5A28A

Leishmania major n-myristoyltransferase in complex with a chlorophenyl 1,3,4-oxadiazole inhibitor.
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of High Affinity Inhibitors of Leishmania Donovani N-Myristoyltransferase.
pubmed doi rcsb
source organism Leishmania major
total genus 123
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5a28A00
4B11A 2YNEA 4B14A 4C68A 4CGPA 5G1ZA 5AG6A 4C7HA 4A32A 4A2ZA 4UCNA 4CGLA 3IU1A 3IU2A 4B12A 4C2XA 5G21A 2YNCC 4A31A 4UFVA 5G22A 5AG7A 5G20A 2YNCA 3JTKA 4CGNA 4A33A 4UCMA 4B10A 5AG4A 4A30A 2WSAA 4CYPA 4CGOA 4UFXA 4BBHA 2WUUA 4CAEA 4CYNA 5A27A 4C7IA 5AG5A 3H5ZA 4C2ZA 4CYQA 4CAFA 4UFWA 4CYOA 4UCPA 4B13A 3IWEA 4CGMA 4A95A 4C2YA 5A28A 2YNDA 5AGEA
chains in the Genus database with same CATH superfamily
5EC4A 4YU9A 4AG9A 4C68A 3WC7A 3B3VA 4EWTA 4R76A 2OB0A 2OR4A 3TX8A 2JDCA 2XEGA 2ZEFA 4H2KA 4NGMA 3R96A 4AXVA 4MFQA 3KKWA 4OKOA 4R57A 2YNCA 5JGFA 2HV2A 4A33A 4CYPA 4NGRA 4KSFA 4QUSA 2J8NA 2AFOA 2JEWA 2BUEA 4F8ZA 4XPLA 1R3NA 4R6TA 1S7NA 5KTAA 4AVAA 3GY9A 3EO4A 5IX3A 3S6HA 4AVBA 3TO7A 1R43A 1XRYA 3VH9A 1XEBA 4B13A 4FD5A 2EBJA 2R8VA 4UEZA 3DSBA 1YVKA 2VBQA 4P45A 1VKCA 2J9AA 4YFJA 4A37A 2DF5A 2QVPA 1M4GA 3T8WA 2Z11A 2AFSA 1YW4A 2VZZA 2Z3LA 3E0KA 4FUUA 2ZENA 4Y49B 1MJ9A 5AG7A 5DWNA 5G20A 3SI2A 1IU8A 4U9YA 4MFZA 4BMHA 1Z8WA 3K9UA 4B10A 4Q36A 2VZYA 1HDQA 3IFEA 3RBUA 5EMIA 2WPWA 1XIXA 3CXPA 4ONUA 2PE3A 2HC9A 3IJ3A 4UCPA 5HVHA 4NGSA 4CGMA 4E8OA 5K8OA 3BJ7A 3T90A 1Q2DA 3DLJA 2Q44A 1F2OA 1PCAA 1CP6A 2CNTA 4MXUA 5I4MA 2QECA 4JJXA 2JEVA 3FF3A 1IYLA 3FECA 2WYRA 3C26A 3GYAA 3EC4A 5K8MA 5G21A 4A31A 4A38A 1FNOA 4FWUA 5HXDA 1Y7RA 1CG2A 1IOIA 4XPDC 3W6XA 4MJ8A 4MCQA 1TKFA 1EE3P 1Z5RA 4OP4A 2BCOA 3BXMA 3FB3A 1YLOA 3LMSA 1B87A 2X7BA 4OC2A 1QSOA 2GREA 3TC8A 5JM6A 4YRHA 2I3CA 3FH4A 2J8RA 4L8AA 4ZY2A 4RS2A 1K4JA 2K5TA 2Q04A 1RXTA 3PBBA 4NGTA 1YK3A 2G3AA 2OZHA 2REFA 2WZNA 4UA3A 3SJXA 5IB0A 2I79A 2EUIA 2FS5A 1NE9A 3B3CA 1TKHA 2ARHA 4Q7AA 3RO0A 3WR7A 3GUXA 4C2YA 4R9MA 2KCWA 4P6YA 1BAVA 3V8IA 2ZPAA 3DR8A 2XEJA 4F6AA 5G1ZA 1Q7LA 4F0XA 2PR1A 3FBUA 4ZBGA 4GS4A 2QJ8A 2QYVA 2PQ8A 3PEIA 4R7MA 5D29A 3CT9A 4RI1A 4IK2A 1S60A 1Z8XA 1Z9UA 3D2MA 3H8GA 5HH1A 3KHZA 2DPSA 2DXQA 1M1DA 3MGDA 4IHMA 1J4JA 1YW6A 3I9SA 3TOBA 5F48A 1M4DA 4M6GA 4KOSA 4NCZA 1B6BA 2I00A 5EBVA 1LANA 4ZYQA 2C6CA 1U6MA 1XE4A 1PU9A 4ONWA 4CAFA 5CPAA 1I12A 4JWPA 3P2FA 4X3RA 2PJ6A 3KI9A 1IOFA 3B3SA 3B7IA 3CPXA 3FYNA 4KVXA 1BPMA 3D68A 4KLWA 2B5GA 1IGBA 3VARA 4EMEA 4KOTA 3NH5A 1ZLIA 4MCSA 4A94A 2C6GA 4PXEA 2XEFA 4KZTA 4CAVA 4NGQA 3NE7A 4YWYA 5DS0A 4JYWA 3FX6A 4KOWA 4LQ6A 4UCMA 2QMLA 3RYOA 4A30A 4DUKA 2RFHA 3GIUA 4UEFA 3L2NA 5A27A 3TO9A 2EK9A 1NSLA 1YSJA 3NH4A 4B5PB 2O28A 2POKA 3JRUA 2C27A 3LACA 4Q38A 2YNDA 4HNXB 4R87A 4NSQA 2NSMA 1KZFA 2F5IA 3TTHA 2GLFA 1MK4A 2VI7A 3QNVA 4F9UA 4ZI6A 5AG6A 5HVGA 4C7HA 3G8WA 1ON0A 2BSWA 5CNPA 3B3TA 2Q7BA 4NGNA 2G0BA 1XOVA 2ZW4A 2B5GB 3D66A 4KOYA 1KUXA 4CGNA 2H5MA 2AFZA 2PJCA 4MHDA 3VWEA 4O23A 5IB9A 1XMTA 6CPAA 2DEAA 4PPZA 3EXNA 2PJ7A 5THWA 1CP7A 3MRUA 2PJAA 3MN8A 4XPDB 2AFXA 2P6FA 4BD9A 1ELLP 2AE6A 3HLPA 3ZJ0A 1KUYA 2PJBA 4PQAA 5LYDA 3JUWA 3IWEA 4XNHC 3EFAA 2PJ1A 4QB9A 4X2TA 3B35A 2BL1A 2PJ8A 4CRZB 3GKRA 4DYOA 1Y9WA 1NMTA 3K9TA 2GFQA 4FD7A 4P4IA 4NFRA 4CGPA 1CJWA 4PV6A 3V38A 3ISXA 2PJ2A 5C82A 2Y0MA 4PSXA 4OIWA 2V8VA 4P10A 5JPHA 3N7ZA 4UFVA 3WT4A 5F09A 4ZY0A 5AG4A 3ZZIA 3CZXA 2D4PA 2CIJA 4UFXA 1M4LA 1Z4EA 1UWYA 2P0WA 1LAPA 4IF5A 4KUBA 1QSTA 3D3SA 1SQHA 4QBJA 3H5ZA 5IV0A 4JLYA 4UFWA 3WABA 2YGWA 4MHPA 2JLMA 3PB8X 2B4BA 1F57A 2O4HA 3S9LA 3BJ8A 4U9ZA 3GLJA 1LOKA 2PIZA 1BPNA 3D7FA 3FIXA 4H6ZA 4K3NA 4UCNA 3SXNA 3IWWA 4FD6A 3P2HA 3TE4A 1CPXA 2IJZA 7CPAA 1TF8A 4E0AA 3RZAA 3KL9A 2B4DB 2WSAA 4B6ZA 2V8DA 4UBRA 3RNZA 2FXFA 1OZPA 3PB9X 2RB7A 4FD4A 1GHEA 4H6UA 3SXOA 3PFEA 5LRJA 1IIDA 5K8PA 1IB1E 4CYOA 2PJ3A 1CPSA 2J8MA 3D7HA 3TCVA 4QC6A 1UFHA 1F2PA 2DPTA 2ZOGA 3KQXA 2CTCA 4R3LA 4NXYA 4UIAA 3R9GA 2IQ6A 3H8EA 4KOXA 4LUAA 2Q4ZA 1YVOA 3R95A 3UY5A 3SJGA 4CGLA 3PB7X 2FCKA 3TO6A 5H84A 2ANPA 2V77A 3BHXA 3DDDA 2Z3PA 2ZXVA 2JDDA 4MFKA 1FT7A 1RTQA 5LYIA 1R57A 4OC0A 1ZG7A 4NGPA 4B5PA 4MHZA 2WUUA 2Z3OA 5KTDA 1VHOA 3SI1A 4X5KA 1AMPA 3FVLA 4CYQA 2OZGA 1Z2LA 4MFPA 1KWMA 5LYLA 2VEZA 5F47A 2GLJA 4CRYB 1MJBA 4ORFA 1Q2YA 2HB6A 1H8LA 2CNMA 2JBJA 3PP9A 3FEDA 4K30A 4B14A 2ZEGA 4II9A 4L89A 4XNHB 3FEEA 4P4DA 4MMOA 4KSAA 4AVCA 2C6PA 2Z3KA 4JD6A 2OOTA 4Z65A 4CS0B 2Q0YA 2FL4A 2YNCC 3R9EA 4MFJA 2NMTA 5ELYA 2PJ5A 1S7LA 4FAIA 3I1UA 4H89A 4F0YA 4I49A 3N5FA 1QQ9A 2REEA 4R8FA 4HPSA 1VHSA 4BINA 1I21A 2ZELA 1TIQA 2Z10A 3D7GA 1ELMP 4U5YA 3H8FA 2HQYA 2RC4A 5GCNA 2R1IA 4LQGA 3D67A 2PDOA 4UWIA 3WC6A 2YNEA 1PUAA 4GXHA 4J3GA 4KVOE 4XPKA 2CY2A 4UEEA 3NFZA 2FIWA 1ARLA 2D4OA 4DNCA 3IU2A 1KUVA 3KHXA 4OIDA 5J8FA 3IC1A 4OC1A 2P6EA 3PZJA 4UF4A 1FY7A 2G3TA 2AFMA 2FSRA 1TXRA 1IY7A 1S7KA 8CPAA 3DNSA 3H4QA 2PCUA 4HKFA 4MY0A 2BOAA 3LD2A 1P0HA 4MBUA 2OH1A 2ZOFA 2PR8A 3PBEA 3OWCA 2R98A 1WK4A 5LRGA 5I0CA 1CX8A 2VL1A 2ZEMA 4KS9A 3S6FA 4P4EA 3FNCA 1V0CA 3FRMA 4MCRA 5BWAB 1QSRA 2Q7SA 4A39A 5JQ4A 4QVTA 1YLEA 1ARMA 3K2KA 1CBXA 4UWJA 3JVNA 1LAMA 5LYFA 3BI0A 1JWQA 4CAWA 2ZEEA 3R9FA 4A32A 1XFOA 2G9DA 1VIXA 5FVJA 2PRBA 2AFWA 2B4DA 4UIBA 2CNSA 2HUZA 3FXTA 4M6HA 4NJRA 4KOVA 4CGOA 1LRZA 3PB4X 3A9LA 1PYTB 4KLVA 4PK3A 2ZEHA 3D2PA 3IGRA 3NH8A 4CAEA 1BO4A 5HMNA 2Q4YA 4G1PA 3PB6X 4JZ0A 4LX9A 4OLLA 3BI1A 4W9YA 1IICA 3QB8A 2EVNA 3F0AA 5DWMA 4C7IA 5J1QA 2A4NA 4M85A 1HDUA 1Z8TA 1Y7EA 4TNUA 4JXQA 1M4IA 2AJ6A 1YMEA 3PGPA 2ZW5A 2EK8A 3CXSA 3IEHA 1Z4RA 2CTBA 3KZWA 1HEEA 1BLLE 1Y9KA 4OMEA 2Q43A 4M3SA 2PJ4A 3KASA 1N71A 4MHYA 5G22A 5KTCA 4MRIA 1ZLHA 4AB7A 2ABZA 4YGOA 3JTKA 1QSNA 3HUVA 3PRTA 3KGQA 1DE4C 2JBKA 3G3SA 2ZW6A 2Z3NA 3DR6A 4MI4A 4OADA 2PIYA 2ZEDA 4EVYA 4X8IA 3LODA 3TT2A 4DJLA 3T9YA 1A2ZA 2CF4A 3ISZA 1S3ZA 4KSIA 1MJAA 2CXAA 4ZX9A 4EFDA 2B58A 4B11A 4IUSA 3TFYA 2B3UA 2FIAA 1YQEA 2B3VA 1NSAA 4KOUA 2VQYA 3KR4A 4NJQA 1ZG9A 5ISVA 4PK2A 4ZY1A 1XMBA 1CM0A 3W91A 1YREA 1QMUA 1M44A 4P4BA 3CXQA 3IU1A 1S5KA 3NA6A 5H86A 4OC5A 3CPAA 5HVFA 4NEXA 3VATA 1X10A 1GYTA 4HNWB 4CPAA 1Q2CA 5JH9A 1VGYA 3FMCA 2Z3MA 4PXCA 4PXDA 3KQZA 1TKJA 2GIVA 4KORA 1ZG8A 3D8PA 3IWGA 4OC3A 3SJEA 2FVGA 3S9MA 4CYNA 2GANA 3I3GA 1ZO0A 4WJBA 5C88A 2IL4A 2R7HA 3F8KA 4R3KA 4TWEA 5AG5A 5F49A 4C2ZA 2EWBA 4WWVA 4NF1A 4P4JA 3VWDA 1OBRA 4ZGYB 1WWZA 2F8HA 2OU2A 1JQGA 1YX0A 1LCPA 2OZUA 4OC4A 2O53A 4PXBA 4Y49C 5K8NA 5LRKA 2PVWA 2C1CA 4MY3A 4E2AA 1AYEA 1L0CA 3GB0A 4CAXA 2QIRA 2V8HA 4A2ZA 4ZX8A 5E96A 1LFWA 2PRQA 3BLNA 2V8GA 4B5OA 4P44A 1XBUA 1Y0YA 4M6IA 2AFUA 2BO9A 3QAHA 3CDXA 2PC1A 1RO5A 1X12A 2Z0ZA 3FJUA 3WC5A 5J8CA 1IYKA 2FT0A 3F5BA 4F9VA 5CBMA 1QSMA 1TF9A 4RN7A 3B8GA 4P4FA 2ATRA 3S6KA 1YGHA 4A95A 1BOBA 2IMOA 1Z8LA 5AGEA 3V7ZA 4GM5A 1S7FA 3IO1A 3LWUA 4PSWA 3W6SA 3SHPA 2GE3A 4FBEA 3DGVA 3B2YA 3R1KA 1DTDA 1I1DA 4HNYB 3QAYA 5D8NA 2PSWA 3S6GA 4C2XA 3SI0A 4B12A 2GU2A 4JXRA 4KVME 3TOAA 3S9NA 2WPXA 1YR0A 2Q4VA 4IAVA 1P4NA 1XF8A 4KUAA 4RUHA 4MFLA 2XEIA 3IIBA 2PJ9A 2ODFA 2F7VA 3SJFA 4BBHA 3B3WA 2BEIA 2EO8A 2ZEPA 2PJ0A 2VXKA 3KR5A 2ZEOA 4OAEA 3D7DA 3RAMA 2PVVA 2NYQA 2Q51A 2ZW7A 1VHEA 1AUGA 1Y0RA 4AG7A 2P6GA 3PFOA 3EY5A 3D4UA 4MHNA 5A28A 5F46A 1XJOA 3NE8A 4MCPA 2FE7A
chains in the Genus database with same CATH topology
5EC4A 4AG9A 4C68A 2OB0A 2JDCA 3R96A 4MFQA 3KKWA 4R57A 2YNCA 2HV2A 4A33A 4CYPA 4QUSA 4KSFA 2J8NA 2BUEA 4XPLA 1S7NA 5KTAA 4AVAA 3GY9A 3EO4A 5IX3A 3S6HA 4AVBA 3TO7A 4B13A 1XEBA 4FD5A 2R8VA 3DSBA 1YVKA 2VBQA 1VKCA 4YFJA 1M4GA 2Z11A 2VZZA 3E0KA 2Z3LA 4Y49B 1MJ9A 5AG7A 5DWNA 5G20A 4U9YA 4MFZA 4BMHA 4B10A 3K9UA 4Q36A 2VZYA 2WPWA 1XIXA 3CXPA 4ONUA 4UCPA 4CGMA 4E8OA 3BJ7A 3T90A 1Q2DA 2Q44A 2CNTA 2QECA 4JJXA 2JEVA 1IYLA 3C26A 3GYAA 3EC4A 5G21A 4A31A 1Y7RA 3W6XA 4XPDC 4MJ8A 3FB3A 1B87A 2X7BA 1QSOA 4YRHA 2J8RA 4L8AA 4RS2A 1K4JA 2K5TA 2Q04A 1RXTA 1YK3A 2G3AA 2OZHA 2REFA 4UA3A 5IB0A 2I79A 2EUIA 2FS5A 1NE9A 3WR7A 2ARHA 4C2YA 4R9MA 2KCWA 3V8IA 2ZPAA 3DR8A 4F6AA 5G1ZA 4F0XA 2PR1A 3FBUA 4ZBGA 4GS4A 2PQ8A 4RI1A 1S60A 1Z9UA 3D2MA 5HH1A 2DPSA 2DXQA 1M1DA 3MGDA 1J4JA 3I9SA 3TOBA 5F48A 1M4DA 5EBVA 4KOSA 4NCZA 1B6BA 2I00A 1U6MA 1XE4A 1PU9A 4CAFA 1I12A 4JWPA 3P2FA 3FYNA 4KVXA 4KLWA 2B5GA 4KOTA 4KZTA 4CAVA 3NE7A 4KOWA 4UCMA 2QMLA 3RYOA 4A30A 5A27A 3TO9A 1NSLA 4B5PB 2O28A 2C27A 4Q38A 2YNDA 4HNXB 4R87A 4NSQA 1KZFA 2F5IA 3TTHA 1MK4A 2VI7A 5AG6A 4C7HA 3G8WA 1ON0A 2BSWA 5CNPA 2Q7BA 2G0BA 2ZW4A 2B5GB 4KOYA 1KUXA 4CGNA 2H5MA 3VWEA 4MHDA 1XMTA 3EXNA 4XPDB 2P6FA 2AE6A 3ZJ0A 1KUYA 3JUWA 3IWEA 4XNHC 3EFAA 4QB9A 4CRZB 2BL1A 3GKRA 1Y9WA 1NMTA 4FD7A 4CGPA 1CJWA 4PV6A 5C82A 2Y0MA 4PSXA 5JPHA 3N7ZA 4UFVA 5AG4A 3ZZIA 2D4PA 4UFXA 1Z4EA 2P0WA 4IF5A 4KUBA 1QSTA 3D3SA 1SQHA 4QBJA 3H5ZA 5IV0A 4JLYA 4UFWA 2YGWA 2JLMA 2B4BA 3BJ8A 4U9ZA 4H6ZA 3FIXA 4UCNA 3SXNA 4FD6A 3P2HA 3TE4A 4E0AA 2B4DB 2WSAA 4UBRA 2FXFA 1OZPA 4FD4A 1GHEA 4H6UA 3SXOA 1IIDA 1IB1E 4CYOA 2J8MA 3TCVA 4QC6A 1UFHA 2DPTA 4R3LA 4NXYA 3R9GA 4LUAA 4KOXA 1YVOA 3R95A 3UY5A 4CGLA 2FCKA 3TO6A 5H84A 3DDDA 2Z3PA 2ZXVA 2JDDA 4MFKA 1R57A 4B5PA 2WUUA 2Z3OA 5KTDA 4X5KA 4CYQA 2OZGA 4MFPA 2VEZA 5F47A 4CRYB 1MJBA 4ORFA 1Q2YA 2CNMA 3PP9A 4K30A 4B14A 4II9A 4L89A 4XNHB 4KSAA 4AVCA 2Z3KA 4JD6A 4CS0B 2Q0YA 2FL4A 2YNCC 3R9EA 4MFJA 2NMTA 1S7LA 4H89A 4F0YA 4I49A 2REEA 1VHSA 1I21A 1TIQA 2Z10A 4U5YA 2HQYA 2RC4A 5GCNA 2R1IA 4UWIA 2PDOA 2YNEA 1PUAA 4J3GA 4KVOE 4XPKA 2CY2A 2FIWA 2D4OA 4DNCA 3IU2A 1KUVA 5J8FA 2P6EA 3PZJA 1FY7A 2G3TA 2FSRA 1S7KA 3DNSA 3H4QA 4HKFA 4MY0A 3LD2A 1P0HA 4MBUA 2OH1A 2PR8A 3OWCA 2R98A 1WK4A 5I0CA 3S6FA 4KS9A 3FNCA 1V0CA 3FRMA 5BWAB 1QSRA 5JQ4A 4QVTA 1YLEA 4UWJA 3JVNA 4CAWA 3R9FA 4A32A 5FVJA 2PRBA 2B4DA 2CNSA 2HUZA 3FXTA 4KOVA 4CGOA 1LRZA 4KLVA 3A9LA 4PK3A 5HMNA 3D2PA 3IGRA 4CAEA 1BO4A 2Q4YA 4LX9A 4OLLA 5DWMA 1IICA 3QB8A 2EVNA 3F0AA 4C7IA 2A4NA 4M85A 4JXQA 1M4IA 2AJ6A 3PGPA 2ZW5A 3CXSA 1Z4RA 1Y9KA 4M3SA 1N71A 5G22A 5KTCA 4AB7A 4YGOA 3JTKA 1QSNA 3G3SA 2ZW6A 2Z3NA 3DR6A 4MI4A 4OADA 4EVYA 3LODA 3TT2A 3T9YA 1S3ZA 1MJAA 2CXAA 2B58A 4B11A 4IUSA 3TFYA 2B3UA 2FIAA 2B3VA 5ISVA 4KOUA 2VQYA 4PK2A 1CM0A 3W91A 1YREA 1M44A 5H86A 3CXQA 3IU1A 1S5KA 4NEXA 4HNWB 1Q2CA 2Z3MA 2GIVA 4KORA 3D8PA 3IWGA 4CYNA 2GANA 3I3GA 1ZO0A 5C88A 2IL4A 2R7HA 3F8KA 4R3KA 5AG5A 5F49A 4C2ZA 4NF1A 3VWDA 4ZGYB 1WWZA 2OU2A 1YX0A 2OZUA 4Y49C 4MY3A 4E2AA 1L0CA 4CAXA 2QIRA 4A2ZA 5E96A 3BLNA 4B5OA 3QAHA 2PC1A 1RO5A 2Z0ZA 5J8CA 1IYKA 2FT0A 3F5BA 1QSMA 3B8GA 3S6KA 2ATRA 4A95A 1YGHA 1BOBA 5AGEA 1S7FA 4PSWA 3W6SA 3SHPA 2GE3A 3R1KA 1I1DA 4HNYB 2PSWA 3S6GA 4C2XA 4B12A 4JXRA 4KVME 3TOAA 2WPXA 1YR0A 2Q4VA 1P4NA 1XF8A 4KUAA 4MFLA 4BBHA 2BEIA 2VXKA 4OAEA 2ZW7A 4AG7A 2P6GA 3EY5A 5A28A 5F46A 2FE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B11 A;  2YNE A;  4B14 A;  4C68 A;  4CGP A;  5G1Z A;  5AG6 A;  4C7H A;  4A32 A;  4A2Z A;  4UCN A;  4CGL A;  3IU1 A;  3IU2 A;  4B12 A;  4C2X A;  5G21 A;  2YNC C;  4A31 A;  4UFV A;  5G22 A;  5AG7 A;  5G20 A;  2YNC A;  3JTK A;  4CGN A;  4A33 A;  4UCM A;  4B10 A;  5AG4 A;  4A30 A;  2WSA A;  4CYP A;  4CGO A;  4UFX A;  4BBH A;  2WUU A;  4CAE A;  4CYN A;  5A27 A;  4C7I A;  5AG5 A;  3H5Z A;  4C2Z A;  4CYQ A;  4CAF A;  4UFW A;  4CYO A;  4UCP A;  4B13 A;  3IWE A;  4CGM A;  4A95 A;  4C2Y A;  5A28 A;  2YND A;  5AGE A; 
#chains in the Genus database with same CATH topology
 5EC4 A;  4YU9 A;  4AG9 A;  4C68 A;  3WC7 A;  3B3V A;  4EWT A;  4R76 A;  2OB0 A;  2OR4 A;  3TX8 A;  2JDC A;  2XEG A;  2ZEF A;  4H2K A;  4NGM A;  3R96 A;  4AXV A;  4MFQ A;  3KKW A;  4OKO A;  4R57 A;  2YNC A;  5JGF A;  2HV2 A;  4A33 A;  4CYP A;  4NGR A;  4KSF A;  4QUS A;  2J8N A;  2AFO A;  2JEW A;  2BUE A;  4F8Z A;  4XPL A;  1R3N A;  4R6T A;  1S7N A;  5KTA A;  4AVA A;  3GY9 A;  3EO4 A;  5IX3 A;  3S6H A;  4AVB A;  3TO7 A;  1R43 A;  1XRY A;  3VH9 A;  1XEB A;  4B13 A;  4FD5 A;  2EBJ A;  2R8V A;  4UEZ A;  3DSB A;  1YVK A;  2VBQ A;  4P45 A;  1VKC A;  2J9A A;  4YFJ A;  4A37 A;  2DF5 A;  2QVP A;  1M4G A;  3T8W A;  2Z11 A;  2AFS A;  1YW4 A;  2VZZ A;  2Z3L A;  3E0K A;  4FUU A;  2ZEN A;  4Y49 B;  1MJ9 A;  5AG7 A;  5DWN A;  5G20 A;  3SI2 A;  1IU8 A;  4U9Y A;  4MFZ A;  4BMH A;  1Z8W A;  3K9U A;  4B10 A;  4Q36 A;  2VZY A;  1HDQ A;  3IFE A;  3RBU A;  5EMI A;  2WPW A;  1XIX A;  3CXP A;  4ONU A;  2PE3 A;  2HC9 A;  3IJ3 A;  4UCP A;  5HVH A;  4NGS A;  4CGM A;  4E8O A;  5K8O A;  3BJ7 A;  3T90 A;  1Q2D A;  3DLJ A;  2Q44 A;  1F2O A;  1PCA A;  1CP6 A;  2CNT A;  4MXU A;  5I4M A;  2QEC A;  4JJX A;  2JEV A;  3FF3 A;  1IYL A;  3FEC A;  2WYR A;  3C26 A;  3GYA A;  3EC4 A;  5K8M A;  5G21 A;  4A31 A;  4A38 A;  1FNO A;  4FWU A;  5HXD A;  1Y7R A;  1CG2 A;  1IOI A;  4XPD C;  3W6X A;  4MJ8 A;  4MCQ A;  1TKF A;  1EE3 P;  1Z5R A;  4OP4 A;  2BCO A;  3BXM A;  3FB3 A;  1YLO A;  3LMS A;  1B87 A;  2X7B A;  4OC2 A;  1QSO A;  2GRE A;  3TC8 A;  5JM6 A;  4YRH A;  2I3C A;  3FH4 A;  2J8R A;  4L8A A;  4ZY2 A;  4RS2 A;  1K4J A;  2K5T A;  2Q04 A;  1RXT A;  3PBB A;  4NGT A;  1YK3 A;  2G3A A;  2OZH A;  2REF A;  2WZN A;  4UA3 A;  3SJX A;  5IB0 A;  2I79 A;  2EUI A;  2FS5 A;  1NE9 A;  3B3C A;  1TKH A;  2ARH A;  4Q7A A;  3RO0 A;  3WR7 A;  3GUX A;  4C2Y A;  4R9M A;  2KCW A;  4P6Y A;  1BAV A;  3V8I A;  2ZPA A;  3DR8 A;  2XEJ A;  4F6A A;  5G1Z A;  1Q7L A;  4F0X A;  2PR1 A;  3FBU A;  4ZBG A;  4GS4 A;  2QJ8 A;  2QYV A;  2PQ8 A;  3PEI A;  4R7M A;  5D29 A;  3CT9 A;  4RI1 A;  4IK2 A;  1S60 A;  1Z8X A;  1Z9U A;  3D2M A;  3H8G A;  5HH1 A;  3KHZ A;  2DPS A;  2DXQ A;  1M1D A;  3MGD A;  4IHM A;  1J4J A;  1YW6 A;  3I9S A;  3TOB A;  5F48 A;  1M4D A;  4M6G A;  4KOS A;  4NCZ A;  1B6B A;  2I00 A;  5EBV A;  1LAN A;  4ZYQ A;  2C6C A;  1U6M A;  1XE4 A;  1PU9 A;  4ONW A;  4CAF A;  5CPA A;  1I12 A;  4JWP A;  3P2F A;  4X3R A;  2PJ6 A;  3KI9 A;  1IOF A;  3B3S A;  3B7I A;  3CPX A;  3FYN A;  4KVX A;  1BPM A;  3D68 A;  4KLW A;  2B5G A;  1IGB A;  3VAR A;  4EME A;  4KOT A;  3NH5 A;  1ZLI A;  4MCS A;  4A94 A;  2C6G A;  4PXE A;  2XEF A;  4KZT A;  4CAV A;  4NGQ A;  3NE7 A;  4YWY A;  5DS0 A;  4JYW A;  3FX6 A;  4KOW A;  4LQ6 A;  4UCM A;  2QML A;  3RYO A;  4A30 A;  4DUK A;  2RFH A;  3GIU A;  4UEF A;  3L2N A;  5A27 A;  3TO9 A;  2EK9 A;  1NSL A;  1YSJ A;  3NH4 A;  4B5P B;  2O28 A;  2POK A;  3JRU A;  2C27 A;  3LAC A;  4Q38 A;  2YND A;  4HNX B;  4R87 A;  4NSQ A;  2NSM A;  1KZF A;  2F5I A;  3TTH A;  2GLF A;  1MK4 A;  2VI7 A;  3QNV A;  4F9U A;  4ZI6 A;  5AG6 A;  5HVG A;  4C7H A;  3G8W A;  1ON0 A;  2BSW A;  5CNP A;  3B3T A;  2Q7B A;  4NGN A;  2G0B A;  1XOV A;  2ZW4 A;  2B5G B;  3D66 A;  4KOY A;  1KUX A;  4CGN A;  2H5M A;  2AFZ A;  2PJC A;  4MHD A;  3VWE A;  4O23 A;  5IB9 A;  1XMT A;  6CPA A;  2DEA A;  4PPZ A;  3EXN A;  2PJ7 A;  5THW A;  1CP7 A;  3MRU A;  2PJA A;  3MN8 A;  4XPD B;  2AFX A;  2P6F A;  4BD9 A;  1ELL P;  2AE6 A;  3HLP A;  3ZJ0 A;  1KUY A;  2PJB A;  4PQA A;  5LYD A;  3JUW A;  3IWE A;  4XNH C;  3EFA A;  2PJ1 A;  4QB9 A;  4X2T A;  3B35 A;  2BL1 A;  2PJ8 A;  4CRZ B;  3GKR A;  4DYO A;  1Y9W A;  1NMT A;  3K9T A;  2GFQ A;  4FD7 A;  4P4I A;  4NFR A;  4CGP A;  1CJW A;  4PV6 A;  3V38 A;  3ISX A;  2PJ2 A;  5C82 A;  2Y0M A;  4PSX A;  4OIW A;  2V8V A;  4P10 A;  5JPH A;  3N7Z A;  4UFV A;  3WT4 A;  5F09 A;  4ZY0 A;  5AG4 A;  3ZZI A;  3CZX A;  2D4P A;  2CIJ A;  4UFX A;  1M4L A;  1Z4E A;  1UWY A;  2P0W A;  1LAP A;  4IF5 A;  4KUB A;  1QST A;  3D3S A;  1SQH A;  4QBJ A;  3H5Z A;  5IV0 A;  4JLY A;  4UFW A;  3WAB A;  2YGW A;  4MHP A;  2JLM A;  3PB8 X;  2B4B A;  1F57 A;  2O4H A;  3S9L A;  3BJ8 A;  4U9Z A;  3GLJ A;  1LOK A;  2PIZ A;  1BPN A;  3D7F A;  3FIX A;  4H6Z A;  4K3N A;  4UCN A;  3SXN A;  3IWW A;  4FD6 A;  3P2H A;  3TE4 A;  1CPX A;  2IJZ A;  7CPA A;  1TF8 A;  4E0A A;  3RZA A;  3KL9 A;  2B4D B;  2WSA A;  4B6Z A;  2V8D A;  4UBR A;  3RNZ A;  2FXF A;  1OZP A;  3PB9 X;  2RB7 A;  4FD4 A;  1GHE A;  4H6U A;  3SXO A;  3PFE A;  5LRJ A;  1IID A;  5K8P A;  1IB1 E;  4CYO A;  2PJ3 A;  1CPS A;  2J8M A;  3D7H A;  3TCV A;  4QC6 A;  1UFH A;  1F2P A;  2DPT A;  2ZOG A;  3KQX A;  2CTC A;  4R3L A;  4NXY A;  4UIA A;  3R9G A;  2IQ6 A;  3H8E A;  4KOX A;  4LUA A;  2Q4Z A;  1YVO A;  3R95 A;  3UY5 A;  3SJG A;  4CGL A;  3PB7 X;  2FCK A;  3TO6 A;  5H84 A;  2ANP A;  2V77 A;  3BHX A;  3DDD A;  2Z3P A;  2ZXV A;  2JDD A;  4MFK A;  1FT7 A;  1RTQ A;  5LYI A;  1R57 A;  4OC0 A;  1ZG7 A;  4NGP A;  4B5P A;  4MHZ A;  2WUU A;  2Z3O A;  5KTD A;  1VHO A;  3SI1 A;  4X5K A;  1AMP A;  3FVL A;  4CYQ A;  2OZG A;  1Z2L A;  4MFP A;  1KWM A;  5LYL A;  2VEZ A;  5F47 A;  2GLJ A;  4CRY B;  1MJB A;  4ORF A;  1Q2Y A;  2HB6 A;  1H8L A;  2CNM A;  2JBJ A;  3PP9 A;  3FED A;  4K30 A;  4B14 A;  2ZEG A;  4II9 A;  4L89 A;  4XNH B;  3FEE A;  4P4D A;  4MMO A;  4KSA A;  4AVC A;  2C6P A;  2Z3K A;  4JD6 A;  2OOT A;  4Z65 A;  4CS0 B;  2Q0Y A;  2FL4 A;  2YNC C;  3R9E A;  4MFJ A;  2NMT A;  5ELY A;  2PJ5 A;  1S7L A;  4FAI A;  3I1U A;  4H89 A;  4F0Y A;  4I49 A;  3N5F A;  1QQ9 A;  2REE A;  4R8F A;  4HPS A;  1VHS A;  4BIN A;  1I21 A;  2ZEL A;  1TIQ A;  2Z10 A;  3D7G A;  1ELM P;  4U5Y A;  3H8F A;  2HQY A;  2RC4 A;  5GCN A;  2R1I A;  4LQG A;  3D67 A;  2PDO A;  4UWI A;  3WC6 A;  2YNE A;  1PUA A;  4GXH A;  4J3G A;  4KVO E;  4XPK A;  2CY2 A;  4UEE A;  3NFZ A;  2FIW A;  1ARL A;  2D4O A;  4DNC A;  3IU2 A;  1KUV A;  3KHX A;  4OID A;  5J8F A;  3IC1 A;  4OC1 A;  2P6E A;  3PZJ A;  4UF4 A;  1FY7 A;  2G3T A;  2AFM A;  2FSR A;  1TXR A;  1IY7 A;  1S7K A;  8CPA A;  3DNS A;  3H4Q A;  2PCU A;  4HKF A;  4MY0 A;  2BOA A;  3LD2 A;  1P0H A;  4MBU A;  2OH1 A;  2ZOF A;  2PR8 A;  3PBE A;  3OWC A;  2R98 A;  1WK4 A;  5LRG A;  5I0C A;  1CX8 A;  2VL1 A;  2ZEM A;  4KS9 A;  3S6F A;  4P4E A;  3FNC A;  1V0C A;  3FRM A;  4MCR A;  5BWA B;  1QSR A;  2Q7S A;  4A39 A;  5JQ4 A;  4QVT A;  1YLE A;  1ARM A;  3K2K A;  1CBX A;  4UWJ A;  3JVN A;  1LAM A;  5LYF A;  3BI0 A;  1JWQ A;  4CAW A;  2ZEE A;  3R9F A;  4A32 A;  1XFO A;  2G9D A;  1VIX A;  5FVJ A;  2PRB A;  2AFW A;  2B4D A;  4UIB A;  2CNS A;  2HUZ A;  3FXT A;  4M6H A;  4NJR A;  4KOV A;  4CGO A;  1LRZ A;  3PB4 X;  3A9L A;  1PYT B;  4KLV A;  4PK3 A;  2ZEH A;  3D2P A;  3IGR A;  3NH8 A;  4CAE A;  1BO4 A;  5HMN A;  2Q4Y A;  4G1P A;  3PB6 X;  4JZ0 A;  4LX9 A;  4OLL A;  3BI1 A;  4W9Y A;  1IIC A;  3QB8 A;  2EVN A;  3F0A A;  5DWM A;  4C7I A;  5J1Q A;  2A4N A;  4M85 A;  1HDU A;  1Z8T A;  1Y7E A;  4TNU A;  4JXQ A;  1M4I A;  2AJ6 A;  1YME A;  3PGP A;  2ZW5 A;  2EK8 A;  3CXS A;  3IEH A;  1Z4R A;  2CTB A;  3KZW A;  1HEE A;  1BLL E;  1Y9K A;  4OME A;  2Q43 A;  4M3S A;  2PJ4 A;  3KAS A;  1N71 A;  4MHY A;  5G22 A;  5KTC A;  4MRI A;  1ZLH A;  4AB7 A;  2ABZ A;  4YGO A;  3JTK A;  1QSN A;  3HUV A;  3PRT A;  3KGQ A;  1DE4 C;  2JBK A;  3G3S A;  2ZW6 A;  2Z3N A;  3DR6 A;  4MI4 A;  4OAD A;  2PIY A;  2ZED A;  4EVY A;  4X8I A;  3LOD A;  3TT2 A;  4DJL A;  3T9Y A;  1A2Z A;  2CF4 A;  3ISZ A;  1S3Z A;  4KSI A;  1MJA A;  2CXA A;  4ZX9 A;  4EFD A;  2B58 A;  4B11 A;  4IUS A;  3TFY A;  2B3U A;  2FIA A;  1YQE A;  2B3V A;  1NSA A;  4KOU A;  2VQY A;  3KR4 A;  4NJQ A;  1ZG9 A;  5ISV A;  4PK2 A;  4ZY1 A;  1XMB A;  1CM0 A;  3W91 A;  1YRE A;  1QMU A;  1M44 A;  4P4B A;  3CXQ A;  3IU1 A;  1S5K A;  3NA6 A;  5H86 A;  4OC5 A;  3CPA A;  5HVF A;  4NEX A;  3VAT A;  1X10 A;  1GYT A;  4HNW B;  4CPA A;  1Q2C A;  5JH9 A;  1VGY A;  3FMC A;  2Z3M A;  4PXC A;  4PXD A;  3KQZ A;  1TKJ A;  2GIV A;  4KOR A;  1ZG8 A;  3D8P A;  3IWG A;  4OC3 A;  3SJE A;  2FVG A;  3S9M A;  4CYN A;  2GAN A;  3I3G A;  1ZO0 A;  4WJB A;  5C88 A;  2IL4 A;  2R7H A;  3F8K A;  4R3K A;  4TWE A;  5AG5 A;  5F49 A;  4C2Z A;  2EWB A;  4WWV A;  4NF1 A;  4P4J A;  3VWD A;  1OBR A;  4ZGY B;  1WWZ A;  2F8H A;  2OU2 A;  1JQG A;  1YX0 A;  1LCP A;  2OZU A;  4OC4 A;  2O53 A;  4PXB A;  4Y49 C;  5K8N A;  5LRK A;  2PVW A;  2C1C A;  4MY3 A;  4E2A A;  1AYE A;  1L0C A;  3GB0 A;  4CAX A;  2QIR A;  2V8H A;  4A2Z A;  4ZX8 A;  5E96 A;  1LFW A;  2PRQ A;  3BLN A;  2V8G A;  4B5O A;  4P44 A;  1XBU A;  1Y0Y A;  4M6I A;  2AFU A;  2BO9 A;  3QAH A;  3CDX A;  2PC1 A;  1RO5 A;  1X12 A;  2Z0Z A;  3FJU A;  3WC5 A;  5J8C A;  1IYK A;  2FT0 A;  3F5B A;  4F9V A;  5CBM A;  1QSM A;  1TF9 A;  4RN7 A;  3B8G A;  4P4F A;  2ATR A;  3S6K A;  1YGH A;  4A95 A;  1BOB A;  2IMO A;  1Z8L A;  5AGE A;  3V7Z A;  4GM5 A;  1S7F A;  3IO1 A;  3LWU A;  4PSW A;  3W6S A;  3SHP A;  2GE3 A;  4FBE A;  3DGV A;  3B2Y A;  3R1K A;  1DTD A;  1I1D A;  4HNY B;  3QAY A;  5D8N A;  2PSW A;  3S6G A;  4C2X A;  3SI0 A;  4B12 A;  2GU2 A;  4JXR A;  4KVM E;  3TOA A;  3S9N A;  2WPX A;  1YR0 A;  2Q4V A;  4IAV A;  1P4N A;  1XF8 A;  4KUA A;  4RUH A;  4MFL A;  2XEI A;  3IIB A;  2PJ9 A;  2ODF A;  2F7V A;  3SJF A;  4BBH A;  3B3W A;  2BEI A;  2EO8 A;  2ZEP A;  2PJ0 A;  2VXK A;  3KR5 A;  2ZEO A;  4OAE A;  3D7D A;  3RAM A;  2PVV A;  2NYQ A;  2Q51 A;  2ZW7 A;  1VHE A;  1AUG A;  1Y0R A;  4AG7 A;  2P6G A;  3PFO A;  3EY5 A;  3D4U A;  4MHN A;  5A28 A;  5F46 A;  1XJO A;  3NE8 A;  4MCP A;  2FE7 A; 
#chains in the Genus database with same CATH homology
 5EC4 A;  4AG9 A;  4C68 A;  2OB0 A;  2JDC A;  3R96 A;  4MFQ A;  3KKW A;  4R57 A;  2YNC A;  2HV2 A;  4A33 A;  4CYP A;  4QUS A;  4KSF A;  2J8N A;  2BUE A;  4XPL A;  1S7N A;  5KTA A;  4AVA A;  3GY9 A;  3EO4 A;  5IX3 A;  3S6H A;  4AVB A;  3TO7 A;  4B13 A;  1XEB A;  4FD5 A;  2R8V A;  3DSB A;  1YVK A;  2VBQ A;  1VKC A;  4YFJ A;  1M4G A;  2Z11 A;  2VZZ A;  3E0K A;  2Z3L A;  4Y49 B;  1MJ9 A;  5AG7 A;  5DWN A;  5G20 A;  4U9Y A;  4MFZ A;  4BMH A;  4B10 A;  3K9U A;  4Q36 A;  2VZY A;  2WPW A;  1XIX A;  3CXP A;  4ONU A;  4UCP A;  4CGM A;  4E8O A;  3BJ7 A;  3T90 A;  1Q2D A;  2Q44 A;  2CNT A;  2QEC A;  4JJX A;  2JEV A;  1IYL A;  3C26 A;  3GYA A;  3EC4 A;  5G21 A;  4A31 A;  1Y7R A;  3W6X A;  4XPD C;  4MJ8 A;  3FB3 A;  1B87 A;  2X7B A;  1QSO A;  4YRH A;  2J8R A;  4L8A A;  4RS2 A;  1K4J A;  2K5T A;  2Q04 A;  1RXT A;  1YK3 A;  2G3A A;  2OZH A;  2REF A;  4UA3 A;  5IB0 A;  2I79 A;  2EUI A;  2FS5 A;  1NE9 A;  3WR7 A;  2ARH A;  4C2Y A;  4R9M A;  2KCW A;  3V8I A;  2ZPA A;  3DR8 A;  4F6A A;  5G1Z A;  4F0X A;  2PR1 A;  3FBU A;  4ZBG A;  4GS4 A;  2PQ8 A;  4RI1 A;  1S60 A;  1Z9U A;  3D2M A;  5HH1 A;  2DPS A;  2DXQ A;  1M1D A;  3MGD A;  1J4J A;  3I9S A;  3TOB A;  5F48 A;  1M4D A;  5EBV A;  4KOS A;  4NCZ A;  1B6B A;  2I00 A;  1U6M A;  1XE4 A;  1PU9 A;  4CAF A;  1I12 A;  4JWP A;  3P2F A;  3FYN A;  4KVX A;  4KLW A;  2B5G A;  4KOT A;  4KZT A;  4CAV A;  3NE7 A;  4KOW A;  4UCM A;  2QML A;  3RYO A;  4A30 A;  5A27 A;  3TO9 A;  1NSL A;  4B5P B;  2O28 A;  2C27 A;  4Q38 A;  2YND A;  4HNX B;  4R87 A;  4NSQ A;  1KZF A;  2F5I A;  3TTH A;  1MK4 A;  2VI7 A;  5AG6 A;  4C7H A;  3G8W A;  1ON0 A;  2BSW A;  5CNP A;  2Q7B A;  2G0B A;  2ZW4 A;  2B5G B;  4KOY A;  1KUX A;  4CGN A;  2H5M A;  3VWE A;  4MHD A;  1XMT A;  3EXN A;  4XPD B;  2P6F A;  2AE6 A;  3ZJ0 A;  1KUY A;  3JUW A;  3IWE A;  4XNH C;  3EFA A;  4QB9 A;  4CRZ B;  2BL1 A;  3GKR A;  1Y9W A;  1NMT A;  4FD7 A;  4CGP A;  1CJW A;  4PV6 A;  5C82 A;  2Y0M A;  4PSX A;  5JPH A;  3N7Z A;  4UFV A;  5AG4 A;  3ZZI A;  2D4P A;  4UFX A;  1Z4E A;  2P0W A;  4IF5 A;  4KUB A;  1QST A;  3D3S A;  1SQH A;  4QBJ A;  3H5Z A;  5IV0 A;  4JLY A;  4UFW A;  2YGW A;  2JLM A;  2B4B A;  3BJ8 A;  4U9Z A;  4H6Z A;  3FIX A;  4UCN A;  3SXN A;  4FD6 A;  3P2H A;  3TE4 A;  4E0A A;  2B4D B;  2WSA A;  4UBR A;  2FXF A;  1OZP A;  4FD4 A;  1GHE A;  4H6U A;  3SXO A;  1IID A;  1IB1 E;  4CYO A;  2J8M A;  3TCV A;  4QC6 A;  1UFH A;  2DPT A;  4R3L A;  4NXY A;  3R9G A;  4LUA A;  4KOX A;  1YVO A;  3R95 A;  3UY5 A;  4CGL A;  2FCK A;  3TO6 A;  5H84 A;  3DDD A;  2Z3P A;  2ZXV A;  2JDD A;  4MFK A;  1R57 A;  4B5P A;  2WUU A;  2Z3O A;  5KTD A;  4X5K A;  4CYQ A;  2OZG A;  4MFP A;  2VEZ A;  5F47 A;  4CRY B;  1MJB A;  4ORF A;  1Q2Y A;  2CNM A;  3PP9 A;  4K30 A;  4B14 A;  4II9 A;  4L89 A;  4XNH B;  4KSA A;  4AVC A;  2Z3K A;  4JD6 A;  4CS0 B;  2Q0Y A;  2FL4 A;  2YNC C;  3R9E A;  4MFJ A;  2NMT A;  1S7L A;  4H89 A;  4F0Y A;  4I49 A;  2REE A;  1VHS A;  1I21 A;  1TIQ A;  2Z10 A;  4U5Y A;  2HQY A;  2RC4 A;  5GCN A;  2R1I A;  4UWI A;  2PDO A;  2YNE A;  1PUA A;  4J3G A;  4KVO E;  4XPK A;  2CY2 A;  2FIW A;  2D4O A;  4DNC A;  3IU2 A;  1KUV A;  5J8F A;  2P6E A;  3PZJ A;  1FY7 A;  2G3T A;  2FSR A;  1S7K A;  3DNS A;  3H4Q A;  4HKF A;  4MY0 A;  3LD2 A;  1P0H A;  4MBU A;  2OH1 A;  2PR8 A;  3OWC A;  2R98 A;  1WK4 A;  5I0C A;  3S6F A;  4KS9 A;  3FNC A;  1V0C A;  3FRM A;  5BWA B;  1QSR A;  5JQ4 A;  4QVT A;  1YLE A;  4UWJ A;  3JVN A;  4CAW A;  3R9F A;  4A32 A;  5FVJ A;  2PRB A;  2B4D A;  2CNS A;  2HUZ A;  3FXT A;  4KOV A;  4CGO A;  1LRZ A;  4KLV A;  3A9L A;  4PK3 A;  5HMN A;  3D2P A;  3IGR A;  4CAE A;  1BO4 A;  2Q4Y A;  4LX9 A;  4OLL A;  5DWM A;  1IIC A;  3QB8 A;  2EVN A;  3F0A A;  4C7I A;  2A4N A;  4M85 A;  4JXQ A;  1M4I A;  2AJ6 A;  3PGP A;  2ZW5 A;  3CXS A;  1Z4R A;  1Y9K A;  4M3S A;  1N71 A;  5G22 A;  5KTC A;  4AB7 A;  4YGO A;  3JTK A;  1QSN A;  3G3S A;  2ZW6 A;  2Z3N A;  3DR6 A;  4MI4 A;  4OAD A;  4EVY A;  3LOD A;  3TT2 A;  3T9Y A;  1S3Z A;  1MJA A;  2CXA A;  2B58 A;  4B11 A;  4IUS A;  3TFY A;  2B3U A;  2FIA A;  2B3V A;  5ISV A;  4KOU A;  2VQY A;  4PK2 A;  1CM0 A;  3W91 A;  1YRE A;  1M44 A;  5H86 A;  3CXQ A;  3IU1 A;  1S5K A;  4NEX A;  4HNW B;  1Q2C A;  2Z3M A;  2GIV A;  4KOR A;  3D8P A;  3IWG A;  4CYN A;  2GAN A;  3I3G A;  1ZO0 A;  5C88 A;  2IL4 A;  2R7H A;  3F8K A;  4R3K A;  5AG5 A;  5F49 A;  4C2Z A;  4NF1 A;  3VWD A;  4ZGY B;  1WWZ A;  2OU2 A;  1YX0 A;  2OZU A;  4Y49 C;  4MY3 A;  4E2A A;  1L0C A;  4CAX A;  2QIR A;  4A2Z A;  5E96 A;  3BLN A;  4B5O A;  3QAH A;  2PC1 A;  1RO5 A;  2Z0Z A;  5J8C A;  1IYK A;  2FT0 A;  3F5B A;  1QSM A;  3B8G A;  3S6K A;  2ATR A;  4A95 A;  1YGH A;  1BOB A;  5AGE A;  1S7F A;  4PSW A;  3W6S A;  3SHP A;  2GE3 A;  3R1K A;  1I1D A;  4HNY B;  2PSW A;  3S6G A;  4C2X A;  4B12 A;  4JXR A;  4KVM E;  3TOA A;  2WPX A;  1YR0 A;  2Q4V A;  1P4N A;  1XF8 A;  4KUA A;  4MFL A;  4BBH A;  2BEI A;  2VXK A;  4OAE A;  2ZW7 A;  4AG7 A;  2P6G A;  3EY5 A;  5A28 A;  5F46 A;  2FE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...