5A28A

Leishmania major n-myristoyltransferase in complex with a chlorophenyl 1,3,4-oxadiazole inhibitor.
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of High Affinity Inhibitors of Leishmania Donovani N-Myristoyltransferase.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 123
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5a28A00
4UFXA 4C2YA 3IU2A 4CYPA 5A28A 4UFWA 4CYQA 5AG7A 2WUUA 4B13A 3IU1A 5G22A 4CYNA 4C7HA 4A32A 4C7IA 4CGOA 2YNEA 3JTKA 5AG6A 2YNCC 4UFVA 4UCNA 4B14A 4UCPA 4A2ZA 4A30A 4CAEA 5AGEA 5G21A 2YNCA 4A95A 4CYOA 5A27A 4C2ZA 2WSAA 4CGPA 4UCMA 3H5ZA 4CGNA 4BBHA 4C68A 5AG5A 4B12A 4C2XA 5G20A 4CAFA 4A31A 5AG4A 2YNDA 5G1ZA 4CGMA 4A33A 3IWEA 4B10A 4CGLA 4B11A
chains in the Genus database with same CATH superfamily
4QUSA 5JQ4A 5J1QA 5C82A 1S60A 3S6GA 2FIWA 3GY9A 4MCPA 1N71A 4HNXB 4F0XA 3PZJA 2JEWA 2QVPA 4KOUA 1KWMA 4CYNA 1M1DA 4Y49C 3N5FA 3D67A 2Z3MA 4NGMA 2QJ8A 1A2ZA 2C6CA 3D7GA 1F2OA 4KUBA 3I3GA 4UFVA 5DWMA 5LYFA 4CYOA 4DYOA 4J3GA 4H89A 2A4NA 3B3VA 1Y9KA 4A37A 3D66A 2VXKA 5D29A 1HEEA 2V8VA 4A31A 3NFZA 4QVTA 4MY3A 1QQ9A 3D7DA 4ZBGA 2X7BA 4F0YA 4UWIA 3DNSA 2Z11A 3D8PA 4L89A 3R1KA 1VHSA 3KHXA 3KKWA 3OWCA 5H84A 2Y0MA 3KQXA 4FD4A 4UIAA 3V8IA 2BOAA 2CIJA 2BSWA 4R9MA 4U9ZA 3RZAA 1K4JA 2BCOA 2FSRA 2JBKA 2PJ8A 5IV0A 3F5BA 4B5PA 4AG9A 2ZENA 2R7HA 3KR4A 2WYRA 2AFOA 1S7FA 1QMUA 1PU9A 1RO5A 2ZOFA 4A2ZA 2P0WA 4BD9A 5AGEA 5G21A 3R95A 4MCSA 4NJRA 4ZX8A 4AVBA 2F8HA 4MHZA 1JWQA 5AG4A 2ODFA 1Q2YA 4TNUA 3EY5A 3QNVA 1TIQA 1XMTA 4K30A 4MXUA 2F7VA 1IY7A 3JRUA 5BWAB 3LMSA 2D4OA 3S6FA 5IX3A 2F5IA 2G0BA 3LD2A 1TXRA 5A28A 5C88A 4C68A 2WUUA 2AJ6A 4JLYA 3T8WA 2GU2A 4CS0B 4NGSA 3BJ8A 1NSAA 3PB4X 4OADA 4BINA 3S9NA 1P0HA 1LOKA 2ABZA 4HNYB 4X2TA 2PJ1A 1XE4A 2RC4A 4KUAA 4WJBA 1MJBA 2JDCA 4MCQA 5LRJA 1LCPA 1I12A 1OZPA 1XEBA 3TX8A 4C2ZA 2PSWA 3R96A 2PJ5A 2EUIA 4MBUA 4MFPA 4CRYB 3LACA 2B5GA 1AUGA 1IOFA 3BHXA 4NCZA 3IGRA 4LQ6A 5KTDA 3DSBA 5I4MA 5ELYA 1NE9A 2ARHA 4NFRA 3IO1A 4JYWA 5F09A 4MFQA 1VKCA 1KUVA 1WWZA 2ZXVA 2QMLA 3H8EA 3D2PA 3D7HA 3FJUA 1IIDA 3NH5A 4P4FA 3CXPA 4CYQA 2PJ4A 3BLNA 3PGPA 4HNWB 3TC8A 3TFYA 1YVKA 5KTAA 3FX6A 5G22A 2G3AA 4UWJA 4XPKA 2IMOA 2OU2A 2Q4ZA 4R87A 4R8FA 3DR6A 1VHEA 4P44A 3H8GA 4P4JA 4ZY2A 3SJXA 5AG6A 3FECA 4CAVA 2C1CA 2PIZA 4Q36A 4F8ZA 3SI2A 3EO4A 3T90A 3CDXA 3EC4A 4EFDA 2DEAA 3BJ7A 4B6ZA 1CP7A 1I1DA 3JVNA 2Q44A 4MFLA 4NGPA 3D68A 3HUVA 4FWUA 4X3RA 3FIXA 2ZEOA 4A33A 3H8FA 4ZY1A 5F46A 2VZYA 3KGQA 3GLJA 3KZWA 2GIVA 2FS5A 4QB9A 4OIDA 1YSJA 4B11A 1LANA 2PVVA 1YW6A 2AFMA 2OH1A 1Q7LA 4I49A 1XMBA 2Z3LA 3RO0A 4A32A 1Z4RA 2OZUA 2P6EA 3R9GA 5HVGA 4ZGYB 2PJ7A 4NJQA 3TO6A 2O28A 3FB3A 4LQGA 4NGRA 4PK3A 3S6KA 4AB7A 5IB0A 4KZTA 4UCPA 1M44A 2FXFA 4A95A 4NGNA 3PBBA 2GLJA 4Z65A 4A39A 1XOVA 3V7ZA 1TF8A 3F0AA 1ZG7A 3FNCA 2ZEMA 4JJXA 5G20A 2IQ6A 2YNDA 5G1ZA 2VZZA 1GHEA 2ZW7A 4R6TA 2XEFA 1X12A 2GANA 4QC6A 4ZX9A 4X5KA 2OZGA 1U6MA 3B3CA 2D4PA 4B13A 2FT0A 2ZEGA 2ZEFA 2H5MA 4AG7A 2PR1A 3PB7X 3TOAA 3B8GA 3ZJ0A 2NMTA 4ZY0A 1HDUA 2Q0YA 2CNMA 4KOTA 5DWNA 4CYPA 1XBUA 1B87A 4XPDC 1ZG8A 5F48A 2PCUA 1YGHA 5K8PA 2REEA 1AYEA 4DNCA 4FBEA 4FD7A 1UFHA 3H4QA 1M4GA 1ZG9A 4GXHA 1LAMA 1Q2CA 1PYTB 2V8HA 2REFA 4IK2A 1YLOA 4AVAA 2PR8A 2R8VA 5HXDA 4H6UA 1QSMA 5JM6A 3LWUA 1M4IA 3ISXA 4MMOA 3WC5A 1PCAA 4C7HA 3K9TA 1Z8LA 4OC5A 1YK3A 5LRGA 5JGFA 5GCNA 4MFZA 4F6AA 3UY5A 2QYVA 2ANPA 4ONUA 2K5TA 3CXQA 2Q7BA 2VQYA 3T9YA 1BAVA 2EBJA 2R98A 3RAMA 4UCMA 1DTDA 1R3NA 5THWA 3CZXA 2XEJA 8CPAA 1NMTA 2Z3PA 2CTCA 4JXRA 4F9UA 4NF1A 2WPXA 4P4BA 4OC2A 3IWEA 2HC9A 3TTHA 4O23A 4KVOE 2B3VA 2EVNA 3PEIA 4UIBA 4XPLA 1F57A 4FD6A 7CPAA 2PE3A 1VIXA 2PJBA 4NXYA 4UFWA 1BO4A 1Y9WA 3FBUA 2FIAA 5LYLA 4MI4A 4RI1A 2V77A 1IGBA 2FL4A 5CBMA 3P2HA 2BUEA 2WPWA 2EWBA 3GYAA 3QB8A 4A30A 3JUWA 3FYNA 3PB9X 3EFAA 3BI1A 5HMNA 2OOTA 4XPDB 3R9FA 2RB7A 3WC6A 3WR7A 4OC3A 4UBRA 3PFEA 3DR8A 2ZPAA 1CP6A 2B5GB 2JEVA 2R1IA 2QECA 5JPHA 1Y7EA 1BLLE 3KHZA 4CRZB 4EVYA 2YGWA 3ZZIA 2V8DA 2AE6A 4OMEA 4Y49B 4A38A 4DUKA 3FH4A 2BEIA 2GFQA 3IWWA 1XFOA 2B58A 4R3LA 2AFXA 1IYKA 3D7FA 3IU1A 3SJEA 1P4NA 4LUAA 1X10A 3PB8X 4XNHC 5CPAA 2C27A 1ZLHA 3PP9A 4PXEA 4R76A 4UA3A 2YNCC 2ATRA 3CPAA 3CPXA 4UCNA 2PVWA 4MJ8A 3L2NA 1CM0A 1MJ9A 4UEFA 2QIRA 4BBHA 2I3CA 2PJ6A 1S7LA 2ZEPA 2PJ9A 2JDDA 4HPSA 4W9YA 5HVFA 1Z5RA 3B3TA 4CAXA 5JH9A 3KL9A 2VBQA 4F9VA 1HDQA 4FUUA 4GS4A 5LYDA 3WC7A 3SXNA 2DPTA 1YW4A 3DLJA 1OBRA 2B4DB 1Y0YA 2G3TA 3FEEA 3KQZA 1MJAA 4PPZA 1XJOA 2Q4VA 5LYIA 1TKHA 2IL4A 2O4HA 3TE4A 1Z8WA 4HKFA 4KLVA 1ELMP 2I79A 3NH4A 3S9LA 2V8GA 3EXNA 2FE7A 2P6FA 2PJ0A 4IF5A 4OIWA 4CAEA 4H2KA 2CNSA 2HQYA 1NSLA 4TWEA 2B4BA 5CNPA 1GYTA 4DJLA 1ON0A 4PQAA 3SXOA 1FNOA 4RUHA 4NSQA 4OC0A 4CGLA 2AFWA 3RBUA 4KOVA 1XRYA 2PJCA 2PJAA 4MFJA 1MK4A 4C2YA 2PJ2A 4WWVA 2Z3NA 5AG7A 6CPAA 2ZEDA 3IJ3A 2ZELA 3KI9A 2NSMA 4JD6A 3WT4A 4OKOA 2ZOGA 4IHMA 3VH9A 4KOWA 1M4DA 5HVHA 3JTKA 4XNHB 2CY2A 3SHPA 3ISZA 4CPAA 1IOIA 4IAVA 4ZYQA 3FEDA 4H6ZA 5J8FA 2Z10A 4KOXA 5A27A 3FRMA 3GIUA 4KSAA 3H5ZA 1YLEA 3PRTA 4YFJA 4FAIA 1J4JA 2BO9A 5F47A 5AG5A 4PK2A 1Q2DA 5LRKA 4JWPA 4U5YA 3B35A 3PB6X 4AXVA 4MHDA 3TO9A 1QSRA 2BL1A 2Z0ZA 4Q7AA 1WK4A 1BOBA 1TF9A 2AFZA 2OB0A 2Z3KA 3TO7A 5J8CA 3W6SA 2CTBA 1YR0A 1Y7RA 5K8OA 2ZW6A 2G9DA 3BI0A 4M6HA 4R57A 2AFSA 3C26A 3GKRA 4UEZA 4E2AA 3VATA 2YNEA 2J8RA 2KCWA 1LFWA 2ZW4A 4PXDA 4UF4A 3V38A 2CF4A 4KS9A 3VARA 1IYLA 4X8IA 5H86A 3D2MA 5IB9A 2YNCA 4MHNA 3B7IA 5ISVA 4PSWA 1QSTA 5F49A 4QBJA 3FVLA 2EO8A 3R9EA 4EMEA 1CG2A 2OZHA 4UEEA 1XIXA 3F8KA 2B3UA 4YWYA 3NH8A 4OAEA 3RNZA 4R3KA 3D4UA 3FF3A 1RTQA 4B10A 3CXSA 4Q38A 1KZFA 4KOYA 3I1UA 4KVME 5K8MA 1S5KA 3QAHA 4FD5A 4KOSA 1TKJA 2O53A 3K9UA 4KSIA 3RYOA 3IWGA 1EE3P 1Z4EA 2DF5A 4OC1A 2PQ8A 4E0AA 2IJZA 2CNTA 2VI7A 5EBVA 3FMCA 1R57A 2POKA 1AMPA 3MGDA 4B5OA 4L8AA 2J9AA 1KUXA 1DE4C 1UWYA 2Q43A 4P45A 3SJFA 1FY7A 3IC1A 2RFHA 4OC4A 4M6GA 3IIBA 2ZW5A 2FVGA 3KASA 3MN8A 1ELLP 3PBEA 4OP4A 4MY0A 1SQHA 4CAFA 3W6XA 5D8NA 5K8NA 3SI0A 5FVJA 2Q51A 4G1PA 2HB6A 4EWTA 1TKFA 4KSFA 1IB1E 4A94A 1S7NA 3S9MA 2PJ3A 1H8LA 1QSOA 2XEIA 5KTCA 1CPXA 4II9A 1LRZA 1VGYA 2XEGA 4CGOA 1ARMA 5I0CA 4NEXA 2VL1A 3VWDA 4MHYA 4PV6A 4R7MA 3DGVA 4YGOA 1LAPA 4BMHA 3WABA 3GB0A 1CBXA 2WSAA 2JBJA 3BXMA 1PUAA 3G8WA 1ZO0A 4OLLA 1CPSA 4P4EA 4CGMA 2GE3A 2OR4A 2C6PA 4P10A 3TT2A 3IFEA 1B6BA 5E96A 2EK8A 2NYQA 3B2YA 3TOBA 3K2KA 2ZEEA 3IU2A 3KR5A 2GLFA 3E0KA 3PFOA 2EK9A 1FT7A 1V0CA 3LODA 1YREA 1Z8XA 5EMIA 3QAYA 4P4IA 3MRUA 4P4DA 4RS2A 4RN7A 1BPMA 4B5PB 3IEHA 3B3WA 1Z9UA 2PIYA 2GREA 2DXQA 1Z2LA 3SJGA 2HV2A 4M85A 3D3SA 3S6HA 4B14A 4NGTA 4PSXA 3W91A 4ONWA 4LX9A 5EC4A 1IICA 1Z8TA 4MCRA 2I00A 3FXTA 4B12A 1XF8A 1YQEA 3CT9A 4K3NA 2P6GA 4CAWA 4KORA 3TCVA 1ARLA 1ZLIA 2Q4YA 1YVOA 2J8MA 1YX0A 3NE7A 1JQGA 1R43A 5DS0A 1CX8A 4YU9A 4UFXA 3DDDA 4KLWA 2B4DA 3VWEA 2Q7SA 5HH1A 1S7KA 3G3SA 3N7ZA 4KVXA 1I21A 1QSNA 1M4LA 2ZEHA 2JLMA 4M3SA 4MHPA 4PXCA 4P6YA 3I9SA 2DPSA 4PXBA 2C6GA 2PRQA 2WZNA 4GM5A 4JZ0A 4C7IA 4E8OA 2CXAA 4ZI6A 2Z3OA 4YRHA 3NA6A 1BPNA 2PRBA 3P2FA 1CJWA 2HUZA 2VEZA 3NE8A 4ORFA 3B3SA 1RXTA 2FCKA 2Q04A 3HLPA 4U9YA 4AVCA 1YMEA 4CGPA 4MRIA 4NGQA 2PC1A 4CGNA 1L0CA 4MFKA 2AFUA 1IU8A 3SI1A 4C2XA 4M6IA 2J8NA 2PDOA 1KUYA 3GUXA 1VHOA 4IUSA 1F2PA 1Y0RA 4JXQA 3A9LA 1S3ZA
chains in the Genus database with same CATH topology
4QUSA 5JQ4A 5C82A 1S60A 3S6GA 2FIWA 3GY9A 1N71A 4HNXB 4F0XA 3PZJA 4KOUA 4CYNA 1M1DA 4Y49C 2Z3MA 4KUBA 5DWMA 3I3GA 4UFVA 4CYOA 4J3GA 4H89A 2A4NA 1Y9KA 2VXKA 4A31A 4QVTA 4MY3A 4ZBGA 2X7BA 4F0YA 4UWIA 3DNSA 2Z11A 3D8PA 4L89A 3R1KA 1VHSA 3KKWA 3OWCA 5H84A 3V8IA 2Y0MA 4FD4A 2BSWA 4R9MA 4U9ZA 1K4JA 2FSRA 5IV0A 3F5BA 4B5PA 4AG9A 2R7HA 1S7FA 1PU9A 1RO5A 4A2ZA 2P0WA 5AGEA 5G21A 3R95A 4AVBA 5AG4A 1Q2YA 3EY5A 1TIQA 1XMTA 4K30A 5BWAB 2D4OA 3S6FA 5IX3A 2F5IA 2G0BA 3LD2A 5A28A 5C88A 2WUUA 2AJ6A 4JLYA 4CS0B 3BJ8A 4OADA 1P0HA 4HNYB 4KUAA 1XE4A 2RC4A 1MJBA 2JDCA 1I12A 1OZPA 1XEBA 4C2ZA 2PSWA 3R96A 2EUIA 4MBUA 4MFPA 4CRYB 2B5GA 4NCZA 3IGRA 5KTDA 3DSBA 1NE9A 2ARHA 4MFQA 1VKCA 1KUVA 1WWZA 2ZXVA 2QMLA 3D2PA 1IIDA 3CXPA 4CYQA 3PGPA 3BLNA 4HNWB 3TFYA 1YVKA 5KTAA 5G22A 2G3AA 4UWJA 4XPKA 2OU2A 4R87A 3DR6A 4CAVA 5AG6A 4Q36A 3EO4A 3T90A 3EC4A 3BJ7A 1I1DA 3JVNA 2Q44A 4MFLA 3FIXA 4A33A 5F46A 2VZYA 2GIVA 2FS5A 4QB9A 4B11A 2OH1A 4I49A 2Z3LA 4A32A 1Z4RA 2OZUA 2P6EA 3R9GA 4ZGYB 3TO6A 2O28A 3FB3A 4AB7A 3S6KA 4PK3A 5IB0A 4KZTA 4UCPA 1M44A 2FXFA 4A95A 3F0AA 3FNCA 4JJXA 5G20A 2YNDA 5G1ZA 2VZZA 1GHEA 2ZW7A 2GANA 4QC6A 4X5KA 2OZGA 1U6MA 2D4PA 4B13A 2FT0A 2H5MA 4AG7A 2PR1A 3TOAA 3B8GA 3ZJ0A 2NMTA 2Q0YA 2CNMA 4KOTA 5DWNA 4CYPA 1B87A 4XPDC 5F48A 1YGHA 2REEA 4DNCA 4FD7A 1UFHA 3H4QA 1M4GA 1Q2CA 2REFA 4AVAA 2PR8A 2R8VA 4H6UA 1QSMA 1M4IA 4C7HA 1YK3A 5GCNA 4MFZA 4F6AA 3UY5A 4ONUA 2K5TA 3CXQA 2Q7BA 2VQYA 3T9YA 2R98A 4UCMA 1NMTA 2Z3PA 4JXRA 4NF1A 2WPXA 3IWEA 3TTHA 4KVOE 2B3VA 2EVNA 4XPLA 4FD6A 4NXYA 4UFWA 1BO4A 1Y9WA 3FBUA 2FIAA 4MI4A 4RI1A 2FL4A 3P2HA 2BUEA 2WPWA 3GYAA 3QB8A 4A30A 5HMNA 3JUWA 3FYNA 3EFAA 4XPDB 3R9FA 3WR7A 4UBRA 3DR8A 2ZPAA 2B5GB 2JEVA 2R1IA 2QECA 5JPHA 4CRZB 4EVYA 2YGWA 3ZZIA 4Y49B 2AE6A 2BEIA 4R3LA 2B58A 1IYKA 3IU1A 1P4NA 4LUAA 4XNHC 2C27A 3PP9A 4UA3A 2YNCC 2ATRA 4UCNA 4MJ8A 1CM0A 1MJ9A 2QIRA 4BBHA 1S7LA 2JDDA 4CAXA 2VBQA 4GS4A 3SXNA 2DPTA 4C2YA 2B4DB 2G3TA 1MJAA 2Q4VA 2IL4A 3TE4A 4HKFA 4KLVA 2I79A 3EXNA 2FE7A 2P6FA 4IF5A 4CAEA 2CNSA 2HQYA 1NSLA 2B4BA 5CNPA 1ON0A 3SXOA 4NSQA 4CGLA 4KOVA 4MFJA 1MK4A 2Z3NA 5AG7A 4JD6A 4KOWA 1M4DA 3JTKA 4XNHB 2CY2A 3SHPA 5J8FA 4H6ZA 2Z10A 4KOXA 5A27A 3FRMA 4KSAA 3H5ZA 1YLEA 4YFJA 1J4JA 5F47A 5AG5A 4PK2A 1Q2DA 4JWPA 4U5YA 4MHDA 3TO9A 1QSRA 2BL1A 2Z0ZA 1WK4A 1BOBA 2OB0A 2Z3KA 3TO7A 5J8CA 3W6SA 1YR0A 1Y7RA 2ZW6A 4R57A 3C26A 3GKRA 4E2AA 2YNEA 2J8RA 2KCWA 2ZW4A 4KS9A 1IYLA 5H86A 3D2MA 2YNCA 5ISVA 4PSWA 1QSTA 5F49A 4QBJA 3R9EA 2OZHA 3F8KA 1XIXA 2B3UA 4OAEA 4R3KA 4B10A 3CXSA 4Q38A 1KZFA 4KOYA 4KVME 1S5KA 3QAHA 4FD5A 4KOSA 3K9UA 3RYOA 3IWGA 1Z4EA 2PQ8A 4E0AA 2CNTA 2VI7A 5EBVA 1R57A 3MGDA 4B5OA 4L8AA 1KUXA 1FY7A 4C68A 2ZW5A 4CAFA 4MY0A 1SQHA 3W6XA 5FVJA 4KSFA 1IB1E 1S7NA 1QSOA 5KTCA 4II9A 1LRZA 4CGOA 5I0CA 4NEXA 3VWDA 4PV6A 4YGOA 4BMHA 2WSAA 1PUAA 3G8WA 1ZO0A 4OLLA 4CGMA 2GE3A 3TT2A 1B6BA 5E96A 3TOBA 3IU2A 3E0KA 1V0CA 3LODA 1YREA 4RS2A 4B5PB 1Z9UA 2DXQA 2HV2A 4M85A 3D3SA 3S6HA 4B14A 4PSXA 3W91A 5EC4A 4LX9A 1IICA 2I00A 3FXTA 4B12A 1XF8A 2P6GA 4CAWA 4KORA 3TCVA 2Q4YA 3NE7A 1YVOA 1YX0A 2J8MA 4UFXA 3DDDA 4KLWA 2B4DA 3VWEA 5HH1A 1S7KA 3N7ZA 3G3SA 4KVXA 1I21A 1QSNA 4M3SA 2JLMA 3I9SA 2DPSA 4E8OA 4C7IA 2CXAA 2Z3OA 4YRHA 2PRBA 4ORFA 3P2FA 1CJWA 2HUZA 2VEZA 1RXTA 2FCKA 2Q04A 4U9YA 4AVCA 4CGPA 2PC1A 4CGNA 1L0CA 4MFKA 4C2XA 2J8NA 2PDOA 1KUYA 4IUSA 4JXQA 3A9LA 1S3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UFX A;  4C2Y A;  3IU2 A;  4CYP A;  5A28 A;  4UFW A;  4CYQ A;  5AG7 A;  2WUU A;  4B13 A;  3IU1 A;  5G22 A;  4CYN A;  4C7H A;  4A32 A;  4C7I A;  4CGO A;  2YNE A;  3JTK A;  5AG6 A;  2YNC C;  4UFV A;  4UCN A;  4B14 A;  4UCP A;  4A2Z A;  4A30 A;  4CAE A;  5AGE A;  5G21 A;  2YNC A;  4A95 A;  4CYO A;  5A27 A;  4C2Z A;  2WSA A;  4CGP A;  4UCM A;  3H5Z A;  4CGN A;  4BBH A;  4C68 A;  5AG5 A;  4B12 A;  4C2X A;  5G20 A;  4CAF A;  4A31 A;  5AG4 A;  2YND A;  5G1Z A;  4CGM A;  4A33 A;  3IWE A;  4B10 A;  4CGL A;  4B11 A; 
#chains in the Genus database with same CATH topology
 4QUS A;  5JQ4 A;  5J1Q A;  5C82 A;  1S60 A;  3S6G A;  2FIW A;  3GY9 A;  4MCP A;  1N71 A;  4HNX B;  4F0X A;  3PZJ A;  2JEW A;  2QVP A;  4KOU A;  1KWM A;  4CYN A;  1M1D A;  4Y49 C;  3N5F A;  3D67 A;  2Z3M A;  4NGM A;  2QJ8 A;  1A2Z A;  2C6C A;  3D7G A;  1F2O A;  4KUB A;  3I3G A;  4UFV A;  5DWM A;  5LYF A;  4CYO A;  4DYO A;  4J3G A;  4H89 A;  2A4N A;  3B3V A;  1Y9K A;  4A37 A;  3D66 A;  2VXK A;  5D29 A;  1HEE A;  2V8V A;  4A31 A;  3NFZ A;  4QVT A;  4MY3 A;  1QQ9 A;  3D7D A;  4ZBG A;  2X7B A;  4F0Y A;  4UWI A;  3DNS A;  2Z11 A;  3D8P A;  4L89 A;  3R1K A;  1VHS A;  3KHX A;  3KKW A;  3OWC A;  5H84 A;  2Y0M A;  3KQX A;  4FD4 A;  4UIA A;  3V8I A;  2BOA A;  2CIJ A;  2BSW A;  4R9M A;  4U9Z A;  3RZA A;  1K4J A;  2BCO A;  2FSR A;  2JBK A;  2PJ8 A;  5IV0 A;  3F5B A;  4B5P A;  4AG9 A;  2ZEN A;  2R7H A;  3KR4 A;  2WYR A;  2AFO A;  1S7F A;  1QMU A;  1PU9 A;  1RO5 A;  2ZOF A;  4A2Z A;  2P0W A;  4BD9 A;  5AGE A;  5G21 A;  3R95 A;  4MCS A;  4NJR A;  4ZX8 A;  4AVB A;  2F8H A;  4MHZ A;  1JWQ A;  5AG4 A;  2ODF A;  1Q2Y A;  4TNU A;  3EY5 A;  3QNV A;  1TIQ A;  1XMT A;  4K30 A;  4MXU A;  2F7V A;  1IY7 A;  3JRU A;  5BWA B;  3LMS A;  2D4O A;  3S6F A;  5IX3 A;  2F5I A;  2G0B A;  3LD2 A;  1TXR A;  5A28 A;  5C88 A;  4C68 A;  2WUU A;  2AJ6 A;  4JLY A;  3T8W A;  2GU2 A;  4CS0 B;  4NGS A;  3BJ8 A;  1NSA A;  3PB4 X;  4OAD A;  4BIN A;  3S9N A;  1P0H A;  1LOK A;  2ABZ A;  4HNY B;  4X2T A;  2PJ1 A;  1XE4 A;  2RC4 A;  4KUA A;  4WJB A;  1MJB A;  2JDC A;  4MCQ A;  5LRJ A;  1LCP A;  1I12 A;  1OZP A;  1XEB A;  3TX8 A;  4C2Z A;  2PSW A;  3R96 A;  2PJ5 A;  2EUI A;  4MBU A;  4MFP A;  4CRY B;  3LAC A;  2B5G A;  1AUG A;  1IOF A;  3BHX A;  4NCZ A;  3IGR A;  4LQ6 A;  5KTD A;  3DSB A;  5I4M A;  5ELY A;  1NE9 A;  2ARH A;  4NFR A;  3IO1 A;  4JYW A;  5F09 A;  4MFQ A;  1VKC A;  1KUV A;  1WWZ A;  2ZXV A;  2QML A;  3H8E A;  3D2P A;  3D7H A;  3FJU A;  1IID A;  3NH5 A;  4P4F A;  3CXP A;  4CYQ A;  2PJ4 A;  3BLN A;  3PGP A;  4HNW B;  3TC8 A;  3TFY A;  1YVK A;  5KTA A;  3FX6 A;  5G22 A;  2G3A A;  4UWJ A;  4XPK A;  2IMO A;  2OU2 A;  2Q4Z A;  4R87 A;  4R8F A;  3DR6 A;  1VHE A;  4P44 A;  3H8G A;  4P4J A;  4ZY2 A;  3SJX A;  5AG6 A;  3FEC A;  4CAV A;  2C1C A;  2PIZ A;  4Q36 A;  4F8Z A;  3SI2 A;  3EO4 A;  3T90 A;  3CDX A;  3EC4 A;  4EFD A;  2DEA A;  3BJ7 A;  4B6Z A;  1CP7 A;  1I1D A;  3JVN A;  2Q44 A;  4MFL A;  4NGP A;  3D68 A;  3HUV A;  4FWU A;  4X3R A;  3FIX A;  2ZEO A;  4A33 A;  3H8F A;  4ZY1 A;  5F46 A;  2VZY A;  3KGQ A;  3GLJ A;  3KZW A;  2GIV A;  2FS5 A;  4QB9 A;  4OID A;  1YSJ A;  4B11 A;  1LAN A;  2PVV A;  1YW6 A;  2AFM A;  2OH1 A;  1Q7L A;  4I49 A;  1XMB A;  2Z3L A;  3RO0 A;  4A32 A;  1Z4R A;  2OZU A;  2P6E A;  3R9G A;  5HVG A;  4ZGY B;  2PJ7 A;  4NJQ A;  3TO6 A;  2O28 A;  3FB3 A;  4LQG A;  4NGR A;  4PK3 A;  3S6K A;  4AB7 A;  5IB0 A;  4KZT A;  4UCP A;  1M44 A;  2FXF A;  4A95 A;  4NGN A;  3PBB A;  2GLJ A;  4Z65 A;  4A39 A;  1XOV A;  3V7Z A;  1TF8 A;  3F0A A;  1ZG7 A;  3FNC A;  2ZEM A;  4JJX A;  5G20 A;  2IQ6 A;  2YND A;  5G1Z A;  2VZZ A;  1GHE A;  2ZW7 A;  4R6T A;  2XEF A;  1X12 A;  2GAN A;  4QC6 A;  4ZX9 A;  4X5K A;  2OZG A;  1U6M A;  3B3C A;  2D4P A;  4B13 A;  2FT0 A;  2ZEG A;  2ZEF A;  2H5M A;  4AG7 A;  2PR1 A;  3PB7 X;  3TOA A;  3B8G A;  3ZJ0 A;  2NMT A;  4ZY0 A;  1HDU A;  2Q0Y A;  2CNM A;  4KOT A;  5DWN A;  4CYP A;  1XBU A;  1B87 A;  4XPD C;  1ZG8 A;  5F48 A;  2PCU A;  1YGH A;  5K8P A;  2REE A;  1AYE A;  4DNC A;  4FBE A;  4FD7 A;  1UFH A;  3H4Q A;  1M4G A;  1ZG9 A;  4GXH A;  1LAM A;  1Q2C A;  1PYT B;  2V8H A;  2REF A;  4IK2 A;  1YLO A;  4AVA A;  2PR8 A;  2R8V A;  5HXD A;  4H6U A;  1QSM A;  5JM6 A;  3LWU A;  1M4I A;  3ISX A;  4MMO A;  3WC5 A;  1PCA A;  4C7H A;  3K9T A;  1Z8L A;  4OC5 A;  1YK3 A;  5LRG A;  5JGF A;  5GCN A;  4MFZ A;  4F6A A;  3UY5 A;  2QYV A;  2ANP A;  4ONU A;  2K5T A;  3CXQ A;  2Q7B A;  2VQY A;  3T9Y A;  1BAV A;  2EBJ A;  2R98 A;  3RAM A;  4UCM A;  1DTD A;  1R3N A;  5THW A;  3CZX A;  2XEJ A;  8CPA A;  1NMT A;  2Z3P A;  2CTC A;  4JXR A;  4F9U A;  4NF1 A;  2WPX A;  4P4B A;  4OC2 A;  3IWE A;  2HC9 A;  3TTH A;  4O23 A;  4KVO E;  2B3V A;  2EVN A;  3PEI A;  4UIB A;  4XPL A;  1F57 A;  4FD6 A;  7CPA A;  2PE3 A;  1VIX A;  2PJB A;  4NXY A;  4UFW A;  1BO4 A;  1Y9W A;  3FBU A;  2FIA A;  5LYL A;  4MI4 A;  4RI1 A;  2V77 A;  1IGB A;  2FL4 A;  5CBM A;  3P2H A;  2BUE A;  2WPW A;  2EWB A;  3GYA A;  3QB8 A;  4A30 A;  3JUW A;  3FYN A;  3PB9 X;  3EFA A;  3BI1 A;  5HMN A;  2OOT A;  4XPD B;  3R9F A;  2RB7 A;  3WC6 A;  3WR7 A;  4OC3 A;  4UBR A;  3PFE A;  3DR8 A;  2ZPA A;  1CP6 A;  2B5G B;  2JEV A;  2R1I A;  2QEC A;  5JPH A;  1Y7E A;  1BLL E;  3KHZ A;  4CRZ B;  4EVY A;  2YGW A;  3ZZI A;  2V8D A;  2AE6 A;  4OME A;  4Y49 B;  4A38 A;  4DUK A;  3FH4 A;  2BEI A;  2GFQ A;  3IWW A;  1XFO A;  2B58 A;  4R3L A;  2AFX A;  1IYK A;  3D7F A;  3IU1 A;  3SJE A;  1P4N A;  4LUA A;  1X10 A;  3PB8 X;  4XNH C;  5CPA A;  2C27 A;  1ZLH A;  3PP9 A;  4PXE A;  4R76 A;  4UA3 A;  2YNC C;  2ATR A;  3CPA A;  3CPX A;  4UCN A;  2PVW A;  4MJ8 A;  3L2N A;  1CM0 A;  1MJ9 A;  4UEF A;  2QIR A;  4BBH A;  2I3C A;  2PJ6 A;  1S7L A;  2ZEP A;  2PJ9 A;  2JDD A;  4HPS A;  4W9Y A;  5HVF A;  1Z5R A;  3B3T A;  4CAX A;  5JH9 A;  3KL9 A;  2VBQ A;  4F9V A;  1HDQ A;  4FUU A;  4GS4 A;  5LYD A;  3WC7 A;  3SXN A;  2DPT A;  1YW4 A;  3DLJ A;  1OBR A;  2B4D B;  1Y0Y A;  2G3T A;  3FEE A;  3KQZ A;  1MJA A;  4PPZ A;  1XJO A;  2Q4V A;  5LYI A;  1TKH A;  2IL4 A;  2O4H A;  3TE4 A;  1Z8W A;  4HKF A;  4KLV A;  1ELM P;  2I79 A;  3NH4 A;  3S9L A;  2V8G A;  3EXN A;  2FE7 A;  2P6F A;  2PJ0 A;  4IF5 A;  4OIW A;  4CAE A;  4H2K A;  2CNS A;  2HQY A;  1NSL A;  4TWE A;  2B4B A;  5CNP A;  1GYT A;  4DJL A;  1ON0 A;  4PQA A;  3SXO A;  1FNO A;  4RUH A;  4NSQ A;  4OC0 A;  4CGL A;  2AFW A;  3RBU A;  4KOV A;  1XRY A;  2PJC A;  2PJA A;  4MFJ A;  1MK4 A;  4C2Y A;  2PJ2 A;  4WWV A;  2Z3N A;  5AG7 A;  6CPA A;  2ZED A;  3IJ3 A;  2ZEL A;  3KI9 A;  2NSM A;  4JD6 A;  3WT4 A;  4OKO A;  2ZOG A;  4IHM A;  3VH9 A;  4KOW A;  1M4D A;  5HVH A;  3JTK A;  4XNH B;  2CY2 A;  3SHP A;  3ISZ A;  4CPA A;  1IOI A;  4IAV A;  4ZYQ A;  3FED A;  4H6Z A;  5J8F A;  2Z10 A;  4KOX A;  5A27 A;  3FRM A;  3GIU A;  4KSA A;  3H5Z A;  1YLE A;  3PRT A;  4YFJ A;  4FAI A;  1J4J A;  2BO9 A;  5F47 A;  5AG5 A;  4PK2 A;  1Q2D A;  5LRK A;  4JWP A;  4U5Y A;  3B35 A;  3PB6 X;  4AXV A;  4MHD A;  3TO9 A;  1QSR A;  2BL1 A;  2Z0Z A;  4Q7A A;  1WK4 A;  1BOB A;  1TF9 A;  2AFZ A;  2OB0 A;  2Z3K A;  3TO7 A;  5J8C A;  3W6S A;  2CTB A;  1YR0 A;  1Y7R A;  5K8O A;  2ZW6 A;  2G9D A;  3BI0 A;  4M6H A;  4R57 A;  2AFS A;  3C26 A;  3GKR A;  4UEZ A;  4E2A A;  3VAT A;  2YNE A;  2J8R A;  2KCW A;  1LFW A;  2ZW4 A;  4PXD A;  4UF4 A;  3V38 A;  2CF4 A;  4KS9 A;  3VAR A;  1IYL A;  4X8I A;  5H86 A;  3D2M A;  5IB9 A;  2YNC A;  4MHN A;  3B7I A;  5ISV A;  4PSW A;  1QST A;  5F49 A;  4QBJ A;  3FVL A;  2EO8 A;  3R9E A;  4EME A;  1CG2 A;  2OZH A;  4UEE A;  1XIX A;  3F8K A;  2B3U A;  4YWY A;  3NH8 A;  4OAE A;  3RNZ A;  4R3K A;  3D4U A;  3FF3 A;  1RTQ A;  4B10 A;  3CXS A;  4Q38 A;  1KZF A;  4KOY A;  3I1U A;  4KVM E;  5K8M A;  1S5K A;  3QAH A;  4FD5 A;  4KOS A;  1TKJ A;  2O53 A;  3K9U A;  4KSI A;  3RYO A;  3IWG A;  1EE3 P;  1Z4E A;  2DF5 A;  4OC1 A;  2PQ8 A;  4E0A A;  2IJZ A;  2CNT A;  2VI7 A;  5EBV A;  3FMC A;  1R57 A;  2POK A;  1AMP A;  3MGD A;  4B5O A;  4L8A A;  2J9A A;  1KUX A;  1DE4 C;  1UWY A;  2Q43 A;  4P45 A;  3SJF A;  1FY7 A;  3IC1 A;  2RFH A;  4OC4 A;  4M6G A;  3IIB A;  2ZW5 A;  2FVG A;  3KAS A;  3MN8 A;  1ELL P;  3PBE A;  4OP4 A;  4MY0 A;  1SQH A;  4CAF A;  3W6X A;  5D8N A;  5K8N A;  3SI0 A;  5FVJ A;  2Q51 A;  4G1P A;  2HB6 A;  4EWT A;  1TKF A;  4KSF A;  1IB1 E;  4A94 A;  1S7N A;  3S9M A;  2PJ3 A;  1H8L A;  1QSO A;  2XEI A;  5KTC A;  1CPX A;  4II9 A;  1LRZ A;  1VGY A;  2XEG A;  4CGO A;  1ARM A;  5I0C A;  4NEX A;  2VL1 A;  3VWD A;  4MHY A;  4PV6 A;  4R7M A;  3DGV A;  4YGO A;  1LAP A;  4BMH A;  3WAB A;  3GB0 A;  1CBX A;  2WSA A;  2JBJ A;  3BXM A;  1PUA A;  3G8W A;  1ZO0 A;  4OLL A;  1CPS A;  4P4E A;  4CGM A;  2GE3 A;  2OR4 A;  2C6P A;  4P10 A;  3TT2 A;  3IFE A;  1B6B A;  5E96 A;  2EK8 A;  2NYQ A;  3B2Y A;  3TOB A;  3K2K A;  2ZEE A;  3IU2 A;  3KR5 A;  2GLF A;  3E0K A;  3PFO A;  2EK9 A;  1FT7 A;  1V0C A;  3LOD A;  1YRE A;  1Z8X A;  5EMI A;  3QAY A;  4P4I A;  3MRU A;  4P4D A;  4RS2 A;  4RN7 A;  1BPM A;  4B5P B;  3IEH A;  3B3W A;  1Z9U A;  2PIY A;  2GRE A;  2DXQ A;  1Z2L A;  3SJG A;  2HV2 A;  4M85 A;  3D3S A;  3S6H A;  4B14 A;  4NGT A;  4PSX A;  3W91 A;  4ONW A;  4LX9 A;  5EC4 A;  1IIC A;  1Z8T A;  4MCR A;  2I00 A;  3FXT A;  4B12 A;  1XF8 A;  1YQE A;  3CT9 A;  4K3N A;  2P6G A;  4CAW A;  4KOR A;  3TCV A;  1ARL A;  1ZLI A;  2Q4Y A;  1YVO A;  2J8M A;  1YX0 A;  3NE7 A;  1JQG A;  1R43 A;  5DS0 A;  1CX8 A;  4YU9 A;  4UFX A;  3DDD A;  4KLW A;  2B4D A;  3VWE A;  2Q7S A;  5HH1 A;  1S7K A;  3G3S A;  3N7Z A;  4KVX A;  1I21 A;  1QSN A;  1M4L A;  2ZEH A;  2JLM A;  4M3S A;  4MHP A;  4PXC A;  4P6Y A;  3I9S A;  2DPS A;  4PXB A;  2C6G A;  2PRQ A;  2WZN A;  4GM5 A;  4JZ0 A;  4C7I A;  4E8O A;  2CXA A;  4ZI6 A;  2Z3O A;  4YRH A;  3NA6 A;  1BPN A;  2PRB A;  3P2F A;  1CJW A;  2HUZ A;  2VEZ A;  3NE8 A;  4ORF A;  3B3S A;  1RXT A;  2FCK A;  2Q04 A;  3HLP A;  4U9Y A;  4AVC A;  1YME A;  4CGP A;  4MRI A;  4NGQ A;  2PC1 A;  4CGN A;  1L0C A;  4MFK A;  2AFU A;  1IU8 A;  3SI1 A;  4C2X A;  4M6I A;  2J8N A;  2PDO A;  1KUY A;  3GUX A;  1VHO A;  4IUS A;  1F2P A;  1Y0R A;  4JXQ A;  3A9L A;  1S3Z A; 
#chains in the Genus database with same CATH homology
 4QUS A;  5JQ4 A;  5C82 A;  1S60 A;  3S6G A;  2FIW A;  3GY9 A;  1N71 A;  4HNX B;  4F0X A;  3PZJ A;  4KOU A;  4CYN A;  1M1D A;  4Y49 C;  2Z3M A;  4KUB A;  5DWM A;  3I3G A;  4UFV A;  4CYO A;  4J3G A;  4H89 A;  2A4N A;  1Y9K A;  2VXK A;  4A31 A;  4QVT A;  4MY3 A;  4ZBG A;  2X7B A;  4F0Y A;  4UWI A;  3DNS A;  2Z11 A;  3D8P A;  4L89 A;  3R1K A;  1VHS A;  3KKW A;  3OWC A;  5H84 A;  3V8I A;  2Y0M A;  4FD4 A;  2BSW A;  4R9M A;  4U9Z A;  1K4J A;  2FSR A;  5IV0 A;  3F5B A;  4B5P A;  4AG9 A;  2R7H A;  1S7F A;  1PU9 A;  1RO5 A;  4A2Z A;  2P0W A;  5AGE A;  5G21 A;  3R95 A;  4AVB A;  5AG4 A;  1Q2Y A;  3EY5 A;  1TIQ A;  1XMT A;  4K30 A;  5BWA B;  2D4O A;  3S6F A;  5IX3 A;  2F5I A;  2G0B A;  3LD2 A;  5A28 A;  5C88 A;  2WUU A;  2AJ6 A;  4JLY A;  4CS0 B;  3BJ8 A;  4OAD A;  1P0H A;  4HNY B;  4KUA A;  1XE4 A;  2RC4 A;  1MJB A;  2JDC A;  1I12 A;  1OZP A;  1XEB A;  4C2Z A;  2PSW A;  3R96 A;  2EUI A;  4MBU A;  4MFP A;  4CRY B;  2B5G A;  4NCZ A;  3IGR A;  5KTD A;  3DSB A;  1NE9 A;  2ARH A;  4MFQ A;  1VKC A;  1KUV A;  1WWZ A;  2ZXV A;  2QML A;  3D2P A;  1IID A;  3CXP A;  4CYQ A;  3PGP A;  3BLN A;  4HNW B;  3TFY A;  1YVK A;  5KTA A;  5G22 A;  2G3A A;  4UWJ A;  4XPK A;  2OU2 A;  4R87 A;  3DR6 A;  4CAV A;  5AG6 A;  4Q36 A;  3EO4 A;  3T90 A;  3EC4 A;  3BJ7 A;  1I1D A;  3JVN A;  2Q44 A;  4MFL A;  3FIX A;  4A33 A;  5F46 A;  2VZY A;  2GIV A;  2FS5 A;  4QB9 A;  4B11 A;  2OH1 A;  4I49 A;  2Z3L A;  4A32 A;  1Z4R A;  2OZU A;  2P6E A;  3R9G A;  4ZGY B;  3TO6 A;  2O28 A;  3FB3 A;  4AB7 A;  3S6K A;  4PK3 A;  5IB0 A;  4KZT A;  4UCP A;  1M44 A;  2FXF A;  4A95 A;  3F0A A;  3FNC A;  4JJX A;  5G20 A;  2YND A;  5G1Z A;  2VZZ A;  1GHE A;  2ZW7 A;  2GAN A;  4QC6 A;  4X5K A;  2OZG A;  1U6M A;  2D4P A;  4B13 A;  2FT0 A;  2H5M A;  4AG7 A;  2PR1 A;  3TOA A;  3B8G A;  3ZJ0 A;  2NMT A;  2Q0Y A;  2CNM A;  4KOT A;  5DWN A;  4CYP A;  1B87 A;  4XPD C;  5F48 A;  1YGH A;  2REE A;  4DNC A;  4FD7 A;  1UFH A;  3H4Q A;  1M4G A;  1Q2C A;  2REF A;  4AVA A;  2PR8 A;  2R8V A;  4H6U A;  1QSM A;  1M4I A;  4C7H A;  1YK3 A;  5GCN A;  4MFZ A;  4F6A A;  3UY5 A;  4ONU A;  2K5T A;  3CXQ A;  2Q7B A;  2VQY A;  3T9Y A;  2R98 A;  4UCM A;  1NMT A;  2Z3P A;  4JXR A;  4NF1 A;  2WPX A;  3IWE A;  3TTH A;  4KVO E;  2B3V A;  2EVN A;  4XPL A;  4FD6 A;  4NXY A;  4UFW A;  1BO4 A;  1Y9W A;  3FBU A;  2FIA A;  4MI4 A;  4RI1 A;  2FL4 A;  3P2H A;  2BUE A;  2WPW A;  3GYA A;  3QB8 A;  4A30 A;  5HMN A;  3JUW A;  3FYN A;  3EFA A;  4XPD B;  3R9F A;  3WR7 A;  4UBR A;  3DR8 A;  2ZPA A;  2B5G B;  2JEV A;  2R1I A;  2QEC A;  5JPH A;  4CRZ B;  4EVY A;  2YGW A;  3ZZI A;  4Y49 B;  2AE6 A;  2BEI A;  4R3L A;  2B58 A;  1IYK A;  3IU1 A;  1P4N A;  4LUA A;  4XNH C;  2C27 A;  3PP9 A;  4UA3 A;  2YNC C;  2ATR A;  4UCN A;  4MJ8 A;  1CM0 A;  1MJ9 A;  2QIR A;  4BBH A;  1S7L A;  2JDD A;  4CAX A;  2VBQ A;  4GS4 A;  3SXN A;  2DPT A;  4C2Y A;  2B4D B;  2G3T A;  1MJA A;  2Q4V A;  2IL4 A;  3TE4 A;  4HKF A;  4KLV A;  2I79 A;  3EXN A;  2FE7 A;  2P6F A;  4IF5 A;  4CAE A;  2CNS A;  2HQY A;  1NSL A;  2B4B A;  5CNP A;  1ON0 A;  3SXO A;  4NSQ A;  4CGL A;  4KOV A;  4MFJ A;  1MK4 A;  2Z3N A;  5AG7 A;  4JD6 A;  4KOW A;  1M4D A;  3JTK A;  4XNH B;  2CY2 A;  3SHP A;  5J8F A;  4H6Z A;  2Z10 A;  4KOX A;  5A27 A;  3FRM A;  4KSA A;  3H5Z A;  1YLE A;  4YFJ A;  1J4J A;  5F47 A;  5AG5 A;  4PK2 A;  1Q2D A;  4JWP A;  4U5Y A;  4MHD A;  3TO9 A;  1QSR A;  2BL1 A;  2Z0Z A;  1WK4 A;  1BOB A;  2OB0 A;  2Z3K A;  3TO7 A;  5J8C A;  3W6S A;  1YR0 A;  1Y7R A;  2ZW6 A;  4R57 A;  3C26 A;  3GKR A;  4E2A A;  2YNE A;  2J8R A;  2KCW A;  2ZW4 A;  4KS9 A;  1IYL A;  5H86 A;  3D2M A;  2YNC A;  5ISV A;  4PSW A;  1QST A;  5F49 A;  4QBJ A;  3R9E A;  2OZH A;  3F8K A;  1XIX A;  2B3U A;  4OAE A;  4R3K A;  4B10 A;  3CXS A;  4Q38 A;  1KZF A;  4KOY A;  4KVM E;  1S5K A;  3QAH A;  4FD5 A;  4KOS A;  3K9U A;  3RYO A;  3IWG A;  1Z4E A;  2PQ8 A;  4E0A A;  2CNT A;  2VI7 A;  5EBV A;  1R57 A;  3MGD A;  4B5O A;  4L8A A;  1KUX A;  1FY7 A;  4C68 A;  2ZW5 A;  4CAF A;  4MY0 A;  1SQH A;  3W6X A;  5FVJ A;  4KSF A;  1IB1 E;  1S7N A;  1QSO A;  5KTC A;  4II9 A;  1LRZ A;  4CGO A;  5I0C A;  4NEX A;  3VWD A;  4PV6 A;  4YGO A;  4BMH A;  2WSA A;  1PUA A;  3G8W A;  1ZO0 A;  4OLL A;  4CGM A;  2GE3 A;  3TT2 A;  1B6B A;  5E96 A;  3TOB A;  3IU2 A;  3E0K A;  1V0C A;  3LOD A;  1YRE A;  4RS2 A;  4B5P B;  1Z9U A;  2DXQ A;  2HV2 A;  4M85 A;  3D3S A;  3S6H A;  4B14 A;  4PSX A;  3W91 A;  5EC4 A;  4LX9 A;  1IIC A;  2I00 A;  3FXT A;  4B12 A;  1XF8 A;  2P6G A;  4CAW A;  4KOR A;  3TCV A;  2Q4Y A;  3NE7 A;  1YVO A;  1YX0 A;  2J8M A;  4UFX A;  3DDD A;  4KLW A;  2B4D A;  3VWE A;  5HH1 A;  1S7K A;  3N7Z A;  3G3S A;  4KVX A;  1I21 A;  1QSN A;  4M3S A;  2JLM A;  3I9S A;  2DPS A;  4E8O A;  4C7I A;  2CXA A;  2Z3O A;  4YRH A;  2PRB A;  4ORF A;  3P2F A;  1CJW A;  2HUZ A;  2VEZ A;  1RXT A;  2FCK A;  2Q04 A;  4U9Y A;  4AVC A;  4CGP A;  2PC1 A;  4CGN A;  1L0C A;  4MFK A;  4C2X A;  2J8N A;  2PDO A;  1KUY A;  4IUS A;  4JXQ A;  3A9L A;  1S3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...