5A28A

Leishmania major n-myristoyltransferase in complex with a chlorophenyl 1,3,4-oxadiazole inhibitor.
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of High Affinity Inhibitors of Leishmania Donovani N-Myristoyltransferase.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 123
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5a28A00
4CGNA 2YNDA 4C7HA 5A27A 5G1ZA 4CYNA 2YNCA 4A32A 3IU2A 4C2YA 4B13A 3JTKA 4C7IA 4C68A 4A30A 4UFWA 4CGMA 4CGPA 2WUUA 4UFVA 4UFXA 4UCNA 5AG6A 4CYPA 5AG7A 3IU1A 4A95A 4B11A 4UCPA 4C2XA 5G22A 4CAEA 4CYOA 4B10A 3H5ZA 2WSAA 5A28A 4A33A 2YNCC 4CGOA 5G20A 4A2ZA 5AG4A 3IWEA 2YNEA 4B12A 4CYQA 4CAFA 5AGEA 5AG5A 5G21A 4B14A 4C2ZA 4A31A 4CGLA 4BBHA 4UCMA
chains in the Genus database with same CATH superfamily
1LAMA 2V8DA 4NF1A 2YNDA 4CGNA 1PUAA 3TO6A 3I3GA 2CIJA 2R7HA 1QSRA 2EO8A 4XPKA 3IU2A 4X3RA 3CPXA 4ZYQA 4UF4A 2GFQA 4RI1A 4CYPA 1B6BA 3B3VA 1KWMA 2WZNA 4YU9A 3RO0A 3FH4A 1Z8LA 1UFHA 4H2KA 3LACA 4OAEA 3R9GA 3KQZA 4MXUA 3VH9A 2PR1A 3DR6A 1YQEA 4NGSA 2D4OA 4PSXA 2ATRA 4PXCA 2R1IA 3GUXA 4ZBGA 5G20A 4MCQA 4NEXA 4ONUA 5K8NA 2JLMA 1YLEA 4KOTA 1ARMA 5G21A 3KI9A 2ZEDA 3VWDA 2Q7BA 3F5BA 3WABA 2ZXVA 5C88A 3I1UA 4R57A 5I4MA 3N7ZA 1Z4RA 1F57A 1Z5RA 2ZW5A 3EXNA 4CAXA 2JBJA 1Z8TA 2ZPAA 4MHZA 2Q4ZA 3VARA 1UWYA 4E2AA 3PB7X 5IV0A 4PXEA 3EY5A 3RYOA 3BHXA 4UEEA 1YX0A 3FX6A 4MFZA 4WJBA 4OC4A 3SJEA 3S9LA 2ZOGA 4UCPA 4KZTA 2VEZA 3IC1A 3D66A 1Q7LA 1MK4A 3GIUA 1IU8A 3CPAA 3JVNA 1XMTA 4DUKA 6CPAA 1X10A 1YREA 3NH5A 4P4JA 2F8HA 4NGMA 4A33A 1GYTA 4F0YA 2AFWA 3DDDA 1IIDA 3R1KA 4W9YA 2PIZA 3K2KA 4CAFA 3SJGA 3H4QA 4KOWA 3RNZA 4CAVA 2G3TA 1YVKA 4FBEA 5F49A 3FNCA 4M6HA 1IGBA 2EWBA 2ZOFA 1CP6A 1WK4A 3EO4A 2ZENA 4KSFA 4AG9A 4EFDA 4H89A 5K8MA 3MN8A 4C68A 5KTDA 1M4IA 1P4NA 2WUUA 2AFMA 4R7MA 1CPXA 1J4JA 3DNSA 4P44A 2QJ8A 4LX9A 4XPDB 5CNPA 1LRZA 2FS5A 4X5KA 3ZJ0A 4E0AA 4P45A 4KORA 4XNHB 2BEIA 5GCNA 2PSWA 4MHNA 3RBUA 3BLNA 2PJ8A 1VHSA 2BO9A 4CAWA 1V0CA 4QUSA 3LD2A 4MFQA 1YGHA 4OKOA 3R95A 3PP9A 4DNCA 2OZUA 4MJ8A 4II9A 1F2PA 1K4JA 2I79A 5H86A 3SI2A 2GREA 4OLLA 3B3TA 4TNUA 2PJ5A 1S7NA 1M4DA 4FD7A 4F9UA 2PJ2A 2O53A 1U6MA 1FY7A 1M44A 2IJZA 2GLJA 3DSBA 4AXVA 4B13A 3V7ZA 4Q36A 1NMTA 2OU2A 4CGMA 4F6AA 2ZELA 3PGPA 2B3VA 4PQAA 2XEFA 4UFVA 4OADA 1Y9WA 3B3CA 2C6PA 1CJWA 3S6KA 4K30A 2PJCA 1TF9A 3FMCA 4P10A 1IICA 2OZGA 5CBMA 4FWUA 4KOSA 2PIYA 1IY7A 1VHOA 2Q4VA 4MBUA 4RN7A 4ZGYB 1YR0A 3SXOA 5LYLA 2BL1A 2Z3LA 1R3NA 1Y0RA 3HLPA 2ZEEA 4IUSA 3FF3A 1TKHA 1BAVA 4ONWA 4A94A 4OC3A 3WT4A 5KTCA 2CNTA 4MFKA 3TFYA 1OZPA 4P4DA 2G9DA 4OMEA 5AG6A 3BI1A 2Q43A 2AFZA 3FYNA 2AE6A 2QYVA 1KZFA 2PJAA 1S60A 3D68A 1XIXA 4B10A 5F46A 1XFOA 3H5ZA 4DYOA 3T9YA 2JEVA 1ZO0A 1CP7A 1Y7EA 3FEEA 3SI0A 2PRQA 4KVXA 2B3UA 4CGLA 2JEWA 4OC5A 3FEDA 1IB1E 3KKWA 1HDQA 4CYNA 2ZW7A 1TKJA 3NFZA 2G0BA 3H8FA 2ZW4A 2ARHA 2PJ1A 1YSJA 3NE8A 2FXFA 3DR8A 4MCSA 1TKFA 3EC4A 5D8NA 5HVGA 3R9EA 4IHMA 4UCNA 3WR7A 2XEIA 4R8FA 3IU1A 4O23A 4HKFA 1QQ9A 3LWUA 4Y49C 4U5YA 2PVVA 1H8LA 2ZEFA 5ELYA 4KOVA 1KUYA 3IWEA 1CM0A 4GS4A 4AVBA 3D2PA 4C2ZA 4QVTA 4NXYA 4MMOA 3FECA 4HNYB 4R3LA 3SJXA 5J8CA 4C7HA 2QMLA 2FE7A 2PJBA 2D4PA 4IF5A 2HB6A 3SXNA 4UA3A 1Z4EA 2AFUA 3PBEA 2NYQA 3B2YA 1BLLE 3C26A 3I9SA 3IIBA 3MGDA 3SI1A 1Z2LA 3T8WA 2VQYA 1XBUA 1BPMA 2O28A 2B5GB 4KVME 4R3KA 2PJ4A 4J3GA 2ZEHA 2R8VA 4JXQA 4MFJA 1M4LA 3CZXA 5AG7A 5D29A 5JGFA 1IOIA 4B11A 1VGYA 3W6XA 3D7HA 1QSMA 1AYEA 4M3SA 3DLJA 2BOAA 3CXPA 1SQHA 2OH1A 2OZHA 4A37A 3IO1A 3TO9A 3CDXA 2GU2A 2ZW6A 4UBRA 5LRJA 3K9UA 2PE3A 4KUAA 4NGNA 4OC2A 2B5GA 2DXQA 3LODA 3P2FA 1AUGA 1ON0A 2PRBA 2Q7SA 2BSWA 2REFA 2X7BA 2P6EA 4R76A 4PSWA 4HNWB 2RB7A 2C1CA 2JDDA 2VZZA 2AFXA 3V8IA 4A32A 3BJ8A 4PPZA 2HC9A 4M6GA 4WWVA 3LMSA 1RO5A 4BINA 1LCPA 2FVGA 1Z9UA 4CGPA 5THWA 1R57A 4UIBA 3S6GA 2QIRA 5LRKA 3L2NA 4A95A 2V8HA 2PJ7A 5K8OA 3FVLA 1HEEA 4NJRA 3DGVA 2C6GA 3PB4X 2DPTA 2FIWA 5EMIA 1NSLA 5C82A 3G8WA 1YW6A 3A9LA 2Z3KA 2Z0ZA 1IOFA 2QVPA 1Y9KA 4ORFA 1ZLHA 4OC0A 1XOVA 1IYLA 2AFOA 2CNMA 2QECA 1M1DA 3TC8A 2EVNA 2Q51A 4UEZA 4ZX9A 3KHZA 4UCMA 5J1QA 3K9TA 4KS9A 4ZY0A 3WC7A 7CPAA 2FL4A 2ZEGA 2CF4A 2Q44A 4IAVA 1XJOA 2B58A 3ZZIA 4C7IA 3EFAA 4MY0A 1XMBA 2VL1A 3FXTA 2IQ6A 2NMTA 3GKRA 4FD4A 5IB0A 4U9YA 4B6ZA 4BMHA 4R9MA 2Y0MA 4IK2A 1XEBA 2OB0A 5FVJA 1Y7RA 3PB8X 4PK2A 5F48A 2B4DB 1TXRA 2PJ6A 4KOXA 2HQYA 2R98A 1B87A 3KZWA 1S7KA 2IMOA 2Z3OA 3IEHA 1Z8XA 4X8IA 3R96A 4Q38A 3TCVA 1FT7A 3NA6A 3B35A 2YNEA 3BJ7A 4JWPA 5DWNA 4AB7A 3B3SA 4CS0B 1IYKA 3IJ3A 4CRYB 5I0CA 2PVWA 4MFLA 3FB3A 4AVAA 4QBJA 1MJ9A 3W91A 2B4DA 1PU9A 4F9VA 4TWEA 1ZG9A 3TE4A 1CBXA 4B5PB 1EE3P 2NSMA 4LQGA 4CPAA 4B5OA 4MY3A 4OIDA 4M6IA 2PJ9A 3S9MA 4UFXA 3S6FA 4X2TA 2PDOA 2GE3A 2J8NA 3FIXA 4C2XA 4NFRA 2XEJA 4DJLA 3N5FA 3FRMA 1CX8A 4XPDC 3TOBA 4MCPA 1YMEA 4B5PA 8CPAA 4UEFA 2WSAA 2V8VA 4OP4A 3UY5A 4M85A 3NH4A 3PRTA 2P6FA 1S5KA 2YNCC 2VZYA 4QB9A 5LRGA 2FIAA 1QMUA 3H8EA 4HNXB 4KSIA 4FD6A 4ZI6A 4OIWA 3VATA 5HVHA 4JZ0A 2PJ0A 3BXMA 3P2HA 4A31A 1QSNA 3E0KA 4EVYA 3KGQA 4JLYA 5A27A 3B7IA 2Q4YA 1DTDA 2PJ3A 2XEGA 1RTQA 2Z3MA 4ZX8A 1I1DA 2VI7A 3D67A 5F09A 2H5MA 1A2ZA 3GYAA 1YVOA 4FUUA 4LUAA 3CXSA 1R43A 3PFEA 3SHPA 1BOBA 2JBKA 2WPWA 3F8KA 2J9AA 1YK3A 3D4UA 2FT0A 4L8AA 4R87A 4CAEA 4KLWA 2PCUA 4UIAA 1PCAA 5EC4A 2Q04A 5A28A 2AFSA 5HXDA 2V77A 4A2ZA 3NE7A 4B12A 4YFJA 2C27A 3TO7A 1ELMP 2FSRA 3KASA 5IB9A 4PXBA 1LAPA 4YRHA 3FBUA 1JQGA 4I49A 1YW4A 2WPXA 3B8GA 3QAHA 4OC1A 3CXQA 4PV6A 2EK9A 2J8MA 4BD9A 3PEIA 2F7VA 3PFOA 4CRZB 4R6TA 4NGTA 3IGRA 3R9FA 3W6SA 5JPHA 4GM5A 3JUWA 4P4IA 3D3SA 2CNSA 4GXHA 4A38A 2GIVA 2ZEMA 3D2MA 1NSAA 3G3SA 4U9ZA 4Z65A 2ABZA 2IL4A 3PB6X 4UWJA 5ISVA 5JH9A 4NJQA 2HUZA 4KSAA 5HH1A 3KQXA 2DPSA 2F5IA 3D7FA 5HVFA 5KTAA 3D8PA 4QC6A 1MJBA 4NGPA 2A4NA 4H6ZA 4F0XA 3D7DA 3TOAA 2WYRA 2K5TA 3ISXA 1Z8WA 3S6HA 3GB0A 3VWEA 5E96A 4G1PA 4MHDA 4C2YA 4ZY1A 4EWTA 1JWQA 2ZEPA 1ZG8A 1Q2YA 2P6GA 3PZJA 4A30A 4AG7A 2OR4A 4HPSA 3CT9A 5DWMA 4A39A 5LYDA 5G22A 4KOUA 2JDCA 3IFEA 4KVOE 4CYOA 5H84A 3T90A 3B3WA 4JXRA 1NE9A 1S3ZA 2POKA 2V8GA 4CGOA 3BI0A 4P4BA 2CXAA 5AG4A 1N71A 1TIQA 1AMPA 2BUEA 2G3AA 2DEAA 4KOYA 4MRIA 4JYWA 2I00A 3WC5A 1VIXA 2EBJA 2VXKA 3NH8A 3KL9A 2Z10A 2DF5A 3IWGA 3QB8A 2O4HA 3PBBA 4NSQA 2VBQA 1F2OA 4UFWA 2RFHA 2REEA 3D7GA 4KUBA 5LYIA 5BWAB 5K8PA 1GHEA 1XRYA 5EBVA 3S9NA 2ANPA 2Z11A 2OOTA 3SJFA 1ZLIA 2PR8A 4NCZA 3TT2A 2BCOA 3PB9X 1QSOA 3ISZA 4RS2A 4LQ6A 5F47A 3H8GA 1RXTA 4NGRA 1XF8A 4H6UA 5HMNA 2HV2A 3GLJA 4K3NA 1I21A 1Q2CA 4B14A 4XPLA 5J8FA 4JJXA 1P0HA 4RUHA 4Q7AA 4MCRA 2CY2A 4E8OA 3KR5A 1TF8A 4L89A 4UWIA 3TX8A 2YNCA 4YGOA 4FD5A 5JQ4A 1XE4A 4YWYA 3JRUA 1KUVA 1LFWA 3MRUA 5DS0A 2P0WA 1VHEA 4KLVA 4F8ZA 4PXDA 1LANA 2CTCA 3IWWA 1FNOA 2YGWA 1YLOA 4P4EA 3KHXA 4Y49B 1PYTB 1QSTA 1X12A 2CTBA 1KUXA 2Q0YA 1S7LA 1CG2A 2KCWA 1ARLA 4PK3A 2FCKA 3GY9A 5IX3A 4NGQA 4MHPA 4XNHC 4CYQA 1WWZA 5AGEA 3TTHA 2ZEOA 3OWCA 1LOKA 2EK8A 3KR4A 4P6YA 3RZAA 1ZG7A 4BBHA 4FAIA 2PC1A 4MFPA 1BO4A 1ELLP 1HDUA 2B4BA 1BPNA 5G1ZA 4AVCA 4EMEA 1CPSA 3JTKA 3HUVA 2PQ8A 2RC4A 2GANA 2EUIA 3FJUA 1M4GA 1S7FA 1DE4C 2J8RA 4P4FA 2I3CA 5LYFA 1Y0YA 2AJ6A 3V38A 4JD6A 3WC6A 4MI4A 1MJAA 3QNVA 3QAYA 1I12A 2C6CA 2Z3NA 2Z3PA 1L0CA 1OBRA 3RAMA 5CPAA 4ZY2A 1VKCA 1Q2DA 5AG5A 4MHYA 5JM6A 2ODFA 2GLFA 3F0AA
chains in the Genus database with same CATH topology
4NF1A 4CGNA 2YNDA 1PUAA 3TO6A 3I3GA 2R7HA 1QSRA 4XPKA 3IU2A 4RI1A 4CYPA 1B6BA 1UFHA 4OAEA 3R9GA 2PR1A 3DR6A 4ZBGA 2D4OA 4PSXA 2ATRA 2R1IA 5G20A 4NEXA 4ONUA 1YLEA 2JLMA 4KOTA 5G21A 3VWDA 2Q7BA 3F5BA 5C88A 2ZXVA 4R57A 3N7ZA 1Z4RA 4CAXA 2ZW5A 3EXNA 2ZPAA 4E2AA 5IV0A 3EY5A 3RYOA 1YX0A 4MFZA 4UCPA 4KZTA 2VEZA 1MK4A 3JVNA 1XMTA 1YREA 4A33A 4F0YA 3DDDA 1IIDA 3R1KA 4CAFA 3H4QA 4KOWA 4CAVA 2G3TA 1YVKA 5F49A 3FNCA 1WK4A 3EO4A 4KSFA 4AG9A 4H89A 4C68A 5KTDA 1M4IA 1P4NA 2WUUA 1J4JA 3DNSA 4LX9A 4XPDB 5CNPA 1LRZA 2FS5A 4X5KA 3ZJ0A 4E0AA 4KORA 4XNHB 2BEIA 5GCNA 2PSWA 3BLNA 1VHSA 4CAWA 1V0CA 4QUSA 3LD2A 4MFQA 1YGHA 3R95A 3PP9A 4DNCA 2OZUA 4MJ8A 4II9A 2I79A 1K4JA 5H86A 4OLLA 1S7NA 1M4DA 4FD7A 1U6MA 1FY7A 1M44A 4B13A 3DSBA 4Q36A 1NMTA 2OU2A 4CGMA 4F6AA 3PGPA 2B3VA 4UFVA 4OADA 1Y9WA 1CJWA 3S6KA 4K30A 1IICA 2OZGA 4KOSA 2Q4VA 4MBUA 4ZGYB 1YR0A 3SXOA 2Z3LA 2BL1A 4IUSA 5KTCA 2CNTA 4MFKA 3TFYA 1OZPA 5AG6A 3FYNA 2AE6A 1KZFA 1S60A 4B10A 1XIXA 5F46A 3H5ZA 3T9YA 2JEVA 1ZO0A 4KVXA 2B3UA 4CGLA 1IB1E 3KKWA 4CYNA 2ZW7A 2G0BA 2ZW4A 2ARHA 2FXFA 3DR8A 3EC4A 3R9EA 4UCNA 3WR7A 3IU1A 4HKFA 4Y49C 4U5YA 4KOVA 1KUYA 3IWEA 1CM0A 4GS4A 4AVBA 3D2PA 4C2ZA 4QVTA 4NXYA 4R3LA 4HNYB 5J8CA 4C7HA 2QMLA 2FE7A 2D4PA 4IF5A 3SXNA 4UA3A 1Z4EA 3C26A 3MGDA 3I9SA 2VQYA 4KVME 2O28A 2B5GB 4R3KA 4J3GA 2R8VA 4JXQA 4MFJA 5AG7A 4B11A 3W6XA 1QSMA 4M3SA 3CXPA 1SQHA 2OH1A 2OZHA 3TO9A 4UBRA 2ZW6A 3K9UA 4KUAA 2B5GA 2DXQA 3LODA 3P2FA 1ON0A 2PRBA 2BSWA 2REFA 2X7BA 2P6EA 4PSWA 4HNWB 2VZZA 2JDDA 3V8IA 4A32A 3BJ8A 1RO5A 1Z9UA 4CGPA 1R57A 3S6GA 2QIRA 4A95A 2DPTA 2FIWA 1NSLA 5C82A 3G8WA 3A9LA 2Z3KA 2Z0ZA 1Y9KA 4ORFA 1IYLA 2CNMA 2QECA 1M1DA 2EVNA 4UCMA 4KS9A 2FL4A 2Q44A 2B58A 3ZZIA 4C7IA 3EFAA 4MY0A 3FXTA 2NMTA 3GKRA 4FD4A 5IB0A 4U9YA 4BMHA 4R9MA 2Y0MA 1XEBA 2OB0A 5FVJA 1Y7RA 4PK2A 5F48A 2B4DB 4KOXA 2HQYA 2R98A 1B87A 1S7KA 2Z3OA 3TCVA 3R96A 4Q38A 4AB7A 3BJ7A 2YNEA 5DWNA 4JWPA 4CS0B 1IYKA 4CRYB 5I0CA 4MFLA 3FB3A 4AVAA 4QBJA 1MJ9A 3W91A 2B4DA 1PU9A 3TE4A 4B5PB 4B5OA 4MY3A 4UFXA 3S6FA 2PDOA 2GE3A 2J8NA 3FIXA 4C2XA 3FRMA 4XPDC 3TOBA 4B5PA 2WSAA 3UY5A 4M85A 2P6FA 1S5KA 2YNCC 2VZYA 4QB9A 2FIAA 4HNXB 4FD6A 4A31A 3P2HA 1QSNA 3E0KA 4EVYA 4JLYA 5A27A 2Q4YA 2Z3MA 1I1DA 2VI7A 2H5MA 3GYAA 1YVOA 4LUAA 3CXSA 3SHPA 1BOBA 3F8KA 2WPWA 1YK3A 4R87A 2FT0A 4L8AA 4CAEA 4KLWA 5EC4A 2Q04A 5A28A 4A2ZA 3NE7A 4B12A 4YFJA 2C27A 3TO7A 2FSRA 4YRHA 3FBUA 4I49A 2WPXA 3B8GA 3QAHA 3CXQA 4PV6A 2J8MA 4CRZB 3IGRA 3R9FA 3W6SA 5JPHA 3JUWA 3D3SA 2CNSA 2GIVA 3D2MA 3G3SA 4U9ZA 2IL4A 4UWJA 5ISVA 2HUZA 5HH1A 2DPSA 2F5IA 5KTAA 3D8PA 4QC6A 1MJBA 2A4NA 4H6ZA 4F0XA 3TOAA 2K5TA 3S6HA 3VWEA 5E96A 4MHDA 4C2YA 1Q2YA 2P6GA 3PZJA 4A30A 4AG7A 5DWMA 5G22A 4KOUA 2JDCA 4KVOE 4CYOA 5H84A 3T90A 4JXRA 1NE9A 1S3ZA 4CGOA 2CXAA 5AG4A 1N71A 1TIQA 2G3AA 2BUEA 4KOYA 2I00A 2VXKA 2Z10A 3IWGA 3QB8A 4NSQA 2VBQA 4UFWA 2REEA 4KUBA 5BWAB 1GHEA 5EBVA 3TT2A 2Z11A 2PR8A 4NCZA 1QSOA 4RS2A 5F47A 1RXTA 1XF8A 4H6UA 5HMNA 2HV2A 1I21A 1Q2CA 4B14A 4XPLA 5J8FA 4JJXA 1P0HA 2CY2A 4E8OA 4L89A 4UWIA 2YNCA 4YGOA 4FD5A 5JQ4A 1XE4A 1KUVA 2P0WA 4KLVA 2YGWA 4Y49B 1QSTA 1KUXA 2Q0YA 1S7LA 2KCWA 4PK3A 2FCKA 3GY9A 5IX3A 4XNHC 4CYQA 1WWZA 5AGEA 3TTHA 3OWCA 4BBHA 2PC1A 4MFPA 1BO4A 5G1ZA 2B4BA 4AVCA 3JTKA 2PQ8A 2RC4A 2EUIA 2GANA 1M4GA 1S7FA 2J8RA 2AJ6A 4JD6A 4MI4A 1MJAA 1I12A 2Z3NA 2Z3PA 1L0CA 1VKCA 1Q2DA 5AG5A 4KSAA 3F0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGN A;  2YND A;  4C7H A;  5A27 A;  5G1Z A;  4CYN A;  2YNC A;  4A32 A;  3IU2 A;  4C2Y A;  4B13 A;  3JTK A;  4C7I A;  4C68 A;  4A30 A;  4UFW A;  4CGM A;  4CGP A;  2WUU A;  4UFV A;  4UFX A;  4UCN A;  5AG6 A;  4CYP A;  5AG7 A;  3IU1 A;  4A95 A;  4B11 A;  4UCP A;  4C2X A;  5G22 A;  4CAE A;  4CYO A;  4B10 A;  3H5Z A;  2WSA A;  5A28 A;  4A33 A;  2YNC C;  4CGO A;  5G20 A;  4A2Z A;  5AG4 A;  3IWE A;  2YNE A;  4B12 A;  4CYQ A;  4CAF A;  5AGE A;  5AG5 A;  5G21 A;  4B14 A;  4C2Z A;  4A31 A;  4CGL A;  4BBH A;  4UCM A; 
#chains in the Genus database with same CATH topology
 1LAM A;  2V8D A;  4NF1 A;  2YND A;  4CGN A;  1PUA A;  3TO6 A;  3I3G A;  2CIJ A;  2R7H A;  1QSR A;  2EO8 A;  4XPK A;  3IU2 A;  4X3R A;  3CPX A;  4ZYQ A;  4UF4 A;  2GFQ A;  4RI1 A;  4CYP A;  1B6B A;  3B3V A;  1KWM A;  2WZN A;  4YU9 A;  3RO0 A;  3FH4 A;  1Z8L A;  1UFH A;  4H2K A;  3LAC A;  4OAE A;  3R9G A;  3KQZ A;  4MXU A;  3VH9 A;  2PR1 A;  3DR6 A;  1YQE A;  4NGS A;  2D4O A;  4PSX A;  2ATR A;  4PXC A;  2R1I A;  3GUX A;  4ZBG A;  5G20 A;  4MCQ A;  4NEX A;  4ONU A;  5K8N A;  2JLM A;  1YLE A;  4KOT A;  1ARM A;  5G21 A;  3KI9 A;  2ZED A;  3VWD A;  2Q7B A;  3F5B A;  3WAB A;  2ZXV A;  5C88 A;  3I1U A;  4R57 A;  5I4M A;  3N7Z A;  1Z4R A;  1F57 A;  1Z5R A;  2ZW5 A;  3EXN A;  4CAX A;  2JBJ A;  1Z8T A;  2ZPA A;  4MHZ A;  2Q4Z A;  3VAR A;  1UWY A;  4E2A A;  3PB7 X;  5IV0 A;  4PXE A;  3EY5 A;  3RYO A;  3BHX A;  4UEE A;  1YX0 A;  3FX6 A;  4MFZ A;  4WJB A;  4OC4 A;  3SJE A;  3S9L A;  2ZOG A;  4UCP A;  4KZT A;  2VEZ A;  3IC1 A;  3D66 A;  1Q7L A;  1MK4 A;  3GIU A;  1IU8 A;  3CPA A;  3JVN A;  1XMT A;  4DUK A;  6CPA A;  1X10 A;  1YRE A;  3NH5 A;  4P4J A;  2F8H A;  4NGM A;  4A33 A;  1GYT A;  4F0Y A;  2AFW A;  3DDD A;  1IID A;  3R1K A;  4W9Y A;  2PIZ A;  3K2K A;  4CAF A;  3SJG A;  3H4Q A;  4KOW A;  3RNZ A;  4CAV A;  2G3T A;  1YVK A;  4FBE A;  5F49 A;  3FNC A;  4M6H A;  1IGB A;  2EWB A;  2ZOF A;  1CP6 A;  1WK4 A;  3EO4 A;  2ZEN A;  4KSF A;  4AG9 A;  4EFD A;  4H89 A;  5K8M A;  3MN8 A;  4C68 A;  5KTD A;  1M4I A;  1P4N A;  2WUU A;  2AFM A;  4R7M A;  1CPX A;  1J4J A;  3DNS A;  4P44 A;  2QJ8 A;  4LX9 A;  4XPD B;  5CNP A;  1LRZ A;  2FS5 A;  4X5K A;  3ZJ0 A;  4E0A A;  4P45 A;  4KOR A;  4XNH B;  2BEI A;  5GCN A;  2PSW A;  4MHN A;  3RBU A;  3BLN A;  2PJ8 A;  1VHS A;  2BO9 A;  4CAW A;  1V0C A;  4QUS A;  3LD2 A;  4MFQ A;  1YGH A;  4OKO A;  3R95 A;  3PP9 A;  4DNC A;  2OZU A;  4MJ8 A;  4II9 A;  1F2P A;  1K4J A;  2I79 A;  5H86 A;  3SI2 A;  2GRE A;  4OLL A;  3B3T A;  4TNU A;  2PJ5 A;  1S7N A;  1M4D A;  4FD7 A;  4F9U A;  2PJ2 A;  2O53 A;  1U6M A;  1FY7 A;  1M44 A;  2IJZ A;  2GLJ A;  3DSB A;  4AXV A;  4B13 A;  3V7Z A;  4Q36 A;  1NMT A;  2OU2 A;  4CGM A;  4F6A A;  2ZEL A;  3PGP A;  2B3V A;  4PQA A;  2XEF A;  4UFV A;  4OAD A;  1Y9W A;  3B3C A;  2C6P A;  1CJW A;  3S6K A;  4K30 A;  2PJC A;  1TF9 A;  3FMC A;  4P10 A;  1IIC A;  2OZG A;  5CBM A;  4FWU A;  4KOS A;  2PIY A;  1IY7 A;  1VHO A;  2Q4V A;  4MBU A;  4RN7 A;  4ZGY B;  1YR0 A;  3SXO A;  5LYL A;  2BL1 A;  2Z3L A;  1R3N A;  1Y0R A;  3HLP A;  2ZEE A;  4IUS A;  3FF3 A;  1TKH A;  1BAV A;  4ONW A;  4A94 A;  4OC3 A;  3WT4 A;  5KTC A;  2CNT A;  4MFK A;  3TFY A;  1OZP A;  4P4D A;  2G9D A;  4OME A;  5AG6 A;  3BI1 A;  2Q43 A;  2AFZ A;  3FYN A;  2AE6 A;  2QYV A;  1KZF A;  2PJA A;  1S60 A;  3D68 A;  1XIX A;  4B10 A;  5F46 A;  1XFO A;  3H5Z A;  4DYO A;  3T9Y A;  2JEV A;  1ZO0 A;  1CP7 A;  1Y7E A;  3FEE A;  3SI0 A;  2PRQ A;  4KVX A;  2B3U A;  4CGL A;  2JEW A;  4OC5 A;  3FED A;  1IB1 E;  3KKW A;  1HDQ A;  4CYN A;  2ZW7 A;  1TKJ A;  3NFZ A;  2G0B A;  3H8F A;  2ZW4 A;  2ARH A;  2PJ1 A;  1YSJ A;  3NE8 A;  2FXF A;  3DR8 A;  4MCS A;  1TKF A;  3EC4 A;  5D8N A;  5HVG A;  3R9E A;  4IHM A;  4UCN A;  3WR7 A;  2XEI A;  4R8F A;  3IU1 A;  4O23 A;  4HKF A;  1QQ9 A;  3LWU A;  4Y49 C;  4U5Y A;  2PVV A;  1H8L A;  2ZEF A;  5ELY A;  4KOV A;  1KUY A;  3IWE A;  1CM0 A;  4GS4 A;  4AVB A;  3D2P A;  4C2Z A;  4QVT A;  4NXY A;  4MMO A;  3FEC A;  4HNY B;  4R3L A;  3SJX A;  5J8C A;  4C7H A;  2QML A;  2FE7 A;  2PJB A;  2D4P A;  4IF5 A;  2HB6 A;  3SXN A;  4UA3 A;  1Z4E A;  2AFU A;  3PBE A;  2NYQ A;  3B2Y A;  1BLL E;  3C26 A;  3I9S A;  3IIB A;  3MGD A;  3SI1 A;  1Z2L A;  3T8W A;  2VQY A;  1XBU A;  1BPM A;  2O28 A;  2B5G B;  4KVM E;  4R3K A;  2PJ4 A;  4J3G A;  2ZEH A;  2R8V A;  4JXQ A;  4MFJ A;  1M4L A;  3CZX A;  5AG7 A;  5D29 A;  5JGF A;  1IOI A;  4B11 A;  1VGY A;  3W6X A;  3D7H A;  1QSM A;  1AYE A;  4M3S A;  3DLJ A;  2BOA A;  3CXP A;  1SQH A;  2OH1 A;  2OZH A;  4A37 A;  3IO1 A;  3TO9 A;  3CDX A;  2GU2 A;  2ZW6 A;  4UBR A;  5LRJ A;  3K9U A;  2PE3 A;  4KUA A;  4NGN A;  4OC2 A;  2B5G A;  2DXQ A;  3LOD A;  3P2F A;  1AUG A;  1ON0 A;  2PRB A;  2Q7S A;  2BSW A;  2REF A;  2X7B A;  2P6E A;  4R76 A;  4PSW A;  4HNW B;  2RB7 A;  2C1C A;  2JDD A;  2VZZ A;  2AFX A;  3V8I A;  4A32 A;  3BJ8 A;  4PPZ A;  2HC9 A;  4M6G A;  4WWV A;  3LMS A;  1RO5 A;  4BIN A;  1LCP A;  2FVG A;  1Z9U A;  4CGP A;  5THW A;  1R57 A;  4UIB A;  3S6G A;  2QIR A;  5LRK A;  3L2N A;  4A95 A;  2V8H A;  2PJ7 A;  5K8O A;  3FVL A;  1HEE A;  4NJR A;  3DGV A;  2C6G A;  3PB4 X;  2DPT A;  2FIW A;  5EMI A;  1NSL A;  5C82 A;  3G8W A;  1YW6 A;  3A9L A;  2Z3K A;  2Z0Z A;  1IOF A;  2QVP A;  1Y9K A;  4ORF A;  1ZLH A;  4OC0 A;  1XOV A;  1IYL A;  2AFO A;  2CNM A;  2QEC A;  1M1D A;  3TC8 A;  2EVN A;  2Q51 A;  4UEZ A;  4ZX9 A;  3KHZ A;  4UCM A;  5J1Q A;  3K9T A;  4KS9 A;  4ZY0 A;  3WC7 A;  7CPA A;  2FL4 A;  2ZEG A;  2CF4 A;  2Q44 A;  4IAV A;  1XJO A;  2B58 A;  3ZZI A;  4C7I A;  3EFA A;  4MY0 A;  1XMB A;  2VL1 A;  3FXT A;  2IQ6 A;  2NMT A;  3GKR A;  4FD4 A;  5IB0 A;  4U9Y A;  4B6Z A;  4BMH A;  4R9M A;  2Y0M A;  4IK2 A;  1XEB A;  2OB0 A;  5FVJ A;  1Y7R A;  3PB8 X;  4PK2 A;  5F48 A;  2B4D B;  1TXR A;  2PJ6 A;  4KOX A;  2HQY A;  2R98 A;  1B87 A;  3KZW A;  1S7K A;  2IMO A;  2Z3O A;  3IEH A;  1Z8X A;  4X8I A;  3R96 A;  4Q38 A;  3TCV A;  1FT7 A;  3NA6 A;  3B35 A;  2YNE A;  3BJ7 A;  4JWP A;  5DWN A;  4AB7 A;  3B3S A;  4CS0 B;  1IYK A;  3IJ3 A;  4CRY B;  5I0C A;  2PVW A;  4MFL A;  3FB3 A;  4AVA A;  4QBJ A;  1MJ9 A;  3W91 A;  2B4D A;  1PU9 A;  4F9V A;  4TWE A;  1ZG9 A;  3TE4 A;  1CBX A;  4B5P B;  1EE3 P;  2NSM A;  4LQG A;  4CPA A;  4B5O A;  4MY3 A;  4OID A;  4M6I A;  2PJ9 A;  3S9M A;  4UFX A;  3S6F A;  4X2T A;  2PDO A;  2GE3 A;  2J8N A;  3FIX A;  4C2X A;  4NFR A;  2XEJ A;  4DJL A;  3N5F A;  3FRM A;  1CX8 A;  4XPD C;  3TOB A;  4MCP A;  1YME A;  4B5P A;  8CPA A;  4UEF A;  2WSA A;  2V8V A;  4OP4 A;  3UY5 A;  4M85 A;  3NH4 A;  3PRT A;  2P6F A;  1S5K A;  2YNC C;  2VZY A;  4QB9 A;  5LRG A;  2FIA A;  1QMU A;  3H8E A;  4HNX B;  4KSI A;  4FD6 A;  4ZI6 A;  4OIW A;  3VAT A;  5HVH A;  4JZ0 A;  2PJ0 A;  3BXM A;  3P2H A;  4A31 A;  1QSN A;  3E0K A;  4EVY A;  3KGQ A;  4JLY A;  5A27 A;  3B7I A;  2Q4Y A;  1DTD A;  2PJ3 A;  2XEG A;  1RTQ A;  2Z3M A;  4ZX8 A;  1I1D A;  2VI7 A;  3D67 A;  5F09 A;  2H5M A;  1A2Z A;  3GYA A;  1YVO A;  4FUU A;  4LUA A;  3CXS A;  1R43 A;  3PFE A;  3SHP A;  1BOB A;  2JBK A;  2WPW A;  3F8K A;  2J9A A;  1YK3 A;  3D4U A;  2FT0 A;  4L8A A;  4R87 A;  4CAE A;  4KLW A;  2PCU A;  4UIA A;  1PCA A;  5EC4 A;  2Q04 A;  5A28 A;  2AFS A;  5HXD A;  2V77 A;  4A2Z A;  3NE7 A;  4B12 A;  4YFJ A;  2C27 A;  3TO7 A;  1ELM P;  2FSR A;  3KAS A;  5IB9 A;  4PXB A;  1LAP A;  4YRH A;  3FBU A;  1JQG A;  4I49 A;  1YW4 A;  2WPX A;  3B8G A;  3QAH A;  4OC1 A;  3CXQ A;  4PV6 A;  2EK9 A;  2J8M A;  4BD9 A;  3PEI A;  2F7V A;  3PFO A;  4CRZ B;  4R6T A;  4NGT A;  3IGR A;  3R9F A;  3W6S A;  5JPH A;  4GM5 A;  3JUW A;  4P4I A;  3D3S A;  2CNS A;  4GXH A;  4A38 A;  2GIV A;  2ZEM A;  3D2M A;  1NSA A;  3G3S A;  4U9Z A;  4Z65 A;  2ABZ A;  2IL4 A;  3PB6 X;  4UWJ A;  5ISV A;  5JH9 A;  4NJQ A;  2HUZ A;  4KSA A;  5HH1 A;  3KQX A;  2DPS A;  2F5I A;  3D7F A;  5HVF A;  5KTA A;  3D8P A;  4QC6 A;  1MJB A;  4NGP A;  2A4N A;  4H6Z A;  4F0X A;  3D7D A;  3TOA A;  2WYR A;  2K5T A;  3ISX A;  1Z8W A;  3S6H A;  3GB0 A;  3VWE A;  5E96 A;  4G1P A;  4MHD A;  4C2Y A;  4ZY1 A;  4EWT A;  1JWQ A;  2ZEP A;  1ZG8 A;  1Q2Y A;  2P6G A;  3PZJ A;  4A30 A;  4AG7 A;  2OR4 A;  4HPS A;  3CT9 A;  5DWM A;  4A39 A;  5LYD A;  5G22 A;  4KOU A;  2JDC A;  3IFE A;  4KVO E;  4CYO A;  5H84 A;  3T90 A;  3B3W A;  4JXR A;  1NE9 A;  1S3Z A;  2POK A;  2V8G A;  4CGO A;  3BI0 A;  4P4B A;  2CXA A;  5AG4 A;  1N71 A;  1TIQ A;  1AMP A;  2BUE A;  2G3A A;  2DEA A;  4KOY A;  4MRI A;  4JYW A;  2I00 A;  3WC5 A;  1VIX A;  2EBJ A;  2VXK A;  3NH8 A;  3KL9 A;  2Z10 A;  2DF5 A;  3IWG A;  3QB8 A;  2O4H A;  3PBB A;  4NSQ A;  2VBQ A;  1F2O A;  4UFW A;  2RFH A;  2REE A;  3D7G A;  4KUB A;  5LYI A;  5BWA B;  5K8P A;  1GHE A;  1XRY A;  5EBV A;  3S9N A;  2ANP A;  2Z11 A;  2OOT A;  3SJF A;  1ZLI A;  2PR8 A;  4NCZ A;  3TT2 A;  2BCO A;  3PB9 X;  1QSO A;  3ISZ A;  4RS2 A;  4LQ6 A;  5F47 A;  3H8G A;  1RXT A;  4NGR A;  1XF8 A;  4H6U A;  5HMN A;  2HV2 A;  3GLJ A;  4K3N A;  1I21 A;  1Q2C A;  4B14 A;  4XPL A;  5J8F A;  4JJX A;  1P0H A;  4RUH A;  4Q7A A;  4MCR A;  2CY2 A;  4E8O A;  3KR5 A;  1TF8 A;  4L89 A;  4UWI A;  3TX8 A;  2YNC A;  4YGO A;  4FD5 A;  5JQ4 A;  1XE4 A;  4YWY A;  3JRU A;  1KUV A;  1LFW A;  3MRU A;  5DS0 A;  2P0W A;  1VHE A;  4KLV A;  4F8Z A;  4PXD A;  1LAN A;  2CTC A;  3IWW A;  1FNO A;  2YGW A;  1YLO A;  4P4E A;  3KHX A;  4Y49 B;  1PYT B;  1QST A;  1X12 A;  2CTB A;  1KUX A;  2Q0Y A;  1S7L A;  1CG2 A;  2KCW A;  1ARL A;  4PK3 A;  2FCK A;  3GY9 A;  5IX3 A;  4NGQ A;  4MHP A;  4XNH C;  4CYQ A;  1WWZ A;  5AGE A;  3TTH A;  2ZEO A;  3OWC A;  1LOK A;  2EK8 A;  3KR4 A;  4P6Y A;  3RZA A;  1ZG7 A;  4BBH A;  4FAI A;  2PC1 A;  4MFP A;  1BO4 A;  1ELL P;  1HDU A;  2B4B A;  1BPN A;  5G1Z A;  4AVC A;  4EME A;  1CPS A;  3JTK A;  3HUV A;  2PQ8 A;  2RC4 A;  2GAN A;  2EUI A;  3FJU A;  1M4G A;  1S7F A;  1DE4 C;  2J8R A;  4P4F A;  2I3C A;  5LYF A;  1Y0Y A;  2AJ6 A;  3V38 A;  4JD6 A;  3WC6 A;  4MI4 A;  1MJA A;  3QNV A;  3QAY A;  1I12 A;  2C6C A;  2Z3N A;  2Z3P A;  1L0C A;  1OBR A;  3RAM A;  5CPA A;  4ZY2 A;  1VKC A;  1Q2D A;  5AG5 A;  4MHY A;  5JM6 A;  2ODF A;  2GLF A;  3F0A A; 
#chains in the Genus database with same CATH homology
 4NF1 A;  4CGN A;  2YND A;  1PUA A;  3TO6 A;  3I3G A;  2R7H A;  1QSR A;  4XPK A;  3IU2 A;  4RI1 A;  4CYP A;  1B6B A;  1UFH A;  4OAE A;  3R9G A;  2PR1 A;  3DR6 A;  4ZBG A;  2D4O A;  4PSX A;  2ATR A;  2R1I A;  5G20 A;  4NEX A;  4ONU A;  1YLE A;  2JLM A;  4KOT A;  5G21 A;  3VWD A;  2Q7B A;  3F5B A;  5C88 A;  2ZXV A;  4R57 A;  3N7Z A;  1Z4R A;  4CAX A;  2ZW5 A;  3EXN A;  2ZPA A;  4E2A A;  5IV0 A;  3EY5 A;  3RYO A;  1YX0 A;  4MFZ A;  4UCP A;  4KZT A;  2VEZ A;  1MK4 A;  3JVN A;  1XMT A;  1YRE A;  4A33 A;  4F0Y A;  3DDD A;  1IID A;  3R1K A;  4CAF A;  3H4Q A;  4KOW A;  4CAV A;  2G3T A;  1YVK A;  5F49 A;  3FNC A;  1WK4 A;  3EO4 A;  4KSF A;  4AG9 A;  4H89 A;  4C68 A;  5KTD A;  1M4I A;  1P4N A;  2WUU A;  1J4J A;  3DNS A;  4LX9 A;  4XPD B;  5CNP A;  1LRZ A;  2FS5 A;  4X5K A;  3ZJ0 A;  4E0A A;  4KOR A;  4XNH B;  2BEI A;  5GCN A;  2PSW A;  3BLN A;  1VHS A;  4CAW A;  1V0C A;  4QUS A;  3LD2 A;  4MFQ A;  1YGH A;  3R95 A;  3PP9 A;  4DNC A;  2OZU A;  4MJ8 A;  4II9 A;  2I79 A;  1K4J A;  5H86 A;  4OLL A;  1S7N A;  1M4D A;  4FD7 A;  1U6M A;  1FY7 A;  1M44 A;  4B13 A;  3DSB A;  4Q36 A;  1NMT A;  2OU2 A;  4CGM A;  4F6A A;  3PGP A;  2B3V A;  4UFV A;  4OAD A;  1Y9W A;  1CJW A;  3S6K A;  4K30 A;  1IIC A;  2OZG A;  4KOS A;  2Q4V A;  4MBU A;  4ZGY B;  1YR0 A;  3SXO A;  2Z3L A;  2BL1 A;  4IUS A;  5KTC A;  2CNT A;  4MFK A;  3TFY A;  1OZP A;  5AG6 A;  3FYN A;  2AE6 A;  1KZF A;  1S60 A;  4B10 A;  1XIX A;  5F46 A;  3H5Z A;  3T9Y A;  2JEV A;  1ZO0 A;  4KVX A;  2B3U A;  4CGL A;  1IB1 E;  3KKW A;  4CYN A;  2ZW7 A;  2G0B A;  2ZW4 A;  2ARH A;  2FXF A;  3DR8 A;  3EC4 A;  3R9E A;  4UCN A;  3WR7 A;  3IU1 A;  4HKF A;  4Y49 C;  4U5Y A;  4KOV A;  1KUY A;  3IWE A;  1CM0 A;  4GS4 A;  4AVB A;  3D2P A;  4C2Z A;  4QVT A;  4NXY A;  4R3L A;  4HNY B;  5J8C A;  4C7H A;  2QML A;  2FE7 A;  2D4P A;  4IF5 A;  3SXN A;  4UA3 A;  1Z4E A;  3C26 A;  3MGD A;  3I9S A;  2VQY A;  4KVM E;  2O28 A;  2B5G B;  4R3K A;  4J3G A;  2R8V A;  4JXQ A;  4MFJ A;  5AG7 A;  4B11 A;  3W6X A;  1QSM A;  4M3S A;  3CXP A;  1SQH A;  2OH1 A;  2OZH A;  3TO9 A;  4UBR A;  2ZW6 A;  3K9U A;  4KUA A;  2B5G A;  2DXQ A;  3LOD A;  3P2F A;  1ON0 A;  2PRB A;  2BSW A;  2REF A;  2X7B A;  2P6E A;  4PSW A;  4HNW B;  2VZZ A;  2JDD A;  3V8I A;  4A32 A;  3BJ8 A;  1RO5 A;  1Z9U A;  4CGP A;  1R57 A;  3S6G A;  2QIR A;  4A95 A;  2DPT A;  2FIW A;  1NSL A;  5C82 A;  3G8W A;  3A9L A;  2Z3K A;  2Z0Z A;  1Y9K A;  4ORF A;  1IYL A;  2CNM A;  2QEC A;  1M1D A;  2EVN A;  4UCM A;  4KS9 A;  2FL4 A;  2Q44 A;  2B58 A;  3ZZI A;  4C7I A;  3EFA A;  4MY0 A;  3FXT A;  2NMT A;  3GKR A;  4FD4 A;  5IB0 A;  4U9Y A;  4BMH A;  4R9M A;  2Y0M A;  1XEB A;  2OB0 A;  5FVJ A;  1Y7R A;  4PK2 A;  5F48 A;  2B4D B;  4KOX A;  2HQY A;  2R98 A;  1B87 A;  1S7K A;  2Z3O A;  3TCV A;  3R96 A;  4Q38 A;  4AB7 A;  3BJ7 A;  2YNE A;  5DWN A;  4JWP A;  4CS0 B;  1IYK A;  4CRY B;  5I0C A;  4MFL A;  3FB3 A;  4AVA A;  4QBJ A;  1MJ9 A;  3W91 A;  2B4D A;  1PU9 A;  3TE4 A;  4B5P B;  4B5O A;  4MY3 A;  4UFX A;  3S6F A;  2PDO A;  2GE3 A;  2J8N A;  3FIX A;  4C2X A;  3FRM A;  4XPD C;  3TOB A;  4B5P A;  2WSA A;  3UY5 A;  4M85 A;  2P6F A;  1S5K A;  2YNC C;  2VZY A;  4QB9 A;  2FIA A;  4HNX B;  4FD6 A;  4A31 A;  3P2H A;  1QSN A;  3E0K A;  4EVY A;  4JLY A;  5A27 A;  2Q4Y A;  2Z3M A;  1I1D A;  2VI7 A;  2H5M A;  3GYA A;  1YVO A;  4LUA A;  3CXS A;  3SHP A;  1BOB A;  3F8K A;  2WPW A;  1YK3 A;  4R87 A;  2FT0 A;  4L8A A;  4CAE A;  4KLW A;  5EC4 A;  2Q04 A;  5A28 A;  4A2Z A;  3NE7 A;  4B12 A;  4YFJ A;  2C27 A;  3TO7 A;  2FSR A;  4YRH A;  3FBU A;  4I49 A;  2WPX A;  3B8G A;  3QAH A;  3CXQ A;  4PV6 A;  2J8M A;  4CRZ B;  3IGR A;  3R9F A;  3W6S A;  5JPH A;  3JUW A;  3D3S A;  2CNS A;  2GIV A;  3D2M A;  3G3S A;  4U9Z A;  2IL4 A;  4UWJ A;  5ISV A;  2HUZ A;  5HH1 A;  2DPS A;  2F5I A;  5KTA A;  3D8P A;  4QC6 A;  1MJB A;  2A4N A;  4H6Z A;  4F0X A;  3TOA A;  2K5T A;  3S6H A;  3VWE A;  5E96 A;  4MHD A;  4C2Y A;  1Q2Y A;  2P6G A;  3PZJ A;  4A30 A;  4AG7 A;  5DWM A;  5G22 A;  4KOU A;  2JDC A;  4KVO E;  4CYO A;  5H84 A;  3T90 A;  4JXR A;  1NE9 A;  1S3Z A;  4CGO A;  2CXA A;  5AG4 A;  1N71 A;  1TIQ A;  2G3A A;  2BUE A;  4KOY A;  2I00 A;  2VXK A;  2Z10 A;  3IWG A;  3QB8 A;  4NSQ A;  2VBQ A;  4UFW A;  2REE A;  4KUB A;  5BWA B;  1GHE A;  5EBV A;  3TT2 A;  2Z11 A;  2PR8 A;  4NCZ A;  1QSO A;  4RS2 A;  5F47 A;  1RXT A;  1XF8 A;  4H6U A;  5HMN A;  2HV2 A;  1I21 A;  1Q2C A;  4B14 A;  4XPL A;  5J8F A;  4JJX A;  1P0H A;  2CY2 A;  4E8O A;  4L89 A;  4UWI A;  2YNC A;  4YGO A;  4FD5 A;  5JQ4 A;  1XE4 A;  1KUV A;  2P0W A;  4KLV A;  2YGW A;  4Y49 B;  1QST A;  1KUX A;  2Q0Y A;  1S7L A;  2KCW A;  4PK3 A;  2FCK A;  3GY9 A;  5IX3 A;  4XNH C;  4CYQ A;  1WWZ A;  5AGE A;  3TTH A;  3OWC A;  4BBH A;  2PC1 A;  4MFP A;  1BO4 A;  5G1Z A;  2B4B A;  4AVC A;  3JTK A;  2PQ8 A;  2RC4 A;  2EUI A;  2GAN A;  1M4G A;  1S7F A;  2J8R A;  2AJ6 A;  4JD6 A;  4MI4 A;  1MJA A;  1I12 A;  2Z3N A;  2Z3P A;  1L0C A;  1VKC A;  1Q2D A;  5AG5 A;  4KSA A;  3F0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...