2NMTA

Myristoyl-coa:protein n-myristoyltransferase bound to myristoyl-coa and peptide analogs
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
422
structure length
422
Chain Sequence
AMKDHKFWRTQPVKDFDEKVVEEGPIDKPKTPEDISDKPLPLLSSFEWCSIDVDNKKQLEDVFVLLNENYVEDRDAGFRFNYTKEFFNWALKSPGWKKDWHIGVRVKETQKLVAFISAIPVTLGVRGKQVPSVEINFLCVHKQLRSKRLTPVLIKEITRRVNKCDIWHALYTAGIVLPAPVSTCRYTHRPLNWKKLYEVDFTGLPDGHTEEDMIAENALPAKTKTAGLRKLKKEDIDQVFELFKRYQSRFELIQIFTKEEFEHNFIGEESLPLDKQVIFSYVVEQPDGKITDFFSFYSLPFTILNNTKYKDLGIGYLYYYATDADFQFKDRFDPKATKALKTRLCELIYDACILAKNANMDVFNALTSQDNTLFLDDLKFGPGDGFLNFYLFNYRAKPITGGLNPDNSNDIKRRSNVGVVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYRISTOYL-COA\:PROTEIN N-MYRISTOYLTRANSFERASE
publication title Structure of N-myristoyltransferase with bound myristoylCoA and peptide substrate analogs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 110
structure length 422
sequence length 422
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 1998-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2nmtA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2nmtA02
1IYLA 1S7KA 4L89A 3PGPA 2Q0YA 4YRHA 1M4DA 2Q04A 1CJWA 2Z0ZA 2ZXVA 3R1KA 5ISVA 1BOBA 1YX0A 4XPLA 2RC4A 1ON0A 2OZUA 2CNTA 1PUAA 4KOWA 2AE6A 4AG7A 4CRYB 2FL4A 2G3AA 4RI1A 1B6BA 2PR1A 2VI7A 3IWGA 1RO5A 4KOXA 4KVOE 2VBQA 3V8IA 1P4NA 1QSRA 4JLYA 3EO4A 3TO6A 2WPXA 2J8MA 5KTCA 3R9FA 3OWCA 3D2MA 4CAVA 3LD2A 4MI4A 3G8WA 2BEIA 5FVJA 2Y0MA 2REFA 4F0YA 1MJ9A 2PRBA 2J8RA 3N7ZA 4UA3A 4MHDA 3EC4A 2JDDA 4RS2A 2CY2A 3JUWA 5H86A 2PQ8A 4CAXA 3NE7A 4R3KA 3P2HA 4PSXA 2J8NA 3D3SA 4HNWB 2R7HA 4IUSA 4KOSA 3MGDA 1MJBA 4M85A 1YREA 4MY0A 2OH1A 4X5KA 3R9EA 4U5YA 3KKWA 4NF1A 2VXKA 2JEVA 2B58A 4CS0B 3S6KA 5HMNA 4BMHA 1Y9KA 3RYOA 3P2FA 3GY9A 2FCKA 1WWZA 2FS5A 2GANA 1Z4RA 4QVTA 1IIDA 4LUAA 4EVYA 2ZW4A 4KLWA 4R87A 1YGHA 4L8AA 5IB0A 1MK4A 2GIVA 3TT2A 3QB8A 3F8KA 1PU9A 2WPWA 1SQHA 2BSWA 4FD5A 1KUVA 4CAWA 4B5PB 4MJ8A 1OZPA 2FT0A 4KVXA 3W6SA 4HNXB 4KZTA 4QUSA 3B8GA 1QSNA 2JDCA 1Z4EA 2I79A 3ZJ0A 1KUYA 1WK4A 4XPKA 3T9YA 2REEA 2O28A 3FBUA 3ZZIA 1YK3A 2EVNA 3TE4A 3W91A 1V0CA 1KUXA 4I49A 4M3SA 3TFYA 2Q4VA 4JXRA 2ZW7A 4KUAA 5C82A 2EUIA 2C27A 2B3VA 4YFJA 4KVME 1YLEA 2ARHA 2Q4YA 4H6ZA 4KLVA 2PC1A 1B87A 2ZPAA 5JQ4A 5C88A 5DWMA 4Y49B 1Q2DA 2P6FA 1S3ZA 1Y9WA 3D2PA 2KCWA 2JLMA 3PP9A 4Y49C 2IL4A 4F6AA 1M4GA 4HKFA 2CNMA 4AB7A 1XEBA 2G0BA 4CRZB 4J3GA 3TOAA 1R57A 2QMLA 1VKCA 3GYAA 1I1DA 3DNSA 3CXSA 2QECA 3EXNA 4NSQA 1IB1E 4DNCA 4FD4A 2OZGA 4OAEA 1S7NA 2AJ6A 5J8FA 2K5TA 2OU2A 2NMTA 4KUBA 1XE4A 1NSLA 2A4NA 3DSBA 2CNSA 4QC6A 3FNCA 2B3UA 4UWIA 2B4DA 1YR0A 1QSTA 4JJXA 1BO4A 4R57A 2D4OA 3CXQA 5F46A 4UWJA 1IYKA 2PR8A 1QSOA 2D4PA 3WR7A 4JWPA 1N71A 1VHSA 1KZFA 3GKRA 4QB9A 1NE9A 3TO9A 4NXYA 2HUZA 4JD6A 1Q2YA 4PK3A 1Z9UA 1LRZA 5H84A 4U9ZA 3DDDA 3R95A 3VWEA 3CXPA 2BL1A 2Z11A 2FE7A 4JXQA 4MY3A 1TIQA 1GHEA 2HV2A 3TO7A 1NMTA 2VZYA 3F0AA 3LODA 5EC4A 3T90A 1S60A 3S6GA 1CM0A 3FB3A 2P0WA 4H89A 1XIXA 3TCVA 3DR6A 1RXTA 4FD7A 4PSWA 2R1IA 3F5BA 3R9GA 2P6GA 3S6HA 3W6XA 3K9UA 4AVCA 3SXOA 2I00A 5EBVA 2OZHA 3TTHA 2B4DB 3SHPA 4AVBA 1YVOA 4KOVA 3I9SA 1S7LA 2ATRA 4PK2A 4FD6A 1Q2CA 4E8OA 2Q44A 5JPHA 4ONUA 2B4BA 2ZW6A 1M44A 4LX9A 2B5GA 4KORA 3UY5A 4HNYB 2ZW5A 4OLLA 5KTDA 2H5MA 2VQYA 5IV0A 3G3SA 1MJAA 4KOTA 5F47A 2Z10A 4GS4A 3FIXA 1U6MA 4U9YA 3H4QA 3D8PA 4ORFA 2QIRA 3R96A 3PZJA 3FXTA 1I21A 4E0AA 4KOYA 2HQYA 3BJ7A 3QAHA 5J8CA 1IICA 3TOBA 5E96A 4K30A 4B5OA 2G3TA 5HH1A 1Y7RA 1S5KA 3FRMA 2R8VA 3IGRA 1XF8A 4OADA 2F5IA 4R9MA 1UFHA 4NEXA 1K4JA 2OB0A 2X7BA 2FIWA 4E2AA 4NCZA 5F49A 4XPDB 3EY5A 4YGOA 3I3GA 4B5PA 4PV6A 2FXFA 2R98A 4XPDC 3E0KA 1S7FA 4AVAA 5F48A 5I0CA 4MBUA 4IF5A 1J4JA 3VWDA 2PDOA 3BLNA 3BJ8A 2BUEA 2B5GB 3DR8A 1XMTA 1M1DA 3SXNA 4XNHB 5KTAA 1M4IA 2P6EA 1QSMA 5GCNA 4XNHC 5DWNA 3JVNA 5IX3A 1L0CA 4R3LA 2FSRA 4H6UA 1FY7A 4AG9A 3C26A 3EFAA 2DXQA 2FIAA 2PSWA 4KOUA 5CNPA 4II9A 4UBRA 2Q7BA 4QBJA 2VZZA 2GE3A 1P0HA 4ZBGA 3S6FA 1YVKA 3FYNA 1I12A 2VEZA
chains in the Genus database with same CATH superfamily
2RFHA 1IYLA 1S7KA 2ZEMA 4H2KA 4L89A 4X3RA 3FJUA 3PGPA 1CX8A 2ZEDA 2Q0YA 4YRHA 1Z8TA 1M4DA 4DJLA 3WABA 2Q04A 1CJWA 2Z0ZA 2ZXVA 3R1KA 5A27A 3FEDA 5ISVA 2XEJA 1BOBA 1YX0A 4YU9A 4Z65A 4XPLA 2RC4A 1ON0A 4W9YA 4PXBA 2OZUA 4DUKA 4LQGA 2CNTA 2QJ8A 1PUAA 4KOWA 1Z5RA 4AXVA 4RUHA 2AE6A 4A32A 4AG7A 5K8MA 4CRYB 4OIDA 4X2TA 2FL4A 2G3AA 4RI1A 1ZG7A 2ABZA 1B6BA 2PR1A 4A30A 5G20A 2VI7A 2NYQA 4ZY0A 3IWGA 1RO5A 4FUUA 4KOXA 4NGNA 3WT4A 1Y0RA 4KVOE 1ELMP 4NFRA 1ZO0A 2VBQA 4P10A 3V8IA 4CGPA 1P4NA 3KASA 3A9LA 4NJRA 4ZY2A 1QSRA 4JLYA 3EO4A 4UCNA 2WPXA 3GUXA 3SJGA 4JYWA 3TO6A 4KSFA 2J8MA 5KTCA 1QQ9A 5F09A 3R9FA 4CAEA 3OWCA 3D2MA 4CAVA 4PPZA 3LD2A 3SJXA 4ZGYB 5IB9A 4MI4A 3IU1A 3G8WA 3T8WA 2BEIA 5FVJA 2Y0MA 4FBEA 1TF9A 2REFA 4F0YA 1MJ9A 2PRBA 2J8RA 3KR5A 5JM6A 3FH4A 3N7ZA 4UA3A 1ZLHA 1R43A 4MHDA 4FAIA 3EC4A 4UCPA 3K2KA 2JDDA 5CPAA 2WZNA 4NJQA 4RS2A 1HDUA 2CY2A 1PCAA 1YW4A 3H8GA 3JUWA 2IQ6A 2PQ8A 5H86A 4CAXA 3NE7A 2C6GA 4C2YA 3IIBA 4R3KA 3P2HA 4CAFA 2Q4ZA 2ZOFA 4B6ZA 2PJ0A 4PSXA 2J8NA 3FEEA 4OC0A 3D3SA 4HNWB 4UEEA 3BI1A 2R7HA 2AFSA 4IUSA 3WC7A 4KOSA 4M6GA 3TX8A 3MGDA 2F8HA 4BBHA 1MJBA 4ZX8A 4M85A 1YREA 4MY0A 2OH1A 4LQ6A 4P4JA 5HVGA 4X5KA 1Z8WA 3R9EA 4U5YA 3HLPA 5ELYA 3KQZA 4NGMA 1F2PA 3KKWA 4NF1A 1ZLIA 3KI9A 1BLLE 2VXKA 3S9NA 2JEVA 2XEIA 4KSAA 1JWQA 1LOKA 2B58A 4CS0B 3S6KA 1CP7A 5HMNA 4BMHA 4C68A 1Y9KA 1HDQA 3RYOA 2IJZA 3P2FA 1Z2LA 3GY9A 2FCKA 4CGLA 1WWZA 4A33A 2FS5A 2GANA 8CPAA 1OBRA 3CPXA 1Z4RA 4MCRA 2OOTA 3MN8A 3PB7X 4QVTA 1IIDA 4F9UA 4LUAA 4A37A 5HXDA 4B12A 2WYRA 3PFEA 4EVYA 4C7HA 2Q7SA 6CPAA 2ZW4A 2Z3LA 4KLWA 4UIAA 3B7IA 5BWAB 3PB8X 1NSAA 4R87A 3H8EA 3MRUA 2PIYA 3BI0A 1YGHA 3FMCA 4MXUA 1IGBA 4CGMA 4UEZA 4B14A 2PIZA 4L8AA 3B3CA 5IB0A 1MK4A 2GIVA 3TT2A 5AG5A 3B3WA 4ONWA 3QB8A 3KR4A 4P4DA 3F8KA 3H8FA 1PU9A 3D67A 2WPWA 4B11A 4CGNA 3KHXA 3ISXA 2POKA 3KGQA 4G1PA 4R76A 2CTBA 2F7VA 3K9TA 2YNCA 1SQHA 1XFOA 2BSWA 4FD5A 5G22A 2JBJA 1KUVA 4YWYA 4CAWA 1F2OA 4B5PB 4Q38A 4NGTA 4OC2A 3BXMA 4MJ8A 1LANA 2AFMA 1OZPA 2FT0A 3LWUA 4KVXA 4OKOA 4HNXB 4KZTA 3W6SA 4QUSA 3B8GA 3KHZA 4UFVA 3VH9A 1TXRA 2BCOA 1QSNA 2JDCA 3CDXA 1Z4EA 2I79A 4MFKA 2Z3MA 4GM5A 3ZJ0A 1KUYA 1WK4A 1Q7LA 2CTCA 3VARA 4XPKA 3T9YA 2REEA 2O28A 3D7GA 1VGYA 3FBUA 4C2XA 3ZZIA 1YK3A 2EVNA 3TE4A 2GFQA 3KL9A 3W91A 1V0CA 1KUXA 1LFWA 4I49A 4M3SA 2VL1A 1EE3P 3TFYA 4C7IA 1AUGA 5G1ZA 2Q4VA 4B13A 4JXRA 2ZW7A 2PE3A 4KUAA 3V38A 3GB0A 2AFXA 3B3VA 5C82A 1DE4C 2EUIA 2Z3OA 2C27A 2B3VA 1VHEA 4YFJA 4KVME 2PRQA 5CBMA 1YLEA 2ARHA 2PJBA 2Q4YA 3CPAA 4MHZA 2ZOGA 4H6ZA 3NFZA 5LYLA 1YQEA 4KLVA 5LYIA 1GYTA 3NH8A 4O23A 5K8PA 1FT7A 5JH9A 4PQAA 4IAVA 2PC1A 3IC1A 1B87A 2ZPAA 5JGFA 1Y7EA 5JQ4A 5C88A 4MHPA 3QAYA 5DWMA 1LAMA 2EBJA 4Y49B 2WUUA 1Q2DA 5AG6A 2JEWA 3NE8A 1CBXA 2BOAA 2P6FA 3IWEA 1S3ZA 2XEGA 1Y9WA 3I1UA 3D2PA 2PJ4A 4P4IA 2KCWA 4UF4A 3PBBA 2JLMA 3PP9A 4OP4A 4Y49C 4CPAA 2IL4A 3B35A 4UCMA 3LACA 1M4GA 2PJ8A 4F6AA 3IEHA 4HKFA 2CNMA 4AB7A 1ZG8A 2ZEOA 4UEFA 1XEBA 3D66A 4HPSA 2G0BA 4CRZB 4J3GA 3TOAA 5I4MA 1R57A 2QMLA 1VKCA 3FX6A 1IOIA 1CPSA 1I1DA 1TKHA 2YNCC 3GYAA 4MCSA 3DNSA 3CXSA 2QECA 3IO1A 3EXNA 4NSQA 1IB1E 4NGQA 4DNCA 4FD4A 2NSMA 2OZGA 4TWEA 2V8VA 4OAEA 2AFZA 4MCPA 1S7NA 2AJ6A 5J8FA 2K5TA 2OU2A 2NMTA 4KUBA 4ZYQA 4PXDA 2HB6A 1XE4A 2PJCA 3GLJA 1NSLA 2A4NA 3DSBA 2G9DA 2CNSA 4QC6A 3FNCA 3SI1A 4NGRA 2B3UA 3B3TA 4UWIA 5D8NA 4RN7A 2B4DA 4IHMA 1YR0A 3RAMA 1H8LA 1QSTA 4JJXA 1BO4A 4R57A 2EWBA 3N5FA 3WC5A 5LRJA 2D4OA 3CXQA 5F46A 4DYOA 4UWJA 1IYKA 2PR8A 2YGWA 4CYPA 3RZAA 1QSOA 3GIUA 2D4PA 3CZXA 4MFPA 3D7DA 2ZEGA 4OC5A 4M6IA 5AGEA 3WR7A 4JWPA 4P4BA 4M6HA 1N71A 1VHSA 1KZFA 3GKRA 4QB9A 4GXHA 1NE9A 1LCPA 3TO9A 4NXYA 2HUZA 5THWA 5K8OA 1VIXA 4ZX9A 2I3CA 4JD6A 3RO0A 1Q2YA 1XOVA 4PK3A 1TKJA 1X10A 2V77A 2QYVA 1XJOA 1Z9UA 4ZI6A 2DEAA 1LRZA 5H84A 4P4FA 4UFXA 4U9ZA 2ZENA 3SI0A 3DDDA 3R95A 3KZWA 3VWEA 3CXPA 2BL1A 2Z11A 2FE7A 3CT9A 4JXQA 4MY3A 3S9MA 3VATA 3PB4X 1CP6A 1TIQA 1GHEA 2HV2A 1ELLP 3TO7A 1NMTA 2VZYA 3F0AA 3LODA 5EC4A 3T90A 4A95A 1S60A 3S6GA 4CYNA 2GU2A 3NH4A 1CM0A 3FB3A 2P0WA 4H89A 1XIXA 5LRKA 4R8FA 3TCVA 3DR6A 1RXTA 4CYOA 4FD7A 3B2YA 4P6YA 4PSWA 3KQXA 1UWYA 2R1IA 1ARLA 1RTQA 4PXEA 3F5BA 3R9GA 2P6GA 3S6HA 1ZG9A 3W6XA 3K9UA 2PVVA 4AVCA 3SXOA 2QVPA 4B10A 2I00A 3IFEA 3D7FA 4MFJA 1BPMA 5EBVA 2OZHA 2Z3NA 5EMIA 3ISZA 3TC8A 3TTHA 2PJ5A 2B4DB 3SHPA 4AVBA 4MHYA 1YVOA 2BO9A 4KOVA 2PCUA 3I9SA 1S7LA 2ATRA 4PK2A 3S9LA 4FD6A 1Q2CA 2DPTA 4OC4A 4X8IA 5LYFA 4E8OA 2Q44A 1JQGA 1YSJA 2Q51A 3PRTA 4OC3A 2GLJA 4FWUA 1CPXA 4MFLA 5JPHA 4ONUA 2V8HA 4F8ZA 2V8GA 2Z3KA 4KSIA 2B4BA 2ZW6A 3IWWA 1M44A 4A31A 4NGPA 2ODFA 4EMEA 4LX9A 3HUVA 2B5GA 2O4HA 3RNZA 3SI2A 4KS9A 4KORA 3UY5A 4HNYB 2CXAA 2ZW5A 2AFUA 3BHXA 4OLLA 2C6CA 5KTDA 1LAPA 2H5MA 2VQYA 5IV0A 2EK9A 1MJAA 1XMBA 3G3SA 4KOTA 5F47A 2PJ2A 1BPNA 2PJ1A 4Q36A 4OIWA 4WWVA 4MFZA 1A2ZA 2Z10A 1Z8XA 1XBUA 2CF4A 3D7HA 2AFWA 3FIXA 4GS4A 1U6MA 2EK8A 2EO8A 3D8PA 3DGVA 3H4QA 4U9YA 5DS0A 5LYDA 4ORFA 2QIRA 3R96A 3PZJA 3FXTA 4OC1A 3FVLA 4EFDA 1I21A 2WSAA 4E0AA 2DPSA 4KOYA 4CGOA 2HQYA 3BJ7A 3H5ZA 3QAHA 1M4LA 3JRUA 5J8CA 3PB9X 7CPAA 1F57A 4MMOA 5AG4A 1IICA 3TOBA 1BAVA 5E96A 4MFQA 1IY7A 4K30A 2ZEEA 2PJ7A 4B5OA 4A39A 2G3TA 5HH1A 1Y7RA 5K8NA 1R3NA 3B3SA 1S5KA 2PJAA 3FRMA 4UFWA 4WJBA 2GREA 2R8VA 4IK2A 4P45A 3IGRA 1XF8A 2YNDA 4OADA 2F5IA 4R9MA 1UFHA 1YW6A 2DF5A 4NEXA 1K4JA 2OB0A 2X7BA 2FIWA 2PJ9A 2PJ6A 4NCZA 3LMSA 3FECA 4XPDB 5F49A 4BINA 3EY5A 1ARMA 4YGOA 2GLFA 2ZEHA 3I3GA 4B5PA 4PV6A 2FXFA 2R98A 2ZEFA 2CIJA 1VHOA 4ZY1A 4MHNA 3PB6X 4C2ZA 4XPDC 4K3NA 4BD9A 5A28A 1YLOA 4R6TA 3E0KA 4EWTA 2C6PA 3JTKA 4A38A 1S7FA 4AVAA 5F48A 5I0CA 4TNUA 1QMUA 1IOFA 2OR4A 4MBUA 4UIBA 3V7ZA 2AFOA 1PYTB 4IF5A 2FVGA 2J9AA 1J4JA 2PJ3A 5AG7A 3VWDA 2PDOA 4F9VA 4NGSA 5HVHA 3BLNA 3BJ8A 1Y0YA 3WC6A 2BUEA 2B5GB 3DR8A 3NA6A 3PFOA 1XMTA 3SJFA 2O53A 1AMPA 1M1DA 2ZELA 3IU2A 4OMEA 5LRGA 3SXNA 4XNHB 3QNVA 5KTAA 2YNEA 1M4IA 2V8DA 2JBKA 2P6EA 1QSMA 2RB7A 5GCNA 4CYQA 4XNHC 4JZ0A 5DWNA 5G21A 3JVNA 5IX3A 1TF8A 4MCQA 1L0CA 4R3LA 3D68A 4R7MA 2FSRA 3DLJA 4H6UA 1FY7A 3FF3A 4AG9A 3C26A 4A2ZA 4A94A 1AYEA 1KWMA 4E2AA 3EFAA 5J1QA 2DXQA 2Q43A 2FIAA 5D29A 4F0XA 2PSWA 4KOUA 4PXCA 5CNPA 2C1CA 4P44A 1YMEA 2Z3PA 3NH5A 3RBUA 4II9A 3PBEA 4UBRA 1HEEA 2Q7BA 3L2NA 4QBJA 2VZZA 5HVFA 2GE3A 1P0HA 1IU8A 4ZBGA 3S6FA 1DTDA 2IMOA 1X12A 1YVKA 4P4EA 3FYNA 1FNOA 1I12A 3PEIA 1XRYA 2VEZA 1CG2A 2PVWA 4MRIA 3SJEA 2XEFA 3IJ3A 2HC9A 1Z8LA 4Q7AA 2ANPA 3D4UA 2ZEPA 1TKFA
chains in the Genus database with same CATH topology
1IYLA 1S7KA 4L89A 3PGPA 2Q0YA 4YRHA 1M4DA 2Q04A 1CJWA 2Z0ZA 2ZXVA 3R1KA 5A27A 5ISVA 1BOBA 1YX0A 4XPLA 2RC4A 1ON0A 2OZUA 2CNTA 1PUAA 4KOWA 2AE6A 4A32A 4AG7A 4CRYB 2FL4A 2G3AA 4RI1A 1B6BA 2PR1A 4A30A 5G20A 2VI7A 3IWGA 1RO5A 4KOXA 4KVOE 1ZO0A 2VBQA 3V8IA 4CGPA 1P4NA 3A9LA 1QSRA 4JLYA 3EO4A 4UCNA 2WPXA 3TO6A 4KSFA 2J8MA 5KTCA 3R9FA 4CAEA 3OWCA 3D2MA 4CAVA 3LD2A 4ZGYB 4MI4A 3IU1A 3G8WA 2BEIA 5FVJA 2Y0MA 2REFA 4F0YA 1MJ9A 2PRBA 2J8RA 3N7ZA 4UA3A 4MHDA 3EC4A 4UCPA 2JDDA 4RS2A 2CY2A 3JUWA 5H86A 2PQ8A 4CAXA 3NE7A 4C2YA 4R3KA 3P2HA 4CAFA 4PSXA 2J8NA 3D3SA 4HNWB 2R7HA 4IUSA 4KOSA 3MGDA 4BBHA 1MJBA 4M85A 1YREA 4MY0A 2OH1A 4X5KA 3R9EA 4U5YA 3KKWA 4NF1A 2VXKA 2JEVA 4KSAA 2B58A 4CS0B 3S6KA 5HMNA 4BMHA 4C68A 1Y9KA 3RYOA 3P2FA 3GY9A 2FCKA 4CGLA 1WWZA 4A33A 2FS5A 2GANA 1Z4RA 4QVTA 1IIDA 4LUAA 4B12A 4EVYA 4C7HA 2ZW4A 2Z3LA 4KLWA 5BWAB 4R87A 1YGHA 4CGMA 4B14A 4L8AA 5IB0A 1MK4A 2GIVA 3TT2A 5AG5A 3QB8A 3F8KA 1PU9A 2WPWA 4B11A 4CGNA 2YNCA 1SQHA 2BSWA 4FD5A 5G22A 1KUVA 4CAWA 4B5PB 4Q38A 4MJ8A 1OZPA 2FT0A 4KVXA 3W6SA 4HNXB 4KZTA 4QUSA 3B8GA 4UFVA 1QSNA 2JDCA 1Z4EA 2I79A 4MFKA 2Z3MA 3ZJ0A 1KUYA 1WK4A 4XPKA 3T9YA 2REEA 2O28A 3FBUA 4C2XA 3ZZIA 1YK3A 2EVNA 3TE4A 3W91A 1V0CA 1KUXA 4I49A 4M3SA 3TFYA 4C7IA 5G1ZA 2Q4VA 4B13A 4JXRA 2ZW7A 4KUAA 5C82A 2EUIA 2Z3OA 2C27A 2B3VA 4YFJA 4KVME 1YLEA 2ARHA 2Q4YA 4H6ZA 4KLVA 2PC1A 1B87A 2ZPAA 5JQ4A 5C88A 5DWMA 4Y49B 2WUUA 1Q2DA 5AG6A 2P6FA 3IWEA 1S3ZA 1Y9WA 3D2PA 2KCWA 2JLMA 3PP9A 4Y49C 2IL4A 4UCMA 4F6AA 1M4GA 4HKFA 2CNMA 4AB7A 1XEBA 2G0BA 4CRZB 4J3GA 3TOAA 1R57A 2QMLA 1VKCA 3GYAA 2YNCC 1I1DA 3DNSA 3CXSA 2QECA 3EXNA 4NSQA 1IB1E 4DNCA 4FD4A 2OZGA 4OAEA 1S7NA 2AJ6A 5J8FA 2K5TA 2OU2A 2NMTA 4KUBA 1XE4A 1NSLA 2A4NA 3DSBA 2CNSA 4QC6A 3FNCA 2B3UA 4UWIA 2B4DA 1YR0A 1QSTA 4JJXA 1BO4A 4R57A 2D4OA 3CXQA 5F46A 4UWJA 1IYKA 2PR8A 2YGWA 4CYPA 1QSOA 2D4PA 4MFPA 5AGEA 3WR7A 4JWPA 1N71A 1VHSA 1KZFA 3GKRA 4QB9A 1NE9A 3TO9A 4NXYA 2HUZA 4JD6A 1Q2YA 4PK3A 1Z9UA 1LRZA 5H84A 4UFXA 4U9ZA 3DDDA 3R95A 3VWEA 3CXPA 2BL1A 2Z11A 2FE7A 4JXQA 4MY3A 1TIQA 1GHEA 2HV2A 3TO7A 1NMTA 2VZYA 3F0AA 3LODA 5EC4A 3T90A 4A95A 1S60A 3S6GA 4CYNA 1CM0A 3FB3A 2P0WA 4H89A 1XIXA 3TCVA 3DR6A 1RXTA 4CYOA 4FD7A 4PSWA 2R1IA 3F5BA 3R9GA 2P6GA 3S6HA 3W6XA 3K9UA 4AVCA 3SXOA 4B10A 2I00A 4MFJA 5EBVA 2OZHA 2Z3NA 3TTHA 2B4DB 3SHPA 4AVBA 1YVOA 4KOVA 3I9SA 1S7LA 2ATRA 4PK2A 4FD6A 1Q2CA 2DPTA 4E8OA 2Q44A 4MFLA 5JPHA 4ONUA 2Z3KA 4A31A 2B4BA 2ZW6A 1M44A 4LX9A 2B5GA 4KS9A 4KORA 3UY5A 4HNYB 2CXAA 2ZW5A 4OLLA 5KTDA 2H5MA 2VQYA 5IV0A 3G3SA 1MJAA 4KOTA 5F47A 4Q36A 4MFZA 2Z10A 4GS4A 3FIXA 1U6MA 4U9YA 3H4QA 3D8PA 4ORFA 2QIRA 3R96A 3PZJA 3FXTA 1I21A 2WSAA 4E0AA 2DPSA 4KOYA 4CGOA 2HQYA 3BJ7A 3H5ZA 3QAHA 5J8CA 5AG4A 1IICA 3TOBA 5E96A 4MFQA 4K30A 4B5OA 2G3TA 5HH1A 1Y7RA 1S5KA 3FRMA 4UFWA 2R8VA 3IGRA 1XF8A 2YNDA 4OADA 2F5IA 4R9MA 1UFHA 4NEXA 1K4JA 2OB0A 2X7BA 2FIWA 4E2AA 4NCZA 5F49A 4XPDB 3EY5A 4YGOA 3I3GA 4B5PA 4PV6A 2FXFA 2R98A 4C2ZA 4XPDC 5A28A 3E0KA 3JTKA 1S7FA 4AVAA 5F48A 5I0CA 4MBUA 4IF5A 1J4JA 5AG7A 3VWDA 2PDOA 3BLNA 3BJ8A 2BUEA 2B5GB 3DR8A 1XMTA 1M1DA 3SXNA 3IU2A 4XNHB 5KTAA 2YNEA 1M4IA 2P6EA 1QSMA 4CYQA 5GCNA 4XNHC 5DWNA 5G21A 3JVNA 5IX3A 1L0CA 4R3LA 2FSRA 4H6UA 1FY7A 4AG9A 3C26A 4A2ZA 3EFAA 2DXQA 2FIAA 4F0XA 2PSWA 4KOUA 5CNPA 2Z3PA 4II9A 4UBRA 2Q7BA 4QBJA 2VZZA 2GE3A 1P0HA 4ZBGA 3S6FA 1YVKA 3FYNA 1I12A 2VEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYL A;  1S7K A;  4L89 A;  3PGP A;  2Q0Y A;  4YRH A;  1M4D A;  2Q04 A;  1CJW A;  2Z0Z A;  2ZXV A;  3R1K A;  5ISV A;  1BOB A;  1YX0 A;  4XPL A;  2RC4 A;  1ON0 A;  2OZU A;  2CNT A;  1PUA A;  4KOW A;  2AE6 A;  4AG7 A;  4CRY B;  2FL4 A;  2G3A A;  4RI1 A;  1B6B A;  2PR1 A;  2VI7 A;  3IWG A;  1RO5 A;  4KOX A;  4KVO E;  2VBQ A;  3V8I A;  1P4N A;  1QSR A;  4JLY A;  3EO4 A;  3TO6 A;  2WPX A;  2J8M A;  5KTC A;  3R9F A;  3OWC A;  3D2M A;  4CAV A;  3LD2 A;  4MI4 A;  3G8W A;  2BEI A;  5FVJ A;  2Y0M A;  2REF A;  4F0Y A;  1MJ9 A;  2PRB A;  2J8R A;  3N7Z A;  4UA3 A;  4MHD A;  3EC4 A;  2JDD A;  4RS2 A;  2CY2 A;  3JUW A;  5H86 A;  2PQ8 A;  4CAX A;  3NE7 A;  4R3K A;  3P2H A;  4PSX A;  2J8N A;  3D3S A;  4HNW B;  2R7H A;  4IUS A;  4KOS A;  3MGD A;  1MJB A;  4M85 A;  1YRE A;  4MY0 A;  2OH1 A;  4X5K A;  3R9E A;  4U5Y A;  3KKW A;  4NF1 A;  2VXK A;  2JEV A;  2B58 A;  4CS0 B;  3S6K A;  5HMN A;  4BMH A;  1Y9K A;  3RYO A;  3P2F A;  3GY9 A;  2FCK A;  1WWZ A;  2FS5 A;  2GAN A;  1Z4R A;  4QVT A;  1IID A;  4LUA A;  4EVY A;  2ZW4 A;  4KLW A;  4R87 A;  1YGH A;  4L8A A;  5IB0 A;  1MK4 A;  2GIV A;  3TT2 A;  3QB8 A;  3F8K A;  1PU9 A;  2WPW A;  1SQH A;  2BSW A;  4FD5 A;  1KUV A;  4CAW A;  4B5P B;  4MJ8 A;  1OZP A;  2FT0 A;  4KVX A;  3W6S A;  4HNX B;  4KZT A;  4QUS A;  3B8G A;  1QSN A;  2JDC A;  1Z4E A;  2I79 A;  3ZJ0 A;  1KUY A;  1WK4 A;  4XPK A;  3T9Y A;  2REE A;  2O28 A;  3FBU A;  3ZZI A;  1YK3 A;  2EVN A;  3TE4 A;  3W91 A;  1V0C A;  1KUX A;  4I49 A;  4M3S A;  3TFY A;  2Q4V A;  4JXR A;  2ZW7 A;  4KUA A;  5C82 A;  2EUI A;  2C27 A;  2B3V A;  4YFJ A;  4KVM E;  1YLE A;  2ARH A;  2Q4Y A;  4H6Z A;  4KLV A;  2PC1 A;  1B87 A;  2ZPA A;  5JQ4 A;  5C88 A;  5DWM A;  4Y49 B;  1Q2D A;  2P6F A;  1S3Z A;  1Y9W A;  3D2P A;  2KCW A;  2JLM A;  3PP9 A;  4Y49 C;  2IL4 A;  4F6A A;  1M4G A;  4HKF A;  2CNM A;  4AB7 A;  1XEB A;  2G0B A;  4CRZ B;  4J3G A;  3TOA A;  1R57 A;  2QML A;  1VKC A;  3GYA A;  1I1D A;  3DNS A;  3CXS A;  2QEC A;  3EXN A;  4NSQ A;  1IB1 E;  4DNC A;  4FD4 A;  2OZG A;  4OAE A;  1S7N A;  2AJ6 A;  5J8F A;  2K5T A;  2OU2 A;  2NMT A;  4KUB A;  1XE4 A;  1NSL A;  2A4N A;  3DSB A;  2CNS A;  4QC6 A;  3FNC A;  2B3U A;  4UWI A;  2B4D A;  1YR0 A;  1QST A;  4JJX A;  1BO4 A;  4R57 A;  2D4O A;  3CXQ A;  5F46 A;  4UWJ A;  1IYK A;  2PR8 A;  1QSO A;  2D4P A;  3WR7 A;  4JWP A;  1N71 A;  1VHS A;  1KZF A;  3GKR A;  4QB9 A;  1NE9 A;  3TO9 A;  4NXY A;  2HUZ A;  4JD6 A;  1Q2Y A;  4PK3 A;  1Z9U A;  1LRZ A;  5H84 A;  4U9Z A;  3DDD A;  3R95 A;  3VWE A;  3CXP A;  2BL1 A;  2Z11 A;  2FE7 A;  4JXQ A;  4MY3 A;  1TIQ A;  1GHE A;  2HV2 A;  3TO7 A;  1NMT A;  2VZY A;  3F0A A;  3LOD A;  5EC4 A;  3T90 A;  1S60 A;  3S6G A;  1CM0 A;  3FB3 A;  2P0W A;  4H89 A;  1XIX A;  3TCV A;  3DR6 A;  1RXT A;  4FD7 A;  4PSW A;  2R1I A;  3F5B A;  3R9G A;  2P6G A;  3S6H A;  3W6X A;  3K9U A;  4AVC A;  3SXO A;  2I00 A;  5EBV A;  2OZH A;  3TTH A;  2B4D B;  3SHP A;  4AVB A;  1YVO A;  4KOV A;  3I9S A;  1S7L A;  2ATR A;  4PK2 A;  4FD6 A;  1Q2C A;  4E8O A;  2Q44 A;  5JPH A;  4ONU A;  2B4B A;  2ZW6 A;  1M44 A;  4LX9 A;  2B5G A;  4KOR A;  3UY5 A;  4HNY B;  2ZW5 A;  4OLL A;  5KTD A;  2H5M A;  2VQY A;  5IV0 A;  3G3S A;  1MJA A;  4KOT A;  5F47 A;  2Z10 A;  4GS4 A;  3FIX A;  1U6M A;  4U9Y A;  3H4Q A;  3D8P A;  4ORF A;  2QIR A;  3R96 A;  3PZJ A;  3FXT A;  1I21 A;  4E0A A;  4KOY A;  2HQY A;  3BJ7 A;  3QAH A;  5J8C A;  1IIC A;  3TOB A;  5E96 A;  4K30 A;  4B5O A;  2G3T A;  5HH1 A;  1Y7R A;  1S5K A;  3FRM A;  2R8V A;  3IGR A;  1XF8 A;  4OAD A;  2F5I A;  4R9M A;  1UFH A;  4NEX A;  1K4J A;  2OB0 A;  2X7B A;  2FIW A;  4E2A A;  4NCZ A;  5F49 A;  4XPD B;  3EY5 A;  4YGO A;  3I3G A;  4B5P A;  4PV6 A;  2FXF A;  2R98 A;  4XPD C;  3E0K A;  1S7F A;  4AVA A;  5F48 A;  5I0C A;  4MBU A;  4IF5 A;  1J4J A;  3VWD A;  2PDO A;  3BLN A;  3BJ8 A;  2BUE A;  2B5G B;  3DR8 A;  1XMT A;  1M1D A;  3SXN A;  4XNH B;  5KTA A;  1M4I A;  2P6E A;  1QSM A;  5GCN A;  4XNH C;  5DWN A;  3JVN A;  5IX3 A;  1L0C A;  4R3L A;  2FSR A;  4H6U A;  1FY7 A;  4AG9 A;  3C26 A;  3EFA A;  2DXQ A;  2FIA A;  2PSW A;  4KOU A;  5CNP A;  4II9 A;  4UBR A;  2Q7B A;  4QBJ A;  2VZZ A;  2GE3 A;  1P0H A;  4ZBG A;  3S6F A;  1YVK A;  3FYN A;  1I12 A;  2VEZ A; 
#chains in the Genus database with same CATH topology
 2RFH A;  1IYL A;  1S7K A;  2ZEM A;  4H2K A;  4L89 A;  4X3R A;  3FJU A;  3PGP A;  1CX8 A;  2ZED A;  2Q0Y A;  4YRH A;  1Z8T A;  1M4D A;  4DJL A;  3WAB A;  2Q04 A;  1CJW A;  2Z0Z A;  2ZXV A;  3R1K A;  5A27 A;  3FED A;  5ISV A;  2XEJ A;  1BOB A;  1YX0 A;  4YU9 A;  4Z65 A;  4XPL A;  2RC4 A;  1ON0 A;  4W9Y A;  4PXB A;  2OZU A;  4DUK A;  4LQG A;  2CNT A;  2QJ8 A;  1PUA A;  4KOW A;  1Z5R A;  4AXV A;  4RUH A;  2AE6 A;  4A32 A;  4AG7 A;  5K8M A;  4CRY B;  4OID A;  4X2T A;  2FL4 A;  2G3A A;  4RI1 A;  1ZG7 A;  2ABZ A;  1B6B A;  2PR1 A;  4A30 A;  5G20 A;  2VI7 A;  2NYQ A;  4ZY0 A;  3IWG A;  1RO5 A;  4FUU A;  4KOX A;  4NGN A;  3WT4 A;  1Y0R A;  4KVO E;  1ELM P;  4NFR A;  1ZO0 A;  2VBQ A;  4P10 A;  3V8I A;  4CGP A;  1P4N A;  3KAS A;  3A9L A;  4NJR A;  4ZY2 A;  1QSR A;  4JLY A;  3EO4 A;  4UCN A;  2WPX A;  3GUX A;  3SJG A;  4JYW A;  3TO6 A;  4KSF A;  2J8M A;  5KTC A;  1QQ9 A;  5F09 A;  3R9F A;  4CAE A;  3OWC A;  3D2M A;  4CAV A;  4PPZ A;  3LD2 A;  3SJX A;  4ZGY B;  5IB9 A;  4MI4 A;  3IU1 A;  3G8W A;  3T8W A;  2BEI A;  5FVJ A;  2Y0M A;  4FBE A;  1TF9 A;  2REF A;  4F0Y A;  1MJ9 A;  2PRB A;  2J8R A;  3KR5 A;  5JM6 A;  3FH4 A;  3N7Z A;  4UA3 A;  1ZLH A;  1R43 A;  4MHD A;  4FAI A;  3EC4 A;  4UCP A;  3K2K A;  2JDD A;  5CPA A;  2WZN A;  4NJQ A;  4RS2 A;  1HDU A;  2CY2 A;  1PCA A;  1YW4 A;  3H8G A;  3JUW A;  2IQ6 A;  2PQ8 A;  5H86 A;  4CAX A;  3NE7 A;  2C6G A;  4C2Y A;  3IIB A;  4R3K A;  3P2H A;  4CAF A;  2Q4Z A;  2ZOF A;  4B6Z A;  2PJ0 A;  4PSX A;  2J8N A;  3FEE A;  4OC0 A;  3D3S A;  4HNW B;  4UEE A;  3BI1 A;  2R7H A;  2AFS A;  4IUS A;  3WC7 A;  4KOS A;  4M6G A;  3TX8 A;  3MGD A;  2F8H A;  4BBH A;  1MJB A;  4ZX8 A;  4M85 A;  1YRE A;  4MY0 A;  2OH1 A;  4LQ6 A;  4P4J A;  5HVG A;  4X5K A;  1Z8W A;  3R9E A;  4U5Y A;  3HLP A;  5ELY A;  3KQZ A;  4NGM A;  1F2P A;  3KKW A;  4NF1 A;  1ZLI A;  3KI9 A;  1BLL E;  2VXK A;  3S9N A;  2JEV A;  2XEI A;  4KSA A;  1JWQ A;  1LOK A;  2B58 A;  4CS0 B;  3S6K A;  1CP7 A;  5HMN A;  4BMH A;  4C68 A;  1Y9K A;  1HDQ A;  3RYO A;  2IJZ A;  3P2F A;  1Z2L A;  3GY9 A;  2FCK A;  4CGL A;  1WWZ A;  4A33 A;  2FS5 A;  2GAN A;  8CPA A;  1OBR A;  3CPX A;  1Z4R A;  4MCR A;  2OOT A;  3MN8 A;  3PB7 X;  4QVT A;  1IID A;  4F9U A;  4LUA A;  4A37 A;  5HXD A;  4B12 A;  2WYR A;  3PFE A;  4EVY A;  4C7H A;  2Q7S A;  6CPA A;  2ZW4 A;  2Z3L A;  4KLW A;  4UIA A;  3B7I A;  5BWA B;  3PB8 X;  1NSA A;  4R87 A;  3H8E A;  3MRU A;  2PIY A;  3BI0 A;  1YGH A;  3FMC A;  4MXU A;  1IGB A;  4CGM A;  4UEZ A;  4B14 A;  2PIZ A;  4L8A A;  3B3C A;  5IB0 A;  1MK4 A;  2GIV A;  3TT2 A;  5AG5 A;  3B3W A;  4ONW A;  3QB8 A;  3KR4 A;  4P4D A;  3F8K A;  3H8F A;  1PU9 A;  3D67 A;  2WPW A;  4B11 A;  4CGN A;  3KHX A;  3ISX A;  2POK A;  3KGQ A;  4G1P A;  4R76 A;  2CTB A;  2F7V A;  3K9T A;  2YNC A;  1SQH A;  1XFO A;  2BSW A;  4FD5 A;  5G22 A;  2JBJ A;  1KUV A;  4YWY A;  4CAW A;  1F2O A;  4B5P B;  4Q38 A;  4NGT A;  4OC2 A;  3BXM A;  4MJ8 A;  1LAN A;  2AFM A;  1OZP A;  2FT0 A;  3LWU A;  4KVX A;  4OKO A;  4HNX B;  4KZT A;  3W6S A;  4QUS A;  3B8G A;  3KHZ A;  4UFV A;  3VH9 A;  1TXR A;  2BCO A;  1QSN A;  2JDC A;  3CDX A;  1Z4E A;  2I79 A;  4MFK A;  2Z3M A;  4GM5 A;  3ZJ0 A;  1KUY A;  1WK4 A;  1Q7L A;  2CTC A;  3VAR A;  4XPK A;  3T9Y A;  2REE A;  2O28 A;  3D7G A;  1VGY A;  3FBU A;  4C2X A;  3ZZI A;  1YK3 A;  2EVN A;  3TE4 A;  2GFQ A;  3KL9 A;  3W91 A;  1V0C A;  1KUX A;  1LFW A;  4I49 A;  4M3S A;  2VL1 A;  1EE3 P;  3TFY A;  4C7I A;  1AUG A;  5G1Z A;  2Q4V A;  4B13 A;  4JXR A;  2ZW7 A;  2PE3 A;  4KUA A;  3V38 A;  3GB0 A;  2AFX A;  3B3V A;  5C82 A;  1DE4 C;  2EUI A;  2Z3O A;  2C27 A;  2B3V A;  1VHE A;  4YFJ A;  4KVM E;  2PRQ A;  5CBM A;  1YLE A;  2ARH A;  2PJB A;  2Q4Y A;  3CPA A;  4MHZ A;  2ZOG A;  4H6Z A;  3NFZ A;  5LYL A;  1YQE A;  4KLV A;  5LYI A;  1GYT A;  3NH8 A;  4O23 A;  5K8P A;  1FT7 A;  5JH9 A;  4PQA A;  4IAV A;  2PC1 A;  3IC1 A;  1B87 A;  2ZPA A;  5JGF A;  1Y7E A;  5JQ4 A;  5C88 A;  4MHP A;  3QAY A;  5DWM A;  1LAM A;  2EBJ A;  4Y49 B;  2WUU A;  1Q2D A;  5AG6 A;  2JEW A;  3NE8 A;  1CBX A;  2BOA A;  2P6F A;  3IWE A;  1S3Z A;  2XEG A;  1Y9W A;  3I1U A;  3D2P A;  2PJ4 A;  4P4I A;  2KCW A;  4UF4 A;  3PBB A;  2JLM A;  3PP9 A;  4OP4 A;  4Y49 C;  4CPA A;  2IL4 A;  3B35 A;  4UCM A;  3LAC A;  1M4G A;  2PJ8 A;  4F6A A;  3IEH A;  4HKF A;  2CNM A;  4AB7 A;  1ZG8 A;  2ZEO A;  4UEF A;  1XEB A;  3D66 A;  4HPS A;  2G0B A;  4CRZ B;  4J3G A;  3TOA A;  5I4M A;  1R57 A;  2QML A;  1VKC A;  3FX6 A;  1IOI A;  1CPS A;  1I1D A;  1TKH A;  2YNC C;  3GYA A;  4MCS A;  3DNS A;  3CXS A;  2QEC A;  3IO1 A;  3EXN A;  4NSQ A;  1IB1 E;  4NGQ A;  4DNC A;  4FD4 A;  2NSM A;  2OZG A;  4TWE A;  2V8V A;  4OAE A;  2AFZ A;  4MCP A;  1S7N A;  2AJ6 A;  5J8F A;  2K5T A;  2OU2 A;  2NMT A;  4KUB A;  4ZYQ A;  4PXD A;  2HB6 A;  1XE4 A;  2PJC A;  3GLJ A;  1NSL A;  2A4N A;  3DSB A;  2G9D A;  2CNS A;  4QC6 A;  3FNC A;  3SI1 A;  4NGR A;  2B3U A;  3B3T A;  4UWI A;  5D8N A;  4RN7 A;  2B4D A;  4IHM A;  1YR0 A;  3RAM A;  1H8L A;  1QST A;  4JJX A;  1BO4 A;  4R57 A;  2EWB A;  3N5F A;  3WC5 A;  5LRJ A;  2D4O A;  3CXQ A;  5F46 A;  4DYO A;  4UWJ A;  1IYK A;  2PR8 A;  2YGW A;  4CYP A;  3RZA A;  1QSO A;  3GIU A;  2D4P A;  3CZX A;  4MFP A;  3D7D A;  2ZEG A;  4OC5 A;  4M6I A;  5AGE A;  3WR7 A;  4JWP A;  4P4B A;  4M6H A;  1N71 A;  1VHS A;  1KZF A;  3GKR A;  4QB9 A;  4GXH A;  1NE9 A;  1LCP A;  3TO9 A;  4NXY A;  2HUZ A;  5THW A;  5K8O A;  1VIX A;  4ZX9 A;  2I3C A;  4JD6 A;  3RO0 A;  1Q2Y A;  1XOV A;  4PK3 A;  1TKJ A;  1X10 A;  2V77 A;  2QYV A;  1XJO A;  1Z9U A;  4ZI6 A;  2DEA A;  1LRZ A;  5H84 A;  4P4F A;  4UFX A;  4U9Z A;  2ZEN A;  3SI0 A;  3DDD A;  3R95 A;  3KZW A;  3VWE A;  3CXP A;  2BL1 A;  2Z11 A;  2FE7 A;  3CT9 A;  4JXQ A;  4MY3 A;  3S9M A;  3VAT A;  3PB4 X;  1CP6 A;  1TIQ A;  1GHE A;  2HV2 A;  1ELL P;  3TO7 A;  1NMT A;  2VZY A;  3F0A A;  3LOD A;  5EC4 A;  3T90 A;  4A95 A;  1S60 A;  3S6G A;  4CYN A;  2GU2 A;  3NH4 A;  1CM0 A;  3FB3 A;  2P0W A;  4H89 A;  1XIX A;  5LRK A;  4R8F A;  3TCV A;  3DR6 A;  1RXT A;  4CYO A;  4FD7 A;  3B2Y A;  4P6Y A;  4PSW A;  3KQX A;  1UWY A;  2R1I A;  1ARL A;  1RTQ A;  4PXE A;  3F5B A;  3R9G A;  2P6G A;  3S6H A;  1ZG9 A;  3W6X A;  3K9U A;  2PVV A;  4AVC A;  3SXO A;  2QVP A;  4B10 A;  2I00 A;  3IFE A;  3D7F A;  4MFJ A;  1BPM A;  5EBV A;  2OZH A;  2Z3N A;  5EMI A;  3ISZ A;  3TC8 A;  3TTH A;  2PJ5 A;  2B4D B;  3SHP A;  4AVB A;  4MHY A;  1YVO A;  2BO9 A;  4KOV A;  2PCU A;  3I9S A;  1S7L A;  2ATR A;  4PK2 A;  3S9L A;  4FD6 A;  1Q2C A;  2DPT A;  4OC4 A;  4X8I A;  5LYF A;  4E8O A;  2Q44 A;  1JQG A;  1YSJ A;  2Q51 A;  3PRT A;  4OC3 A;  2GLJ A;  4FWU A;  1CPX A;  4MFL A;  5JPH A;  4ONU A;  2V8H A;  4F8Z A;  2V8G A;  2Z3K A;  4KSI A;  2B4B A;  2ZW6 A;  3IWW A;  1M44 A;  4A31 A;  4NGP A;  2ODF A;  4EME A;  4LX9 A;  3HUV A;  2B5G A;  2O4H A;  3RNZ A;  3SI2 A;  4KS9 A;  4KOR A;  3UY5 A;  4HNY B;  2CXA A;  2ZW5 A;  2AFU A;  3BHX A;  4OLL A;  2C6C A;  5KTD A;  1LAP A;  2H5M A;  2VQY A;  5IV0 A;  2EK9 A;  1MJA A;  1XMB A;  3G3S A;  4KOT A;  5F47 A;  2PJ2 A;  1BPN A;  2PJ1 A;  4Q36 A;  4OIW A;  4WWV A;  4MFZ A;  1A2Z A;  2Z10 A;  1Z8X A;  1XBU A;  2CF4 A;  3D7H A;  2AFW A;  3FIX A;  4GS4 A;  1U6M A;  2EK8 A;  2EO8 A;  3D8P A;  3DGV A;  3H4Q A;  4U9Y A;  5DS0 A;  5LYD A;  4ORF A;  2QIR A;  3R96 A;  3PZJ A;  3FXT A;  4OC1 A;  3FVL A;  4EFD A;  1I21 A;  2WSA A;  4E0A A;  2DPS A;  4KOY A;  4CGO A;  2HQY A;  3BJ7 A;  3H5Z A;  3QAH A;  1M4L A;  3JRU A;  5J8C A;  3PB9 X;  7CPA A;  1F57 A;  4MMO A;  5AG4 A;  1IIC A;  3TOB A;  1BAV A;  5E96 A;  4MFQ A;  1IY7 A;  4K30 A;  2ZEE A;  2PJ7 A;  4B5O A;  4A39 A;  2G3T A;  5HH1 A;  1Y7R A;  5K8N A;  1R3N A;  3B3S A;  1S5K A;  2PJA A;  3FRM A;  4UFW A;  4WJB A;  2GRE A;  2R8V A;  4IK2 A;  4P45 A;  3IGR A;  1XF8 A;  2YND A;  4OAD A;  2F5I A;  4R9M A;  1UFH A;  1YW6 A;  2DF5 A;  4NEX A;  1K4J A;  2OB0 A;  2X7B A;  2FIW A;  2PJ9 A;  2PJ6 A;  4NCZ A;  3LMS A;  3FEC A;  4XPD B;  5F49 A;  4BIN A;  3EY5 A;  1ARM A;  4YGO A;  2GLF A;  2ZEH A;  3I3G A;  4B5P A;  4PV6 A;  2FXF A;  2R98 A;  2ZEF A;  2CIJ A;  1VHO A;  4ZY1 A;  4MHN A;  3PB6 X;  4C2Z A;  4XPD C;  4K3N A;  4BD9 A;  5A28 A;  1YLO A;  4R6T A;  3E0K A;  4EWT A;  2C6P A;  3JTK A;  4A38 A;  1S7F A;  4AVA A;  5F48 A;  5I0C A;  4TNU A;  1QMU A;  1IOF A;  2OR4 A;  4MBU A;  4UIB A;  3V7Z A;  2AFO A;  1PYT B;  4IF5 A;  2FVG A;  2J9A A;  1J4J A;  2PJ3 A;  5AG7 A;  3VWD A;  2PDO A;  4F9V A;  4NGS A;  5HVH A;  3BLN A;  3BJ8 A;  1Y0Y A;  3WC6 A;  2BUE A;  2B5G B;  3DR8 A;  3NA6 A;  3PFO A;  1XMT A;  3SJF A;  2O53 A;  1AMP A;  1M1D A;  2ZEL A;  3IU2 A;  4OME A;  5LRG A;  3SXN A;  4XNH B;  3QNV A;  5KTA A;  2YNE A;  1M4I A;  2V8D A;  2JBK A;  2P6E A;  1QSM A;  2RB7 A;  5GCN A;  4CYQ A;  4XNH C;  4JZ0 A;  5DWN A;  5G21 A;  3JVN A;  5IX3 A;  1TF8 A;  4MCQ A;  1L0C A;  4R3L A;  3D68 A;  4R7M A;  2FSR A;  3DLJ A;  4H6U A;  1FY7 A;  3FF3 A;  4AG9 A;  3C26 A;  4A2Z A;  4A94 A;  1AYE A;  1KWM A;  4E2A A;  3EFA A;  5J1Q A;  2DXQ A;  2Q43 A;  2FIA A;  5D29 A;  4F0X A;  2PSW A;  4KOU A;  4PXC A;  5CNP A;  2C1C A;  4P44 A;  1YME A;  2Z3P A;  3NH5 A;  3RBU A;  4II9 A;  3PBE A;  4UBR A;  1HEE A;  2Q7B A;  3L2N A;  4QBJ A;  2VZZ A;  5HVF A;  2GE3 A;  1P0H A;  1IU8 A;  4ZBG A;  3S6F A;  1DTD A;  2IMO A;  1X12 A;  1YVK A;  4P4E A;  3FYN A;  1FNO A;  1I12 A;  3PEI A;  1XRY A;  2VEZ A;  1CG2 A;  2PVW A;  4MRI A;  3SJE A;  2XEF A;  3IJ3 A;  2HC9 A;  1Z8L A;  4Q7A A;  2ANP A;  3D4U A;  2ZEP A;  1TKF A; 
#chains in the Genus database with same CATH homology
 1IYL A;  1S7K A;  4L89 A;  3PGP A;  2Q0Y A;  4YRH A;  1M4D A;  2Q04 A;  1CJW A;  2Z0Z A;  2ZXV A;  3R1K A;  5A27 A;  5ISV A;  1BOB A;  1YX0 A;  4XPL A;  2RC4 A;  1ON0 A;  2OZU A;  2CNT A;  1PUA A;  4KOW A;  2AE6 A;  4A32 A;  4AG7 A;  4CRY B;  2FL4 A;  2G3A A;  4RI1 A;  1B6B A;  2PR1 A;  4A30 A;  5G20 A;  2VI7 A;  3IWG A;  1RO5 A;  4KOX A;  4KVO E;  1ZO0 A;  2VBQ A;  3V8I A;  4CGP A;  1P4N A;  3A9L A;  1QSR A;  4JLY A;  3EO4 A;  4UCN A;  2WPX A;  3TO6 A;  4KSF A;  2J8M A;  5KTC A;  3R9F A;  4CAE A;  3OWC A;  3D2M A;  4CAV A;  3LD2 A;  4ZGY B;  4MI4 A;  3IU1 A;  3G8W A;  2BEI A;  5FVJ A;  2Y0M A;  2REF A;  4F0Y A;  1MJ9 A;  2PRB A;  2J8R A;  3N7Z A;  4UA3 A;  4MHD A;  3EC4 A;  4UCP A;  2JDD A;  4RS2 A;  2CY2 A;  3JUW A;  5H86 A;  2PQ8 A;  4CAX A;  3NE7 A;  4C2Y A;  4R3K A;  3P2H A;  4CAF A;  4PSX A;  2J8N A;  3D3S A;  4HNW B;  2R7H A;  4IUS A;  4KOS A;  3MGD A;  4BBH A;  1MJB A;  4M85 A;  1YRE A;  4MY0 A;  2OH1 A;  4X5K A;  3R9E A;  4U5Y A;  3KKW A;  4NF1 A;  2VXK A;  2JEV A;  4KSA A;  2B58 A;  4CS0 B;  3S6K A;  5HMN A;  4BMH A;  4C68 A;  1Y9K A;  3RYO A;  3P2F A;  3GY9 A;  2FCK A;  4CGL A;  1WWZ A;  4A33 A;  2FS5 A;  2GAN A;  1Z4R A;  4QVT A;  1IID A;  4LUA A;  4B12 A;  4EVY A;  4C7H A;  2ZW4 A;  2Z3L A;  4KLW A;  5BWA B;  4R87 A;  1YGH A;  4CGM A;  4B14 A;  4L8A A;  5IB0 A;  1MK4 A;  2GIV A;  3TT2 A;  5AG5 A;  3QB8 A;  3F8K A;  1PU9 A;  2WPW A;  4B11 A;  4CGN A;  2YNC A;  1SQH A;  2BSW A;  4FD5 A;  5G22 A;  1KUV A;  4CAW A;  4B5P B;  4Q38 A;  4MJ8 A;  1OZP A;  2FT0 A;  4KVX A;  3W6S A;  4HNX B;  4KZT A;  4QUS A;  3B8G A;  4UFV A;  1QSN A;  2JDC A;  1Z4E A;  2I79 A;  4MFK A;  2Z3M A;  3ZJ0 A;  1KUY A;  1WK4 A;  4XPK A;  3T9Y A;  2REE A;  2O28 A;  3FBU A;  4C2X A;  3ZZI A;  1YK3 A;  2EVN A;  3TE4 A;  3W91 A;  1V0C A;  1KUX A;  4I49 A;  4M3S A;  3TFY A;  4C7I A;  5G1Z A;  2Q4V A;  4B13 A;  4JXR A;  2ZW7 A;  4KUA A;  5C82 A;  2EUI A;  2Z3O A;  2C27 A;  2B3V A;  4YFJ A;  4KVM E;  1YLE A;  2ARH A;  2Q4Y A;  4H6Z A;  4KLV A;  2PC1 A;  1B87 A;  2ZPA A;  5JQ4 A;  5C88 A;  5DWM A;  4Y49 B;  2WUU A;  1Q2D A;  5AG6 A;  2P6F A;  3IWE A;  1S3Z A;  1Y9W A;  3D2P A;  2KCW A;  2JLM A;  3PP9 A;  4Y49 C;  2IL4 A;  4UCM A;  4F6A A;  1M4G A;  4HKF A;  2CNM A;  4AB7 A;  1XEB A;  2G0B A;  4CRZ B;  4J3G A;  3TOA A;  1R57 A;  2QML A;  1VKC A;  3GYA A;  2YNC C;  1I1D A;  3DNS A;  3CXS A;  2QEC A;  3EXN A;  4NSQ A;  1IB1 E;  4DNC A;  4FD4 A;  2OZG A;  4OAE A;  1S7N A;  2AJ6 A;  5J8F A;  2K5T A;  2OU2 A;  2NMT A;  4KUB A;  1XE4 A;  1NSL A;  2A4N A;  3DSB A;  2CNS A;  4QC6 A;  3FNC A;  2B3U A;  4UWI A;  2B4D A;  1YR0 A;  1QST A;  4JJX A;  1BO4 A;  4R57 A;  2D4O A;  3CXQ A;  5F46 A;  4UWJ A;  1IYK A;  2PR8 A;  2YGW A;  4CYP A;  1QSO A;  2D4P A;  4MFP A;  5AGE A;  3WR7 A;  4JWP A;  1N71 A;  1VHS A;  1KZF A;  3GKR A;  4QB9 A;  1NE9 A;  3TO9 A;  4NXY A;  2HUZ A;  4JD6 A;  1Q2Y A;  4PK3 A;  1Z9U A;  1LRZ A;  5H84 A;  4UFX A;  4U9Z A;  3DDD A;  3R95 A;  3VWE A;  3CXP A;  2BL1 A;  2Z11 A;  2FE7 A;  4JXQ A;  4MY3 A;  1TIQ A;  1GHE A;  2HV2 A;  3TO7 A;  1NMT A;  2VZY A;  3F0A A;  3LOD A;  5EC4 A;  3T90 A;  4A95 A;  1S60 A;  3S6G A;  4CYN A;  1CM0 A;  3FB3 A;  2P0W A;  4H89 A;  1XIX A;  3TCV A;  3DR6 A;  1RXT A;  4CYO A;  4FD7 A;  4PSW A;  2R1I A;  3F5B A;  3R9G A;  2P6G A;  3S6H A;  3W6X A;  3K9U A;  4AVC A;  3SXO A;  4B10 A;  2I00 A;  4MFJ A;  5EBV A;  2OZH A;  2Z3N A;  3TTH A;  2B4D B;  3SHP A;  4AVB A;  1YVO A;  4KOV A;  3I9S A;  1S7L A;  2ATR A;  4PK2 A;  4FD6 A;  1Q2C A;  2DPT A;  4E8O A;  2Q44 A;  4MFL A;  5JPH A;  4ONU A;  2Z3K A;  4A31 A;  2B4B A;  2ZW6 A;  1M44 A;  4LX9 A;  2B5G A;  4KS9 A;  4KOR A;  3UY5 A;  4HNY B;  2CXA A;  2ZW5 A;  4OLL A;  5KTD A;  2H5M A;  2VQY A;  5IV0 A;  3G3S A;  1MJA A;  4KOT A;  5F47 A;  4Q36 A;  4MFZ A;  2Z10 A;  4GS4 A;  3FIX A;  1U6M A;  4U9Y A;  3H4Q A;  3D8P A;  4ORF A;  2QIR A;  3R96 A;  3PZJ A;  3FXT A;  1I21 A;  2WSA A;  4E0A A;  2DPS A;  4KOY A;  4CGO A;  2HQY A;  3BJ7 A;  3H5Z A;  3QAH A;  5J8C A;  5AG4 A;  1IIC A;  3TOB A;  5E96 A;  4MFQ A;  4K30 A;  4B5O A;  2G3T A;  5HH1 A;  1Y7R A;  1S5K A;  3FRM A;  4UFW A;  2R8V A;  3IGR A;  1XF8 A;  2YND A;  4OAD A;  2F5I A;  4R9M A;  1UFH A;  4NEX A;  1K4J A;  2OB0 A;  2X7B A;  2FIW A;  4E2A A;  4NCZ A;  5F49 A;  4XPD B;  3EY5 A;  4YGO A;  3I3G A;  4B5P A;  4PV6 A;  2FXF A;  2R98 A;  4C2Z A;  4XPD C;  5A28 A;  3E0K A;  3JTK A;  1S7F A;  4AVA A;  5F48 A;  5I0C A;  4MBU A;  4IF5 A;  1J4J A;  5AG7 A;  3VWD A;  2PDO A;  3BLN A;  3BJ8 A;  2BUE A;  2B5G B;  3DR8 A;  1XMT A;  1M1D A;  3SXN A;  3IU2 A;  4XNH B;  5KTA A;  2YNE A;  1M4I A;  2P6E A;  1QSM A;  4CYQ A;  5GCN A;  4XNH C;  5DWN A;  5G21 A;  3JVN A;  5IX3 A;  1L0C A;  4R3L A;  2FSR A;  4H6U A;  1FY7 A;  4AG9 A;  3C26 A;  4A2Z A;  3EFA A;  2DXQ A;  2FIA A;  4F0X A;  2PSW A;  4KOU A;  5CNP A;  2Z3P A;  4II9 A;  4UBR A;  2Q7B A;  4QBJ A;  2VZZ A;  2GE3 A;  1P0H A;  4ZBG A;  3S6F A;  1YVK A;  3FYN A;  1I12 A;  2VEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...