2NMTA

Myristoyl-coa:protein n-myristoyltransferase bound to myristoyl-coa and peptide analogs
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
422
structure length
422
Chain Sequence
AMKDHKFWRTQPVKDFDEKVVEEGPIDKPKTPEDISDKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFNYTKEFFNWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVRGKQVPSVEINFLCVHKQLRSKRLTPVLIKEITRRVNKCDIWHALYTAGIVLPAPVSTCRYTHRPLNWKKLYEVDFTGLPDGHTEEDMIAENALPAKTKTAGLRKLKKEDIDQVFELFKRYQSRFELIQIFTKEEFEHNFIGEESLPLDKQVIFSYVVEQPDGKITDFFSFYSLPFTILNNTKYKDLGIGYLYYYATDADFQFKDRFDPKATKALKTRLCELIYDACILAKNANMDVFNALTSQDNTLFLDDLKFGPGDGFLNFYLFNYRAKPITGGLNPDNSNDIKRRSNVGVVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYRISTOYL-COA\:PROTEIN N-MYRISTOYLTRANSFERASE
publication title Structure of N-myristoyltransferase with bound myristoylCoA and peptide substrate analogs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 110
structure length 422
sequence length 422
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 1998-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2nmtA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2nmtA02
4UWJA 2Q4YA 1XIXA 1OZPA 3EFAA 2OZHA 3B8GA 5HMNA 2ZW7A 1B87A 2FIAA 2OU2A 1Q2YA 1YREA 1IYLA 2Y0MA 5DWNA 4CAVA 2ATRA 3DR8A 1YR0A 4L8AA 1BO4A 2B4BA 3UY5A 4KOWA 4NXYA 1S3ZA 3DSBA 3TOAA 3TTHA 4IF5A 2HV2A 4OAEA 3R9FA 1TIQA 2QMLA 2FE7A 4BMHA 4MHDA 3VWEA 2VZZA 1BOBA 4E8OA 3TCVA 4AB7A 4IUSA 4B5OA 1P4NA 4QUSA 1PU9A 3IWGA 3TO9A 4LUAA 3FRMA 4II9A 2RC4A 2EUIA 4CS0B 3F5BA 2VXKA 1M4IA 4NEXA 3PGPA 2Q7BA 4JD6A 1ON0A 4CRZB 4E2AA 1YVKA 1KUYA 2PSWA 2QECA 2ZW4A 4OLLA 1S7LA 5C82A 5J8FA 2C27A 3E0KA 5IB0A 2FS5A 4HNYB 1MJBA 2G0BA 3BJ8A 2I79A 3R95A 2PC1A 2PRBA 1VHSA 4UBRA 3S6FA 5CNPA 5FVJA 3SXNA 1S7KA 1I1DA 1Y7RA 2REFA 5JPHA 4HKFA 2Z0ZA 4GS4A 4KVME 4XNHB 2J8RA 2P0WA 1YGHA 4AG7A 4CAXA 1YX0A 1QSMA 1XMTA 3NE7A 2BL1A 1QSRA 2VI7A 4KOSA 1NSLA 3TOBA 2VEZA 5F49A 4KZTA 4ONUA 4ZBGA 4AVCA 2ARHA 3DR6A 3TT2A 4K30A 3ZJ0A 4AVAA 2F5IA 2WPWA 4JJXA 2IL4A 1I12A 1I21A 2ZW5A 1NE9A 4XPKA 3CXPA 1J4JA 3JVNA 4FD6A 2B4DB 3SXOA 3GY9A 5H84A 4F6AA 1UFHA 2J8NA 4L89A 3F8KA 2Q44A 2PR1A 1PUAA 3TE4A 2G3TA 2I00A 3OWCA 4KVXA 2OB0A 4OADA 4AVBA 1Y9KA 4H6ZA 4KOXA 4U5YA 4JLYA 4M3SA 4KLWA 4X5KA 3D8PA 3SHPA 1WK4A 4NCZA 3GYAA 3QB8A 3KKWA 2R98A 3ZZIA 2FT0A 1N71A 2R1IA 4RS2A 4FD5A 3TO6A 1P0HA 3CXSA 4XPDC 2PDOA 3H4QA 2Q0YA 3DNSA 3JUWA 4PK2A 1FY7A 3MGDA 4EVYA 4J3GA 2ZXVA 1L0CA 4CRYB 2OZGA 4QB9A 2GIVA 5DWMA 4Y49B 4KOYA 1S60A 2B4DA 2FXFA 4MY3A 3S6GA 3R9EA 3EY5A 3I3GA 1WWZA 3LD2A 2GANA 5F48A 2DXQA 1R57A 2K5TA 2B3UA 5GCNA 2Z10A 1QSTA 1YK3A 4U9YA 1KZFA 3BLNA 2FCKA 3W6SA 3PP9A 4KOUA 1M44A 3V8IA 2ZW6A 5HH1A 3R96A 4NF1A 2CNTA 4MY0A 2OZUA 1CM0A 4HNXB 1IIDA 4DNCA 4NSQA 3LODA 3GKRA 3PZJA 4KOTA 4JXQA 2Q4VA 2JDDA 3W6XA 2B3VA 1CJWA 4FD4A 2Q04A 4HNWB 2REEA 3QAHA 4KUAA 3EC4A 3IGRA 5EBVA 2CNMA 3D2MA 1XF8A 2PR8A 3N7ZA 2H5MA 4UWIA 2CY2A 1IYKA 2G3AA 1V0CA 4R3KA 2J8MA 1YVOA 3K9UA 2D4OA 3EXNA 4JXRA 1RO5A 1MJ9A 1LRZA 2P6EA 3T90A 2B58A 2HUZA 4PK3A 2X7BA 3CXQA 2ZPAA 2B5GB 4H6UA 4XNHC 3BJ7A 3EO4A 3P2FA 4YRHA 2FSRA 3S6HA 1NMTA 3FBUA 3FYNA 5H86A 3T9YA 3RYOA 1Y9WA 3P2HA 4LX9A 1MJAA 5IX3A 2JDCA 3FB3A 1VKCA 3I9SA 1YLEA 4R3LA 2GE3A 4QBJA 2R7HA 1QSOA 4JWPA 4YFJA 1K4JA 4MJ8A 5I0CA 2CNSA 2P6FA 4YGOA 5IV0A 1GHEA 2VZYA 4H89A 1SQHA 1QSNA 4XPLA 2BSWA 3FNCA 2WPXA 3TFYA 2A4NA 1KUXA 4B5PB 2P6GA 4ORFA 2R8VA 2AE6A 5EC4A 3WR7A 3DDDA 4M85A 4E0AA 2Z11A 4CAWA 1Z9UA 3F0AA 4KVOE 1IB1E 4RI1A 2JLMA 4PSWA 2QIRA 2VQYA 3VWDA 4PSXA 2B5GA 1MK4A 1M1DA 2O28A 5JQ4A 4KOVA 1B6BA 1M4DA 3R1KA 2FL4A 1S5KA 2KCWA 3C26A 3G8WA 3FXTA 5F46A 5E96A 1Z4EA 4F0YA 2FIWA 3G3SA 4UA3A 2NMTA 5KTAA 3S6KA 5C88A 2BUEA 5J8CA 1Q2DA 2HQYA 1M4GA 4KUBA 3TO7A 1IICA 2PQ8A 2BEIA 1XEBA 4KLVA 1Q2CA 5ISVA 2D4PA 1XE4A 4MI4A 1S7FA 4KORA 2AJ6A 4R87A 5KTDA 4I49A 4Y49C 1S7NA 2EVNA 5KTCA 3D2PA 4AG9A 1Z4RA 5F47A 4QVTA 4QC6A 1RXTA 2OH1A 4R57A 3R9GA 4PV6A 2JEVA 4B5PA 3W91A 4MBUA 4R9MA 1U6MA 4XPDB 3D3SA 4U9ZA 1KUVA 2VBQA 3FIXA 4FD7A
chains in the Genus database with same CATH superfamily
2O53A 4UWJA 2Q4YA 4R6TA 1XIXA 2PJCA 5LYDA 1OZPA 3EFAA 2OOTA 3NH4A 2OZHA 2GLJA 2Q51A 3B8GA 3B3VA 5HMNA 3GB0A 4Q38A 1LOKA 2ZW7A 4EMEA 1B87A 1F2OA 4C2ZA 2FIAA 4UIAA 2OU2A 1Q2YA 5JH9A 1YREA 3BXMA 1ZG9A 1IYLA 1CG2A 2Y0MA 5DWNA 2WUUA 4CAVA 2ATRA 3DR8A 4MHPA 4FBEA 1YR0A 3B3TA 1BO4A 4L8AA 2B4BA 2DPSA 2IMOA 2ZEDA 4UEZA 3UY5A 2C6GA 4KOWA 4NXYA 1FT7A 1S3ZA 3DSBA 5D8NA 3TOAA 4IF5A 3TTHA 4WJBA 2HV2A 2PJ8A 3GIUA 4AXVA 4OAEA 3R9FA 4A31A 4M6HA 1HEEA 1TIQA 2QMLA 2FE7A 4BMHA 1XJOA 2XEGA 1TKFA 2C6CA 1IU8A 3FEDA 4MHDA 3GLJA 4A37A 2OR4A 3VWEA 4MFKA 2CTBA 2VZZA 1BOBA 4E8OA 3TCVA 5ELYA 3IC1A 4H2KA 3SJFA 4AB7A 4UIBA 2Z3MA 3B3WA 4IUSA 4B5OA 1P4NA 4QUSA 1PU9A 1HDUA 3IWGA 5LYIA 3TO9A 4LUAA 2ZEEA 2GLFA 4Z65A 4P10A 3FRMA 3IEHA 2RC4A 3KI9A 3WC5A 4II9A 2EUIA 2PJBA 4CS0B 3F5BA 4KSIA 2VXKA 2ZEPA 1M4IA 2PE3A 1VHEA 4NEXA 4CYNA 5JM6A 3SI2A 1DE4C 2XEIA 3PGPA 2Q7BA 4MRIA 1FNOA 4JD6A 4MHYA 1KWMA 3B2YA 4YWYA 1ON0A 3T8WA 3RBUA 4MFZA 4CRZB 4O23A 1YVKA 4E2AA 1KUYA 2F7VA 1HDQA 2PSWA 4ZY0A 4K3NA 2QECA 2ZW4A 4OLLA 4OC5A 4R8FA 4HPSA 5CBMA 5AG6A 1R3NA 1GYTA 2PJ7A 1S7LA 5C82A 5J8FA 1VIXA 2YGWA 2C27A 4CYPA 1LANA 4NJRA 5HVGA 3E0KA 3SI1A 3IIBA 5IB0A 4IK2A 1ZO0A 2FS5A 4HNYB 1MJBA 2G0BA 4LQ6A 5LRKA 4X2TA 1QQ9A 2Z3NA 3KR5A 4GM5A 3V38A 3BJ8A 2I79A 3R95A 4F9UA 4KSAA 2PC1A 4M6GA 4MCQA 4GXHA 4MCSA 2PRBA 1VHSA 2QJ8A 4P45A 4UBRA 3S6FA 5CNPA 5FVJA 5I4MA 1Y0RA 3SXNA 2NYQA 1S7KA 3FEEA 1I1DA 1Y7RA 2F8HA 2YNDA 2Z3KA 2REFA 5JPHA 5HXDA 4HKFA 4ZI6A 2YNCA 2Z0ZA 4GS4A 2BCOA 2YNEA 4F8ZA 4KVME 3JTKA 3SJXA 5IB9A 4XNHB 1F2PA 2J8RA 2P0WA 1YGHA 4YU9A 1CP6A 4AG7A 4CAXA 4OIDA 1YX0A 1TKHA 1QSMA 4NGTA 1XMTA 3VATA 2PJ2A 3NE7A 2PJAA 2BL1A 1QSRA 2VI7A 4KOSA 3MRUA 4PPZA 1NSLA 3TOBA 2VEZA 5F49A 4KZTA 2ZEHA 2Q4ZA 4ONUA 4ZBGA 4AVCA 3NA6A 2ARHA 3K9TA 3DR6A 3TT2A 4K30A 2V8DA 3NFZA 3BI0A 3IJ3A 3ZJ0A 4AVAA 2F5IA 2WPWA 3FH4A 2ZOFA 4JJXA 2IL4A 4B11A 4P6YA 4P4FA 1I12A 1I21A 4MXUA 4A32A 5JGFA 3PBBA 4PXDA 2ZW5A 4NGQA 3N5FA 1VHOA 1CPXA 1Z8TA 1NE9A 5AG5A 4XPKA 3TC8A 7CPAA 3CXPA 1JWQA 2AFMA 1J4JA 3JVNA 4FD6A 2B4DB 3SXOA 3GY9A 5H84A 5AG4A 3D4UA 3IU1A 4F6AA 5A27A 3H8FA 2G9DA 1YSJA 4FUUA 1UFHA 1DTDA 2J8NA 4L89A 4B13A 2DPTA 4A39A 3F8KA 4JZ0A 4CGOA 2Q44A 3WABA 2PR1A 1PUAA 1ZLIA 2ANPA 1Z8XA 3K2KA 1ZG7A 3D68A 4ZX9A 3TE4A 2G3TA 2ODFA 2WYRA 4NFRA 2I00A 4UFXA 3OWCA 1LAMA 2OB0A 4KVXA 4OADA 4Q36A 4AVBA 2POKA 1X12A 1Y9KA 3S9MA 4B14A 4H6ZA 2PJ4A 2PIZA 4KOXA 4U5YA 4JLYA 4A38A 5LYFA 1BAVA 4M3SA 4KLWA 3QAYA 2QYVA 4P4DA 4X5KA 3D8PA 1VGYA 3SHPA 1WK4A 2Z3PA 4NCZA 3GYAA 3QB8A 3KKWA 4DUKA 2R98A 3D7FA 2FT0A 3ZZIA 2JBJA 1N71A 1RTQA 2R1IA 4UEEA 4RS2A 4FD5A 4OKOA 3TO6A 4PQAA 1P0HA 2PJ0A 4UF4A 5D29A 4ZY2A 3CXSA 1M4LA 4CYOA 4FWUA 3NH5A 3IFEA 3B7IA 2PDOA 4XPDC 3KL9A 4PXCA 3H4QA 8CPAA 3KGQA 2Q7SA 2DF5A 2Q0YA 3DNSA 4P4EA 1IOFA 3JUWA 4PK2A 1FY7A 4UEFA 4W9YA 3MGDA 4C7IA 4EVYA 4J3GA 2ZXVA 1XBUA 1L0CA 3PFEA 2EBJA 4MHZA 4OMEA 4CRYB 2OZGA 3CPXA 2GIVA 4QB9A 5DWMA 4Y49B 3HUVA 1S60A 2ABZA 2B4DA 2CIJA 2FXFA 3KHXA 4KOYA 4JYWA 4MY3A 1TF9A 4UCMA 1X10A 3EY5A 3QNVA 3R9EA 3I3GA 1WWZA 2C6PA 3LD2A 2XEFA 3RZAA 4PXBA 2GANA 3KQXA 5F48A 2NSMA 3FX6A 5KTDA 1YLOA 2AFZA 3CDXA 2DXQA 3B3SA 3NE8A 3PB7X 1R57A 3FF3A 5J1QA 2K5TA 4EWTA 2BOAA 2B3UA 3PB9X 4OC1A 5GCNA 2Z10A 3IU2A 2CF4A 1QSTA 2GREA 1YK3A 2VL1A 3CZXA 3IWWA 1YW6A 4U9YA 2YNCC 1KZFA 4UFWA 3BLNA 2DEAA 2FCKA 5F09A 2PJ3A 3KASA 3W6SA 4A94A 5K8NA 2JBKA 2Q43A 1PYTB 3PP9A 3PRTA 2PJ9A 5K8OA 3D7HA 4KOUA 1M44A 3V8IA 3KR4A 2ZW6A 5HH1A 3R96A 5DS0A 2HC9A 4NF1A 2CNTA 3S9NA 4MY0A 3FECA 1R43A 2OZUA 1LFWA 3DGVA 4B10A 1CM0A 2V8GA 1IIDA 3KHZA 4HNXB 4NSQA 4DNCA 3NH8A 1BPNA 3H8EA 3LODA 2XEJA 1ZG8A 3GKRA 3PZJA 4KOTA 5LYLA 2GU2A 3FVLA 3ISXA 2JEWA 4UCPA 4UFVA 5EMIA 1NSAA 4JXQA 4LQGA 2Q4VA 4OC4A 2JDDA 5AG7A 4RUHA 4R7MA 3W6XA 2B3VA 3RAMA 3HLPA 1CJWA 4IAVA 2C1CA 4BINA 1LCPA 4FD4A 3BI1A 4A30A 3CT9A 2Q04A 4CGLA 4HNWB 1ELLP 2PRQA 4DYOA 2REEA 1AUGA 1ARLA 2CXAA 1A2ZA 3QAHA 4KUAA 1Y0YA 3EC4A 1BLLE 3IGRA 4KS9A 2CNMA 3D2MA 5EBVA 1XF8A 2PR8A 4NJQA 3N7ZA 3PB8X 2CTCA 2H5MA 4CAEA 4MFPA 4UWIA 2CY2A 4F0XA 1IYKA 2G3AA 1V0CA 2I3CA 4C2XA 4R3KA 2J8MA 1YVOA 4CGPA 1EE3P 2AFXA 3K9UA 2D4OA 3EXNA 4B12A 4JXRA 1RO5A 1XMBA 1MJ9A 2PVVA 1LRZA 2P6EA 3T90A 2B58A 2HUZA 4PK3A 5G21A 6CPAA 2X7BA 4ZGYB 1YW4A 4C7HA 3WT4A 3CXQA 1LAPA 2ZPAA 5A28A 2B5GB 4TNUA 4H6UA 4XNHC 3BJ7A 2QVPA 3EO4A 3P2FA 4KSFA 4YRHA 2FSRA 3IWEA 4OP4A 4MCPA 4OC0A 4A95A 4F9VA 3S6HA 1NMTA 1CP7A 2PIYA 4WWVA 4A2ZA 3FBUA 3FYNA 2ZEFA 2AFOA 5H86A 4ONWA 4ZYQA 3I1UA 4IHMA 3T9YA 3RYOA 3VARA 4FAIA 1Y9WA 3P2HA 4LX9A 4CPAA 2BO9A 1MJAA 3S6GA 5IX3A 2JDCA 3FB3A 5THWA 1CPSA 3H5ZA 1CX8A 1VKCA 1TXRA 3I9SA 1XRYA 3D67A 4MFQA 4TWEA 1YLEA 4R3LA 2GE3A 2EO8A 4BD9A 4QBJA 2R7HA 3B35A 1QSOA 4JWPA 1Z8LA 3D66A 3TX8A 2RFHA 4A33A 1TKJA 4YFJA 1K4JA 4MJ8A 5I0CA 3V7ZA 2PCUA 2CNSA 5HVFA 2P6FA 4P4IA 1H8LA 4YGOA 4MFLA 1AMPA 5IV0A 4Q7AA 1GHEA 4MFJA 1XOVA 2VZYA 4P4BA 1BPMA 3IO1A 5K8PA 4MMOA 4H89A 4P4JA 1SQHA 1QSNA 2WSAA 2BSWA 4XPLA 3FNCA 1ARMA 4PXEA 3S9LA 4C2YA 2WPXA 4EFDA 3LMSA 5G1ZA 3TFYA 1QMUA 4ZY1A 2A4NA 1KUXA 4B5PB 2P6GA 4ORFA 3WC7A 2R8VA 1CBXA 2AE6A 2EK8A 5EC4A 5G22A 3WR7A 3DDDA 3FMCA 4M85A 2PJ1A 4E0AA 2Z11A 3MN8A 4CAWA 4R76A 3DLJA 2IQ6A 1YQEA 1Z9UA 3F0AA 4KVOE 1IB1E 4RI1A 1OBRA 2JLMA 2AFUA 3PFOA 4NGNA 1PCAA 3SJEA 4PSWA 2QIRA 3VH9A 2VQYA 3VWDA 2ZENA 1Q7LA 2B5GA 2EWBA 1MK4A 1M1DA 2IJZA 3KZWA 4PSXA 3KQZA 4RN7A 2O28A 2PJ6A 4X3RA 1ELMP 2HB6A 1Z5RA 3LWUA 4KOVA 3RNZA 5JQ4A 4CAFA 1B6BA 1IGBA 5G20A 1AYEA 1M4DA 2FVGA 3R1KA 5BWAB 1Z8WA 2V8VA 1UWYA 2FL4A 3CPAA 1S5KA 2KCWA 3A9LA 3C26A 4X8IA 3G8WA 2PVWA 3FXTA 4OIWA 3GUXA 4B6ZA 4G1PA 1F57A 5F46A 3D7DA 2GFQA 2V77A 3SI0A 5HVHA 3RO0A 2ZEOA 5E96A 2EK9A 4MHNA 4NGMA 5CPAA 5AGEA 1Z4EA 4F0YA 1ZLHA 2Z3OA 3FJUA 3JRUA 2FIWA 3G3SA 4UA3A 2NMTA 5KTAA 1YMEA 2PJ5A 4MCRA 2AFWA 3S6KA 3SJGA 5C88A 4OC3A 3D7GA 2BUEA 5J8CA 1Q2DA 2HQYA 1M4GA 2O4HA 4KUBA 3TO7A 1IICA 5LRGA 2PQ8A 2BEIA 1XEBA 4P44A 2ZELA 4KLVA 4CYQA 2ZEGA 1Q2CA 4UCNA 4NGSA 5ISVA 4BBHA 1Y7EA 2D4PA 1XE4A 4NGPA 4MI4A 1IOIA 1S7FA 4KORA 4OC2A 3PB4X 1TF8A 2AJ6A 2RB7A 2ZOGA 3LACA 4R87A 3H8GA 4I49A 4Y49C 3BHXA 1S7NA 2AFSA 4CGNA 4DJLA 3ISZA 3B3CA 2EVNA 1JQGA 1IY7A 2V8HA 4CGMA 5KTCA 3D2PA 4AG9A 2Z3LA 1Z4RA 5F47A 1Z2LA 3L2NA 4QVTA 4QC6A 1RXTA 2WZNA 2OH1A 3WC6A 4R57A 3R9GA 4PV6A 1XFOA 2JEVA 4B5PA 2ZEMA 4NGRA 2J9AA 5K8MA 3PB6X 3PEIA 4M6IA 4MBUA 4R9MA 3W91A 5LRJA 1U6MA 4XPDB 4ZX8A 3D3SA 3PBEA 4U9ZA 4C68A 1KUVA 2VBQA 3FIXA 4FD7A
chains in the Genus database with same CATH topology
4UWJA 2Q4YA 1XIXA 1OZPA 3EFAA 2OZHA 3B8GA 5HMNA 4Q38A 2ZW7A 1B87A 4C2ZA 2FIAA 2OU2A 1Q2YA 1YREA 1IYLA 2Y0MA 5DWNA 2WUUA 4CAVA 2ATRA 3DR8A 1YR0A 4L8AA 1BO4A 2B4BA 2DPSA 3UY5A 4KOWA 4NXYA 1S3ZA 3DSBA 3TOAA 3TTHA 4IF5A 2HV2A 4OAEA 3R9FA 4A31A 1TIQA 2QMLA 2FE7A 4BMHA 4MHDA 3VWEA 4MFKA 2VZZA 1BOBA 4E8OA 3TCVA 4AB7A 2Z3MA 4IUSA 4B5OA 1P4NA 4QUSA 1PU9A 3IWGA 3TO9A 4LUAA 3FRMA 4II9A 2RC4A 2EUIA 4CS0B 3F5BA 2VXKA 1M4IA 4NEXA 4CYNA 3PGPA 2Q7BA 4JD6A 1ON0A 4CRZB 4MFZA 4E2AA 1YVKA 1KUYA 2PSWA 2QECA 2ZW4A 4OLLA 5AG6A 1S7LA 5C82A 5J8FA 2YGWA 2C27A 4CYPA 3E0KA 5IB0A 1ZO0A 2FS5A 4HNYB 1MJBA 2G0BA 2Z3NA 3BJ8A 2I79A 3R95A 4KSAA 2PC1A 2PRBA 1VHSA 4UBRA 3S6FA 5CNPA 5FVJA 3SXNA 1S7KA 1I1DA 1Y7RA 2YNDA 2Z3KA 2REFA 5JPHA 4HKFA 2YNCA 2Z0ZA 4GS4A 2YNEA 4KVME 3JTKA 4XNHB 2J8RA 2P0WA 1YGHA 4AG7A 4CAXA 1YX0A 1QSMA 1XMTA 3NE7A 2BL1A 1QSRA 2VI7A 4KOSA 1NSLA 3TOBA 2VEZA 5F49A 4KZTA 4ONUA 4ZBGA 4AVCA 2ARHA 3DR6A 3TT2A 4K30A 3ZJ0A 4AVAA 2F5IA 2WPWA 4JJXA 2IL4A 4B11A 1I12A 1I21A 4A32A 2ZW5A 1NE9A 5AG5A 4XPKA 3CXPA 1J4JA 3JVNA 4FD6A 2B4DB 3SXOA 3GY9A 5H84A 5AG4A 3IU1A 4F6AA 5A27A 1UFHA 4B13A 2J8NA 4L89A 2DPTA 3F8KA 4CGOA 2Q44A 2PR1A 1PUAA 3TE4A 2G3TA 2I00A 4UFXA 3OWCA 4KVXA 2OB0A 4OADA 4Q36A 4AVBA 1Y9KA 4B14A 4H6ZA 4KOXA 4U5YA 4JLYA 4M3SA 4KLWA 4X5KA 3D8PA 3SHPA 1WK4A 2Z3PA 4NCZA 3GYAA 3QB8A 3KKWA 2R98A 3ZZIA 2FT0A 1N71A 2R1IA 4RS2A 4FD5A 3TO6A 1P0HA 4CYOA 3CXSA 4XPDC 2PDOA 3H4QA 2Q0YA 3DNSA 3JUWA 4PK2A 1FY7A 3MGDA 4C7IA 4EVYA 4J3GA 2ZXVA 1L0CA 4CRYB 2OZGA 4QB9A 2GIVA 5DWMA 4Y49B 4KOYA 1S60A 2B4DA 2FXFA 4MY3A 3S6GA 4UCMA 3R9EA 3EY5A 3I3GA 1WWZA 3LD2A 2GANA 5F48A 2DXQA 1R57A 2K5TA 2B3UA 5GCNA 2Z10A 3IU2A 1QSTA 1YK3A 4U9YA 2YNCC 1KZFA 4UFWA 3BLNA 2FCKA 3W6SA 3PP9A 4KOUA 1M44A 3V8IA 2ZW6A 5HH1A 3R96A 4NF1A 2CNTA 4MY0A 2OZUA 4B10A 1CM0A 4HNXB 1IIDA 4DNCA 4NSQA 3LODA 3GKRA 3PZJA 4KOTA 4UCPA 4UFVA 4JXQA 2Q4VA 2JDDA 5AG7A 3W6XA 2B3VA 1CJWA 4FD4A 4A30A 2Q04A 4CGLA 4HNWB 2REEA 2CXAA 3QAHA 4KUAA 3EC4A 3IGRA 4KS9A 2CNMA 3D2MA 5EBVA 1XF8A 2PR8A 3N7ZA 4CAEA 2H5MA 4MFPA 4UWIA 2CY2A 4F0XA 1IYKA 2G3AA 1V0CA 4C2XA 4R3KA 2J8MA 1YVOA 4CGPA 3K9UA 2D4OA 3EXNA 4B12A 4JXRA 1RO5A 1MJ9A 1LRZA 2P6EA 3T90A 2B58A 2HUZA 4PK3A 5G21A 2X7BA 4ZGYB 4C7HA 3CXQA 2ZPAA 5A28A 2B5GB 4H6UA 4XNHC 3BJ7A 4KSFA 3EO4A 3P2FA 4YRHA 2FSRA 3IWEA 4A95A 3S6HA 1NMTA 4A2ZA 3FBUA 3FYNA 5H86A 3T9YA 3RYOA 1Y9WA 3P2HA 4LX9A 1MJAA 5IX3A 2JDCA 3FB3A 3H5ZA 1VKCA 3I9SA 4MFQA 1YLEA 4R3LA 2GE3A 4QBJA 2R7HA 1QSOA 4JWPA 4A33A 4YFJA 1K4JA 4MJ8A 5I0CA 2CNSA 2P6FA 4YGOA 4MFLA 5IV0A 1GHEA 4MFJA 2VZYA 4H89A 1SQHA 1QSNA 2WSAA 2BSWA 4XPLA 3FNCA 4C2YA 2WPXA 5G1ZA 3TFYA 2A4NA 1KUXA 4B5PB 2P6GA 4ORFA 2R8VA 2AE6A 5EC4A 5G22A 3WR7A 3DDDA 4M85A 4E0AA 2Z11A 4CAWA 1Z9UA 3F0AA 4KVOE 1IB1E 4RI1A 2JLMA 4PSWA 2QIRA 2VQYA 3VWDA 4PSXA 2B5GA 1MK4A 1M1DA 2O28A 5JQ4A 4KOVA 4CAFA 1B6BA 5G20A 1M4DA 3R1KA 5BWAB 2FL4A 1S5KA 2KCWA 3A9LA 3C26A 3G8WA 3FXTA 5F46A 5E96A 5AGEA 1Z4EA 4F0YA 2Z3OA 2FIWA 3G3SA 4UA3A 2NMTA 5KTAA 3S6KA 5C88A 2BUEA 5J8CA 1Q2DA 2HQYA 1M4GA 4KUBA 3TO7A 1IICA 2PQ8A 2BEIA 1XEBA 4CYQA 4KLVA 1Q2CA 4UCNA 5ISVA 4BBHA 2D4PA 1XE4A 4MI4A 1S7FA 4KORA 2AJ6A 4R87A 5KTDA 4I49A 4Y49C 4CGNA 1S7NA 2EVNA 4CGMA 5KTCA 3D2PA 4AG9A 2Z3LA 1Z4RA 5F47A 4QVTA 4QC6A 1RXTA 2OH1A 4R57A 3R9GA 4PV6A 2JEVA 4B5PA 3W91A 4MBUA 4R9MA 1U6MA 4XPDB 3D3SA 4U9ZA 4C68A 1KUVA 2VBQA 3FIXA 4FD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UWJ A;  2Q4Y A;  1XIX A;  1OZP A;  3EFA A;  2OZH A;  3B8G A;  5HMN A;  2ZW7 A;  1B87 A;  2FIA A;  2OU2 A;  1Q2Y A;  1YRE A;  1IYL A;  2Y0M A;  5DWN A;  4CAV A;  2ATR A;  3DR8 A;  1YR0 A;  4L8A A;  1BO4 A;  2B4B A;  3UY5 A;  4KOW A;  4NXY A;  1S3Z A;  3DSB A;  3TOA A;  3TTH A;  4IF5 A;  2HV2 A;  4OAE A;  3R9F A;  1TIQ A;  2QML A;  2FE7 A;  4BMH A;  4MHD A;  3VWE A;  2VZZ A;  1BOB A;  4E8O A;  3TCV A;  4AB7 A;  4IUS A;  4B5O A;  1P4N A;  4QUS A;  1PU9 A;  3IWG A;  3TO9 A;  4LUA A;  3FRM A;  4II9 A;  2RC4 A;  2EUI A;  4CS0 B;  3F5B A;  2VXK A;  1M4I A;  4NEX A;  3PGP A;  2Q7B A;  4JD6 A;  1ON0 A;  4CRZ B;  4E2A A;  1YVK A;  1KUY A;  2PSW A;  2QEC A;  2ZW4 A;  4OLL A;  1S7L A;  5C82 A;  5J8F A;  2C27 A;  3E0K A;  5IB0 A;  2FS5 A;  4HNY B;  1MJB A;  2G0B A;  3BJ8 A;  2I79 A;  3R95 A;  2PC1 A;  2PRB A;  1VHS A;  4UBR A;  3S6F A;  5CNP A;  5FVJ A;  3SXN A;  1S7K A;  1I1D A;  1Y7R A;  2REF A;  5JPH A;  4HKF A;  2Z0Z A;  4GS4 A;  4KVM E;  4XNH B;  2J8R A;  2P0W A;  1YGH A;  4AG7 A;  4CAX A;  1YX0 A;  1QSM A;  1XMT A;  3NE7 A;  2BL1 A;  1QSR A;  2VI7 A;  4KOS A;  1NSL A;  3TOB A;  2VEZ A;  5F49 A;  4KZT A;  4ONU A;  4ZBG A;  4AVC A;  2ARH A;  3DR6 A;  3TT2 A;  4K30 A;  3ZJ0 A;  4AVA A;  2F5I A;  2WPW A;  4JJX A;  2IL4 A;  1I12 A;  1I21 A;  2ZW5 A;  1NE9 A;  4XPK A;  3CXP A;  1J4J A;  3JVN A;  4FD6 A;  2B4D B;  3SXO A;  3GY9 A;  5H84 A;  4F6A A;  1UFH A;  2J8N A;  4L89 A;  3F8K A;  2Q44 A;  2PR1 A;  1PUA A;  3TE4 A;  2G3T A;  2I00 A;  3OWC A;  4KVX A;  2OB0 A;  4OAD A;  4AVB A;  1Y9K A;  4H6Z A;  4KOX A;  4U5Y A;  4JLY A;  4M3S A;  4KLW A;  4X5K A;  3D8P A;  3SHP A;  1WK4 A;  4NCZ A;  3GYA A;  3QB8 A;  3KKW A;  2R98 A;  3ZZI A;  2FT0 A;  1N71 A;  2R1I A;  4RS2 A;  4FD5 A;  3TO6 A;  1P0H A;  3CXS A;  4XPD C;  2PDO A;  3H4Q A;  2Q0Y A;  3DNS A;  3JUW A;  4PK2 A;  1FY7 A;  3MGD A;  4EVY A;  4J3G A;  2ZXV A;  1L0C A;  4CRY B;  2OZG A;  4QB9 A;  2GIV A;  5DWM A;  4Y49 B;  4KOY A;  1S60 A;  2B4D A;  2FXF A;  4MY3 A;  3S6G A;  3R9E A;  3EY5 A;  3I3G A;  1WWZ A;  3LD2 A;  2GAN A;  5F48 A;  2DXQ A;  1R57 A;  2K5T A;  2B3U A;  5GCN A;  2Z10 A;  1QST A;  1YK3 A;  4U9Y A;  1KZF A;  3BLN A;  2FCK A;  3W6S A;  3PP9 A;  4KOU A;  1M44 A;  3V8I A;  2ZW6 A;  5HH1 A;  3R96 A;  4NF1 A;  2CNT A;  4MY0 A;  2OZU A;  1CM0 A;  4HNX B;  1IID A;  4DNC A;  4NSQ A;  3LOD A;  3GKR A;  3PZJ A;  4KOT A;  4JXQ A;  2Q4V A;  2JDD A;  3W6X A;  2B3V A;  1CJW A;  4FD4 A;  2Q04 A;  4HNW B;  2REE A;  3QAH A;  4KUA A;  3EC4 A;  3IGR A;  5EBV A;  2CNM A;  3D2M A;  1XF8 A;  2PR8 A;  3N7Z A;  2H5M A;  4UWI A;  2CY2 A;  1IYK A;  2G3A A;  1V0C A;  4R3K A;  2J8M A;  1YVO A;  3K9U A;  2D4O A;  3EXN A;  4JXR A;  1RO5 A;  1MJ9 A;  1LRZ A;  2P6E A;  3T90 A;  2B58 A;  2HUZ A;  4PK3 A;  2X7B A;  3CXQ A;  2ZPA A;  2B5G B;  4H6U A;  4XNH C;  3BJ7 A;  3EO4 A;  3P2F A;  4YRH A;  2FSR A;  3S6H A;  1NMT A;  3FBU A;  3FYN A;  5H86 A;  3T9Y A;  3RYO A;  1Y9W A;  3P2H A;  4LX9 A;  1MJA A;  5IX3 A;  2JDC A;  3FB3 A;  1VKC A;  3I9S A;  1YLE A;  4R3L A;  2GE3 A;  4QBJ A;  2R7H A;  1QSO A;  4JWP A;  4YFJ A;  1K4J A;  4MJ8 A;  5I0C A;  2CNS A;  2P6F A;  4YGO A;  5IV0 A;  1GHE A;  2VZY A;  4H89 A;  1SQH A;  1QSN A;  4XPL A;  2BSW A;  3FNC A;  2WPX A;  3TFY A;  2A4N A;  1KUX A;  4B5P B;  2P6G A;  4ORF A;  2R8V A;  2AE6 A;  5EC4 A;  3WR7 A;  3DDD A;  4M85 A;  4E0A A;  2Z11 A;  4CAW A;  1Z9U A;  3F0A A;  4KVO E;  1IB1 E;  4RI1 A;  2JLM A;  4PSW A;  2QIR A;  2VQY A;  3VWD A;  4PSX A;  2B5G A;  1MK4 A;  1M1D A;  2O28 A;  5JQ4 A;  4KOV A;  1B6B A;  1M4D A;  3R1K A;  2FL4 A;  1S5K A;  2KCW A;  3C26 A;  3G8W A;  3FXT A;  5F46 A;  5E96 A;  1Z4E A;  4F0Y A;  2FIW A;  3G3S A;  4UA3 A;  2NMT A;  5KTA A;  3S6K A;  5C88 A;  2BUE A;  5J8C A;  1Q2D A;  2HQY A;  1M4G A;  4KUB A;  3TO7 A;  1IIC A;  2PQ8 A;  2BEI A;  1XEB A;  4KLV A;  1Q2C A;  5ISV A;  2D4P A;  1XE4 A;  4MI4 A;  1S7F A;  4KOR A;  2AJ6 A;  4R87 A;  5KTD A;  4I49 A;  4Y49 C;  1S7N A;  2EVN A;  5KTC A;  3D2P A;  4AG9 A;  1Z4R A;  5F47 A;  4QVT A;  4QC6 A;  1RXT A;  2OH1 A;  4R57 A;  3R9G A;  4PV6 A;  2JEV A;  4B5P A;  3W91 A;  4MBU A;  4R9M A;  1U6M A;  4XPD B;  3D3S A;  4U9Z A;  1KUV A;  2VBQ A;  3FIX A;  4FD7 A; 
#chains in the Genus database with same CATH topology
 2O53 A;  4UWJ A;  2Q4Y A;  4R6T A;  1XIX A;  2PJC A;  5LYD A;  1OZP A;  3EFA A;  2OOT A;  3NH4 A;  2OZH A;  2GLJ A;  2Q51 A;  3B8G A;  3B3V A;  5HMN A;  3GB0 A;  4Q38 A;  1LOK A;  2ZW7 A;  4EME A;  1B87 A;  1F2O A;  4C2Z A;  2FIA A;  4UIA A;  2OU2 A;  1Q2Y A;  5JH9 A;  1YRE A;  3BXM A;  1ZG9 A;  1IYL A;  1CG2 A;  2Y0M A;  5DWN A;  2WUU A;  4CAV A;  2ATR A;  3DR8 A;  4MHP A;  4FBE A;  1YR0 A;  3B3T A;  1BO4 A;  4L8A A;  2B4B A;  2DPS A;  2IMO A;  2ZED A;  4UEZ A;  3UY5 A;  2C6G A;  4KOW A;  4NXY A;  1FT7 A;  1S3Z A;  3DSB A;  5D8N A;  3TOA A;  4IF5 A;  3TTH A;  4WJB A;  2HV2 A;  2PJ8 A;  3GIU A;  4AXV A;  4OAE A;  3R9F A;  4A31 A;  4M6H A;  1HEE A;  1TIQ A;  2QML A;  2FE7 A;  4BMH A;  1XJO A;  2XEG A;  1TKF A;  2C6C A;  1IU8 A;  3FED A;  4MHD A;  3GLJ A;  4A37 A;  2OR4 A;  3VWE A;  4MFK A;  2CTB A;  2VZZ A;  1BOB A;  4E8O A;  3TCV A;  5ELY A;  3IC1 A;  4H2K A;  3SJF A;  4AB7 A;  4UIB A;  2Z3M A;  3B3W A;  4IUS A;  4B5O A;  1P4N A;  4QUS A;  1PU9 A;  1HDU A;  3IWG A;  5LYI A;  3TO9 A;  4LUA A;  2ZEE A;  2GLF A;  4Z65 A;  4P10 A;  3FRM A;  3IEH A;  2RC4 A;  3KI9 A;  3WC5 A;  4II9 A;  2EUI A;  2PJB A;  4CS0 B;  3F5B A;  4KSI A;  2VXK A;  2ZEP A;  1M4I A;  2PE3 A;  1VHE A;  4NEX A;  4CYN A;  5JM6 A;  3SI2 A;  1DE4 C;  2XEI A;  3PGP A;  2Q7B A;  4MRI A;  1FNO A;  4JD6 A;  4MHY A;  1KWM A;  3B2Y A;  4YWY A;  1ON0 A;  3T8W A;  3RBU A;  4MFZ A;  4CRZ B;  4O23 A;  1YVK A;  4E2A A;  1KUY A;  2F7V A;  1HDQ A;  2PSW A;  4ZY0 A;  4K3N A;  2QEC A;  2ZW4 A;  4OLL A;  4OC5 A;  4R8F A;  4HPS A;  5CBM A;  5AG6 A;  1R3N A;  1GYT A;  2PJ7 A;  1S7L A;  5C82 A;  5J8F A;  1VIX A;  2YGW A;  2C27 A;  4CYP A;  1LAN A;  4NJR A;  5HVG A;  3E0K A;  3SI1 A;  3IIB A;  5IB0 A;  4IK2 A;  1ZO0 A;  2FS5 A;  4HNY B;  1MJB A;  2G0B A;  4LQ6 A;  5LRK A;  4X2T A;  1QQ9 A;  2Z3N A;  3KR5 A;  4GM5 A;  3V38 A;  3BJ8 A;  2I79 A;  3R95 A;  4F9U A;  4KSA A;  2PC1 A;  4M6G A;  4MCQ A;  4GXH A;  4MCS A;  2PRB A;  1VHS A;  2QJ8 A;  4P45 A;  4UBR A;  3S6F A;  5CNP A;  5FVJ A;  5I4M A;  1Y0R A;  3SXN A;  2NYQ A;  1S7K A;  3FEE A;  1I1D A;  1Y7R A;  2F8H A;  2YND A;  2Z3K A;  2REF A;  5JPH A;  5HXD A;  4HKF A;  4ZI6 A;  2YNC A;  2Z0Z A;  4GS4 A;  2BCO A;  2YNE A;  4F8Z A;  4KVM E;  3JTK A;  3SJX A;  5IB9 A;  4XNH B;  1F2P A;  2J8R A;  2P0W A;  1YGH A;  4YU9 A;  1CP6 A;  4AG7 A;  4CAX A;  4OID A;  1YX0 A;  1TKH A;  1QSM A;  4NGT A;  1XMT A;  3VAT A;  2PJ2 A;  3NE7 A;  2PJA A;  2BL1 A;  1QSR A;  2VI7 A;  4KOS A;  3MRU A;  4PPZ A;  1NSL A;  3TOB A;  2VEZ A;  5F49 A;  4KZT A;  2ZEH A;  2Q4Z A;  4ONU A;  4ZBG A;  4AVC A;  3NA6 A;  2ARH A;  3K9T A;  3DR6 A;  3TT2 A;  4K30 A;  2V8D A;  3NFZ A;  3BI0 A;  3IJ3 A;  3ZJ0 A;  4AVA A;  2F5I A;  2WPW A;  3FH4 A;  2ZOF A;  4JJX A;  2IL4 A;  4B11 A;  4P6Y A;  4P4F A;  1I12 A;  1I21 A;  4MXU A;  4A32 A;  5JGF A;  3PBB A;  4PXD A;  2ZW5 A;  4NGQ A;  3N5F A;  1VHO A;  1CPX A;  1Z8T A;  1NE9 A;  5AG5 A;  4XPK A;  3TC8 A;  7CPA A;  3CXP A;  1JWQ A;  2AFM A;  1J4J A;  3JVN A;  4FD6 A;  2B4D B;  3SXO A;  3GY9 A;  5H84 A;  5AG4 A;  3D4U A;  3IU1 A;  4F6A A;  5A27 A;  3H8F A;  2G9D A;  1YSJ A;  4FUU A;  1UFH A;  1DTD A;  2J8N A;  4L89 A;  4B13 A;  2DPT A;  4A39 A;  3F8K A;  4JZ0 A;  4CGO A;  2Q44 A;  3WAB A;  2PR1 A;  1PUA A;  1ZLI A;  2ANP A;  1Z8X A;  3K2K A;  1ZG7 A;  3D68 A;  4ZX9 A;  3TE4 A;  2G3T A;  2ODF A;  2WYR A;  4NFR A;  2I00 A;  4UFX A;  3OWC A;  1LAM A;  2OB0 A;  4KVX A;  4OAD A;  4Q36 A;  4AVB A;  2POK A;  1X12 A;  1Y9K A;  3S9M A;  4B14 A;  4H6Z A;  2PJ4 A;  2PIZ A;  4KOX A;  4U5Y A;  4JLY A;  4A38 A;  5LYF A;  1BAV A;  4M3S A;  4KLW A;  3QAY A;  2QYV A;  4P4D A;  4X5K A;  3D8P A;  1VGY A;  3SHP A;  1WK4 A;  2Z3P A;  4NCZ A;  3GYA A;  3QB8 A;  3KKW A;  4DUK A;  2R98 A;  3D7F A;  2FT0 A;  3ZZI A;  2JBJ A;  1N71 A;  1RTQ A;  2R1I A;  4UEE A;  4RS2 A;  4FD5 A;  4OKO A;  3TO6 A;  4PQA A;  1P0H A;  2PJ0 A;  4UF4 A;  5D29 A;  4ZY2 A;  3CXS A;  1M4L A;  4CYO A;  4FWU A;  3NH5 A;  3IFE A;  3B7I A;  2PDO A;  4XPD C;  3KL9 A;  4PXC A;  3H4Q A;  8CPA A;  3KGQ A;  2Q7S A;  2DF5 A;  2Q0Y A;  3DNS A;  4P4E A;  1IOF A;  3JUW A;  4PK2 A;  1FY7 A;  4UEF A;  4W9Y A;  3MGD A;  4C7I A;  4EVY A;  4J3G A;  2ZXV A;  1XBU A;  1L0C A;  3PFE A;  2EBJ A;  4MHZ A;  4OME A;  4CRY B;  2OZG A;  3CPX A;  2GIV A;  4QB9 A;  5DWM A;  4Y49 B;  3HUV A;  1S60 A;  2ABZ A;  2B4D A;  2CIJ A;  2FXF A;  3KHX A;  4KOY A;  4JYW A;  4MY3 A;  1TF9 A;  4UCM A;  1X10 A;  3EY5 A;  3QNV A;  3R9E A;  3I3G A;  1WWZ A;  2C6P A;  3LD2 A;  2XEF A;  3RZA A;  4PXB A;  2GAN A;  3KQX A;  5F48 A;  2NSM A;  3FX6 A;  5KTD A;  1YLO A;  2AFZ A;  3CDX A;  2DXQ A;  3B3S A;  3NE8 A;  3PB7 X;  1R57 A;  3FF3 A;  5J1Q A;  2K5T A;  4EWT A;  2BOA A;  2B3U A;  3PB9 X;  4OC1 A;  5GCN A;  2Z10 A;  3IU2 A;  2CF4 A;  1QST A;  2GRE A;  1YK3 A;  2VL1 A;  3CZX A;  3IWW A;  1YW6 A;  4U9Y A;  2YNC C;  1KZF A;  4UFW A;  3BLN A;  2DEA A;  2FCK A;  5F09 A;  2PJ3 A;  3KAS A;  3W6S A;  4A94 A;  5K8N A;  2JBK A;  2Q43 A;  1PYT B;  3PP9 A;  3PRT A;  2PJ9 A;  5K8O A;  3D7H A;  4KOU A;  1M44 A;  3V8I A;  3KR4 A;  2ZW6 A;  5HH1 A;  3R96 A;  5DS0 A;  2HC9 A;  4NF1 A;  2CNT A;  3S9N A;  4MY0 A;  3FEC A;  1R43 A;  2OZU A;  1LFW A;  3DGV A;  4B10 A;  1CM0 A;  2V8G A;  1IID A;  3KHZ A;  4HNX B;  4NSQ A;  4DNC A;  3NH8 A;  1BPN A;  3H8E A;  3LOD A;  2XEJ A;  1ZG8 A;  3GKR A;  3PZJ A;  4KOT A;  5LYL A;  2GU2 A;  3FVL A;  3ISX A;  2JEW A;  4UCP A;  4UFV A;  5EMI A;  1NSA A;  4JXQ A;  4LQG A;  2Q4V A;  4OC4 A;  2JDD A;  5AG7 A;  4RUH A;  4R7M A;  3W6X A;  2B3V A;  3RAM A;  3HLP A;  1CJW A;  4IAV A;  2C1C A;  4BIN A;  1LCP A;  4FD4 A;  3BI1 A;  4A30 A;  3CT9 A;  2Q04 A;  4CGL A;  4HNW B;  1ELL P;  2PRQ A;  4DYO A;  2REE A;  1AUG A;  1ARL A;  2CXA A;  1A2Z A;  3QAH A;  4KUA A;  1Y0Y A;  3EC4 A;  1BLL E;  3IGR A;  4KS9 A;  2CNM A;  3D2M A;  5EBV A;  1XF8 A;  2PR8 A;  4NJQ A;  3N7Z A;  3PB8 X;  2CTC A;  2H5M A;  4CAE A;  4MFP A;  4UWI A;  2CY2 A;  4F0X A;  1IYK A;  2G3A A;  1V0C A;  2I3C A;  4C2X A;  4R3K A;  2J8M A;  1YVO A;  4CGP A;  1EE3 P;  2AFX A;  3K9U A;  2D4O A;  3EXN A;  4B12 A;  4JXR A;  1RO5 A;  1XMB A;  1MJ9 A;  2PVV A;  1LRZ A;  2P6E A;  3T90 A;  2B58 A;  2HUZ A;  4PK3 A;  5G21 A;  6CPA A;  2X7B A;  4ZGY B;  1YW4 A;  4C7H A;  3WT4 A;  3CXQ A;  1LAP A;  2ZPA A;  5A28 A;  2B5G B;  4TNU A;  4H6U A;  4XNH C;  3BJ7 A;  2QVP A;  3EO4 A;  3P2F A;  4KSF A;  4YRH A;  2FSR A;  3IWE A;  4OP4 A;  4MCP A;  4OC0 A;  4A95 A;  4F9V A;  3S6H A;  1NMT A;  1CP7 A;  2PIY A;  4WWV A;  4A2Z A;  3FBU A;  3FYN A;  2ZEF A;  2AFO A;  5H86 A;  4ONW A;  4ZYQ A;  3I1U A;  4IHM A;  3T9Y A;  3RYO A;  3VAR A;  4FAI A;  1Y9W A;  3P2H A;  4LX9 A;  4CPA A;  2BO9 A;  1MJA A;  3S6G A;  5IX3 A;  2JDC A;  3FB3 A;  5THW A;  1CPS A;  3H5Z A;  1CX8 A;  1VKC A;  1TXR A;  3I9S A;  1XRY A;  3D67 A;  4MFQ A;  4TWE A;  1YLE A;  4R3L A;  2GE3 A;  2EO8 A;  4BD9 A;  4QBJ A;  2R7H A;  3B35 A;  1QSO A;  4JWP A;  1Z8L A;  3D66 A;  3TX8 A;  2RFH A;  4A33 A;  1TKJ A;  4YFJ A;  1K4J A;  4MJ8 A;  5I0C A;  3V7Z A;  2PCU A;  2CNS A;  5HVF A;  2P6F A;  4P4I A;  1H8L A;  4YGO A;  4MFL A;  1AMP A;  5IV0 A;  4Q7A A;  1GHE A;  4MFJ A;  1XOV A;  2VZY A;  4P4B A;  1BPM A;  3IO1 A;  5K8P A;  4MMO A;  4H89 A;  4P4J A;  1SQH A;  1QSN A;  2WSA A;  2BSW A;  4XPL A;  3FNC A;  1ARM A;  4PXE A;  3S9L A;  4C2Y A;  2WPX A;  4EFD A;  3LMS A;  5G1Z A;  3TFY A;  1QMU A;  4ZY1 A;  2A4N A;  1KUX A;  4B5P B;  2P6G A;  4ORF A;  3WC7 A;  2R8V A;  1CBX A;  2AE6 A;  2EK8 A;  5EC4 A;  5G22 A;  3WR7 A;  3DDD A;  3FMC A;  4M85 A;  2PJ1 A;  4E0A A;  2Z11 A;  3MN8 A;  4CAW A;  4R76 A;  3DLJ A;  2IQ6 A;  1YQE A;  1Z9U A;  3F0A A;  4KVO E;  1IB1 E;  4RI1 A;  1OBR A;  2JLM A;  2AFU A;  3PFO A;  4NGN A;  1PCA A;  3SJE A;  4PSW A;  2QIR A;  3VH9 A;  2VQY A;  3VWD A;  2ZEN A;  1Q7L A;  2B5G A;  2EWB A;  1MK4 A;  1M1D A;  2IJZ A;  3KZW A;  4PSX A;  3KQZ A;  4RN7 A;  2O28 A;  2PJ6 A;  4X3R A;  1ELM P;  2HB6 A;  1Z5R A;  3LWU A;  4KOV A;  3RNZ A;  5JQ4 A;  4CAF A;  1B6B A;  1IGB A;  5G20 A;  1AYE A;  1M4D A;  2FVG A;  3R1K A;  5BWA B;  1Z8W A;  2V8V A;  1UWY A;  2FL4 A;  3CPA A;  1S5K A;  2KCW A;  3A9L A;  3C26 A;  4X8I A;  3G8W A;  2PVW A;  3FXT A;  4OIW A;  3GUX A;  4B6Z A;  4G1P A;  1F57 A;  5F46 A;  3D7D A;  2GFQ A;  2V77 A;  3SI0 A;  5HVH A;  3RO0 A;  2ZEO A;  5E96 A;  2EK9 A;  4MHN A;  4NGM A;  5CPA A;  5AGE A;  1Z4E A;  4F0Y A;  1ZLH A;  2Z3O A;  3FJU A;  3JRU A;  2FIW A;  3G3S A;  4UA3 A;  2NMT A;  5KTA A;  1YME A;  2PJ5 A;  4MCR A;  2AFW A;  3S6K A;  3SJG A;  5C88 A;  4OC3 A;  3D7G A;  2BUE A;  5J8C A;  1Q2D A;  2HQY A;  1M4G A;  2O4H A;  4KUB A;  3TO7 A;  1IIC A;  5LRG A;  2PQ8 A;  2BEI A;  1XEB A;  4P44 A;  2ZEL A;  4KLV A;  4CYQ A;  2ZEG A;  1Q2C A;  4UCN A;  4NGS A;  5ISV A;  4BBH A;  1Y7E A;  2D4P A;  1XE4 A;  4NGP A;  4MI4 A;  1IOI A;  1S7F A;  4KOR A;  4OC2 A;  3PB4 X;  1TF8 A;  2AJ6 A;  2RB7 A;  2ZOG A;  3LAC A;  4R87 A;  3H8G A;  4I49 A;  4Y49 C;  3BHX A;  1S7N A;  2AFS A;  4CGN A;  4DJL A;  3ISZ A;  3B3C A;  2EVN A;  1JQG A;  1IY7 A;  2V8H A;  4CGM A;  5KTC A;  3D2P A;  4AG9 A;  2Z3L A;  1Z4R A;  5F47 A;  1Z2L A;  3L2N A;  4QVT A;  4QC6 A;  1RXT A;  2WZN A;  2OH1 A;  3WC6 A;  4R57 A;  3R9G A;  4PV6 A;  1XFO A;  2JEV A;  4B5P A;  2ZEM A;  4NGR A;  2J9A A;  5K8M A;  3PB6 X;  3PEI A;  4M6I A;  4MBU A;  4R9M A;  3W91 A;  5LRJ A;  1U6M A;  4XPD B;  4ZX8 A;  3D3S A;  3PBE A;  4U9Z A;  4C68 A;  1KUV A;  2VBQ A;  3FIX A;  4FD7 A; 
#chains in the Genus database with same CATH homology
 4UWJ A;  2Q4Y A;  1XIX A;  1OZP A;  3EFA A;  2OZH A;  3B8G A;  5HMN A;  4Q38 A;  2ZW7 A;  1B87 A;  4C2Z A;  2FIA A;  2OU2 A;  1Q2Y A;  1YRE A;  1IYL A;  2Y0M A;  5DWN A;  2WUU A;  4CAV A;  2ATR A;  3DR8 A;  1YR0 A;  4L8A A;  1BO4 A;  2B4B A;  2DPS A;  3UY5 A;  4KOW A;  4NXY A;  1S3Z A;  3DSB A;  3TOA A;  3TTH A;  4IF5 A;  2HV2 A;  4OAE A;  3R9F A;  4A31 A;  1TIQ A;  2QML A;  2FE7 A;  4BMH A;  4MHD A;  3VWE A;  4MFK A;  2VZZ A;  1BOB A;  4E8O A;  3TCV A;  4AB7 A;  2Z3M A;  4IUS A;  4B5O A;  1P4N A;  4QUS A;  1PU9 A;  3IWG A;  3TO9 A;  4LUA A;  3FRM A;  4II9 A;  2RC4 A;  2EUI A;  4CS0 B;  3F5B A;  2VXK A;  1M4I A;  4NEX A;  4CYN A;  3PGP A;  2Q7B A;  4JD6 A;  1ON0 A;  4CRZ B;  4MFZ A;  4E2A A;  1YVK A;  1KUY A;  2PSW A;  2QEC A;  2ZW4 A;  4OLL A;  5AG6 A;  1S7L A;  5C82 A;  5J8F A;  2YGW A;  2C27 A;  4CYP A;  3E0K A;  5IB0 A;  1ZO0 A;  2FS5 A;  4HNY B;  1MJB A;  2G0B A;  2Z3N A;  3BJ8 A;  2I79 A;  3R95 A;  4KSA A;  2PC1 A;  2PRB A;  1VHS A;  4UBR A;  3S6F A;  5CNP A;  5FVJ A;  3SXN A;  1S7K A;  1I1D A;  1Y7R A;  2YND A;  2Z3K A;  2REF A;  5JPH A;  4HKF A;  2YNC A;  2Z0Z A;  4GS4 A;  2YNE A;  4KVM E;  3JTK A;  4XNH B;  2J8R A;  2P0W A;  1YGH A;  4AG7 A;  4CAX A;  1YX0 A;  1QSM A;  1XMT A;  3NE7 A;  2BL1 A;  1QSR A;  2VI7 A;  4KOS A;  1NSL A;  3TOB A;  2VEZ A;  5F49 A;  4KZT A;  4ONU A;  4ZBG A;  4AVC A;  2ARH A;  3DR6 A;  3TT2 A;  4K30 A;  3ZJ0 A;  4AVA A;  2F5I A;  2WPW A;  4JJX A;  2IL4 A;  4B11 A;  1I12 A;  1I21 A;  4A32 A;  2ZW5 A;  1NE9 A;  5AG5 A;  4XPK A;  3CXP A;  1J4J A;  3JVN A;  4FD6 A;  2B4D B;  3SXO A;  3GY9 A;  5H84 A;  5AG4 A;  3IU1 A;  4F6A A;  5A27 A;  1UFH A;  4B13 A;  2J8N A;  4L89 A;  2DPT A;  3F8K A;  4CGO A;  2Q44 A;  2PR1 A;  1PUA A;  3TE4 A;  2G3T A;  2I00 A;  4UFX A;  3OWC A;  4KVX A;  2OB0 A;  4OAD A;  4Q36 A;  4AVB A;  1Y9K A;  4B14 A;  4H6Z A;  4KOX A;  4U5Y A;  4JLY A;  4M3S A;  4KLW A;  4X5K A;  3D8P A;  3SHP A;  1WK4 A;  2Z3P A;  4NCZ A;  3GYA A;  3QB8 A;  3KKW A;  2R98 A;  3ZZI A;  2FT0 A;  1N71 A;  2R1I A;  4RS2 A;  4FD5 A;  3TO6 A;  1P0H A;  4CYO A;  3CXS A;  4XPD C;  2PDO A;  3H4Q A;  2Q0Y A;  3DNS A;  3JUW A;  4PK2 A;  1FY7 A;  3MGD A;  4C7I A;  4EVY A;  4J3G A;  2ZXV A;  1L0C A;  4CRY B;  2OZG A;  4QB9 A;  2GIV A;  5DWM A;  4Y49 B;  4KOY A;  1S60 A;  2B4D A;  2FXF A;  4MY3 A;  3S6G A;  4UCM A;  3R9E A;  3EY5 A;  3I3G A;  1WWZ A;  3LD2 A;  2GAN A;  5F48 A;  2DXQ A;  1R57 A;  2K5T A;  2B3U A;  5GCN A;  2Z10 A;  3IU2 A;  1QST A;  1YK3 A;  4U9Y A;  2YNC C;  1KZF A;  4UFW A;  3BLN A;  2FCK A;  3W6S A;  3PP9 A;  4KOU A;  1M44 A;  3V8I A;  2ZW6 A;  5HH1 A;  3R96 A;  4NF1 A;  2CNT A;  4MY0 A;  2OZU A;  4B10 A;  1CM0 A;  4HNX B;  1IID A;  4DNC A;  4NSQ A;  3LOD A;  3GKR A;  3PZJ A;  4KOT A;  4UCP A;  4UFV A;  4JXQ A;  2Q4V A;  2JDD A;  5AG7 A;  3W6X A;  2B3V A;  1CJW A;  4FD4 A;  4A30 A;  2Q04 A;  4CGL A;  4HNW B;  2REE A;  2CXA A;  3QAH A;  4KUA A;  3EC4 A;  3IGR A;  4KS9 A;  2CNM A;  3D2M A;  5EBV A;  1XF8 A;  2PR8 A;  3N7Z A;  4CAE A;  2H5M A;  4MFP A;  4UWI A;  2CY2 A;  4F0X A;  1IYK A;  2G3A A;  1V0C A;  4C2X A;  4R3K A;  2J8M A;  1YVO A;  4CGP A;  3K9U A;  2D4O A;  3EXN A;  4B12 A;  4JXR A;  1RO5 A;  1MJ9 A;  1LRZ A;  2P6E A;  3T90 A;  2B58 A;  2HUZ A;  4PK3 A;  5G21 A;  2X7B A;  4ZGY B;  4C7H A;  3CXQ A;  2ZPA A;  5A28 A;  2B5G B;  4H6U A;  4XNH C;  3BJ7 A;  4KSF A;  3EO4 A;  3P2F A;  4YRH A;  2FSR A;  3IWE A;  4A95 A;  3S6H A;  1NMT A;  4A2Z A;  3FBU A;  3FYN A;  5H86 A;  3T9Y A;  3RYO A;  1Y9W A;  3P2H A;  4LX9 A;  1MJA A;  5IX3 A;  2JDC A;  3FB3 A;  3H5Z A;  1VKC A;  3I9S A;  4MFQ A;  1YLE A;  4R3L A;  2GE3 A;  4QBJ A;  2R7H A;  1QSO A;  4JWP A;  4A33 A;  4YFJ A;  1K4J A;  4MJ8 A;  5I0C A;  2CNS A;  2P6F A;  4YGO A;  4MFL A;  5IV0 A;  1GHE A;  4MFJ A;  2VZY A;  4H89 A;  1SQH A;  1QSN A;  2WSA A;  2BSW A;  4XPL A;  3FNC A;  4C2Y A;  2WPX A;  5G1Z A;  3TFY A;  2A4N A;  1KUX A;  4B5P B;  2P6G A;  4ORF A;  2R8V A;  2AE6 A;  5EC4 A;  5G22 A;  3WR7 A;  3DDD A;  4M85 A;  4E0A A;  2Z11 A;  4CAW A;  1Z9U A;  3F0A A;  4KVO E;  1IB1 E;  4RI1 A;  2JLM A;  4PSW A;  2QIR A;  2VQY A;  3VWD A;  4PSX A;  2B5G A;  1MK4 A;  1M1D A;  2O28 A;  5JQ4 A;  4KOV A;  4CAF A;  1B6B A;  5G20 A;  1M4D A;  3R1K A;  5BWA B;  2FL4 A;  1S5K A;  2KCW A;  3A9L A;  3C26 A;  3G8W A;  3FXT A;  5F46 A;  5E96 A;  5AGE A;  1Z4E A;  4F0Y A;  2Z3O A;  2FIW A;  3G3S A;  4UA3 A;  2NMT A;  5KTA A;  3S6K A;  5C88 A;  2BUE A;  5J8C A;  1Q2D A;  2HQY A;  1M4G A;  4KUB A;  3TO7 A;  1IIC A;  2PQ8 A;  2BEI A;  1XEB A;  4CYQ A;  4KLV A;  1Q2C A;  4UCN A;  5ISV A;  4BBH A;  2D4P A;  1XE4 A;  4MI4 A;  1S7F A;  4KOR A;  2AJ6 A;  4R87 A;  5KTD A;  4I49 A;  4Y49 C;  4CGN A;  1S7N A;  2EVN A;  4CGM A;  5KTC A;  3D2P A;  4AG9 A;  2Z3L A;  1Z4R A;  5F47 A;  4QVT A;  4QC6 A;  1RXT A;  2OH1 A;  4R57 A;  3R9G A;  4PV6 A;  2JEV A;  4B5P A;  3W91 A;  4MBU A;  4R9M A;  1U6M A;  4XPD B;  3D3S A;  4U9Z A;  4C68 A;  1KUV A;  2VBQ A;  3FIX A;  4FD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...