2NMTA

Myristoyl-coa:protein n-myristoyltransferase bound to myristoyl-coa and peptide analogs
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
422
structure length
422
Chain Sequence
AMKDHKFWRTQPVKDFDEKVVEEGPIDKPKTPEDISDKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFNYTKEFFNWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVRGKQVPSVEINFLCVHKQLRSKRLTPVLIKEITRRVNKCDIWHALYTAGIVLPAPVSTCRYTHRPLNWKKLYEVDFTGLPDGHTEEDMIAENALPAKTKTAGLRKLKKEDIDQVFELFKRYQSRFELIQIFTKEEFEHNFIGEESLPLDKQVIFSYVVEQPDGKITDFFSFYSLPFTILNNTKYKDLGIGYLYYYATDADFQFKDRFDPKATKALKTRLCELIYDACILAKNANMDVFNALTSQDNTLFLDDLKFGPGDGFLNFYLFNYRAKPITGGLNPDNSNDIKRRSNVGVVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MYRISTOYL-COA\:PROTEIN N-MYRISTOYLTRANSFERASE
publication title Structure of N-myristoyltransferase with bound myristoylCoA and peptide substrate analogs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 110
structure length 422
sequence length 422
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 1998-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2nmtA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2nmtA02
1UFHA 1YR0A 2FIWA 1NMTA 1P4NA 2Q04A 4NXYA 2FL4A 3D2MA 4PSXA 4HNYB 1NE9A 2BL1A 3S6HA 2Q4YA 2BEIA 1M4GA 4X5KA 4R3KA 2B4BA 3BJ8A 4KLWA 4KOYA 2EUIA 2ZW4A 1B87A 2JDDA 4OLLA 4KOVA 4YRHA 4IF5A 1Z9UA 3MGDA 1B6BA 4PV6A 5F46A 2ZW5A 1XF8A 5KTDA 4CRYB 4MI4A 4R3LA 2G0BA 4FD7A 2R1IA 3TT2A 3FB3A 4LX9A 2FS5A 2Y0MA 2Q44A 5HMNA 3TTHA 4NSQA 3H4QA 4HNWB 1YK3A 1I12A 2D4OA 3S6FA 2FSRA 1GHEA 2VZZA 3R95A 4JXQA 1S3ZA 5JPHA 2ARHA 2I00A 2GIVA 5JQ4A 3SXOA 2J8RA 4HNXB 1IYLA 4B5PB 2J8NA 4KORA 4H6ZA 3JUWA 3IWGA 2P6GA 5F47A 1J4JA 3PZJA 4FD6A 2QECA 3R96A 4CS0B 4CAWA 4R9MA 4MY3A 4QBJA 2Z0ZA 3ZJ0A 4XPLA 2OH1A 3GKRA 1IB1E 1YLEA 3T90A 5KTCA 2CNSA 1V0CA 2KCWA 3W6XA 1OZPA 2ZW7A 2JEVA 4JLYA 2B5GA 3EO4A 5J8CA 2Z11A 4KUAA 2F5IA 4RS2A 1R57A 3D3SA 3JVNA 1S5KA 3FXTA 5I0CA 4KOUA 5J8FA 4NCZA 3FRMA 3TOAA 4E8OA 4LUAA 2BSWA 2AJ6A 3P2FA 1TIQA 3FNCA 2PQ8A 4J3GA 3D2PA 4JXRA 4U9YA 1KUYA 1QSRA 2IL4A 3SXNA 4M85A 2O28A 3P2HA 4UWJA 5H86A 3BJ7A 5IB0A 3F0AA 4L8AA 4YFJA 2PSWA 3FYNA 4PK3A 3OWCA 3FIXA 2WPWA 4CAXA 3TE4A 3DR6A 2R98A 2B3UA 4JWPA 4I49A 3R9EA 1S60A 2QMLA 4M3SA 2PRBA 3UY5A 4MHDA 2JLMA 2EVNA 3QB8A 4R57A 4Y49C 4BMHA 3TCVA 1M1DA 1Z4RA 1NSLA 2REEA 3F5BA 4XNHC 2B58A 4II9A 2VBQA 2ZXVA 5IV0A 4UWIA 2GE3A 2PDOA 3S6GA 2Q7BA 4E0AA 4KVXA 3CXPA 3T9YA 3R9GA 2CY2A 4XPDC 4B5OA 1QSMA 4PK2A 1KZFA 2FIAA 2NMTA 2OZGA 5F48A 1MJBA 1PUAA 2QIRA 4KOTA 3TO9A 3VWDA 2PR1A 5IX3A 2OZHA 2P6FA 4EVYA 3DR8A 4AVAA 3LD2A 4U5YA 4F0YA 1M44A 2Q0YA 5GCNA 1IYKA 2AE6A 4IUSA 2VI7A 1ON0A 1Y9KA 2CNTA 3QAHA 2CNMA 4B5PA 5DWNA 2K5TA 3I9SA 2Z10A 4AB7A 3I3GA 1VHSA 4QVTA 3R9FA 1L0CA 4KLVA 4L89A 2VXKA 3VWEA 2OB0A 3WR7A 3W6SA 4QUSA 3G8WA 1Y7RA 1S7KA 4RI1A 1BOBA 5HH1A 1S7FA 4AG7A 1YGHA 2GANA 1IICA 3IGRA 4MJ8A 5C82A 1YVKA 2HUZA 1S7NA 1XE4A 4U9ZA 2Q4VA 5EC4A 4NEXA 1Q2DA 2G3AA 5F49A 3ZZIA 1M4IA 2OZUA 2DXQA 1CM0A 3C26A 3DDDA 1FY7A 4F6AA 4QB9A 2BUEA 4UA3A 1Q2CA 3PP9A 1WK4A 1Q2YA 1M4DA 3E0KA 3PGPA 3BLNA 3LODA 4MBUA 1XMTA 2R8VA 2VQYA 2VEZA 4OADA 2FT0A 3TO7A 4NF1A 4Y49B 1Y9WA 4ONUA 3DSBA 5CNPA 3N7ZA 2FE7A 4ORFA 4XNHB 1WWZA 4JJXA 4K30A 1IIDA 1P0HA 2D4PA 3TFYA 3B8GA 4XPDB 4YGOA 1MJAA 3EC4A 4GS4A 2FXFA 2ZPAA 1S7LA 3R1KA 1YVOA 4KVOE 3S6KA 4QC6A 2P6EA 1MK4A 2VZYA 2PC1A 1XEBA 4MY0A 1RXTA 4UBRA 2RC4A 1PU9A 4FD4A 2REFA 3K9UA 2B3VA 5H84A 3NE7A 1YX0A 1QSOA 5ISVA 3GY9A 1LRZA 1BO4A 2R7HA 4AVBA 5KTAA 1KUXA 2FCKA 3D8PA 3EY5A 2P0WA 2I79A 3V8IA 4H6UA 3CXSA 4XPKA 2A4NA 2HQYA 4AG9A 3RYOA 2H5MA 1MJ9A 4R87A 4AVCA 3SHPA 3DNSA 3TO6A 4JD6A 1XIXA 4HKFA 4KZTA 5EBVA 3EFAA 2PR8A 3GYAA 4KOSA 5C88A 3F8KA 1I1DA 4FD5A 1I21A 4H89A 1RO5A 4CAVA 4CRZB 4KVME 2C27A 2X7BA 1VKCA 1SQHA 2OU2A 2HV2A 3G3SA 5E96A 3EXNA 2J8MA 1QSTA 1K4JA 1CJWA 2B5GB 1U6MA 5DWMA 4PSWA 1QSNA 1YREA 1Z4EA 2JDCA 4KUBA 4KOXA 3FBUA 2B4DB 5FVJA 4DNCA 4KOWA 3KKWA 1N71A 2B4DA 2ATRA 3W91A 2G3TA 4OAEA 2ZW6A 4E2AA 1KUVA 3CXQA 3TOBA 2WPXA 4ZBGA
chains in the Genus database with same CATH superfamily
4C2ZA 4CGOA 1UFHA 4UFXA 3KQXA 1YR0A 4OP4A 1NSAA 2FIWA 1NMTA 1P4NA 1QMUA 2Q04A 4NXYA 2FL4A 3D2MA 1BPNA 1F57A 2BCOA 4PSXA 4HNYB 1NE9A 1ELLP 2BL1A 2AFZA 4FUUA 1X10A 1VHOA 3S6HA 1CG2A 2Q4YA 3KR5A 2BEIA 4OMEA 4UF4A 1M4GA 2EBJA 2XEFA 2ODFA 4UCNA 4X5KA 4R3KA 1DE4C 1Z8LA 4AXVA 5LRGA 4B6ZA 1ZLIA 2B4BA 3BJ8A 3ISXA 4KLWA 4KOYA 2EUIA 4C2YA 3WC7A 2ZW4A 3PEIA 1B87A 3PB9X 2JDDA 1TKHA 4OLLA 3PB6X 4UFVA 4MRIA 2F7VA 4KOVA 2Z3OA 4LQGA 1TXRA 4IF5A 4YRHA 5KTAA 3IJ3A 1Z9UA 4OIWA 3MGDA 2CTCA 3SJGA 1B6BA 2BOAA 4PV6A 1ELMP 5F46A 2ZW5A 1Z5RA 2ZEOA 4UEZA 4EFDA 1XF8A 4FAIA 1Y0YA 2HB6A 5KTDA 2WYRA 4ZX8A 2NYQA 2PVWA 4CRYB 1ZLHA 4CYPA 4X2TA 4F8ZA 4MI4A 4MCQA 2G0BA 4R3LA 3B3WA 4A2ZA 4FD7A 1QQ9A 2R1IA 3MRUA 3TT2A 3FB3A 4ZY2A 2RB7A 4LX9A 1F2PA 4MHYA 2FS5A 2Y0MA 2Q44A 4JZ0A 4B10A 3TTHA 4Z65A 2Q51A 4NSQA 1LAPA 5HMNA 3H4QA 3FEEA 4OC4A 4HNWB 1YK3A 1I12A 2DF5A 2D4OA 3S6FA 2FSRA 1GHEA 2VZZA 4KS9A 2CIJA 2I3CA 3R95A 4JXQA 2IMOA 4B13A 1S3ZA 3FJUA 5JPHA 2ARHA 2I00A 2GIVA 5JQ4A 1Q7LA 1FNOA 3RNZA 4IK2A 3SXOA 2J8RA 4HNXB 1IYLA 1XRYA 2J9AA 3S9LA 4B5PB 3V38A 1ZG7A 2J8NA 3LACA 4KORA 4F9VA 4P4EA 3B7IA 3NH8A 4H6ZA 3JUWA 5K8OA 2Z3NA 4MXUA 5LYFA 3FX6A 4A38A 2PJ3A 3IWGA 2P6GA 4RN7A 3KQZA 5F47A 3WABA 1J4JA 3GB0A 2AFSA 3PZJA 4FD6A 5AG5A 2QECA 3R96A 3QNVA 4CS0B 4TNUA 4DUKA 4MFKA 4CAWA 2GREA 4R9MA 1LOKA 2YNEA 2ZEFA 4A37A 4MY3A 4QBJA 5JM6A 3D67A 3K2KA 1FT7A 2Z0ZA 3ZJ0A 4XPLA 1Y7EA 2ZEDA 2OH1A 3JTKA 3KZWA 3GKRA 1IB1E 3CDXA 5HVGA 4A32A 2OOTA 3IIBA 5A27A 3V7ZA 1YLEA 3T90A 2Z3MA 3T8WA 3IEHA 5KTCA 2CNSA 2WSAA 4NGPA 4NGMA 4NFRA 1V0CA 4O23A 2KCWA 3QAYA 1OZPA 3W6XA 2ZW7A 2JEVA 4JLYA 4PXDA 2AFXA 2XEGA 3SJEA 2B5GA 3EO4A 5J8CA 2PVVA 2Z11A 4KUAA 3IO1A 2F5IA 4RS2A 4ZBGA 1R57A 3D3SA 3JVNA 1S5KA 3FXTA 4OC3A 5I0CA 4KOUA 4BINA 3BI0A 2WUUA 5J8FA 4NCZA 3FRMA 2ZOFA 3TOAA 4E8OA 4LUAA 4MFJA 2BSWA 5DS0A 3PFEA 4ZY0A 2CXAA 2AJ6A 2C6CA 3P2FA 1TIQA 3FNCA 2PQ8A 4J3GA 3D2PA 4JXRA 5G20A 2XEIA 4U9YA 4ZI6A 2YNCC 1KUYA 2PJBA 3SI0A 1JWQA 1QSRA 2IL4A 2PJ4A 2V8VA 3SXNA 4UEFA 4M85A 2O28A 2Q4ZA 3B3VA 3P2HA 4UWJA 2HC9A 5H86A 4X3RA 3BJ7A 5IB0A 3F0AA 3ISZA 4L8AA 4DYOA 4YFJA 1R3NA 2PSWA 5HVHA 3FYNA 4PK3A 3OWCA 2PJ1A 3FIXA 2WPWA 4CAXA 3TE4A 3FH4A 3DR6A 4P4BA 2R98A 2B3UA 4JWPA 4I49A 3R9EA 1S60A 2QMLA 4YWYA 1LFWA 3GLJA 3IWWA 1AUGA 4M3SA 5I4MA 2PRBA 3H8EA 1F2OA 4MCSA 3UY5A 4UEEA 4MHDA 2JLMA 2EVNA 1ZG9A 3FVLA 1YW6A 3NA6A 3QB8A 4R57A 4Y49C 4BMHA 2JEWA 6CPAA 3TCVA 1M1DA 1Z4RA 1NSLA 1HDUA 4A33A 2REEA 3F5BA 4XNHC 2B58A 4II9A 1X12A 4P10A 2VBQA 1XMBA 2Q7SA 2ZXVA 5IV0A 4UWIA 2GE3A 2PDOA 3KI9A 3B35A 3S6GA 2DEAA 2G9DA 2Q7BA 4KVXA 3CXPA 4E0AA 3T9YA 3R9GA 2CY2A 4W9YA 4XPDC 4B5OA 1QSMA 4MHZA 4PK2A 4CGPA 1KZFA 2FIAA 2PRQA 2JBKA 2NMTA 1EE3P 2OZGA 5F48A 1TF8A 5LRKA 3BHXA 1MJBA 1IY7A 3BI1A 1IU8A 4G1PA 1PUAA 3KL9A 2PJCA 2QIRA 4KOTA 4TWEA 3TO9A 4RUHA 5HXDA 3VWDA 3KGQA 2PR1A 5IX3A 1ZO0A 2OZHA 4ZYQA 4NGQA 2P6FA 4EVYA 3B3TA 3DR8A 1Z8WA 1LCPA 4AVAA 5AGEA 1IOFA 3SI2A 1VGYA 3LD2A 1HEEA 3NE8A 2Z3LA 4U5YA 2PJ8A 1HDQA 4F0YA 1M44A 2Q0YA 5GCNA 1YLOA 4CYNA 3KHXA 1IYKA 4MFZA 2AE6A 4IUSA 4R6TA 2VI7A 2POKA 1ON0A 1A2ZA 1Y9KA 1XJOA 3HUVA 4X8IA 3DLJA 5D8NA 1Y0RA 1PCAA 2PJ2A 1H8LA 4M6IA 2PIZA 2QYVA 2V77A 4IHMA 2CNTA 3QAHA 2EK8A 4M6GA 2BO9A 2VL1A 2CNMA 2ZENA 1Z8TA 4B5PA 5DWNA 2IQ6A 2K5TA 2OR4A 2V8GA 4B12A 5G1ZA 4A39A 3I9SA 2Z10A 4MCRA 3NH5A 2AFUA 4AB7A 5LYLA 3I3GA 1VHSA 1XOVA 2PJ6A 4QVTA 4LQ6A 2DPTA 3R9FA 2EWBA 1Z8XA 1TKJA 4NGNA 1L0CA 1RTQA 4KLVA 4Q36A 2EK9A 4L89A 4CYQA 3S9MA 2ABZA 2VXKA 3VWEA 2OB0A 3D7GA 4P4IA 3WR7A 3W6SA 3FMCA 4QUSA 3G8WA 1IGBA 1Y7RA 2AFMA 4R8FA 4CPAA 4YU9A 1JQGA 1S7KA 1ZG8A 3MN8A 3L2NA 2ANPA 1TF9A 4RI1A 1BOBA 4A31A 1GYTA 2ZEPA 3IC1A 1BAVA 1S7FA 1YGHA 5HH1A 3B3CA 4AG7A 2GANA 1IICA 3IGRA 7CPAA 4MJ8A 3IU2A 3PFOA 3D4UA 5C82A 1YVKA 4MFLA 3RAMA 5G21A 2HUZA 1S7NA 4UCPA 3N5FA 4P45A 4PPZA 1KWMA 4K3NA 4B11A 1XE4A 4U9ZA 2Q4VA 1VHEA 2FVGA 4OC1A 5EC4A 4NEXA 3FF3A 1Q2DA 2ZOGA 2G3AA 2ZELA 5F49A 1XFOA 2DPSA 2PE3A 3VH9A 3ZZIA 4MHNA 1M4IA 4CGMA 2OZUA 3CPAA 2DXQA 2IJZA 1CM0A 3C26A 3DDDA 3H8GA 4PQAA 1CPXA 4BD9A 2CF4A 4Q7AA 1FY7A 3B2YA 2O53A 4F6AA 4QB9A 8CPAA 5JGFA 2BUEA 3KHZA 4UA3A 5LYIA 1Q2CA 2EO8A 1YQEA 2PJAA 3RBUA 4C7HA 4M6HA 3CT9A 3PP9A 1WK4A 2NSMA 5A28A 1Q2YA 1CP7A 1M4DA 3E0KA 3GIUA 4OKOA 3D68A 3PGPA 4MCPA 5F09A 3PB8X 3BLNA 3H8FA 3LODA 4OC0A 4CGNA 5HVFA 3KASA 2RFHA 4MBUA 1XMTA 2R8VA 2VQYA 1AMPA 5G22A 2QVPA 2C1CA 3NFZA 3VATA 2VEZA 4OADA 2FT0A 5D29A 3TO7A 5CBMA 4CYOA 1LANA 4NF1A 5LYDA 3CZXA 1Y9WA 4ONUA 4Y49B 4NGTA 4R76A 3DSBA 4CAFA 1BLLE 5CNPA 3PBBA 4IAVA 3N7ZA 2FE7A 4ORFA 4XNHB 4DJLA 5K8MA 4F9UA 1OBRA 1WWZA 2Q43A 4H2KA 4JJXA 4FBEA 2PJ5A 4K30A 4PXEA 4C2XA 1DTDA 3H5ZA 1IIDA 1P0HA 2D4PA 4MFPA 3TX8A 3FECA 1ARMA 4CAEA 3B8GA 4XPDB 3TFYA 5J1QA 2GFQA 4Q38A 4UFWA 4YGOA 1MJAA 3EC4A 3LWUA 4GS4A 4CGLA 4KSFA 2FXFA 4NJQA 4OC5A 2ZPAA 1S7LA 3R1KA 1YVOA 4EWTA 4KVOE 5ELYA 2Z3PA 3S6KA 4QC6A 3BXMA 2CTBA 2P6EA 1MK4A 3A9LA 3D7DA 4ZY1A 2VZYA 3SJFA 2PC1A 2PJ9A 3PRTA 4UIAA 4OC2A 1XEBA 4MMOA 1RXTA 4MY0A 4UBRA 2RC4A 3NH4A 4WJBA 4OIDA 5LRJA 4B14A 1PU9A 4FD4A 5K8NA 2REFA 3K9UA 3RZAA 2B3VA 3KR4A 4NGSA 4PXCA 3NE7A 5H84A 3FEDA 3B3SA 4ZGYB 4BBHA 2C6GA 1YX0A 1QSOA 2AFWA 3D7FA 4A95A 5ISVA 3GY9A 4P6YA 1LRZA 1BO4A 2R7HA 1TKFA 4KSAA 3WT4A 3TC8A 1KUXA 2YNDA 4AVBA 2FCKA 3D8PA 3EY5A 2P0WA 3WC6A 4EMEA 4ONWA 2I79A 2C6PA 4WWVA 1CBXA 2GLFA 4H6UA 3V8IA 3CXSA 1M4LA 4GM5A 3PB7X 4XPKA 2GU2A 3PB4X 2A4NA 2HQYA 4GXHA 4AG9A 3RYOA 2H5MA 3SI1A 1MJ9A 4P44A 4R87A 1CPSA 4AVCA 3SHPA 3DNSA 3TO6A 5AG7A 4JD6A 1XIXA 4HKFA 4KZTA 5EBVA 5BWAB 3EFAA 2PR8A 4KSIA 1VIXA 1PYTB 3GYAA 3IU1A 4KOSA 5AG4A 5K8PA 5C88A 2V8DA 3F8KA 1I1DA 3HLPA 3K9TA 4FD5A 3JRUA 1I21A 2QJ8A 4H89A 1RO5A 2JBJA 4NJRA 4CAVA 4CRZB 4KVME 5AG6A 2C27A 4UCMA 1CX8A 3RO0A 3VARA 1ARLA 2X7BA 1CP6A 4UIBA 1VKCA 1SQHA 2OU2A 2HV2A 3G3SA 5E96A 4C7IA 3D7HA 3PBEA 5CPAA 2O4HA 1BPMA 4F0XA 4A94A 1YSJA 2ZEHA 2ZEMA 3EXNA 4FWUA 3LMSA 3IWEA 3S9NA 2J8MA 4HPSA 4MHPA 4MFQA 1IOIA 2F8HA 2PJ0A 1QSTA 1K4JA 1CJWA 1UWYA 4PXBA 3D66A 3WC5A 2XEJA 3GUXA 1YW4A 2B5GB 2Z3KA 4P4JA 4NGRA 1U6MA 5DWMA 1Z2LA 1LAMA 4PSWA 3SJXA 1QSNA 1YREA 1Z4EA 2JDCA 4KUBA 2V8HA 4KOXA 2YNCA 5THWA 3CPXA 3FBUA 3I1UA 1AYEA 2YGWA 5JH9A 2B4DB 2ZEEA 4R7MA 5FVJA 2ZEGA 2GLJA 4C68A 4KOWA 4DNCA 3KKWA 1N71A 2B4DA 2PCUA 2ATRA 2PIYA 4JYWA 3DGVA 2WZNA 5IB9A 3W91A 2PJ7A 1R43A 2G3TA 4ZX9A 4OAEA 2ZW6A 4P4DA 5EMIA 4E2AA 1KUVA 3CXQA 3TOBA 1YMEA 2WPXA 3IFEA 2AFOA 4P4FA 1XBUA 4A30A
chains in the Genus database with same CATH topology
4C2ZA 4CGOA 1UFHA 4UFXA 1YR0A 2FIWA 1NMTA 1P4NA 2Q04A 4NXYA 2FL4A 3D2MA 4PSXA 4HNYB 1NE9A 2BL1A 3S6HA 2Q4YA 2BEIA 1M4GA 4UCNA 4X5KA 4R3KA 2B4BA 3BJ8A 4KLWA 4KOYA 2EUIA 4C2YA 2ZW4A 1B87A 2JDDA 4OLLA 4UFVA 4KOVA 2Z3OA 4YRHA 4IF5A 1Z9UA 3MGDA 1B6BA 4PV6A 5F46A 2ZW5A 1XF8A 5KTDA 4CRYB 4CYPA 4MI4A 4R3LA 2G0BA 4A2ZA 4FD7A 2R1IA 3TT2A 3FB3A 4LX9A 2FS5A 2Y0MA 2Q44A 4B10A 5HMNA 3TTHA 4NSQA 3H4QA 4HNWB 1YK3A 1I12A 2D4OA 3S6FA 2FSRA 1GHEA 2VZZA 4KS9A 3R95A 4JXQA 4B13A 1S3ZA 5JPHA 2ARHA 2I00A 2GIVA 5JQ4A 3SXOA 2J8RA 4HNXB 1IYLA 4B5PB 2J8NA 4KORA 4H6ZA 3JUWA 2Z3NA 3IWGA 2P6GA 5F47A 1J4JA 3PZJA 4FD6A 5AG5A 2QECA 3R96A 4CS0B 4MFKA 4CAWA 4R9MA 2YNEA 4MY3A 4QBJA 2Z0ZA 3ZJ0A 4XPLA 3JTKA 2OH1A 3GKRA 1IB1E 4A32A 5A27A 1YLEA 3T90A 2Z3MA 5KTCA 2CNSA 2WSAA 1V0CA 2KCWA 3W6XA 1OZPA 2ZW7A 2JEVA 4JLYA 2B5GA 3EO4A 5J8CA 2Z11A 4KUAA 2F5IA 4RS2A 1R57A 3D3SA 3JVNA 1S5KA 3FXTA 5I0CA 4KOUA 2WUUA 5J8FA 4NCZA 3FRMA 3TOAA 4E8OA 4LUAA 4MFJA 2BSWA 2CXAA 2AJ6A 3P2FA 1TIQA 3FNCA 2PQ8A 4J3GA 3D2PA 4JXRA 5G20A 4U9YA 2YNCC 1KUYA 1QSRA 2IL4A 3SXNA 4M85A 2O28A 3P2HA 4UWJA 5H86A 3BJ7A 5IB0A 3F0AA 4L8AA 4YFJA 2PSWA 3FYNA 4PK3A 3OWCA 3FIXA 2WPWA 4CAXA 3TE4A 3DR6A 2R98A 2B3UA 4JWPA 4I49A 3R9EA 1S60A 2QMLA 4M3SA 2PRBA 3UY5A 4MHDA 2JLMA 2EVNA 3QB8A 4R57A 4Y49C 4BMHA 3TCVA 1M1DA 1Z4RA 1NSLA 4A33A 2REEA 3F5BA 4XNHC 2B58A 4II9A 2VBQA 2ZXVA 5IV0A 4UWIA 2GE3A 2PDOA 3S6GA 2Q7BA 4E0AA 4KVXA 3CXPA 3T9YA 3R9GA 2CY2A 4XPDC 4B5OA 1QSMA 4PK2A 4CGPA 1KZFA 2FIAA 2NMTA 2OZGA 5F48A 1MJBA 1PUAA 2QIRA 4KOTA 3TO9A 3VWDA 2PR1A 5IX3A 1ZO0A 2OZHA 2P6FA 4EVYA 3DR8A 4AVAA 5AGEA 3LD2A 2Z3LA 4U5YA 4F0YA 1M44A 2Q0YA 5GCNA 4CYNA 4MFZA 1IYKA 2AE6A 4IUSA 2VI7A 1ON0A 1Y9KA 2CNTA 3QAHA 2CNMA 4B5PA 5DWNA 2K5TA 4B12A 5G1ZA 3I9SA 2Z10A 4AB7A 3I3GA 1VHSA 4QVTA 3R9FA 2DPTA 4CYQA 1L0CA 4Q36A 4KLVA 4L89A 2VXKA 3VWEA 2OB0A 3WR7A 3W6SA 4QUSA 3G8WA 1Y7RA 1S7KA 4RI1A 1BOBA 4A31A 5HH1A 1S7FA 4AG7A 1YGHA 2GANA 1IICA 3IGRA 4MJ8A 3IU2A 5C82A 1YVKA 4MFLA 5G21A 2HUZA 1S7NA 4UCPA 4B11A 1XE4A 4U9ZA 2Q4VA 5EC4A 4NEXA 1Q2DA 2G3AA 5F49A 2DPSA 3ZZIA 1M4IA 4CGMA 2OZUA 2DXQA 1CM0A 3C26A 3DDDA 1FY7A 4F6AA 4QB9A 2BUEA 4UA3A 1Q2CA 4C7HA 3PP9A 1WK4A 5A28A 1Q2YA 1M4DA 3E0KA 3PGPA 3BLNA 3LODA 4CGNA 4MBUA 1XMTA 2R8VA 2VQYA 5G22A 2VEZA 4OADA 2FT0A 3TO7A 4CYOA 4NF1A 4Y49B 1Y9WA 4ONUA 3DSBA 4CAFA 5CNPA 3N7ZA 2FE7A 4ORFA 4XNHB 1WWZA 4JJXA 4K30A 4C2XA 3H5ZA 1IIDA 1P0HA 2D4PA 4MFPA 4CAEA 3B8GA 4XPDB 3TFYA 4Q38A 4UFWA 4YGOA 1MJAA 3EC4A 4GS4A 4CGLA 4KSFA 2FXFA 2ZPAA 1S7LA 3R1KA 1YVOA 4KVOE 2Z3PA 3S6KA 4QC6A 2P6EA 1MK4A 3A9LA 2VZYA 2PC1A 1XEBA 4MY0A 1RXTA 4UBRA 2RC4A 4B14A 1PU9A 4FD4A 2REFA 3K9UA 2B3VA 5H84A 3NE7A 4ZGYB 4BBHA 1YX0A 1QSOA 4A95A 5ISVA 3GY9A 1LRZA 1BO4A 2R7HA 4KSAA 4AVBA 5KTAA 1KUXA 2YNDA 2FCKA 3D8PA 3EY5A 2P0WA 2I79A 3V8IA 4H6UA 3CXSA 4XPKA 2A4NA 2HQYA 4AG9A 3RYOA 2H5MA 1MJ9A 4R87A 4AVCA 3SHPA 3DNSA 3TO6A 5AG7A 4JD6A 1XIXA 4HKFA 4KZTA 5EBVA 5BWAB 3EFAA 2PR8A 3GYAA 3IU1A 4KOSA 5AG4A 5C88A 3F8KA 1I1DA 4FD5A 1I21A 4H89A 1RO5A 4CAVA 4CRZB 4KVME 5AG6A 2C27A 4UCMA 2X7BA 1VKCA 1SQHA 2OU2A 2HV2A 3G3SA 5E96A 4C7IA 4F0XA 3EXNA 3IWEA 2J8MA 4MFQA 1QSTA 1K4JA 1CJWA 2B5GB 2Z3KA 1U6MA 5DWMA 4PSWA 1QSNA 1YREA 1Z4EA 2JDCA 4KUBA 4KOXA 2YNCA 3FBUA 2YGWA 2B4DB 5FVJA 4DNCA 4C68A 4KOWA 3KKWA 1N71A 2B4DA 2ATRA 3W91A 2G3TA 4OAEA 2ZW6A 4E2AA 1KUVA 3CXQA 3TOBA 2WPXA 4ZBGA 4A30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UFH A;  1YR0 A;  2FIW A;  1NMT A;  1P4N A;  2Q04 A;  4NXY A;  2FL4 A;  3D2M A;  4PSX A;  4HNY B;  1NE9 A;  2BL1 A;  3S6H A;  2Q4Y A;  2BEI A;  1M4G A;  4X5K A;  4R3K A;  2B4B A;  3BJ8 A;  4KLW A;  4KOY A;  2EUI A;  2ZW4 A;  1B87 A;  2JDD A;  4OLL A;  4KOV A;  4YRH A;  4IF5 A;  1Z9U A;  3MGD A;  1B6B A;  4PV6 A;  5F46 A;  2ZW5 A;  1XF8 A;  5KTD A;  4CRY B;  4MI4 A;  4R3L A;  2G0B A;  4FD7 A;  2R1I A;  3TT2 A;  3FB3 A;  4LX9 A;  2FS5 A;  2Y0M A;  2Q44 A;  5HMN A;  3TTH A;  4NSQ A;  3H4Q A;  4HNW B;  1YK3 A;  1I12 A;  2D4O A;  3S6F A;  2FSR A;  1GHE A;  2VZZ A;  3R95 A;  4JXQ A;  1S3Z A;  5JPH A;  2ARH A;  2I00 A;  2GIV A;  5JQ4 A;  3SXO A;  2J8R A;  4HNX B;  1IYL A;  4B5P B;  2J8N A;  4KOR A;  4H6Z A;  3JUW A;  3IWG A;  2P6G A;  5F47 A;  1J4J A;  3PZJ A;  4FD6 A;  2QEC A;  3R96 A;  4CS0 B;  4CAW A;  4R9M A;  4MY3 A;  4QBJ A;  2Z0Z A;  3ZJ0 A;  4XPL A;  2OH1 A;  3GKR A;  1IB1 E;  1YLE A;  3T90 A;  5KTC A;  2CNS A;  1V0C A;  2KCW A;  3W6X A;  1OZP A;  2ZW7 A;  2JEV A;  4JLY A;  2B5G A;  3EO4 A;  5J8C A;  2Z11 A;  4KUA A;  2F5I A;  4RS2 A;  1R57 A;  3D3S A;  3JVN A;  1S5K A;  3FXT A;  5I0C A;  4KOU A;  5J8F A;  4NCZ A;  3FRM A;  3TOA A;  4E8O A;  4LUA A;  2BSW A;  2AJ6 A;  3P2F A;  1TIQ A;  3FNC A;  2PQ8 A;  4J3G A;  3D2P A;  4JXR A;  4U9Y A;  1KUY A;  1QSR A;  2IL4 A;  3SXN A;  4M85 A;  2O28 A;  3P2H A;  4UWJ A;  5H86 A;  3BJ7 A;  5IB0 A;  3F0A A;  4L8A A;  4YFJ A;  2PSW A;  3FYN A;  4PK3 A;  3OWC A;  3FIX A;  2WPW A;  4CAX A;  3TE4 A;  3DR6 A;  2R98 A;  2B3U A;  4JWP A;  4I49 A;  3R9E A;  1S60 A;  2QML A;  4M3S A;  2PRB A;  3UY5 A;  4MHD A;  2JLM A;  2EVN A;  3QB8 A;  4R57 A;  4Y49 C;  4BMH A;  3TCV A;  1M1D A;  1Z4R A;  1NSL A;  2REE A;  3F5B A;  4XNH C;  2B58 A;  4II9 A;  2VBQ A;  2ZXV A;  5IV0 A;  4UWI A;  2GE3 A;  2PDO A;  3S6G A;  2Q7B A;  4E0A A;  4KVX A;  3CXP A;  3T9Y A;  3R9G A;  2CY2 A;  4XPD C;  4B5O A;  1QSM A;  4PK2 A;  1KZF A;  2FIA A;  2NMT A;  2OZG A;  5F48 A;  1MJB A;  1PUA A;  2QIR A;  4KOT A;  3TO9 A;  3VWD A;  2PR1 A;  5IX3 A;  2OZH A;  2P6F A;  4EVY A;  3DR8 A;  4AVA A;  3LD2 A;  4U5Y A;  4F0Y A;  1M44 A;  2Q0Y A;  5GCN A;  1IYK A;  2AE6 A;  4IUS A;  2VI7 A;  1ON0 A;  1Y9K A;  2CNT A;  3QAH A;  2CNM A;  4B5P A;  5DWN A;  2K5T A;  3I9S A;  2Z10 A;  4AB7 A;  3I3G A;  1VHS A;  4QVT A;  3R9F A;  1L0C A;  4KLV A;  4L89 A;  2VXK A;  3VWE A;  2OB0 A;  3WR7 A;  3W6S A;  4QUS A;  3G8W A;  1Y7R A;  1S7K A;  4RI1 A;  1BOB A;  5HH1 A;  1S7F A;  4AG7 A;  1YGH A;  2GAN A;  1IIC A;  3IGR A;  4MJ8 A;  5C82 A;  1YVK A;  2HUZ A;  1S7N A;  1XE4 A;  4U9Z A;  2Q4V A;  5EC4 A;  4NEX A;  1Q2D A;  2G3A A;  5F49 A;  3ZZI A;  1M4I A;  2OZU A;  2DXQ A;  1CM0 A;  3C26 A;  3DDD A;  1FY7 A;  4F6A A;  4QB9 A;  2BUE A;  4UA3 A;  1Q2C A;  3PP9 A;  1WK4 A;  1Q2Y A;  1M4D A;  3E0K A;  3PGP A;  3BLN A;  3LOD A;  4MBU A;  1XMT A;  2R8V A;  2VQY A;  2VEZ A;  4OAD A;  2FT0 A;  3TO7 A;  4NF1 A;  4Y49 B;  1Y9W A;  4ONU A;  3DSB A;  5CNP A;  3N7Z A;  2FE7 A;  4ORF A;  4XNH B;  1WWZ A;  4JJX A;  4K30 A;  1IID A;  1P0H A;  2D4P A;  3TFY A;  3B8G A;  4XPD B;  4YGO A;  1MJA A;  3EC4 A;  4GS4 A;  2FXF A;  2ZPA A;  1S7L A;  3R1K A;  1YVO A;  4KVO E;  3S6K A;  4QC6 A;  2P6E A;  1MK4 A;  2VZY A;  2PC1 A;  1XEB A;  4MY0 A;  1RXT A;  4UBR A;  2RC4 A;  1PU9 A;  4FD4 A;  2REF A;  3K9U A;  2B3V A;  5H84 A;  3NE7 A;  1YX0 A;  1QSO A;  5ISV A;  3GY9 A;  1LRZ A;  1BO4 A;  2R7H A;  4AVB A;  5KTA A;  1KUX A;  2FCK A;  3D8P A;  3EY5 A;  2P0W A;  2I79 A;  3V8I A;  4H6U A;  3CXS A;  4XPK A;  2A4N A;  2HQY A;  4AG9 A;  3RYO A;  2H5M A;  1MJ9 A;  4R87 A;  4AVC A;  3SHP A;  3DNS A;  3TO6 A;  4JD6 A;  1XIX A;  4HKF A;  4KZT A;  5EBV A;  3EFA A;  2PR8 A;  3GYA A;  4KOS A;  5C88 A;  3F8K A;  1I1D A;  4FD5 A;  1I21 A;  4H89 A;  1RO5 A;  4CAV A;  4CRZ B;  4KVM E;  2C27 A;  2X7B A;  1VKC A;  1SQH A;  2OU2 A;  2HV2 A;  3G3S A;  5E96 A;  3EXN A;  2J8M A;  1QST A;  1K4J A;  1CJW A;  2B5G B;  1U6M A;  5DWM A;  4PSW A;  1QSN A;  1YRE A;  1Z4E A;  2JDC A;  4KUB A;  4KOX A;  3FBU A;  2B4D B;  5FVJ A;  4DNC A;  4KOW A;  3KKW A;  1N71 A;  2B4D A;  2ATR A;  3W91 A;  2G3T A;  4OAE A;  2ZW6 A;  4E2A A;  1KUV A;  3CXQ A;  3TOB A;  2WPX A;  4ZBG A; 
#chains in the Genus database with same CATH topology
 4C2Z A;  4CGO A;  1UFH A;  4UFX A;  3KQX A;  1YR0 A;  4OP4 A;  1NSA A;  2FIW A;  1NMT A;  1P4N A;  1QMU A;  2Q04 A;  4NXY A;  2FL4 A;  3D2M A;  1BPN A;  1F57 A;  2BCO A;  4PSX A;  4HNY B;  1NE9 A;  1ELL P;  2BL1 A;  2AFZ A;  4FUU A;  1X10 A;  1VHO A;  3S6H A;  1CG2 A;  2Q4Y A;  3KR5 A;  2BEI A;  4OME A;  4UF4 A;  1M4G A;  2EBJ A;  2XEF A;  2ODF A;  4UCN A;  4X5K A;  4R3K A;  1DE4 C;  1Z8L A;  4AXV A;  5LRG A;  4B6Z A;  1ZLI A;  2B4B A;  3BJ8 A;  3ISX A;  4KLW A;  4KOY A;  2EUI A;  4C2Y A;  3WC7 A;  2ZW4 A;  3PEI A;  1B87 A;  3PB9 X;  2JDD A;  1TKH A;  4OLL A;  3PB6 X;  4UFV A;  4MRI A;  2F7V A;  4KOV A;  2Z3O A;  4LQG A;  1TXR A;  4IF5 A;  4YRH A;  5KTA A;  3IJ3 A;  1Z9U A;  4OIW A;  3MGD A;  2CTC A;  3SJG A;  1B6B A;  2BOA A;  4PV6 A;  1ELM P;  5F46 A;  2ZW5 A;  1Z5R A;  2ZEO A;  4UEZ A;  4EFD A;  1XF8 A;  4FAI A;  1Y0Y A;  2HB6 A;  5KTD A;  2WYR A;  4ZX8 A;  2NYQ A;  2PVW A;  4CRY B;  1ZLH A;  4CYP A;  4X2T A;  4F8Z A;  4MI4 A;  4MCQ A;  2G0B A;  4R3L A;  3B3W A;  4A2Z A;  4FD7 A;  1QQ9 A;  2R1I A;  3MRU A;  3TT2 A;  3FB3 A;  4ZY2 A;  2RB7 A;  4LX9 A;  1F2P A;  4MHY A;  2FS5 A;  2Y0M A;  2Q44 A;  4JZ0 A;  4B10 A;  3TTH A;  4Z65 A;  2Q51 A;  4NSQ A;  1LAP A;  5HMN A;  3H4Q A;  3FEE A;  4OC4 A;  4HNW B;  1YK3 A;  1I12 A;  2DF5 A;  2D4O A;  3S6F A;  2FSR A;  1GHE A;  2VZZ A;  4KS9 A;  2CIJ A;  2I3C A;  3R95 A;  4JXQ A;  2IMO A;  4B13 A;  1S3Z A;  3FJU A;  5JPH A;  2ARH A;  2I00 A;  2GIV A;  5JQ4 A;  1Q7L A;  1FNO A;  3RNZ A;  4IK2 A;  3SXO A;  2J8R A;  4HNX B;  1IYL A;  1XRY A;  2J9A A;  3S9L A;  4B5P B;  3V38 A;  1ZG7 A;  2J8N A;  3LAC A;  4KOR A;  4F9V A;  4P4E A;  3B7I A;  3NH8 A;  4H6Z A;  3JUW A;  5K8O A;  2Z3N A;  4MXU A;  5LYF A;  3FX6 A;  4A38 A;  2PJ3 A;  3IWG A;  2P6G A;  4RN7 A;  3KQZ A;  5F47 A;  3WAB A;  1J4J A;  3GB0 A;  2AFS A;  3PZJ A;  4FD6 A;  5AG5 A;  2QEC A;  3R96 A;  3QNV A;  4CS0 B;  4TNU A;  4DUK A;  4MFK A;  4CAW A;  2GRE A;  4R9M A;  1LOK A;  2YNE A;  2ZEF A;  4A37 A;  4MY3 A;  4QBJ A;  5JM6 A;  3D67 A;  3K2K A;  1FT7 A;  2Z0Z A;  3ZJ0 A;  4XPL A;  1Y7E A;  2ZED A;  2OH1 A;  3JTK A;  3KZW A;  3GKR A;  1IB1 E;  3CDX A;  5HVG A;  4A32 A;  2OOT A;  3IIB A;  5A27 A;  3V7Z A;  1YLE A;  3T90 A;  2Z3M A;  3T8W A;  3IEH A;  5KTC A;  2CNS A;  2WSA A;  4NGP A;  4NGM A;  4NFR A;  1V0C A;  4O23 A;  2KCW A;  3QAY A;  1OZP A;  3W6X A;  2ZW7 A;  2JEV A;  4JLY A;  4PXD A;  2AFX A;  2XEG A;  3SJE A;  2B5G A;  3EO4 A;  5J8C A;  2PVV A;  2Z11 A;  4KUA A;  3IO1 A;  2F5I A;  4RS2 A;  4ZBG A;  1R57 A;  3D3S A;  3JVN A;  1S5K A;  3FXT A;  4OC3 A;  5I0C A;  4KOU A;  4BIN A;  3BI0 A;  2WUU A;  5J8F A;  4NCZ A;  3FRM A;  2ZOF A;  3TOA A;  4E8O A;  4LUA A;  4MFJ A;  2BSW A;  5DS0 A;  3PFE A;  4ZY0 A;  2CXA A;  2AJ6 A;  2C6C A;  3P2F A;  1TIQ A;  3FNC A;  2PQ8 A;  4J3G A;  3D2P A;  4JXR A;  5G20 A;  2XEI A;  4U9Y A;  4ZI6 A;  2YNC C;  1KUY A;  2PJB A;  3SI0 A;  1JWQ A;  1QSR A;  2IL4 A;  2PJ4 A;  2V8V A;  3SXN A;  4UEF A;  4M85 A;  2O28 A;  2Q4Z A;  3B3V A;  3P2H A;  4UWJ A;  2HC9 A;  5H86 A;  4X3R A;  3BJ7 A;  5IB0 A;  3F0A A;  3ISZ A;  4L8A A;  4DYO A;  4YFJ A;  1R3N A;  2PSW A;  5HVH A;  3FYN A;  4PK3 A;  3OWC A;  2PJ1 A;  3FIX A;  2WPW A;  4CAX A;  3TE4 A;  3FH4 A;  3DR6 A;  4P4B A;  2R98 A;  2B3U A;  4JWP A;  4I49 A;  3R9E A;  1S60 A;  2QML A;  4YWY A;  1LFW A;  3GLJ A;  3IWW A;  1AUG A;  4M3S A;  5I4M A;  2PRB A;  3H8E A;  1F2O A;  4MCS A;  3UY5 A;  4UEE A;  4MHD A;  2JLM A;  2EVN A;  1ZG9 A;  3FVL A;  1YW6 A;  3NA6 A;  3QB8 A;  4R57 A;  4Y49 C;  4BMH A;  2JEW A;  6CPA A;  3TCV A;  1M1D A;  1Z4R A;  1NSL A;  1HDU A;  4A33 A;  2REE A;  3F5B A;  4XNH C;  2B58 A;  4II9 A;  1X12 A;  4P10 A;  2VBQ A;  1XMB A;  2Q7S A;  2ZXV A;  5IV0 A;  4UWI A;  2GE3 A;  2PDO A;  3KI9 A;  3B35 A;  3S6G A;  2DEA A;  2G9D A;  2Q7B A;  4KVX A;  3CXP A;  4E0A A;  3T9Y A;  3R9G A;  2CY2 A;  4W9Y A;  4XPD C;  4B5O A;  1QSM A;  4MHZ A;  4PK2 A;  4CGP A;  1KZF A;  2FIA A;  2PRQ A;  2JBK A;  2NMT A;  1EE3 P;  2OZG A;  5F48 A;  1TF8 A;  5LRK A;  3BHX A;  1MJB A;  1IY7 A;  3BI1 A;  1IU8 A;  4G1P A;  1PUA A;  3KL9 A;  2PJC A;  2QIR A;  4KOT A;  4TWE A;  3TO9 A;  4RUH A;  5HXD A;  3VWD A;  3KGQ A;  2PR1 A;  5IX3 A;  1ZO0 A;  2OZH A;  4ZYQ A;  4NGQ A;  2P6F A;  4EVY A;  3B3T A;  3DR8 A;  1Z8W A;  1LCP A;  4AVA A;  5AGE A;  1IOF A;  3SI2 A;  1VGY A;  3LD2 A;  1HEE A;  3NE8 A;  2Z3L A;  4U5Y A;  2PJ8 A;  1HDQ A;  4F0Y A;  1M44 A;  2Q0Y A;  5GCN A;  1YLO A;  4CYN A;  3KHX A;  1IYK A;  4MFZ A;  2AE6 A;  4IUS A;  4R6T A;  2VI7 A;  2POK A;  1ON0 A;  1A2Z A;  1Y9K A;  1XJO A;  3HUV A;  4X8I A;  3DLJ A;  5D8N A;  1Y0R A;  1PCA A;  2PJ2 A;  1H8L A;  4M6I A;  2PIZ A;  2QYV A;  2V77 A;  4IHM A;  2CNT A;  3QAH A;  2EK8 A;  4M6G A;  2BO9 A;  2VL1 A;  2CNM A;  2ZEN A;  1Z8T A;  4B5P A;  5DWN A;  2IQ6 A;  2K5T A;  2OR4 A;  2V8G A;  4B12 A;  5G1Z A;  4A39 A;  3I9S A;  2Z10 A;  4MCR A;  3NH5 A;  2AFU A;  4AB7 A;  5LYL A;  3I3G A;  1VHS A;  1XOV A;  2PJ6 A;  4QVT A;  4LQ6 A;  2DPT A;  3R9F A;  2EWB A;  1Z8X A;  1TKJ A;  4NGN A;  1L0C A;  1RTQ A;  4KLV A;  4Q36 A;  2EK9 A;  4L89 A;  4CYQ A;  3S9M A;  2ABZ A;  2VXK A;  3VWE A;  2OB0 A;  3D7G A;  4P4I A;  3WR7 A;  3W6S A;  3FMC A;  4QUS A;  3G8W A;  1IGB A;  1Y7R A;  2AFM A;  4R8F A;  4CPA A;  4YU9 A;  1JQG A;  1S7K A;  1ZG8 A;  3MN8 A;  3L2N A;  2ANP A;  1TF9 A;  4RI1 A;  1BOB A;  4A31 A;  1GYT A;  2ZEP A;  3IC1 A;  1BAV A;  1S7F A;  1YGH A;  5HH1 A;  3B3C A;  4AG7 A;  2GAN A;  1IIC A;  3IGR A;  7CPA A;  4MJ8 A;  3IU2 A;  3PFO A;  3D4U A;  5C82 A;  1YVK A;  4MFL A;  3RAM A;  5G21 A;  2HUZ A;  1S7N A;  4UCP A;  3N5F A;  4P45 A;  4PPZ A;  1KWM A;  4K3N A;  4B11 A;  1XE4 A;  4U9Z A;  2Q4V A;  1VHE A;  2FVG A;  4OC1 A;  5EC4 A;  4NEX A;  3FF3 A;  1Q2D A;  2ZOG A;  2G3A A;  2ZEL A;  5F49 A;  1XFO A;  2DPS A;  2PE3 A;  3VH9 A;  3ZZI A;  4MHN A;  1M4I A;  4CGM A;  2OZU A;  3CPA A;  2DXQ A;  2IJZ A;  1CM0 A;  3C26 A;  3DDD A;  3H8G A;  4PQA A;  1CPX A;  4BD9 A;  2CF4 A;  4Q7A A;  1FY7 A;  3B2Y A;  2O53 A;  4F6A A;  4QB9 A;  8CPA A;  5JGF A;  2BUE A;  3KHZ A;  4UA3 A;  5LYI A;  1Q2C A;  2EO8 A;  1YQE A;  2PJA A;  3RBU A;  4C7H A;  4M6H A;  3CT9 A;  3PP9 A;  1WK4 A;  2NSM A;  5A28 A;  1Q2Y A;  1CP7 A;  1M4D A;  3E0K A;  3GIU A;  4OKO A;  3D68 A;  3PGP A;  4MCP A;  5F09 A;  3PB8 X;  3BLN A;  3H8F A;  3LOD A;  4OC0 A;  4CGN A;  5HVF A;  3KAS A;  2RFH A;  4MBU A;  1XMT A;  2R8V A;  2VQY A;  1AMP A;  5G22 A;  2QVP A;  2C1C A;  3NFZ A;  3VAT A;  2VEZ A;  4OAD A;  2FT0 A;  5D29 A;  3TO7 A;  5CBM A;  4CYO A;  1LAN A;  4NF1 A;  5LYD A;  3CZX A;  1Y9W A;  4ONU A;  4Y49 B;  4NGT A;  4R76 A;  3DSB A;  4CAF A;  1BLL E;  5CNP A;  3PBB A;  4IAV A;  3N7Z A;  2FE7 A;  4ORF A;  4XNH B;  4DJL A;  5K8M A;  4F9U A;  1OBR A;  1WWZ A;  2Q43 A;  4H2K A;  4JJX A;  4FBE A;  2PJ5 A;  4K30 A;  4PXE A;  4C2X A;  1DTD A;  3H5Z A;  1IID A;  1P0H A;  2D4P A;  4MFP A;  3TX8 A;  3FEC A;  1ARM A;  4CAE A;  3B8G A;  4XPD B;  3TFY A;  5J1Q A;  2GFQ A;  4Q38 A;  4UFW A;  4YGO A;  1MJA A;  3EC4 A;  3LWU A;  4GS4 A;  4CGL A;  4KSF A;  2FXF A;  4NJQ A;  4OC5 A;  2ZPA A;  1S7L A;  3R1K A;  1YVO A;  4EWT A;  4KVO E;  5ELY A;  2Z3P A;  3S6K A;  4QC6 A;  3BXM A;  2CTB A;  2P6E A;  1MK4 A;  3A9L A;  3D7D A;  4ZY1 A;  2VZY A;  3SJF A;  2PC1 A;  2PJ9 A;  3PRT A;  4UIA A;  4OC2 A;  1XEB A;  4MMO A;  1RXT A;  4MY0 A;  4UBR A;  2RC4 A;  3NH4 A;  4WJB A;  4OID A;  5LRJ A;  4B14 A;  1PU9 A;  4FD4 A;  5K8N A;  2REF A;  3K9U A;  3RZA A;  2B3V A;  3KR4 A;  4NGS A;  4PXC A;  3NE7 A;  5H84 A;  3FED A;  3B3S A;  4ZGY B;  4BBH A;  2C6G A;  1YX0 A;  1QSO A;  2AFW A;  3D7F A;  4A95 A;  5ISV A;  3GY9 A;  4P6Y A;  1LRZ A;  1BO4 A;  2R7H A;  1TKF A;  4KSA A;  3WT4 A;  3TC8 A;  1KUX A;  2YND A;  4AVB A;  2FCK A;  3D8P A;  3EY5 A;  2P0W A;  3WC6 A;  4EME A;  4ONW A;  2I79 A;  2C6P A;  4WWV A;  1CBX A;  2GLF A;  4H6U A;  3V8I A;  3CXS A;  1M4L A;  4GM5 A;  3PB7 X;  4XPK A;  2GU2 A;  3PB4 X;  2A4N A;  2HQY A;  4GXH A;  4AG9 A;  3RYO A;  2H5M A;  3SI1 A;  1MJ9 A;  4P44 A;  4R87 A;  1CPS A;  4AVC A;  3SHP A;  3DNS A;  3TO6 A;  5AG7 A;  4JD6 A;  1XIX A;  4HKF A;  4KZT A;  5EBV A;  5BWA B;  3EFA A;  2PR8 A;  4KSI A;  1VIX A;  1PYT B;  3GYA A;  3IU1 A;  4KOS A;  5AG4 A;  5K8P A;  5C88 A;  2V8D A;  3F8K A;  1I1D A;  3HLP A;  3K9T A;  4FD5 A;  3JRU A;  1I21 A;  2QJ8 A;  4H89 A;  1RO5 A;  2JBJ A;  4NJR A;  4CAV A;  4CRZ B;  4KVM E;  5AG6 A;  2C27 A;  4UCM A;  1CX8 A;  3RO0 A;  3VAR A;  1ARL A;  2X7B A;  1CP6 A;  4UIB A;  1VKC A;  1SQH A;  2OU2 A;  2HV2 A;  3G3S A;  5E96 A;  4C7I A;  3D7H A;  3PBE A;  5CPA A;  2O4H A;  1BPM A;  4F0X A;  4A94 A;  1YSJ A;  2ZEH A;  2ZEM A;  3EXN A;  4FWU A;  3LMS A;  3IWE A;  3S9N A;  2J8M A;  4HPS A;  4MHP A;  4MFQ A;  1IOI A;  2F8H A;  2PJ0 A;  1QST A;  1K4J A;  1CJW A;  1UWY A;  4PXB A;  3D66 A;  3WC5 A;  2XEJ A;  3GUX A;  1YW4 A;  2B5G B;  2Z3K A;  4P4J A;  4NGR A;  1U6M A;  5DWM A;  1Z2L A;  1LAM A;  4PSW A;  3SJX A;  1QSN A;  1YRE A;  1Z4E A;  2JDC A;  4KUB A;  2V8H A;  4KOX A;  2YNC A;  5THW A;  3CPX A;  3FBU A;  3I1U A;  1AYE A;  2YGW A;  5JH9 A;  2B4D B;  2ZEE A;  4R7M A;  5FVJ A;  2ZEG A;  2GLJ A;  4C68 A;  4KOW A;  4DNC A;  3KKW A;  1N71 A;  2B4D A;  2PCU A;  2ATR A;  2PIY A;  4JYW A;  3DGV A;  2WZN A;  5IB9 A;  3W91 A;  2PJ7 A;  1R43 A;  2G3T A;  4ZX9 A;  4OAE A;  2ZW6 A;  4P4D A;  5EMI A;  4E2A A;  1KUV A;  3CXQ A;  3TOB A;  1YME A;  2WPX A;  3IFE A;  2AFO A;  4P4F A;  1XBU A;  4A30 A; 
#chains in the Genus database with same CATH homology
 4C2Z A;  4CGO A;  1UFH A;  4UFX A;  1YR0 A;  2FIW A;  1NMT A;  1P4N A;  2Q04 A;  4NXY A;  2FL4 A;  3D2M A;  4PSX A;  4HNY B;  1NE9 A;  2BL1 A;  3S6H A;  2Q4Y A;  2BEI A;  1M4G A;  4UCN A;  4X5K A;  4R3K A;  2B4B A;  3BJ8 A;  4KLW A;  4KOY A;  2EUI A;  4C2Y A;  2ZW4 A;  1B87 A;  2JDD A;  4OLL A;  4UFV A;  4KOV A;  2Z3O A;  4YRH A;  4IF5 A;  1Z9U A;  3MGD A;  1B6B A;  4PV6 A;  5F46 A;  2ZW5 A;  1XF8 A;  5KTD A;  4CRY B;  4CYP A;  4MI4 A;  4R3L A;  2G0B A;  4A2Z A;  4FD7 A;  2R1I A;  3TT2 A;  3FB3 A;  4LX9 A;  2FS5 A;  2Y0M A;  2Q44 A;  4B10 A;  5HMN A;  3TTH A;  4NSQ A;  3H4Q A;  4HNW B;  1YK3 A;  1I12 A;  2D4O A;  3S6F A;  2FSR A;  1GHE A;  2VZZ A;  4KS9 A;  3R95 A;  4JXQ A;  4B13 A;  1S3Z A;  5JPH A;  2ARH A;  2I00 A;  2GIV A;  5JQ4 A;  3SXO A;  2J8R A;  4HNX B;  1IYL A;  4B5P B;  2J8N A;  4KOR A;  4H6Z A;  3JUW A;  2Z3N A;  3IWG A;  2P6G A;  5F47 A;  1J4J A;  3PZJ A;  4FD6 A;  5AG5 A;  2QEC A;  3R96 A;  4CS0 B;  4MFK A;  4CAW A;  4R9M A;  2YNE A;  4MY3 A;  4QBJ A;  2Z0Z A;  3ZJ0 A;  4XPL A;  3JTK A;  2OH1 A;  3GKR A;  1IB1 E;  4A32 A;  5A27 A;  1YLE A;  3T90 A;  2Z3M A;  5KTC A;  2CNS A;  2WSA A;  1V0C A;  2KCW A;  3W6X A;  1OZP A;  2ZW7 A;  2JEV A;  4JLY A;  2B5G A;  3EO4 A;  5J8C A;  2Z11 A;  4KUA A;  2F5I A;  4RS2 A;  1R57 A;  3D3S A;  3JVN A;  1S5K A;  3FXT A;  5I0C A;  4KOU A;  2WUU A;  5J8F A;  4NCZ A;  3FRM A;  3TOA A;  4E8O A;  4LUA A;  4MFJ A;  2BSW A;  2CXA A;  2AJ6 A;  3P2F A;  1TIQ A;  3FNC A;  2PQ8 A;  4J3G A;  3D2P A;  4JXR A;  5G20 A;  4U9Y A;  2YNC C;  1KUY A;  1QSR A;  2IL4 A;  3SXN A;  4M85 A;  2O28 A;  3P2H A;  4UWJ A;  5H86 A;  3BJ7 A;  5IB0 A;  3F0A A;  4L8A A;  4YFJ A;  2PSW A;  3FYN A;  4PK3 A;  3OWC A;  3FIX A;  2WPW A;  4CAX A;  3TE4 A;  3DR6 A;  2R98 A;  2B3U A;  4JWP A;  4I49 A;  3R9E A;  1S60 A;  2QML A;  4M3S A;  2PRB A;  3UY5 A;  4MHD A;  2JLM A;  2EVN A;  3QB8 A;  4R57 A;  4Y49 C;  4BMH A;  3TCV A;  1M1D A;  1Z4R A;  1NSL A;  4A33 A;  2REE A;  3F5B A;  4XNH C;  2B58 A;  4II9 A;  2VBQ A;  2ZXV A;  5IV0 A;  4UWI A;  2GE3 A;  2PDO A;  3S6G A;  2Q7B A;  4E0A A;  4KVX A;  3CXP A;  3T9Y A;  3R9G A;  2CY2 A;  4XPD C;  4B5O A;  1QSM A;  4PK2 A;  4CGP A;  1KZF A;  2FIA A;  2NMT A;  2OZG A;  5F48 A;  1MJB A;  1PUA A;  2QIR A;  4KOT A;  3TO9 A;  3VWD A;  2PR1 A;  5IX3 A;  1ZO0 A;  2OZH A;  2P6F A;  4EVY A;  3DR8 A;  4AVA A;  5AGE A;  3LD2 A;  2Z3L A;  4U5Y A;  4F0Y A;  1M44 A;  2Q0Y A;  5GCN A;  4CYN A;  4MFZ A;  1IYK A;  2AE6 A;  4IUS A;  2VI7 A;  1ON0 A;  1Y9K A;  2CNT A;  3QAH A;  2CNM A;  4B5P A;  5DWN A;  2K5T A;  4B12 A;  5G1Z A;  3I9S A;  2Z10 A;  4AB7 A;  3I3G A;  1VHS A;  4QVT A;  3R9F A;  2DPT A;  4CYQ A;  1L0C A;  4Q36 A;  4KLV A;  4L89 A;  2VXK A;  3VWE A;  2OB0 A;  3WR7 A;  3W6S A;  4QUS A;  3G8W A;  1Y7R A;  1S7K A;  4RI1 A;  1BOB A;  4A31 A;  5HH1 A;  1S7F A;  4AG7 A;  1YGH A;  2GAN A;  1IIC A;  3IGR A;  4MJ8 A;  3IU2 A;  5C82 A;  1YVK A;  4MFL A;  5G21 A;  2HUZ A;  1S7N A;  4UCP A;  4B11 A;  1XE4 A;  4U9Z A;  2Q4V A;  5EC4 A;  4NEX A;  1Q2D A;  2G3A A;  5F49 A;  2DPS A;  3ZZI A;  1M4I A;  4CGM A;  2OZU A;  2DXQ A;  1CM0 A;  3C26 A;  3DDD A;  1FY7 A;  4F6A A;  4QB9 A;  2BUE A;  4UA3 A;  1Q2C A;  4C7H A;  3PP9 A;  1WK4 A;  5A28 A;  1Q2Y A;  1M4D A;  3E0K A;  3PGP A;  3BLN A;  3LOD A;  4CGN A;  4MBU A;  1XMT A;  2R8V A;  2VQY A;  5G22 A;  2VEZ A;  4OAD A;  2FT0 A;  3TO7 A;  4CYO A;  4NF1 A;  4Y49 B;  1Y9W A;  4ONU A;  3DSB A;  4CAF A;  5CNP A;  3N7Z A;  2FE7 A;  4ORF A;  4XNH B;  1WWZ A;  4JJX A;  4K30 A;  4C2X A;  3H5Z A;  1IID A;  1P0H A;  2D4P A;  4MFP A;  4CAE A;  3B8G A;  4XPD B;  3TFY A;  4Q38 A;  4UFW A;  4YGO A;  1MJA A;  3EC4 A;  4GS4 A;  4CGL A;  4KSF A;  2FXF A;  2ZPA A;  1S7L A;  3R1K A;  1YVO A;  4KVO E;  2Z3P A;  3S6K A;  4QC6 A;  2P6E A;  1MK4 A;  3A9L A;  2VZY A;  2PC1 A;  1XEB A;  4MY0 A;  1RXT A;  4UBR A;  2RC4 A;  4B14 A;  1PU9 A;  4FD4 A;  2REF A;  3K9U A;  2B3V A;  5H84 A;  3NE7 A;  4ZGY B;  4BBH A;  1YX0 A;  1QSO A;  4A95 A;  5ISV A;  3GY9 A;  1LRZ A;  1BO4 A;  2R7H A;  4KSA A;  4AVB A;  5KTA A;  1KUX A;  2YND A;  2FCK A;  3D8P A;  3EY5 A;  2P0W A;  2I79 A;  3V8I A;  4H6U A;  3CXS A;  4XPK A;  2A4N A;  2HQY A;  4AG9 A;  3RYO A;  2H5M A;  1MJ9 A;  4R87 A;  4AVC A;  3SHP A;  3DNS A;  3TO6 A;  5AG7 A;  4JD6 A;  1XIX A;  4HKF A;  4KZT A;  5EBV A;  5BWA B;  3EFA A;  2PR8 A;  3GYA A;  3IU1 A;  4KOS A;  5AG4 A;  5C88 A;  3F8K A;  1I1D A;  4FD5 A;  1I21 A;  4H89 A;  1RO5 A;  4CAV A;  4CRZ B;  4KVM E;  5AG6 A;  2C27 A;  4UCM A;  2X7B A;  1VKC A;  1SQH A;  2OU2 A;  2HV2 A;  3G3S A;  5E96 A;  4C7I A;  4F0X A;  3EXN A;  3IWE A;  2J8M A;  4MFQ A;  1QST A;  1K4J A;  1CJW A;  2B5G B;  2Z3K A;  1U6M A;  5DWM A;  4PSW A;  1QSN A;  1YRE A;  1Z4E A;  2JDC A;  4KUB A;  4KOX A;  2YNC A;  3FBU A;  2YGW A;  2B4D B;  5FVJ A;  4DNC A;  4C68 A;  4KOW A;  3KKW A;  1N71 A;  2B4D A;  2ATR A;  3W91 A;  2G3T A;  4OAE A;  2ZW6 A;  4E2A A;  1KUV A;  3CXQ A;  3TOB A;  2WPX A;  4ZBG A;  4A30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...