5A28A

Leishmania major n-myristoyltransferase in complex with a chlorophenyl 1,3,4-oxadiazole inhibitor.
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of High Affinity Inhibitors of Leishmania Donovani N-Myristoyltransferase.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 123
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5a28A00
2YNDA 4A30A 4CAEA 5G22A 4A95A 4A32A 4B13A 4CGNA 4CYPA 4UFXA 5AGEA 4C7HA 4CGOA 4CYQA 2WUUA 4A33A 5A27A 4C2ZA 4UCNA 4A31A 3IWEA 4B12A 5A28A 4C2XA 3IU1A 2WSAA 4CGPA 4C2YA 5AG5A 3IU2A 3H5ZA 5G1ZA 5G21A 2YNEA 4CGLA 4UFWA 5AG4A 4CGMA 4CYNA 4C7IA 4CAFA 4B10A 5AG7A 5G20A 3JTKA 4UCMA 4CYOA 4B11A 4C68A 4A2ZA 4B14A 4BBHA 4UFVA 4UCPA 2YNCA 2YNCC 5AG6A
chains in the Genus database with same CATH superfamily
4PXDA 3BLNA 5IV0A 4LQ6A 1P0HA 2FSRA 1GYTA 1EE3P 3QAHA 2ZEOA 3A9LA 4U9YA 1QSMA 4WJBA 5HVHA 2PJ7A 3TTHA 1YVOA 2HV2A 1S7LA 4K30A 4OADA 1IB1E 4OMEA 3IWEA 4W9YA 1NSLA 2FCKA 2ODFA 3EFAA 4BMHA 4C2XA 1QSNA 2F8HA 4II9A 2Z3OA 4XPLA 3CXSA 1VHSA 2PR8A 1QMUA 4MHZA 3JRUA 2NMTA 3FH4A 1TXRA 4LX9A 3SJFA 4YFJA 2QIRA 4GXHA 1BAVA 1ON0A 4HKFA 1KZFA 4C68A 3R9FA 4Q7AA 1L0CA 5EMIA 3RBUA 2DXQA 2Q4YA 2WYRA 4EVYA 5KTAA 4F0YA 3FEEA 5G22A 3QB8A 1Z8WA 4B13A 4YU9A 1QQ9A 4KSAA 1ZG8A 3PBEA 4P45A 1CM0A 2PVVA 3LMSA 4X2TA 3ISZA 2OOTA 2AFOA 2HB6A 2ZOGA 4KOXA 3CDXA 3NH5A 4J3GA 4ZY2A 3SJGA 4PPZA 2QYVA 2PC1A 2GLJA 1PUAA 1BOBA 3FNCA 3KKWA 5IB9A 1Q2CA 4P6YA 1JWQA 1ZLIA 1KUVA 1Z2LA 1B6BA 2PSWA 1N71A 3SXOA 2PJ8A 4OAEA 4X8IA 2B5GB 3VARA 4A94A 5DWNA 1NE9A 1NSAA 4UEEA 4A95A 3IFEA 1YREA 2PJCA 4KOYA 1YGHA 4KLVA 4NGQA 5IB0A 3H4QA 3T9YA 1M44A 4KLWA 4OC2A 1LAMA 2GU2A 4B5PB 4HNWB 4B12A 1MJAA 4FAIA 2AFZA 3GLJA 4OC4A 2JDCA 4NGTA 3CZXA 5CBMA 5G21A 3TO9A 2YGWA 1HDQA 2EVNA 4FWUA 4H6ZA 2WPXA 1YMEA 2OZGA 5EBVA 4K3NA 1BPNA 1CP7A 1RO5A 2B4DB 3N7ZA 4Y49C 5LRGA 3GIUA 4NGSA 4PV6A 3V38A 3F0AA 1Y0YA 1YR0A 3DGVA 5DS0A 3PB7X 4UFVA 2CTCA 4GM5A 4PK2A 4QVTA 5AG6A 4EFDA 4IUSA 4UBRA 1YSJA 3BI0A 3D7GA 1Z5RA 2Z3NA 3IEHA 4NGNA 4RI1A 3NH8A 3QNVA 4Y49B 3PP9A 5LRJA 5J8CA 1KUXA 2AFWA 1IYKA 1VHOA 4C7HA 3D3SA 4L8AA 5A27A 4AG9A 2REEA 2ZW4A 2C6GA 4UEZA 2NSMA 4NF1A 5IX3A 3KGQA 2J8RA 2O4HA 1RTQA 3E0KA 3FIXA 3H8GA 4OKOA 2PR1A 4C7IA 1TKFA 1PYTB 1S60A 4KUAA 2Q0YA 2VZZA 2OH1A 4MMOA 4PSXA 1K4JA 2ZW5A 3EY5A 1F2OA 4HPSA 2V8DA 3DR6A 4P4IA 3TOAA 4F6AA 3SHPA 2VQYA 2FXFA 4KOSA 2I3CA 3PGPA 4MFLA 2Z11A 4OC0A 2Q7BA 2CNTA 4R8FA 1M1DA 1X12A 2G9DA 2ZEPA 1RXTA 2AFUA 1AUGA 5FVJA 2XEIA 3WC7A 4JD6A 2D4OA 2WPWA 1BLLE 4MHDA 3D4UA 4QC6A 2J9AA 3P2FA 4R6TA 4Z65A 1XE4A 4H2KA 4CS0B 1NMTA 5AG7A 4KOWA 5F46A 3TO6A 1IGBA 5HXDA 3FYNA 4MXUA 4OIDA 2R7HA 3S6FA 2GREA 3KQXA 3IWGA 4OC1A 3VH9A 1M4IA 3B3CA 4MY0A 4U9ZA 1ZO0A 2ZOFA 4IF5A 1GHEA 2ATRA 2HQYA 1IU8A 2PJ0A 4OC5A 3FECA 1YW4A 2ZEFA 3B7IA 1CBXA 3OWCA 1JQGA 1Y0RA 3DSBA 1S7FA 4UCNA 4AVBA 2HUZA 2ZPAA 4O23A 4CAWA 4F9VA 2PJ9A 3DR8A 2JDDA 3D68A 5C82A 1M4DA 4CPAA 4C2YA 3SJXA 2PJ5A 4ONWA 3B3TA 4NJRA 2OB0A 4PXEA 3R95A 5AG4A 5K8NA 4CGMA 3JUWA 4R76A 4A38A 4B10A 3R9EA 2OR4A 1LRZA 4P4EA 3L2NA 3P2HA 4F0XA 2AJ6A 4JXQA 4KS9A 1QSRA 4OP4A 3S6KA 2DPTA 3FF3A 2Q43A 4YRHA 3SXNA 3HLPA 5I4MA 4FUUA 2PCUA 4E2AA 2FIWA 2ABZA 4MFJA 1YLEA 4P4FA 7CPAA 3FXTA 4UF4A 1CPXA 4CGNA 4MFZA 3RYOA 4NEXA 3DDDA 3PZJA 1LCPA 1VGYA 4C2ZA 1P4NA 2PJBA 2Q7SA 3LWUA 3FJUA 4HNXB 3T90A 3N5FA 3HUVA 3GYAA 2G3AA 3B3VA 2WSAA 4EMEA 4M6HA 4NGPA 3W91A 3H5ZA 4G1PA 2ZEGA 2PQ8A 4YWYA 2YNEA 3S6HA 5HH1A 2BO9A 4PSWA 5LYFA 2RC4A 4AVAA 1M4GA 1S3ZA 1LANA 2EUIA 3JVNA 4A33A 3WR7A 3NFZA 3R9GA 4KVOE 4P4JA 1UWYA 2P6EA 1S7NA 3D66A 3KL9A 1YW6A 4QUSA 5E96A 2J8MA 3NH4A 1ZG7A 4CAEA 3KR5A 5J1QA 3DNSA 3SI0A 2I79A 4R7MA 4E0AA 1I12A 2Z3LA 4JXRA 3BJ8A 1ELMP 1DTDA 1IIDA 1Z4EA 2Z3PA 4JWPA 2AFXA 4MCRA 4Q38A 3VWDA 3IWWA 2JEWA 2V8VA 3R1KA 4AXVA 5JQ4A 2KCWA 3IC1A 2B5GA 2PJ4A 2Z10A 3B2YA 4DUKA 3B35A 2G3TA 2VL1A 2ZENA 4RUHA 2Q4ZA 3CXPA 3BXMA 2P6FA 3FEDA 4B11A 4A2ZA 1KUYA 1XBUA 1CP6A 1F57A 1S7KA 3RNZA 2YNCC 3G8WA 3V7ZA 4B5PA 4R57A 3TO7A 2PRQA 4I49A 4UEFA 1YQEA 2JBKA 3G3SA 1KWMA 3CT9A 4L89A 3D2PA 3SI2A 2EWBA 1PU9A 4MFKA 4ONUA 2WUUA 2ANPA 4DNCA 2BOAA 2B4DA 3KQZA 5F47A 4TNUA 4E8OA 3TE4A 2V8HA 8CPAA 5JM6A 4CGPA 3MGDA 4UWJA 4NJQA 3NE7A 1LFWA 5KTCA 4ZY0A 5JPHA 2AFMA 2B58A 2C6PA 2Z3KA 2XEJA 4P10A 4PXCA 5JH9A 4PXBA 3PB4X 4CAXA 2JEVA 4CYOA 4KSIA 2EK8A 2PJ2A 3D7FA 2Q4VA 4M85A 5D29A 3EC4A 4ZY1A 2PDOA 4MCQA 3SJEA 2YNDA 1LOKA 2PVWA 4FD7A 4ZBGA 5HVFA 4ZI6A 2BCOA 3TCVA 4AVCA 4KZTA 2RFHA 3FRMA 1ARLA 4UFXA 1M4LA 2D4PA 5C88A 2FT0A 2V77A 3FX6A 4CGOA 2VXKA 4DYOA 1Z8XA 2GLFA 3FBUA 2PJ3A 2OZUA 5A28A 1QSOA 1A2ZA 1XRYA 3GB0A 3S9MA 2CNMA 2ARHA 4MRIA 2JLMA 1WK4A 1ZG9A 3IO1A 4XNHC 3KI9A 4IAVA 1FY7A 4X3RA 4KSFA 4PQAA 5G20A 4JYWA 2H5MA 4UA3A 3C26A 2ZEEA 4LQGA 3SI1A 5CNPA 3D67A 1MK4A 3PFOA 1I21A 4U5YA 5LYIA 4XNHB 1YLOA 1HEEA 4GS4A 1IYLA 2CXAA 2POKA 2BEIA 5JGFA 2HC9A 1Y9KA 5F49A 2Z3MA 1HDUA 2V8GA 5D8NA 2FVGA 3H8EA 4QBJA 5HVGA 2PJAA 2PIYA 1MJ9A 2DEAA 4B6ZA 5LYLA 1Z9UA 3S9LA 2PJ1A 2Z0ZA 4A39A 1Q2DA 2RB7A 1CG2A 3IJ3A 3TC8A 4EWTA 3LODA 4FBEA 4FD6A 5CPAA 2ZELA 1IOFA 3VWEA 1R3NA 3DLJA 4MFQA 1TF8A 1Q7LA 4CAFA 3RO0A 2OU2A 2FE7A 5I0CA 3K9TA 3UY5A 2ZW7A 3FVLA 3B3WA 5F09A 3NA6A 4NGMA 1VHEA 4CAVA 3T8WA 3LD2A 4HNYB 2JBJA 3IIBA 2PE3A 4KOUA 2C6CA 4A37A 2CIJA 4FD4A 4CYQA 2CNSA 4ORFA 5K8OA 2XEFA 2CY2A 1CX8A 2IQ6A 4KVXA 4MHPA 4X5KA 2FS5A 3R96A 3TOBA 3PB8X 1XEBA 5AG5A 1XIXA 3IU2A 3TFYA 1IY7A 4P4BA 4M3SA 4MCSA 1R43A 2FIAA 5GCNA 2DPSA 5H84A 2IL4A 1AMPA 3PFEA 2EK9A 4IK2A 4PK3A 4R87A 3ZJ0A 1U6MA 1TIQA 4UCPA 5G1ZA 3KHZA 3V8IA 2ZXVA 1YVKA 4NCZA 4A30A 3W6XA 3VATA 2DF5A 4A32A 2NYQA 4CYPA 1BPMA 2ZEHA 1CPSA 2O28A 4P44A 5LRKA 3K2KA 4M6IA 1ZLHA 2CTBA 3WT4A 4AG7A 4M6GA 1VKCA 2R8VA 2C27A 4F9UA 1FT7A 3PEIA 1Z8TA 1XFOA 1DE4C 1VIXA 2G0BA 4MFPA 3EO4A 3BJ7A 1Q2YA 3F8KA 5H86A 4KORA 2ZW6A 2J8NA 1Y7EA 1IICA 4H89A 2BL1A 4CYNA 2REFA 2WZNA 2X7BA 2XEGA 4MBUA 1LAPA 1TKJA 1H8LA 1WWZA 2QJ8A 4P4DA 3RZAA 1S5KA 5ISVA 1Y9WA 2BUEA 3CPXA 1ELLP 1OZPA 3I1UA 4WWVA 4MY3A 3EXNA 2VI7A 4LUAA 5BWAB 4KVME 3H8FA 1Z8LA 3CPAA 3TX8A 4AB7A 2VBQA 3KASA 3KZWA 4R3LA 4RN7A 2R1IA 4DJLA 4ZYQA 1SQHA 2IJZA 4MHNA 4QB9A 4A31A 2FL4A 2ZEDA 3PRTA 1FNOA 3I9SA 1XJOA 4IHMA 4OLLA 5THWA 4B5OA 4TWEA 3MN8A 3PB6X 3FB3A 3W6SA 1YK3A 3D7DA 3KHXA 4JJXA 2Q44A 3WC6A 3CXQA 2C1CA 1YX0A 4NSQA 1MJBA 3JTKA 5ELYA 3S9NA 2GIVA 4CRZB 1I1DA 2EO8A 2PRBA 4OC3A 2O53A 2YNCA 1UFHA 2B3VA 2CF4A 4NFRA 4H6UA 3B8GA 2F5IA 4KOTA 4BINA 2K5TA 1R57A 2AFSA 2QMLA 4JZ0A 5K8PA 3MRUA 1XF8A 2QVPA 4MCPA 4FD5A 3IGRA 4JLYA 1F2PA 2QECA 2R98A 3QAYA 2EBJA 1TF9A 2AE6A 2I00A 1XMTA 2OZHA 2Q51A 1PCAA 4CRYB 4NXYA 4YGOA 3ZZIA 4CGLA 2B4BA 1TKHA 2GANA 5KTDA 3RAMA 2P6GA 4UFWA 3WC5A 5HMNA 1IOIA 1V0CA 3GKRA 4UIBA 4F8ZA 4OIWA 2ZEMA 3BI1A 4B14A 2VZYA 3K9UA 4UIAA 4XPDC 1Z4RA 1ARMA 2Q04A 4R3KA 1Y7RA 4XPKA 2A4NA 3F5BA 3I3GA 3LACA 3GUXA 3WABA 1J4JA 2Y0MA 3D2MA 1QSTA 4Q36A 4MI4A 2B3UA 5J8FA 4ZX9A 4NGRA 4XPDB 5AGEA 5DWMA 3D8PA 3D7HA 3TT2A 1CJWA 3PB9X 5F48A 4ZGYB 2GFQA 3FMCA 1B87A 2VEZA 1XMBA 3BHXA 2P0WA 3IU1A 4MJ8A 3GY9A 4R9MA 5EC4A 1XOVA 3NE8A 5LYDA 1BO4A 2GE3A 3ISXA 6CPAA 3KR4A 3PBBA 2PJ6A 4UWIA 4RS2A 4ZX8A 2BSWA 2PIZA 4UCMA 1AYEA 4KOVA 4KUBA 1X10A 5K8MA 3S6GA 3B3SA 4BBHA 4MHYA 2IMOA 4BD9A 2F7VA 1OBRA
chains in the Genus database with same CATH topology
3BLNA 5IV0A 1P0HA 2FSRA 3QAHA 4U9YA 3A9LA 1QSMA 3TTHA 1YVOA 2HV2A 1S7LA 4K30A 4OADA 1IB1E 3IWEA 1NSLA 2FCKA 3EFAA 4BMHA 4C2XA 1QSNA 4II9A 2Z3OA 4XPLA 3CXSA 1VHSA 2PR8A 2NMTA 4LX9A 4YFJA 2QIRA 1ON0A 4HKFA 4C68A 1KZFA 3R9FA 1L0CA 2DXQA 2Q4YA 5KTAA 4EVYA 4F0YA 5G22A 3QB8A 4B13A 4KSAA 1CM0A 4KOXA 4J3GA 2PC1A 1PUAA 1BOBA 3FNCA 3KKWA 1Q2CA 1KUVA 1B6BA 2PSWA 1N71A 3SXOA 4OAEA 2B5GB 5DWNA 1NE9A 4A95A 1YREA 4KOYA 1YGHA 4KLVA 5IB0A 3H4QA 3T9YA 1M44A 4KLWA 4B5PB 4HNWB 4B12A 1MJAA 2JDCA 5G21A 3TO9A 2YGWA 4H6ZA 2EVNA 2WPXA 2OZGA 5EBVA 2B4DB 1RO5A 4Y49C 3N7ZA 4PV6A 1YR0A 4UFVA 4PK2A 4QVTA 5AG6A 4IUSA 4UBRA 2Z3NA 4Y49B 4RI1A 3PP9A 5J8CA 1KUXA 1IYKA 4C7HA 3D3SA 4L8AA 5A27A 4AG9A 2REEA 2ZW4A 4NF1A 5IX3A 2J8RA 3E0KA 3FIXA 2PR1A 4C7IA 1S60A 4KUAA 2Q0YA 2VZZA 2OH1A 4PSXA 1K4JA 2ZW5A 3EY5A 3DR6A 3TOAA 4F6AA 3SHPA 2VQYA 2FXFA 4KOSA 3PGPA 4MFLA 2Z11A 2Q7BA 2CNTA 1M1DA 1RXTA 5FVJA 4JD6A 2D4OA 2WPWA 4MHDA 4QC6A 3P2FA 1XE4A 4CS0B 1NMTA 5AG7A 4KOWA 5F46A 3TO6A 3FYNA 3S6FA 2R7HA 3IWGA 1M4IA 4MY0A 4U9ZA 1ZO0A 4IF5A 1GHEA 2ATRA 2HQYA 3OWCA 4AVBA 3DSBA 1S7FA 4UCNA 4CAWA 2HUZA 2ZPAA 3DR8A 2JDDA 5C82A 1M4DA 4C2YA 3R95A 2OB0A 5AG4A 4CGMA 3JUWA 4B10A 3R9EA 1LRZA 3P2HA 4F0XA 2AJ6A 4JXQA 4KS9A 1QSRA 3S6KA 2DPTA 4YRHA 3SXNA 4E2AA 2FIWA 4MFJA 1YLEA 3FXTA 4CGNA 4MFZA 3RYOA 4NEXA 3DDDA 3PZJA 4C2ZA 1P4NA 3T90A 4HNXB 3GYAA 2G3AA 2WSAA 3W91A 3H5ZA 2PQ8A 2YNEA 3S6HA 5HH1A 4PSWA 2RC4A 4AVAA 1M4GA 1S3ZA 2EUIA 3JVNA 4A33A 3WR7A 3R9GA 4KVOE 5E96A 2P6EA 1S7NA 4QUSA 2J8MA 4CAEA 3DNSA 2I79A 4E0AA 1I12A 2Z3LA 4JXRA 3BJ8A 2Z3PA 1IIDA 1Z4EA 4JWPA 4Q38A 3VWDA 3R1KA 5JQ4A 2KCWA 2B5GA 2Z10A 2G3TA 3CXPA 2P6FA 4B11A 4A2ZA 1KUYA 1S7KA 2YNCC 3G8WA 4B5PA 4R57A 3TO7A 4I49A 3G3SA 4L89A 3D2PA 1PU9A 4MFKA 4ONUA 2WUUA 4DNCA 2B4DA 5F47A 4E8OA 3TE4A 4CGPA 3MGDA 4UWJA 3NE7A 5KTCA 5JPHA 2Z3KA 2B58A 4CAXA 2JEVA 4CYOA 4M85A 2Q4VA 3EC4A 2PDOA 2YNDA 4FD7A 4ZBGA 3TCVA 4AVCA 4KZTA 3FRMA 4UFXA 2D4PA 5C88A 2FT0A 4CGOA 2VXKA 3FBUA 2OZUA 5A28A 1QSOA 2CNMA 2ARHA 2JLMA 1WK4A 4XNHC 1FY7A 4KSFA 5G20A 2H5MA 4UA3A 3C26A 5CNPA 1MK4A 1I21A 4U5YA 4XNHB 4GS4A 1IYLA 2CXAA 2BEIA 5F49A 1Y9KA 2Z3MA 4QBJA 1MJ9A 1Z9UA 2Z0ZA 1Q2DA 3LODA 4FD6A 3VWEA 4CAFA 4MFQA 2OU2A 2FE7A 5I0CA 3UY5A 2ZW7A 4CAVA 3LD2A 4HNYB 4KOUA 4FD4A 4CYQA 2CNSA 4ORFA 2CY2A 4KVXA 3R96A 4X5KA 2FS5A 3TOBA 1XEBA 5AG5A 1XIXA 3IU2A 3TFYA 4M3SA 2FIAA 5GCNA 2DPSA 5H84A 2IL4A 4PK3A 4R87A 3ZJ0A 1U6MA 1TIQA 4UCPA 5G1ZA 3V8IA 2ZXVA 1YVKA 4NCZA 4A30A 3W6XA 4A32A 4CYPA 2O28A 4AG7A 1VKCA 2R8VA 2C27A 2G0BA 4MFPA 3EO4A 3BJ7A 1Q2YA 3F8KA 5H86A 4KORA 2ZW6A 2J8NA 1IICA 4H89A 2BL1A 4CYNA 2REFA 2X7BA 4MBUA 1WWZA 1S5KA 1Y9WA 2BUEA 1OZPA 4MY3A 3EXNA 2VI7A 4LUAA 5BWAB 4KVME 2VBQA 4R3LA 2R1IA 1SQHA 4QB9A 4A31A 2FL4A 3I9SA 4OLLA 4B5OA 3W6SA 3FB3A 1YK3A 4JJXA 2Q44A 3CXQA 5ISVA 1YX0A 4NSQA 1MJBA 3JTKA 2GIVA 4CRZB 1I1DA 2PRBA 2YNCA 1UFHA 2B3VA 4H6UA 3B8GA 2F5IA 4KOTA 2K5TA 1R57A 2QMLA 1XF8A 4FD5A 3IGRA 4JLYA 2QECA 2R98A 2AE6A 2I00A 2OZHA 1XMTA 4CRYB 4NXYA 4YGOA 3ZZIA 4CGLA 2B4BA 2GANA 5KTDA 2P6GA 4UFWA 5HMNA 1V0CA 3GKRA 4B14A 2VZYA 3K9UA 4XPDC 1Z4RA 2Q04A 4R3KA 1Y7RA 4XPKA 2A4NA 3F5BA 3I3GA 1J4JA 2Y0MA 3D2MA 1QSTA 4Q36A 4MI4A 2B3UA 5J8FA 4XPDB 5AGEA 5DWMA 3D8PA 3TT2A 1CJWA 5F48A 4ZGYB 1B87A 2VEZA 3IU1A 4R9MA 2P0WA 4MJ8A 3GY9A 5EC4A 1BO4A 2GE3A 4UWIA 4RS2A 2BSWA 4UCMA 4KOVA 4KUBA 3S6GA 4BBHA 4AB7A 3F0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YND A;  4A30 A;  4CAE A;  5G22 A;  4A95 A;  4A32 A;  4B13 A;  4CGN A;  4CYP A;  4UFX A;  5AGE A;  4C7H A;  4CGO A;  4CYQ A;  2WUU A;  4A33 A;  5A27 A;  4C2Z A;  4UCN A;  4A31 A;  3IWE A;  4B12 A;  5A28 A;  4C2X A;  3IU1 A;  2WSA A;  4CGP A;  4C2Y A;  5AG5 A;  3IU2 A;  3H5Z A;  5G1Z A;  5G21 A;  2YNE A;  4CGL A;  4UFW A;  5AG4 A;  4CGM A;  4CYN A;  4C7I A;  4CAF A;  4B10 A;  5AG7 A;  5G20 A;  3JTK A;  4UCM A;  4CYO A;  4B11 A;  4C68 A;  4A2Z A;  4B14 A;  4BBH A;  4UFV A;  4UCP A;  2YNC A;  2YNC C;  5AG6 A; 
#chains in the Genus database with same CATH topology
 4PXD A;  3BLN A;  5IV0 A;  4LQ6 A;  1P0H A;  2FSR A;  1GYT A;  1EE3 P;  3QAH A;  2ZEO A;  3A9L A;  4U9Y A;  1QSM A;  4WJB A;  5HVH A;  2PJ7 A;  3TTH A;  1YVO A;  2HV2 A;  1S7L A;  4K30 A;  4OAD A;  1IB1 E;  4OME A;  3IWE A;  4W9Y A;  1NSL A;  2FCK A;  2ODF A;  3EFA A;  4BMH A;  4C2X A;  1QSN A;  2F8H A;  4II9 A;  2Z3O A;  4XPL A;  3CXS A;  1VHS A;  2PR8 A;  1QMU A;  4MHZ A;  3JRU A;  2NMT A;  3FH4 A;  1TXR A;  4LX9 A;  3SJF A;  4YFJ A;  2QIR A;  4GXH A;  1BAV A;  1ON0 A;  4HKF A;  1KZF A;  4C68 A;  3R9F A;  4Q7A A;  1L0C A;  5EMI A;  3RBU A;  2DXQ A;  2Q4Y A;  2WYR A;  4EVY A;  5KTA A;  4F0Y A;  3FEE A;  5G22 A;  3QB8 A;  1Z8W A;  4B13 A;  4YU9 A;  1QQ9 A;  4KSA A;  1ZG8 A;  3PBE A;  4P45 A;  1CM0 A;  2PVV A;  3LMS A;  4X2T A;  3ISZ A;  2OOT A;  2AFO A;  2HB6 A;  2ZOG A;  4KOX A;  3CDX A;  3NH5 A;  4J3G A;  4ZY2 A;  3SJG A;  4PPZ A;  2QYV A;  2PC1 A;  2GLJ A;  1PUA A;  1BOB A;  3FNC A;  3KKW A;  5IB9 A;  1Q2C A;  4P6Y A;  1JWQ A;  1ZLI A;  1KUV A;  1Z2L A;  1B6B A;  2PSW A;  1N71 A;  3SXO A;  2PJ8 A;  4OAE A;  4X8I A;  2B5G B;  3VAR A;  4A94 A;  5DWN A;  1NE9 A;  1NSA A;  4UEE A;  4A95 A;  3IFE A;  1YRE A;  2PJC A;  4KOY A;  1YGH A;  4KLV A;  4NGQ A;  5IB0 A;  3H4Q A;  3T9Y A;  1M44 A;  4KLW A;  4OC2 A;  1LAM A;  2GU2 A;  4B5P B;  4HNW B;  4B12 A;  1MJA A;  4FAI A;  2AFZ A;  3GLJ A;  4OC4 A;  2JDC A;  4NGT A;  3CZX A;  5CBM A;  5G21 A;  3TO9 A;  2YGW A;  1HDQ A;  2EVN A;  4FWU A;  4H6Z A;  2WPX A;  1YME A;  2OZG A;  5EBV A;  4K3N A;  1BPN A;  1CP7 A;  1RO5 A;  2B4D B;  3N7Z A;  4Y49 C;  5LRG A;  3GIU A;  4NGS A;  4PV6 A;  3V38 A;  3F0A A;  1Y0Y A;  1YR0 A;  3DGV A;  5DS0 A;  3PB7 X;  4UFV A;  2CTC A;  4GM5 A;  4PK2 A;  4QVT A;  5AG6 A;  4EFD A;  4IUS A;  4UBR A;  1YSJ A;  3BI0 A;  3D7G A;  1Z5R A;  2Z3N A;  3IEH A;  4NGN A;  4RI1 A;  3NH8 A;  3QNV A;  4Y49 B;  3PP9 A;  5LRJ A;  5J8C A;  1KUX A;  2AFW A;  1IYK A;  1VHO A;  4C7H A;  3D3S A;  4L8A A;  5A27 A;  4AG9 A;  2REE A;  2ZW4 A;  2C6G A;  4UEZ A;  2NSM A;  4NF1 A;  5IX3 A;  3KGQ A;  2J8R A;  2O4H A;  1RTQ A;  3E0K A;  3FIX A;  3H8G A;  4OKO A;  2PR1 A;  4C7I A;  1TKF A;  1PYT B;  1S60 A;  4KUA A;  2Q0Y A;  2VZZ A;  2OH1 A;  4MMO A;  4PSX A;  1K4J A;  2ZW5 A;  3EY5 A;  1F2O A;  4HPS A;  2V8D A;  3DR6 A;  4P4I A;  3TOA A;  4F6A A;  3SHP A;  2VQY A;  2FXF A;  4KOS A;  2I3C A;  3PGP A;  4MFL A;  2Z11 A;  4OC0 A;  2Q7B A;  2CNT A;  4R8F A;  1M1D A;  1X12 A;  2G9D A;  2ZEP A;  1RXT A;  2AFU A;  1AUG A;  5FVJ A;  2XEI A;  3WC7 A;  4JD6 A;  2D4O A;  2WPW A;  1BLL E;  4MHD A;  3D4U A;  4QC6 A;  2J9A A;  3P2F A;  4R6T A;  4Z65 A;  1XE4 A;  4H2K A;  4CS0 B;  1NMT A;  5AG7 A;  4KOW A;  5F46 A;  3TO6 A;  1IGB A;  5HXD A;  3FYN A;  4MXU A;  4OID A;  2R7H A;  3S6F A;  2GRE A;  3KQX A;  3IWG A;  4OC1 A;  3VH9 A;  1M4I A;  3B3C A;  4MY0 A;  4U9Z A;  1ZO0 A;  2ZOF A;  4IF5 A;  1GHE A;  2ATR A;  2HQY A;  1IU8 A;  2PJ0 A;  4OC5 A;  3FEC A;  1YW4 A;  2ZEF A;  3B7I A;  1CBX A;  3OWC A;  1JQG A;  1Y0R A;  3DSB A;  1S7F A;  4UCN A;  4AVB A;  2HUZ A;  2ZPA A;  4O23 A;  4CAW A;  4F9V A;  2PJ9 A;  3DR8 A;  2JDD A;  3D68 A;  5C82 A;  1M4D A;  4CPA A;  4C2Y A;  3SJX A;  2PJ5 A;  4ONW A;  3B3T A;  4NJR A;  2OB0 A;  4PXE A;  3R95 A;  5AG4 A;  5K8N A;  4CGM A;  3JUW A;  4R76 A;  4A38 A;  4B10 A;  3R9E A;  2OR4 A;  1LRZ A;  4P4E A;  3L2N A;  3P2H A;  4F0X A;  2AJ6 A;  4JXQ A;  4KS9 A;  1QSR A;  4OP4 A;  3S6K A;  2DPT A;  3FF3 A;  2Q43 A;  4YRH A;  3SXN A;  3HLP A;  5I4M A;  4FUU A;  2PCU A;  4E2A A;  2FIW A;  2ABZ A;  4MFJ A;  1YLE A;  4P4F A;  7CPA A;  3FXT A;  4UF4 A;  1CPX A;  4CGN A;  4MFZ A;  3RYO A;  4NEX A;  3DDD A;  3PZJ A;  1LCP A;  1VGY A;  4C2Z A;  1P4N A;  2PJB A;  2Q7S A;  3LWU A;  3FJU A;  4HNX B;  3T90 A;  3N5F A;  3HUV A;  3GYA A;  2G3A A;  3B3V A;  2WSA A;  4EME A;  4M6H A;  4NGP A;  3W91 A;  3H5Z A;  4G1P A;  2ZEG A;  2PQ8 A;  4YWY A;  2YNE A;  3S6H A;  5HH1 A;  2BO9 A;  4PSW A;  5LYF A;  2RC4 A;  4AVA A;  1M4G A;  1S3Z A;  1LAN A;  2EUI A;  3JVN A;  4A33 A;  3WR7 A;  3NFZ A;  3R9G A;  4KVO E;  4P4J A;  1UWY A;  2P6E A;  1S7N A;  3D66 A;  3KL9 A;  1YW6 A;  4QUS A;  5E96 A;  2J8M A;  3NH4 A;  1ZG7 A;  4CAE A;  3KR5 A;  5J1Q A;  3DNS A;  3SI0 A;  2I79 A;  4R7M A;  4E0A A;  1I12 A;  2Z3L A;  4JXR A;  3BJ8 A;  1ELM P;  1DTD A;  1IID A;  1Z4E A;  2Z3P A;  4JWP A;  2AFX A;  4MCR A;  4Q38 A;  3VWD A;  3IWW A;  2JEW A;  2V8V A;  3R1K A;  4AXV A;  5JQ4 A;  2KCW A;  3IC1 A;  2B5G A;  2PJ4 A;  2Z10 A;  3B2Y A;  4DUK A;  3B35 A;  2G3T A;  2VL1 A;  2ZEN A;  4RUH A;  2Q4Z A;  3CXP A;  3BXM A;  2P6F A;  3FED A;  4B11 A;  4A2Z A;  1KUY A;  1XBU A;  1CP6 A;  1F57 A;  1S7K A;  3RNZ A;  2YNC C;  3G8W A;  3V7Z A;  4B5P A;  4R57 A;  3TO7 A;  2PRQ A;  4I49 A;  4UEF A;  1YQE A;  2JBK A;  3G3S A;  1KWM A;  3CT9 A;  4L89 A;  3D2P A;  3SI2 A;  2EWB A;  1PU9 A;  4MFK A;  4ONU A;  2WUU A;  2ANP A;  4DNC A;  2BOA A;  2B4D A;  3KQZ A;  5F47 A;  4TNU A;  4E8O A;  3TE4 A;  2V8H A;  8CPA A;  5JM6 A;  4CGP A;  3MGD A;  4UWJ A;  4NJQ A;  3NE7 A;  1LFW A;  5KTC A;  4ZY0 A;  5JPH A;  2AFM A;  2B58 A;  2C6P A;  2Z3K A;  2XEJ A;  4P10 A;  4PXC A;  5JH9 A;  4PXB A;  3PB4 X;  4CAX A;  2JEV A;  4CYO A;  4KSI A;  2EK8 A;  2PJ2 A;  3D7F A;  2Q4V A;  4M85 A;  5D29 A;  3EC4 A;  4ZY1 A;  2PDO A;  4MCQ A;  3SJE A;  2YND A;  1LOK A;  2PVW A;  4FD7 A;  4ZBG A;  5HVF A;  4ZI6 A;  2BCO A;  3TCV A;  4AVC A;  4KZT A;  2RFH A;  3FRM A;  1ARL A;  4UFX A;  1M4L A;  2D4P A;  5C88 A;  2FT0 A;  2V77 A;  3FX6 A;  4CGO A;  2VXK A;  4DYO A;  1Z8X A;  2GLF A;  3FBU A;  2PJ3 A;  2OZU A;  5A28 A;  1QSO A;  1A2Z A;  1XRY A;  3GB0 A;  3S9M A;  2CNM A;  2ARH A;  4MRI A;  2JLM A;  1WK4 A;  1ZG9 A;  3IO1 A;  4XNH C;  3KI9 A;  4IAV A;  1FY7 A;  4X3R A;  4KSF A;  4PQA A;  5G20 A;  4JYW A;  2H5M A;  4UA3 A;  3C26 A;  2ZEE A;  4LQG A;  3SI1 A;  5CNP A;  3D67 A;  1MK4 A;  3PFO A;  1I21 A;  4U5Y A;  5LYI A;  4XNH B;  1YLO A;  1HEE A;  4GS4 A;  1IYL A;  2CXA A;  2POK A;  2BEI A;  5JGF A;  2HC9 A;  1Y9K A;  5F49 A;  2Z3M A;  1HDU A;  2V8G A;  5D8N A;  2FVG A;  3H8E A;  4QBJ A;  5HVG A;  2PJA A;  2PIY A;  1MJ9 A;  2DEA A;  4B6Z A;  5LYL A;  1Z9U A;  3S9L A;  2PJ1 A;  2Z0Z A;  4A39 A;  1Q2D A;  2RB7 A;  1CG2 A;  3IJ3 A;  3TC8 A;  4EWT A;  3LOD A;  4FBE A;  4FD6 A;  5CPA A;  2ZEL A;  1IOF A;  3VWE A;  1R3N A;  3DLJ A;  4MFQ A;  1TF8 A;  1Q7L A;  4CAF A;  3RO0 A;  2OU2 A;  2FE7 A;  5I0C A;  3K9T A;  3UY5 A;  2ZW7 A;  3FVL A;  3B3W A;  5F09 A;  3NA6 A;  4NGM A;  1VHE A;  4CAV A;  3T8W A;  3LD2 A;  4HNY B;  2JBJ A;  3IIB A;  2PE3 A;  4KOU A;  2C6C A;  4A37 A;  2CIJ A;  4FD4 A;  4CYQ A;  2CNS A;  4ORF A;  5K8O A;  2XEF A;  2CY2 A;  1CX8 A;  2IQ6 A;  4KVX A;  4MHP A;  4X5K A;  2FS5 A;  3R96 A;  3TOB A;  3PB8 X;  1XEB A;  5AG5 A;  1XIX A;  3IU2 A;  3TFY A;  1IY7 A;  4P4B A;  4M3S A;  4MCS A;  1R43 A;  2FIA A;  5GCN A;  2DPS A;  5H84 A;  2IL4 A;  1AMP A;  3PFE A;  2EK9 A;  4IK2 A;  4PK3 A;  4R87 A;  3ZJ0 A;  1U6M A;  1TIQ A;  4UCP A;  5G1Z A;  3KHZ A;  3V8I A;  2ZXV A;  1YVK A;  4NCZ A;  4A30 A;  3W6X A;  3VAT A;  2DF5 A;  4A32 A;  2NYQ A;  4CYP A;  1BPM A;  2ZEH A;  1CPS A;  2O28 A;  4P44 A;  5LRK A;  3K2K A;  4M6I A;  1ZLH A;  2CTB A;  3WT4 A;  4AG7 A;  4M6G A;  1VKC A;  2R8V A;  2C27 A;  4F9U A;  1FT7 A;  3PEI A;  1Z8T A;  1XFO A;  1DE4 C;  1VIX A;  2G0B A;  4MFP A;  3EO4 A;  3BJ7 A;  1Q2Y A;  3F8K A;  5H86 A;  4KOR A;  2ZW6 A;  2J8N A;  1Y7E A;  1IIC A;  4H89 A;  2BL1 A;  4CYN A;  2REF A;  2WZN A;  2X7B A;  2XEG A;  4MBU A;  1LAP A;  1TKJ A;  1H8L A;  1WWZ A;  2QJ8 A;  4P4D A;  3RZA A;  1S5K A;  5ISV A;  1Y9W A;  2BUE A;  3CPX A;  1ELL P;  1OZP A;  3I1U A;  4WWV A;  4MY3 A;  3EXN A;  2VI7 A;  4LUA A;  5BWA B;  4KVM E;  3H8F A;  1Z8L A;  3CPA A;  3TX8 A;  4AB7 A;  2VBQ A;  3KAS A;  3KZW A;  4R3L A;  4RN7 A;  2R1I A;  4DJL A;  4ZYQ A;  1SQH A;  2IJZ A;  4MHN A;  4QB9 A;  4A31 A;  2FL4 A;  2ZED A;  3PRT A;  1FNO A;  3I9S A;  1XJO A;  4IHM A;  4OLL A;  5THW A;  4B5O A;  4TWE A;  3MN8 A;  3PB6 X;  3FB3 A;  3W6S A;  1YK3 A;  3D7D A;  3KHX A;  4JJX A;  2Q44 A;  3WC6 A;  3CXQ A;  2C1C A;  1YX0 A;  4NSQ A;  1MJB A;  3JTK A;  5ELY A;  3S9N A;  2GIV A;  4CRZ B;  1I1D A;  2EO8 A;  2PRB A;  4OC3 A;  2O53 A;  2YNC A;  1UFH A;  2B3V A;  2CF4 A;  4NFR A;  4H6U A;  3B8G A;  2F5I A;  4KOT A;  4BIN A;  2K5T A;  1R57 A;  2AFS A;  2QML A;  4JZ0 A;  5K8P A;  3MRU A;  1XF8 A;  2QVP A;  4MCP A;  4FD5 A;  3IGR A;  4JLY A;  1F2P A;  2QEC A;  2R98 A;  3QAY A;  2EBJ A;  1TF9 A;  2AE6 A;  2I00 A;  1XMT A;  2OZH A;  2Q51 A;  1PCA A;  4CRY B;  4NXY A;  4YGO A;  3ZZI A;  4CGL A;  2B4B A;  1TKH A;  2GAN A;  5KTD A;  3RAM A;  2P6G A;  4UFW A;  3WC5 A;  5HMN A;  1IOI A;  1V0C A;  3GKR A;  4UIB A;  4F8Z A;  4OIW A;  2ZEM A;  3BI1 A;  4B14 A;  2VZY A;  3K9U A;  4UIA A;  4XPD C;  1Z4R A;  1ARM A;  2Q04 A;  4R3K A;  1Y7R A;  4XPK A;  2A4N A;  3F5B A;  3I3G A;  3LAC A;  3GUX A;  3WAB A;  1J4J A;  2Y0M A;  3D2M A;  1QST A;  4Q36 A;  4MI4 A;  2B3U A;  5J8F A;  4ZX9 A;  4NGR A;  4XPD B;  5AGE A;  5DWM A;  3D8P A;  3D7H A;  3TT2 A;  1CJW A;  3PB9 X;  5F48 A;  4ZGY B;  2GFQ A;  3FMC A;  1B87 A;  2VEZ A;  1XMB A;  3BHX A;  2P0W A;  3IU1 A;  4MJ8 A;  3GY9 A;  4R9M A;  5EC4 A;  1XOV A;  3NE8 A;  5LYD A;  1BO4 A;  2GE3 A;  3ISX A;  6CPA A;  3KR4 A;  3PBB A;  2PJ6 A;  4UWI A;  4RS2 A;  4ZX8 A;  2BSW A;  2PIZ A;  4UCM A;  1AYE A;  4KOV A;  4KUB A;  1X10 A;  5K8M A;  3S6G A;  3B3S A;  4BBH A;  4MHY A;  2IMO A;  4BD9 A;  2F7V A;  1OBR A; 
#chains in the Genus database with same CATH homology
 3BLN A;  5IV0 A;  1P0H A;  2FSR A;  3QAH A;  4U9Y A;  3A9L A;  1QSM A;  3TTH A;  1YVO A;  2HV2 A;  1S7L A;  4K30 A;  4OAD A;  1IB1 E;  3IWE A;  1NSL A;  2FCK A;  3EFA A;  4BMH A;  4C2X A;  1QSN A;  4II9 A;  2Z3O A;  4XPL A;  3CXS A;  1VHS A;  2PR8 A;  2NMT A;  4LX9 A;  4YFJ A;  2QIR A;  1ON0 A;  4HKF A;  4C68 A;  1KZF A;  3R9F A;  1L0C A;  2DXQ A;  2Q4Y A;  5KTA A;  4EVY A;  4F0Y A;  5G22 A;  3QB8 A;  4B13 A;  4KSA A;  1CM0 A;  4KOX A;  4J3G A;  2PC1 A;  1PUA A;  1BOB A;  3FNC A;  3KKW A;  1Q2C A;  1KUV A;  1B6B A;  2PSW A;  1N71 A;  3SXO A;  4OAE A;  2B5G B;  5DWN A;  1NE9 A;  4A95 A;  1YRE A;  4KOY A;  1YGH A;  4KLV A;  5IB0 A;  3H4Q A;  3T9Y A;  1M44 A;  4KLW A;  4B5P B;  4HNW B;  4B12 A;  1MJA A;  2JDC A;  5G21 A;  3TO9 A;  2YGW A;  4H6Z A;  2EVN A;  2WPX A;  2OZG A;  5EBV A;  2B4D B;  1RO5 A;  4Y49 C;  3N7Z A;  4PV6 A;  1YR0 A;  4UFV A;  4PK2 A;  4QVT A;  5AG6 A;  4IUS A;  4UBR A;  2Z3N A;  4Y49 B;  4RI1 A;  3PP9 A;  5J8C A;  1KUX A;  1IYK A;  4C7H A;  3D3S A;  4L8A A;  5A27 A;  4AG9 A;  2REE A;  2ZW4 A;  4NF1 A;  5IX3 A;  2J8R A;  3E0K A;  3FIX A;  2PR1 A;  4C7I A;  1S60 A;  4KUA A;  2Q0Y A;  2VZZ A;  2OH1 A;  4PSX A;  1K4J A;  2ZW5 A;  3EY5 A;  3DR6 A;  3TOA A;  4F6A A;  3SHP A;  2VQY A;  2FXF A;  4KOS A;  3PGP A;  4MFL A;  2Z11 A;  2Q7B A;  2CNT A;  1M1D A;  1RXT A;  5FVJ A;  4JD6 A;  2D4O A;  2WPW A;  4MHD A;  4QC6 A;  3P2F A;  1XE4 A;  4CS0 B;  1NMT A;  5AG7 A;  4KOW A;  5F46 A;  3TO6 A;  3FYN A;  3S6F A;  2R7H A;  3IWG A;  1M4I A;  4MY0 A;  4U9Z A;  1ZO0 A;  4IF5 A;  1GHE A;  2ATR A;  2HQY A;  3OWC A;  4AVB A;  3DSB A;  1S7F A;  4UCN A;  4CAW A;  2HUZ A;  2ZPA A;  3DR8 A;  2JDD A;  5C82 A;  1M4D A;  4C2Y A;  3R95 A;  2OB0 A;  5AG4 A;  4CGM A;  3JUW A;  4B10 A;  3R9E A;  1LRZ A;  3P2H A;  4F0X A;  2AJ6 A;  4JXQ A;  4KS9 A;  1QSR A;  3S6K A;  2DPT A;  4YRH A;  3SXN A;  4E2A A;  2FIW A;  4MFJ A;  1YLE A;  3FXT A;  4CGN A;  4MFZ A;  3RYO A;  4NEX A;  3DDD A;  3PZJ A;  4C2Z A;  1P4N A;  3T90 A;  4HNX B;  3GYA A;  2G3A A;  2WSA A;  3W91 A;  3H5Z A;  2PQ8 A;  2YNE A;  3S6H A;  5HH1 A;  4PSW A;  2RC4 A;  4AVA A;  1M4G A;  1S3Z A;  2EUI A;  3JVN A;  4A33 A;  3WR7 A;  3R9G A;  4KVO E;  5E96 A;  2P6E A;  1S7N A;  4QUS A;  2J8M A;  4CAE A;  3DNS A;  2I79 A;  4E0A A;  1I12 A;  2Z3L A;  4JXR A;  3BJ8 A;  2Z3P A;  1IID A;  1Z4E A;  4JWP A;  4Q38 A;  3VWD A;  3R1K A;  5JQ4 A;  2KCW A;  2B5G A;  2Z10 A;  2G3T A;  3CXP A;  2P6F A;  4B11 A;  4A2Z A;  1KUY A;  1S7K A;  2YNC C;  3G8W A;  4B5P A;  4R57 A;  3TO7 A;  4I49 A;  3G3S A;  4L89 A;  3D2P A;  1PU9 A;  4MFK A;  4ONU A;  2WUU A;  4DNC A;  2B4D A;  5F47 A;  4E8O A;  3TE4 A;  4CGP A;  3MGD A;  4UWJ A;  3NE7 A;  5KTC A;  5JPH A;  2Z3K A;  2B58 A;  4CAX A;  2JEV A;  4CYO A;  4M85 A;  2Q4V A;  3EC4 A;  2PDO A;  2YND A;  4FD7 A;  4ZBG A;  3TCV A;  4AVC A;  4KZT A;  3FRM A;  4UFX A;  2D4P A;  5C88 A;  2FT0 A;  4CGO A;  2VXK A;  3FBU A;  2OZU A;  5A28 A;  1QSO A;  2CNM A;  2ARH A;  2JLM A;  1WK4 A;  4XNH C;  1FY7 A;  4KSF A;  5G20 A;  2H5M A;  4UA3 A;  3C26 A;  5CNP A;  1MK4 A;  1I21 A;  4U5Y A;  4XNH B;  4GS4 A;  1IYL A;  2CXA A;  2BEI A;  5F49 A;  1Y9K A;  2Z3M A;  4QBJ A;  1MJ9 A;  1Z9U A;  2Z0Z A;  1Q2D A;  3LOD A;  4FD6 A;  3VWE A;  4CAF A;  4MFQ A;  2OU2 A;  2FE7 A;  5I0C A;  3UY5 A;  2ZW7 A;  4CAV A;  3LD2 A;  4HNY B;  4KOU A;  4FD4 A;  4CYQ A;  2CNS A;  4ORF A;  2CY2 A;  4KVX A;  3R96 A;  4X5K A;  2FS5 A;  3TOB A;  1XEB A;  5AG5 A;  1XIX A;  3IU2 A;  3TFY A;  4M3S A;  2FIA A;  5GCN A;  2DPS A;  5H84 A;  2IL4 A;  4PK3 A;  4R87 A;  3ZJ0 A;  1U6M A;  1TIQ A;  4UCP A;  5G1Z A;  3V8I A;  2ZXV A;  1YVK A;  4NCZ A;  4A30 A;  3W6X A;  4A32 A;  4CYP A;  2O28 A;  4AG7 A;  1VKC A;  2R8V A;  2C27 A;  2G0B A;  4MFP A;  3EO4 A;  3BJ7 A;  1Q2Y A;  3F8K A;  5H86 A;  4KOR A;  2ZW6 A;  2J8N A;  1IIC A;  4H89 A;  2BL1 A;  4CYN A;  2REF A;  2X7B A;  4MBU A;  1WWZ A;  1S5K A;  1Y9W A;  2BUE A;  1OZP A;  4MY3 A;  3EXN A;  2VI7 A;  4LUA A;  5BWA B;  4KVM E;  2VBQ A;  4R3L A;  2R1I A;  1SQH A;  4QB9 A;  4A31 A;  2FL4 A;  3I9S A;  4OLL A;  4B5O A;  3W6S A;  3FB3 A;  1YK3 A;  4JJX A;  2Q44 A;  3CXQ A;  5ISV A;  1YX0 A;  4NSQ A;  1MJB A;  3JTK A;  2GIV A;  4CRZ B;  1I1D A;  2PRB A;  2YNC A;  1UFH A;  2B3V A;  4H6U A;  3B8G A;  2F5I A;  4KOT A;  2K5T A;  1R57 A;  2QML A;  1XF8 A;  4FD5 A;  3IGR A;  4JLY A;  2QEC A;  2R98 A;  2AE6 A;  2I00 A;  2OZH A;  1XMT A;  4CRY B;  4NXY A;  4YGO A;  3ZZI A;  4CGL A;  2B4B A;  2GAN A;  5KTD A;  2P6G A;  4UFW A;  5HMN A;  1V0C A;  3GKR A;  4B14 A;  2VZY A;  3K9U A;  4XPD C;  1Z4R A;  2Q04 A;  4R3K A;  1Y7R A;  4XPK A;  2A4N A;  3F5B A;  3I3G A;  1J4J A;  2Y0M A;  3D2M A;  1QST A;  4Q36 A;  4MI4 A;  2B3U A;  5J8F A;  4XPD B;  5AGE A;  5DWM A;  3D8P A;  3TT2 A;  1CJW A;  5F48 A;  4ZGY B;  1B87 A;  2VEZ A;  3IU1 A;  4R9M A;  2P0W A;  4MJ8 A;  3GY9 A;  5EC4 A;  1BO4 A;  2GE3 A;  4UWI A;  4RS2 A;  2BSW A;  4UCM A;  4KOV A;  4KUB A;  3S6G A;  4BBH A;  4AB7 A;  3F0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...