B35A 3FX6A 3GIUA 2YNEA 4OADA 3RO0A 3FF3A 4E0AA 1YVKA 3IU2A 3C26A 4MJ8A 5ISVA 2BSWA 1Z9UA 2Z11A 4J3GA 1XRYA 4Y49C 5AG4A 2FSRA 1UFHA 4MHYA 2PJ6A 1CP7A 3TCVA 3FYNA 5LRKA 4M6HA 1NSLA 5G20A 3S9MA 1S5KA 2G3AA 4MY0A 4OC1A 3JVNA 3D7GA 3PRTA 3LMSA 4NJQA 2DPTA 3W6XA 1VGYA 2ZEPA 4ZI6A 5KTDA 5LRJA 4NJRA 2VL1A 1IOIA 4ZY1A 2VZYA 4AG9A 1Z5RA 4FD6A 2ODFA 3B7IA 2F7VA 4NGQA 4UEFA 5J1QA 1BPMA 2C27A 2H5MA 4RN7A 1YW6A 4M3SA 3S6FA 1Q7LA 4C7HA 2FCKA 4TWEA 2AFSA 3N5FA 1QSOA 1YLEA 4PQAA 2ZEOA 2CNMA 2VQYA 2FVGA 5H84A 5DWNA 1PCAA 5LYLA 3T9YA 3TE4A 4CGNA 2DEAA 5F48A 1RO5A 3WC7A 2AJ6A 3DR6A 3MRUA 5LYDA 5IB0A 2I00A 4H6ZA 5K8OA 2OZGA 1AUGA 4OC2A 3L2NA 3EO4A 5EBVA 3UY5A 4NGPA 3MGDA 2XEFA 3TTHA 4IUSA 4I49A 2BOAA 2REFA 2EVNA 1EE3P 1ELLP 2PJAA 3D66A 3SI0A 3ISXA 3B2YA 5IX3A 4II9A 4MHDA 2Z0ZA 1Z8LA 2VEZA 2ZEDA 4UCNA 1XMBA 2B5GB 1Y7EA 1GYTA 3I1UA 4MXUA 5J8CA 2I79A 3D2MA 1L0CA 4FD7A 4KOWA 2ABZA 4CAEA 1VHOA 2B5GA 5CNPA 4CRYB 3H8EA 3BLNA 3IO1A 2QVPA 1KUXA 4CGMA 1IB1E 2ATRA 3SJEA 2GREA 3SJXA 2R8VA 2Z10A 2J8RA 3G8WA 3S6HA 5HVHA 5HXDA 3DNSA 2ZEFA 2VXKA 4MHNA 4MFQA 1F57A 4CAVA 4P4DA 1B87A 4Q7AA 4X8IA 3KR4A 2D4PA 4UBRA 2CNSA 3FH4A 3D8PA 1BAVA 4XNHB 4UIAA 1QMUA 2EWBA 3WABA 4AVBA 1CM0A 2JEVA 3FJUA 2Z3OA 4KS9A 3TOBA 4Q38A 4PSWA 1IU8A 1F2OA 3QAHA 1VKCA 2ZXVA 1DE4C 3D67A 2VI7A 3P2HA 4RS2A 4WJBA 2FXFA 3D68A 4A39A 2GIVA 1ZG8A 2ZOFA 5LRGA 4CYPA 4YFJA 3EFAA 1ZG7A 5DS0A 3ZJ0A 2F8HA 3CDXA 3MN8A 2FT0A 5F09A 4PXDA 3CXSA 3CPAA 2EUIA 2Q0YA 4H6UA 4NEXA 3IU1A 4AB7A 4HPSA 3F5BA 4MFJA 2YNCA 2IMOA 2DXQA 5IB9A 5IV0A 1S7KA 3QAYA 4KZTA 4OIWA 4IK2A 4P4BA 3D2PA 4JLYA 3RYOA 4JD6A 2P6GA 4MFPA 4KOXA 2V8VA 4B14A 2QYVA 4FD5A 3GB0A 2OZUA 2O28A 4OKOA 1Y7RA 1YK3A 2AFXA 2REEA 4P6YA 3R96A 2B4BA 4BD9A 2Z3NA 3FIXA 4H2KA 2G3TA 3V8IA 1K4JA 5I4MA 4E8OA 5AG5A 1XJOA 1LANA 2V77A 4R57A 3H5ZA 2A4NA 4KVME 2Q4YA 3NH4A 4MFZA 1TKJA 5HVGA 1H8LA 4OAEA 3IIBA 1Q2YA 2F5IA 4UFXA 3IFEA 3KQZA 4XPKA 3DDDA 1VHSA 5C82A 4UCPA 4BINA 4Y49B 1S7FA 2Q4VA 1LAPA 1XMTA 1N71A 1S3ZA 4PK3A 5KTCA 3TO6A 3LD2A 2Q04A 2QIRA 4WWVA 2V8HA 1HDUA 1MJAA 2G0BA 2ZOGA 4MCPA 2Q44A 3H8FA 1X10A 1NMTA 2FS5A 4KSAA 4PSXA 2J9AA 3PFEA 4LQ6A 4LX9A 3OWCA 4R3LA 2WYRA 4ZBGA 1HEEA 2ZEGA 4PV6A 1B6BA 1YVOA 3CPXA 4C2YA 1XIXA 3TO7A 2PE3A 1GHEA 4NGSA 4R7MA 1Z4EA 3PB9X 4KOYA 1YR0A 5FVJA 3VWEA 1Y0YA 3PBEA 4GM5A 3EY5A 4YU9A 3KHZA 3FB3A 3E0KA 2PJBA 4AVCA 4W9YA 2IJZA 3KKWA 2OH1A 3PB4X 5A28A 5JM6A 4UIBA 2DF5A 2WSAA 4LUAA 3RBUA 3SXOA 4KVOE 1RTQA 2B4DB 3EC4A 3HUVA 4OC0A 1ARLA 2NMTA 2C6PA 2FE7A 2JDCA 2RC4A 3KR5A 4KLVA 5C88A 4KSIA 2PJ5A 3D7HA 2OU2A 3TT2A 3CT9A 2ZW4A 2JBJA 4KSFA 2AFUA 3KZWA 2XEGA 3GY9A 2PJ8A 2GLJA 3S9NA 1M4IA 1ZLHA 5G22A 2O53A 3BJ7A 2PSWA 4MCSA 3W91A 4C7IA 5J8FA 3VH9A 3FECA 1RXTA 2Q7BA 4GXHA 5THWA 3LACA 2K5TA 4M6GA 3R9FA 1BO4A 2Z3MA 2ZEEA 1I12A 2B3VA 2PIZA 1XFOA 2Q4ZA 4CPAA 4OIDA 3KHXA 2ARHA 4BMHA 2XEJA 1WK4A 4MFLA 5EC4A 5HVFA 3R9GA 2ZELA 4X5KA 2OOTA 4ZY0A 2RFHA 2JEWA 4PXEA 2BEIA 2JLMA 4A2ZA 1TXRA 1BPNA 1CJWA 3GUXA 5CPAA 3V7ZA 2AFOA 1A2ZA 3IGRA 2CTCA 3LWUA 4MHZA 4U9YA 1R57A 3QNVA 1CPSA 1KUYA 3NFZA 4XPDC 3SI1A 4AXVA 2JDDA 4B5OA 4F6AA 5JH9A 1DTDA 4JYWA 4CAFA 1CPXA 2PJ3A 4NGMA 3RAMA 2BO9A 4DYOA 4PK2A 4DNCA 3PFOA 4OMEA 2OR4A 3LODA 5F49A 1ARMA 5AGEA 4IAVA 1TF8A 3D3SA 2Q51A 1M44A 2IL4A 1M1DA 2PIYA 2PQ8A 4KOUA 4P4FA 4R76A 5G21A 4RUHA 3CXPA 4XPLA 3FEDA 1MK4A 3I3GA 1F2PA 3WC5A 1BOBA 1VHEA 3IC1A 4ZY2A 4A94A 4B13A 1XE4A 5AG6A 4JXQA 4CAXA 4CGOA 4PPZA 4UFVA 3R95A 4OC5A 2P6FA 4M6IA 4Z65A 3VATA 2C6GA 1X12A 3R1KA 3GKRA 4P4JA 4PXCA 1JQGA 1YLOA 1S7NA 1XF8A 4R6TA 5F46A 2PRBA 1PYTB 1ZLIA 2AFZA 3BI1A 2FL4A 4KVXA 4P10A 3R9EA 1WWZA 4BBHA 2Q7SA 5A27A 4HKFA 4UEEA 2KCWA 5AG7A 4OLLA 2X7BA 2EK9A 2ZEHA 4B6ZA 3DSBA 4ZYQA 4B5PB 3IWWA 4NFRA 2PJ1A 1CX8A 2PCUA 4QVTA 4B5PA 4C2XA 1BLLE 4Q36A 1FY7A 5K8MA 1NE9A 1Z2LA 3GLJA 1IICA 2PDOA 4HNWB 3D4UA 2YGWA 4IHMA 1TIQA 3QB8A 1TKHA 1ZO0A 1IOFA 5GCNA 2QJ8A 1YGHA 1R3NA 2CNTA 2HQYA 3BI0A 2PR1A 3F8KA 4KLWA 4CYNA 2PC1A 1KZFA 4R87A 3PBBA 3FMCA 3KQXA 1Z8TA 3DR8A 3W6SA 3B8GA 4A31A 4A95A 2I3CA 4ONWA 2JBKA 3V38A 5I0CA 4C2ZA 4R9MA 4CYQA 8CPAA 1IYLA 4FAIA 2WPXA 5BWAB 4KUBA 1XEBA 3K9TA 3KGQA 4MCRA 1Q2CA 5K8PA 4MFKA 4MCQA 3B3CA 4EWTA 1P4NA 2GANA 4A32A 2CTBA 2PVWA 1AYEA 3CZXA 1FNOA 4CS0B 2QECA 4NSQA 1M4GA 3JUWA 2PVVA 3JRUA 1VIXA 3SJFA 3B3TA 1FT7A 4FUUA 2PJ4A 1ELMP 2PJ9A 3HLPA 3K9UA 4QC6A 1PUAA 1OBRA 2Y0MA 3G3SA 3PP9A 2J8NA 3BJ8A 4K30A 2FIAA 1LFWA 2Q43A 4A38A 1I1DA 2CIJA 5DWMA 3CXQA 2ZPAA 3PB7X 4TNUA 3FNCA 3NH8A 4ORFA
chains in the Genus database with same CATH topology
3H8GA 4NGNA 1R43A 4EFDA 2WZNA 3D7FA 1LAMA 5D8NA 3PB8X 3DLJA 3IEHA 2BCOA 4NGTA 4P4IA 4A37A 2ZENA 2AFMA 4P4EA 1TF9A 2V8DA 3SJGA 3B3VA 2ANPA 2EK8A 4G1PA 4MHPA 4ZX8A 2O4HA 1CBXA 2PRQA 4DJLA 4UF4A 4P44A 1XBUA 4PXBA 3NA6A 4P45A 1M4LA 4X2TA 4OC3A 3WT4A 4JZ0A 7CPAA 4MRIA 2V8GA 2GLFA 4UEZA 3VARA 6CPAA 1UWYA 4F8ZA 2C6CA 2RB7A 2HB6A 1CP6A 1AMPA 2GU2A 3B3SA 5ELYA 1NSAA 4X3RA 3T8WA 2NSMA 3BHXA 1IY7A 1LCPA 1HDQA 3IJ3A 1YMEA 4OC4A 4ZX9A 4EMEA 2PJ2A 4K3NA 2AFWA 3DGVA 3ISZA 1YSJA 2NYQA 3KL9A 2POKA 1LOKA 2C1CA 2HC9A 1Y0RA 3TX8A 3FEEA 1TKFA 2PJ7A 2PJCA 5CBMA 3S9LA 4O23A 3WC6A 4F9UA 3RZAA 3NH5A 2IQ6A 2XEIA 4NGRA 4FBEA 4LQGA 4OP4A 5K8NA 5LYFA 2G9DA 3B3WA 2CF4A 1KWMA 5LYIA 3K2KA 1CG2A 3TC8A 1YW4A 4FWUA 2ZEMA 1ZG9A 2PJ0A 3PB6X 3SI2A 4DUKA 5D29A 4YWYA 5JGFA 3D7DA 1IGBA 3KASA 3BXMA 1QQ9A 3KI9A 4MMOA 4R8FA 4F9VA 3PEIA 3FVLA 3B35A 3FX6A 3FF3A 1XRYA 4MHYA 2PJ6A 1CP7A 5LRKA 3S9MA 4OC1A 4NJQA 3D7GA 3PRTA 3LMSA 1VGYA 2ZEPA 4ZI6A 5LRJA 4NJRA 2VL1A 4ZY1A 1Z5RA 3B7IA 2F7VA 4NGQA 4UEFA 5J1QA 1BPMA 1YW6A 1Q7LA 4TWEA 2AFSA 3N5FA 4PQAA 2ZEOA 2FVGA 1PCAA 5LYLA 2DEAA 3WC7A 3MRUA 5LYDA 5K8OA 4OC2A 3L2NA 4NGPA 2XEFA 2BOAA 1EE3P 1ELLP 2PJAA 3D66A 3SI0A 3ISXA 3B2YA 1Z8LA 2ZEDA 1XMBA 1Y7EA 1GYTA 3I1UA 4MXUA 2ABZA 1VHOA 3H8EA 3IO1A 2QVPA 3SJEA 2GREA 3SJXA 5HVHA 5HXDA 2ZEFA 4MHNA 1F57A 4P4DA 4Q7AA 4X8IA 3KR4A 3FH4A 1BAVA 4UIAA 1QMUA 2EWBA 3WABA 3FJUA 1F2OA 1DE4C 3D67A 4WJBA 4A39A 3D68A 2ZOFA 1ZG8A 5LRGA 1ZG7A 5DS0A 2F8HA 3CDXA 3MN8A 5F09A 4PXDA 3CPAA 5IB9A 2IMOA 4OIWA 4IK2A 4P4BA 2V8VA 2QYVA 3GB0A 4OKOA 2AFXA 4P6YA 4BD9A 4H2KA 5I4MA 1XJOA 1LANA 2V77A 3NH4A 1TKJA 5HVGA 1H8LA 3IIBA 3IFEA 3KQZA 1LAPA 4WWVA 2V8HA 1HDUA 2ZOGA 4MCPA 3H8FA 2J9AA 3PFEA 2WYRA 1HEEA 2ZEGA 3CPXA 2PE3A 4NGSA 4R7MA 3PB9X 4GM5A 1Y0YA 3PBEA 4YU9A 3KHZA 2PJBA 4W9YA 2IJZA 5JM6A 3PB4X 4UIBA 3RBUA 1RTQA 3HUVA 4OC0A 1ARLA 2C6PA 3KR5A 4KSIA 2PJ5A 3D7HA 3CT9A 2JBJA 2AFUA 3KZWA 2XEGA 3S9NA 2PJ8A 2GLJA 1ZLHA 2O53A 4MCSA 3VH9A 3FECA 5THWA 2ZEEA 2PIZA 1XFOA 2Q4ZA 4CPAA 4OIDA 3KHXA 2XEJA 5HVFA 2ZELA 2OOTA 4ZY0A 2RFHA 2JEWA 4PXEA 1BPNA 1TXRA 3GUXA 5CPAA 3V7ZA 2AFOA 2CTCA 3LWUA 4MHZA 3QNVA 1CPSA 3SI1A 3NFZA 5JH9A 4AXVA 1DTDA 4JYWA 1CPXA 2PJ3A 4NGMA 3RAMA 2BO9A 4DYOA 3PFOA 4OMEA 2OR4A 1ARMA 4IAVA 1TF8A 4P4FA 2Q51A 2PIYA 4R76A 4RUHA 3FEDA 1F2PA 3WC5A 3IC1A 1VHEA 4ZY2A 4A94A 4PPZA 4OC5A 4Z65A 3VATA 2C6GA 4P4JA 4PXCA 1JQGA 1YLOA 4R6TA 1PYTB 1ZLIA 2AFZA 3BI1A 4P10A 4UEEA 2EK9A 2ZEHA 4B6ZA 4ZYQA 3IWWA 4NFRA 2PJ1A 1CX8A 2PCUA 1BLLE 5K8MA 1Z2LA 3GLJA 3D4UA 4IHMA 1TKHA 2QJ8A 1R3NA 3BI0A 3PBBA 3FMCA 3KQXA 2I3CA 4ONWA 2JBKA 3V38A 8CPAA 4FAIA 3K9TA 3KGQA 4MCRA 5K8PA 4MCQA 3B3CA 4EWTA 2CTBA 2PVWA 1AYEA 1FNOA 2PVVA 3JRUA 1VIXA 3SJFA 3B3TA 1FT7A 4FUUA 2PJ4A 1ELMP 2PJ9A 3HLPA 1OBRA 1LFWA 2Q43A 4A38A 2CIJA 3PB7X 4TNUA 3NH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8G A;  4NGN A;  1R43 A;  4EFD A;  2WZN A;  3D7F A;  1LAM A;  5D8N A;  3PB8 X;  3DLJ A;  3IEH A;  2BCO A;  4NGT A;  4P4I A;  4A37 A;  2ZEN A;  2AFM A;  4P4E A;  1TF9 A;  2V8D A;  3SJG A;  3B3V A;  2ANP A;  2EK8 A;  4G1P A;  4MHP A;  4ZX8 A;  2O4H A;  1CBX A;  2PRQ A;  4DJL A;  4UF4 A;  4P44 A;  1XBU A;  4PXB A;  3NA6 A;  4P45 A;  1M4L A;  4X2T A;  4OC3 A;  3WT4 A;  4JZ0 A;  7CPA A;  4MRI A;  2V8G A;  2GLF A;  4UEZ A;  3VAR A;  6CPA A;  1UWY A;  4F8Z A;  2C6C A;  2RB7 A;  2HB6 A;  1CP6 A;  1AMP A;  2GU2 A;  3B3S A;  5ELY A;  1NSA A;  4X3R A;  3T8W A;  2NSM A;  3BHX A;  1IY7 A;  1LCP A;  1HDQ A;  3IJ3 A;  1YME A;  4OC4 A;  4ZX9 A;  4EME A;  2PJ2 A;  4K3N A;  2AFW A;  3DGV A;  3ISZ A;  1YSJ A;  2NYQ A;  3KL9 A;  2POK A;  1LOK A;  2C1C A;  2HC9 A;  1Y0R A;  3TX8 A;  3FEE A;  1TKF A;  2PJ7 A;  2PJC A;  5CBM A;  3S9L A;  4O23 A;  3WC6 A;  4F9U A;  3RZA A;  3NH5 A;  2IQ6 A;  2XEI A;  4NGR A;  4FBE A;  4LQG A;  4OP4 A;  5K8N A;  5LYF A;  2G9D A;  3B3W A;  2CF4 A;  1KWM A;  5LYI A;  3K2K A;  1CG2 A;  3TC8 A;  1YW4 A;  4FWU A;  2ZEM A;  1ZG9 A;  2PJ0 A;  3PB6 X;  3SI2 A;  4DUK A;  5D29 A;  4YWY A;  5JGF A;  3D7D A;  1IGB A;  3KAS A;  3BXM A;  1QQ9 A;  3KI9 A;  4MMO A;  4R8F A;  4F9V A;  3PEI A;  3FVL A;  3B35 A;  3FX6 A;  3FF3 A;  1XRY A;  4MHY A;  2PJ6 A;  1CP7 A;  5LRK A;  3S9M A;  4OC1 A;  4NJQ A;  3D7G A;  3PRT A;  3LMS A;  1VGY A;  2ZEP A;  4ZI6 A;  5LRJ A;  4NJR A;  2VL1 A;  4ZY1 A;  1Z5R A;  3B7I A;  2F7V A;  4NGQ A;  4UEF A;  5J1Q A;  1BPM A;  1YW6 A;  1Q7L A;  4TWE A;  2AFS A;  3N5F A;  4PQA A;  2ZEO A;  2FVG A;  1PCA A;  5LYL A;  2DEA A;  3WC7 A;  3MRU A;  5LYD A;  5K8O A;  4OC2 A;  3L2N A;  4NGP A;  2XEF A;  2BOA A;  1EE3 P;  1ELL P;  2PJA A;  3D66 A;  3SI0 A;  3ISX A;  3B2Y A;  1Z8L A;  2ZED A;  1XMB A;  1Y7E A;  1GYT A;  3I1U A;  4MXU A;  2ABZ A;  1VHO A;  3H8E A;  3IO1 A;  2QVP A;  3SJE A;  2GRE A;  3SJX A;  5HVH A;  5HXD A;  2ZEF A;  4MHN A;  1F57 A;  4P4D A;  4Q7A A;  4X8I A;  3KR4 A;  3FH4 A;  1BAV A;  4UIA A;  1QMU A;  2EWB A;  3WAB A;  3FJU A;  1F2O A;  1DE4 C;  3D67 A;  4WJB A;  4A39 A;  3D68 A;  2ZOF A;  1ZG8 A;  5LRG A;  1ZG7 A;  5DS0 A;  2F8H A;  3CDX A;  3MN8 A;  5F09 A;  4PXD A;  3CPA A;  5IB9 A;  2IMO A;  4OIW A;  4IK2 A;  4P4B A;  2V8V A;  2QYV A;  3GB0 A;  4OKO A;  2AFX A;  4P6Y A;  4BD9 A;  4H2K A;  5I4M A;  1XJO A;  1LAN A;  2V77 A;  3NH4 A;  1TKJ A;  5HVG A;  1H8L A;  3IIB A;  3IFE A;  3KQZ A;  1LAP A;  4WWV A;  2V8H A;  1HDU A;  2ZOG A;  4MCP A;  3H8F A;  2J9A A;  3PFE A;  2WYR A;  1HEE A;  2ZEG A;  3CPX A;  2PE3 A;  4NGS A;  4R7M A;  3PB9 X;  4GM5 A;  1Y0Y A;  3PBE A;  4YU9 A;  3KHZ A;  2PJB A;  4W9Y A;  2IJZ A;  5JM6 A;  3PB4 X;  4UIB A;  3RBU A;  1RTQ A;  3HUV A;  4OC0 A;  1ARL A;  2C6P A;  3KR5 A;  4KSI A;  2PJ5 A;  3D7H A;  3CT9 A;  2JBJ A;  2AFU A;  3KZW A;  2XEG A;  3S9N A;  2PJ8 A;  2GLJ A;  1ZLH A;  2O53 A;  4MCS A;  3VH9 A;  3FEC A;  5THW A;  2ZEE A;  2PIZ A;  1XFO A;  2Q4Z A;  4CPA A;  4OID A;  3KHX A;  2XEJ A;  5HVF A;  2ZEL A;  2OOT A;  4ZY0 A;  2RFH A;  2JEW A;  4PXE A;  1BPN A;  1TXR A;  3GUX A;  5CPA A;  3V7Z A;  2AFO A;  2CTC A;  3LWU A;  4MHZ A;  3QNV A;  1CPS A;  3SI1 A;  3NFZ A;  5JH9 A;  4AXV A;  1DTD A;  4JYW A;  1CPX A;  2PJ3 A;  4NGM A;  3RAM A;  2BO9 A;  4DYO A;  3PFO A;  4OME A;  2OR4 A;  1ARM A;  4IAV A;  1TF8 A;  4P4F A;  2Q51 A;  2PIY A;  4R76 A;  4RUH A;  3FED A;  1F2P A;  3WC5 A;  3IC1 A;  1VHE A;  4ZY2 A;  4A94 A;  4PPZ A;  4OC5 A;  4Z65 A;  3VAT A;  2C6G A;  4P4J A;  4PXC A;  1JQG A;  1YLO A;  4R6T A;  1PYT B;  1ZLI A;  2AFZ A;  3BI1 A;  4P10 A;  4UEE A;  2EK9 A;  2ZEH A;  4B6Z A;  4ZYQ A;  3IWW A;  4NFR A;  2PJ1 A;  1CX8 A;  2PCU A;  1BLL E;  5K8M A;  1Z2L A;  3GLJ A;  3D4U A;  4IHM A;  1TKH A;  2QJ8 A;  1R3N A;  3BI0 A;  3PBB A;  3FMC A;  3KQX A;  2I3C A;  4ONW A;  2JBK A;  3V38 A;  8CPA A;  4FAI A;  3K9T A;  3KGQ A;  4MCR A;  5K8P A;  4MCQ A;  3B3C A;  4EWT A;  2CTB A;  2PVW A;  1AYE A;  1FNO A;  2PVV A;  3JRU A;  1VIX A;  3SJF A;  3B3T A;  1FT7 A;  4FUU A;  2PJ4 A;  1ELM P;  2PJ9 A;  3HLP A;  1OBR A;  1LFW A;  2Q43 A;  4A38 A;  2CIJ A;  3PB7 X;  4TNU A;  3NH8 A; 
#chains in the Genus database with same CATH topology
 3H8G A;  1V0C A;  3F0A A;  1R43 A;  4NGN A;  4EFD A;  4B11 A;  2B4D A;  2PR8 A;  2WZN A;  3TFY A;  2WPW A;  3D7F A;  1LAM A;  5D8N A;  3PB8 X;  4CGP A;  3DLJ A;  3IEH A;  3P2F A;  2BCO A;  1S7L A;  1YQE A;  4H89 A;  4NGT A;  4NCZ A;  4P4I A;  4A37 A;  4KOV A;  4CRZ B;  2ZEN A;  2AFM A;  1KUV A;  4P4E A;  1TF9 A;  1MJB A;  2V8D A;  5HH1 A;  2AE6 A;  2P6E A;  4EVY A;  2HUZ A;  4JXR A;  3PZJ A;  3B3V A;  4NF1 A;  2ANP A;  2BL1 A;  2EO8 A;  3SJG A;  4A33 A;  2EK8 A;  4KUA A;  5E96 A;  3A9L A;  1U6M A;  4G1P A;  4MHP A;  2WUU A;  1QSN A;  3RNZ A;  4ZX8 A;  2YND A;  2O4H A;  1CBX A;  2PRQ A;  5EMI A;  3GYA A;  2CY2 A;  3VWD A;  4AVA A;  4DJL A;  4YGO A;  4F0X A;  4UF4 A;  4P44 A;  1XBU A;  4PXB A;  4U5Y A;  1SQH A;  2Z3K A;  3NA6 A;  1Z8X A;  4JWP A;  4UA3 A;  4P45 A;  4UCM A;  4XPD B;  1M4L A;  4X2T A;  4OC3 A;  3WT4 A;  1IYK A;  3I9S A;  4JZ0 A;  2VBQ A;  7CPA A;  1PU9 A;  1OZP A;  4MRI A;  2V8G A;  4QB9 A;  3JTK A;  4B10 A;  2GLF A;  4QUS A;  4UEZ A;  1Z4R A;  4UWJ A;  3VAR A;  4F0Y A;  4ZGY B;  1UWY A;  3NE7 A;  4F8Z A;  2ZW5 A;  6CPA A;  2C6C A;  2RB7 A;  1P0H A;  2HB6 A;  4MI4 A;  2J8M A;  1QST A;  3IWE A;  1CP6 A;  1AMP A;  5JPH A;  2GU2 A;  3B3S A;  3NE8 A;  5ELY A;  1NSA A;  3T90 A;  3WR7 A;  4X3R A;  1Z8W A;  3N7Z A;  2NSM A;  3BHX A;  3SHP A;  3T8W A;  2OZH A;  4HNX B;  2R7H A;  1IY7 A;  1LCP A;  1HDQ A;  3IJ3 A;  2EBJ A;  4IF5 A;  2R98 A;  4ONU A;  4RI1 A;  1YME A;  4OC4 A;  4ZX9 A;  4EME A;  4MY3 A;  2PJ2 A;  4CAW A;  4K3N A;  4KOT A;  2AFW A;  3DGV A;  1MJ9 A;  3ISZ A;  4CGL A;  1YSJ A;  2NYQ A;  3FXT A;  3KL9 A;  2QML A;  2B58 A;  3S6G A;  2DPS A;  2POK A;  4UFW A;  1LOK A;  2C1C A;  2HC9 A;  1Y0R A;  2D4O A;  3TX8 A;  3FEE A;  3IWG A;  4U9Z A;  1TKF A;  4XNH C;  4AG7 A;  4KOS A;  3ZZI A;  1XOV A;  2PJ7 A;  2PJC A;  5CBM A;  3S9L A;  2HV2 A;  4O23 A;  2CXA A;  3FBU A;  2Z3L A;  3WC6 A;  2Z3P A;  4F9U A;  4HNY B;  3RZA A;  3NH5 A;  2IQ6 A;  2XEI A;  3FRM A;  4FD4 A;  4NGR A;  4FBE A;  4GS4 A;  2VZZ A;  4LQG A;  4OP4 A;  3S6K A;  2OB0 A;  2ZW6 A;  2ZW7 A;  4M85 A;  4CYO A;  1Y9K A;  1J4J A;  1ON0 A;  3SXN A;  5K8N A;  1QSM A;  2FIW A;  2G9D A;  4L89 A;  5LYF A;  3B3W A;  2YNC C;  5G1Z A;  2CF4 A;  1KWM A;  5LYI A;  3H4Q A;  4A30 A;  1JWQ A;  1I21 A;  3TO9 A;  3K2K A;  2GE3 A;  1CG2 A;  1Y9W A;  3PGP A;  1Q2D A;  1YX0 A;  1S60 A;  1YRE A;  3TC8 A;  4NXY A;  4UWI A;  1YW4 A;  2ZEM A;  4FWU A;  1ZG9 A;  2BUE A;  2PJ0 A;  3PB6 X;  2GFQ A;  3SI2 A;  4B12 A;  1M4D A;  4L8A A;  4DUK A;  2P0W A;  4R3K A;  4MBU A;  3EXN A;  5D29 A;  4YWY A;  5JGF A;  2B3U A;  4E2A A;  3TOA A;  3D7D A;  4QBJ A;  1IGB A;  3KAS A;  4JJX A;  4YRH A;  5F47 A;  5HMN A;  5JQ4 A;  1IID A;  3BXM A;  1QQ9 A;  4KOR A;  3KI9 A;  2R1I A;  4C68 A;  4MMO A;  5KTA A;  1LRZ A;  1QSR A;  4R8F A;  4F9V A;  3PEI A;  3FVL A;  5H86 A;  3B35 A;  3FX6 A;  3GIU A;  2YNE A;  4OAD A;  3RO0 A;  3FF3 A;  4E0A A;  1YVK A;  3IU2 A;  3C26 A;  4MJ8 A;  5ISV A;  2BSW A;  1Z9U A;  2Z11 A;  4J3G A;  1XRY A;  4Y49 C;  5AG4 A;  2FSR A;  1UFH A;  4MHY A;  2PJ6 A;  1CP7 A;  3TCV A;  3FYN A;  5LRK A;  4M6H A;  1NSL A;  5G20 A;  3S9M A;  1S5K A;  2G3A A;  4MY0 A;  4OC1 A;  3JVN A;  3D7G A;  3PRT A;  3LMS A;  4NJQ A;  2DPT A;  3W6X A;  1VGY A;  2ZEP A;  4ZI6 A;  5KTD A;  5LRJ A;  4NJR A;  2VL1 A;  1IOI A;  4ZY1 A;  2VZY A;  4AG9 A;  1Z5R A;  4FD6 A;  2ODF A;  3B7I A;  2F7V A;  4NGQ A;  4UEF A;  5J1Q A;  1BPM A;  2C27 A;  2H5M A;  4RN7 A;  1YW6 A;  4M3S A;  3S6F A;  1Q7L A;  4C7H A;  2FCK A;  4TWE A;  2AFS A;  3N5F A;  1QSO A;  1YLE A;  4PQA A;  2ZEO A;  2CNM A;  2VQY A;  2FVG A;  5H84 A;  5DWN A;  1PCA A;  5LYL A;  3T9Y A;  3TE4 A;  4CGN A;  2DEA A;  5F48 A;  1RO5 A;  3WC7 A;  2AJ6 A;  3DR6 A;  3MRU A;  5LYD A;  5IB0 A;  2I00 A;  4H6Z A;  5K8O A;  2OZG A;  1AUG A;  4OC2 A;  3L2N A;  3EO4 A;  5EBV A;  3UY5 A;  4NGP A;  3MGD A;  2XEF A;  3TTH A;  4IUS A;  4I49 A;  2BOA A;  2REF A;  2EVN A;  1EE3 P;  1ELL P;  2PJA A;  3D66 A;  3SI0 A;  3ISX A;  3B2Y A;  5IX3 A;  4II9 A;  4MHD A;  2Z0Z A;  1Z8L A;  2VEZ A;  2ZED A;  4UCN A;  1XMB A;  2B5G B;  1Y7E A;  1GYT A;  3I1U A;  4MXU A;  5J8C A;  2I79 A;  3D2M A;  1L0C A;  4FD7 A;  4KOW A;  2ABZ A;  4CAE A;  1VHO A;  2B5G A;  5CNP A;  4CRY B;  3H8E A;  3BLN A;  3IO1 A;  2QVP A;  1KUX A;  4CGM A;  1IB1 E;  2ATR A;  3SJE A;  2GRE A;  3SJX A;  2R8V A;  2Z10 A;  2J8R A;  3G8W A;  3S6H A;  5HVH A;  5HXD A;  3DNS A;  2ZEF A;  2VXK A;  4MHN A;  4MFQ A;  1F57 A;  4CAV A;  4P4D A;  1B87 A;  4Q7A A;  4X8I A;  3KR4 A;  2D4P A;  4UBR A;  2CNS A;  3FH4 A;  3D8P A;  1BAV A;  4XNH B;  4UIA A;  1QMU A;  2EWB A;  3WAB A;  4AVB A;  1CM0 A;  2JEV A;  3FJU A;  2Z3O A;  4KS9 A;  3TOB A;  4Q38 A;  4PSW A;  1IU8 A;  1F2O A;  3QAH A;  1VKC A;  2ZXV A;  1DE4 C;  3D67 A;  2VI7 A;  3P2H A;  4RS2 A;  4WJB A;  2FXF A;  3D68 A;  4A39 A;  2GIV A;  1ZG8 A;  2ZOF A;  5LRG A;  4CYP A;  4YFJ A;  3EFA A;  1ZG7 A;  5DS0 A;  3ZJ0 A;  2F8H A;  3CDX A;  3MN8 A;  2FT0 A;  5F09 A;  4PXD A;  3CXS A;  3CPA A;  2EUI A;  2Q0Y A;  4H6U A;  4NEX A;  3IU1 A;  4AB7 A;  4HPS A;  3F5B A;  4MFJ A;  2YNC A;  2IMO A;  2DXQ A;  5IB9 A;  5IV0 A;  1S7K A;  3QAY A;  4KZT A;  4OIW A;  4IK2 A;  4P4B A;  3D2P A;  4JLY A;  3RYO A;  4JD6 A;  2P6G A;  4MFP A;  4KOX A;  2V8V A;  4B14 A;  2QYV A;  4FD5 A;  3GB0 A;  2OZU A;  2O28 A;  4OKO A;  1Y7R A;  1YK3 A;  2AFX A;  2REE A;  4P6Y A;  3R96 A;  2B4B A;  4BD9 A;  2Z3N A;  3FIX A;  4H2K A;  2G3T A;  3V8I A;  1K4J A;  5I4M A;  4E8O A;  5AG5 A;  1XJO A;  1LAN A;  2V77 A;  4R57 A;  3H5Z A;  2A4N A;  4KVM E;  2Q4Y A;  3NH4 A;  4MFZ A;  1TKJ A;  5HVG A;  1H8L A;  4OAE A;  3IIB A;  1Q2Y A;  2F5I A;  4UFX A;  3IFE A;  3KQZ A;  4XPK A;  3DDD A;  1VHS A;  5C82 A;  4UCP A;  4BIN A;  4Y49 B;  1S7F A;  2Q4V A;  1LAP A;  1XMT A;  1N71 A;  1S3Z A;  4PK3 A;  5KTC A;  3TO6 A;  3LD2 A;  2Q04 A;  2QIR A;  4WWV A;  2V8H A;  1HDU A;  1MJA A;  2G0B A;  2ZOG A;  4MCP A;  2Q44 A;  3H8F A;  1X10 A;  1NMT A;  2FS5 A;  4KSA A;  4PSX A;  2J9A A;  3PFE A;  4LQ6 A;  4LX9 A;  3OWC A;  4R3L A;  2WYR A;  4ZBG A;  1HEE A;  2ZEG A;  4PV6 A;  1B6B A;  1YVO A;  3CPX A;  4C2Y A;  1XIX A;  3TO7 A;  2PE3 A;  1GHE A;  4NGS A;  4R7M A;  1Z4E A;  3PB9 X;  4KOY A;  1YR0 A;  5FVJ A;  3VWE A;  1Y0Y A;  3PBE A;  4GM5 A;  3EY5 A;  4YU9 A;  3KHZ A;  3FB3 A;  3E0K A;  2PJB A;  4AVC A;  4W9Y A;  2IJZ A;  3KKW A;  2OH1 A;  3PB4 X;  5A28 A;  5JM6 A;  4UIB A;  2DF5 A;  2WSA A;  4LUA A;  3RBU A;  3SXO A;  4KVO E;  1RTQ A;  2B4D B;  3EC4 A;  3HUV A;  4OC0 A;  1ARL A;  2NMT A;  2C6P A;  2FE7 A;  2JDC A;  2RC4 A;  3KR5 A;  4KLV A;  5C88 A;  4KSI A;  2PJ5 A;  3D7H A;  2OU2 A;  3TT2 A;  3CT9 A;  2ZW4 A;  2JBJ A;  4KSF A;  2AFU A;  3KZW A;  2XEG A;  3GY9 A;  2PJ8 A;  2GLJ A;  3S9N A;  1M4I A;  1ZLH A;  5G22 A;  2O53 A;  3BJ7 A;  2PSW A;  4MCS A;  3W91 A;  4C7I A;  5J8F A;  3VH9 A;  3FEC A;  1RXT A;  2Q7B A;  4GXH A;  5THW A;  3LAC A;  2K5T A;  4M6G A;  3R9F A;  1BO4 A;  2Z3M A;  2ZEE A;  1I12 A;  2B3V A;  2PIZ A;  1XFO A;  2Q4Z A;  4CPA A;  4OID A;  3KHX A;  2ARH A;  4BMH A;  2XEJ A;  1WK4 A;  4MFL A;  5EC4 A;  5HVF A;  3R9G A;  2ZEL A;  4X5K A;  2OOT A;  4ZY0 A;  2RFH A;  2JEW A;  4PXE A;  2BEI A;  2JLM A;  4A2Z A;  1TXR A;  1BPN A;  1CJW A;  3GUX A;  5CPA A;  3V7Z A;  2AFO A;  1A2Z A;  3IGR A;  2CTC A;  3LWU A;  4MHZ A;  4U9Y A;  1R57 A;  3QNV A;  1CPS A;  1KUY A;  3NFZ A;  4XPD C;  3SI1 A;  4AXV A;  2JDD A;  4B5O A;  4F6A A;  5JH9 A;  1DTD A;  4JYW A;  4CAF A;  1CPX A;  2PJ3 A;  4NGM A;  3RAM A;  2BO9 A;  4DYO A;  4PK2 A;  4DNC A;  3PFO A;  4OME A;  2OR4 A;  3LOD A;  5F49 A;  1ARM A;  5AGE A;  4IAV A;  1TF8 A;  3D3S A;  2Q51 A;  1M44 A;  2IL4 A;  1M1D A;  2PIY A;  2PQ8 A;  4KOU A;  4P4F A;  4R76 A;  5G21 A;  4RUH A;  3CXP A;  4XPL A;  3FED A;  1MK4 A;  3I3G A;  1F2P A;  3WC5 A;  1BOB A;  1VHE A;  3IC1 A;  4ZY2 A;  4A94 A;  4B13 A;  1XE4 A;  5AG6 A;  4JXQ A;  4CAX A;  4CGO A;  4PPZ A;  4UFV A;  3R95 A;  4OC5 A;  2P6F A;  4M6I A;  4Z65 A;  3VAT A;  2C6G A;  1X12 A;  3R1K A;  3GKR A;  4P4J A;  4PXC A;  1JQG A;  1YLO A;  1S7N A;  1XF8 A;  4R6T A;  5F46 A;  2PRB A;  1PYT B;  1ZLI A;  2AFZ A;  3BI1 A;  2FL4 A;  4KVX A;  4P10 A;  3R9E A;  1WWZ A;  4BBH A;  2Q7S A;  5A27 A;  4HKF A;  4UEE A;  2KCW A;  5AG7 A;  4OLL A;  2X7B A;  2EK9 A;  2ZEH A;  4B6Z A;  3DSB A;  4ZYQ A;  4B5P B;  3IWW A;  4NFR A;  2PJ1 A;  1CX8 A;  2PCU A;  4QVT A;  4B5P A;  4C2X A;  1BLL E;  4Q36 A;  1FY7 A;  5K8M A;  1NE9 A;  1Z2L A;  3GLJ A;  1IIC A;  2PDO A;  4HNW B;  3D4U A;  2YGW A;  4IHM A;  1TIQ A;  3QB8 A;  1TKH A;  1ZO0 A;  1IOF A;  5GCN A;  2QJ8 A;  1YGH A;  1R3N A;  2CNT A;  2HQY A;  3BI0 A;  2PR1 A;  3F8K A;  4KLW A;  4CYN A;  2PC1 A;  1KZF A;  4R87 A;  3PBB A;  3FMC A;  3KQX A;  1Z8T A;  3DR8 A;  3W6S A;  3B8G A;  4A31 A;  4A95 A;  2I3C A;  4ONW A;  2JBK A;  3V38 A;  5I0C A;  4C2Z A;  4R9M A;  4CYQ A;  8CPA A;  1IYL A;  4FAI A;  2WPX A;  5BWA B;  4KUB A;  1XEB A;  3K9T A;  3KGQ A;  4MCR A;  1Q2C A;  5K8P A;  4MFK A;  4MCQ A;  3B3C A;  4EWT A;  1P4N A;  2GAN A;  4A32 A;  2CTB A;  2PVW A;  1AYE A;  3CZX A;  1FNO A;  4CS0 B;  2QEC A;  4NSQ A;  1M4G A;  3JUW A;  2PVV A;  3JRU A;  1VIX A;  3SJF A;  3B3T A;  1FT7 A;  4FUU A;  2PJ4 A;  1ELM P;  2PJ9 A;  3HLP A;  3K9U A;  4QC6 A;  1PUA A;  1OBR A;  2Y0M A;  3G3S A;  3PP9 A;  2J8N A;  3BJ8 A;  4K30 A;  2FIA A;  1LFW A;  2Q43 A;  4A38 A;  1I1D A;  2CIJ A;  5DWM A;  3CXQ A;  2ZPA A;  3PB7 X;  4TNU A;  3FNC A;  3NH8 A;  4ORF A; 
#chains in the Genus database with same CATH homology
 3H8G A;  4NGN A;  1R43 A;  4EFD A;  2WZN A;  3D7F A;  1LAM A;  5D8N A;  3PB8 X;  3DLJ A;  3IEH A;  2BCO A;  4NGT A;  4P4I A;  4A37 A;  2ZEN A;  2AFM A;  4P4E A;  1TF9 A;  2V8D A;  3SJG A;  3B3V A;  2ANP A;  2EK8 A;  4G1P A;  4MHP A;  4ZX8 A;  2O4H A;  1CBX A;  2PRQ A;  4DJL A;  4UF4 A;  4P44 A;  1XBU A;  4PXB A;  3NA6 A;  4P45 A;  1M4L A;  4X2T A;  4OC3 A;  3WT4 A;  4JZ0 A;  7CPA A;  4MRI A;  2V8G A;  2GLF A;  4UEZ A;  3VAR A;  6CPA A;  1UWY A;  4F8Z A;  2C6C A;  2RB7 A;  2HB6 A;  1CP6 A;  1AMP A;  2GU2 A;  3B3S A;  5ELY A;  1NSA A;  4X3R A;  3T8W A;  2NSM A;  3BHX A;  1IY7 A;  1LCP A;  1HDQ A;  3IJ3 A;  1YME A;  4OC4 A;  4ZX9 A;  4EME A;  2PJ2 A;  4K3N A;  2AFW A;  3DGV A;  3ISZ A;  1YSJ A;  2NYQ A;  3KL9 A;  2POK A;  1LOK A;  2C1C A;  2HC9 A;  1Y0R A;  3TX8 A;  3FEE A;  1TKF A;  2PJ7 A;  2PJC A;  5CBM A;  3S9L A;  4O23 A;  3WC6 A;  4F9U A;  3RZA A;  3NH5 A;  2IQ6 A;  2XEI A;  4NGR A;  4FBE A;  4LQG A;  4OP4 A;  5K8N A;  5LYF A;  2G9D A;  3B3W A;  2CF4 A;  1KWM A;  5LYI A;  3K2K A;  1CG2 A;  3TC8 A;  1YW4 A;  4FWU A;  2ZEM A;  1ZG9 A;  2PJ0 A;  3PB6 X;  3SI2 A;  4DUK A;  5D29 A;  4YWY A;  5JGF A;  3D7D A;  1IGB A;  3KAS A;  3BXM A;  1QQ9 A;  3KI9 A;  4MMO A;  4R8F A;  4F9V A;  3PEI A;  3FVL A;  3B35 A;  3FX6 A;  3FF3 A;  1XRY A;  4MHY A;  2PJ6 A;  1CP7 A;  5LRK A;  3S9M A;  4OC1 A;  4NJQ A;  3D7G A;  3PRT A;  3LMS A;  1VGY A;  2ZEP A;  4ZI6 A;  5LRJ A;  4NJR A;  2VL1 A;  4ZY1 A;  1Z5R A;  3B7I A;  2F7V A;  4NGQ A;  4UEF A;  5J1Q A;  1BPM A;  1YW6 A;  1Q7L A;  4TWE A;  2AFS A;  3N5F A;  4PQA A;  2ZEO A;  2FVG A;  1PCA A;  5LYL A;  2DEA A;  3WC7 A;  3MRU A;  5LYD A;  5K8O A;  4OC2 A;  3L2N A;  4NGP A;  2XEF A;  2BOA A;  1EE3 P;  1ELL P;  2PJA A;  3D66 A;  3SI0 A;  3ISX A;  3B2Y A;  1Z8L A;  2ZED A;  1XMB A;  1Y7E A;  1GYT A;  3I1U A;  4MXU A;  2ABZ A;  1VHO A;  3H8E A;  3IO1 A;  2QVP A;  3SJE A;  2GRE A;  3SJX A;  5HVH A;  5HXD A;  2ZEF A;  4MHN A;  1F57 A;  4P4D A;  4Q7A A;  4X8I A;  3KR4 A;  3FH4 A;  1BAV A;  4UIA A;  1QMU A;  2EWB A;  3WAB A;  3FJU A;  1F2O A;  1DE4 C;  3D67 A;  4WJB A;  4A39 A;  3D68 A;  2ZOF A;  1ZG8 A;  5LRG A;  1ZG7 A;  5DS0 A;  2F8H A;  3CDX A;  3MN8 A;  5F09 A;  4PXD A;  3CPA A;  5IB9 A;  2IMO A;  4OIW A;  4IK2 A;  4P4B A;  2V8V A;  2QYV A;  3GB0 A;  4OKO A;  2AFX A;  4P6Y A;  4BD9 A;  4H2K A;  5I4M A;  1XJO A;  1LAN A;  2V77 A;  3NH4 A;  1TKJ A;  5HVG A;  1H8L A;  3IIB A;  3IFE A;  3KQZ A;  1LAP A;  4WWV A;  2V8H A;  1HDU A;  2ZOG A;  4MCP A;  3H8F A;  2J9A A;  3PFE A;  2WYR A;  1HEE A;  2ZEG A;  3CPX A;  2PE3 A;  4NGS A;  4R7M A;  3PB9 X;  4GM5 A;  1Y0Y A;  3PBE A;  4YU9 A;  3KHZ A;  2PJB A;  4W9Y A;  2IJZ A;  5JM6 A;  3PB4 X;  4UIB A;  3RBU A;  1RTQ A;  3HUV A;  4OC0 A;  1ARL A;  2C6P A;  3KR5 A;  4KSI A;  2PJ5 A;  3D7H A;  3CT9 A;  2JBJ A;  2AFU A;  3KZW A;  2XEG A;  3S9N A;  2PJ8 A;  2GLJ A;  1ZLH A;  2O53 A;  4MCS A;  3VH9 A;  3FEC A;  5THW A;  2ZEE A;  2PIZ A;  1XFO A;  2Q4Z A;  4CPA A;  4OID A;  3KHX A;  2XEJ A;  5HVF A;  2ZEL A;  2OOT A;  4ZY0 A;  2RFH A;  2JEW A;  4PXE A;  1BPN A;  1TXR A;  3GUX A;  5CPA A;  3V7Z A;  2AFO A;  2CTC A;  3LWU A;  4MHZ A;  3QNV A;  1CPS A;  3SI1 A;  3NFZ A;  5JH9 A;  4AXV A;  1DTD A;  4JYW A;  1CPX A;  2PJ3 A;  4NGM A;  3RAM A;  2BO9 A;  4DYO A;  3PFO A;  4OME A;  2OR4 A;  1ARM A;  4IAV A;  1TF8 A;  4P4F A;  2Q51 A;  2PIY A;  4R76 A;  4RUH A;  3FED A;  1F2P A;  3WC5 A;  3IC1 A;  1VHE A;  4ZY2 A;  4A94 A;  4PPZ A;  4OC5 A;  4Z65 A;  3VAT A;  2C6G A;  4P4J A;  4PXC A;  1JQG A;  1YLO A;  4R6T A;  1PYT B;  1ZLI A;  2AFZ A;  3BI1 A;  4P10 A;  4UEE A;  2EK9 A;  2ZEH A;  4B6Z A;  4ZYQ A;  3IWW A;  4NFR A;  2PJ1 A;  1CX8 A;  2PCU A;  1BLL E;  5K8M A;  1Z2L A;  3GLJ A;  3D4U A;  4IHM A;  1TKH A;  2QJ8 A;  1R3N A;  3BI0 A;  3PBB A;  3FMC A;  3KQX A;  2I3C A;  4ONW A;  2JBK A;  3V38 A;  8CPA A;  4FAI A;  3K9T A;  3KGQ A;  4MCR A;  5K8P A;  4MCQ A;  3B3C A;  4EWT A;  2CTB A;  2PVW A;  1AYE A;  1FNO A;  2PVV A;  3JRU A;  1VIX A;  3SJF A;  3B3T A;  1FT7 A;  4FUU A;  2PJ4 A;  1ELM P;  2PJ9 A;  3HLP A;  1OBR A;  1LFW A;  2Q43 A;  4A38 A;  2CIJ A;  3PB7 X;  4TNU A;  3NH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...