4R3LA

Crystal structure of ard1 n-terminal acetyltransferase from sulfolobus solfataricus bound to substrate peptide fragment and coa
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
DFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAIVDNSVVGYIMPRIEWGFSNIKQLPSLVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYYADGEDAYLMARPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized N-acetyltransferase SSO0209
publication title Structural Basis for Substrate-specific Acetylation of N alpha-acetyltransferase Ard1 from Sulfolobus solfataricus
pubmed doi rcsb
source organism Sulfolobus solfataricus p2
molecule tags Transferase/transferase substrate
total genus 51
structure length 157
sequence length 157
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2014-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4r3lA00
1RO5A 4AVBA 3F0AA 2AE6A 4YRHA 1L0CA 1YGHA 3P2HA 4FD5A 4KLVA 2HUZA 5F48A 1Q2DA 5JPHA 3D3SA 3NE7A 4H6ZA 1YX0A 3R96A 4MY3A 4F6AA 4QC6A 2X7BA 4XPLA 2Q7BA 2PQ8A 2DXQA 4R3KA 3KKWA 4YFJA 2CNMA 2C27A 3BJ7A 2O28A 2R98A 1YVKA 2KCWA 4ONUA 2Z0ZA 1RXTA 4XNHB 2IL4A 3R1KA 2ZW4A 1M4GA 4U5YA 5CNPA 4QVTA 4HKFA 5C88A 4KOXA 4PV6A 1YREA 4NF1A 2ZPAA 2J8MA 1CM0A 4MY0A 2FIAA 1OZPA 2CNSA 3JVNA 1Z4RA 4B5PA 1S3ZA 2B5GB 4CS0B 1I12A 2REEA 4LX9A 3K9UA 4U9YA 5EBVA 2J8RA 1QSMA 4CAVA 1WK4A 1GHEA 3BJ8A 4B5PB 4II9A 4PSXA 3D2MA 1B87A 2G3AA 3VWEA 3S6FA 4AVAA 3PZJA 4MI4A 2QIRA 4UA3A 4R3LA 5DWNA 3G8WA 4KOSA 4L89A 1MJ9A 3PP9A 1VHSA 4OLLA 2ARHA 4F0YA 5HMNA 3EXNA 1N71A 2GIVA 1S5KA 4DNCA 3TO9A 3S6GA 4NXYA 3DDDA 1LRZA 2AJ6A 1XMTA 2RC4A 2FIWA 4NEXA 3R9FA 1I1DA 5EC4A 2Q04A 3SHPA 4CRYB 5DWMA 3EO4A 2F5IA 1MK4A 4UWIA 2GE3A 1KUYA 3IGRA 1Q2CA 4JXRA 3TOAA 2PR1A 2ZXVA 4KOWA 4JD6A 1MJBA 3F8KA 2PSWA 2FS5A 3FXTA 1S7FA 3MGDA 5HH1A 3TO7A 4KZTA 3EY5A 3SXOA 5JQ4A 1S7NA 1Q2YA 1QSNA 1P0HA 4JXQA 3CXSA 4ORFA 2FE7A 2ZW5A 2A4NA 4KVME 1YK3A 1NE9A 3F5BA 4PK2A 2BEIA 3V8IA 4KLWA 1J4JA 4HNWB 3G3SA 1IYLA 2G3TA 2ZW7A 3ZJ0A 2P6EA 2FT0A 4UBRA 2Q4YA 5C82A 3I9SA 2QECA 2R8VA 2CNTA 2JDCA 2B3UA 4QBJA 5GCNA 4XPKA 3TT2A 1R57A 3BLNA 1QSRA 2FSRA 2OH1A 1CJWA 4HNXB 1TIQA 4CRZB 4BMHA 2P6GA 1S60A 5FVJA 4AG7A 5KTAA 2P0WA 4FD4A 2VEZA 1PUAA 2PC1A 4J3GA 2OZHA 4FD7A 4MBUA 2Q4VA 4KOUA 2EVNA 3QB8A 2VBQA 3C26A 3W6XA 1IB1E 1V0CA 1PU9A 5J8CA 4JLYA 2VXKA 3N7ZA 1XF8A 2B4BA 3FB3A 2VZYA 4KOVA 5E96A 1Z4EA 3FBUA 3TOBA 3H4QA 3T90A 2D4OA 5KTCA 2VQYA 3TCVA 3RYOA 4KUAA 2PRBA 3FIXA 3WR7A 1YVOA 4X5KA 4E0AA 1FY7A 3DNSA 1QSTA 4KOTA 1IYKA 1XIXA 2PR8A 3R9GA 5J8FA 1KUXA 1WWZA 4EVYA 1K4JA 2VI7A 4CAWA 1Z9UA 1VKCA 2R7HA 3DR8A 3EC4A 4H6UA 1M1DA 1I21A 2Y0MA 4M85A 4RS2A 2BSWA 1S7LA 4GS4A 1MJAA 3TFYA 2G0BA 3T9YA 3IWGA 5F46A 1UFHA 3GY9A 3QAHA 2B4DA 4HNYB 3UY5A 1NMTA 5ISVA 3D8PA 3B8GA 1XEBA 4K30A 1IIDA 2QMLA 4AB7A 2HQYA 2B4DB 2ATRA 2OU2A 2HV2A 1U6MA 2ZW6A 4QB9A 1KZFA 1Y9WA 1M4DA 4Y49C 3CXQA 2K5TA 2EUIA 2BL1A 2P6FA 5IB0A 4IF5A 2FCKA 2FL4A 4R87A 3DR6A 1Y7RA 4KVOE 1B6BA 3GYAA 1XE4A 2Q44A 4MHDA 4I49A 5F49A 3JUWA 4KVXA 5F47A 3SXNA 4RI1A 2Z11A 1P4NA 2VZZA 4U9ZA 4UWJA 4IUSA 2OZGA 3EFAA 1M4IA 4FD6A 3S6HA 4MJ8A 3TTHA 2WPXA 4H89A 4KORA 4PK3A 3FRMA 3R9EA 4B5OA 2J8NA 4L8AA 4JJXA 2B5GA 3DSBA 3LODA 2NMTA 4XNHC 2CY2A 1BOBA 3ZZIA 2OB0A 3PGPA 1S7KA 2Z10A 3D2PA 3W6SA 4E2AA 1IICA 1SQHA 5H84A 2WPWA 4QUSA 4R57A 4YGOA 5KTDA 4E8OA 4XPDB 4AVCA 2REFA 4NSQA 2GANA 3TO6A 1QSOA 4AG9A 2BUEA 2FXFA 4LUAA 3TE4A 4PSWA 5IV0A 3FYNA 3CXPA 3FNCA 3W91A 3LD2A 1YR0A 3S6KA 4OADA 2I00A 2B58A 4XPDC 4KUBA 2I79A 1ON0A 2PDOA 4KOYA 2JLMA 4ZBGA 1Y9KA 3GKRA 3VWDA 3R95A 5IX3A 3OWCA 3P2FA 4R9MA 1BO4A 2B3VA 2JDDA 4OAEA 4CAXA 5H86A 4Y49B 4JWPA 2R1IA 1KUVA 2D4PA 1YLEA 1M44A 4M3SA 1NSLA 4NCZA 2H5MA 2JEVA 5I0CA 3E0KA 2OZUA 2Q0YA 3I3GA
chains in the Genus database with same CATH superfamily
3D4UA 2BOAA 3B2YA 2F8HA 1RO5A 4AVBA 5HXDA 3F0AA 2AE6A 4ZX9A 1TF9A 4OC2A 4YRHA 2ZOGA 3DLJA 1L0CA 1CBXA 5K8PA 1YGHA 3P2HA 4IHMA 4FD5A 5LRGA 4P4BA 4KLVA 2HUZA 5F48A 4A38A 1Q2DA 3IU2A 4FUUA 5JPHA 3D3SA 3NE7A 4H6ZA 1YX0A 3R96A 4MY3A 4F6AA 2POKA 4QC6A 1R43A 4OC3A 4UCNA 5G20A 2X7BA 4MFJA 4P4DA 4O23A 3KR5A 2QJ8A 4XPLA 1YW4A 2Q7BA 2CXAA 2PQ8A 4UFXA 2DXQA 2PJCA 4R3KA 3KKWA 4YFJA 2YGWA 4B12A 2CNMA 2C27A 3BJ7A 4OC4A 2O28A 2GFQA 4B11A 4CYOA 4RN7A 1AUGA 5K8NA 1BPMA 8CPAA 1JQGA 2R98A 1YVKA 2KCWA 3B3VA 3LACA 1M4LA 4ONUA 2Z0ZA 1RXTA 4XNHB 2IL4A 2J9AA 3R1KA 2ZW4A 1M4GA 4U5YA 1H8LA 3IC1A 5CNPA 2GU2A 4QVTA 3B3TA 4HKFA 5C88A 4GM5A 1IGBA 1BAVA 4KOXA 4R7MA 4PV6A 1YREA 4NF1A 2ANPA 4F9UA 4CYQA 1F2PA 2ZPAA 4PXDA 4CYNA 3S9NA 2V8HA 4JYWA 2J8MA 1CM0A 3BXMA 3QNVA 3D67A 2PJ3A 5CBMA 3IEHA 4MY0A 2FIAA 1GYTA 1OZPA 2CNSA 3D7HA 3JVNA 1Z4RA 1CG2A 5EMIA 1S3ZA 3SJGA 4B5PA 3CZXA 4IAVA 2B5GB 4B6ZA 4CS0B 4C2ZA 1I12A 2REEA 5A28A 4A33A 4LX9A 2PJ7A 3K9UA 3CPXA 2XEIA 4U9YA 5EBVA 3V38A 2J8RA 4TNUA 1QSMA 4CAVA 5LYFA 2PVVA 1WK4A 3PB7X 4NGSA 4R76A 1GHEA 3BJ8A 4B5PB 3H8EA 4II9A 4PSXA 4A30A 3D2MA 1B87A 4NGMA 5JH9A 2G3AA 4C2XA 2EK9A 2GLFA 3KQZA 3VWEA 3S6FA 4AVAA 7CPAA 2RFHA 3PZJA 4CAEA 4MI4A 2QIRA 2Z3OA 3PEIA 4DYOA 4UA3A 5IB9A 4ZYQA 4R3LA 5DWNA 1NSAA 3G8WA 3GIUA 4KOSA 1ELMP 2ZEHA 3CT9A 1FNOA 2YNDA 4L89A 4P6YA 1MJ9A 5JGFA 4UIAA 3IIBA 3PP9A 1VHSA 2C1CA 4OLLA 4NGNA 3KR4A 2EK8A 4Q38A 2ARHA 2HC9A 4CGNA 4F0YA 5HMNA 5K8OA 2CIJA 3EXNA 2NSMA 4CPAA 4MCQA 2PIZA 1PYTB 4MXUA 1N71A 4KSIA 2GIVA 2I3CA 5G1ZA 1S5KA 3PFOA 4DNCA 4PXBA 5AG7A 3TO9A 3S6GA 4NXYA 3SJXA 4MHYA 4OIDA 3DDDA 1YMEA 1LRZA 1DTDA 3PFEA 2AJ6A 1XMTA 2ZEPA 2RC4A 3L2NA 1FT7A 4C2YA 2FIWA 2C6PA 2ZEGA 4NEXA 3R9FA 1I1DA 3NFZA 2PJ4A 3D7FA 3LMSA 5EC4A 3IWEA 4G1PA 2C6CA 4UEZA 4DJLA 2Q04A 3SHPA 3BI0A 1IOFA 5G22A 4CRYB 1XFOA 3EO4A 5DWMA 2F5IA 2XEGA 2WYRA 1MK4A 4UWIA 2DF5A 2GE3A 1KUYA 3IGRA 5CPAA 3V7ZA 1Q2CA 4JXRA 3FEEA 5LRKA 3TOAA 1F2OA 1AMPA 3IJ3A 2PR1A 2ZXVA 4KOWA 4JD6A 3D7DA 1MJBA 4UIBA 1Y0RA 3NH8A 2RB7A 3F8KA 1LAMA 2PSWA 2HB6A 3K9TA 3CDXA 2FS5A 3FXTA 1S7FA 3KQXA 2ZOFA 3MGDA 2JBJA 5HVHA 5HH1A 4FWUA 1Q7LA 3TO7A 3NH4A 2EWBA 4C68A 1VGYA 1X12A 4M6HA 5K8MA 3FJUA 4KZTA 3EY5A 1ZG9A 1Z5RA 2Q43A 3SXOA 1BLLE 5JQ4A 1S7NA 1Q2YA 1XBUA 3H8FA 1QSNA 1P0HA 4JXQA 3CXSA 1A2ZA 2PCUA 4ORFA 2FE7A 2ZW5A 2A4NA 3FVLA 1YK3A 4KVME 5KTDA 1NE9A 2PJ6A 4P44A 2AFMA 4JZ0A 3F5BA 3CPAA 4ONWA 4PK2A 2BEIA 2PRQA 4CGMA 1X10A 4TWEA 3V8IA 4MRIA 1Y0YA 3B3WA 4KLWA 5D8NA 1J4JA 4CYPA 4HNWB 3G3SA 1LANA 4A39A 1JWQA 1IYLA 1TXRA 3K2KA 2G3TA 2QYVA 2PJBA 4RUHA 2AFZA 1Z8WA 2ZW7A 3ZJ0A 4LQ6A 2P6EA 2FT0A 1LOKA 4UBRA 3ISZA 3GLJA 3A9LA 2F7VA 2Q4YA 1ZG8A 5C82A 3I9SA 4R6TA 2QECA 2R8VA 1TKJA 4M6IA 2CNTA 3WC7A 4BINA 3RBUA 2JDCA 4KS9A 1KWMA 3NH5A 2B3UA 4FBEA 4QBJA 3B3SA 6CPAA 5GCNA 4XPKA 3TT2A 1XMBA 3D68A 4A94A 4CGOA 1IU8A 2AFWA 1CP7A 4A37A 1R57A 3VH9A 4Q7AA 1PCAA 4LQGA 3BLNA 4OKOA 1QSRA 2FSRA 4MHPA 1XRYA 4A95A 5J1QA 1Z8TA 2OH1A 1CJWA 3FEDA 4HNXB 1TIQA 2PJ8A 4PPZA 4CRZB 3KL9A 3FH4A 4BMHA 2PJAA 4KSAA 3HLPA 2P6GA 1S60A 1VHEA 5FVJA 4ZY1A 4AG7A 3D7GA 4OC5A 4KSFA 5HVFA 3VARA 5KTAA 2V8GA 2NYQA 2Z3NA 3FF3A 4C7IA 2P0WA 4FD4A 5D29A 2VEZA 1PUAA 2PC1A 3PB8X 1ZLHA 4J3GA 2OZHA 1RTQA 4FD7A 3JRUA 1AYEA 4MBUA 2Q4VA 4ZY2A 4B13A 2GREA 1ARLA 1CPXA 2ZEMA 4KOUA 2EVNA 4NGRA 4UEEA 3QB8A 2ZEEA 2VBQA 2C6GA 2PJ2A 3C26A 2Q7SA 3W6XA 3WC5A 1IB1E 1V0CA 1PU9A 5J8CA 4JLYA 2VXKA 3N7ZA 4UCPA 2VL1A 3FMCA 1LAPA 1XF8A 2B4BA 2AFXA 4CGLA 3FB3A 5AGEA 2DEAA 2VZYA 4KOVA 5E96A 1Z4EA 3FBUA 3TC8A 2QVPA 2BO9A 3TOBA 3NE8A 2ZEOA 5JM6A 4ZY0A 1IY7A 3H4QA 4MFKA 4NFRA 3T90A 2D4OA 4YWYA 3HUVA 4NJQA 4WWVA 1LCPA 5KTCA 2VQYA 4UF4A 3TCVA 4HPSA 3RYOA 4KUAA 1ELLP 2EO8A 2PRBA 4YU9A 2IJZA 2IQ6A 4CAFA 3KHZA 3FIXA 2DPSA 3WR7A 2O53A 1YVOA 4X5KA 1R3NA 3B7IA 4P10A 4E0AA 1FY7A 3DNSA 1QSTA 4Q36A 4MCPA 4KOTA 2ABZA 3S9LA 2Z3PA 1IYKA 1XIXA 1YW6A 2PR8A 3R9GA 5J8FA 1KUXA 1WWZA 4EVYA 1K4JA 2WZNA 2VI7A 3VATA 5G21A 4CAWA 2OOTA 1Z9UA 1YQEA 1VKCA 2R7HA 1CPSA 4MHNA 2ZENA 3DR8A 3EC4A 1M1DA 1I21A 2Y0MA 4H6UA 4M85A 4AXVA 4RS2A 2BSWA 2V8VA 5AG4A 1OBRA 1S7LA 2PJ0A 4GS4A 2AFOA 4B14A 3SI1A 1MJAA 4UFWA 3TFYA 1VIXA 1ZO0A 2G0BA 3T9YA 3IWGA 5F46A 1UFHA 4ZI6A 3GY9A 3QAHA 2B4DA 2PJ1A 4BBHA 4HNYB 3UY5A 1NMTA 3WABA 4F0XA 5ISVA 2OR4A 3D8PA 3B8GA 5F09A 1XEBA 5AG6A 2AFUA 2PVWA 3MRUA 1F57A 4MFZA 4K30A 4ZX8A 1IIDA 2QMLA 4AB7A 2HQYA 4Z65A 2B4DB 2ATRA 2CTCA 2OU2A 2HV2A 1U6MA 2ZW6A 4NGTA 1TKHA 1KZFA 4P4EA 4QB9A 4X8IA 1Y9WA 1M4DA 1TKFA 4R8FA 4Y49C 3CXQA 3IO1A 2ZEDA 1ZG7A 3SJFA 2K5TA 2EUIA 1UWYA 2BL1A 2P6FA 3GUXA 3TX8A 2FVGA 5IB0A 4IF5A 2FCKA 2FL4A 4R87A 2CF4A 3DR6A 1Y7RA 2Z3KA 5AG5A 4KVOE 2PJ9A 3IU1A 4M6GA 4FAIA 4EWTA 2BCOA 1HDQA 1B6BA 2JEWA 1EE3P 3GYAA 1XE4A 2Q44A 4ZGYB 4MHDA 1XOVA 1QQ9A 2JBKA 4I49A 3T8WA 5F49A 4UFVA 3JUWA 5THWA 4KVXA 5ELYA 3PBEA 5F47A 3SXNA 4OMEA 4RI1A 3I3GA 2Z11A 1P4NA 2GLJA 2VZZA 4UEFA 2DPTA 4IK2A 4U9ZA 4UWJA 4IUSA 2OZGA 3EFAA 4MFLA 5A27A 1M4IA 4FD6A 1DE4C 3MN8A 4MFPA 4X3RA 4MJ8A 3S6HA 3TTHA 1Z8LA 2WPXA 3B35A 2Z3MA 4H89A 4PXCA 4KORA 4PK3A 5LRJA 1CP6A 3FRMA 2PIYA 2V8DA 3FX6A 3R9EA 1ZLIA 4B5OA 3PRTA 2J8NA 4L8AA 4JJXA 1Z8XA 2B5GA 2ZELA 3FECA 3PB4X 3DSBA 3LODA 4A32A 2NMTA 3D66A 4XNHC 1HDUA 2CY2A 1BOBA 3KASA 1YLOA 3RNZA 3ZZIA 2OB0A 3PGPA 4P4JA 1S7KA 2Z10A 2XEJA 3BHXA 4EFDA 3D2PA 3W6SA 4E2AA 4P4FA 1IICA 1SQHA 5H84A 4F9VA 5LYLA 3NA6A 3IWWA 4MHZA 2WPWA 4QUSA 2YNCA 4NJRA 4R57A 1IOIA 3H8GA 2Q4ZA 4YGOA 4NGPA 3SI0A 4E8OA 4XPDB 3SI2A 4AVCA 4CGPA 1XJOA 2REFA 4NSQA 2GANA 3TO6A 1QSOA 4OIWA 4AG9A 2BUEA 2FXFA 2EBJA 4LUAA 4F8ZA 3TE4A 4PSWA 2CTBA 5LYDA 1CX8A 5IV0A 5LYIA 4MCRA 3FYNA 2WUUA 3WC6A 2V77A 3CXPA 4A31A 3FNCA 1BPNA 3BI1A 3W91A 3LD2A 4WJBA 3PBBA 1ARMA 1YR0A 3S6KA 4OADA 2I00A 2B58A 2YNEA 2XEFA 4UCMA 4XPDC 4A2ZA 3RZAA 4PXEA 4P4IA 1LFWA 4KUBA 3PB9X 3N5FA 2I79A 3ISXA 4B10A 2YNCC 1ON0A 2PDOA 4K3NA 5HVGA 3LWUA 4X2TA 5I4MA 1VHOA 4W9YA 5DS0A 4KOYA 4MCSA 4OP4A 2JLMA 4ZBGA 1Y9KA 3GKRA 3I1UA 3KGQA 4OC0A 3R95A 1YSJA 3PB6X 3VWDA 3KI9A 4EMEA 5IX3A 3JTKA 2AFSA 3OWCA 4P45A 2Z3LA 3P2FA 1QMUA 4R9MA 2O4HA 4BD9A 1BO4A 4GXHA 4MMOA 2B3VA 2JDDA 4C7HA 2IMOA 4OAEA 3S9MA 4CAXA 5H86A 1Y7EA 4DUKA 5BWAB 1HEEA 3B3CA 4Y49B 4MFQA 2ZEFA 4NGQA 4H2KA 3SJEA 3KZWA 2WSAA 3WT4A 4JWPA 2R1IA 2PJ5A 3H5ZA 3IFEA 1TF8A 4PQAA 3QAYA 3RO0A 3KHXA 2PE3A 1KUVA 2D4PA 1YLEA 1M44A 4M3SA 1Z2LA 1NSLA 4NCZA 2H5MA 2JEVA 5I0CA 2Q51A 3E0KA 3RAMA 2OZUA 4OC1A 3DGVA 2ODFA 2Q0YA 3GB0A 2G9DA
chains in the Genus database with same CATH topology
1RO5A 4AVBA 3F0AA 2AE6A 4YRHA 1L0CA 1YGHA 3P2HA 4FD5A 4KLVA 2HUZA 5F48A 1Q2DA 3IU2A 5JPHA 3D3SA 3NE7A 4H6ZA 1YX0A 3R96A 4MY3A 4F6AA 4QC6A 4UCNA 5G20A 2X7BA 4MFJA 4XPLA 2Q7BA 2CXAA 2PQ8A 4UFXA 2DXQA 4R3KA 3KKWA 4YFJA 2YGWA 4B12A 2CNMA 2C27A 3BJ7A 2O28A 4B11A 4CYOA 2R98A 1YVKA 2KCWA 4ONUA 2Z0ZA 1RXTA 4XNHB 2IL4A 3R1KA 2ZW4A 1M4GA 4U5YA 5CNPA 4QVTA 4HKFA 5C88A 4KOXA 4PV6A 1YREA 4NF1A 4CYQA 2ZPAA 4CYNA 2J8MA 1CM0A 4MY0A 2FIAA 1OZPA 2CNSA 3JVNA 1Z4RA 4B5PA 1S3ZA 2B5GB 4CS0B 4C2ZA 1I12A 2REEA 5A28A 4A33A 4LX9A 3K9UA 4U9YA 5EBVA 2J8RA 1QSMA 4CAVA 1WK4A 1GHEA 3BJ8A 4B5PB 4II9A 4PSXA 4A30A 3D2MA 1B87A 2G3AA 4C2XA 3VWEA 3S6FA 4AVAA 3PZJA 4CAEA 4MI4A 2QIRA 2Z3OA 4UA3A 4R3LA 5DWNA 3G8WA 4KOSA 4L89A 2YNDA 1MJ9A 3PP9A 1VHSA 4OLLA 4Q38A 2ARHA 4CGNA 4F0YA 5HMNA 3EXNA 1N71A 2GIVA 5G1ZA 1S5KA 4DNCA 5AG7A 3TO9A 3S6GA 4NXYA 3DDDA 1LRZA 2AJ6A 1XMTA 2RC4A 4C2YA 2FIWA 4NEXA 3R9FA 1I1DA 5EC4A 3IWEA 2Q04A 3SHPA 5G22A 4CRYB 5DWMA 3EO4A 2F5IA 1MK4A 4UWIA 2GE3A 1KUYA 3IGRA 1Q2CA 4JXRA 3TOAA 2PR1A 2ZXVA 4KOWA 4JD6A 1MJBA 3F8KA 2PSWA 2FS5A 3FXTA 1S7FA 3MGDA 5HH1A 3TO7A 4C68A 4KZTA 3EY5A 3SXOA 5JQ4A 1S7NA 1Q2YA 1QSNA 1P0HA 4JXQA 3CXSA 4ORFA 2FE7A 2ZW5A 2A4NA 4KVME 1YK3A 1NE9A 3F5BA 4PK2A 2BEIA 4CGMA 3V8IA 4KLWA 1J4JA 4CYPA 4HNWB 3G3SA 1IYLA 2G3TA 2ZW7A 3ZJ0A 2P6EA 2FT0A 4UBRA 3A9LA 2Q4YA 5C82A 3I9SA 2QECA 2R8VA 2CNTA 2JDCA 4KS9A 2B3UA 4QBJA 5GCNA 4XPKA 3TT2A 4CGOA 1R57A 3BLNA 1QSRA 2FSRA 4A95A 2OH1A 1CJWA 4HNXB 1TIQA 4CRZB 4BMHA 4KSAA 2P6GA 1S60A 5FVJA 4AG7A 4KSFA 5KTAA 2Z3NA 4C7IA 2P0WA 4FD4A 2VEZA 1PUAA 2PC1A 4J3GA 2OZHA 4FD7A 4MBUA 2Q4VA 4B13A 4KOUA 2EVNA 3QB8A 2VBQA 3C26A 3W6XA 1IB1E 1V0CA 1PU9A 5J8CA 4JLYA 2VXKA 3N7ZA 4UCPA 1XF8A 2B4BA 4CGLA 3FB3A 5AGEA 2VZYA 4KOVA 5E96A 1Z4EA 3FBUA 3TOBA 3H4QA 4MFKA 3T90A 2D4OA 5KTCA 2VQYA 3TCVA 3RYOA 4KUAA 2PRBA 4CAFA 3FIXA 2DPSA 3WR7A 1YVOA 4X5KA 4E0AA 1FY7A 3DNSA 1QSTA 4Q36A 4KOTA 2Z3PA 1IYKA 1XIXA 2PR8A 3R9GA 5J8FA 1KUXA 1WWZA 4EVYA 1K4JA 2VI7A 5G21A 4CAWA 1Z9UA 1VKCA 2R7HA 3DR8A 3EC4A 4H6UA 1M1DA 1I21A 2Y0MA 4M85A 4RS2A 2BSWA 5AG4A 1S7LA 4GS4A 4B14A 1MJAA 4UFWA 3TFYA 1ZO0A 2G0BA 3T9YA 3IWGA 5F46A 1UFHA 3GY9A 3QAHA 2B4DA 4BBHA 4HNYB 3UY5A 1NMTA 4F0XA 5ISVA 3D8PA 3B8GA 1XEBA 5AG6A 4MFZA 4K30A 1IIDA 2QMLA 4AB7A 2HQYA 2B4DB 2ATRA 2OU2A 2HV2A 1U6MA 2ZW6A 4QB9A 1KZFA 1Y9WA 1M4DA 4Y49C 3CXQA 2K5TA 2EUIA 2BL1A 2P6FA 5IB0A 4IF5A 2FCKA 2FL4A 4R87A 3DR6A 1Y7RA 2Z3KA 5AG5A 4KVOE 3IU1A 1B6BA 3GYAA 1XE4A 2Q44A 4ZGYB 4MHDA 4I49A 5F49A 4UFVA 3JUWA 4KVXA 5F47A 3SXNA 4RI1A 2Z11A 1P4NA 2VZZA 2DPTA 4U9ZA 4UWJA 4IUSA 2OZGA 3EFAA 4MFLA 5A27A 1M4IA 4FD6A 4MFPA 3S6HA 4MJ8A 3TTHA 2WPXA 2Z3MA 4H89A 4KORA 4PK3A 3FRMA 3R9EA 4B5OA 2J8NA 4L8AA 4JJXA 2B5GA 3DSBA 3LODA 4A32A 2NMTA 4XNHC 2CY2A 1BOBA 3ZZIA 2OB0A 3PGPA 1S7KA 2Z10A 3D2PA 3W6SA 4E2AA 1IICA 1SQHA 5H84A 2WPWA 4QUSA 2YNCA 4R57A 4YGOA 5KTDA 4E8OA 4XPDB 4AVCA 4CGPA 2REFA 4NSQA 2GANA 3TO6A 1QSOA 4AG9A 2BUEA 2FXFA 4LUAA 3TE4A 4PSWA 5IV0A 3FYNA 2WUUA 4A31A 3CXPA 3FNCA 3W91A 3LD2A 1YR0A 3S6KA 4OADA 2I00A 2B58A 2YNEA 4UCMA 4XPDC 4A2ZA 4KUBA 2I79A 4B10A 2YNCC 1ON0A 2PDOA 4KOYA 2JLMA 4ZBGA 1Y9KA 3GKRA 3VWDA 3R95A 5IX3A 3JTKA 3OWCA 2Z3LA 3P2FA 4R9MA 1BO4A 2B3VA 2JDDA 4C7HA 4OAEA 4CAXA 5H86A 5BWAB 4Y49B 4MFQA 2WSAA 4JWPA 2R1IA 3H5ZA 1KUVA 2D4PA 1YLEA 1M44A 4M3SA 1NSLA 4NCZA 2H5MA 2JEVA 5I0CA 3E0KA 2OZUA 2Q0YA 3I3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RO5 A;  4AVB A;  3F0A A;  2AE6 A;  4YRH A;  1L0C A;  1YGH A;  3P2H A;  4FD5 A;  4KLV A;  2HUZ A;  5F48 A;  1Q2D A;  5JPH A;  3D3S A;  3NE7 A;  4H6Z A;  1YX0 A;  3R96 A;  4MY3 A;  4F6A A;  4QC6 A;  2X7B A;  4XPL A;  2Q7B A;  2PQ8 A;  2DXQ A;  4R3K A;  3KKW A;  4YFJ A;  2CNM A;  2C27 A;  3BJ7 A;  2O28 A;  2R98 A;  1YVK A;  2KCW A;  4ONU A;  2Z0Z A;  1RXT A;  4XNH B;  2IL4 A;  3R1K A;  2ZW4 A;  1M4G A;  4U5Y A;  5CNP A;  4QVT A;  4HKF A;  5C88 A;  4KOX A;  4PV6 A;  1YRE A;  4NF1 A;  2ZPA A;  2J8M A;  1CM0 A;  4MY0 A;  2FIA A;  1OZP A;  2CNS A;  3JVN A;  1Z4R A;  4B5P A;  1S3Z A;  2B5G B;  4CS0 B;  1I12 A;  2REE A;  4LX9 A;  3K9U A;  4U9Y A;  5EBV A;  2J8R A;  1QSM A;  4CAV A;  1WK4 A;  1GHE A;  3BJ8 A;  4B5P B;  4II9 A;  4PSX A;  3D2M A;  1B87 A;  2G3A A;  3VWE A;  3S6F A;  4AVA A;  3PZJ A;  4MI4 A;  2QIR A;  4UA3 A;  4R3L A;  5DWN A;  3G8W A;  4KOS A;  4L89 A;  1MJ9 A;  3PP9 A;  1VHS A;  4OLL A;  2ARH A;  4F0Y A;  5HMN A;  3EXN A;  1N71 A;  2GIV A;  1S5K A;  4DNC A;  3TO9 A;  3S6G A;  4NXY A;  3DDD A;  1LRZ A;  2AJ6 A;  1XMT A;  2RC4 A;  2FIW A;  4NEX A;  3R9F A;  1I1D A;  5EC4 A;  2Q04 A;  3SHP A;  4CRY B;  5DWM A;  3EO4 A;  2F5I A;  1MK4 A;  4UWI A;  2GE3 A;  1KUY A;  3IGR A;  1Q2C A;  4JXR A;  3TOA A;  2PR1 A;  2ZXV A;  4KOW A;  4JD6 A;  1MJB A;  3F8K A;  2PSW A;  2FS5 A;  3FXT A;  1S7F A;  3MGD A;  5HH1 A;  3TO7 A;  4KZT A;  3EY5 A;  3SXO A;  5JQ4 A;  1S7N A;  1Q2Y A;  1QSN A;  1P0H A;  4JXQ A;  3CXS A;  4ORF A;  2FE7 A;  2ZW5 A;  2A4N A;  4KVM E;  1YK3 A;  1NE9 A;  3F5B A;  4PK2 A;  2BEI A;  3V8I A;  4KLW A;  1J4J A;  4HNW B;  3G3S A;  1IYL A;  2G3T A;  2ZW7 A;  3ZJ0 A;  2P6E A;  2FT0 A;  4UBR A;  2Q4Y A;  5C82 A;  3I9S A;  2QEC A;  2R8V A;  2CNT A;  2JDC A;  2B3U A;  4QBJ A;  5GCN A;  4XPK A;  3TT2 A;  1R57 A;  3BLN A;  1QSR A;  2FSR A;  2OH1 A;  1CJW A;  4HNX B;  1TIQ A;  4CRZ B;  4BMH A;  2P6G A;  1S60 A;  5FVJ A;  4AG7 A;  5KTA A;  2P0W A;  4FD4 A;  2VEZ A;  1PUA A;  2PC1 A;  4J3G A;  2OZH A;  4FD7 A;  4MBU A;  2Q4V A;  4KOU A;  2EVN A;  3QB8 A;  2VBQ A;  3C26 A;  3W6X A;  1IB1 E;  1V0C A;  1PU9 A;  5J8C A;  4JLY A;  2VXK A;  3N7Z A;  1XF8 A;  2B4B A;  3FB3 A;  2VZY A;  4KOV A;  5E96 A;  1Z4E A;  3FBU A;  3TOB A;  3H4Q A;  3T90 A;  2D4O A;  5KTC A;  2VQY A;  3TCV A;  3RYO A;  4KUA A;  2PRB A;  3FIX A;  3WR7 A;  1YVO A;  4X5K A;  4E0A A;  1FY7 A;  3DNS A;  1QST A;  4KOT A;  1IYK A;  1XIX A;  2PR8 A;  3R9G A;  5J8F A;  1KUX A;  1WWZ A;  4EVY A;  1K4J A;  2VI7 A;  4CAW A;  1Z9U A;  1VKC A;  2R7H A;  3DR8 A;  3EC4 A;  4H6U A;  1M1D A;  1I21 A;  2Y0M A;  4M85 A;  4RS2 A;  2BSW A;  1S7L A;  4GS4 A;  1MJA A;  3TFY A;  2G0B A;  3T9Y A;  3IWG A;  5F46 A;  1UFH A;  3GY9 A;  3QAH A;  2B4D A;  4HNY B;  3UY5 A;  1NMT A;  5ISV A;  3D8P A;  3B8G A;  1XEB A;  4K30 A;  1IID A;  2QML A;  4AB7 A;  2HQY A;  2B4D B;  2ATR A;  2OU2 A;  2HV2 A;  1U6M A;  2ZW6 A;  4QB9 A;  1KZF A;  1Y9W A;  1M4D A;  4Y49 C;  3CXQ A;  2K5T A;  2EUI A;  2BL1 A;  2P6F A;  5IB0 A;  4IF5 A;  2FCK A;  2FL4 A;  4R87 A;  3DR6 A;  1Y7R A;  4KVO E;  1B6B A;  3GYA A;  1XE4 A;  2Q44 A;  4MHD A;  4I49 A;  5F49 A;  3JUW A;  4KVX A;  5F47 A;  3SXN A;  4RI1 A;  2Z11 A;  1P4N A;  2VZZ A;  4U9Z A;  4UWJ A;  4IUS A;  2OZG A;  3EFA A;  1M4I A;  4FD6 A;  3S6H A;  4MJ8 A;  3TTH A;  2WPX A;  4H89 A;  4KOR A;  4PK3 A;  3FRM A;  3R9E A;  4B5O A;  2J8N A;  4L8A A;  4JJX A;  2B5G A;  3DSB A;  3LOD A;  2NMT A;  4XNH C;  2CY2 A;  1BOB A;  3ZZI A;  2OB0 A;  3PGP A;  1S7K A;  2Z10 A;  3D2P A;  3W6S A;  4E2A A;  1IIC A;  1SQH A;  5H84 A;  2WPW A;  4QUS A;  4R57 A;  4YGO A;  5KTD A;  4E8O A;  4XPD B;  4AVC A;  2REF A;  4NSQ A;  2GAN A;  3TO6 A;  1QSO A;  4AG9 A;  2BUE A;  2FXF A;  4LUA A;  3TE4 A;  4PSW A;  5IV0 A;  3FYN A;  3CXP A;  3FNC A;  3W91 A;  3LD2 A;  1YR0 A;  3S6K A;  4OAD A;  2I00 A;  2B58 A;  4XPD C;  4KUB A;  2I79 A;  1ON0 A;  2PDO A;  4KOY A;  2JLM A;  4ZBG A;  1Y9K A;  3GKR A;  3VWD A;  3R95 A;  5IX3 A;  3OWC A;  3P2F A;  4R9M A;  1BO4 A;  2B3V A;  2JDD A;  4OAE A;  4CAX A;  5H86 A;  4Y49 B;  4JWP A;  2R1I A;  1KUV A;  2D4P A;  1YLE A;  1M44 A;  4M3S A;  1NSL A;  4NCZ A;  2H5M A;  2JEV A;  5I0C A;  3E0K A;  2OZU A;  2Q0Y A;  3I3G A; 
#chains in the Genus database with same CATH topology
 3D4U A;  2BOA A;  3B2Y A;  2F8H A;  1RO5 A;  4AVB A;  5HXD A;  3F0A A;  2AE6 A;  4ZX9 A;  1TF9 A;  4OC2 A;  4YRH A;  2ZOG A;  3DLJ A;  1L0C A;  1CBX A;  5K8P A;  1YGH A;  3P2H A;  4IHM A;  4FD5 A;  5LRG A;  4P4B A;  4KLV A;  2HUZ A;  5F48 A;  4A38 A;  1Q2D A;  3IU2 A;  4FUU A;  5JPH A;  3D3S A;  3NE7 A;  4H6Z A;  1YX0 A;  3R96 A;  4MY3 A;  4F6A A;  2POK A;  4QC6 A;  1R43 A;  4OC3 A;  4UCN A;  5G20 A;  2X7B A;  4MFJ A;  4P4D A;  4O23 A;  3KR5 A;  2QJ8 A;  4XPL A;  1YW4 A;  2Q7B A;  2CXA A;  2PQ8 A;  4UFX A;  2DXQ A;  2PJC A;  4R3K A;  3KKW A;  4YFJ A;  2YGW A;  4B12 A;  2CNM A;  2C27 A;  3BJ7 A;  4OC4 A;  2O28 A;  2GFQ A;  4B11 A;  4CYO A;  4RN7 A;  1AUG A;  5K8N A;  1BPM A;  8CPA A;  1JQG A;  2R98 A;  1YVK A;  2KCW A;  3B3V A;  3LAC A;  1M4L A;  4ONU A;  2Z0Z A;  1RXT A;  4XNH B;  2IL4 A;  2J9A A;  3R1K A;  2ZW4 A;  1M4G A;  4U5Y A;  1H8L A;  3IC1 A;  5CNP A;  2GU2 A;  4QVT A;  3B3T A;  4HKF A;  5C88 A;  4GM5 A;  1IGB A;  1BAV A;  4KOX A;  4R7M A;  4PV6 A;  1YRE A;  4NF1 A;  2ANP A;  4F9U A;  4CYQ A;  1F2P A;  2ZPA A;  4PXD A;  4CYN A;  3S9N A;  2V8H A;  4JYW A;  2J8M A;  1CM0 A;  3BXM A;  3QNV A;  3D67 A;  2PJ3 A;  5CBM A;  3IEH A;  4MY0 A;  2FIA A;  1GYT A;  1OZP A;  2CNS A;  3D7H A;  3JVN A;  1Z4R A;  1CG2 A;  5EMI A;  1S3Z A;  3SJG A;  4B5P A;  3CZX A;  4IAV A;  2B5G B;  4B6Z A;  4CS0 B;  4C2Z A;  1I12 A;  2REE A;  5A28 A;  4A33 A;  4LX9 A;  2PJ7 A;  3K9U A;  3CPX A;  2XEI A;  4U9Y A;  5EBV A;  3V38 A;  2J8R A;  4TNU A;  1QSM A;  4CAV A;  5LYF A;  2PVV A;  1WK4 A;  3PB7 X;  4NGS A;  4R76 A;  1GHE A;  3BJ8 A;  4B5P B;  3H8E A;  4II9 A;  4PSX A;  4A30 A;  3D2M A;  1B87 A;  4NGM A;  5JH9 A;  2G3A A;  4C2X A;  2EK9 A;  2GLF A;  3KQZ A;  3VWE A;  3S6F A;  4AVA A;  7CPA A;  2RFH A;  3PZJ A;  4CAE A;  4MI4 A;  2QIR A;  2Z3O A;  3PEI A;  4DYO A;  4UA3 A;  5IB9 A;  4ZYQ A;  4R3L A;  5DWN A;  1NSA A;  3G8W A;  3GIU A;  4KOS A;  1ELM P;  2ZEH A;  3CT9 A;  1FNO A;  2YND A;  4L89 A;  4P6Y A;  1MJ9 A;  5JGF A;  4UIA A;  3IIB A;  3PP9 A;  1VHS A;  2C1C A;  4OLL A;  4NGN A;  3KR4 A;  2EK8 A;  4Q38 A;  2ARH A;  2HC9 A;  4CGN A;  4F0Y A;  5HMN A;  5K8O A;  2CIJ A;  3EXN A;  2NSM A;  4CPA A;  4MCQ A;  2PIZ A;  1PYT B;  4MXU A;  1N71 A;  4KSI A;  2GIV A;  2I3C A;  5G1Z A;  1S5K A;  3PFO A;  4DNC A;  4PXB A;  5AG7 A;  3TO9 A;  3S6G A;  4NXY A;  3SJX A;  4MHY A;  4OID A;  3DDD A;  1YME A;  1LRZ A;  1DTD A;  3PFE A;  2AJ6 A;  1XMT A;  2ZEP A;  2RC4 A;  3L2N A;  1FT7 A;  4C2Y A;  2FIW A;  2C6P A;  2ZEG A;  4NEX A;  3R9F A;  1I1D A;  3NFZ A;  2PJ4 A;  3D7F A;  3LMS A;  5EC4 A;  3IWE A;  4G1P A;  2C6C A;  4UEZ A;  4DJL A;  2Q04 A;  3SHP A;  3BI0 A;  1IOF A;  5G22 A;  4CRY B;  1XFO A;  3EO4 A;  5DWM A;  2F5I A;  2XEG A;  2WYR A;  1MK4 A;  4UWI A;  2DF5 A;  2GE3 A;  1KUY A;  3IGR A;  5CPA A;  3V7Z A;  1Q2C A;  4JXR A;  3FEE A;  5LRK A;  3TOA A;  1F2O A;  1AMP A;  3IJ3 A;  2PR1 A;  2ZXV A;  4KOW A;  4JD6 A;  3D7D A;  1MJB A;  4UIB A;  1Y0R A;  3NH8 A;  2RB7 A;  3F8K A;  1LAM A;  2PSW A;  2HB6 A;  3K9T A;  3CDX A;  2FS5 A;  3FXT A;  1S7F A;  3KQX A;  2ZOF A;  3MGD A;  2JBJ A;  5HVH A;  5HH1 A;  4FWU A;  1Q7L A;  3TO7 A;  3NH4 A;  2EWB A;  4C68 A;  1VGY A;  1X12 A;  4M6H A;  5K8M A;  3FJU A;  4KZT A;  3EY5 A;  1ZG9 A;  1Z5R A;  2Q43 A;  3SXO A;  1BLL E;  5JQ4 A;  1S7N A;  1Q2Y A;  1XBU A;  3H8F A;  1QSN A;  1P0H A;  4JXQ A;  3CXS A;  1A2Z A;  2PCU A;  4ORF A;  2FE7 A;  2ZW5 A;  2A4N A;  3FVL A;  1YK3 A;  4KVM E;  5KTD A;  1NE9 A;  2PJ6 A;  4P44 A;  2AFM A;  4JZ0 A;  3F5B A;  3CPA A;  4ONW A;  4PK2 A;  2BEI A;  2PRQ A;  4CGM A;  1X10 A;  4TWE A;  3V8I A;  4MRI A;  1Y0Y A;  3B3W A;  4KLW A;  5D8N A;  1J4J A;  4CYP A;  4HNW B;  3G3S A;  1LAN A;  4A39 A;  1JWQ A;  1IYL A;  1TXR A;  3K2K A;  2G3T A;  2QYV A;  2PJB A;  4RUH A;  2AFZ A;  1Z8W A;  2ZW7 A;  3ZJ0 A;  4LQ6 A;  2P6E A;  2FT0 A;  1LOK A;  4UBR A;  3ISZ A;  3GLJ A;  3A9L A;  2F7V A;  2Q4Y A;  1ZG8 A;  5C82 A;  3I9S A;  4R6T A;  2QEC A;  2R8V A;  1TKJ A;  4M6I A;  2CNT A;  3WC7 A;  4BIN A;  3RBU A;  2JDC A;  4KS9 A;  1KWM A;  3NH5 A;  2B3U A;  4FBE A;  4QBJ A;  3B3S A;  6CPA A;  5GCN A;  4XPK A;  3TT2 A;  1XMB A;  3D68 A;  4A94 A;  4CGO A;  1IU8 A;  2AFW A;  1CP7 A;  4A37 A;  1R57 A;  3VH9 A;  4Q7A A;  1PCA A;  4LQG A;  3BLN A;  4OKO A;  1QSR A;  2FSR A;  4MHP A;  1XRY A;  4A95 A;  5J1Q A;  1Z8T A;  2OH1 A;  1CJW A;  3FED A;  4HNX B;  1TIQ A;  2PJ8 A;  4PPZ A;  4CRZ B;  3KL9 A;  3FH4 A;  4BMH A;  2PJA A;  4KSA A;  3HLP A;  2P6G A;  1S60 A;  1VHE A;  5FVJ A;  4ZY1 A;  4AG7 A;  3D7G A;  4OC5 A;  4KSF A;  5HVF A;  3VAR A;  5KTA A;  2V8G A;  2NYQ A;  2Z3N A;  3FF3 A;  4C7I A;  2P0W A;  4FD4 A;  5D29 A;  2VEZ A;  1PUA A;  2PC1 A;  3PB8 X;  1ZLH A;  4J3G A;  2OZH A;  1RTQ A;  4FD7 A;  3JRU A;  1AYE A;  4MBU A;  2Q4V A;  4ZY2 A;  4B13 A;  2GRE A;  1ARL A;  1CPX A;  2ZEM A;  4KOU A;  2EVN A;  4NGR A;  4UEE A;  3QB8 A;  2ZEE A;  2VBQ A;  2C6G A;  2PJ2 A;  3C26 A;  2Q7S A;  3W6X A;  3WC5 A;  1IB1 E;  1V0C A;  1PU9 A;  5J8C A;  4JLY A;  2VXK A;  3N7Z A;  4UCP A;  2VL1 A;  3FMC A;  1LAP A;  1XF8 A;  2B4B A;  2AFX A;  4CGL A;  3FB3 A;  5AGE A;  2DEA A;  2VZY A;  4KOV A;  5E96 A;  1Z4E A;  3FBU A;  3TC8 A;  2QVP A;  2BO9 A;  3TOB A;  3NE8 A;  2ZEO A;  5JM6 A;  4ZY0 A;  1IY7 A;  3H4Q A;  4MFK A;  4NFR A;  3T90 A;  2D4O A;  4YWY A;  3HUV A;  4NJQ A;  4WWV A;  1LCP A;  5KTC A;  2VQY A;  4UF4 A;  3TCV A;  4HPS A;  3RYO A;  4KUA A;  1ELL P;  2EO8 A;  2PRB A;  4YU9 A;  2IJZ A;  2IQ6 A;  4CAF A;  3KHZ A;  3FIX A;  2DPS A;  3WR7 A;  2O53 A;  1YVO A;  4X5K A;  1R3N A;  3B7I A;  4P10 A;  4E0A A;  1FY7 A;  3DNS A;  1QST A;  4Q36 A;  4MCP A;  4KOT A;  2ABZ A;  3S9L A;  2Z3P A;  1IYK A;  1XIX A;  1YW6 A;  2PR8 A;  3R9G A;  5J8F A;  1KUX A;  1WWZ A;  4EVY A;  1K4J A;  2WZN A;  2VI7 A;  3VAT A;  5G21 A;  4CAW A;  2OOT A;  1Z9U A;  1YQE A;  1VKC A;  2R7H A;  1CPS A;  4MHN A;  2ZEN A;  3DR8 A;  3EC4 A;  1M1D A;  1I21 A;  2Y0M A;  4H6U A;  4M85 A;  4AXV A;  4RS2 A;  2BSW A;  2V8V A;  5AG4 A;  1OBR A;  1S7L A;  2PJ0 A;  4GS4 A;  2AFO A;  4B14 A;  3SI1 A;  1MJA A;  4UFW A;  3TFY A;  1VIX A;  1ZO0 A;  2G0B A;  3T9Y A;  3IWG A;  5F46 A;  1UFH A;  4ZI6 A;  3GY9 A;  3QAH A;  2B4D A;  2PJ1 A;  4BBH A;  4HNY B;  3UY5 A;  1NMT A;  3WAB A;  4F0X A;  5ISV A;  2OR4 A;  3D8P A;  3B8G A;  5F09 A;  1XEB A;  5AG6 A;  2AFU A;  2PVW A;  3MRU A;  1F57 A;  4MFZ A;  4K30 A;  4ZX8 A;  1IID A;  2QML A;  4AB7 A;  2HQY A;  4Z65 A;  2B4D B;  2ATR A;  2CTC A;  2OU2 A;  2HV2 A;  1U6M A;  2ZW6 A;  4NGT A;  1TKH A;  1KZF A;  4P4E A;  4QB9 A;  4X8I A;  1Y9W A;  1M4D A;  1TKF A;  4R8F A;  4Y49 C;  3CXQ A;  3IO1 A;  2ZED A;  1ZG7 A;  3SJF A;  2K5T A;  2EUI A;  1UWY A;  2BL1 A;  2P6F A;  3GUX A;  3TX8 A;  2FVG A;  5IB0 A;  4IF5 A;  2FCK A;  2FL4 A;  4R87 A;  2CF4 A;  3DR6 A;  1Y7R A;  2Z3K A;  5AG5 A;  4KVO E;  2PJ9 A;  3IU1 A;  4M6G A;  4FAI A;  4EWT A;  2BCO A;  1HDQ A;  1B6B A;  2JEW A;  1EE3 P;  3GYA A;  1XE4 A;  2Q44 A;  4ZGY B;  4MHD A;  1XOV A;  1QQ9 A;  2JBK A;  4I49 A;  3T8W A;  5F49 A;  4UFV A;  3JUW A;  5THW A;  4KVX A;  5ELY A;  3PBE A;  5F47 A;  3SXN A;  4OME A;  4RI1 A;  3I3G A;  2Z11 A;  1P4N A;  2GLJ A;  2VZZ A;  4UEF A;  2DPT A;  4IK2 A;  4U9Z A;  4UWJ A;  4IUS A;  2OZG A;  3EFA A;  4MFL A;  5A27 A;  1M4I A;  4FD6 A;  1DE4 C;  3MN8 A;  4MFP A;  4X3R A;  4MJ8 A;  3S6H A;  3TTH A;  1Z8L A;  2WPX A;  3B35 A;  2Z3M A;  4H89 A;  4PXC A;  4KOR A;  4PK3 A;  5LRJ A;  1CP6 A;  3FRM A;  2PIY A;  2V8D A;  3FX6 A;  3R9E A;  1ZLI A;  4B5O A;  3PRT A;  2J8N A;  4L8A A;  4JJX A;  1Z8X A;  2B5G A;  2ZEL A;  3FEC A;  3PB4 X;  3DSB A;  3LOD A;  4A32 A;  2NMT A;  3D66 A;  4XNH C;  1HDU A;  2CY2 A;  1BOB A;  3KAS A;  1YLO A;  3RNZ A;  3ZZI A;  2OB0 A;  3PGP A;  4P4J A;  1S7K A;  2Z10 A;  2XEJ A;  3BHX A;  4EFD A;  3D2P A;  3W6S A;  4E2A A;  4P4F A;  1IIC A;  1SQH A;  5H84 A;  4F9V A;  5LYL A;  3NA6 A;  3IWW A;  4MHZ A;  2WPW A;  4QUS A;  2YNC A;  4NJR A;  4R57 A;  1IOI A;  3H8G A;  2Q4Z A;  4YGO A;  4NGP A;  3SI0 A;  4E8O A;  4XPD B;  3SI2 A;  4AVC A;  4CGP A;  1XJO A;  2REF A;  4NSQ A;  2GAN A;  3TO6 A;  1QSO A;  4OIW A;  4AG9 A;  2BUE A;  2FXF A;  2EBJ A;  4LUA A;  4F8Z A;  3TE4 A;  4PSW A;  2CTB A;  5LYD A;  1CX8 A;  5IV0 A;  5LYI A;  4MCR A;  3FYN A;  2WUU A;  3WC6 A;  2V77 A;  3CXP A;  4A31 A;  3FNC A;  1BPN A;  3BI1 A;  3W91 A;  3LD2 A;  4WJB A;  3PBB A;  1ARM A;  1YR0 A;  3S6K A;  4OAD A;  2I00 A;  2B58 A;  2YNE A;  2XEF A;  4UCM A;  4XPD C;  4A2Z A;  3RZA A;  4PXE A;  4P4I A;  1LFW A;  4KUB A;  3PB9 X;  3N5F A;  2I79 A;  3ISX A;  4B10 A;  2YNC C;  1ON0 A;  2PDO A;  4K3N A;  5HVG A;  3LWU A;  4X2T A;  5I4M A;  1VHO A;  4W9Y A;  5DS0 A;  4KOY A;  4MCS A;  4OP4 A;  2JLM A;  4ZBG A;  1Y9K A;  3GKR A;  3I1U A;  3KGQ A;  4OC0 A;  3R95 A;  1YSJ A;  3PB6 X;  3VWD A;  3KI9 A;  4EME A;  5IX3 A;  3JTK A;  2AFS A;  3OWC A;  4P45 A;  2Z3L A;  3P2F A;  1QMU A;  4R9M A;  2O4H A;  4BD9 A;  1BO4 A;  4GXH A;  4MMO A;  2B3V A;  2JDD A;  4C7H A;  2IMO A;  4OAE A;  3S9M A;  4CAX A;  5H86 A;  1Y7E A;  4DUK A;  5BWA B;  1HEE A;  3B3C A;  4Y49 B;  4MFQ A;  2ZEF A;  4NGQ A;  4H2K A;  3SJE A;  3KZW A;  2WSA A;  3WT4 A;  4JWP A;  2R1I A;  2PJ5 A;  3H5Z A;  3IFE A;  1TF8 A;  4PQA A;  3QAY A;  3RO0 A;  3KHX A;  2PE3 A;  1KUV A;  2D4P A;  1YLE A;  1M44 A;  4M3S A;  1Z2L A;  1NSL A;  4NCZ A;  2H5M A;  2JEV A;  5I0C A;  2Q51 A;  3E0K A;  3RAM A;  2OZU A;  4OC1 A;  3DGV A;  2ODF A;  2Q0Y A;  3GB0 A;  2G9D A; 
#chains in the Genus database with same CATH homology
 1RO5 A;  4AVB A;  3F0A A;  2AE6 A;  4YRH A;  1L0C A;  1YGH A;  3P2H A;  4FD5 A;  4KLV A;  2HUZ A;  5F48 A;  1Q2D A;  3IU2 A;  5JPH A;  3D3S A;  3NE7 A;  4H6Z A;  1YX0 A;  3R96 A;  4MY3 A;  4F6A A;  4QC6 A;  4UCN A;  5G20 A;  2X7B A;  4MFJ A;  4XPL A;  2Q7B A;  2CXA A;  2PQ8 A;  4UFX A;  2DXQ A;  4R3K A;  3KKW A;  4YFJ A;  2YGW A;  4B12 A;  2CNM A;  2C27 A;  3BJ7 A;  2O28 A;  4B11 A;  4CYO A;  2R98 A;  1YVK A;  2KCW A;  4ONU A;  2Z0Z A;  1RXT A;  4XNH B;  2IL4 A;  3R1K A;  2ZW4 A;  1M4G A;  4U5Y A;  5CNP A;  4QVT A;  4HKF A;  5C88 A;  4KOX A;  4PV6 A;  1YRE A;  4NF1 A;  4CYQ A;  2ZPA A;  4CYN A;  2J8M A;  1CM0 A;  4MY0 A;  2FIA A;  1OZP A;  2CNS A;  3JVN A;  1Z4R A;  4B5P A;  1S3Z A;  2B5G B;  4CS0 B;  4C2Z A;  1I12 A;  2REE A;  5A28 A;  4A33 A;  4LX9 A;  3K9U A;  4U9Y A;  5EBV A;  2J8R A;  1QSM A;  4CAV A;  1WK4 A;  1GHE A;  3BJ8 A;  4B5P B;  4II9 A;  4PSX A;  4A30 A;  3D2M A;  1B87 A;  2G3A A;  4C2X A;  3VWE A;  3S6F A;  4AVA A;  3PZJ A;  4CAE A;  4MI4 A;  2QIR A;  2Z3O A;  4UA3 A;  4R3L A;  5DWN A;  3G8W A;  4KOS A;  4L89 A;  2YND A;  1MJ9 A;  3PP9 A;  1VHS A;  4OLL A;  4Q38 A;  2ARH A;  4CGN A;  4F0Y A;  5HMN A;  3EXN A;  1N71 A;  2GIV A;  5G1Z A;  1S5K A;  4DNC A;  5AG7 A;  3TO9 A;  3S6G A;  4NXY A;  3DDD A;  1LRZ A;  2AJ6 A;  1XMT A;  2RC4 A;  4C2Y A;  2FIW A;  4NEX A;  3R9F A;  1I1D A;  5EC4 A;  3IWE A;  2Q04 A;  3SHP A;  5G22 A;  4CRY B;  5DWM A;  3EO4 A;  2F5I A;  1MK4 A;  4UWI A;  2GE3 A;  1KUY A;  3IGR A;  1Q2C A;  4JXR A;  3TOA A;  2PR1 A;  2ZXV A;  4KOW A;  4JD6 A;  1MJB A;  3F8K A;  2PSW A;  2FS5 A;  3FXT A;  1S7F A;  3MGD A;  5HH1 A;  3TO7 A;  4C68 A;  4KZT A;  3EY5 A;  3SXO A;  5JQ4 A;  1S7N A;  1Q2Y A;  1QSN A;  1P0H A;  4JXQ A;  3CXS A;  4ORF A;  2FE7 A;  2ZW5 A;  2A4N A;  4KVM E;  1YK3 A;  1NE9 A;  3F5B A;  4PK2 A;  2BEI A;  4CGM A;  3V8I A;  4KLW A;  1J4J A;  4CYP A;  4HNW B;  3G3S A;  1IYL A;  2G3T A;  2ZW7 A;  3ZJ0 A;  2P6E A;  2FT0 A;  4UBR A;  3A9L A;  2Q4Y A;  5C82 A;  3I9S A;  2QEC A;  2R8V A;  2CNT A;  2JDC A;  4KS9 A;  2B3U A;  4QBJ A;  5GCN A;  4XPK A;  3TT2 A;  4CGO A;  1R57 A;  3BLN A;  1QSR A;  2FSR A;  4A95 A;  2OH1 A;  1CJW A;  4HNX B;  1TIQ A;  4CRZ B;  4BMH A;  4KSA A;  2P6G A;  1S60 A;  5FVJ A;  4AG7 A;  4KSF A;  5KTA A;  2Z3N A;  4C7I A;  2P0W A;  4FD4 A;  2VEZ A;  1PUA A;  2PC1 A;  4J3G A;  2OZH A;  4FD7 A;  4MBU A;  2Q4V A;  4B13 A;  4KOU A;  2EVN A;  3QB8 A;  2VBQ A;  3C26 A;  3W6X A;  1IB1 E;  1V0C A;  1PU9 A;  5J8C A;  4JLY A;  2VXK A;  3N7Z A;  4UCP A;  1XF8 A;  2B4B A;  4CGL A;  3FB3 A;  5AGE A;  2VZY A;  4KOV A;  5E96 A;  1Z4E A;  3FBU A;  3TOB A;  3H4Q A;  4MFK A;  3T90 A;  2D4O A;  5KTC A;  2VQY A;  3TCV A;  3RYO A;  4KUA A;  2PRB A;  4CAF A;  3FIX A;  2DPS A;  3WR7 A;  1YVO A;  4X5K A;  4E0A A;  1FY7 A;  3DNS A;  1QST A;  4Q36 A;  4KOT A;  2Z3P A;  1IYK A;  1XIX A;  2PR8 A;  3R9G A;  5J8F A;  1KUX A;  1WWZ A;  4EVY A;  1K4J A;  2VI7 A;  5G21 A;  4CAW A;  1Z9U A;  1VKC A;  2R7H A;  3DR8 A;  3EC4 A;  4H6U A;  1M1D A;  1I21 A;  2Y0M A;  4M85 A;  4RS2 A;  2BSW A;  5AG4 A;  1S7L A;  4GS4 A;  4B14 A;  1MJA A;  4UFW A;  3TFY A;  1ZO0 A;  2G0B A;  3T9Y A;  3IWG A;  5F46 A;  1UFH A;  3GY9 A;  3QAH A;  2B4D A;  4BBH A;  4HNY B;  3UY5 A;  1NMT A;  4F0X A;  5ISV A;  3D8P A;  3B8G A;  1XEB A;  5AG6 A;  4MFZ A;  4K30 A;  1IID A;  2QML A;  4AB7 A;  2HQY A;  2B4D B;  2ATR A;  2OU2 A;  2HV2 A;  1U6M A;  2ZW6 A;  4QB9 A;  1KZF A;  1Y9W A;  1M4D A;  4Y49 C;  3CXQ A;  2K5T A;  2EUI A;  2BL1 A;  2P6F A;  5IB0 A;  4IF5 A;  2FCK A;  2FL4 A;  4R87 A;  3DR6 A;  1Y7R A;  2Z3K A;  5AG5 A;  4KVO E;  3IU1 A;  1B6B A;  3GYA A;  1XE4 A;  2Q44 A;  4ZGY B;  4MHD A;  4I49 A;  5F49 A;  4UFV A;  3JUW A;  4KVX A;  5F47 A;  3SXN A;  4RI1 A;  2Z11 A;  1P4N A;  2VZZ A;  2DPT A;  4U9Z A;  4UWJ A;  4IUS A;  2OZG A;  3EFA A;  4MFL A;  5A27 A;  1M4I A;  4FD6 A;  4MFP A;  3S6H A;  4MJ8 A;  3TTH A;  2WPX A;  2Z3M A;  4H89 A;  4KOR A;  4PK3 A;  3FRM A;  3R9E A;  4B5O A;  2J8N A;  4L8A A;  4JJX A;  2B5G A;  3DSB A;  3LOD A;  4A32 A;  2NMT A;  4XNH C;  2CY2 A;  1BOB A;  3ZZI A;  2OB0 A;  3PGP A;  1S7K A;  2Z10 A;  3D2P A;  3W6S A;  4E2A A;  1IIC A;  1SQH A;  5H84 A;  2WPW A;  4QUS A;  2YNC A;  4R57 A;  4YGO A;  5KTD A;  4E8O A;  4XPD B;  4AVC A;  4CGP A;  2REF A;  4NSQ A;  2GAN A;  3TO6 A;  1QSO A;  4AG9 A;  2BUE A;  2FXF A;  4LUA A;  3TE4 A;  4PSW A;  5IV0 A;  3FYN A;  2WUU A;  4A31 A;  3CXP A;  3FNC A;  3W91 A;  3LD2 A;  1YR0 A;  3S6K A;  4OAD A;  2I00 A;  2B58 A;  2YNE A;  4UCM A;  4XPD C;  4A2Z A;  4KUB A;  2I79 A;  4B10 A;  2YNC C;  1ON0 A;  2PDO A;  4KOY A;  2JLM A;  4ZBG A;  1Y9K A;  3GKR A;  3VWD A;  3R95 A;  5IX3 A;  3JTK A;  3OWC A;  2Z3L A;  3P2F A;  4R9M A;  1BO4 A;  2B3V A;  2JDD A;  4C7H A;  4OAE A;  4CAX A;  5H86 A;  5BWA B;  4Y49 B;  4MFQ A;  2WSA A;  4JWP A;  2R1I A;  3H5Z A;  1KUV A;  2D4P A;  1YLE A;  1M44 A;  4M3S A;  1NSL A;  4NCZ A;  2H5M A;  2JEV A;  5I0C A;  3E0K A;  2OZU A;  2Q0Y A;  3I3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...