5A28A

Leishmania major n-myristoyltransferase in complex with a chlorophenyl 1,3,4-oxadiazole inhibitor.
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
411
structure length
411
Chain Sequence
b'AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of High Affinity Inhibitors of Leishmania Donovani N-Myristoyltransferase.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 123
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5a28A00
5AG4A 5AGEA 3H5ZA 4CYNA 4B11A 4BBHA 4CGMA 5AG5A 3IWEA 4C7IA 4UFVA 4A30A 4A95A 4UCMA 2WUUA 3IU1A 3IU2A 4A32A 4A2ZA 5AG7A 4A31A 5A27A 4CAFA 2YNCA 4CGLA 4CYOA 4UFWA 3JTKA 4CYPA 4UCNA 4B10A 2YNDA 5G1ZA 4CAEA 2YNCC 4C2ZA 4C68A 5G22A 4C2XA 4CGOA 4CGPA 2YNEA 4B12A 4A33A 4C2YA 5A28A 4CGNA 4CYQA 5AG6A 4B14A 4UCPA 4C7HA 4UFXA 2WSAA 5G21A 5G20A 4B13A
chains in the Genus database with same CATH superfamily
1LAMA 2CTCA 2C6GA 3KQXA 4LUAA 4UA3A 1WK4A 4KORA 3B8GA 5HMNA 4F0YA 2BL1A 4CYNA 4BBHA 2GLFA 2ARHA 2V8HA 2PSWA 3PZJA 2JBJA 4P4FA 2RB7A 1QSTA 2WUUA 2X7BA 1PYTB 1GYTA 2D4OA 2Z3PA 3WR7A 1SQHA 1XJOA 1Y7EA 3W91A 4RS2A 4ZI6A 4M3SA 7CPAA 2VEZA 3FXTA 4MCQA 1S7LA 4C2ZA 2JDCA 2FE7A 3LWUA 2AFWA 4AXVA 1H8LA 5KTCA 5D29A 4R8FA 4X5KA 3RZAA 1QSNA 5I0CA 4IF5A 3WC6A 3TO9A 2BSWA 4CGNA 2R98A 3I9SA 1YK3A 2JLMA 5G20A 3CXSA 3CDXA 3IIBA 4IUSA 4MFQA 4KOTA 4XPKA 1ON0A 1TKFA 1CP7A 4MXUA 1Z9UA 3NE8A 3FB3A 5H86A 3NH4A 4PXBA 3TO7A 1WWZA 4MMOA 2CNSA 4NGSA 3R1KA 4P6YA 1BPNA 2ZPAA 2R1IA 3B3VA 3JTKA 2G3TA 3ISXA 4CPAA 4M6GA 4R3LA 3HUVA 2FIWA 4PV6A 2I3CA 1CPSA 4FWUA 6CPAA 2JDDA 3T8WA 2PVWA 3FH4A 1R43A 4NGRA 5ISVA 2J8NA 3R9GA 2AE6A 5AG4A 1F2OA 3QB8A 2ZW6A 2D4PA 1KUYA 3QAHA 3H8EA 4MCPA 3IWEA 2F5IA 2PJ3A 1AUGA 1LAPA 3GYAA 3TOAA 4OC3A 1ARMA 2G3AA 2PJCA 4A32A 4CAWA 1VHSA 1QSOA 4G1PA 2VZYA 2POKA 3SI2A 5EBVA 2QECA 5GCNA 3I1UA 4Q36A 3DSBA 2BUEA 2PJ7A 2ZW5A 5C88A 4NF1A 1UWYA 5JPHA 2B3VA 1DTDA 1P4NA 1Y0YA 3D8PA 4MHPA 5HVHA 3KHZA 1CPXA 4OKOA 3ISZA 4X8IA 3IGRA 4A33A 4QC6A 2C6CA 2PC1A 2I00A 1LCPA 4JD6A 2ZEMA 1S3ZA 4JWPA 1M1DA 4OC0A 4QB9A 2PJBA 1TF9A 3DR8A 4RN7A 1UFHA 2OZGA 3IWGA 2VZZA 3NH5A 5JGFA 5THWA 5H84A 4AVCA 2Z3LA 1XMBA 4H2KA 3IO1A 3FF3A 4UEEA 3TC8A 2C6PA 4XPDC 4CAFA 3W6SA 3BI0A 3W6XA 4NJRA 2NSMA 1IYKA 3N5FA 1Z5RA 3TX8A 3FRMA 4ONUA 4B10A 2YNDA 1IGBA 5G1ZA 4M6HA 4H6UA 1I1DA 3KQZA 3SI0A 3ZZIA 4AB7A 1J4JA 2PVVA 3B2YA 2OH1A 3KI9A 5EMIA 3VH9A 1V0CA 5J1QA 2PE3A 3KHXA 4CYQA 2CTBA 2NMTA 2BEIA 3E0KA 1Y7RA 4ZYQA 4FAIA 3F0AA 2WPXA 4I49A 1JWQA 3BJ7A 5KTDA 1MJ9A 1BLLE 2OU2A 2EUIA 1HDQA 3IC1A 1IICA 1Y9WA 5J8FA 3VWEA 4MHNA 4UCMA 1A2ZA 1Z2LA 4P4EA 4MCSA 3CXQA 3CZXA 4NXYA 3KASA 3D2MA 1I21A 1XBUA 4UBRA 3D4UA 4JXQA 1TIQA 1R57A 2PCUA 5DWMA 3L2NA 2P6EA 4KOSA 2AFZA 1VHOA 4MJ8A 2CNMA 5DWNA 5G22A 1N71A 4C2XA 4EMEA 5LYFA 2VQYA 3DGVA 4JYWA 3GB0A 1ZO0A 3PB8X 4MFKA 1TKJA 4P10A 4C7HA 4UEFA 2WSAA 2B4BA 2R7HA 5E96A 2FS5A 4B13A 3JUWA 3MN8A 1CBXA 2FVGA 2CNTA 3HLPA 4B5PA 1YQEA 1LRZA 4OC5A 1IYLA 1S60A 2PJ8A 1YSJA 4M85A 3D7HA 3KR4A 4NEXA 4UIBA 3SJGA 5EC4A 1YW4A 2DXQA 3JRUA 3MRUA 1PCAA 5JQ4A 3DLJA 2PR8A 2EK8A 1YW6A 4XNHB 4CRZB 2V8VA 4P4IA 3B35A 3S9NA 4KVOE 4P4DA 4UF4A 3IWWA 4F9VA 2BOAA 3H8FA 4EFDA 1KWMA 1IB1E 1OZPA 4M6IA 4DUKA 3F8KA 4W9YA 1Z8LA 2V8GA 4B14A 2CF4A 2OR4A 4KOVA 3R96A 4P45A 3S6HA 1Y0RA 3S6GA 3JVNA 4A37A 2B3UA 4R76A 3PFEA 1ZG9A 1MJBA 4IHMA 4HPSA 2Q7BA 2GU2A 4F8ZA 5HVFA 2PJAA 4UFVA 3KR5A 4A95A 3EY5A 1QQ9A 4YRHA 2DEAA 2OB0A 2QJ8A 4OP4A 2RFHA 1YVKA 2HV2A 3KGQA 3B7IA 3LD2A 4RI1A 2IMOA 2YNCC 3P2FA 4NCZA 1IOIA 4A94A 2WZNA 2G0BA 1RO5A 4CGPA 4ZBGA 2B5GA 2JBKA 3SXNA 3DNSA 2I79A 3GUXA 3D68A 3VWDA 4A38A 3DR6A 2ATRA 3V38A 3WT4A 4II9A 1PU9A 1LANA 4LX9A 1LOKA 1XIXA 3D7DA 1ZLIA 4QUSA 3S9LA 4FBEA 1NSAA 3IU1A 1YREA 4MCRA 1Q2YA 2CIJA 3FBUA 4MBUA 1LFWA 1Z4EA 4YFJA 4KLVA 4X2TA 4L8AA 4B5PB 5IV0A 1XEBA 2F7VA 3CPXA 4IK2A 5LRJA 4CS0B 3CT9A 4F9UA 1VKCA 4P4BA 3FEDA 4PK2A 1DE4C 2BO9A 2ODFA 4JLYA 5LRKA 2VBQA 3T9YA 5JM6A 4C2YA 1XRYA 2ZW7A 4OAEA 4U5YA 1RTQA 1XF8A 1ZLHA 2QMLA 5G21A 1IY7A 2GANA 2GREA 2ZXVA 1BOBA 2HC9A 4KS9A 5AGEA 3H5ZA 4OLLA 3TOBA 3EFAA 3EC4A 3VATA 1YLOA 4FD5A 2XEIA 2PJ2A 3CXPA 3IU2A 5AG7A 4AG7A 2J8RA 4QVTA 2ABZA 3G3SA 4E0AA 4ZX8A 4PSXA 1M4LA 4R6TA 1JQGA 1YX0A 2IQ6A 5LYDA 3BLNA 4NGQA 3FJUA 3SJXA 2P6GA 4DJLA 5CPAA 2REEA 2Z10A 4UWIA 3TCVA 2Q0YA 3A9LA 1OBRA 1BAVA 2FCKA 2HQYA 3CPAA 2PIZA 4LQGA 5AG6A 4WJBA 3B3SA 4C68A 3FVLA 3PRTA 3GY9A 3G8WA 2PDOA 5K8OA 4E2AA 4NJQA 1VGYA 3H8GA 4R87A 1P0HA 3T90A 8CPAA 2B5GB 3WABA 3RYOA 1XOVA 4MRIA 5BWAB 1AYEA 4OC4A 1CG2A 3FIXA 4A2ZA 2XEGA 1GHEA 2PRQA 2Y0MA 3TE4A 1Z8WA 2PJ0A 3P2HA 4HNXB 4XPDB 4PXCA 5F46A 2J8MA 5FVJA 2EVNA 4GXHA 4ZY2A 2KCWA 4DYOA 2A4NA 2PJ1A 3LMSA 1BPMA 1ARLA 4UEZA 5A28A 5IB9A 4U9ZA 2DF5A 2OZHA 5LYLA 2V8DA 3OWCA 4H89A 4P44A 4R7MA 3TO6A 1EE3P 2AFXA 1X10A 1X12A 3IEHA 3S6FA 5LRGA 4XPLA 5AG5A 2C1CA 4B6ZA 1S5KA 4KOXA 2QVPA 3WC5A 2DPTA 1KZFA 4C7IA 3B3CA 2ZEFA 1K4JA 3D7FA 4HNYB 4TNUA 4KOYA 4YGOA 4AG9A 2PJ6A 1FT7A 4Y49C 5JH9A 5K8PA 1YVOA 2PR1A 2YNCA 5K8NA 3GLJA 1KUXA 1NMTA 2ZEOA 4UIAA 4GM5A 3ZJ0A 4EVYA 2FIAA 1S7FA 4NGTA 2Q51A 3B3WA 1VIXA 3PB6X 3DDDA 4F6AA 1YLEA 4JJXA 5LYIA 1Q7LA 1RXTA 4ZY1A 5IB0A 2PJ5A 1F2PA 3EXNA 4IAVA 4KOUA 4MFJA 2Z3NA 2BCOA 3IJ3A 3TFYA 4B11A 2GIVA 1IOFA 2R8VA 2ZEEA 1KUVA 3PP9A 5F49A 4KOWA 3KKWA 3N7ZA 4KVME 2OOTA 2OZUA 1PUAA 2O28A 3GIUA 4R3KA 5HVGA 1ELMP 2ZW4A 4ZY0A 1HDUA 3I3GA 3R95A 4PPZA 5CBMA 3BJ8A 5CNPA 4EWTA 5J8CA 2PJ9A 3BXMA 1R3NA 4OIWA 4UCNA 4Y49B 2Q4ZA 3SJFA 4AVBA 4AVAA 1AMPA 4CAEA 3SI1A 1CJWA 2ZEHA 4HNWB 4L89A 2FT0A 1ZG7A 2VL1A 2YNEA 4NGMA 5HH1A 3RNZA 2JEVA 1QSRA 2QYVA 2GLJA 4FD4A 3PGPA 4FD7A 4PK3A 3MGDA 4UCPA 4CAVA 3FYNA 4P4JA 3UY5A 4TWEA 1QSMA 4JXRA 3TT2A 1M4DA 3D67A 4GS4A 4MY3A 4Q7AA 5K8MA 1YMEA 2XEFA 2ANPA 3VARA 1B87A 3D3SA 2Q44A 4NFRA 3R9EA 2Q04A 1NE9A 1MK4A 4KUBA 2ZEGA 4MFPA 4A31A 2PRBA 5F48A 2G9DA 1Q2DA 2AFSA 4MHZA 2F8HA 4ZX9A 4CGLA 4CYOA 3FX6A 4OC2A 3SXOA 2DPSA 4A39A 2FXFA 5D8NA 4MI4A 1M4IA 3B3TA 1Y9KA 2ZOGA 4F0XA 3RO0A 2B4DA 2AFUA 1M4GA 3SHPA 4PXEA 1YGHA 3LODA 1IIDA 4CRYB 4YWYA 4B12A 3S6KA 4WWVA 2IL4A 1XFOA 1TXRA 3QAYA 4A30A 2ZOFA 1CX8A 2FL4A 2Z3OA 3F5BA 3NFZA 3NH8A 1Z8TA 5IX3A 3R9FA 4BINA 4KSFA 2O4HA 4NSQA 2ZENA 2Q4VA 3GKRA 4HKFA 4R57A 4DNCA 5A27A 2V77A 3KZWA 3PB7X 4RUHA 3PFOA 5F09A 4MHDA 2PQ8A 4BMHA 4JZ0A 2C27A 4UFWA 3NA6A 4CYPA 4O23A 2FSRA 4MY0A 4MFZA 5DS0A 3V8IA 2VXKA 2O53A 2Z0ZA 3K2KA 4J3GA 1QMUA 2NYQA 3IFEA 4UWJA 3K9UA 1U6MA 4Z65A 5C82A 4MFLA 3D7GA 1ZG8A 2RC4A 4FUUA 4PSWA 1ELLP 2B58A 1NSLA 3KL9A 4OADA 1CP6A 1L0CA 1VHEA 4CGMA 1Z8XA 2AFOA 2H5MA 2P0WA 3D66A 2Q4YA 3TTHA 2ZEDA 5HXDA 2GFQA 3C26A 2Z11A 2ZELA 4KLWA 1FNOA 2REFA 4BD9A 2Z3MA 2HB6A 2AJ6A 2YGWA 3LACA 3S9MA 4CAXA 3WC7A 3QNVA 4K30A 3FMCA 1BO4A 3EO4A 3H4QA 4R9MA 1M44A 2EO8A 2IJZA 1TF8A 4KSIA 1XE4A 1MJAA 2WYRA 1I12A 4YU9A 4ONWA 3NE7A 4H6ZA 3RBUA 1Z4RA 1S7NA 2VI7A 4ORFA 2JEWA 4UFXA 1XMTA 3PBEA 4E8OA 3FEEA 4KVXA 3BHXA 2Q43A 2ZEPA 1HEEA 2B4DB 4KUAA 5F47A 4OIDA 3FNCA 1TKHA 3SJEA 2QIRA 2PIYA 1F57A 2EBJA 2Q7SA 3K9TA 3PEIA 4OMEA 3D2PA 4XNHC 2J9AA 4KSAA 1B6BA 2WPWA 4NGNA 4B5OA 3RAMA 3PB9X 3V7ZA 2Z3KA 4ZGYB 4PXDA 4QBJA 2CXAA 1S7KA 2EK9A 5ELYA 4PQAA 4LQ6A 2CY2A 2HUZA 2AFMA 4X3RA 1IU8A 1CM0A 2EWBA 2XEJA 4Q38A 5KTAA 2PJ4A 2GE3A 5I4MA 4CGOA 3PBBA 3BI1A 3FECA 4U9YA 1YR0A 1FY7A 4FD6A 4NGPA 3PB4X 1Q2CA 4KZTA 4OC1A 2P6FA 2K5TA 4K3NA 4MHYA
chains in the Genus database with same CATH topology
4UA3A 4LUAA 1WK4A 4KORA 3B8GA 5HMNA 4F0YA 2BL1A 4CYNA 4BBHA 2ARHA 2PSWA 3PZJA 1QSTA 2WUUA 2X7BA 2D4OA 2Z3PA 3WR7A 1SQHA 3W91A 4RS2A 4M3SA 2VEZA 3FXTA 1S7LA 4C2ZA 2JDCA 2FE7A 5KTCA 4X5KA 1QSNA 5I0CA 4IF5A 3TO9A 2BSWA 4CGNA 2R98A 3I9SA 1YK3A 2JLMA 5G20A 3CXSA 4IUSA 4MFQA 4KOTA 4XPKA 1ON0A 1Z9UA 3FB3A 5H86A 3TO7A 1WWZA 2CNSA 3R1KA 2ZPAA 2R1IA 3JTKA 2G3TA 4R3LA 2FIWA 4PV6A 2JDDA 5ISVA 2J8NA 3R9GA 2AE6A 5AG4A 3QB8A 2ZW6A 2D4PA 1KUYA 3QAHA 3IWEA 2F5IA 3GYAA 3TOAA 2G3AA 4A32A 4CAWA 1VHSA 1QSOA 2VZYA 5EBVA 2QECA 5GCNA 4Q36A 3DSBA 2BUEA 2ZW5A 5C88A 4NF1A 5JPHA 2B3VA 1P4NA 3D8PA 3IGRA 4A33A 4QC6A 2PC1A 2I00A 4JD6A 4JWPA 1S3ZA 4QB9A 1M1DA 3DR8A 1UFHA 2OZGA 3IWGA 2VZZA 5H84A 4AVCA 2Z3LA 4XPDC 4CAFA 3W6SA 3W6XA 1IYKA 3FRMA 4ONUA 4B10A 2YNDA 3ZZIA 5G1ZA 4H6UA 1I1DA 4AB7A 1J4JA 2OH1A 1V0CA 4CYQA 2NMTA 2BEIA 3E0KA 1Y7RA 4I49A 3F0AA 2WPXA 3BJ7A 5KTDA 1MJ9A 2OU2A 2EUIA 1IICA 1Y9WA 5J8FA 3VWEA 4UCMA 3CXQA 4NXYA 3D2MA 1I21A 4UBRA 4JXQA 1TIQA 1R57A 5DWMA 5G22A 2P6EA 4KOSA 4MJ8A 5DWNA 4C2XA 2CNMA 1N71A 2VQYA 1ZO0A 4MFKA 4C7HA 2WSAA 2B4BA 2R7HA 5E96A 2FS5A 4B13A 3JUWA 2CNTA 4B5PA 1LRZA 1IYLA 1S60A 4M85A 4NEXA 5EC4A 2DXQA 5JQ4A 4XNHB 2PR8A 4CRZB 4KVOE 1IB1E 1OZPA 3F8KA 4B14A 3R96A 4KOVA 3S6HA 3S6GA 3JVNA 2B3UA 1MJBA 2Q7BA 4UFVA 4A95A 3EY5A 4YRHA 2OB0A 1YVKA 2HV2A 3LD2A 4RI1A 2YNCC 3P2FA 4NCZA 2G0BA 1RO5A 4CGPA 4ZBGA 2B5GA 3SXNA 3DNSA 2I79A 3VWDA 3DR6A 2ATRA 4II9A 1PU9A 4LX9A 1XIXA 4QUSA 3IU1A 1YREA 1Q2YA 3FBUA 4MBUA 1Z4EA 4YFJA 4KLVA 4L8AA 4B5PB 5IV0A 1XEBA 4CS0B 1VKCA 4PK2A 4JLYA 2VBQA 3T9YA 4C2YA 2ZW7A 4OAEA 4U5YA 1XF8A 2QMLA 5G21A 2GANA 2ZXVA 1BOBA 5AGEA 4KS9A 3H5ZA 4OLLA 3TOBA 3EFAA 3EC4A 4FD5A 3CXPA 3IU2A 5AG7A 4AG7A 2J8RA 4QVTA 4E0AA 3G3SA 4PSXA 1YX0A 3BLNA 2P6GA 2REEA 2Z10A 4UWIA 3TCVA 2Q0YA 3A9LA 2HQYA 2FCKA 5AG6A 4C68A 3GY9A 3G8WA 2PDOA 4E2AA 3T90A 4R87A 1P0HA 2B5GB 3RYOA 5BWAB 3FIXA 4A2ZA 1GHEA 3TE4A 2Y0MA 3P2HA 4HNXB 4XPDB 5F46A 2J8MA 5FVJA 2EVNA 2KCWA 2A4NA 5A28A 4U9ZA 2OZHA 3OWCA 4H89A 3TO6A 3S6FA 4XPLA 5AG5A 1S5KA 4KOXA 4C7IA 2DPTA 1KZFA 4HNYB 1K4JA 4KOYA 4YGOA 4AG9A 4Y49C 1YVOA 2PR1A 2YNCA 1KUXA 1NMTA 4EVYA 3ZJ0A 2FIAA 1S7FA 3DDDA 4F6AA 1YLEA 4JJXA 5IB0A 1RXTA 3EXNA 4KOUA 4MFJA 2Z3NA 3TFYA 4B11A 2GIVA 2R8VA 1KUVA 3PP9A 5F49A 4KOWA 3KKWA 3N7ZA 4KVME 2OZUA 1PUAA 2O28A 4R3KA 2ZW4A 3I3GA 3R95A 3BJ8A 5CNPA 5J8CA 4AVBA 4UCNA 4Y49B 4AVAA 4CAEA 1CJWA 4HNWB 4L89A 2FT0A 2YNEA 5HH1A 2JEVA 1QSRA 4FD4A 3PGPA 4FD7A 4PK3A 3MGDA 4UCPA 4CAVA 3FYNA 3UY5A 1QSMA 4JXRA 3TT2A 1M4DA 4GS4A 4MY3A 1B87A 3D3SA 2Q44A 3R9EA 2Q04A 1NE9A 1MK4A 4KUBA 4MFPA 4A31A 2PRBA 5F48A 1Q2DA 4CGLA 4CYOA 3SXOA 2DPSA 2FXFA 4MI4A 1M4IA 1Y9KA 4F0XA 2B4DA 3SHPA 1M4GA 1YGHA 3LODA 1IIDA 4CRYB 4B12A 3S6KA 2IL4A 4A30A 2FL4A 2Z3OA 3F5BA 5IX3A 3R9FA 4KSFA 4NSQA 2Q4VA 3GKRA 4HKFA 4R57A 4DNCA 5A27A 4MHDA 2PQ8A 4BMHA 2C27A 4UFWA 4CYPA 2FSRA 4MY0A 4MFZA 3V8IA 2VXKA 4J3GA 2Z0ZA 4UWJA 3K9UA 1U6MA 5C82A 4MFLA 2RC4A 4PSWA 2B58A 1NSLA 4OADA 1L0CA 4CGMA 2H5MA 2P0WA 2Q4YA 3TTHA 3C26A 2Z11A 4KLWA 2REFA 2Z3MA 2YGWA 2AJ6A 4CAXA 4K30A 1BO4A 3EO4A 3H4QA 4R9MA 1M44A 1XE4A 1MJAA 1I12A 3NE7A 4H6ZA 1Z4RA 1S7NA 2VI7A 4ORFA 4UFXA 1XMTA 4E8OA 4KVXA 5F47A 2B4DB 4KUAA 3FNCA 2QIRA 3D2PA 4XNHC 4KSAA 1B6BA 2WPWA 4B5OA 4ZGYB 2Z3KA 4QBJA 2CXAA 1S7KA 2CY2A 2HUZA 1CM0A 4Q38A 5KTAA 2GE3A 4CGOA 4U9YA 4FD6A 1YR0A 1FY7A 1Q2CA 4KZTA 2P6FA 2K5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AG4 A;  5AGE A;  3H5Z A;  4CYN A;  4B11 A;  4BBH A;  4CGM A;  5AG5 A;  3IWE A;  4C7I A;  4UFV A;  4A30 A;  4A95 A;  4UCM A;  2WUU A;  3IU1 A;  3IU2 A;  4A32 A;  4A2Z A;  5AG7 A;  4A31 A;  5A27 A;  4CAF A;  2YNC A;  4CGL A;  4CYO A;  4UFW A;  3JTK A;  4CYP A;  4UCN A;  4B10 A;  2YND A;  5G1Z A;  4CAE A;  2YNC C;  4C2Z A;  4C68 A;  5G22 A;  4C2X A;  4CGO A;  4CGP A;  2YNE A;  4B12 A;  4A33 A;  4C2Y A;  5A28 A;  4CGN A;  4CYQ A;  5AG6 A;  4B14 A;  4UCP A;  4C7H A;  4UFX A;  2WSA A;  5G21 A;  5G20 A;  4B13 A; 
#chains in the Genus database with same CATH topology
 1LAM A;  2CTC A;  2C6G A;  3KQX A;  4LUA A;  4UA3 A;  1WK4 A;  4KOR A;  3B8G A;  5HMN A;  4F0Y A;  2BL1 A;  4CYN A;  4BBH A;  2GLF A;  2ARH A;  2V8H A;  2PSW A;  3PZJ A;  2JBJ A;  4P4F A;  2RB7 A;  1QST A;  2WUU A;  2X7B A;  1PYT B;  1GYT A;  2D4O A;  2Z3P A;  3WR7 A;  1SQH A;  1XJO A;  1Y7E A;  3W91 A;  4RS2 A;  4ZI6 A;  4M3S A;  7CPA A;  2VEZ A;  3FXT A;  4MCQ A;  1S7L A;  4C2Z A;  2JDC A;  2FE7 A;  3LWU A;  2AFW A;  4AXV A;  1H8L A;  5KTC A;  5D29 A;  4R8F A;  4X5K A;  3RZA A;  1QSN A;  5I0C A;  4IF5 A;  3WC6 A;  3TO9 A;  2BSW A;  4CGN A;  2R98 A;  3I9S A;  1YK3 A;  2JLM A;  5G20 A;  3CXS A;  3CDX A;  3IIB A;  4IUS A;  4MFQ A;  4KOT A;  4XPK A;  1ON0 A;  1TKF A;  1CP7 A;  4MXU A;  1Z9U A;  3NE8 A;  3FB3 A;  5H86 A;  3NH4 A;  4PXB A;  3TO7 A;  1WWZ A;  4MMO A;  2CNS A;  4NGS A;  3R1K A;  4P6Y A;  1BPN A;  2ZPA A;  2R1I A;  3B3V A;  3JTK A;  2G3T A;  3ISX A;  4CPA A;  4M6G A;  4R3L A;  3HUV A;  2FIW A;  4PV6 A;  2I3C A;  1CPS A;  4FWU A;  6CPA A;  2JDD A;  3T8W A;  2PVW A;  3FH4 A;  1R43 A;  4NGR A;  5ISV A;  2J8N A;  3R9G A;  2AE6 A;  5AG4 A;  1F2O A;  3QB8 A;  2ZW6 A;  2D4P A;  1KUY A;  3QAH A;  3H8E A;  4MCP A;  3IWE A;  2F5I A;  2PJ3 A;  1AUG A;  1LAP A;  3GYA A;  3TOA A;  4OC3 A;  1ARM A;  2G3A A;  2PJC A;  4A32 A;  4CAW A;  1VHS A;  1QSO A;  4G1P A;  2VZY A;  2POK A;  3SI2 A;  5EBV A;  2QEC A;  5GCN A;  3I1U A;  4Q36 A;  3DSB A;  2BUE A;  2PJ7 A;  2ZW5 A;  5C88 A;  4NF1 A;  1UWY A;  5JPH A;  2B3V A;  1DTD A;  1P4N A;  1Y0Y A;  3D8P A;  4MHP A;  5HVH A;  3KHZ A;  1CPX A;  4OKO A;  3ISZ A;  4X8I A;  3IGR A;  4A33 A;  4QC6 A;  2C6C A;  2PC1 A;  2I00 A;  1LCP A;  4JD6 A;  2ZEM A;  1S3Z A;  4JWP A;  1M1D A;  4OC0 A;  4QB9 A;  2PJB A;  1TF9 A;  3DR8 A;  4RN7 A;  1UFH A;  2OZG A;  3IWG A;  2VZZ A;  3NH5 A;  5JGF A;  5THW A;  5H84 A;  4AVC A;  2Z3L A;  1XMB A;  4H2K A;  3IO1 A;  3FF3 A;  4UEE A;  3TC8 A;  2C6P A;  4XPD C;  4CAF A;  3W6S A;  3BI0 A;  3W6X A;  4NJR A;  2NSM A;  1IYK A;  3N5F A;  1Z5R A;  3TX8 A;  3FRM A;  4ONU A;  4B10 A;  2YND A;  1IGB A;  5G1Z A;  4M6H A;  4H6U A;  1I1D A;  3KQZ A;  3SI0 A;  3ZZI A;  4AB7 A;  1J4J A;  2PVV A;  3B2Y A;  2OH1 A;  3KI9 A;  5EMI A;  3VH9 A;  1V0C A;  5J1Q A;  2PE3 A;  3KHX A;  4CYQ A;  2CTB A;  2NMT A;  2BEI A;  3E0K A;  1Y7R A;  4ZYQ A;  4FAI A;  3F0A A;  2WPX A;  4I49 A;  1JWQ A;  3BJ7 A;  5KTD A;  1MJ9 A;  1BLL E;  2OU2 A;  2EUI A;  1HDQ A;  3IC1 A;  1IIC A;  1Y9W A;  5J8F A;  3VWE A;  4MHN A;  4UCM A;  1A2Z A;  1Z2L A;  4P4E A;  4MCS A;  3CXQ A;  3CZX A;  4NXY A;  3KAS A;  3D2M A;  1I21 A;  1XBU A;  4UBR A;  3D4U A;  4JXQ A;  1TIQ A;  1R57 A;  2PCU A;  5DWM A;  3L2N A;  2P6E A;  4KOS A;  2AFZ A;  1VHO A;  4MJ8 A;  2CNM A;  5DWN A;  5G22 A;  1N71 A;  4C2X A;  4EME A;  5LYF A;  2VQY A;  3DGV A;  4JYW A;  3GB0 A;  1ZO0 A;  3PB8 X;  4MFK A;  1TKJ A;  4P10 A;  4C7H A;  4UEF A;  2WSA A;  2B4B A;  2R7H A;  5E96 A;  2FS5 A;  4B13 A;  3JUW A;  3MN8 A;  1CBX A;  2FVG A;  2CNT A;  3HLP A;  4B5P A;  1YQE A;  1LRZ A;  4OC5 A;  1IYL A;  1S60 A;  2PJ8 A;  1YSJ A;  4M85 A;  3D7H A;  3KR4 A;  4NEX A;  4UIB A;  3SJG A;  5EC4 A;  1YW4 A;  2DXQ A;  3JRU A;  3MRU A;  1PCA A;  5JQ4 A;  3DLJ A;  2PR8 A;  2EK8 A;  1YW6 A;  4XNH B;  4CRZ B;  2V8V A;  4P4I A;  3B35 A;  3S9N A;  4KVO E;  4P4D A;  4UF4 A;  3IWW A;  4F9V A;  2BOA A;  3H8F A;  4EFD A;  1KWM A;  1IB1 E;  1OZP A;  4M6I A;  4DUK A;  3F8K A;  4W9Y A;  1Z8L A;  2V8G A;  4B14 A;  2CF4 A;  2OR4 A;  4KOV A;  3R96 A;  4P45 A;  3S6H A;  1Y0R A;  3S6G A;  3JVN A;  4A37 A;  2B3U A;  4R76 A;  3PFE A;  1ZG9 A;  1MJB A;  4IHM A;  4HPS A;  2Q7B A;  2GU2 A;  4F8Z A;  5HVF A;  2PJA A;  4UFV A;  3KR5 A;  4A95 A;  3EY5 A;  1QQ9 A;  4YRH A;  2DEA A;  2OB0 A;  2QJ8 A;  4OP4 A;  2RFH A;  1YVK A;  2HV2 A;  3KGQ A;  3B7I A;  3LD2 A;  4RI1 A;  2IMO A;  2YNC C;  3P2F A;  4NCZ A;  1IOI A;  4A94 A;  2WZN A;  2G0B A;  1RO5 A;  4CGP A;  4ZBG A;  2B5G A;  2JBK A;  3SXN A;  3DNS A;  2I79 A;  3GUX A;  3D68 A;  3VWD A;  4A38 A;  3DR6 A;  2ATR A;  3V38 A;  3WT4 A;  4II9 A;  1PU9 A;  1LAN A;  4LX9 A;  1LOK A;  1XIX A;  3D7D A;  1ZLI A;  4QUS A;  3S9L A;  4FBE A;  1NSA A;  3IU1 A;  1YRE A;  4MCR A;  1Q2Y A;  2CIJ A;  3FBU A;  4MBU A;  1LFW A;  1Z4E A;  4YFJ A;  4KLV A;  4X2T A;  4L8A A;  4B5P B;  5IV0 A;  1XEB A;  2F7V A;  3CPX A;  4IK2 A;  5LRJ A;  4CS0 B;  3CT9 A;  4F9U A;  1VKC A;  4P4B A;  3FED A;  4PK2 A;  1DE4 C;  2BO9 A;  2ODF A;  4JLY A;  5LRK A;  2VBQ A;  3T9Y A;  5JM6 A;  4C2Y A;  1XRY A;  2ZW7 A;  4OAE A;  4U5Y A;  1RTQ A;  1XF8 A;  1ZLH A;  2QML A;  5G21 A;  1IY7 A;  2GAN A;  2GRE A;  2ZXV A;  1BOB A;  2HC9 A;  4KS9 A;  5AGE A;  3H5Z A;  4OLL A;  3TOB A;  3EFA A;  3EC4 A;  3VAT A;  1YLO A;  4FD5 A;  2XEI A;  2PJ2 A;  3CXP A;  3IU2 A;  5AG7 A;  4AG7 A;  2J8R A;  4QVT A;  2ABZ A;  3G3S A;  4E0A A;  4ZX8 A;  4PSX A;  1M4L A;  4R6T A;  1JQG A;  1YX0 A;  2IQ6 A;  5LYD A;  3BLN A;  4NGQ A;  3FJU A;  3SJX A;  2P6G A;  4DJL A;  5CPA A;  2REE A;  2Z10 A;  4UWI A;  3TCV A;  2Q0Y A;  3A9L A;  1OBR A;  1BAV A;  2FCK A;  2HQY A;  3CPA A;  2PIZ A;  4LQG A;  5AG6 A;  4WJB A;  3B3S A;  4C68 A;  3FVL A;  3PRT A;  3GY9 A;  3G8W A;  2PDO A;  5K8O A;  4E2A A;  4NJQ A;  1VGY A;  3H8G A;  4R87 A;  1P0H A;  3T90 A;  8CPA A;  2B5G B;  3WAB A;  3RYO A;  1XOV A;  4MRI A;  5BWA B;  1AYE A;  4OC4 A;  1CG2 A;  3FIX A;  4A2Z A;  2XEG A;  1GHE A;  2PRQ A;  2Y0M A;  3TE4 A;  1Z8W A;  2PJ0 A;  3P2H A;  4HNX B;  4XPD B;  4PXC A;  5F46 A;  2J8M A;  5FVJ A;  2EVN A;  4GXH A;  4ZY2 A;  2KCW A;  4DYO A;  2A4N A;  2PJ1 A;  3LMS A;  1BPM A;  1ARL A;  4UEZ A;  5A28 A;  5IB9 A;  4U9Z A;  2DF5 A;  2OZH A;  5LYL A;  2V8D A;  3OWC A;  4H89 A;  4P44 A;  4R7M A;  3TO6 A;  1EE3 P;  2AFX A;  1X10 A;  1X12 A;  3IEH A;  3S6F A;  5LRG A;  4XPL A;  5AG5 A;  2C1C A;  4B6Z A;  1S5K A;  4KOX A;  2QVP A;  3WC5 A;  2DPT A;  1KZF A;  4C7I A;  3B3C A;  2ZEF A;  1K4J A;  3D7F A;  4HNY B;  4TNU A;  4KOY A;  4YGO A;  4AG9 A;  2PJ6 A;  1FT7 A;  4Y49 C;  5JH9 A;  5K8P A;  1YVO A;  2PR1 A;  2YNC A;  5K8N A;  3GLJ A;  1KUX A;  1NMT A;  2ZEO A;  4UIA A;  4GM5 A;  3ZJ0 A;  4EVY A;  2FIA A;  1S7F A;  4NGT A;  2Q51 A;  3B3W A;  1VIX A;  3PB6 X;  3DDD A;  4F6A A;  1YLE A;  4JJX A;  5LYI A;  1Q7L A;  1RXT A;  4ZY1 A;  5IB0 A;  2PJ5 A;  1F2P A;  3EXN A;  4IAV A;  4KOU A;  4MFJ A;  2Z3N A;  2BCO A;  3IJ3 A;  3TFY A;  4B11 A;  2GIV A;  1IOF A;  2R8V A;  2ZEE A;  1KUV A;  3PP9 A;  5F49 A;  4KOW A;  3KKW A;  3N7Z A;  4KVM E;  2OOT A;  2OZU A;  1PUA A;  2O28 A;  3GIU A;  4R3K A;  5HVG A;  1ELM P;  2ZW4 A;  4ZY0 A;  1HDU A;  3I3G A;  3R95 A;  4PPZ A;  5CBM A;  3BJ8 A;  5CNP A;  4EWT A;  5J8C A;  2PJ9 A;  3BXM A;  1R3N A;  4OIW A;  4UCN A;  4Y49 B;  2Q4Z A;  3SJF A;  4AVB A;  4AVA A;  1AMP A;  4CAE A;  3SI1 A;  1CJW A;  2ZEH A;  4HNW B;  4L89 A;  2FT0 A;  1ZG7 A;  2VL1 A;  2YNE A;  4NGM A;  5HH1 A;  3RNZ A;  2JEV A;  1QSR A;  2QYV A;  2GLJ A;  4FD4 A;  3PGP A;  4FD7 A;  4PK3 A;  3MGD A;  4UCP A;  4CAV A;  3FYN A;  4P4J A;  3UY5 A;  4TWE A;  1QSM A;  4JXR A;  3TT2 A;  1M4D A;  3D67 A;  4GS4 A;  4MY3 A;  4Q7A A;  5K8M A;  1YME A;  2XEF A;  2ANP A;  3VAR A;  1B87 A;  3D3S A;  2Q44 A;  4NFR A;  3R9E A;  2Q04 A;  1NE9 A;  1MK4 A;  4KUB A;  2ZEG A;  4MFP A;  4A31 A;  2PRB A;  5F48 A;  2G9D A;  1Q2D A;  2AFS A;  4MHZ A;  2F8H A;  4ZX9 A;  4CGL A;  4CYO A;  3FX6 A;  4OC2 A;  3SXO A;  2DPS A;  4A39 A;  2FXF A;  5D8N A;  4MI4 A;  1M4I A;  3B3T A;  1Y9K A;  2ZOG A;  4F0X A;  3RO0 A;  2B4D A;  2AFU A;  1M4G A;  3SHP A;  4PXE A;  1YGH A;  3LOD A;  1IID A;  4CRY B;  4YWY A;  4B12 A;  3S6K A;  4WWV A;  2IL4 A;  1XFO A;  1TXR A;  3QAY A;  4A30 A;  2ZOF A;  1CX8 A;  2FL4 A;  2Z3O A;  3F5B A;  3NFZ A;  3NH8 A;  1Z8T A;  5IX3 A;  3R9F A;  4BIN A;  4KSF A;  2O4H A;  4NSQ A;  2ZEN A;  2Q4V A;  3GKR A;  4HKF A;  4R57 A;  4DNC A;  5A27 A;  2V77 A;  3KZW A;  3PB7 X;  4RUH A;  3PFO A;  5F09 A;  4MHD A;  2PQ8 A;  4BMH A;  4JZ0 A;  2C27 A;  4UFW A;  3NA6 A;  4CYP A;  4O23 A;  2FSR A;  4MY0 A;  4MFZ A;  5DS0 A;  3V8I A;  2VXK A;  2O53 A;  2Z0Z A;  3K2K A;  4J3G A;  1QMU A;  2NYQ A;  3IFE A;  4UWJ A;  3K9U A;  1U6M A;  4Z65 A;  5C82 A;  4MFL A;  3D7G A;  1ZG8 A;  2RC4 A;  4FUU A;  4PSW A;  1ELL P;  2B58 A;  1NSL A;  3KL9 A;  4OAD A;  1CP6 A;  1L0C A;  1VHE A;  4CGM A;  1Z8X A;  2AFO A;  2H5M A;  2P0W A;  3D66 A;  2Q4Y A;  3TTH A;  2ZED A;  5HXD A;  2GFQ A;  3C26 A;  2Z11 A;  2ZEL A;  4KLW A;  1FNO A;  2REF A;  4BD9 A;  2Z3M A;  2HB6 A;  2AJ6 A;  2YGW A;  3LAC A;  3S9M A;  4CAX A;  3WC7 A;  3QNV A;  4K30 A;  3FMC A;  1BO4 A;  3EO4 A;  3H4Q A;  4R9M A;  1M44 A;  2EO8 A;  2IJZ A;  1TF8 A;  4KSI A;  1XE4 A;  1MJA A;  2WYR A;  1I12 A;  4YU9 A;  4ONW A;  3NE7 A;  4H6Z A;  3RBU A;  1Z4R A;  1S7N A;  2VI7 A;  4ORF A;  2JEW A;  4UFX A;  1XMT A;  3PBE A;  4E8O A;  3FEE A;  4KVX A;  3BHX A;  2Q43 A;  2ZEP A;  1HEE A;  2B4D B;  4KUA A;  5F47 A;  4OID A;  3FNC A;  1TKH A;  3SJE A;  2QIR A;  2PIY A;  1F57 A;  2EBJ A;  2Q7S A;  3K9T A;  3PEI A;  4OME A;  3D2P A;  4XNH C;  2J9A A;  4KSA A;  1B6B A;  2WPW A;  4NGN A;  4B5O A;  3RAM A;  3PB9 X;  3V7Z A;  2Z3K A;  4ZGY B;  4PXD A;  4QBJ A;  2CXA A;  1S7K A;  2EK9 A;  5ELY A;  4PQA A;  4LQ6 A;  2CY2 A;  2HUZ A;  2AFM A;  4X3R A;  1IU8 A;  1CM0 A;  2EWB A;  2XEJ A;  4Q38 A;  5KTA A;  2PJ4 A;  2GE3 A;  5I4M A;  4CGO A;  3PBB A;  3BI1 A;  3FEC A;  4U9Y A;  1YR0 A;  1FY7 A;  4FD6 A;  4NGP A;  3PB4 X;  1Q2C A;  4KZT A;  4OC1 A;  2P6F A;  2K5T A;  4K3N A;  4MHY A; 
#chains in the Genus database with same CATH homology
 4UA3 A;  4LUA A;  1WK4 A;  4KOR A;  3B8G A;  5HMN A;  4F0Y A;  2BL1 A;  4CYN A;  4BBH A;  2ARH A;  2PSW A;  3PZJ A;  1QST A;  2WUU A;  2X7B A;  2D4O A;  2Z3P A;  3WR7 A;  1SQH A;  3W91 A;  4RS2 A;  4M3S A;  2VEZ A;  3FXT A;  1S7L A;  4C2Z A;  2JDC A;  2FE7 A;  5KTC A;  4X5K A;  1QSN A;  5I0C A;  4IF5 A;  3TO9 A;  2BSW A;  4CGN A;  2R98 A;  3I9S A;  1YK3 A;  2JLM A;  5G20 A;  3CXS A;  4IUS A;  4MFQ A;  4KOT A;  4XPK A;  1ON0 A;  1Z9U A;  3FB3 A;  5H86 A;  3TO7 A;  1WWZ A;  2CNS A;  3R1K A;  2ZPA A;  2R1I A;  3JTK A;  2G3T A;  4R3L A;  2FIW A;  4PV6 A;  2JDD A;  5ISV A;  2J8N A;  3R9G A;  2AE6 A;  5AG4 A;  3QB8 A;  2ZW6 A;  2D4P A;  1KUY A;  3QAH A;  3IWE A;  2F5I A;  3GYA A;  3TOA A;  2G3A A;  4A32 A;  4CAW A;  1VHS A;  1QSO A;  2VZY A;  5EBV A;  2QEC A;  5GCN A;  4Q36 A;  3DSB A;  2BUE A;  2ZW5 A;  5C88 A;  4NF1 A;  5JPH A;  2B3V A;  1P4N A;  3D8P A;  3IGR A;  4A33 A;  4QC6 A;  2PC1 A;  2I00 A;  4JD6 A;  4JWP A;  1S3Z A;  4QB9 A;  1M1D A;  3DR8 A;  1UFH A;  2OZG A;  3IWG A;  2VZZ A;  5H84 A;  4AVC A;  2Z3L A;  4XPD C;  4CAF A;  3W6S A;  3W6X A;  1IYK A;  3FRM A;  4ONU A;  4B10 A;  2YND A;  3ZZI A;  5G1Z A;  4H6U A;  1I1D A;  4AB7 A;  1J4J A;  2OH1 A;  1V0C A;  4CYQ A;  2NMT A;  2BEI A;  3E0K A;  1Y7R A;  4I49 A;  3F0A A;  2WPX A;  3BJ7 A;  5KTD A;  1MJ9 A;  2OU2 A;  2EUI A;  1IIC A;  1Y9W A;  5J8F A;  3VWE A;  4UCM A;  3CXQ A;  4NXY A;  3D2M A;  1I21 A;  4UBR A;  4JXQ A;  1TIQ A;  1R57 A;  5DWM A;  5G22 A;  2P6E A;  4KOS A;  4MJ8 A;  5DWN A;  4C2X A;  2CNM A;  1N71 A;  2VQY A;  1ZO0 A;  4MFK A;  4C7H A;  2WSA A;  2B4B A;  2R7H A;  5E96 A;  2FS5 A;  4B13 A;  3JUW A;  2CNT A;  4B5P A;  1LRZ A;  1IYL A;  1S60 A;  4M85 A;  4NEX A;  5EC4 A;  2DXQ A;  5JQ4 A;  4XNH B;  2PR8 A;  4CRZ B;  4KVO E;  1IB1 E;  1OZP A;  3F8K A;  4B14 A;  3R96 A;  4KOV A;  3S6H A;  3S6G A;  3JVN A;  2B3U A;  1MJB A;  2Q7B A;  4UFV A;  4A95 A;  3EY5 A;  4YRH A;  2OB0 A;  1YVK A;  2HV2 A;  3LD2 A;  4RI1 A;  2YNC C;  3P2F A;  4NCZ A;  2G0B A;  1RO5 A;  4CGP A;  4ZBG A;  2B5G A;  3SXN A;  3DNS A;  2I79 A;  3VWD A;  3DR6 A;  2ATR A;  4II9 A;  1PU9 A;  4LX9 A;  1XIX A;  4QUS A;  3IU1 A;  1YRE A;  1Q2Y A;  3FBU A;  4MBU A;  1Z4E A;  4YFJ A;  4KLV A;  4L8A A;  4B5P B;  5IV0 A;  1XEB A;  4CS0 B;  1VKC A;  4PK2 A;  4JLY A;  2VBQ A;  3T9Y A;  4C2Y A;  2ZW7 A;  4OAE A;  4U5Y A;  1XF8 A;  2QML A;  5G21 A;  2GAN A;  2ZXV A;  1BOB A;  5AGE A;  4KS9 A;  3H5Z A;  4OLL A;  3TOB A;  3EFA A;  3EC4 A;  4FD5 A;  3CXP A;  3IU2 A;  5AG7 A;  4AG7 A;  2J8R A;  4QVT A;  4E0A A;  3G3S A;  4PSX A;  1YX0 A;  3BLN A;  2P6G A;  2REE A;  2Z10 A;  4UWI A;  3TCV A;  2Q0Y A;  3A9L A;  2HQY A;  2FCK A;  5AG6 A;  4C68 A;  3GY9 A;  3G8W A;  2PDO A;  4E2A A;  3T90 A;  4R87 A;  1P0H A;  2B5G B;  3RYO A;  5BWA B;  3FIX A;  4A2Z A;  1GHE A;  3TE4 A;  2Y0M A;  3P2H A;  4HNX B;  4XPD B;  5F46 A;  2J8M A;  5FVJ A;  2EVN A;  2KCW A;  2A4N A;  5A28 A;  4U9Z A;  2OZH A;  3OWC A;  4H89 A;  3TO6 A;  3S6F A;  4XPL A;  5AG5 A;  1S5K A;  4KOX A;  4C7I A;  2DPT A;  1KZF A;  4HNY B;  1K4J A;  4KOY A;  4YGO A;  4AG9 A;  4Y49 C;  1YVO A;  2PR1 A;  2YNC A;  1KUX A;  1NMT A;  4EVY A;  3ZJ0 A;  2FIA A;  1S7F A;  3DDD A;  4F6A A;  1YLE A;  4JJX A;  5IB0 A;  1RXT A;  3EXN A;  4KOU A;  4MFJ A;  2Z3N A;  3TFY A;  4B11 A;  2GIV A;  2R8V A;  1KUV A;  3PP9 A;  5F49 A;  4KOW A;  3KKW A;  3N7Z A;  4KVM E;  2OZU A;  1PUA A;  2O28 A;  4R3K A;  2ZW4 A;  3I3G A;  3R95 A;  3BJ8 A;  5CNP A;  5J8C A;  4AVB A;  4UCN A;  4Y49 B;  4AVA A;  4CAE A;  1CJW A;  4HNW B;  4L89 A;  2FT0 A;  2YNE A;  5HH1 A;  2JEV A;  1QSR A;  4FD4 A;  3PGP A;  4FD7 A;  4PK3 A;  3MGD A;  4UCP A;  4CAV A;  3FYN A;  3UY5 A;  1QSM A;  4JXR A;  3TT2 A;  1M4D A;  4GS4 A;  4MY3 A;  1B87 A;  3D3S A;  2Q44 A;  3R9E A;  2Q04 A;  1NE9 A;  1MK4 A;  4KUB A;  4MFP A;  4A31 A;  2PRB A;  5F48 A;  1Q2D A;  4CGL A;  4CYO A;  3SXO A;  2DPS A;  2FXF A;  4MI4 A;  1M4I A;  1Y9K A;  4F0X A;  2B4D A;  3SHP A;  1M4G A;  1YGH A;  3LOD A;  1IID A;  4CRY B;  4B12 A;  3S6K A;  2IL4 A;  4A30 A;  2FL4 A;  2Z3O A;  3F5B A;  5IX3 A;  3R9F A;  4KSF A;  4NSQ A;  2Q4V A;  3GKR A;  4HKF A;  4R57 A;  4DNC A;  5A27 A;  4MHD A;  2PQ8 A;  4BMH A;  2C27 A;  4UFW A;  4CYP A;  2FSR A;  4MY0 A;  4MFZ A;  3V8I A;  2VXK A;  4J3G A;  2Z0Z A;  4UWJ A;  3K9U A;  1U6M A;  5C82 A;  4MFL A;  2RC4 A;  4PSW A;  2B58 A;  1NSL A;  4OAD A;  1L0C A;  4CGM A;  2H5M A;  2P0W A;  2Q4Y A;  3TTH A;  3C26 A;  2Z11 A;  4KLW A;  2REF A;  2Z3M A;  2YGW A;  2AJ6 A;  4CAX A;  4K30 A;  1BO4 A;  3EO4 A;  3H4Q A;  4R9M A;  1M44 A;  1XE4 A;  1MJA A;  1I12 A;  3NE7 A;  4H6Z A;  1Z4R A;  1S7N A;  2VI7 A;  4ORF A;  4UFX A;  1XMT A;  4E8O A;  4KVX A;  5F47 A;  2B4D B;  4KUA A;  3FNC A;  2QIR A;  3D2P A;  4XNH C;  4KSA A;  1B6B A;  2WPW A;  4B5O A;  4ZGY B;  2Z3K A;  4QBJ A;  2CXA A;  1S7K A;  2CY2 A;  2HUZ A;  1CM0 A;  4Q38 A;  5KTA A;  2GE3 A;  4CGO A;  4U9Y A;  4FD6 A;  1YR0 A;  1FY7 A;  1Q2C A;  4KZT A;  2P6F A;  2K5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...