4R3LA

Crystal structure of ard1 n-terminal acetyltransferase from sulfolobus solfataricus bound to substrate peptide fragment and coa
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
DFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAIVDNSVVGYIMPRIEWGFSNIKQLPSLVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYYADGEDAYLMARPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase substrate
molecule keywords Uncharacterized N-acetyltransferase SSO0209
publication title Structural Basis for Substrate-specific Acetylation of N alpha-acetyltransferase Ard1 from Sulfolobus solfataricus
pubmed doi rcsb
source organism Sulfolobus solfataricus p2
total genus 51
structure length 157
sequence length 157
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2014-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4r3lA00
5KTDA 3H4QA 3R9EA 5ISVA 2H5MA 3TOBA 1K4JA 2Y0MA 5JQ4A 2HQYA 3TOAA 2CNTA 3DDDA 4RI1A 4HKFA 2AJ6A 3D2MA 3QAHA 2CNSA 4JXRA 2Q7BA 3P2FA 5EC4A 2Q4YA 4MY0A 1I1DA 4CAXA 4YFJA 1M44A 4KOVA 2CY2A 2P6EA 1OZPA 3PGPA 4PK2A 1BOBA 2A4NA 4MI4A 5F47A 3R96A 3NE7A 1S60A 4UWJA 4M3SA 3VWDA 2OB0A 4R3LA 4PSXA 4OADA 2D4PA 4OAEA 1XF8A 4II9A 2VXKA 1PU9A 5E96A 2R8VA 4NF1A 3SXNA 2GANA 3OWCA 1CM0A 2PR8A 3BJ8A 5J8CA 4AG9A 2DXQA 1RXTA 3EC4A 4PK3A 4AVBA 1IB1E 2P6GA 2OZGA 4U5YA 4XPDB 2B4DB 2FE7A 5F46A 3E0KA 1YVOA 4HNXB 4JJXA 2BUEA 3TT2A 2JDDA 4XNHC 2R7HA 2BL1A 2EUIA 3T9YA 2G3TA 3N7ZA 1M4DA 2AE6A 3FRMA 1N71A 1UFHA 1B6BA 3S6HA 4XPLA 1KUYA 1VKCA 3I9SA 3MGDA 4FD7A 2GIVA 2JDCA 2ZPAA 2QMLA 4HNYB 3CXSA 1GHEA 4QBJA 1IYLA 5C82A 1M4IA 4MHDA 4LX9A 2EVNA 1MJ9A 4E0AA 4XPKA 5C88A 4NEXA 2KCWA 2PRBA 4F0YA 3WR7A 3FYNA 4B5PA 2ATRA 2O28A 2RC4A 2F5IA 4IF5A 4KVOE 2JEVA 4R3KA 2VBQA 3UY5A 4B5OA 3FB3A 4MY3A 3W6XA 1S7KA 5DWNA 2REEA 3P2HA 3G8WA 2WPXA 1Q2CA 3JVNA 3F0AA 2REFA 2VZYA 1NMTA 3FNCA 2J8MA 1PUAA 2BEIA 3IWGA 4AVAA 1YX0A 2ZW5A 4KVXA 4QUSA 1WWZA 3IGRA 4KUAA 2PQ8A 4J3GA 3TO6A 2OZHA 1QSTA 2PC1A 1XEBA 4KOTA 4Y49C 4F6AA 2CNMA 5F48A 4L8AA 2Q04A 2C27A 4M85A 4L89A 1M1DA 4EVYA 2J8NA 2Z11A 2B58A 4KOUA 3CXPA 2PSWA 5J8FA 2QECA 5H86A 4X5KA 5DWMA 4KLWA 1LRZA 1P4NA 1KUXA 3F8KA 1L0CA 3S6FA 2GE3A 4OLLA 4BMHA 1YREA 4R9MA 2P0WA 4IUSA 1KZFA 4FD5A 1ON0A 4MBUA 3R1KA 1KUVA 2J8RA 3GY9A 5GCNA 2I00A 4NCZA 3D8PA 1B87A 2VEZA 1XE4A 1QSNA 4CRYB 3FIXA 1V0CA 3R9FA 1Z9UA 1Z4EA 3TCVA 3W6SA 3W91A 4LUAA 2X7BA 1IYKA 4CAWA 5HH1A 1VHSA 2IL4A 4QVTA 2B5GA 5KTAA 1MJBA 3KKWA 1YR0A 4PV6A 1Y9KA 3DR6A 2Z10A 2PR1A 3PZJA 1Z4RA 1IICA 4XPDC 1NSLA 5KTCA 4H6ZA 4UBRA 1WK4A 2FL4A 5IV0A 5EBVA 3TO7A 2FSRA 4AG7A 3QB8A 4KOXA 3ZJ0A 4RS2A 5H84A 2JLMA 3S6GA 2Q4VA 2FS5A 4KOYA 4QC6A 4KLVA 4Y49B 3I3GA 1M4GA 1S7FA 2P6FA 1QSOA 3BJ7A 2FIWA 1S3ZA 2B3VA 3DR8A 4CS0B 2BSWA 3TO9A 3DNSA 3CXQA 2WPWA 1NE9A 3TE4A 2Q44A 5CNPA 5I0CA 2FXFA 4PSWA 3B8GA 4R87A 4HNWB 3T90A 3EO4A 1I12A 2B4BA 2R98A 4B5PB 2FCKA 3R9GA 4E8OA 3BLNA 2B4DA 2HUZA 3K9UA 4XNHB 1QSMA 4GS4A 1CJWA 2PDOA 3G3SA 3PP9A 5HMNA 4QB9A 3JUWA 3LD2A 4AVCA 4FD6A 3ZZIA 2ZW4A 2G0BA 4KVME 2OU2A 3GYAA 1MJAA 1Q2YA 4MJ8A 3EFAA 4JD6A 3TTHA 1YLEA 1YGHA 1J4JA 3FBUA 2ZW6A 2ZW7A 3RYOA 5FVJA 2NMTA 3R95A 4CRZB 4R57A 4K30A 2OZUA 4KUBA 3D2PA 1Y7RA 2Z0ZA 3S6KA 4H89A 1Q2DA 1QSRA 4KOSA 4YRHA 4JWPA 3LODA 1S5KA 4NSQA 1I21A 3FXTA 4ZBGA 1P0HA 1YK3A 1BO4A 1RO5A 5IB0A 1Y9WA 2D4OA 1SQHA 2FT0A 4KOWA 2Q0YA 1U6MA 4YGOA 5JPHA 2B3UA 2HV2A 1XMTA 4FD4A 4CAVA 4E2AA 3VWEA 4ORFA 3C26A 4AB7A 3D3SA 1MK4A 1S7NA 1S7LA 2VQYA 2VI7A 2K5TA 2ARHA 1XIXA 1YVKA 4U9YA 1R57A 3EXNA 2VZZA 2G3AA 3SHPA 3TFYA 4NXYA 2QIRA 5F49A 2I79A 1FY7A 1TIQA 2OH1A 3EY5A 4ONUA 3SXOA 2FIAA 5IX3A 4UWIA 3F5BA 4KZTA 1IIDA 4UA3A 3V8IA 2ZXVA 2B5GB 4DNCA 4KORA 4I49A 4H6UA 4JXQA 4U9ZA 3DSBA 3GKRA 4JLYA 2R1IA
chains in the Genus database with same CATH superfamily
3FEDA 3S9MA 5KTDA 2XEGA 3H4QA 7CPAA 1ELMP 4PXDA 3FJUA 3R9EA 3D66A 5ISVA 2H5MA 3FX6A 2F7VA 2PJ1A 3TOBA 4B14A 1K4JA 2Y0MA 3CT9A 4MHNA 5JQ4A 4Q7AA 2HQYA 4UFVA 3TOAA 5K8PA 2CNTA 1AMPA 4P4BA 2PJ3A 3DDDA 4RI1A 4Q38A 4HKFA 2AJ6A 3D2MA 2IMOA 3NH8A 4MFZA 1YMEA 3QAHA 2CNSA 3SJFA 4JXRA 2Q7BA 3P2FA 5EC4A 2AFUA 1GYTA 2Q4YA 1I1DA 3HLPA 4MY0A 5HVFA 1M44A 4CAXA 4YFJA 4KOVA 4A94A 2CY2A 2P6EA 4OC3A 1OZPA 3PGPA 4GM5A 4PK2A 2DPSA 4C7IA 1BOBA 3IWWA 2A4NA 3N5FA 2XEFA 4MI4A 5F47A 3R96A 2PJ0A 3NE7A 1S60A 4UWJA 5BWAB 4M3SA 3VWDA 2OB0A 4OIWA 4R3LA 4PSXA 4OADA 1M4LA 2D4PA 3IIBA 1FNOA 4OAEA 1XF8A 5F09A 1F2PA 2PJAA 4YWYA 4II9A 3PFOA 3WC5A 2VXKA 3RZAA 1PU9A 4CYQA 4UIBA 3ISXA 2PJBA 2C6CA 2Z3LA 2R8VA 4NF1A 5AG5A 5E96A 5G20A 3SXNA 2GANA 3OWCA 1CM0A 1H8LA 3LWUA 3GLJA 4C7HA 3PB7X 2HB6A 2PR8A 2GLJA 2G9DA 3BJ8A 4UEEA 3IU2A 5J8CA 4A39A 1LOKA 4A95A 4MFKA 1VHOA 3WC6A 3WT4A 2DXQA 1RXTA 3EC4A 3PRTA 2AFZA 4AG9A 4ZI6A 3FF3A 4PK3A 2WYRA 4AVBA 3V7ZA 1IB1E 2P6GA 4P45A 5A28A 2OZGA 4U5YA 4CAFA 4ZYQA 4P10A 3B3TA 5AG7A 3FECA 4XPDB 2B4DB 2FE7A 5F46A 3E0KA 4PPZA 1TXRA 1YVOA 4BD9A 4HNXB 4JJXA 2BUEA 1HEEA 3TT2A 2JDDA 3FVLA 3JTKA 4XNHC 2R7HA 2Q43A 2BL1A 1YW4A 3PB6X 2EUIA 4PXCA 3T9YA 4B6ZA 3GUXA 4EMEA 2G3TA 5IB9A 3KR4A 3SJGA 3N7ZA 1M4DA 2AE6A 4KS9A 3FRMA 1N71A 3KHZA 4HPSA 5K8NA 1UFHA 3QAYA 1B6BA 4OKOA 3S6HA 4XPLA 1KUYA 5CPAA 5G22A 1FT7A 3MN8A 2XEIA 3SI1A 1VKCA 4MHZA 4G1PA 4MXUA 3I9SA 4CYPA 1BPMA 1CP6A 3MGDA 2Z3NA 2GIVA 4FD7A 4K3NA 4F9VA 5HVHA 1X10A 2JDCA 2ZPAA 4FWUA 2QMLA 4NGPA 3D7GA 5D29A 4TWEA 2RFHA 4HNYB 3CXSA 2PVWA 1JWQA 3LMSA 1Y0YA 1GHEA 4UFWA 4QBJA 1IYLA 3D68A 2POKA 5C82A 1M4IA 4MHDA 4LX9A 4C68A 2EVNA 5LYFA 1MJ9A 5LRGA 4E0AA 4CGNA 2V8DA 1TKHA 4XPKA 2DF5A 5C88A 4NEXA 3TC8A 2YGWA 2DPTA 2KCWA 3HUVA 4NGNA 2PRBA 4F0YA 1PYTB 3GIUA 3WR7A 3FYNA 4B5PA 3ISZA 2ATRA 3B3WA 2O28A 2PJ7A 2RC4A 2F5IA 5LRKA 4A37A 5DS0A 4ZX9A 4DJLA 2Q4ZA 3K2KA 4IF5A 3VARA 1IOIA 5LYLA 1Y7EA 4NJQA 4OC4A 4KVOE 4X8IA 3H5ZA 2JEVA 1Z5RA 3PEIA 4R3KA 3H8EA 2VBQA 1NSAA 2YNCA 3UY5A 1TF8A 3BXMA 4MCQA 4B5OA 2F8HA 4NFRA 4MCRA 3FB3A 4MY3A 2ANPA 3IU1A 3W6XA 3IEHA 1S7KA 2PE3A 1IGBA 2GLFA 5DWNA 3RO0A 2REEA 2ZOFA 3P2HA 3G8WA 2WPXA 1IY7A 1Q2CA 3PBBA 5K8OA 3JVNA 3B3CA 3F0AA 2REFA 2VZYA 1NMTA 4MRIA 2ZOGA 3FNCA 1XOVA 4UIAA 4B12A 3KQZA 2J8MA 2QVPA 1PUAA 2BEIA 1ZLHA 2QJ8A 3IWGA 4KSAA 4AVAA 4FUUA 1YX0A 2ZW5A 2PJ8A 4KVXA 2IQ6A 4QUSA 2PJ9A 3KGQA 1WWZA 3H8GA 2AFWA 3IGRA 3KI9A 4KUAA 2PQ8A 2ZELA 4J3GA 3D7HA 4MFQA 2ZEOA 2PCUA 3TO6A 4A30A 2OZHA 4F0XA 1X12A 1QSTA 1R43A 1XEBA 2PC1A 2EK9A 4KOTA 1IU8A 3FMCA 4Y49C 2AFOA 4F6AA 4X3RA 2CNMA 5F48A 4L8AA 2Q04A 3T8WA 2C27A 1Z8TA 4M85A 2J9AA 2QYVA 4OC2A 4L89A 1CPXA 1M1DA 2O4HA 4EVYA 2J8NA 3B35A 3CZXA 4WWVA 2Z11A 2B58A 4KOUA 4JYWA 3S9NA 1VGYA 3KZWA 2IJZA 2PVVA 3CXPA 4W9YA 4A33A 2PSWA 5J8FA 4UEFA 5EMIA 2QECA 5H86A 3D7DA 5LYDA 5CBMA 4X5KA 1EE3P 1YSJA 5DWMA 3B7IA 1QQ9A 1HDQA 2PIYA 4KLWA 4RN7A 6CPAA 2ABZA 4UFXA 1LRZA 4P4EA 1P4NA 1KUXA 1UWYA 1ZG7A 2V8HA 4CGOA 2GREA 4PQAA 4RUHA 3F8KA 5G1ZA 1L0CA 5J1QA 2ZEHA 4H2KA 2VL1A 1Z8LA 3S6FA 2GE3A 4NGSA 1TF9A 2ZENA 4OLLA 1ZLIA 3FEEA 3BI0A 3SI0A 1BLLE 4BMHA 1YREA 2EWBA 2ZEDA 4CYNA 1XRYA 2AFXA 4WJBA 1ELLP 2YNCC 2P0WA 4R9MA 5LRJA 4IUSA 1KZFA 2YNEA 4FD5A 1F57A 1ON0A 4MBUA 2Q51A 3R1KA 4MHYA 4CGLA 5JM6A 2NYQA 1KUVA 2J8RA 1F2OA 3GY9A 4O23A 5AGEA 2I00A 4NCZA 5GCNA 3D8PA 1B87A 1XJOA 2VEZA 3D67A 1XE4A 1QSNA 3IFEA 1Z2LA 4DYOA 4CRYB 2C1CA 3FIXA 1V0CA 5AG6A 3R9FA 3SJXA 4B10A 1Z9UA 4C2ZA 1CX8A 4CGPA 1Z4EA 4IK2A 3TCVA 2PIZA 3W6SA 3W91A 4LUAA 2I3CA 2X7BA 5D8NA 1IYKA 4CAWA 5HH1A 2CF4A 2WZNA 4ZGYB 2Z3OA 2JBJA 1VHSA 2IL4A 4QVTA 4YU9A 2B5GA 3H8FA 5KTAA 1XFOA 2NSMA 1MJBA 3K9TA 3KKWA 1YR0A 1LAMA 4OMEA 4PV6A 2BO9A 1TKJA 4P4FA 1Y9KA 3DR6A 2Z10A 2PR1A 2ZEEA 3PZJA 3I1UA 5I4MA 5AG4A 1Z4RA 4M6GA 4PXBA 1IICA 1OBRA 4XPDC 1CP7A 4Q36A 1NSLA 1VHEA 2WSAA 5KTCA 4DUKA 4H6ZA 4UBRA 3MRUA 1WK4A 2FL4A 1DE4C 5IV0A 5EBVA 3TO7A 4M6IA 2FSRA 4AG7A 4Z65A 3QB8A 4KOXA 4A32A 3NA6A 1LCPA 3ZJ0A 1KWMA 1ZG9A 4RS2A 3PB9X 2PJ2A 4M6HA 2WUUA 3PB4X 2JLMA 2RB7A 5H84A 4FAIA 2DEAA 3S6GA 3CPAA 4A31A 4AXVA 4IHMA 2Q4VA 2FS5A 4KOYA 2BOAA 4QC6A 4KLVA 4MCSA 4Y49B 5A27A 3I3GA 3SJEA 1M4GA 1S7FA 1CPSA 2V8GA 2V77A 4OP4A 2P6FA 2EBJA 3KHXA 1QSOA 1Y0RA 5HVGA 3BJ7A 2FIWA 1S3ZA 2B3VA 3DR8A 3SI2A 1YW6A 4CS0B 2BSWA 3DGVA 3TO9A 2PJ6A 3DNSA 3QNVA 1XMBA 3CXQA 4NGTA 2WPWA 1NE9A 2XEJA 3TE4A 2Q44A 5CNPA 5I0CA 2FXFA 8CPAA 4PSWA 4BBHA 3NH4A 1VIXA 4UEZA 1DTDA 2BCOA 4F8ZA 1LANA 3B8GA 2AFMA 2OR4A 1CBXA 4HNWB 4R87A 3T90A 3EO4A 4CPAA 1I12A 3L2NA 2B4BA 4UCMA 2R98A 4NGQA 1IOFA 2FCKA 3R9GA 3WC7A 4B5PB 3BI1A 4E8OA 4OIDA 3BLNA 3PFEA 2C6PA 3B3SA 2B4DA 3RNZA 2HUZA 2CTBA 3K9UA 4NGMA 3B2YA 4XNHB 1QSMA 2C6GA 4GS4A 1YLOA 4LQ6A 4ZX8A 1CJWA 2PDOA 3G3SA 3FH4A 3PP9A 3NH5A 3JUWA 2GU2A 4QB9A 5ELYA 4A38A 3D4UA 5HMNA 3LD2A 4AVCA 1PCAA 4FD6A 4A2ZA 2GFQA 4ONWA 4P4IA 3ZZIA 2ZW4A 1AYEA 2G0BA 1Q7LA 3GB0A 3JRUA 4KVME 2OU2A 3GYAA 1MJAA 1Q2YA 2CIJA 4MJ8A 4JZ0A 3EFAA 4R6TA 4MMOA 5JH9A 2JBKA 4JD6A 3TTHA 2Z3MA 1YLEA 1YGHA 1J4JA 3FBUA 2ZW6A 2PJ5A 2ZW7A 3RYOA 5FVJA 2NMTA 2FVGA 4UCPA 4NGRA 3IC1A 3R95A 4UF4A 3A9LA 1AUGA 4CRZB 3LACA 4R57A 4K30A 4EWTA 2O53A 2OZUA 4KUBA 4ZY1A 4CYOA 4MHPA 1CG2A 4MFJA 3CPXA 3D2PA 1Y7RA 2Z0ZA 1RTQA 1A2ZA 4LQGA 4H89A 3S6KA 1ZG8A 1TKFA 4FBEA 3IO1A 1Q2DA 1QSRA 2ZEMA 4KOSA 4YRHA 4JWPA 3NE8A 3V38A 3KL9A 3LODA 3WABA 3PBEA 4ZY0A 1S5KA 4P4JA 4B11A 4NSQA 4B13A 4GXHA 1HDUA 1I21A 3FXTA 5THWA 4ZBGA 5LYIA 3BHXA 3KASA 1P0HA 2JEWA 2PJ4A 1YK3A 1BO4A 1RO5A 2AFSA 4C2XA 5IB0A 1Z8XA 1QMUA 4MCPA 4P4DA 1Y9WA 1XBUA 2D4OA 2OOTA 1SQHA 1BAVA 4C2YA 4CGMA 4MFPA 2FT0A 2EK8A 3DLJA 3VH9A 4X2TA 4KOWA 2PJCA 2Q7SA 4P44A 4P6YA 2Q0YA 1U6MA 4UCNA 3VATA 4YGOA 4BINA 2B3UA 2R1IA 3IWEA 4R8FA 4CAEA 2HV2A 2V8VA 5JPHA 2Z3KA 4TNUA 1XMTA 2ODFA 4FD4A 4CAVA 4E2AA 1ARLA 1Z8WA 3VWEA 4ORFA 3C26A 4OC5A 4EFDA 4F9UA 5K8MA 4AB7A 3D3SA 1MK4A 4ZY2A 1S7NA 2ZEFA 4R7MA 1S7LA 2VQYA 3B3VA 1ARMA 2VI7A 2K5TA 2ARHA 5G21A 3D7FA 1XIXA 3S9LA 1YVKA 4U9YA 1R57A 2CXAA 1JQGA 3EXNA 1R3NA 4KSIA 2VZZA 2G3AA 3SHPA 3TFYA 4NXYA 2QIRA 2Z3PA 3KR5A 2I79A 5F49A 1FY7A 1TIQA 2OH1A 4IAVA 3EY5A 4ONUA 4OC1A 3SXOA 4KSFA 5HXDA 2FIAA 2YNDA 1BPNA 3RAMA 2ZEPA 5IX3A 4R76A 1LAPA 3F5BA 4UWIA 4KZTA 4OC0A 1IIDA 3KQXA 4UA3A 3V8IA 2HC9A 2ZXVA 3NFZA 2B5GB 4DNCA 1YQEA 4PXEA 4KORA 1LFWA 3CDXA 3IJ3A 2ZEGA 3PB8X 4H6UA 4I49A 4JXQA 3TX8A 2EO8A 4U9ZA 3DSBA 4NJRA 5JGFA 2CTCA 3GKRA 4MFLA 4JLYA 3RBUA 1ZO0A 2PRQA
chains in the Genus database with same CATH topology
5KTDA 3H4QA 3R9EA 5ISVA 2H5MA 3TOBA 4B14A 1K4JA 2Y0MA 5JQ4A 4UFVA 2HQYA 3TOAA 2CNTA 3DDDA 4RI1A 4Q38A 4HKFA 2AJ6A 3D2MA 4MFZA 3QAHA 2CNSA 4JXRA 2Q7BA 3P2FA 5EC4A 2Q4YA 4MY0A 1I1DA 4CAXA 4YFJA 1M44A 4KOVA 2CY2A 2P6EA 1OZPA 3PGPA 4PK2A 2DPSA 4C7IA 1BOBA 2A4NA 4MI4A 5F47A 3R96A 3NE7A 1S60A 4UWJA 5BWAB 4M3SA 3VWDA 2OB0A 4R3LA 4PSXA 4OADA 2D4PA 4OAEA 1XF8A 4II9A 2VXKA 1PU9A 4CYQA 5E96A 2Z3LA 5G20A 2R8VA 4NF1A 5AG5A 3SXNA 2GANA 3OWCA 1CM0A 4C7HA 2PR8A 3BJ8A 3IU2A 5J8CA 4A95A 4MFKA 4AG9A 2DXQA 1RXTA 3EC4A 4PK3A 4AVBA 1IB1E 2P6GA 5A28A 2OZGA 4U5YA 4CAFA 5AG7A 4XPDB 2B4DB 2FE7A 5F46A 3E0KA 1YVOA 4HNXB 4JJXA 2BUEA 3TT2A 2JDDA 3JTKA 4XNHC 2R7HA 2BL1A 2EUIA 3T9YA 2G3TA 3N7ZA 1M4DA 2AE6A 4KS9A 3FRMA 1N71A 1UFHA 1B6BA 3S6HA 4XPLA 1KUYA 5G22A 1VKCA 3I9SA 4CYPA 3MGDA 2Z3NA 2GIVA 4FD7A 2JDCA 2ZPAA 2QMLA 4HNYB 3CXSA 1GHEA 4UFWA 4QBJA 1IYLA 5C82A 1M4IA 4MHDA 4LX9A 4C68A 2EVNA 1MJ9A 4E0AA 4CGNA 4XPKA 5C88A 4NEXA 2YGWA 2DPTA 2KCWA 2PRBA 4F0YA 3WR7A 3FYNA 4B5PA 2ATRA 2O28A 2RC4A 2F5IA 4IF5A 4KVOE 3H5ZA 2JEVA 4R3KA 2VBQA 2YNCA 3UY5A 4B5OA 3FB3A 4MY3A 3W6XA 3IU1A 1S7KA 5DWNA 2REEA 3P2HA 3G8WA 2WPXA 1Q2CA 3JVNA 3F0AA 2REFA 2VZYA 1NMTA 3FNCA 4B12A 2J8MA 4KSAA 1PUAA 2BEIA 3IWGA 4AVAA 1YX0A 2ZW5A 4KVXA 4QUSA 1WWZA 3IGRA 4KUAA 2PQ8A 4J3GA 4MFQA 3TO6A 4A30A 2OZHA 4F0XA 1QSTA 2PC1A 1XEBA 4KOTA 4Y49C 4F6AA 2CNMA 5F48A 4L8AA 2Q04A 2C27A 4M85A 4L89A 1M1DA 4EVYA 2J8NA 2Z11A 2B58A 4KOUA 3CXPA 4A33A 2PSWA 5J8FA 2QECA 5H86A 4X5KA 5DWMA 4KLWA 4UFXA 1LRZA 1P4NA 1KUXA 4CGOA 3F8KA 5G1ZA 1L0CA 3S6FA 2GE3A 4OLLA 4BMHA 1YREA 4CYNA 4R9MA 2YNCC 2P0WA 4IUSA 1KZFA 2YNEA 4FD5A 1ON0A 4CGLA 4MBUA 3R1KA 1KUVA 2J8RA 3GY9A 5AGEA 5GCNA 2I00A 4NCZA 3D8PA 1B87A 2VEZA 1XE4A 1QSNA 4CRYB 3FIXA 1V0CA 5AG6A 3R9FA 4B10A 1Z9UA 4C2ZA 4CGPA 1Z4EA 3TCVA 3W6SA 3W91A 4LUAA 2X7BA 1IYKA 4CAWA 5HH1A 4ZGYB 2Z3OA 1VHSA 2IL4A 4QVTA 2B5GA 5KTAA 1MJBA 3KKWA 1YR0A 4PV6A 1Y9KA 3DR6A 2Z10A 2PR1A 3PZJA 5AG4A 1Z4RA 1IICA 4XPDC 4Q36A 1NSLA 5KTCA 2WSAA 4H6ZA 4UBRA 1WK4A 2FL4A 5IV0A 5EBVA 3TO7A 2FSRA 4AG7A 3QB8A 4KOXA 4A32A 3ZJ0A 4RS2A 2WUUA 5H84A 2JLMA 4A31A 3S6GA 2Q4VA 2FS5A 4KOYA 4QC6A 4KLVA 4Y49B 5A27A 3I3GA 1M4GA 1S7FA 2P6FA 1QSOA 3BJ7A 2FIWA 1S3ZA 2B3VA 3DR8A 4CS0B 2BSWA 3TO9A 3DNSA 3CXQA 2WPWA 1NE9A 3TE4A 2Q44A 5CNPA 5I0CA 2FXFA 4PSWA 4BBHA 3B8GA 4R87A 4HNWB 3T90A 3EO4A 1I12A 2B4BA 4UCMA 2R98A 4B5PB 2FCKA 3R9GA 4E8OA 3BLNA 2B4DA 2HUZA 3K9UA 4XNHB 1QSMA 4GS4A 1CJWA 2PDOA 3G3SA 3PP9A 5HMNA 4QB9A 3JUWA 3LD2A 4AVCA 4FD6A 4A2ZA 3ZZIA 2ZW4A 2G0BA 4KVME 2OU2A 3GYAA 1MJAA 1Q2YA 4MJ8A 3EFAA 4JD6A 3TTHA 2Z3MA 1YLEA 1YGHA 1J4JA 3FBUA 2ZW6A 2ZW7A 3RYOA 5FVJA 2NMTA 4UCPA 3R95A 3A9LA 4CRZB 4R57A 4K30A 2OZUA 4KUBA 4CYOA 4MFJA 3D2PA 1Y7RA 2Z0ZA 3S6KA 4H89A 1Q2DA 1QSRA 4KOSA 4YRHA 4JWPA 3LODA 1S5KA 4B11A 4NSQA 4B13A 1I21A 3FXTA 4ZBGA 1P0HA 1YK3A 1BO4A 1RO5A 4C2XA 5IB0A 1Y9WA 2D4OA 4C2YA 1SQHA 4CGMA 4MFPA 2FT0A 4KOWA 2Q0YA 1U6MA 4UCNA 4YGOA 4CAEA 2B3UA 2R1IA 3IWEA 5JPHA 2HV2A 2Z3KA 1XMTA 4FD4A 4CAVA 4E2AA 3VWEA 4ORFA 3C26A 4AB7A 3D3SA 1MK4A 1S7NA 1S7LA 2VQYA 2VI7A 2K5TA 2ARHA 5G21A 1XIXA 1YVKA 4U9YA 1R57A 2CXAA 3EXNA 2VZZA 2G3AA 3SHPA 3TFYA 4NXYA 2QIRA 2Z3PA 5F49A 2I79A 1FY7A 1TIQA 2OH1A 3EY5A 4ONUA 3SXOA 4KSFA 2FIAA 2YNDA 5IX3A 4UWIA 3F5BA 4KZTA 1IIDA 4UA3A 3V8IA 2ZXVA 2B5GB 4DNCA 4KORA 4I49A 4H6UA 4JXQA 4U9ZA 3DSBA 3GKRA 4MFLA 4JLYA 1ZO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KTD A;  3H4Q A;  3R9E A;  5ISV A;  2H5M A;  3TOB A;  1K4J A;  2Y0M A;  5JQ4 A;  2HQY A;  3TOA A;  2CNT A;  3DDD A;  4RI1 A;  4HKF A;  2AJ6 A;  3D2M A;  3QAH A;  2CNS A;  4JXR A;  2Q7B A;  3P2F A;  5EC4 A;  2Q4Y A;  4MY0 A;  1I1D A;  4CAX A;  4YFJ A;  1M44 A;  4KOV A;  2CY2 A;  2P6E A;  1OZP A;  3PGP A;  4PK2 A;  1BOB A;  2A4N A;  4MI4 A;  5F47 A;  3R96 A;  3NE7 A;  1S60 A;  4UWJ A;  4M3S A;  3VWD A;  2OB0 A;  4R3L A;  4PSX A;  4OAD A;  2D4P A;  4OAE A;  1XF8 A;  4II9 A;  2VXK A;  1PU9 A;  5E96 A;  2R8V A;  4NF1 A;  3SXN A;  2GAN A;  3OWC A;  1CM0 A;  2PR8 A;  3BJ8 A;  5J8C A;  4AG9 A;  2DXQ A;  1RXT A;  3EC4 A;  4PK3 A;  4AVB A;  1IB1 E;  2P6G A;  2OZG A;  4U5Y A;  4XPD B;  2B4D B;  2FE7 A;  5F46 A;  3E0K A;  1YVO A;  4HNX B;  4JJX A;  2BUE A;  3TT2 A;  2JDD A;  4XNH C;  2R7H A;  2BL1 A;  2EUI A;  3T9Y A;  2G3T A;  3N7Z A;  1M4D A;  2AE6 A;  3FRM A;  1N71 A;  1UFH A;  1B6B A;  3S6H A;  4XPL A;  1KUY A;  1VKC A;  3I9S A;  3MGD A;  4FD7 A;  2GIV A;  2JDC A;  2ZPA A;  2QML A;  4HNY B;  3CXS A;  1GHE A;  4QBJ A;  1IYL A;  5C82 A;  1M4I A;  4MHD A;  4LX9 A;  2EVN A;  1MJ9 A;  4E0A A;  4XPK A;  5C88 A;  4NEX A;  2KCW A;  2PRB A;  4F0Y A;  3WR7 A;  3FYN A;  4B5P A;  2ATR A;  2O28 A;  2RC4 A;  2F5I A;  4IF5 A;  4KVO E;  2JEV A;  4R3K A;  2VBQ A;  3UY5 A;  4B5O A;  3FB3 A;  4MY3 A;  3W6X A;  1S7K A;  5DWN A;  2REE A;  3P2H A;  3G8W A;  2WPX A;  1Q2C A;  3JVN A;  3F0A A;  2REF A;  2VZY A;  1NMT A;  3FNC A;  2J8M A;  1PUA A;  2BEI A;  3IWG A;  4AVA A;  1YX0 A;  2ZW5 A;  4KVX A;  4QUS A;  1WWZ A;  3IGR A;  4KUA A;  2PQ8 A;  4J3G A;  3TO6 A;  2OZH A;  1QST A;  2PC1 A;  1XEB A;  4KOT A;  4Y49 C;  4F6A A;  2CNM A;  5F48 A;  4L8A A;  2Q04 A;  2C27 A;  4M85 A;  4L89 A;  1M1D A;  4EVY A;  2J8N A;  2Z11 A;  2B58 A;  4KOU A;  3CXP A;  2PSW A;  5J8F A;  2QEC A;  5H86 A;  4X5K A;  5DWM A;  4KLW A;  1LRZ A;  1P4N A;  1KUX A;  3F8K A;  1L0C A;  3S6F A;  2GE3 A;  4OLL A;  4BMH A;  1YRE A;  4R9M A;  2P0W A;  4IUS A;  1KZF A;  4FD5 A;  1ON0 A;  4MBU A;  3R1K A;  1KUV A;  2J8R A;  3GY9 A;  5GCN A;  2I00 A;  4NCZ A;  3D8P A;  1B87 A;  2VEZ A;  1XE4 A;  1QSN A;  4CRY B;  3FIX A;  1V0C A;  3R9F A;  1Z9U A;  1Z4E A;  3TCV A;  3W6S A;  3W91 A;  4LUA A;  2X7B A;  1IYK A;  4CAW A;  5HH1 A;  1VHS A;  2IL4 A;  4QVT A;  2B5G A;  5KTA A;  1MJB A;  3KKW A;  1YR0 A;  4PV6 A;  1Y9K A;  3DR6 A;  2Z10 A;  2PR1 A;  3PZJ A;  1Z4R A;  1IIC A;  4XPD C;  1NSL A;  5KTC A;  4H6Z A;  4UBR A;  1WK4 A;  2FL4 A;  5IV0 A;  5EBV A;  3TO7 A;  2FSR A;  4AG7 A;  3QB8 A;  4KOX A;  3ZJ0 A;  4RS2 A;  5H84 A;  2JLM A;  3S6G A;  2Q4V A;  2FS5 A;  4KOY A;  4QC6 A;  4KLV A;  4Y49 B;  3I3G A;  1M4G A;  1S7F A;  2P6F A;  1QSO A;  3BJ7 A;  2FIW A;  1S3Z A;  2B3V A;  3DR8 A;  4CS0 B;  2BSW A;  3TO9 A;  3DNS A;  3CXQ A;  2WPW A;  1NE9 A;  3TE4 A;  2Q44 A;  5CNP A;  5I0C A;  2FXF A;  4PSW A;  3B8G A;  4R87 A;  4HNW B;  3T90 A;  3EO4 A;  1I12 A;  2B4B A;  2R98 A;  4B5P B;  2FCK A;  3R9G A;  4E8O A;  3BLN A;  2B4D A;  2HUZ A;  3K9U A;  4XNH B;  1QSM A;  4GS4 A;  1CJW A;  2PDO A;  3G3S A;  3PP9 A;  5HMN A;  4QB9 A;  3JUW A;  3LD2 A;  4AVC A;  4FD6 A;  3ZZI A;  2ZW4 A;  2G0B A;  4KVM E;  2OU2 A;  3GYA A;  1MJA A;  1Q2Y A;  4MJ8 A;  3EFA A;  4JD6 A;  3TTH A;  1YLE A;  1YGH A;  1J4J A;  3FBU A;  2ZW6 A;  2ZW7 A;  3RYO A;  5FVJ A;  2NMT A;  3R95 A;  4CRZ B;  4R57 A;  4K30 A;  2OZU A;  4KUB A;  3D2P A;  1Y7R A;  2Z0Z A;  3S6K A;  4H89 A;  1Q2D A;  1QSR A;  4KOS A;  4YRH A;  4JWP A;  3LOD A;  1S5K A;  4NSQ A;  1I21 A;  3FXT A;  4ZBG A;  1P0H A;  1YK3 A;  1BO4 A;  1RO5 A;  5IB0 A;  1Y9W A;  2D4O A;  1SQH A;  2FT0 A;  4KOW A;  2Q0Y A;  1U6M A;  4YGO A;  5JPH A;  2B3U A;  2HV2 A;  1XMT A;  4FD4 A;  4CAV A;  4E2A A;  3VWE A;  4ORF A;  3C26 A;  4AB7 A;  3D3S A;  1MK4 A;  1S7N A;  1S7L A;  2VQY A;  2VI7 A;  2K5T A;  2ARH A;  1XIX A;  1YVK A;  4U9Y A;  1R57 A;  3EXN A;  2VZZ A;  2G3A A;  3SHP A;  3TFY A;  4NXY A;  2QIR A;  5F49 A;  2I79 A;  1FY7 A;  1TIQ A;  2OH1 A;  3EY5 A;  4ONU A;  3SXO A;  2FIA A;  5IX3 A;  4UWI A;  3F5B A;  4KZT A;  1IID A;  4UA3 A;  3V8I A;  2ZXV A;  2B5G B;  4DNC A;  4KOR A;  4I49 A;  4H6U A;  4JXQ A;  4U9Z A;  3DSB A;  3GKR A;  4JLY A;  2R1I A; 
#chains in the Genus database with same CATH topology
 3FED A;  3S9M A;  5KTD A;  2XEG A;  3H4Q A;  7CPA A;  1ELM P;  4PXD A;  3FJU A;  3R9E A;  3D66 A;  5ISV A;  2H5M A;  3FX6 A;  2F7V A;  2PJ1 A;  3TOB A;  4B14 A;  1K4J A;  2Y0M A;  3CT9 A;  4MHN A;  5JQ4 A;  4Q7A A;  2HQY A;  4UFV A;  3TOA A;  5K8P A;  2CNT A;  1AMP A;  4P4B A;  2PJ3 A;  3DDD A;  4RI1 A;  4Q38 A;  4HKF A;  2AJ6 A;  3D2M A;  2IMO A;  3NH8 A;  4MFZ A;  1YME A;  3QAH A;  2CNS A;  3SJF A;  4JXR A;  2Q7B A;  3P2F A;  5EC4 A;  2AFU A;  1GYT A;  2Q4Y A;  1I1D A;  3HLP A;  4MY0 A;  5HVF A;  1M44 A;  4CAX A;  4YFJ A;  4KOV A;  4A94 A;  2CY2 A;  2P6E A;  4OC3 A;  1OZP A;  3PGP A;  4GM5 A;  4PK2 A;  2DPS A;  4C7I A;  1BOB A;  3IWW A;  2A4N A;  3N5F A;  2XEF A;  4MI4 A;  5F47 A;  3R96 A;  2PJ0 A;  3NE7 A;  1S60 A;  4UWJ A;  5BWA B;  4M3S A;  3VWD A;  2OB0 A;  4OIW A;  4R3L A;  4PSX A;  4OAD A;  1M4L A;  2D4P A;  3IIB A;  1FNO A;  4OAE A;  1XF8 A;  5F09 A;  1F2P A;  2PJA A;  4YWY A;  4II9 A;  3PFO A;  3WC5 A;  2VXK A;  3RZA A;  1PU9 A;  4CYQ A;  4UIB A;  3ISX A;  2PJB A;  2C6C A;  2Z3L A;  2R8V A;  4NF1 A;  5AG5 A;  5E96 A;  5G20 A;  3SXN A;  2GAN A;  3OWC A;  1CM0 A;  1H8L A;  3LWU A;  3GLJ A;  4C7H A;  3PB7 X;  2HB6 A;  2PR8 A;  2GLJ A;  2G9D A;  3BJ8 A;  4UEE A;  3IU2 A;  5J8C A;  4A39 A;  1LOK A;  4A95 A;  4MFK A;  1VHO A;  3WC6 A;  3WT4 A;  2DXQ A;  1RXT A;  3EC4 A;  3PRT A;  2AFZ A;  4AG9 A;  4ZI6 A;  3FF3 A;  4PK3 A;  2WYR A;  4AVB A;  3V7Z A;  1IB1 E;  2P6G A;  4P45 A;  5A28 A;  2OZG A;  4U5Y A;  4CAF A;  4ZYQ A;  4P10 A;  3B3T A;  5AG7 A;  3FEC A;  4XPD B;  2B4D B;  2FE7 A;  5F46 A;  3E0K A;  4PPZ A;  1TXR A;  1YVO A;  4BD9 A;  4HNX B;  4JJX A;  2BUE A;  1HEE A;  3TT2 A;  2JDD A;  3FVL A;  3JTK A;  4XNH C;  2R7H A;  2Q43 A;  2BL1 A;  1YW4 A;  3PB6 X;  2EUI A;  4PXC A;  3T9Y A;  4B6Z A;  3GUX A;  4EME A;  2G3T A;  5IB9 A;  3KR4 A;  3SJG A;  3N7Z A;  1M4D A;  2AE6 A;  4KS9 A;  3FRM A;  1N71 A;  3KHZ A;  4HPS A;  5K8N A;  1UFH A;  3QAY A;  1B6B A;  4OKO A;  3S6H A;  4XPL A;  1KUY A;  5CPA A;  5G22 A;  1FT7 A;  3MN8 A;  2XEI A;  3SI1 A;  1VKC A;  4MHZ A;  4G1P A;  4MXU A;  3I9S A;  4CYP A;  1BPM A;  1CP6 A;  3MGD A;  2Z3N A;  2GIV A;  4FD7 A;  4K3N A;  4F9V A;  5HVH A;  1X10 A;  2JDC A;  2ZPA A;  4FWU A;  2QML A;  4NGP A;  3D7G A;  5D29 A;  4TWE A;  2RFH A;  4HNY B;  3CXS A;  2PVW A;  1JWQ A;  3LMS A;  1Y0Y A;  1GHE A;  4UFW A;  4QBJ A;  1IYL A;  3D68 A;  2POK A;  5C82 A;  1M4I A;  4MHD A;  4LX9 A;  4C68 A;  2EVN A;  5LYF A;  1MJ9 A;  5LRG A;  4E0A A;  4CGN A;  2V8D A;  1TKH A;  4XPK A;  2DF5 A;  5C88 A;  4NEX A;  3TC8 A;  2YGW A;  2DPT A;  2KCW A;  3HUV A;  4NGN A;  2PRB A;  4F0Y A;  1PYT B;  3GIU A;  3WR7 A;  3FYN A;  4B5P A;  3ISZ A;  2ATR A;  3B3W A;  2O28 A;  2PJ7 A;  2RC4 A;  2F5I A;  5LRK A;  4A37 A;  5DS0 A;  4ZX9 A;  4DJL A;  2Q4Z A;  3K2K A;  4IF5 A;  3VAR A;  1IOI A;  5LYL A;  1Y7E A;  4NJQ A;  4OC4 A;  4KVO E;  4X8I A;  3H5Z A;  2JEV A;  1Z5R A;  3PEI A;  4R3K A;  3H8E A;  2VBQ A;  1NSA A;  2YNC A;  3UY5 A;  1TF8 A;  3BXM A;  4MCQ A;  4B5O A;  2F8H A;  4NFR A;  4MCR A;  3FB3 A;  4MY3 A;  2ANP A;  3IU1 A;  3W6X A;  3IEH A;  1S7K A;  2PE3 A;  1IGB A;  2GLF A;  5DWN A;  3RO0 A;  2REE A;  2ZOF A;  3P2H A;  3G8W A;  2WPX A;  1IY7 A;  1Q2C A;  3PBB A;  5K8O A;  3JVN A;  3B3C A;  3F0A A;  2REF A;  2VZY A;  1NMT A;  4MRI A;  2ZOG A;  3FNC A;  1XOV A;  4UIA A;  4B12 A;  3KQZ A;  2J8M A;  2QVP A;  1PUA A;  2BEI A;  1ZLH A;  2QJ8 A;  3IWG A;  4KSA A;  4AVA A;  4FUU A;  1YX0 A;  2ZW5 A;  2PJ8 A;  4KVX A;  2IQ6 A;  4QUS A;  2PJ9 A;  3KGQ A;  1WWZ A;  3H8G A;  2AFW A;  3IGR A;  3KI9 A;  4KUA A;  2PQ8 A;  2ZEL A;  4J3G A;  3D7H A;  4MFQ A;  2ZEO A;  2PCU A;  3TO6 A;  4A30 A;  2OZH A;  4F0X A;  1X12 A;  1QST A;  1R43 A;  1XEB A;  2PC1 A;  2EK9 A;  4KOT A;  1IU8 A;  3FMC A;  4Y49 C;  2AFO A;  4F6A A;  4X3R A;  2CNM A;  5F48 A;  4L8A A;  2Q04 A;  3T8W A;  2C27 A;  1Z8T A;  4M85 A;  2J9A A;  2QYV A;  4OC2 A;  4L89 A;  1CPX A;  1M1D A;  2O4H A;  4EVY A;  2J8N A;  3B35 A;  3CZX A;  4WWV A;  2Z11 A;  2B58 A;  4KOU A;  4JYW A;  3S9N A;  1VGY A;  3KZW A;  2IJZ A;  2PVV A;  3CXP A;  4W9Y A;  4A33 A;  2PSW A;  5J8F A;  4UEF A;  5EMI A;  2QEC A;  5H86 A;  3D7D A;  5LYD A;  5CBM A;  4X5K A;  1EE3 P;  1YSJ A;  5DWM A;  3B7I A;  1QQ9 A;  1HDQ A;  2PIY A;  4KLW A;  4RN7 A;  6CPA A;  2ABZ A;  4UFX A;  1LRZ A;  4P4E A;  1P4N A;  1KUX A;  1UWY A;  1ZG7 A;  2V8H A;  4CGO A;  2GRE A;  4PQA A;  4RUH A;  3F8K A;  5G1Z A;  1L0C A;  5J1Q A;  2ZEH A;  4H2K A;  2VL1 A;  1Z8L A;  3S6F A;  2GE3 A;  4NGS A;  1TF9 A;  2ZEN A;  4OLL A;  1ZLI A;  3FEE A;  3BI0 A;  3SI0 A;  1BLL E;  4BMH A;  1YRE A;  2EWB A;  2ZED A;  4CYN A;  1XRY A;  2AFX A;  4WJB A;  1ELL P;  2YNC C;  2P0W A;  4R9M A;  5LRJ A;  4IUS A;  1KZF A;  2YNE A;  4FD5 A;  1F57 A;  1ON0 A;  4MBU A;  2Q51 A;  3R1K A;  4MHY A;  4CGL A;  5JM6 A;  2NYQ A;  1KUV A;  2J8R A;  1F2O A;  3GY9 A;  4O23 A;  5AGE A;  2I00 A;  4NCZ A;  5GCN A;  3D8P A;  1B87 A;  1XJO A;  2VEZ A;  3D67 A;  1XE4 A;  1QSN A;  3IFE A;  1Z2L A;  4DYO A;  4CRY B;  2C1C A;  3FIX A;  1V0C A;  5AG6 A;  3R9F A;  3SJX A;  4B10 A;  1Z9U A;  4C2Z A;  1CX8 A;  4CGP A;  1Z4E A;  4IK2 A;  3TCV A;  2PIZ A;  3W6S A;  3W91 A;  4LUA A;  2I3C A;  2X7B A;  5D8N A;  1IYK A;  4CAW A;  5HH1 A;  2CF4 A;  2WZN A;  4ZGY B;  2Z3O A;  2JBJ A;  1VHS A;  2IL4 A;  4QVT A;  4YU9 A;  2B5G A;  3H8F A;  5KTA A;  1XFO A;  2NSM A;  1MJB A;  3K9T A;  3KKW A;  1YR0 A;  1LAM A;  4OME A;  4PV6 A;  2BO9 A;  1TKJ A;  4P4F A;  1Y9K A;  3DR6 A;  2Z10 A;  2PR1 A;  2ZEE A;  3PZJ A;  3I1U A;  5I4M A;  5AG4 A;  1Z4R A;  4M6G A;  4PXB A;  1IIC A;  1OBR A;  4XPD C;  1CP7 A;  4Q36 A;  1NSL A;  1VHE A;  2WSA A;  5KTC A;  4DUK A;  4H6Z A;  4UBR A;  3MRU A;  1WK4 A;  2FL4 A;  1DE4 C;  5IV0 A;  5EBV A;  3TO7 A;  4M6I A;  2FSR A;  4AG7 A;  4Z65 A;  3QB8 A;  4KOX A;  4A32 A;  3NA6 A;  1LCP A;  3ZJ0 A;  1KWM A;  1ZG9 A;  4RS2 A;  3PB9 X;  2PJ2 A;  4M6H A;  2WUU A;  3PB4 X;  2JLM A;  2RB7 A;  5H84 A;  4FAI A;  2DEA A;  3S6G A;  3CPA A;  4A31 A;  4AXV A;  4IHM A;  2Q4V A;  2FS5 A;  4KOY A;  2BOA A;  4QC6 A;  4KLV A;  4MCS A;  4Y49 B;  5A27 A;  3I3G A;  3SJE A;  1M4G A;  1S7F A;  1CPS A;  2V8G A;  2V77 A;  4OP4 A;  2P6F A;  2EBJ A;  3KHX A;  1QSO A;  1Y0R A;  5HVG A;  3BJ7 A;  2FIW A;  1S3Z A;  2B3V A;  3DR8 A;  3SI2 A;  1YW6 A;  4CS0 B;  2BSW A;  3DGV A;  3TO9 A;  2PJ6 A;  3DNS A;  3QNV A;  1XMB A;  3CXQ A;  4NGT A;  2WPW A;  1NE9 A;  2XEJ A;  3TE4 A;  2Q44 A;  5CNP A;  5I0C A;  2FXF A;  8CPA A;  4PSW A;  4BBH A;  3NH4 A;  1VIX A;  4UEZ A;  1DTD A;  2BCO A;  4F8Z A;  1LAN A;  3B8G A;  2AFM A;  2OR4 A;  1CBX A;  4HNW B;  4R87 A;  3T90 A;  3EO4 A;  4CPA A;  1I12 A;  3L2N A;  2B4B A;  4UCM A;  2R98 A;  4NGQ A;  1IOF A;  2FCK A;  3R9G A;  3WC7 A;  4B5P B;  3BI1 A;  4E8O A;  4OID A;  3BLN A;  3PFE A;  2C6P A;  3B3S A;  2B4D A;  3RNZ A;  2HUZ A;  2CTB A;  3K9U A;  4NGM A;  3B2Y A;  4XNH B;  1QSM A;  2C6G A;  4GS4 A;  1YLO A;  4LQ6 A;  4ZX8 A;  1CJW A;  2PDO A;  3G3S A;  3FH4 A;  3PP9 A;  3NH5 A;  3JUW A;  2GU2 A;  4QB9 A;  5ELY A;  4A38 A;  3D4U A;  5HMN A;  3LD2 A;  4AVC A;  1PCA A;  4FD6 A;  4A2Z A;  2GFQ A;  4ONW A;  4P4I A;  3ZZI A;  2ZW4 A;  1AYE A;  2G0B A;  1Q7L A;  3GB0 A;  3JRU A;  4KVM E;  2OU2 A;  3GYA A;  1MJA A;  1Q2Y A;  2CIJ A;  4MJ8 A;  4JZ0 A;  3EFA A;  4R6T A;  4MMO A;  5JH9 A;  2JBK A;  4JD6 A;  3TTH A;  2Z3M A;  1YLE A;  1YGH A;  1J4J A;  3FBU A;  2ZW6 A;  2PJ5 A;  2ZW7 A;  3RYO A;  5FVJ A;  2NMT A;  2FVG A;  4UCP A;  4NGR A;  3IC1 A;  3R95 A;  4UF4 A;  3A9L A;  1AUG A;  4CRZ B;  3LAC A;  4R57 A;  4K30 A;  4EWT A;  2O53 A;  2OZU A;  4KUB A;  4ZY1 A;  4CYO A;  4MHP A;  1CG2 A;  4MFJ A;  3CPX A;  3D2P A;  1Y7R A;  2Z0Z A;  1RTQ A;  1A2Z A;  4LQG A;  4H89 A;  3S6K A;  1ZG8 A;  1TKF A;  4FBE A;  3IO1 A;  1Q2D A;  1QSR A;  2ZEM A;  4KOS A;  4YRH A;  4JWP A;  3NE8 A;  3V38 A;  3KL9 A;  3LOD A;  3WAB A;  3PBE A;  4ZY0 A;  1S5K A;  4P4J A;  4B11 A;  4NSQ A;  4B13 A;  4GXH A;  1HDU A;  1I21 A;  3FXT A;  5THW A;  4ZBG A;  5LYI A;  3BHX A;  3KAS A;  1P0H A;  2JEW A;  2PJ4 A;  1YK3 A;  1BO4 A;  1RO5 A;  2AFS A;  4C2X A;  5IB0 A;  1Z8X A;  1QMU A;  4MCP A;  4P4D A;  1Y9W A;  1XBU A;  2D4O A;  2OOT A;  1SQH A;  1BAV A;  4C2Y A;  4CGM A;  4MFP A;  2FT0 A;  2EK8 A;  3DLJ A;  3VH9 A;  4X2T A;  4KOW A;  2PJC A;  2Q7S A;  4P44 A;  4P6Y A;  2Q0Y A;  1U6M A;  4UCN A;  3VAT A;  4YGO A;  4BIN A;  2B3U A;  2R1I A;  3IWE A;  4R8F A;  4CAE A;  2HV2 A;  2V8V A;  5JPH A;  2Z3K A;  4TNU A;  1XMT A;  2ODF A;  4FD4 A;  4CAV A;  4E2A A;  1ARL A;  1Z8W A;  3VWE A;  4ORF A;  3C26 A;  4OC5 A;  4EFD A;  4F9U A;  5K8M A;  4AB7 A;  3D3S A;  1MK4 A;  4ZY2 A;  1S7N A;  2ZEF A;  4R7M A;  1S7L A;  2VQY A;  3B3V A;  1ARM A;  2VI7 A;  2K5T A;  2ARH A;  5G21 A;  3D7F A;  1XIX A;  3S9L A;  1YVK A;  4U9Y A;  1R57 A;  2CXA A;  1JQG A;  3EXN A;  1R3N A;  4KSI A;  2VZZ A;  2G3A A;  3SHP A;  3TFY A;  4NXY A;  2QIR A;  2Z3P A;  3KR5 A;  2I79 A;  5F49 A;  1FY7 A;  1TIQ A;  2OH1 A;  4IAV A;  3EY5 A;  4ONU A;  4OC1 A;  3SXO A;  4KSF A;  5HXD A;  2FIA A;  2YND A;  1BPN A;  3RAM A;  2ZEP A;  5IX3 A;  4R76 A;  1LAP A;  3F5B A;  4UWI A;  4KZT A;  4OC0 A;  1IID A;  3KQX A;  4UA3 A;  3V8I A;  2HC9 A;  2ZXV A;  3NFZ A;  2B5G B;  4DNC A;  1YQE A;  4PXE A;  4KOR A;  1LFW A;  3CDX A;  3IJ3 A;  2ZEG A;  3PB8 X;  4H6U A;  4I49 A;  4JXQ A;  3TX8 A;  2EO8 A;  4U9Z A;  3DSB A;  4NJR A;  5JGF A;  2CTC A;  3GKR A;  4MFL A;  4JLY A;  3RBU A;  1ZO0 A;  2PRQ A; 
#chains in the Genus database with same CATH homology
 5KTD A;  3H4Q A;  3R9E A;  5ISV A;  2H5M A;  3TOB A;  4B14 A;  1K4J A;  2Y0M A;  5JQ4 A;  4UFV A;  2HQY A;  3TOA A;  2CNT A;  3DDD A;  4RI1 A;  4Q38 A;  4HKF A;  2AJ6 A;  3D2M A;  4MFZ A;  3QAH A;  2CNS A;  4JXR A;  2Q7B A;  3P2F A;  5EC4 A;  2Q4Y A;  4MY0 A;  1I1D A;  4CAX A;  4YFJ A;  1M44 A;  4KOV A;  2CY2 A;  2P6E A;  1OZP A;  3PGP A;  4PK2 A;  2DPS A;  4C7I A;  1BOB A;  2A4N A;  4MI4 A;  5F47 A;  3R96 A;  3NE7 A;  1S60 A;  4UWJ A;  5BWA B;  4M3S A;  3VWD A;  2OB0 A;  4R3L A;  4PSX A;  4OAD A;  2D4P A;  4OAE A;  1XF8 A;  4II9 A;  2VXK A;  1PU9 A;  4CYQ A;  5E96 A;  2Z3L A;  5G20 A;  2R8V A;  4NF1 A;  5AG5 A;  3SXN A;  2GAN A;  3OWC A;  1CM0 A;  4C7H A;  2PR8 A;  3BJ8 A;  3IU2 A;  5J8C A;  4A95 A;  4MFK A;  4AG9 A;  2DXQ A;  1RXT A;  3EC4 A;  4PK3 A;  4AVB A;  1IB1 E;  2P6G A;  5A28 A;  2OZG A;  4U5Y A;  4CAF A;  5AG7 A;  4XPD B;  2B4D B;  2FE7 A;  5F46 A;  3E0K A;  1YVO A;  4HNX B;  4JJX A;  2BUE A;  3TT2 A;  2JDD A;  3JTK A;  4XNH C;  2R7H A;  2BL1 A;  2EUI A;  3T9Y A;  2G3T A;  3N7Z A;  1M4D A;  2AE6 A;  4KS9 A;  3FRM A;  1N71 A;  1UFH A;  1B6B A;  3S6H A;  4XPL A;  1KUY A;  5G22 A;  1VKC A;  3I9S A;  4CYP A;  3MGD A;  2Z3N A;  2GIV A;  4FD7 A;  2JDC A;  2ZPA A;  2QML A;  4HNY B;  3CXS A;  1GHE A;  4UFW A;  4QBJ A;  1IYL A;  5C82 A;  1M4I A;  4MHD A;  4LX9 A;  4C68 A;  2EVN A;  1MJ9 A;  4E0A A;  4CGN A;  4XPK A;  5C88 A;  4NEX A;  2YGW A;  2DPT A;  2KCW A;  2PRB A;  4F0Y A;  3WR7 A;  3FYN A;  4B5P A;  2ATR A;  2O28 A;  2RC4 A;  2F5I A;  4IF5 A;  4KVO E;  3H5Z A;  2JEV A;  4R3K A;  2VBQ A;  2YNC A;  3UY5 A;  4B5O A;  3FB3 A;  4MY3 A;  3W6X A;  3IU1 A;  1S7K A;  5DWN A;  2REE A;  3P2H A;  3G8W A;  2WPX A;  1Q2C A;  3JVN A;  3F0A A;  2REF A;  2VZY A;  1NMT A;  3FNC A;  4B12 A;  2J8M A;  4KSA A;  1PUA A;  2BEI A;  3IWG A;  4AVA A;  1YX0 A;  2ZW5 A;  4KVX A;  4QUS A;  1WWZ A;  3IGR A;  4KUA A;  2PQ8 A;  4J3G A;  4MFQ A;  3TO6 A;  4A30 A;  2OZH A;  4F0X A;  1QST A;  2PC1 A;  1XEB A;  4KOT A;  4Y49 C;  4F6A A;  2CNM A;  5F48 A;  4L8A A;  2Q04 A;  2C27 A;  4M85 A;  4L89 A;  1M1D A;  4EVY A;  2J8N A;  2Z11 A;  2B58 A;  4KOU A;  3CXP A;  4A33 A;  2PSW A;  5J8F A;  2QEC A;  5H86 A;  4X5K A;  5DWM A;  4KLW A;  4UFX A;  1LRZ A;  1P4N A;  1KUX A;  4CGO A;  3F8K A;  5G1Z A;  1L0C A;  3S6F A;  2GE3 A;  4OLL A;  4BMH A;  1YRE A;  4CYN A;  4R9M A;  2YNC C;  2P0W A;  4IUS A;  1KZF A;  2YNE A;  4FD5 A;  1ON0 A;  4CGL A;  4MBU A;  3R1K A;  1KUV A;  2J8R A;  3GY9 A;  5AGE A;  5GCN A;  2I00 A;  4NCZ A;  3D8P A;  1B87 A;  2VEZ A;  1XE4 A;  1QSN A;  4CRY B;  3FIX A;  1V0C A;  5AG6 A;  3R9F A;  4B10 A;  1Z9U A;  4C2Z A;  4CGP A;  1Z4E A;  3TCV A;  3W6S A;  3W91 A;  4LUA A;  2X7B A;  1IYK A;  4CAW A;  5HH1 A;  4ZGY B;  2Z3O A;  1VHS A;  2IL4 A;  4QVT A;  2B5G A;  5KTA A;  1MJB A;  3KKW A;  1YR0 A;  4PV6 A;  1Y9K A;  3DR6 A;  2Z10 A;  2PR1 A;  3PZJ A;  5AG4 A;  1Z4R A;  1IIC A;  4XPD C;  4Q36 A;  1NSL A;  5KTC A;  2WSA A;  4H6Z A;  4UBR A;  1WK4 A;  2FL4 A;  5IV0 A;  5EBV A;  3TO7 A;  2FSR A;  4AG7 A;  3QB8 A;  4KOX A;  4A32 A;  3ZJ0 A;  4RS2 A;  2WUU A;  5H84 A;  2JLM A;  4A31 A;  3S6G A;  2Q4V A;  2FS5 A;  4KOY A;  4QC6 A;  4KLV A;  4Y49 B;  5A27 A;  3I3G A;  1M4G A;  1S7F A;  2P6F A;  1QSO A;  3BJ7 A;  2FIW A;  1S3Z A;  2B3V A;  3DR8 A;  4CS0 B;  2BSW A;  3TO9 A;  3DNS A;  3CXQ A;  2WPW A;  1NE9 A;  3TE4 A;  2Q44 A;  5CNP A;  5I0C A;  2FXF A;  4PSW A;  4BBH A;  3B8G A;  4R87 A;  4HNW B;  3T90 A;  3EO4 A;  1I12 A;  2B4B A;  4UCM A;  2R98 A;  4B5P B;  2FCK A;  3R9G A;  4E8O A;  3BLN A;  2B4D A;  2HUZ A;  3K9U A;  4XNH B;  1QSM A;  4GS4 A;  1CJW A;  2PDO A;  3G3S A;  3PP9 A;  5HMN A;  4QB9 A;  3JUW A;  3LD2 A;  4AVC A;  4FD6 A;  4A2Z A;  3ZZI A;  2ZW4 A;  2G0B A;  4KVM E;  2OU2 A;  3GYA A;  1MJA A;  1Q2Y A;  4MJ8 A;  3EFA A;  4JD6 A;  3TTH A;  2Z3M A;  1YLE A;  1YGH A;  1J4J A;  3FBU A;  2ZW6 A;  2ZW7 A;  3RYO A;  5FVJ A;  2NMT A;  4UCP A;  3R95 A;  3A9L A;  4CRZ B;  4R57 A;  4K30 A;  2OZU A;  4KUB A;  4CYO A;  4MFJ A;  3D2P A;  1Y7R A;  2Z0Z A;  3S6K A;  4H89 A;  1Q2D A;  1QSR A;  4KOS A;  4YRH A;  4JWP A;  3LOD A;  1S5K A;  4B11 A;  4NSQ A;  4B13 A;  1I21 A;  3FXT A;  4ZBG A;  1P0H A;  1YK3 A;  1BO4 A;  1RO5 A;  4C2X A;  5IB0 A;  1Y9W A;  2D4O A;  4C2Y A;  1SQH A;  4CGM A;  4MFP A;  2FT0 A;  4KOW A;  2Q0Y A;  1U6M A;  4UCN A;  4YGO A;  4CAE A;  2B3U A;  2R1I A;  3IWE A;  5JPH A;  2HV2 A;  2Z3K A;  1XMT A;  4FD4 A;  4CAV A;  4E2A A;  3VWE A;  4ORF A;  3C26 A;  4AB7 A;  3D3S A;  1MK4 A;  1S7N A;  1S7L A;  2VQY A;  2VI7 A;  2K5T A;  2ARH A;  5G21 A;  1XIX A;  1YVK A;  4U9Y A;  1R57 A;  2CXA A;  3EXN A;  2VZZ A;  2G3A A;  3SHP A;  3TFY A;  4NXY A;  2QIR A;  2Z3P A;  5F49 A;  2I79 A;  1FY7 A;  1TIQ A;  2OH1 A;  3EY5 A;  4ONU A;  3SXO A;  4KSF A;  2FIA A;  2YND A;  5IX3 A;  4UWI A;  3F5B A;  4KZT A;  1IID A;  4UA3 A;  3V8I A;  2ZXV A;  2B5G B;  4DNC A;  4KOR A;  4I49 A;  4H6U A;  4JXQ A;  4U9Z A;  3DSB A;  3GKR A;  4MFL A;  4JLY A;  1ZO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...