1Q7LA

Zn-binding domain of the t347g mutant of human aminoacylase-i
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
192
structure length
192
Chain Sequence
EEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Aminoacylase-1
publication title Essential roles of zinc ligation and enzyme dimerization for catalysis in the aminoacylase-1/M20 family.
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 192
sequence length 192
chains with identical sequence C
ec nomenclature ec 3.5.1.14: N-acyl-aliphatic-L-amino acid amidohydrolase.
pdb deposition date 2003-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1q7lA00
4P4EA 4UEZA 4Q7AA 3KHZA 1YW6A 2PIYA 4OP4A 1DE4C 3S9NA 7CPAA 4GM5A 4WJBA 2ANPA 4KSIA 2ZELA 3KL9A 4F8ZA 4OIWA 3B3SA 4A94A 1ELLP 4G1PA 4PQAA 4PPZA 2CF4A 2PVVA 4F9UA 2XEGA 2C1CA 5LYLA 1XMBA 3RAMA 4OMEA 3D4UA 3BXMA 2PRQA 1BPNA 5IB9A 4LQGA 2PCUA 2ZEOA 2GREA 4FWUA 4IHMA 4JZ0A 4P10A 3IIBA 3D7FA 1Y0RA 3KZWA 1VGYA 4EMEA 3LMSA 3FECA 2PJ1A 2V77A 4P45A 3I1UA 4NGTA 3QNVA 4FAIA 4ZY1A 1Y7EA 3DGVA 2RB7A 1IY7A 4JYWA 1JQGA 3PBEA 3JRUA 5LRJA 4A39A 3IWWA 2NYQA 1YSJA 4P4DA 3PEIA 4EFDA 1CPXA 3KASA 3D7HA 2PJCA 2G9DA 3IFEA 4EWTA 1TF9A 3WC5A 2ZEEA 1Z8LA 1CG2A 2WYRA 2ZEGA 2O4HA 2XEJA 3K9TA 2PJ9A 3DLJA 2JBKA 3VATA 3FJUA 4B6ZA 5K8PA 2PVWA 5I4MA 3PB8X 3B3CA 1TKHA 1OBRA 3FMCA 4R76A 2GLFA 4MHZA 1Y0YA 4AXVA 2JEWA 1QQ9A 3CPXA 2ZOGA 1HEEA 5D8NA 5LYIA 4P44A 3ISZA 1ZG7A 5J1QA 4IK2A 3WC7A 3FVLA 6CPAA 4P6YA 5K8NA 4UIBA 5HVGA 3PFEA 4MCSA 2ABZA 4A38A 1H8LA 2WZNA 4NGPA 4NGQA 2CIJA 5LYDA 1YMEA 1Q7LA 1LOKA 2AFUA 2ZEHA 3V7ZA 2QVPA 4P4FA 2VL1A 2NSMA 3D7GA 3S9MA 1BPMA 3NH5A 2ZOFA 2PJAA 3WC6A 3IEHA 4H2KA 1DTDA 4MMOA 2HC9A 3H8FA 4MXUA 4NFRA 1CP7A 4UIAA 5CBMA 2V8VA 1AMPA 3B3WA 3CPAA 2EWBA 1XFOA 2CTCA 3VH9A 4OC1A 3V38A 1VIXA 2PJ0A 2ZEPA 4ZY0A 5HVHA 2FVGA 3SI1A 1LANA 3N5FA 4X2TA 2PJBA 2F7VA 3T8WA 1TF8A 2GLJA 2QYVA 3B7IA 3SI0A 1AYEA 2C6PA 3NH8A 1FNOA 1LCPA 5JM6A 5K8MA 2AFZA 2OR4A 4OKOA 2OOTA 4W9YA 2C6GA 3SJEA 1TXRA 4A37A 1ELMP 2J9AA 4TNUA 1BLLE 1F57A 4MCPA 4OC2A 3KI9A 5HXDA 5JH9A 1QMUA 4IAVA 2AFSA 4OC5A 3IC1A 4R6TA 1ZLHA 3KHXA 3D66A 3B35A 3TX8A 4TWEA 3B3VA 3L2NA 4MHYA 2PJ7A 4BD9A 4X8IA 3MRUA 5HVFA 5JGFA 2EK9A 3NFZA 4ZY2A 3KQZA 4WWVA 3BI0A 4Z65A 4ZX9A 2AFXA 4PXCA 3FH4A 1XRYA 4RUHA 1YLOA 4DJLA 4OC4A 3NH4A 3PB4X 1CPSA 2PE3A 2AFMA 1EE3P 3K2KA 3FEEA 1ARMA 2F8HA 3HUVA 2Q43A 4MRIA 3KR5A 4NJQA 1VHOA 4PXDA 2CTBA 3FEDA 3PB6X 2HB6A 3IO1A 3SJFA 4MCQA 2BOAA 2PJ2A 5F09A 4ZX8A 3BHXA 1KWMA 1HDUA 3SJXA 1IGBA 5LYFA 3KR4A 2EK8A 2QJ8A 4P4IA 1ZLIA 3D68A 4PXBA 2AFOA 4OC0A 4UEFA 4NJRA 2JBJA 3CDXA 5CPAA 1ZG8A 4DYOA 2C6CA 4FUUA 1GYTA 2BO9A 1LAPA 3TC8A 4PXEA 2ZEFA 4DUKA 5DS0A 4YU9A 3WT4A 2O53A 4NGNA 2Q4ZA 4CPAA 1LFWA 1YW4A 1XJOA 3GB0A 1CX8A 3RBUA 4ZI6A 2PJ8A 3H8EA 2RFHA 4OC3A 5THWA 2AFWA 8CPAA 1UWYA 4UF4A 4K3NA 2DEAA 5LRGA 2XEIA 4X3RA 1CBXA 4FBEA 4R7MA 1M4LA 1VHEA 4F9VA 4NGRA 1F2OA 2IQ6A 2PJ3A 4MHPA 4YWYA 1XBUA 3RZAA 3PFOA 3PBBA 3S9LA 3KQXA 2V8GA 3B3TA 2V8DA 2BCOA 1RTQA 2IJZA 1TKFA 3D67A 5ELYA 1CP6A 2IMOA 1Z2LA 3SJGA 1R3NA 1FT7A 1Z5RA 4O23A 3H8GA 3BI1A 3CT9A 3WABA 1TKJA 5LRKA 3KGQA 3MN8A 5D29A 2I3CA 4MCRA 1PCAA 3FF3A 1F2PA 3GLJA 1HDQA 2PJ4A 4NGMA 4OIDA 2PJ6A 3FX6A 3LWUA 2ZENA 3SI2A 3PRTA 2XEFA 2ZEMA 2ZEDA 1NSAA 3GUXA 2POKA 1PYTB 5K8OA 1ARLA 3D7DA 4ZYQA 4NGSA 4UEEA 2PIZA 4P4BA 3PB9X 1R43A 1ZG9A 2GU2A 3ISXA 4MHNA 2PJ5A 1LAMA 1BAVA 3PB7X 4P4JA 3HLPA 2Q51A 3B2YA 2V8HA 3NA6A 4R8FA 4ONWA 3IJ3A 3VARA
chains in the Genus database with same CATH superfamily
5KTAA 1M4GA 4P4EA 4UEZA 4Q7AA 5JQ4A 3PZJA 4YGOA 4AG7A 2FS5A 2HQYA 3KHZA 1YW6A 2PIYA 3VWEA 4FD6A 3DNSA 4OP4A 1Z8XA 1BOBA 3FB3A 1DE4C 4KOXA 4XPKA 1Y7RA 3R95A 3S9NA 7CPAA 4GM5A 1IYKA 2OB0A 4WJBA 3TFYA 2ANPA 4MFPA 3UY5A 1M1DA 2Z10A 4KSIA 2ZELA 4L89A 4OAEA 3C26A 5F48A 3KL9A 4F8ZA 3R9FA 1X10A 3H4QA 4OIWA 3EC4A 4MFJA 2IL4A 3B3SA 3TE4A 4A94A 1ELLP 4G1PA 4PQAA 4CGOA 4XPDB 3F8KA 4KZTA 2PR1A 2CF4A 2PVVA 4PPZA 4F9UA 2XEGA 4B5PB 2C1CA 5G21A 5F49A 5LYLA 2CNSA 1XMBA 3RAMA 4OMEA 1MJ9A 5G20A 4QC6A 1K4JA 1Z4RA 3D4UA 3BXMA 1M4DA 4XPLA 2PRQA 3CXPA 1BPNA 3BLNA 5IB9A 1XF8A 4LQGA 4F0YA 5H84A 3DSBA 4PSWA 3K9UA 2PCUA 1BO4A 2ZEOA 2GREA 4AB7A 4B14A 4FWUA 3FRMA 4IHMA 2Q7SA 2Z0ZA 2RC4A 4JZ0A 4P10A 3IIBA 2P0WA 3D7FA 1Y0RA 3KZWA 1VGYA 2J8MA 2Z3LA 4EMEA 3LMSA 3FECA 2PJ1A 2V77A 4P45A 4C2XA 4EVYA 5F47A 1R57A 3CXQA 2ZW7A 3I1UA 4NGTA 3QNVA 4KUAA 4BMHA 4CYPA 4RS2A 2FT0A 4FAIA 4ZY1A 1Y7EA 3DGVA 2RB7A 1IY7A 4JYWA 4KVXA 1JQGA 2FXFA 3P2FA 2OZGA 3PBEA 3IGRA 4C2ZA 2Z3KA 3JRUA 5LRJA 4JD6A 5AGEA 1S3ZA 4A39A 3IWWA 4I49A 2NYQA 4B10A 1YSJA 3T9YA 5KTCA 4P4DA 5F46A 3PEIA 4DNCA 4EFDA 3D8PA 1CPXA 2QIRA 3S6FA 4JJXA 2HV2A 2CY2A 3KASA 3D7HA 2G3TA 2PJCA 2G9DA 3IFEA 4KOUA 4NCZA 4OLLA 1NSLA 4EWTA 1TF9A 3JVNA 3WC5A 3V8IA 1ZO0A 3TO7A 4C7IA 2CXAA 2ZEEA 2J8NA 1Z8LA 1U6MA 2OZHA 1L0CA 3S6HA 4B13A 1CG2A 4X5KA 2WYRA 5A28A 4RI1A 3EFAA 1IYLA 2ZEGA 3RYOA 3ZJ0A 2O4HA 2XEJA 3K9TA 4CAFA 2PJ9A 1S5KA 2OH1A 1XOVA 2JBKA 2VEZA 3DLJA 3KKWA 4PSXA 5HH1A 3VATA 3FJUA 2D4PA 2R8VA 2WUUA 4B6ZA 5K8PA 3SXNA 3WR7A 2PVWA 1NMTA 3FNCA 4B11A 5I4MA 1YQEA 2P6GA 4FD5A 2P6EA 3G8WA 3PB8X 4HNYB 3IWGA 4E8OA 3B3CA 1TKHA 4LUAA 4U9YA 1OBRA 1X12A 2PSWA 5E96A 1CJWA 1S7KA 3FMCA 4R76A 2GLFA 4AG9A 4MHZA 2REFA 2YNEA 1Y0YA 1YVOA 3EY5A 5CNPA 1Q2YA 2JEWA 4UCNA 4AXVA 4CYOA 1QQ9A 3B8GA 4KOYA 3R9EA 3CPXA 3TO9A 3T90A 2ZOGA 4CGPA 4KSAA 1HEEA 2DPTA 5D8NA 2KCWA 4CYQA 4E0AA 5LYIA 4M3SA 5ISVA 2P6FA 4ORFA 4P44A 4MY0A 4A31A 3JTKA 3ISZA 1ZG7A 1IU8A 5J1QA 1QSMA 4IK2A 1S7NA 4UWJA 4MHDA 2WPXA 3EO4A 3FVLA 3WC7A 6CPAA 2EVNA 2JDDA 4P6YA 3GIUA 5K8NA 4QVTA 4UIBA 3PFEA 1M4IA 4MCSA 2ABZA 4A38A 5HVGA 1H8LA 2WZNA 3MGDA 4NGPA 4NGQA 2CIJA 3G3SA 5LYDA 1YMEA 3DR8A 3W6XA 5AG5A 1YGHA 2GANA 1Q7LA 3D2PA 2R7HA 1LOKA 2AFUA 2DPSA 2ZEHA 3IU1A 4A30A 3V7ZA 2QVPA 4P4FA 2VL1A 2NSMA 2Q7BA 3D7GA 3I3GA 4CRZB 2BUEA 3S9MA 1BPMA 3NH5A 4JXRA 2ZOFA 4ZGYB 3D2MA 2PJAA 4KOSA 2B4BA 1SQHA 3WC6A 3IEHA 4GXHA 4H2KA 1DTDA 4QBJA 2Z3PA 5KTDA 4MMOA 2HC9A 1QSTA 4C68A 3H8FA 4MXUA 4NFRA 1WWZA 4R87A 1CP7A 4UIAA 5CBMA 2B58A 2V8VA 2QMLA 1AMPA 4UFWA 3B3WA 4JWPA 3F5BA 3CPAA 2EWBA 1XFOA 2CTCA 3VH9A 2JEVA 2YNDA 4OC1A 3SXOA 3V38A 3QB8A 1VIXA 4AVCA 2B3VA 2PJ0A 2C27A 2ZEPA 4HKFA 4NXYA 4R57A 4ZY0A 4QB9A 2CNMA 2ZW6A 4KOVA 5HVHA 4NSQA 2FVGA 1IIDA 3SI1A 1LANA 5AG7A 3N5FA 4F0XA 2GIVA 1KUXA 2Z3MA 5H86A 4X2TA 2PJBA 2F7VA 1B6BA 3T8WA 2QECA 3FYNA 3R1KA 1TF8A 2GLJA 2QYVA 2ZXVA 4R9MA 4II9A 3B7IA 4Y49C 3SI0A 2EUIA 4MY3A 4H6UA 1AYEA 2C6PA 3NH8A 5EBVA 2EBJA 2AJ6A 2VZZA 1FNOA 1LCPA 2WPWA 4YRHA 5JM6A 2Q4VA 4XNHC 3RNZA 4C7HA 4CRYB 5K8MA 2AFZA 2OR4A 4OKOA 4A32A 1Z8TA 2OOTA 4W9YA 4NEXA 2C6GA 3SJEA 3OWCA 1S60A 1TXRA 2FL4A 4A37A 2JDCA 4ZBGA 1ELMP 3I9SA 4E2AA 3R9GA 2F5IA 2J9AA 4NF1A 4TNUA 1BLLE 1F57A 4LX9A 2FIWA 4M6HA 4MCPA 4AVBA 3H5ZA 4OC2A 2I79A 3LACA 3LODA 5DWMA 3KI9A 5HXDA 5JH9A 1QMUA 4YFJA 2PR8A 1RXTA 2FIAA 4IAVA 2AFSA 4OC5A 3IC1A 2AE6A 1YREA 1ZLHA 3KHXA 4R6TA 5DWNA 3IU2A 3QAYA 3D66A 3PGPA 5G22A 3B35A 3TX8A 2EO8A 2ZPAA 1CM0A 1FY7A 3GKRA 4TWEA 3RO0A 3B3VA 3L2NA 4B5OA 4MHYA 1I1DA 2PJ7A 3FXTA 4PK3A 4BD9A 4Y49B 4X8IA 5A27A 3MRUA 5HVFA 5JGFA 2EK9A 3QAHA 3NFZA 4ZY2A 3KQZA 1Z9UA 3P2HA 2VI7A 2NMTA 4WWVA 1P0HA 3BI0A 4Z65A 4ZX9A 2AFXA 2OU2A 3NE8A 2ZW4A 4PXCA 2K5TA 3FH4A 2ODFA 1XRYA 4RUHA 1YLOA 5J8FA 4DJLA 1WK4A 1LRZA 4OC4A 3S6KA 4KSFA 1N71A 3NH4A 4BBHA 1CPSA 3PB4X 2PE3A 2AFMA 4L8AA 1EE3P 3K2KA 3FEEA 4MFKA 2DF5A 1ARMA 3A9LA 2F8HA 2G0BA 3CZXA 3HUVA 2Q43A 2YNCA 5EMIA 4MRIA 1S7FA 3KR5A 5G1ZA 4NJQA 1VHOA 3DR6A 4PXDA 1QSRA 3R96A 2CTBA 3FEDA 3PB6X 2HB6A 1IICA 5IV0A 4CGLA 4H6ZA 1XMTA 3IO1A 3SJFA 1MJAA 4MCQA 2BOAA 2PJ2A 5F09A 5AG6A 4UFXA 2I00A 2YGWA 2G3AA 3TO6A 4F6AA 3CXSA 4ZX8A 3E0KA 3BHXA 1KWMA 1HDUA 3SJXA 2H5MA 1IGBA 4XPDC 2YNCC 1YR0A 1XEBA 1YVKA 2VXKA 4CAXA 5LYFA 5IB0A 3KR4A 2Q04A 4KVOE 2EK8A 3TT2A 2QJ8A 4HPSA 2B3UA 4LQ6A 4J3GA 1UFHA 4P4IA 1ZLIA 3D68A 2ARHA 4ONUA 4PXBA 2OZUA 2AFOA 1AUGA 1S7LA 4HNXB 4OC0A 4UEFA 2JBJA 3CDXA 4NJRA 5CPAA 1ZG8A 1MK4A 3FBUA 4DYOA 4IF5A 2C6CA 2B4DA 2FCKA 1P4NA 4JLYA 4FUUA 1GYTA 2VQYA 2BO9A 2BL1A 4A33A 2O28A 1QSNA 1LAPA 4CAWA 3S6GA 2Z11A 1Z8WA 2Q4YA 3D3SA 2Y0MA 2ZW5A 4PV6A 3TC8A 4PXEA 4CAVA 1VHSA 1IB1E 5HMNA 2CNTA 2ZEFA 5FVJA 4A2ZA 4DUKA 4IUSA 2REEA 5DS0A 4YU9A 3WT4A 4UBRA 1Z4EA 3ZZIA 1VKCA 1Q2DA 1ON0A 3LD2A 2Q0YA 4PK2A 2VBQA 4RN7A 1TIQA 5J8CA 2O53A 4M85A 5JPHA 4NGNA 2Q4ZA 2DXQA 2ATRA 4GS4A 2Z3NA 1XIXA 4H89A 1LFWA 1YW4A 1XJOA 4CPAA 3GB0A 4MFLA 1CX8A 3BJ7A 3RBUA 4ZI6A 4FD7A 3W6SA 4MJ8A 2PJ8A 3H8EA 4A95A 2RFHA 4OC3A 2X7BA 2AFWA 5THWA 8CPAA 1NE9A 5C82A 2GE3A 1UWYA 4UF4A 4C2YA 5I0CA 1KZFA 3SHPA 4K3NA 4MFZA 2DEAA 5LRGA 1A2ZA 2XEIA 4X3RA 1CBXA 4FBEA 3F0AA 1PUAA 1M4LA 1J4JA 1VHEA 1XE4A 1YK3A 3JUWA 4R3KA 4R7MA 3EXNA 2FE7A 4F9VA 4NGRA 1QSOA 3GY9A 4M6IA 2BEIA 1I21A 1PU9A 1F2OA 2IQ6A 2PJ3A 4MHPA 3W91A 2BSWA 2WSAA 1IOFA 4YWYA 1XBUA 3RZAA 3PFOA 2JLMA 2VZYA 4HNWB 4KOWA 3PBBA 1GHEA 4UCMA 3S9LA 1M44A 4BINA 3KQXA 4B12A 4UCPA 2V8GA 1MJBA 2V8DA 3B3TA 2B5GA 2BCOA 1RTQA 2IJZA 1TKFA 3D67A 2R1IA 1Y9KA 5ELYA 4CGMA 1CP6A 2IMOA 2B4DB 1Z2LA 4CYNA 2FSRA 3TCVA 2PC1A 3SJGA 1YX0A 4MI4A 1R3NA 1FT7A 1Z5RA 1B87A 4O23A 3GYAA 4Q36A 3H8GA 4UA3A 3TTHA 3BI1A 3CT9A 5GCNA 4QUSA 3WABA 1TKJA 5LRKA 4AVAA 4KLWA 3KGQA 3MN8A 2PQ8A 5D29A 2I3CA 3PP9A 4MCRA 1RO5A 3DDDA 1PCAA 4JXQA 3FF3A 1F2PA 4U9ZA 5EC4A 3GLJA 1YLEA 1KUYA 1HDQA 2PJ4A 4NGMA 4KS9A 4XNHB 4OIDA 2PJ6A 5AG4A 3FX6A 3LWUA 5C88A 2ZENA 1KUVA 3SI2A 2A4NA 3TOBA 2GFQA 4K30A 1V0CA 3PRTA 4MFQA 2XEFA 2ZEMA 2ZEDA 1NSAA 4U5YA 3GUXA 2POKA 1PYTB 3IWEA 1Y9WA 5K8OA 4KLVA 4M6GA 3BJ8A 4UWIA 1ARLA 4Q38A 1Q2CA 4CS0B 3D7DA 4ZYQA 4NGSA 3N7ZA 4B5PA 4UEEA 5BWAB 2PIZA 1IOIA 2PDOA 2J8RA 2R98A 4P4BA 2D4OA 3PB9X 1R43A 2PRBA 4UFVA 2HUZA 1ZG9A 2GU2A 3ISXA 4KORA 4MHNA 4R3LA 2PJ5A 4KUBA 1LAMA 5IX3A 4OADA 3NE7A 3TOAA 2Z3OA 1BAVA 3PB7X 4P4JA 4KOTA 3HLPA 4KVME 4MBUA 2B5GB 1JWQA 4CAEA 4CGNA 1OZPA 2Q44A 2Q51A 2V8HA 3B2YA 3NA6A 4R8FA 3VWDA 4FD4A 1I12A 3IJ3A 4ONWA 3VARA 3FIXA
chains in the Genus database with same CATH topology
4P4EA 4UEZA 4Q7AA 3KHZA 1YW6A 2PIYA 4OP4A 1DE4C 3S9NA 7CPAA 4GM5A 4WJBA 2ANPA 4KSIA 2ZELA 3KL9A 4F8ZA 4OIWA 3B3SA 4A94A 1ELLP 4G1PA 4PQAA 4PPZA 2CF4A 2PVVA 4F9UA 2XEGA 2C1CA 5LYLA 1XMBA 3RAMA 4OMEA 3D4UA 3BXMA 2PRQA 1BPNA 5IB9A 4LQGA 2PCUA 2ZEOA 2GREA 4FWUA 4IHMA 4JZ0A 4P10A 3IIBA 3D7FA 1Y0RA 3KZWA 1VGYA 4EMEA 3LMSA 3FECA 2PJ1A 2V77A 4P45A 3I1UA 4NGTA 3QNVA 4FAIA 4ZY1A 1Y7EA 3DGVA 2RB7A 1IY7A 4JYWA 1JQGA 3PBEA 3JRUA 5LRJA 4A39A 3IWWA 2NYQA 1YSJA 4P4DA 3PEIA 4EFDA 1CPXA 3KASA 3D7HA 2PJCA 2G9DA 3IFEA 4EWTA 1TF9A 3WC5A 2ZEEA 1Z8LA 1CG2A 2WYRA 2ZEGA 2O4HA 2XEJA 3K9TA 2PJ9A 3DLJA 2JBKA 3VATA 3FJUA 4B6ZA 5K8PA 2PVWA 5I4MA 3PB8X 3B3CA 1TKHA 1OBRA 3FMCA 4R76A 2GLFA 4MHZA 1Y0YA 4AXVA 2JEWA 1QQ9A 3CPXA 2ZOGA 1HEEA 5D8NA 5LYIA 4P44A 3ISZA 1ZG7A 5J1QA 4IK2A 3WC7A 3FVLA 6CPAA 4P6YA 5K8NA 4UIBA 5HVGA 3PFEA 4MCSA 2ABZA 4A38A 1H8LA 2WZNA 4NGPA 4NGQA 2CIJA 5LYDA 1YMEA 1Q7LA 1LOKA 2AFUA 2ZEHA 3V7ZA 2QVPA 4P4FA 2VL1A 2NSMA 3D7GA 3S9MA 1BPMA 3NH5A 2ZOFA 2PJAA 3WC6A 3IEHA 4H2KA 1DTDA 4MMOA 2HC9A 3H8FA 4MXUA 4NFRA 1CP7A 4UIAA 5CBMA 2V8VA 1AMPA 3B3WA 3CPAA 2EWBA 1XFOA 2CTCA 3VH9A 4OC1A 3V38A 1VIXA 2PJ0A 2ZEPA 4ZY0A 5HVHA 2FVGA 3SI1A 1LANA 3N5FA 4X2TA 2PJBA 2F7VA 3T8WA 1TF8A 2GLJA 2QYVA 3B7IA 3SI0A 1AYEA 2C6PA 3NH8A 1FNOA 1LCPA 5JM6A 5K8MA 2AFZA 2OR4A 4OKOA 2OOTA 4W9YA 2C6GA 3SJEA 1TXRA 4A37A 1ELMP 2J9AA 4TNUA 1BLLE 1F57A 4MCPA 4OC2A 3KI9A 5HXDA 5JH9A 1QMUA 4IAVA 2AFSA 4OC5A 3IC1A 4R6TA 1ZLHA 3KHXA 3D66A 3B35A 3TX8A 4TWEA 3B3VA 3L2NA 4MHYA 2PJ7A 4BD9A 4X8IA 3MRUA 5HVFA 5JGFA 2EK9A 3NFZA 4ZY2A 3KQZA 4WWVA 3BI0A 4Z65A 4ZX9A 2AFXA 4PXCA 3FH4A 1XRYA 4RUHA 1YLOA 4DJLA 4OC4A 3NH4A 3PB4X 1CPSA 2PE3A 2AFMA 1EE3P 3K2KA 3FEEA 1ARMA 2F8HA 3HUVA 2Q43A 4MRIA 3KR5A 4NJQA 1VHOA 4PXDA 2CTBA 3FEDA 3PB6X 2HB6A 3IO1A 3SJFA 4MCQA 2BOAA 2PJ2A 5F09A 4ZX8A 3BHXA 1KWMA 1HDUA 3SJXA 1IGBA 5LYFA 3KR4A 2EK8A 2QJ8A 4P4IA 1ZLIA 3D68A 4PXBA 2AFOA 4OC0A 4UEFA 4NJRA 2JBJA 3CDXA 5CPAA 1ZG8A 4DYOA 2C6CA 4FUUA 1GYTA 2BO9A 1LAPA 3TC8A 4PXEA 2ZEFA 4DUKA 5DS0A 4YU9A 3WT4A 2O53A 4NGNA 2Q4ZA 4CPAA 1LFWA 1YW4A 1XJOA 3GB0A 1CX8A 3RBUA 4ZI6A 2PJ8A 3H8EA 2RFHA 4OC3A 5THWA 2AFWA 8CPAA 1UWYA 4UF4A 4K3NA 2DEAA 5LRGA 2XEIA 4X3RA 1CBXA 4FBEA 4R7MA 1M4LA 1VHEA 4F9VA 4NGRA 1F2OA 2IQ6A 2PJ3A 4MHPA 4YWYA 1XBUA 3RZAA 3PFOA 3PBBA 3S9LA 3KQXA 2V8GA 3B3TA 2V8DA 2BCOA 1RTQA 2IJZA 1TKFA 3D67A 5ELYA 1CP6A 2IMOA 1Z2LA 3SJGA 1R3NA 1FT7A 1Z5RA 4O23A 3H8GA 3BI1A 3CT9A 3WABA 1TKJA 5LRKA 3KGQA 3MN8A 5D29A 2I3CA 4MCRA 1PCAA 3FF3A 1F2PA 3GLJA 1HDQA 2PJ4A 4NGMA 4OIDA 2PJ6A 3FX6A 3LWUA 2ZENA 3SI2A 3PRTA 2XEFA 2ZEMA 2ZEDA 1NSAA 3GUXA 2POKA 1PYTB 5K8OA 1ARLA 3D7DA 4ZYQA 4NGSA 4UEEA 2PIZA 4P4BA 3PB9X 1R43A 1ZG9A 2GU2A 3ISXA 4MHNA 2PJ5A 1LAMA 1BAVA 3PB7X 4P4JA 3HLPA 2Q51A 3B2YA 2V8HA 3NA6A 4R8FA 4ONWA 3IJ3A 3VARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4E A;  4UEZ A;  4Q7A A;  3KHZ A;  1YW6 A;  2PIY A;  4OP4 A;  1DE4 C;  3S9N A;  7CPA A;  4GM5 A;  4WJB A;  2ANP A;  4KSI A;  2ZEL A;  3KL9 A;  4F8Z A;  4OIW A;  3B3S A;  4A94 A;  1ELL P;  4G1P A;  4PQA A;  4PPZ A;  2CF4 A;  2PVV A;  4F9U A;  2XEG A;  2C1C A;  5LYL A;  1XMB A;  3RAM A;  4OME A;  3D4U A;  3BXM A;  2PRQ A;  1BPN A;  5IB9 A;  4LQG A;  2PCU A;  2ZEO A;  2GRE A;  4FWU A;  4IHM A;  4JZ0 A;  4P10 A;  3IIB A;  3D7F A;  1Y0R A;  3KZW A;  1VGY A;  4EME A;  3LMS A;  3FEC A;  2PJ1 A;  2V77 A;  4P45 A;  3I1U A;  4NGT A;  3QNV A;  4FAI A;  4ZY1 A;  1Y7E A;  3DGV A;  2RB7 A;  1IY7 A;  4JYW A;  1JQG A;  3PBE A;  3JRU A;  5LRJ A;  4A39 A;  3IWW A;  2NYQ A;  1YSJ A;  4P4D A;  3PEI A;  4EFD A;  1CPX A;  3KAS A;  3D7H A;  2PJC A;  2G9D A;  3IFE A;  4EWT A;  1TF9 A;  3WC5 A;  2ZEE A;  1Z8L A;  1CG2 A;  2WYR A;  2ZEG A;  2O4H A;  2XEJ A;  3K9T A;  2PJ9 A;  3DLJ A;  2JBK A;  3VAT A;  3FJU A;  4B6Z A;  5K8P A;  2PVW A;  5I4M A;  3PB8 X;  3B3C A;  1TKH A;  1OBR A;  3FMC A;  4R76 A;  2GLF A;  4MHZ A;  1Y0Y A;  4AXV A;  2JEW A;  1QQ9 A;  3CPX A;  2ZOG A;  1HEE A;  5D8N A;  5LYI A;  4P44 A;  3ISZ A;  1ZG7 A;  5J1Q A;  4IK2 A;  3WC7 A;  3FVL A;  6CPA A;  4P6Y A;  5K8N A;  4UIB A;  5HVG A;  3PFE A;  4MCS A;  2ABZ A;  4A38 A;  1H8L A;  2WZN A;  4NGP A;  4NGQ A;  2CIJ A;  5LYD A;  1YME A;  1Q7L A;  1LOK A;  2AFU A;  2ZEH A;  3V7Z A;  2QVP A;  4P4F A;  2VL1 A;  2NSM A;  3D7G A;  3S9M A;  1BPM A;  3NH5 A;  2ZOF A;  2PJA A;  3WC6 A;  3IEH A;  4H2K A;  1DTD A;  4MMO A;  2HC9 A;  3H8F A;  4MXU A;  4NFR A;  1CP7 A;  4UIA A;  5CBM A;  2V8V A;  1AMP A;  3B3W A;  3CPA A;  2EWB A;  1XFO A;  2CTC A;  3VH9 A;  4OC1 A;  3V38 A;  1VIX A;  2PJ0 A;  2ZEP A;  4ZY0 A;  5HVH A;  2FVG A;  3SI1 A;  1LAN A;  3N5F A;  4X2T A;  2PJB A;  2F7V A;  3T8W A;  1TF8 A;  2GLJ A;  2QYV A;  3B7I A;  3SI0 A;  1AYE A;  2C6P A;  3NH8 A;  1FNO A;  1LCP A;  5JM6 A;  5K8M A;  2AFZ A;  2OR4 A;  4OKO A;  2OOT A;  4W9Y A;  2C6G A;  3SJE A;  1TXR A;  4A37 A;  1ELM P;  2J9A A;  4TNU A;  1BLL E;  1F57 A;  4MCP A;  4OC2 A;  3KI9 A;  5HXD A;  5JH9 A;  1QMU A;  4IAV A;  2AFS A;  4OC5 A;  3IC1 A;  4R6T A;  1ZLH A;  3KHX A;  3D66 A;  3B35 A;  3TX8 A;  4TWE A;  3B3V A;  3L2N A;  4MHY A;  2PJ7 A;  4BD9 A;  4X8I A;  3MRU A;  5HVF A;  5JGF A;  2EK9 A;  3NFZ A;  4ZY2 A;  3KQZ A;  4WWV A;  3BI0 A;  4Z65 A;  4ZX9 A;  2AFX A;  4PXC A;  3FH4 A;  1XRY A;  4RUH A;  1YLO A;  4DJL A;  4OC4 A;  3NH4 A;  3PB4 X;  1CPS A;  2PE3 A;  2AFM A;  1EE3 P;  3K2K A;  3FEE A;  1ARM A;  2F8H A;  3HUV A;  2Q43 A;  4MRI A;  3KR5 A;  4NJQ A;  1VHO A;  4PXD A;  2CTB A;  3FED A;  3PB6 X;  2HB6 A;  3IO1 A;  3SJF A;  4MCQ A;  2BOA A;  2PJ2 A;  5F09 A;  4ZX8 A;  3BHX A;  1KWM A;  1HDU A;  3SJX A;  1IGB A;  5LYF A;  3KR4 A;  2EK8 A;  2QJ8 A;  4P4I A;  1ZLI A;  3D68 A;  4PXB A;  2AFO A;  4OC0 A;  4UEF A;  4NJR A;  2JBJ A;  3CDX A;  5CPA A;  1ZG8 A;  4DYO A;  2C6C A;  4FUU A;  1GYT A;  2BO9 A;  1LAP A;  3TC8 A;  4PXE A;  2ZEF A;  4DUK A;  5DS0 A;  4YU9 A;  3WT4 A;  2O53 A;  4NGN A;  2Q4Z A;  4CPA A;  1LFW A;  1YW4 A;  1XJO A;  3GB0 A;  1CX8 A;  3RBU A;  4ZI6 A;  2PJ8 A;  3H8E A;  2RFH A;  4OC3 A;  5THW A;  2AFW A;  8CPA A;  1UWY A;  4UF4 A;  4K3N A;  2DEA A;  5LRG A;  2XEI A;  4X3R A;  1CBX A;  4FBE A;  4R7M A;  1M4L A;  1VHE A;  4F9V A;  4NGR A;  1F2O A;  2IQ6 A;  2PJ3 A;  4MHP A;  4YWY A;  1XBU A;  3RZA A;  3PFO A;  3PBB A;  3S9L A;  3KQX A;  2V8G A;  3B3T A;  2V8D A;  2BCO A;  1RTQ A;  2IJZ A;  1TKF A;  3D67 A;  5ELY A;  1CP6 A;  2IMO A;  1Z2L A;  3SJG A;  1R3N A;  1FT7 A;  1Z5R A;  4O23 A;  3H8G A;  3BI1 A;  3CT9 A;  3WAB A;  1TKJ A;  5LRK A;  3KGQ A;  3MN8 A;  5D29 A;  2I3C A;  4MCR A;  1PCA A;  3FF3 A;  1F2P A;  3GLJ A;  1HDQ A;  2PJ4 A;  4NGM A;  4OID A;  2PJ6 A;  3FX6 A;  3LWU A;  2ZEN A;  3SI2 A;  3PRT A;  2XEF A;  2ZEM A;  2ZED A;  1NSA A;  3GUX A;  2POK A;  1PYT B;  5K8O A;  1ARL A;  3D7D A;  4ZYQ A;  4NGS A;  4UEE A;  2PIZ A;  4P4B A;  3PB9 X;  1R43 A;  1ZG9 A;  2GU2 A;  3ISX A;  4MHN A;  2PJ5 A;  1LAM A;  1BAV A;  3PB7 X;  4P4J A;  3HLP A;  2Q51 A;  3B2Y A;  2V8H A;  3NA6 A;  4R8F A;  4ONW A;  3IJ3 A;  3VAR A; 
#chains in the Genus database with same CATH topology
 5KTA A;  1M4G A;  4P4E A;  4UEZ A;  4Q7A A;  5JQ4 A;  3PZJ A;  4YGO A;  4AG7 A;  2FS5 A;  2HQY A;  3KHZ A;  1YW6 A;  2PIY A;  3VWE A;  4FD6 A;  3DNS A;  4OP4 A;  1Z8X A;  1BOB A;  3FB3 A;  1DE4 C;  4KOX A;  4XPK A;  1Y7R A;  3R95 A;  3S9N A;  7CPA A;  4GM5 A;  1IYK A;  2OB0 A;  4WJB A;  3TFY A;  2ANP A;  4MFP A;  3UY5 A;  1M1D A;  2Z10 A;  4KSI A;  2ZEL A;  4L89 A;  4OAE A;  3C26 A;  5F48 A;  3KL9 A;  4F8Z A;  3R9F A;  1X10 A;  3H4Q A;  4OIW A;  3EC4 A;  4MFJ A;  2IL4 A;  3B3S A;  3TE4 A;  4A94 A;  1ELL P;  4G1P A;  4PQA A;  4CGO A;  4XPD B;  3F8K A;  4KZT A;  2PR1 A;  2CF4 A;  2PVV A;  4PPZ A;  4F9U A;  2XEG A;  4B5P B;  2C1C A;  5G21 A;  5F49 A;  5LYL A;  2CNS A;  1XMB A;  3RAM A;  4OME A;  1MJ9 A;  5G20 A;  4QC6 A;  1K4J A;  1Z4R A;  3D4U A;  3BXM A;  1M4D A;  4XPL A;  2PRQ A;  3CXP A;  1BPN A;  3BLN A;  5IB9 A;  1XF8 A;  4LQG A;  4F0Y A;  5H84 A;  3DSB A;  4PSW A;  3K9U A;  2PCU A;  1BO4 A;  2ZEO A;  2GRE A;  4AB7 A;  4B14 A;  4FWU A;  3FRM A;  4IHM A;  2Q7S A;  2Z0Z A;  2RC4 A;  4JZ0 A;  4P10 A;  3IIB A;  2P0W A;  3D7F A;  1Y0R A;  3KZW A;  1VGY A;  2J8M A;  2Z3L A;  4EME A;  3LMS A;  3FEC A;  2PJ1 A;  2V77 A;  4P45 A;  4C2X A;  4EVY A;  5F47 A;  1R57 A;  3CXQ A;  2ZW7 A;  3I1U A;  4NGT A;  3QNV A;  4KUA A;  4BMH A;  4CYP A;  4RS2 A;  2FT0 A;  4FAI A;  4ZY1 A;  1Y7E A;  3DGV A;  2RB7 A;  1IY7 A;  4JYW A;  4KVX A;  1JQG A;  2FXF A;  3P2F A;  2OZG A;  3PBE A;  3IGR A;  4C2Z A;  2Z3K A;  3JRU A;  5LRJ A;  4JD6 A;  5AGE A;  1S3Z A;  4A39 A;  3IWW A;  4I49 A;  2NYQ A;  4B10 A;  1YSJ A;  3T9Y A;  5KTC A;  4P4D A;  5F46 A;  3PEI A;  4DNC A;  4EFD A;  3D8P A;  1CPX A;  2QIR A;  3S6F A;  4JJX A;  2HV2 A;  2CY2 A;  3KAS A;  3D7H A;  2G3T A;  2PJC A;  2G9D A;  3IFE A;  4KOU A;  4NCZ A;  4OLL A;  1NSL A;  4EWT A;  1TF9 A;  3JVN A;  3WC5 A;  3V8I A;  1ZO0 A;  3TO7 A;  4C7I A;  2CXA A;  2ZEE A;  2J8N A;  1Z8L A;  1U6M A;  2OZH A;  1L0C A;  3S6H A;  4B13 A;  1CG2 A;  4X5K A;  2WYR A;  5A28 A;  4RI1 A;  3EFA A;  1IYL A;  2ZEG A;  3RYO A;  3ZJ0 A;  2O4H A;  2XEJ A;  3K9T A;  4CAF A;  2PJ9 A;  1S5K A;  2OH1 A;  1XOV A;  2JBK A;  2VEZ A;  3DLJ A;  3KKW A;  4PSX A;  5HH1 A;  3VAT A;  3FJU A;  2D4P A;  2R8V A;  2WUU A;  4B6Z A;  5K8P A;  3SXN A;  3WR7 A;  2PVW A;  1NMT A;  3FNC A;  4B11 A;  5I4M A;  1YQE A;  2P6G A;  4FD5 A;  2P6E A;  3G8W A;  3PB8 X;  4HNY B;  3IWG A;  4E8O A;  3B3C A;  1TKH A;  4LUA A;  4U9Y A;  1OBR A;  1X12 A;  2PSW A;  5E96 A;  1CJW A;  1S7K A;  3FMC A;  4R76 A;  2GLF A;  4AG9 A;  4MHZ A;  2REF A;  2YNE A;  1Y0Y A;  1YVO A;  3EY5 A;  5CNP A;  1Q2Y A;  2JEW A;  4UCN A;  4AXV A;  4CYO A;  1QQ9 A;  3B8G A;  4KOY A;  3R9E A;  3CPX A;  3TO9 A;  3T90 A;  2ZOG A;  4CGP A;  4KSA A;  1HEE A;  2DPT A;  5D8N A;  2KCW A;  4CYQ A;  4E0A A;  5LYI A;  4M3S A;  5ISV A;  2P6F A;  4ORF A;  4P44 A;  4MY0 A;  4A31 A;  3JTK A;  3ISZ A;  1ZG7 A;  1IU8 A;  5J1Q A;  1QSM A;  4IK2 A;  1S7N A;  4UWJ A;  4MHD A;  2WPX A;  3EO4 A;  3FVL A;  3WC7 A;  6CPA A;  2EVN A;  2JDD A;  4P6Y A;  3GIU A;  5K8N A;  4QVT A;  4UIB A;  3PFE A;  1M4I A;  4MCS A;  2ABZ A;  4A38 A;  5HVG A;  1H8L A;  2WZN A;  3MGD A;  4NGP A;  4NGQ A;  2CIJ A;  3G3S A;  5LYD A;  1YME A;  3DR8 A;  3W6X A;  5AG5 A;  1YGH A;  2GAN A;  1Q7L A;  3D2P A;  2R7H A;  1LOK A;  2AFU A;  2DPS A;  2ZEH A;  3IU1 A;  4A30 A;  3V7Z A;  2QVP A;  4P4F A;  2VL1 A;  2NSM A;  2Q7B A;  3D7G A;  3I3G A;  4CRZ B;  2BUE A;  3S9M A;  1BPM A;  3NH5 A;  4JXR A;  2ZOF A;  4ZGY B;  3D2M A;  2PJA A;  4KOS A;  2B4B A;  1SQH A;  3WC6 A;  3IEH A;  4GXH A;  4H2K A;  1DTD A;  4QBJ A;  2Z3P A;  5KTD A;  4MMO A;  2HC9 A;  1QST A;  4C68 A;  3H8F A;  4MXU A;  4NFR A;  1WWZ A;  4R87 A;  1CP7 A;  4UIA A;  5CBM A;  2B58 A;  2V8V A;  2QML A;  1AMP A;  4UFW A;  3B3W A;  4JWP A;  3F5B A;  3CPA A;  2EWB A;  1XFO A;  2CTC A;  3VH9 A;  2JEV A;  2YND A;  4OC1 A;  3SXO A;  3V38 A;  3QB8 A;  1VIX A;  4AVC A;  2B3V A;  2PJ0 A;  2C27 A;  2ZEP A;  4HKF A;  4NXY A;  4R57 A;  4ZY0 A;  4QB9 A;  2CNM A;  2ZW6 A;  4KOV A;  5HVH A;  4NSQ A;  2FVG A;  1IID A;  3SI1 A;  1LAN A;  5AG7 A;  3N5F A;  4F0X A;  2GIV A;  1KUX A;  2Z3M A;  5H86 A;  4X2T A;  2PJB A;  2F7V A;  1B6B A;  3T8W A;  2QEC A;  3FYN A;  3R1K A;  1TF8 A;  2GLJ A;  2QYV A;  2ZXV A;  4R9M A;  4II9 A;  3B7I A;  4Y49 C;  3SI0 A;  2EUI A;  4MY3 A;  4H6U A;  1AYE A;  2C6P A;  3NH8 A;  5EBV A;  2EBJ A;  2AJ6 A;  2VZZ A;  1FNO A;  1LCP A;  2WPW A;  4YRH A;  5JM6 A;  2Q4V A;  4XNH C;  3RNZ A;  4C7H A;  4CRY B;  5K8M A;  2AFZ A;  2OR4 A;  4OKO A;  4A32 A;  1Z8T A;  2OOT A;  4W9Y A;  4NEX A;  2C6G A;  3SJE A;  3OWC A;  1S60 A;  1TXR A;  2FL4 A;  4A37 A;  2JDC A;  4ZBG A;  1ELM P;  3I9S A;  4E2A A;  3R9G A;  2F5I A;  2J9A A;  4NF1 A;  4TNU A;  1BLL E;  1F57 A;  4LX9 A;  2FIW A;  4M6H A;  4MCP A;  4AVB A;  3H5Z A;  4OC2 A;  2I79 A;  3LAC A;  3LOD A;  5DWM A;  3KI9 A;  5HXD A;  5JH9 A;  1QMU A;  4YFJ A;  2PR8 A;  1RXT A;  2FIA A;  4IAV A;  2AFS A;  4OC5 A;  3IC1 A;  2AE6 A;  1YRE A;  1ZLH A;  3KHX A;  4R6T A;  5DWN A;  3IU2 A;  3QAY A;  3D66 A;  3PGP A;  5G22 A;  3B35 A;  3TX8 A;  2EO8 A;  2ZPA A;  1CM0 A;  1FY7 A;  3GKR A;  4TWE A;  3RO0 A;  3B3V A;  3L2N A;  4B5O A;  4MHY A;  1I1D A;  2PJ7 A;  3FXT A;  4PK3 A;  4BD9 A;  4Y49 B;  4X8I A;  5A27 A;  3MRU A;  5HVF A;  5JGF A;  2EK9 A;  3QAH A;  3NFZ A;  4ZY2 A;  3KQZ A;  1Z9U A;  3P2H A;  2VI7 A;  2NMT A;  4WWV A;  1P0H A;  3BI0 A;  4Z65 A;  4ZX9 A;  2AFX A;  2OU2 A;  3NE8 A;  2ZW4 A;  4PXC A;  2K5T A;  3FH4 A;  2ODF A;  1XRY A;  4RUH A;  1YLO A;  5J8F A;  4DJL A;  1WK4 A;  1LRZ A;  4OC4 A;  3S6K A;  4KSF A;  1N71 A;  3NH4 A;  4BBH A;  1CPS A;  3PB4 X;  2PE3 A;  2AFM A;  4L8A A;  1EE3 P;  3K2K A;  3FEE A;  4MFK A;  2DF5 A;  1ARM A;  3A9L A;  2F8H A;  2G0B A;  3CZX A;  3HUV A;  2Q43 A;  2YNC A;  5EMI A;  4MRI A;  1S7F A;  3KR5 A;  5G1Z A;  4NJQ A;  1VHO A;  3DR6 A;  4PXD A;  1QSR A;  3R96 A;  2CTB A;  3FED A;  3PB6 X;  2HB6 A;  1IIC A;  5IV0 A;  4CGL A;  4H6Z A;  1XMT A;  3IO1 A;  3SJF A;  1MJA A;  4MCQ A;  2BOA A;  2PJ2 A;  5F09 A;  5AG6 A;  4UFX A;  2I00 A;  2YGW A;  2G3A A;  3TO6 A;  4F6A A;  3CXS A;  4ZX8 A;  3E0K A;  3BHX A;  1KWM A;  1HDU A;  3SJX A;  2H5M A;  1IGB A;  4XPD C;  2YNC C;  1YR0 A;  1XEB A;  1YVK A;  2VXK A;  4CAX A;  5LYF A;  5IB0 A;  3KR4 A;  2Q04 A;  4KVO E;  2EK8 A;  3TT2 A;  2QJ8 A;  4HPS A;  2B3U A;  4LQ6 A;  4J3G A;  1UFH A;  4P4I A;  1ZLI A;  3D68 A;  2ARH A;  4ONU A;  4PXB A;  2OZU A;  2AFO A;  1AUG A;  1S7L A;  4HNX B;  4OC0 A;  4UEF A;  2JBJ A;  3CDX A;  4NJR A;  5CPA A;  1ZG8 A;  1MK4 A;  3FBU A;  4DYO A;  4IF5 A;  2C6C A;  2B4D A;  2FCK A;  1P4N A;  4JLY A;  4FUU A;  1GYT A;  2VQY A;  2BO9 A;  2BL1 A;  4A33 A;  2O28 A;  1QSN A;  1LAP A;  4CAW A;  3S6G A;  2Z11 A;  1Z8W A;  2Q4Y A;  3D3S A;  2Y0M A;  2ZW5 A;  4PV6 A;  3TC8 A;  4PXE A;  4CAV A;  1VHS A;  1IB1 E;  5HMN A;  2CNT A;  2ZEF A;  5FVJ A;  4A2Z A;  4DUK A;  4IUS A;  2REE A;  5DS0 A;  4YU9 A;  3WT4 A;  4UBR A;  1Z4E A;  3ZZI A;  1VKC A;  1Q2D A;  1ON0 A;  3LD2 A;  2Q0Y A;  4PK2 A;  2VBQ A;  4RN7 A;  1TIQ A;  5J8C A;  2O53 A;  4M85 A;  5JPH A;  4NGN A;  2Q4Z A;  2DXQ A;  2ATR A;  4GS4 A;  2Z3N A;  1XIX A;  4H89 A;  1LFW A;  1YW4 A;  1XJO A;  4CPA A;  3GB0 A;  4MFL A;  1CX8 A;  3BJ7 A;  3RBU A;  4ZI6 A;  4FD7 A;  3W6S A;  4MJ8 A;  2PJ8 A;  3H8E A;  4A95 A;  2RFH A;  4OC3 A;  2X7B A;  2AFW A;  5THW A;  8CPA A;  1NE9 A;  5C82 A;  2GE3 A;  1UWY A;  4UF4 A;  4C2Y A;  5I0C A;  1KZF A;  3SHP A;  4K3N A;  4MFZ A;  2DEA A;  5LRG A;  1A2Z A;  2XEI A;  4X3R A;  1CBX A;  4FBE A;  3F0A A;  1PUA A;  1M4L A;  1J4J A;  1VHE A;  1XE4 A;  1YK3 A;  3JUW A;  4R3K A;  4R7M A;  3EXN A;  2FE7 A;  4F9V A;  4NGR A;  1QSO A;  3GY9 A;  4M6I A;  2BEI A;  1I21 A;  1PU9 A;  1F2O A;  2IQ6 A;  2PJ3 A;  4MHP A;  3W91 A;  2BSW A;  2WSA A;  1IOF A;  4YWY A;  1XBU A;  3RZA A;  3PFO A;  2JLM A;  2VZY A;  4HNW B;  4KOW A;  3PBB A;  1GHE A;  4UCM A;  3S9L A;  1M44 A;  4BIN A;  3KQX A;  4B12 A;  4UCP A;  2V8G A;  1MJB A;  2V8D A;  3B3T A;  2B5G A;  2BCO A;  1RTQ A;  2IJZ A;  1TKF A;  3D67 A;  2R1I A;  1Y9K A;  5ELY A;  4CGM A;  1CP6 A;  2IMO A;  2B4D B;  1Z2L A;  4CYN A;  2FSR A;  3TCV A;  2PC1 A;  3SJG A;  1YX0 A;  4MI4 A;  1R3N A;  1FT7 A;  1Z5R A;  1B87 A;  4O23 A;  3GYA A;  4Q36 A;  3H8G A;  4UA3 A;  3TTH A;  3BI1 A;  3CT9 A;  5GCN A;  4QUS A;  3WAB A;  1TKJ A;  5LRK A;  4AVA A;  4KLW A;  3KGQ A;  3MN8 A;  2PQ8 A;  5D29 A;  2I3C A;  3PP9 A;  4MCR A;  1RO5 A;  3DDD A;  1PCA A;  4JXQ A;  3FF3 A;  1F2P A;  4U9Z A;  5EC4 A;  3GLJ A;  1YLE A;  1KUY A;  1HDQ A;  2PJ4 A;  4NGM A;  4KS9 A;  4XNH B;  4OID A;  2PJ6 A;  5AG4 A;  3FX6 A;  3LWU A;  5C88 A;  2ZEN A;  1KUV A;  3SI2 A;  2A4N A;  3TOB A;  2GFQ A;  4K30 A;  1V0C A;  3PRT A;  4MFQ A;  2XEF A;  2ZEM A;  2ZED A;  1NSA A;  4U5Y A;  3GUX A;  2POK A;  1PYT B;  3IWE A;  1Y9W A;  5K8O A;  4KLV A;  4M6G A;  3BJ8 A;  4UWI A;  1ARL A;  4Q38 A;  1Q2C A;  4CS0 B;  3D7D A;  4ZYQ A;  4NGS A;  3N7Z A;  4B5P A;  4UEE A;  5BWA B;  2PIZ A;  1IOI A;  2PDO A;  2J8R A;  2R98 A;  4P4B A;  2D4O A;  3PB9 X;  1R43 A;  2PRB A;  4UFV A;  2HUZ A;  1ZG9 A;  2GU2 A;  3ISX A;  4KOR A;  4MHN A;  4R3L A;  2PJ5 A;  4KUB A;  1LAM A;  5IX3 A;  4OAD A;  3NE7 A;  3TOA A;  2Z3O A;  1BAV A;  3PB7 X;  4P4J A;  4KOT A;  3HLP A;  4KVM E;  4MBU A;  2B5G B;  1JWQ A;  4CAE A;  4CGN A;  1OZP A;  2Q44 A;  2Q51 A;  2V8H A;  3B2Y A;  3NA6 A;  4R8F A;  3VWD A;  4FD4 A;  1I12 A;  3IJ3 A;  4ONW A;  3VAR A;  3FIX A; 
#chains in the Genus database with same CATH homology
 4P4E A;  4UEZ A;  4Q7A A;  3KHZ A;  1YW6 A;  2PIY A;  4OP4 A;  1DE4 C;  3S9N A;  7CPA A;  4GM5 A;  4WJB A;  2ANP A;  4KSI A;  2ZEL A;  3KL9 A;  4F8Z A;  4OIW A;  3B3S A;  4A94 A;  1ELL P;  4G1P A;  4PQA A;  4PPZ A;  2CF4 A;  2PVV A;  4F9U A;  2XEG A;  2C1C A;  5LYL A;  1XMB A;  3RAM A;  4OME A;  3D4U A;  3BXM A;  2PRQ A;  1BPN A;  5IB9 A;  4LQG A;  2PCU A;  2ZEO A;  2GRE A;  4FWU A;  4IHM A;  4JZ0 A;  4P10 A;  3IIB A;  3D7F A;  1Y0R A;  3KZW A;  1VGY A;  4EME A;  3LMS A;  3FEC A;  2PJ1 A;  2V77 A;  4P45 A;  3I1U A;  4NGT A;  3QNV A;  4FAI A;  4ZY1 A;  1Y7E A;  3DGV A;  2RB7 A;  1IY7 A;  4JYW A;  1JQG A;  3PBE A;  3JRU A;  5LRJ A;  4A39 A;  3IWW A;  2NYQ A;  1YSJ A;  4P4D A;  3PEI A;  4EFD A;  1CPX A;  3KAS A;  3D7H A;  2PJC A;  2G9D A;  3IFE A;  4EWT A;  1TF9 A;  3WC5 A;  2ZEE A;  1Z8L A;  1CG2 A;  2WYR A;  2ZEG A;  2O4H A;  2XEJ A;  3K9T A;  2PJ9 A;  3DLJ A;  2JBK A;  3VAT A;  3FJU A;  4B6Z A;  5K8P A;  2PVW A;  5I4M A;  3PB8 X;  3B3C A;  1TKH A;  1OBR A;  3FMC A;  4R76 A;  2GLF A;  4MHZ A;  1Y0Y A;  4AXV A;  2JEW A;  1QQ9 A;  3CPX A;  2ZOG A;  1HEE A;  5D8N A;  5LYI A;  4P44 A;  3ISZ A;  1ZG7 A;  5J1Q A;  4IK2 A;  3WC7 A;  3FVL A;  6CPA A;  4P6Y A;  5K8N A;  4UIB A;  5HVG A;  3PFE A;  4MCS A;  2ABZ A;  4A38 A;  1H8L A;  2WZN A;  4NGP A;  4NGQ A;  2CIJ A;  5LYD A;  1YME A;  1Q7L A;  1LOK A;  2AFU A;  2ZEH A;  3V7Z A;  2QVP A;  4P4F A;  2VL1 A;  2NSM A;  3D7G A;  3S9M A;  1BPM A;  3NH5 A;  2ZOF A;  2PJA A;  3WC6 A;  3IEH A;  4H2K A;  1DTD A;  4MMO A;  2HC9 A;  3H8F A;  4MXU A;  4NFR A;  1CP7 A;  4UIA A;  5CBM A;  2V8V A;  1AMP A;  3B3W A;  3CPA A;  2EWB A;  1XFO A;  2CTC A;  3VH9 A;  4OC1 A;  3V38 A;  1VIX A;  2PJ0 A;  2ZEP A;  4ZY0 A;  5HVH A;  2FVG A;  3SI1 A;  1LAN A;  3N5F A;  4X2T A;  2PJB A;  2F7V A;  3T8W A;  1TF8 A;  2GLJ A;  2QYV A;  3B7I A;  3SI0 A;  1AYE A;  2C6P A;  3NH8 A;  1FNO A;  1LCP A;  5JM6 A;  5K8M A;  2AFZ A;  2OR4 A;  4OKO A;  2OOT A;  4W9Y A;  2C6G A;  3SJE A;  1TXR A;  4A37 A;  1ELM P;  2J9A A;  4TNU A;  1BLL E;  1F57 A;  4MCP A;  4OC2 A;  3KI9 A;  5HXD A;  5JH9 A;  1QMU A;  4IAV A;  2AFS A;  4OC5 A;  3IC1 A;  4R6T A;  1ZLH A;  3KHX A;  3D66 A;  3B35 A;  3TX8 A;  4TWE A;  3B3V A;  3L2N A;  4MHY A;  2PJ7 A;  4BD9 A;  4X8I A;  3MRU A;  5HVF A;  5JGF A;  2EK9 A;  3NFZ A;  4ZY2 A;  3KQZ A;  4WWV A;  3BI0 A;  4Z65 A;  4ZX9 A;  2AFX A;  4PXC A;  3FH4 A;  1XRY A;  4RUH A;  1YLO A;  4DJL A;  4OC4 A;  3NH4 A;  3PB4 X;  1CPS A;  2PE3 A;  2AFM A;  1EE3 P;  3K2K A;  3FEE A;  1ARM A;  2F8H A;  3HUV A;  2Q43 A;  4MRI A;  3KR5 A;  4NJQ A;  1VHO A;  4PXD A;  2CTB A;  3FED A;  3PB6 X;  2HB6 A;  3IO1 A;  3SJF A;  4MCQ A;  2BOA A;  2PJ2 A;  5F09 A;  4ZX8 A;  3BHX A;  1KWM A;  1HDU A;  3SJX A;  1IGB A;  5LYF A;  3KR4 A;  2EK8 A;  2QJ8 A;  4P4I A;  1ZLI A;  3D68 A;  4PXB A;  2AFO A;  4OC0 A;  4UEF A;  4NJR A;  2JBJ A;  3CDX A;  5CPA A;  1ZG8 A;  4DYO A;  2C6C A;  4FUU A;  1GYT A;  2BO9 A;  1LAP A;  3TC8 A;  4PXE A;  2ZEF A;  4DUK A;  5DS0 A;  4YU9 A;  3WT4 A;  2O53 A;  4NGN A;  2Q4Z A;  4CPA A;  1LFW A;  1YW4 A;  1XJO A;  3GB0 A;  1CX8 A;  3RBU A;  4ZI6 A;  2PJ8 A;  3H8E A;  2RFH A;  4OC3 A;  5THW A;  2AFW A;  8CPA A;  1UWY A;  4UF4 A;  4K3N A;  2DEA A;  5LRG A;  2XEI A;  4X3R A;  1CBX A;  4FBE A;  4R7M A;  1M4L A;  1VHE A;  4F9V A;  4NGR A;  1F2O A;  2IQ6 A;  2PJ3 A;  4MHP A;  4YWY A;  1XBU A;  3RZA A;  3PFO A;  3PBB A;  3S9L A;  3KQX A;  2V8G A;  3B3T A;  2V8D A;  2BCO A;  1RTQ A;  2IJZ A;  1TKF A;  3D67 A;  5ELY A;  1CP6 A;  2IMO A;  1Z2L A;  3SJG A;  1R3N A;  1FT7 A;  1Z5R A;  4O23 A;  3H8G A;  3BI1 A;  3CT9 A;  3WAB A;  1TKJ A;  5LRK A;  3KGQ A;  3MN8 A;  5D29 A;  2I3C A;  4MCR A;  1PCA A;  3FF3 A;  1F2P A;  3GLJ A;  1HDQ A;  2PJ4 A;  4NGM A;  4OID A;  2PJ6 A;  3FX6 A;  3LWU A;  2ZEN A;  3SI2 A;  3PRT A;  2XEF A;  2ZEM A;  2ZED A;  1NSA A;  3GUX A;  2POK A;  1PYT B;  5K8O A;  1ARL A;  3D7D A;  4ZYQ A;  4NGS A;  4UEE A;  2PIZ A;  4P4B A;  3PB9 X;  1R43 A;  1ZG9 A;  2GU2 A;  3ISX A;  4MHN A;  2PJ5 A;  1LAM A;  1BAV A;  3PB7 X;  4P4J A;  3HLP A;  2Q51 A;  3B2Y A;  2V8H A;  3NA6 A;  4R8F A;  4ONW A;  3IJ3 A;  3VAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...