4R3LA

Crystal structure of ard1 n-terminal acetyltransferase from sulfolobus solfataricus bound to substrate peptide fragment and coa
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
DFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAIVDNSVVGYIMPRIEWGFSNIKQLPSLVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYYADGEDAYLMARPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized N-acetyltransferase SSO0209
publication title Structural Basis for Substrate-specific Acetylation of N alpha-acetyltransferase Ard1 from Sulfolobus solfataricus
pubmed doi rcsb
source organism Sulfolobus solfataricus p2
molecule tags Transferase/transferase substrate
total genus 51
structure length 157
sequence length 157
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2014-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4r3lA00
4YRHA 3JVNA 4U5YA 4YFJA 3N7ZA 4MBUA 4GS4A 2JDDA 2ZW7A 4ONUA 3EY5A 1IIDA 3FNCA 4PK3A 3UY5A 1YX0A 2RC4A 2Q0YA 2REEA 1P0HA 4CAWA 3FB3A 1YVKA 1KZFA 4KZTA 1ON0A 4UWIA 3D2PA 5H86A 4UBRA 4CS0B 3V8IA 3D3SA 4U9YA 4ORFA 1Z4RA 1CJWA 2Z0ZA 2Q44A 3EO4A 3SHPA 3H4QA 2BEIA 2AJ6A 4KOUA 4B5PB 4KOTA 5DWNA 4HNYB 5E96A 2VZZA 5KTCA 2FXFA 2OZGA 5IX3A 4FD4A 2ARHA 2OZUA 2JDCA 2ZW6A 1B6BA 2B5GA 2HUZA 4AG9A 1Z9UA 5J8CA 2HQYA 2VI7A 3DDDA 1Y7RA 5GCNA 3W6SA 1KUXA 3KKWA 4AVAA 4LX9A 2FS5A 3BJ8A 3G3SA 4YGOA 3GY9A 3TOAA 4QVTA 5KTDA 3PGPA 3SXOA 4PV6A 3T9YA 4H89A 3RYOA 1I12A 4HNXB 3B8GA 4KVOE 4AG7A 4KUAA 2JEVA 4F6AA 1IB1E 1YR0A 2PC1A 1FY7A 4B5OA 4JXQA 4FD6A 3W91A 4NF1A 2EUIA 3ZJ0A 2B4DA 3WR7A 2FIWA 2P6GA 4JWPA 5EC4A 3CXSA 2PSWA 4LUAA 3D8PA 2GE3A 2CNSA 2P0WA 5CNPA 1MJ9A 1UFHA 2OH1A 4KVXA 4CRZB 5JQ4A 4HKFA 2A4NA 2GANA 4B5PA 4QBJA 2BUEA 2ZW4A 4FD7A 3BLNA 3EXNA 4NXYA 4OADA 1YREA 1NMTA 5IB0A 3S6HA 4XPLA 4KOXA 2OZHA 4KOVA 2B4BA 3VWDA 5DWMA 2HV2A 3QB8A 3CXPA 3TT2A 2J8MA 1MJBA 3FBUA 2QIRA 4L8AA 4CAVA 4K30A 4OLLA 2ZPAA 1N71A 3R95A 4MHDA 3R1KA 4R57A 1I1DA 1IYLA 3TCVA 2B4DB 1IICA 2BSWA 4XPKA 4NCZA 1YLEA 1Z4EA 1S3ZA 3K9UA 5FVJA 3SXNA 2G3TA 2O28A 2REFA 1SQHA 4L89A 2PDOA 4JLYA 4NSQA 2BL1A 3R9EA 2Q7BA 1LRZA 1XEBA 2CY2A 2ZW5A 3DSBA 4FD5A 5J8FA 2PRBA 2R98A 2Z10A 2OB0A 3TFYA 3R96A 2QMLA 2VZYA 1S5KA 1VHSA 1TIQA 5H84A 5KTAA 1IYKA 3S6KA 1NE9A 3E0KA 4HNWB 2P6EA 3EC4A 4F0YA 1CM0A 4II9A 1QSRA 1U6MA 2QECA 3GKRA 3PP9A 2IL4A 5C82A 3CXQA 1OZPA 1Q2DA 2FT0A 3TE4A 4NEXA 1YGHA 1M4GA 4QUSA 1MJAA 4KOWA 2WPXA 1RO5A 2R7HA 2PQ8A 2VXKA 3C26A 1PUAA 3F0AA 4XPDC 4KOYA 4XPDB 2X7BA 4MI4A 3F8KA 5C88A 1S7LA 4X5KA 3GYAA 2EVNA 1NSLA 1YVOA 2GIVA 2B3UA 3FIXA 3TO7A 4KLVA 1KUYA 1QSMA 4AB7A 2VQYA 2PR1A 4E0AA 1L0CA 1B87A 2FIAA 3LD2A 4PSWA 1S7NA 1R57A 4H6UA 4PSXA 3ZZIA 4JJXA 1S60A 2D4PA 4IUSA 4XNHB 2JLMA 4EVYA 2FCKA 4KLWA 4R3LA 3PZJA 4PK2A 3D2MA 4ZBGA 4CRYB 5F47A 4R87A 3BJ7A 4UWJA 2R1IA 3TO9A 3VWEA 3IWGA 1BO4A 2WPWA 2ZXVA 3I9SA 5F48A 2NMTA 5EBVA 2VEZA 4MJ8A 2FL4A 4MY0A 1M4IA 1P4NA 1WK4A 2CNMA 2AE6A 2PR8A 1Q2YA 3TO6A 4MY3A 4Y49C 2VBQA 4Y49B 4RI1A 2H5MA 4J3GA 1Y9KA 3P2FA 4E8OA 2OU2A 2B58A 3JUWA 4U9ZA 2Z11A 1XIXA 3F5BA 3FYNA 5I0CA 1QSNA 3P2HA 2G0BA 3S6GA 4I49A 5HH1A 2Q04A 4QB9A 1Q2CA 1M44A 4AVCA 1QSTA 2Q4VA 4AVBA 4KUBA 4JD6A 2G3AA 1M4DA 2R8VA 4KORA 2ATRA 4JXRA 2F5IA 3S6FA 1GHEA 2K5TA 1XE4A 4BMHA 1XMTA 3LODA 4CAXA 3DNSA 4H6ZA 4R9MA 2J8RA 3W6XA 1S7KA 3TTHA 4KVME 2I00A 1M1DA 4DNCA 2C27A 1J4JA 4OAEA 4KOSA 5JPHA 1MK4A 1QSOA 4RS2A 5F46A 2Q4YA 1K4JA 4UA3A 5IV0A 1RXTA 1S7FA 2FE7A 3G8WA 3T90A 2FSRA 3OWCA 1XF8A 2D4OA 1VKCA 1YK3A 3EFAA 3NE7A 4M85A 3FXTA 1WWZA 1KUVA 3R9FA 3R9GA 2KCWA 3DR6A 1PU9A 5ISVA 3I3GA 4IF5A 4E2AA 4XNHC 5F49A 2B3VA 2I79A 3DR8A 3FRMA 5HMNA 3MGDA 3TOBA 4M3SA 2B5GB 2CNTA 4R3KA 1Y9WA 1BOBA 4QC6A 3IGRA 2DXQA 3QAHA 1V0CA 1I21A 2Y0MA 2J8NA 2P6FA
chains in the Genus database with same CATH superfamily
2HB6A 2O53A 1TF8A 3JVNA 4YRHA 3D4UA 4U5YA 4Q38A 1Z8XA 2Y0MA 4YFJA 2Q4ZA 3N7ZA 4GS4A 4MBUA 4MFJA 3FJUA 3KGQA 2JDDA 1PCAA 2PJ3A 4G1PA 3VATA 2ZW7A 5G20A 1AUGA 4ONUA 1H8LA 4ZI6A 3NH4A 3BI1A 3EY5A 3FMCA 3K2KA 1IIDA 3FNCA 4NGMA 4PK3A 3UY5A 1LAPA 4CYNA 1YMEA 5THWA 2IJZA 2RC4A 3CZXA 4F0XA 2Q0YA 2REEA 1P0HA 4MFZA 4CAWA 4YWYA 2HC9A 3FB3A 1F2OA 1YVKA 1KZFA 4KZTA 1ON0A 1CBXA 3KASA 3NH5A 4UWIA 2EK8A 3D2PA 5H86A 4OMEA 4UBRA 4CS0B 4OP4A 3V8IA 3D3SA 4U9YA 2ZEDA 4ORFA 3SI2A 3WC7A 3B7IA 1Z4RA 1CJWA 1F57A 2Z0ZA 3GIUA 2CF4A 4X8IA 4A2ZA 2Q44A 2YNCC 3EO4A 3S9LA 3SHPA 3SJGA 3H4QA 2BEIA 4R6TA 4MCQA 5K8PA 4NGQA 2AJ6A 5AG5A 4KOUA 4B5PB 1Y7EA 4KOTA 5DWNA 4HNYB 5E96A 3SJEA 2VZZA 3ISXA 2FXFA 2OZGA 4B13A 5IX3A 1LFWA 5KTCA 2PJ8A 4FD4A 4P4JA 5JGFA 2ARHA 4RUHA 3WABA 5HVHA 1VIXA 1Q7LA 2OZUA 3IJ3A 2JDCA 4P10A 4CGNA 2ZW6A 1B6BA 2Z3NA 4UFXA 2B5GA 2HUZA 4YU9A 1IOFA 1Z9UA 4AG9A 4EWTA 2AFZA 5J8CA 2HQYA 3BXMA 2VI7A 2V8DA 1R43A 2YGWA 4IAVA 1DE4C 3DDDA 4M6GA 2RB7A 1Y7RA 1FT7A 5GCNA 5G22A 3W6SA 1KUXA 5ELYA 3KKWA 4AVAA 4LX9A 1TKJA 2FS5A 2PJ6A 2PJ1A 3BJ8A 3H8FA 3G3SA 4UF4A 4YGOA 3LWUA 5AGEA 3GY9A 3TOAA 4QVTA 5KTDA 2C6CA 2CXAA 1Z8WA 3PGPA 3SXOA 3CPAA 1M4LA 2PJ9A 4MHNA 4PV6A 3T9YA 4R76A 4H89A 3RYOA 1I12A 3FEEA 4HNXB 4F9VA 5LYDA 1ZO0A 2XEJA 3B8GA 4KVOE 3KQZA 4KUAA 4AG7A 2JEVA 4F6AA 4C68A 1IB1E 1YR0A 3JRUA 2PC1A 1FY7A 2QVPA 4OC0A 3RAMA 5JM6A 4B5OA 4JXQA 5IB9A 4FD6A 4ONWA 4NF1A 3W91A 2EUIA 1ZG8A 6CPAA 3ZJ0A 3RBUA 2B4DA 1YSJA 3PBEA 4MXUA 3WR7A 2ODFA 2FIWA 4LQGA 2P6GA 3QNVA 4EMEA 4JWPA 3WC6A 1X10A 3CXSA 2PSWA 5EC4A 4LUAA 1A2ZA 4MHYA 1BPMA 2C6PA 3D8PA 5LRGA 3KI9A 2F8HA 1UWYA 4CAEA 1Y0YA 3MN8A 1ZLIA 2GE3A 1X12A 5AG7A 4ZX8A 4TNUA 1VHOA 2CNSA 2P0WA 5CNPA 1MJ9A 1UFHA 2AFWA 4W9YA 2GLFA 2OH1A 4KVXA 4CRZB 2PJ7A 5JQ4A 4GXHA 4HKFA 2A4NA 2GANA 3FH4A 3PB9X 2BUEA 2C6GA 2ZW4A 4FD7A 4R7MA 1FNOA 4B5PA 4NGRA 1AYEA 3BLNA 3EXNA 4NXYA 4UCPA 4B14A 4OADA 1YREA 4CGPA 2BCOA 1NMTA 5IB0A 4A38A 4ZGYB 3S6HA 4XPLA 2GREA 5K8NA 4KOXA 2PJCA 2OZHA 4KOVA 5LRKA 1QQ9A 2PJ5A 2B4BA 2Q43A 3IO1A 1IY7A 3VWDA 3KHZA 5DWMA 1CPSA 4CGOA 4OIDA 2WYRA 2HV2A 2OOTA 4P4IA 4QBJA 2ZELA 3I1UA 4P4DA 2XEFA 3QB8A 1QMUA 3CXPA 3PFEA 4JYWA 5A28A 4PXEA 3TT2A 2J8MA 4PQAA 5LYIA 4FUUA 1MJBA 3FX6A 3FBUA 1LOKA 2QIRA 3K9TA 4KS9A 4MRIA 4L8AA 3CDXA 2Z3LA 4CAVA 4K30A 4OLLA 3N5FA 2ZPAA 1N71A 4MHPA 2YNEA 2ZEEA 3R95A 4MHDA 3R1KA 3IEHA 4R57A 5F09A 3RZAA 2C1CA 3LMSA 3PFOA 1I1DA 1IYLA 4NGNA 3TCVA 3D68A 2B4DB 4UEZA 3B3CA 2ABZA 1IICA 2BSWA 4XPKA 1CP6A 3SJFA 1PYTB 4NCZA 1YLEA 1Z4EA 4FWUA 2WSAA 3PRTA 1XRYA 3KL9A 1S3ZA 3K9UA 5FVJA 4UCMA 3SXNA 4CYQA 2G3TA 2O28A 2REFA 1SQHA 4L89A 4B6ZA 2PDOA 2PVWA 5JH9A 4A39A 1CX8A 4JLYA 5HVGA 4NSQA 2BL1A 3IU1A 3R9EA 1LCPA 2Z3KA 2Q7BA 1LRZA 1XEBA 4PXDA 2CY2A 2ZW5A 3DSBA 4FD5A 4MFKA 4OKOA 1Z8LA 5J8FA 4EFDA 2PJAA 1NSAA 2RFHA 1TKHA 2PRBA 5I4MA 2R98A 2DPSA 1F2PA 2Z10A 4MMOA 2OB0A 4WJBA 5AG6A 5HVFA 3TFYA 4ZYQA 4MFQA 4OC5A 3R96A 2DF5A 2QMLA 2VZYA 4OC1A 1S5KA 2V8GA 1VHSA 1BAVA 1TIQA 5H84A 3IC1A 5KTAA 1OBRA 4KSFA 3D7GA 1IYKA 1XJOA 4ZY2A 3S6KA 2CTBA 1NE9A 3PB7X 3IIBA 4JZ0A 4P6YA 3FVLA 3BHXA 4CPAA 1DTDA 2V8VA 1LANA 3E0KA 2PRQA 3IFEA 5CPAA 4HNWB 2P6EA 3EC4A 4A95A 2ZEOA 4F0YA 4MCPA 3VH9A 1CM0A 3PB4X 2Q51A 4II9A 1QSRA 1XMBA 4IHMA 1U6MA 2QECA 3GKRA 3PP9A 2IL4A 3SI1A 4CYPA 5C82A 3CXQA 2PVVA 1OZPA 1VHEA 1Q2DA 1XBUA 1IU8A 2FT0A 4DUKA 7CPAA 5J1QA 2DEAA 5K8MA 3TE4A 4IK2A 4NEXA 3TX8A 1YGHA 1M4GA 4QUSA 8CPAA 1MJAA 4KOWA 5A27A 2WPXA 2AFUA 1RO5A 4Z65A 2R7HA 2PQ8A 2VXKA 2IMOA 3C26A 2EK9A 4CAFA 1PUAA 1HDUA 3F0AA 4XPDC 3KHXA 4KOYA 4XPDB 4X2TA 2X7BA 4MI4A 2AFSA 3F8KA 4Q36A 3RO0A 4AXVA 5C88A 1S7LA 3H8EA 4K3NA 4C7IA 4X5KA 3B3WA 3GYAA 2EVNA 4C7HA 1NSLA 1YVOA 2GIVA 2ANPA 4NGPA 4UIBA 1VGYA 2B3UA 3FIXA 4CYOA 3TO7A 4KLVA 3B3TA 1KUYA 1QSMA 4KSIA 4AB7A 4PXCA 2VQYA 3LACA 2PIZA 2PR1A 3NFZA 3B2YA 4E0AA 1L0CA 1B87A 2FIAA 5G1ZA 3IU2A 3LD2A 2ZEPA 4PSWA 1S7NA 4HPSA 1R57A 4H6UA 4NFRA 1ZLHA 4EVYA 4WWVA 5EMIA 4PSXA 4P45A 3ZZIA 4JJXA 1S60A 2D4PA 2XEGA 3JTKA 4LQ6A 3PBBA 4IUSA 4XNHB 2J9AA 2GFQA 1TKFA 2FCKA 2JLMA 3DLJA 4KLWA 4NGTA 4P4BA 4R3LA 4B12A 4B11A 4BINA 5K8OA 1Z5RA 3PZJA 4PK2A 3D2MA 3IWEA 4DYOA 4UIAA 2Z3MA 1CP7A 2NYQA 2PJ4A 4ZBGA 3WT4A 2XEIA 4CRYB 4CGMA 5F47A 4R87A 3BJ7A 4A94A 4MFLA 1ARMA 4UWJA 2DPTA 1XOVA 4MFPA 2R1IA 3TO9A 1XFOA 4F8ZA 3RNZA 3V38A 2VL1A 1TF9A 2AFXA 5BWAB 1CPXA 3H5ZA 3VWEA 3PB6X 3IWGA 1BO4A 2WPWA 2ZXVA 3I9SA 5F48A 2NMTA 3GLJA 3IWWA 4P4FA 2EWBA 1IGBA 2ZENA 5EBVA 1HEEA 2VEZA 3D7DA 3D67A 4MJ8A 2FL4A 2OR4A 3PB8X 3SJXA 4OC2A 4MY0A 4C2ZA 3KR4A 4ZY1A 2PJ2A 1M4IA 4UEFA 1RTQA 4TWEA 1IOIA 4A37A 3B3SA 1ARLA 2ZOGA 3T8WA 1P4NA 1WK4A 4NJQA 2CNMA 4M6HA 4PXBA 2AE6A 2PR8A 1Q2YA 2ZEGA 3D7HA 4F9UA 2NSMA 3TO6A 4MY3A 3S9NA 2YNDA 4Y49C 4Q7AA 3SI0A 2VBQA 3D7FA 2O4HA 4Y49B 2G9DA 4UEEA 4RI1A 1YW6A 2H5MA 4M6IA 2JEWA 4J3GA 3NH8A 5LRJA 1Y9KA 3P2FA 4E8OA 2OU2A 2B58A 3BI0A 3H8GA 3JUWA 2POKA 2Z3OA 4U9ZA 1BLLE 2Z11A 1XIXA 3F5BA 2ZEFA 3FYNA 4MHZA 4NGSA 4A31A 4KSAA 4MCSA 5I0CA 4RN7A 1QSNA 2PCUA 2PIYA 3P2HA 2BO9A 3S9MA 2G0BA 3S6GA 3KR5A 4R8FA 4FBEA 4I49A 4C2YA 3CT9A 3HLPA 2PE3A 5HH1A 3GB0A 2Q04A 2V77A 4C2XA 4QB9A 1M44A 1Q2CA 1Y0RA 1ELLP 1QSTA 4AVCA 2Q4VA 3GUXA 5G21A 4AVBA 5AG4A 3FF3A 4KUBA 4JD6A 3V7ZA 2G3AA 1M4DA 2R8VA 4KORA 3FECA 2ATRA 2IQ6A 5LYLA 1ELMP 4JXRA 2PJ0A 2F5IA 3S6FA 1GHEA 2K5TA 1XE4A 2FVGA 5HXDA 1Z8TA 1JQGA 4BMHA 3VARA 1XMTA 2QJ8A 5DS0A 2JBJA 3LODA 4CAXA 3DNSA 1Z2LA 4H6ZA 4UFVA 1CG2A 1ZG7A 4R9MA 2J8RA 3W6XA 1S7KA 3TTHA 1EE3P 4KVME 2I00A 1M1DA 2WZNA 5LYFA 4DNCA 2JBKA 2C27A 1J4JA 1GYTA 4OC4A 4OAEA 4KOSA 5JPHA 1MK4A 1BPNA 1QSOA 1HDQA 2EBJA 4RS2A 5F46A 3A9LA 2Q4YA 2ZOFA 1K4JA 4X3RA 4OIWA 4UA3A 5IV0A 2QYVA 1RXTA 1S7FA 2V8HA 2FE7A 3G8WA 1YLOA 2FSRA 3T90A 2Z3PA 1XF8A 2D4OA 3OWCA 4A32A 4BBHA 1VKCA 3KZWA 2ZEHA 3HUVA 1YK3A 1YQEA 3EFAA 3NE7A 4FAIA 4M85A 1TXRA 2EO8A 3L2NA 2WUUA 4P4EA 4ZX9A 3FXTA 1JWQA 1WWZA 3FEDA 2CIJA 2BOAA 4MCRA 1KUVA 2F7VA 2PJBA 2GLJA 4UCNA 3R9FA 3R9GA 2KCWA 5CBMA 3DR6A 1PU9A 3ISZA 4O23A 3I3GA 5ISVA 3B3VA 3MRUA 4NJRA 1ZG9A 1LAMA 2GU2A 2YNCA 4IF5A 4CGLA 4E2AA 3KQXA 1KWMA 4XNHC 4ZY0A 5D29A 5F49A 2B3VA 2I79A 3DR8A 3FRMA 2ZEMA 3NA6A 4H2KA 2AFOA 5HMNA 3MGDA 4P44A 3TOBA 4PPZA 5D8NA 4M3SA 4DJLA 2B5GB 2CNTA 2CTCA 4GM5A 3CPXA 4BD9A 1YW4A 3QAYA 4B10A 4A30A 3D66A 4R3KA 4UFWA 3TC8A 3WC5A 1Y9WA 1BOBA 4A33A 4QC6A 2AFMA 1AMPA 2I3CA 1R3NA 3DGVA 3IGRA 2DXQA 3NE8A 1V0CA 3PEIA 1I21A 3QAHA 1YX0A 4OC3A 2J8NA 2Q7SA 3B35A 2P6FA
chains in the Genus database with same CATH topology
4YRHA 3JVNA 4U5YA 4Q38A 4YFJA 3N7ZA 4MBUA 4GS4A 4MFJA 2JDDA 2ZW7A 5G20A 4ONUA 3EY5A 1IIDA 3FNCA 4PK3A 4CYNA 3UY5A 1YX0A 2RC4A 4F0XA 2Q0YA 2REEA 1P0HA 4MFZA 4CAWA 3FB3A 1YVKA 1KZFA 4KZTA 1ON0A 4UWIA 3D2PA 5H86A 4UBRA 4CS0B 3V8IA 3D3SA 4U9YA 4ORFA 1Z4RA 1CJWA 2Z0ZA 4A2ZA 2Q44A 2YNCC 3EO4A 3SHPA 3H4QA 2BEIA 5AG5A 2AJ6A 4KOUA 4B5PB 4KOTA 5DWNA 4HNYB 5E96A 2VZZA 4B13A 2FXFA 2OZGA 5IX3A 5KTCA 4FD4A 2ARHA 2OZUA 2JDCA 4CGNA 2ZW6A 1B6BA 2Z3NA 4UFXA 2B5GA 2HUZA 4AG9A 1Z9UA 5J8CA 2HQYA 2VI7A 2YGWA 3DDDA 1Y7RA 5GCNA 5G22A 3W6SA 1KUXA 3KKWA 4AVAA 4LX9A 2FS5A 3BJ8A 3G3SA 4YGOA 5AGEA 3GY9A 3TOAA 4QVTA 5KTDA 2CXAA 3PGPA 3SXOA 4PV6A 3T9YA 4H89A 3RYOA 1I12A 4HNXB 1ZO0A 3B8GA 4KVOE 4AG7A 4KUAA 2JEVA 4F6AA 4C68A 1IB1E 1YR0A 2PC1A 1FY7A 4B5OA 4JXQA 4FD6A 3W91A 4NF1A 2EUIA 3ZJ0A 2B4DA 3WR7A 5A28A 2FIWA 2P6GA 4JWPA 5EC4A 3CXSA 2PSWA 4LUAA 3D8PA 4CAEA 2GE3A 5AG7A 2CNSA 2P0WA 5CNPA 1MJ9A 1UFHA 2OH1A 4KVXA 4CRZB 5JQ4A 4HKFA 2A4NA 2GANA 4B5PA 4QBJA 2BUEA 2ZW4A 4FD7A 4B14A 3BLNA 3EXNA 4NXYA 4UCPA 4CGPA 4OADA 1YREA 1NMTA 5IB0A 4ZGYB 3S6HA 4XPLA 4KOXA 2OZHA 4KOVA 2B4BA 3VWDA 5DWMA 4CGOA 2HV2A 3QB8A 3CXPA 3TT2A 2J8MA 1MJBA 3FBUA 2QIRA 4KS9A 4L8AA 2Z3LA 4CAVA 4K30A 4OLLA 2ZPAA 1N71A 2YNEA 3R95A 4MHDA 3R1KA 4R57A 1I1DA 1IYLA 3TCVA 2B4DB 1IICA 2BSWA 4XPKA 4NCZA 1YLEA 1Z4EA 2WSAA 1S3ZA 3K9UA 5FVJA 4UCMA 3SXNA 4CYQA 2G3TA 2O28A 2REFA 1SQHA 4L89A 2PDOA 4JLYA 4NSQA 2BL1A 3IU1A 3R9EA 2Z3KA 2Q7BA 1LRZA 1XEBA 2CY2A 2ZW5A 3DSBA 4FD5A 4MFKA 5J8FA 2PRBA 2R98A 2DPSA 2Z10A 2OB0A 5AG6A 3TFYA 4MFQA 3R96A 2QMLA 2VZYA 1S5KA 1VHSA 1TIQA 5H84A 5KTAA 4KSFA 1IYKA 3S6KA 1NE9A 3E0KA 4HNWB 2P6EA 3EC4A 4A95A 4F0YA 1CM0A 4II9A 1QSRA 1U6MA 2QECA 3GKRA 3PP9A 2IL4A 5C82A 4CYPA 3CXQA 1OZPA 1Q2DA 2FT0A 3TE4A 4NEXA 1YGHA 1M4GA 4QUSA 1MJAA 4KOWA 5A27A 2WPXA 1RO5A 2R7HA 2PQ8A 2VXKA 3C26A 4CAFA 1PUAA 3F0AA 4XPDC 4KOYA 4XPDB 2X7BA 4MI4A 3F8KA 4Q36A 5C88A 1S7LA 4C7IA 4X5KA 3GYAA 2EVNA 4C7HA 1NSLA 1YVOA 2GIVA 2B3UA 3FIXA 4CYOA 3TO7A 4KLVA 1KUYA 1QSMA 4AB7A 2VQYA 2PR1A 4E0AA 1L0CA 1B87A 2FIAA 5G1ZA 3IU2A 3LD2A 4PSWA 1S7NA 1R57A 4H6UA 4PSXA 3ZZIA 4JJXA 1S60A 2D4PA 3JTKA 4IUSA 4XNHB 2JLMA 4EVYA 2FCKA 4KLWA 4R3LA 4B12A 4B11A 3PZJA 4PK2A 3D2MA 3IWEA 2Z3MA 4ZBGA 4CRYB 4CGMA 5F47A 4R87A 3BJ7A 4MFLA 4UWJA 2DPTA 4MFPA 2R1IA 3TO9A 5BWAB 3H5ZA 3VWEA 3IWGA 1BO4A 2WPWA 2ZXVA 3I9SA 5F48A 2NMTA 5EBVA 2VEZA 4MJ8A 2FL4A 4MY0A 4C2ZA 1M4IA 1P4NA 1WK4A 2CNMA 2AE6A 2PR8A 1Q2YA 3TO6A 4MY3A 2YNDA 4Y49C 2VBQA 4Y49B 4RI1A 2H5MA 4J3GA 1Y9KA 3P2FA 4E8OA 2OU2A 2B58A 3JUWA 2Z3OA 4U9ZA 2Z11A 1XIXA 3F5BA 3FYNA 4A31A 4KSAA 5I0CA 1QSNA 3P2HA 2G0BA 3S6GA 4I49A 4C2YA 5HH1A 2Q04A 4C2XA 4QB9A 1Q2CA 1M44A 4AVCA 1QSTA 2Q4VA 5G21A 4AVBA 5AG4A 4KUBA 4JD6A 2G3AA 1M4DA 2R8VA 4KORA 2ATRA 4JXRA 2F5IA 3S6FA 1GHEA 2K5TA 1XE4A 4BMHA 1XMTA 3LODA 4CAXA 3DNSA 4H6ZA 4UFVA 4R9MA 2J8RA 3W6XA 1S7KA 3TTHA 4KVME 2I00A 1M1DA 4DNCA 2C27A 1J4JA 4OAEA 4KOSA 5JPHA 1MK4A 1QSOA 4RS2A 5F46A 3A9LA 2Q4YA 1K4JA 4UA3A 5IV0A 1RXTA 1S7FA 2FE7A 3G8WA 3T90A 2FSRA 2Z3PA 1XF8A 2D4OA 3OWCA 4A32A 4BBHA 1VKCA 1YK3A 3EFAA 3NE7A 4M85A 2WUUA 3FXTA 1WWZA 1KUVA 4UCNA 3R9FA 3R9GA 2KCWA 3DR6A 1PU9A 5ISVA 3I3GA 2YNCA 4IF5A 4E2AA 4CGLA 4XNHC 5F49A 2B3VA 2I79A 3DR8A 3FRMA 5HMNA 3MGDA 3TOBA 4M3SA 2B5GB 2CNTA 4B10A 4A30A 4R3KA 4UFWA 1Y9WA 1BOBA 4A33A 4QC6A 3IGRA 2DXQA 3QAHA 1V0CA 1I21A 2Y0MA 2J8NA 2P6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YRH A;  3JVN A;  4U5Y A;  4YFJ A;  3N7Z A;  4MBU A;  4GS4 A;  2JDD A;  2ZW7 A;  4ONU A;  3EY5 A;  1IID A;  3FNC A;  4PK3 A;  3UY5 A;  1YX0 A;  2RC4 A;  2Q0Y A;  2REE A;  1P0H A;  4CAW A;  3FB3 A;  1YVK A;  1KZF A;  4KZT A;  1ON0 A;  4UWI A;  3D2P A;  5H86 A;  4UBR A;  4CS0 B;  3V8I A;  3D3S A;  4U9Y A;  4ORF A;  1Z4R A;  1CJW A;  2Z0Z A;  2Q44 A;  3EO4 A;  3SHP A;  3H4Q A;  2BEI A;  2AJ6 A;  4KOU A;  4B5P B;  4KOT A;  5DWN A;  4HNY B;  5E96 A;  2VZZ A;  5KTC A;  2FXF A;  2OZG A;  5IX3 A;  4FD4 A;  2ARH A;  2OZU A;  2JDC A;  2ZW6 A;  1B6B A;  2B5G A;  2HUZ A;  4AG9 A;  1Z9U A;  5J8C A;  2HQY A;  2VI7 A;  3DDD A;  1Y7R A;  5GCN A;  3W6S A;  1KUX A;  3KKW A;  4AVA A;  4LX9 A;  2FS5 A;  3BJ8 A;  3G3S A;  4YGO A;  3GY9 A;  3TOA A;  4QVT A;  5KTD A;  3PGP A;  3SXO A;  4PV6 A;  3T9Y A;  4H89 A;  3RYO A;  1I12 A;  4HNX B;  3B8G A;  4KVO E;  4AG7 A;  4KUA A;  2JEV A;  4F6A A;  1IB1 E;  1YR0 A;  2PC1 A;  1FY7 A;  4B5O A;  4JXQ A;  4FD6 A;  3W91 A;  4NF1 A;  2EUI A;  3ZJ0 A;  2B4D A;  3WR7 A;  2FIW A;  2P6G A;  4JWP A;  5EC4 A;  3CXS A;  2PSW A;  4LUA A;  3D8P A;  2GE3 A;  2CNS A;  2P0W A;  5CNP A;  1MJ9 A;  1UFH A;  2OH1 A;  4KVX A;  4CRZ B;  5JQ4 A;  4HKF A;  2A4N A;  2GAN A;  4B5P A;  4QBJ A;  2BUE A;  2ZW4 A;  4FD7 A;  3BLN A;  3EXN A;  4NXY A;  4OAD A;  1YRE A;  1NMT A;  5IB0 A;  3S6H A;  4XPL A;  4KOX A;  2OZH A;  4KOV A;  2B4B A;  3VWD A;  5DWM A;  2HV2 A;  3QB8 A;  3CXP A;  3TT2 A;  2J8M A;  1MJB A;  3FBU A;  2QIR A;  4L8A A;  4CAV A;  4K30 A;  4OLL A;  2ZPA A;  1N71 A;  3R95 A;  4MHD A;  3R1K A;  4R57 A;  1I1D A;  1IYL A;  3TCV A;  2B4D B;  1IIC A;  2BSW A;  4XPK A;  4NCZ A;  1YLE A;  1Z4E A;  1S3Z A;  3K9U A;  5FVJ A;  3SXN A;  2G3T A;  2O28 A;  2REF A;  1SQH A;  4L89 A;  2PDO A;  4JLY A;  4NSQ A;  2BL1 A;  3R9E A;  2Q7B A;  1LRZ A;  1XEB A;  2CY2 A;  2ZW5 A;  3DSB A;  4FD5 A;  5J8F A;  2PRB A;  2R98 A;  2Z10 A;  2OB0 A;  3TFY A;  3R96 A;  2QML A;  2VZY A;  1S5K A;  1VHS A;  1TIQ A;  5H84 A;  5KTA A;  1IYK A;  3S6K A;  1NE9 A;  3E0K A;  4HNW B;  2P6E A;  3EC4 A;  4F0Y A;  1CM0 A;  4II9 A;  1QSR A;  1U6M A;  2QEC A;  3GKR A;  3PP9 A;  2IL4 A;  5C82 A;  3CXQ A;  1OZP A;  1Q2D A;  2FT0 A;  3TE4 A;  4NEX A;  1YGH A;  1M4G A;  4QUS A;  1MJA A;  4KOW A;  2WPX A;  1RO5 A;  2R7H A;  2PQ8 A;  2VXK A;  3C26 A;  1PUA A;  3F0A A;  4XPD C;  4KOY A;  4XPD B;  2X7B A;  4MI4 A;  3F8K A;  5C88 A;  1S7L A;  4X5K A;  3GYA A;  2EVN A;  1NSL A;  1YVO A;  2GIV A;  2B3U A;  3FIX A;  3TO7 A;  4KLV A;  1KUY A;  1QSM A;  4AB7 A;  2VQY A;  2PR1 A;  4E0A A;  1L0C A;  1B87 A;  2FIA A;  3LD2 A;  4PSW A;  1S7N A;  1R57 A;  4H6U A;  4PSX A;  3ZZI A;  4JJX A;  1S60 A;  2D4P A;  4IUS A;  4XNH B;  2JLM A;  4EVY A;  2FCK A;  4KLW A;  4R3L A;  3PZJ A;  4PK2 A;  3D2M A;  4ZBG A;  4CRY B;  5F47 A;  4R87 A;  3BJ7 A;  4UWJ A;  2R1I A;  3TO9 A;  3VWE A;  3IWG A;  1BO4 A;  2WPW A;  2ZXV A;  3I9S A;  5F48 A;  2NMT A;  5EBV A;  2VEZ A;  4MJ8 A;  2FL4 A;  4MY0 A;  1M4I A;  1P4N A;  1WK4 A;  2CNM A;  2AE6 A;  2PR8 A;  1Q2Y A;  3TO6 A;  4MY3 A;  4Y49 C;  2VBQ A;  4Y49 B;  4RI1 A;  2H5M A;  4J3G A;  1Y9K A;  3P2F A;  4E8O A;  2OU2 A;  2B58 A;  3JUW A;  4U9Z A;  2Z11 A;  1XIX A;  3F5B A;  3FYN A;  5I0C A;  1QSN A;  3P2H A;  2G0B A;  3S6G A;  4I49 A;  5HH1 A;  2Q04 A;  4QB9 A;  1Q2C A;  1M44 A;  4AVC A;  1QST A;  2Q4V A;  4AVB A;  4KUB A;  4JD6 A;  2G3A A;  1M4D A;  2R8V A;  4KOR A;  2ATR A;  4JXR A;  2F5I A;  3S6F A;  1GHE A;  2K5T A;  1XE4 A;  4BMH A;  1XMT A;  3LOD A;  4CAX A;  3DNS A;  4H6Z A;  4R9M A;  2J8R A;  3W6X A;  1S7K A;  3TTH A;  4KVM E;  2I00 A;  1M1D A;  4DNC A;  2C27 A;  1J4J A;  4OAE A;  4KOS A;  5JPH A;  1MK4 A;  1QSO A;  4RS2 A;  5F46 A;  2Q4Y A;  1K4J A;  4UA3 A;  5IV0 A;  1RXT A;  1S7F A;  2FE7 A;  3G8W A;  3T90 A;  2FSR A;  3OWC A;  1XF8 A;  2D4O A;  1VKC A;  1YK3 A;  3EFA A;  3NE7 A;  4M85 A;  3FXT A;  1WWZ A;  1KUV A;  3R9F A;  3R9G A;  2KCW A;  3DR6 A;  1PU9 A;  5ISV A;  3I3G A;  4IF5 A;  4E2A A;  4XNH C;  5F49 A;  2B3V A;  2I79 A;  3DR8 A;  3FRM A;  5HMN A;  3MGD A;  3TOB A;  4M3S A;  2B5G B;  2CNT A;  4R3K A;  1Y9W A;  1BOB A;  4QC6 A;  3IGR A;  2DXQ A;  3QAH A;  1V0C A;  1I21 A;  2Y0M A;  2J8N A;  2P6F A; 
#chains in the Genus database with same CATH topology
 2HB6 A;  2O53 A;  1TF8 A;  3JVN A;  4YRH A;  3D4U A;  4U5Y A;  4Q38 A;  1Z8X A;  2Y0M A;  4YFJ A;  2Q4Z A;  3N7Z A;  4GS4 A;  4MBU A;  4MFJ A;  3FJU A;  3KGQ A;  2JDD A;  1PCA A;  2PJ3 A;  4G1P A;  3VAT A;  2ZW7 A;  5G20 A;  1AUG A;  4ONU A;  1H8L A;  4ZI6 A;  3NH4 A;  3BI1 A;  3EY5 A;  3FMC A;  3K2K A;  1IID A;  3FNC A;  4NGM A;  4PK3 A;  3UY5 A;  1LAP A;  4CYN A;  1YME A;  5THW A;  2IJZ A;  2RC4 A;  3CZX A;  4F0X A;  2Q0Y A;  2REE A;  1P0H A;  4MFZ A;  4CAW A;  4YWY A;  2HC9 A;  3FB3 A;  1F2O A;  1YVK A;  1KZF A;  4KZT A;  1ON0 A;  1CBX A;  3KAS A;  3NH5 A;  4UWI A;  2EK8 A;  3D2P A;  5H86 A;  4OME A;  4UBR A;  4CS0 B;  4OP4 A;  3V8I A;  3D3S A;  4U9Y A;  2ZED A;  4ORF A;  3SI2 A;  3WC7 A;  3B7I A;  1Z4R A;  1CJW A;  1F57 A;  2Z0Z A;  3GIU A;  2CF4 A;  4X8I A;  4A2Z A;  2Q44 A;  2YNC C;  3EO4 A;  3S9L A;  3SHP A;  3SJG A;  3H4Q A;  2BEI A;  4R6T A;  4MCQ A;  5K8P A;  4NGQ A;  2AJ6 A;  5AG5 A;  4KOU A;  4B5P B;  1Y7E A;  4KOT A;  5DWN A;  4HNY B;  5E96 A;  3SJE A;  2VZZ A;  3ISX A;  2FXF A;  2OZG A;  4B13 A;  5IX3 A;  1LFW A;  5KTC A;  2PJ8 A;  4FD4 A;  4P4J A;  5JGF A;  2ARH A;  4RUH A;  3WAB A;  5HVH A;  1VIX A;  1Q7L A;  2OZU A;  3IJ3 A;  2JDC A;  4P10 A;  4CGN A;  2ZW6 A;  1B6B A;  2Z3N A;  4UFX A;  2B5G A;  2HUZ A;  4YU9 A;  1IOF A;  1Z9U A;  4AG9 A;  4EWT A;  2AFZ A;  5J8C A;  2HQY A;  3BXM A;  2VI7 A;  2V8D A;  1R43 A;  2YGW A;  4IAV A;  1DE4 C;  3DDD A;  4M6G A;  2RB7 A;  1Y7R A;  1FT7 A;  5GCN A;  5G22 A;  3W6S A;  1KUX A;  5ELY A;  3KKW A;  4AVA A;  4LX9 A;  1TKJ A;  2FS5 A;  2PJ6 A;  2PJ1 A;  3BJ8 A;  3H8F A;  3G3S A;  4UF4 A;  4YGO A;  3LWU A;  5AGE A;  3GY9 A;  3TOA A;  4QVT A;  5KTD A;  2C6C A;  2CXA A;  1Z8W A;  3PGP A;  3SXO A;  3CPA A;  1M4L A;  2PJ9 A;  4MHN A;  4PV6 A;  3T9Y A;  4R76 A;  4H89 A;  3RYO A;  1I12 A;  3FEE A;  4HNX B;  4F9V A;  5LYD A;  1ZO0 A;  2XEJ A;  3B8G A;  4KVO E;  3KQZ A;  4KUA A;  4AG7 A;  2JEV A;  4F6A A;  4C68 A;  1IB1 E;  1YR0 A;  3JRU A;  2PC1 A;  1FY7 A;  2QVP A;  4OC0 A;  3RAM A;  5JM6 A;  4B5O A;  4JXQ A;  5IB9 A;  4FD6 A;  4ONW A;  4NF1 A;  3W91 A;  2EUI A;  1ZG8 A;  6CPA A;  3ZJ0 A;  3RBU A;  2B4D A;  1YSJ A;  3PBE A;  4MXU A;  3WR7 A;  2ODF A;  2FIW A;  4LQG A;  2P6G A;  3QNV A;  4EME A;  4JWP A;  3WC6 A;  1X10 A;  3CXS A;  2PSW A;  5EC4 A;  4LUA A;  1A2Z A;  4MHY A;  1BPM A;  2C6P A;  3D8P A;  5LRG A;  3KI9 A;  2F8H A;  1UWY A;  4CAE A;  1Y0Y A;  3MN8 A;  1ZLI A;  2GE3 A;  1X12 A;  5AG7 A;  4ZX8 A;  4TNU A;  1VHO A;  2CNS A;  2P0W A;  5CNP A;  1MJ9 A;  1UFH A;  2AFW A;  4W9Y A;  2GLF A;  2OH1 A;  4KVX A;  4CRZ B;  2PJ7 A;  5JQ4 A;  4GXH A;  4HKF A;  2A4N A;  2GAN A;  3FH4 A;  3PB9 X;  2BUE A;  2C6G A;  2ZW4 A;  4FD7 A;  4R7M A;  1FNO A;  4B5P A;  4NGR A;  1AYE A;  3BLN A;  3EXN A;  4NXY A;  4UCP A;  4B14 A;  4OAD A;  1YRE A;  4CGP A;  2BCO A;  1NMT A;  5IB0 A;  4A38 A;  4ZGY B;  3S6H A;  4XPL A;  2GRE A;  5K8N A;  4KOX A;  2PJC A;  2OZH A;  4KOV A;  5LRK A;  1QQ9 A;  2PJ5 A;  2B4B A;  2Q43 A;  3IO1 A;  1IY7 A;  3VWD A;  3KHZ A;  5DWM A;  1CPS A;  4CGO A;  4OID A;  2WYR A;  2HV2 A;  2OOT A;  4P4I A;  4QBJ A;  2ZEL A;  3I1U A;  4P4D A;  2XEF A;  3QB8 A;  1QMU A;  3CXP A;  3PFE A;  4JYW A;  5A28 A;  4PXE A;  3TT2 A;  2J8M A;  4PQA A;  5LYI A;  4FUU A;  1MJB A;  3FX6 A;  3FBU A;  1LOK A;  2QIR A;  3K9T A;  4KS9 A;  4MRI A;  4L8A A;  3CDX A;  2Z3L A;  4CAV A;  4K30 A;  4OLL A;  3N5F A;  2ZPA A;  1N71 A;  4MHP A;  2YNE A;  2ZEE A;  3R95 A;  4MHD A;  3R1K A;  3IEH A;  4R57 A;  5F09 A;  3RZA A;  2C1C A;  3LMS A;  3PFO A;  1I1D A;  1IYL A;  4NGN A;  3TCV A;  3D68 A;  2B4D B;  4UEZ A;  3B3C A;  2ABZ A;  1IIC A;  2BSW A;  4XPK A;  1CP6 A;  3SJF A;  1PYT B;  4NCZ A;  1YLE A;  1Z4E A;  4FWU A;  2WSA A;  3PRT A;  1XRY A;  3KL9 A;  1S3Z A;  3K9U A;  5FVJ A;  4UCM A;  3SXN A;  4CYQ A;  2G3T A;  2O28 A;  2REF A;  1SQH A;  4L89 A;  4B6Z A;  2PDO A;  2PVW A;  5JH9 A;  4A39 A;  1CX8 A;  4JLY A;  5HVG A;  4NSQ A;  2BL1 A;  3IU1 A;  3R9E A;  1LCP A;  2Z3K A;  2Q7B A;  1LRZ A;  1XEB A;  4PXD A;  2CY2 A;  2ZW5 A;  3DSB A;  4FD5 A;  4MFK A;  4OKO A;  1Z8L A;  5J8F A;  4EFD A;  2PJA A;  1NSA A;  2RFH A;  1TKH A;  2PRB A;  5I4M A;  2R98 A;  2DPS A;  1F2P A;  2Z10 A;  4MMO A;  2OB0 A;  4WJB A;  5AG6 A;  5HVF A;  3TFY A;  4ZYQ A;  4MFQ A;  4OC5 A;  3R96 A;  2DF5 A;  2QML A;  2VZY A;  4OC1 A;  1S5K A;  2V8G A;  1VHS A;  1BAV A;  1TIQ A;  5H84 A;  3IC1 A;  5KTA A;  1OBR A;  4KSF A;  3D7G A;  1IYK A;  1XJO A;  4ZY2 A;  3S6K A;  2CTB A;  1NE9 A;  3PB7 X;  3IIB A;  4JZ0 A;  4P6Y A;  3FVL A;  3BHX A;  4CPA A;  1DTD A;  2V8V A;  1LAN A;  3E0K A;  2PRQ A;  3IFE A;  5CPA A;  4HNW B;  2P6E A;  3EC4 A;  4A95 A;  2ZEO A;  4F0Y A;  4MCP A;  3VH9 A;  1CM0 A;  3PB4 X;  2Q51 A;  4II9 A;  1QSR A;  1XMB A;  4IHM A;  1U6M A;  2QEC A;  3GKR A;  3PP9 A;  2IL4 A;  3SI1 A;  4CYP A;  5C82 A;  3CXQ A;  2PVV A;  1OZP A;  1VHE A;  1Q2D A;  1XBU A;  1IU8 A;  2FT0 A;  4DUK A;  7CPA A;  5J1Q A;  2DEA A;  5K8M A;  3TE4 A;  4IK2 A;  4NEX A;  3TX8 A;  1YGH A;  1M4G A;  4QUS A;  8CPA A;  1MJA A;  4KOW A;  5A27 A;  2WPX A;  2AFU A;  1RO5 A;  4Z65 A;  2R7H A;  2PQ8 A;  2VXK A;  2IMO A;  3C26 A;  2EK9 A;  4CAF A;  1PUA A;  1HDU A;  3F0A A;  4XPD C;  3KHX A;  4KOY A;  4XPD B;  4X2T A;  2X7B A;  4MI4 A;  2AFS A;  3F8K A;  4Q36 A;  3RO0 A;  4AXV A;  5C88 A;  1S7L A;  3H8E A;  4K3N A;  4C7I A;  4X5K A;  3B3W A;  3GYA A;  2EVN A;  4C7H A;  1NSL A;  1YVO A;  2GIV A;  2ANP A;  4NGP A;  4UIB A;  1VGY A;  2B3U A;  3FIX A;  4CYO A;  3TO7 A;  4KLV A;  3B3T A;  1KUY A;  1QSM A;  4KSI A;  4AB7 A;  4PXC A;  2VQY A;  3LAC A;  2PIZ A;  2PR1 A;  3NFZ A;  3B2Y A;  4E0A A;  1L0C A;  1B87 A;  2FIA A;  5G1Z A;  3IU2 A;  3LD2 A;  2ZEP A;  4PSW A;  1S7N A;  4HPS A;  1R57 A;  4H6U A;  4NFR A;  1ZLH A;  4EVY A;  4WWV A;  5EMI A;  4PSX A;  4P45 A;  3ZZI A;  4JJX A;  1S60 A;  2D4P A;  2XEG A;  3JTK A;  4LQ6 A;  3PBB A;  4IUS A;  4XNH B;  2J9A A;  2GFQ A;  1TKF A;  2FCK A;  2JLM A;  3DLJ A;  4KLW A;  4NGT A;  4P4B A;  4R3L A;  4B12 A;  4B11 A;  4BIN A;  5K8O A;  1Z5R A;  3PZJ A;  4PK2 A;  3D2M A;  3IWE A;  4DYO A;  4UIA A;  2Z3M A;  1CP7 A;  2NYQ A;  2PJ4 A;  4ZBG A;  3WT4 A;  2XEI A;  4CRY B;  4CGM A;  5F47 A;  4R87 A;  3BJ7 A;  4A94 A;  4MFL A;  1ARM A;  4UWJ A;  2DPT A;  1XOV A;  4MFP A;  2R1I A;  3TO9 A;  1XFO A;  4F8Z A;  3RNZ A;  3V38 A;  2VL1 A;  1TF9 A;  2AFX A;  5BWA B;  1CPX A;  3H5Z A;  3VWE A;  3PB6 X;  3IWG A;  1BO4 A;  2WPW A;  2ZXV A;  3I9S A;  5F48 A;  2NMT A;  3GLJ A;  3IWW A;  4P4F A;  2EWB A;  1IGB A;  2ZEN A;  5EBV A;  1HEE A;  2VEZ A;  3D7D A;  3D67 A;  4MJ8 A;  2FL4 A;  2OR4 A;  3PB8 X;  3SJX A;  4OC2 A;  4MY0 A;  4C2Z A;  3KR4 A;  4ZY1 A;  2PJ2 A;  1M4I A;  4UEF A;  1RTQ A;  4TWE A;  1IOI A;  4A37 A;  3B3S A;  1ARL A;  2ZOG A;  3T8W A;  1P4N A;  1WK4 A;  4NJQ A;  2CNM A;  4M6H A;  4PXB A;  2AE6 A;  2PR8 A;  1Q2Y A;  2ZEG A;  3D7H A;  4F9U A;  2NSM A;  3TO6 A;  4MY3 A;  3S9N A;  2YND A;  4Y49 C;  4Q7A A;  3SI0 A;  2VBQ A;  3D7F A;  2O4H A;  4Y49 B;  2G9D A;  4UEE A;  4RI1 A;  1YW6 A;  2H5M A;  4M6I A;  2JEW A;  4J3G A;  3NH8 A;  5LRJ A;  1Y9K A;  3P2F A;  4E8O A;  2OU2 A;  2B58 A;  3BI0 A;  3H8G A;  3JUW A;  2POK A;  2Z3O A;  4U9Z A;  1BLL E;  2Z11 A;  1XIX A;  3F5B A;  2ZEF A;  3FYN A;  4MHZ A;  4NGS A;  4A31 A;  4KSA A;  4MCS A;  5I0C A;  4RN7 A;  1QSN A;  2PCU A;  2PIY A;  3P2H A;  2BO9 A;  3S9M A;  2G0B A;  3S6G A;  3KR5 A;  4R8F A;  4FBE A;  4I49 A;  4C2Y A;  3CT9 A;  3HLP A;  2PE3 A;  5HH1 A;  3GB0 A;  2Q04 A;  2V77 A;  4C2X A;  4QB9 A;  1M44 A;  1Q2C A;  1Y0R A;  1ELL P;  1QST A;  4AVC A;  2Q4V A;  3GUX A;  5G21 A;  4AVB A;  5AG4 A;  3FF3 A;  4KUB A;  4JD6 A;  3V7Z A;  2G3A A;  1M4D A;  2R8V A;  4KOR A;  3FEC A;  2ATR A;  2IQ6 A;  5LYL A;  1ELM P;  4JXR A;  2PJ0 A;  2F5I A;  3S6F A;  1GHE A;  2K5T A;  1XE4 A;  2FVG A;  5HXD A;  1Z8T A;  1JQG A;  4BMH A;  3VAR A;  1XMT A;  2QJ8 A;  5DS0 A;  2JBJ A;  3LOD A;  4CAX A;  3DNS A;  1Z2L A;  4H6Z A;  4UFV A;  1CG2 A;  1ZG7 A;  4R9M A;  2J8R A;  3W6X A;  1S7K A;  3TTH A;  1EE3 P;  4KVM E;  2I00 A;  1M1D A;  2WZN A;  5LYF A;  4DNC A;  2JBK A;  2C27 A;  1J4J A;  1GYT A;  4OC4 A;  4OAE A;  4KOS A;  5JPH A;  1MK4 A;  1BPN A;  1QSO A;  1HDQ A;  2EBJ A;  4RS2 A;  5F46 A;  3A9L A;  2Q4Y A;  2ZOF A;  1K4J A;  4X3R A;  4OIW A;  4UA3 A;  5IV0 A;  2QYV A;  1RXT A;  1S7F A;  2V8H A;  2FE7 A;  3G8W A;  1YLO A;  2FSR A;  3T90 A;  2Z3P A;  1XF8 A;  2D4O A;  3OWC A;  4A32 A;  4BBH A;  1VKC A;  3KZW A;  2ZEH A;  3HUV A;  1YK3 A;  1YQE A;  3EFA A;  3NE7 A;  4FAI A;  4M85 A;  1TXR A;  2EO8 A;  3L2N A;  2WUU A;  4P4E A;  4ZX9 A;  3FXT A;  1JWQ A;  1WWZ A;  3FED A;  2CIJ A;  2BOA A;  4MCR A;  1KUV A;  2F7V A;  2PJB A;  2GLJ A;  4UCN A;  3R9F A;  3R9G A;  2KCW A;  5CBM A;  3DR6 A;  1PU9 A;  3ISZ A;  4O23 A;  3I3G A;  5ISV A;  3B3V A;  3MRU A;  4NJR A;  1ZG9 A;  1LAM A;  2GU2 A;  2YNC A;  4IF5 A;  4CGL A;  4E2A A;  3KQX A;  1KWM A;  4XNH C;  4ZY0 A;  5D29 A;  5F49 A;  2B3V A;  2I79 A;  3DR8 A;  3FRM A;  2ZEM A;  3NA6 A;  4H2K A;  2AFO A;  5HMN A;  3MGD A;  4P44 A;  3TOB A;  4PPZ A;  5D8N A;  4M3S A;  4DJL A;  2B5G B;  2CNT A;  2CTC A;  4GM5 A;  3CPX A;  4BD9 A;  1YW4 A;  3QAY A;  4B10 A;  4A30 A;  3D66 A;  4R3K A;  4UFW A;  3TC8 A;  3WC5 A;  1Y9W A;  1BOB A;  4A33 A;  4QC6 A;  2AFM A;  1AMP A;  2I3C A;  1R3N A;  3DGV A;  3IGR A;  2DXQ A;  3NE8 A;  1V0C A;  3PEI A;  1I21 A;  3QAH A;  1YX0 A;  4OC3 A;  2J8N A;  2Q7S A;  3B35 A;  2P6F A; 
#chains in the Genus database with same CATH homology
 4YRH A;  3JVN A;  4U5Y A;  4Q38 A;  4YFJ A;  3N7Z A;  4MBU A;  4GS4 A;  4MFJ A;  2JDD A;  2ZW7 A;  5G20 A;  4ONU A;  3EY5 A;  1IID A;  3FNC A;  4PK3 A;  4CYN A;  3UY5 A;  1YX0 A;  2RC4 A;  4F0X A;  2Q0Y A;  2REE A;  1P0H A;  4MFZ A;  4CAW A;  3FB3 A;  1YVK A;  1KZF A;  4KZT A;  1ON0 A;  4UWI A;  3D2P A;  5H86 A;  4UBR A;  4CS0 B;  3V8I A;  3D3S A;  4U9Y A;  4ORF A;  1Z4R A;  1CJW A;  2Z0Z A;  4A2Z A;  2Q44 A;  2YNC C;  3EO4 A;  3SHP A;  3H4Q A;  2BEI A;  5AG5 A;  2AJ6 A;  4KOU A;  4B5P B;  4KOT A;  5DWN A;  4HNY B;  5E96 A;  2VZZ A;  4B13 A;  2FXF A;  2OZG A;  5IX3 A;  5KTC A;  4FD4 A;  2ARH A;  2OZU A;  2JDC A;  4CGN A;  2ZW6 A;  1B6B A;  2Z3N A;  4UFX A;  2B5G A;  2HUZ A;  4AG9 A;  1Z9U A;  5J8C A;  2HQY A;  2VI7 A;  2YGW A;  3DDD A;  1Y7R A;  5GCN A;  5G22 A;  3W6S A;  1KUX A;  3KKW A;  4AVA A;  4LX9 A;  2FS5 A;  3BJ8 A;  3G3S A;  4YGO A;  5AGE A;  3GY9 A;  3TOA A;  4QVT A;  5KTD A;  2CXA A;  3PGP A;  3SXO A;  4PV6 A;  3T9Y A;  4H89 A;  3RYO A;  1I12 A;  4HNX B;  1ZO0 A;  3B8G A;  4KVO E;  4AG7 A;  4KUA A;  2JEV A;  4F6A A;  4C68 A;  1IB1 E;  1YR0 A;  2PC1 A;  1FY7 A;  4B5O A;  4JXQ A;  4FD6 A;  3W91 A;  4NF1 A;  2EUI A;  3ZJ0 A;  2B4D A;  3WR7 A;  5A28 A;  2FIW A;  2P6G A;  4JWP A;  5EC4 A;  3CXS A;  2PSW A;  4LUA A;  3D8P A;  4CAE A;  2GE3 A;  5AG7 A;  2CNS A;  2P0W A;  5CNP A;  1MJ9 A;  1UFH A;  2OH1 A;  4KVX A;  4CRZ B;  5JQ4 A;  4HKF A;  2A4N A;  2GAN A;  4B5P A;  4QBJ A;  2BUE A;  2ZW4 A;  4FD7 A;  4B14 A;  3BLN A;  3EXN A;  4NXY A;  4UCP A;  4CGP A;  4OAD A;  1YRE A;  1NMT A;  5IB0 A;  4ZGY B;  3S6H A;  4XPL A;  4KOX A;  2OZH A;  4KOV A;  2B4B A;  3VWD A;  5DWM A;  4CGO A;  2HV2 A;  3QB8 A;  3CXP A;  3TT2 A;  2J8M A;  1MJB A;  3FBU A;  2QIR A;  4KS9 A;  4L8A A;  2Z3L A;  4CAV A;  4K30 A;  4OLL A;  2ZPA A;  1N71 A;  2YNE A;  3R95 A;  4MHD A;  3R1K A;  4R57 A;  1I1D A;  1IYL A;  3TCV A;  2B4D B;  1IIC A;  2BSW A;  4XPK A;  4NCZ A;  1YLE A;  1Z4E A;  2WSA A;  1S3Z A;  3K9U A;  5FVJ A;  4UCM A;  3SXN A;  4CYQ A;  2G3T A;  2O28 A;  2REF A;  1SQH A;  4L89 A;  2PDO A;  4JLY A;  4NSQ A;  2BL1 A;  3IU1 A;  3R9E A;  2Z3K A;  2Q7B A;  1LRZ A;  1XEB A;  2CY2 A;  2ZW5 A;  3DSB A;  4FD5 A;  4MFK A;  5J8F A;  2PRB A;  2R98 A;  2DPS A;  2Z10 A;  2OB0 A;  5AG6 A;  3TFY A;  4MFQ A;  3R96 A;  2QML A;  2VZY A;  1S5K A;  1VHS A;  1TIQ A;  5H84 A;  5KTA A;  4KSF A;  1IYK A;  3S6K A;  1NE9 A;  3E0K A;  4HNW B;  2P6E A;  3EC4 A;  4A95 A;  4F0Y A;  1CM0 A;  4II9 A;  1QSR A;  1U6M A;  2QEC A;  3GKR A;  3PP9 A;  2IL4 A;  5C82 A;  4CYP A;  3CXQ A;  1OZP A;  1Q2D A;  2FT0 A;  3TE4 A;  4NEX A;  1YGH A;  1M4G A;  4QUS A;  1MJA A;  4KOW A;  5A27 A;  2WPX A;  1RO5 A;  2R7H A;  2PQ8 A;  2VXK A;  3C26 A;  4CAF A;  1PUA A;  3F0A A;  4XPD C;  4KOY A;  4XPD B;  2X7B A;  4MI4 A;  3F8K A;  4Q36 A;  5C88 A;  1S7L A;  4C7I A;  4X5K A;  3GYA A;  2EVN A;  4C7H A;  1NSL A;  1YVO A;  2GIV A;  2B3U A;  3FIX A;  4CYO A;  3TO7 A;  4KLV A;  1KUY A;  1QSM A;  4AB7 A;  2VQY A;  2PR1 A;  4E0A A;  1L0C A;  1B87 A;  2FIA A;  5G1Z A;  3IU2 A;  3LD2 A;  4PSW A;  1S7N A;  1R57 A;  4H6U A;  4PSX A;  3ZZI A;  4JJX A;  1S60 A;  2D4P A;  3JTK A;  4IUS A;  4XNH B;  2JLM A;  4EVY A;  2FCK A;  4KLW A;  4R3L A;  4B12 A;  4B11 A;  3PZJ A;  4PK2 A;  3D2M A;  3IWE A;  2Z3M A;  4ZBG A;  4CRY B;  4CGM A;  5F47 A;  4R87 A;  3BJ7 A;  4MFL A;  4UWJ A;  2DPT A;  4MFP A;  2R1I A;  3TO9 A;  5BWA B;  3H5Z A;  3VWE A;  3IWG A;  1BO4 A;  2WPW A;  2ZXV A;  3I9S A;  5F48 A;  2NMT A;  5EBV A;  2VEZ A;  4MJ8 A;  2FL4 A;  4MY0 A;  4C2Z A;  1M4I A;  1P4N A;  1WK4 A;  2CNM A;  2AE6 A;  2PR8 A;  1Q2Y A;  3TO6 A;  4MY3 A;  2YND A;  4Y49 C;  2VBQ A;  4Y49 B;  4RI1 A;  2H5M A;  4J3G A;  1Y9K A;  3P2F A;  4E8O A;  2OU2 A;  2B58 A;  3JUW A;  2Z3O A;  4U9Z A;  2Z11 A;  1XIX A;  3F5B A;  3FYN A;  4A31 A;  4KSA A;  5I0C A;  1QSN A;  3P2H A;  2G0B A;  3S6G A;  4I49 A;  4C2Y A;  5HH1 A;  2Q04 A;  4C2X A;  4QB9 A;  1Q2C A;  1M44 A;  4AVC A;  1QST A;  2Q4V A;  5G21 A;  4AVB A;  5AG4 A;  4KUB A;  4JD6 A;  2G3A A;  1M4D A;  2R8V A;  4KOR A;  2ATR A;  4JXR A;  2F5I A;  3S6F A;  1GHE A;  2K5T A;  1XE4 A;  4BMH A;  1XMT A;  3LOD A;  4CAX A;  3DNS A;  4H6Z A;  4UFV A;  4R9M A;  2J8R A;  3W6X A;  1S7K A;  3TTH A;  4KVM E;  2I00 A;  1M1D A;  4DNC A;  2C27 A;  1J4J A;  4OAE A;  4KOS A;  5JPH A;  1MK4 A;  1QSO A;  4RS2 A;  5F46 A;  3A9L A;  2Q4Y A;  1K4J A;  4UA3 A;  5IV0 A;  1RXT A;  1S7F A;  2FE7 A;  3G8W A;  3T90 A;  2FSR A;  2Z3P A;  1XF8 A;  2D4O A;  3OWC A;  4A32 A;  4BBH A;  1VKC A;  1YK3 A;  3EFA A;  3NE7 A;  4M85 A;  2WUU A;  3FXT A;  1WWZ A;  1KUV A;  4UCN A;  3R9F A;  3R9G A;  2KCW A;  3DR6 A;  1PU9 A;  5ISV A;  3I3G A;  2YNC A;  4IF5 A;  4E2A A;  4CGL A;  4XNH C;  5F49 A;  2B3V A;  2I79 A;  3DR8 A;  3FRM A;  5HMN A;  3MGD A;  3TOB A;  4M3S A;  2B5G B;  2CNT A;  4B10 A;  4A30 A;  4R3K A;  4UFW A;  1Y9W A;  1BOB A;  4A33 A;  4QC6 A;  3IGR A;  2DXQ A;  3QAH A;  1V0C A;  1I21 A;  2Y0M A;  2J8N A;  2P6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...