3LACA

Crystal structure of bacillus anthracis pyrrolidone-carboxylate peptidase, pcp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
204
structure length
203
Chain Sequence
MKTVLLTGFDPFGGESINPAWEVAKSLHEKTIGEYKIISKQVPTVFHKSISVLKEYIEELAPEFIICIGQAGGRPDITIERVAINIDDARIADNEGNQPVDVPVVEEGPAAYWSTLPMKAIVKKLQEEGIPASVSQTAGTFVNHLFYGLMHELEKHDTKMKGGFIHIPFLPEQASNYPGQPSMSLSTIRKGIELAVEVTTTVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrrolidone-carboxylate peptidase
publication title Crystal structure of Bacillus anthracis pyrrolidone-carboxylate peptidase, pcP
rcsb
source organism Bacillus anthracis
molecule tags Hydrolase
total genus 64
structure length 203
sequence length 204
chains with identical sequence B
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 3lacA00
2DF5A 1Z8TA 1AUGA 3RO0A 4GXHA 2EO8A 1Z8XA 1IU8A 1Z8WA 1X12A 3RNZA 2EBJA 3LACA 1IOFA 1X10A 1A2ZA 4HPSA 3GIUA 1IOIA
chains in the Genus database with same CATH superfamily
1LAMA 3NE8A 4MHNA 4KUAA 2ZEGA 3BXMA 3PP9A 5IB0A 3EO4A 2EK9A 4FAIA 3TO6A 5F46A 1HDQA 5J1QA 3IIBA 2FT0A 4UF4A 1P0HA 1ZG7A 1OZPA 4B14A 3KI9A 3KZWA 4PSWA 4KZTA 1IOFA 4A39A 2FS5A 2ODFA 1B87A 1V0CA 2R8VA 2CY2A 5C88A 1R57A 2DEAA 1M4DA 3D8PA 4HPSA 4ZX8A 5HVGA 2PR1A 4WWVA 3R96A 2PJ7A 4KOTA 1VHOA 3SXOA 3KR4A 3IGRA 2PCUA 4CRZB 4B5PB 2FL4A 1YR0A 1XOVA 1BO4A 3D67A 4P4IA 2QJ8A 2VQYA 3LMSA 3NFZA 5HXDA 1NMTA 2D4OA 4AVBA 2ATRA 3B3VA 3DGVA 5G1ZA 4GXHA 4OC2A 3NH5A 2Z3MA 4LUAA 1Z8XA 4MFQA 1M4LA 2C1CA 1YK3A 2AFXA 3A9LA 4MY3A 4NEXA 4NGSA 3IWGA 2ZEOA 1F2PA 5KTDA 1XMTA 2CIJA 4UEZA 5LRJA 4KOYA 2BO9A 1XF8A 2BEIA 3JRUA 3C26A 5F09A 4MHPA 3KASA 2GLJA 3H8GA 4NJQA 3EFAA 4EWTA 4FWUA 2AFOA 4GS4A 2OZUA 2AJ6A 2GFQA 3SJXA 4A37A 4A30A 2ZOGA 2XEJA 4MFKA 4B10A 4CGPA 1AYEA 1PCAA 3PBEA 8CPAA 3FNCA 2ANPA 4P4FA 5JQ4A 1NE9A 4AG7A 4KLWA 2WUUA 3PB9X 2FIAA 3N7ZA 4UBRA 4UIAA 1IY7A 2VZYA 2PIZA 3G3SA 4U5YA 3I1UA 5JH9A 1EE3P 2Z11A 1CP7A 3FXTA 3FECA 4PV6A 4UEEA 3LACA 2PJ8A 4HNXB 2G3AA 4OC1A 4B12A 1QSMA 4X3RA 4R87A 1A2ZA 1MJBA 3GB0A 5K8OA 1LFWA 4F8ZA 3QB8A 3LODA 4OIWA 3TTHA 4MCRA 3EC4A 3WABA 1VKCA 4MFZA 1Y9KA 2I79A 1QQ9A 3TC8A 2JEWA 4PXBA 2ZEPA 1XEBA 2PJ9A 3RYOA 4F0XA 1YSJA 2FVGA 2PRBA 2ZELA 3NA6A 1QSTA 5DWMA 3VWDA 4AB7A 2YNDA 2Q7BA 3G8WA 1ZG8A 4PQAA 1TIQA 4QB9A 4CYOA 1UFHA 2XEFA 4M6HA 4NGRA 1X12A 4J3GA 4ZX9A 3WT4A 3QAHA 1S5KA 3IO1A 2WPWA 2EBJA 1Z8LA 1MJAA 5LYDA 4QC6A 4Z65A 4ONUA 4A94A 4NFRA 3GUXA 2PJ0A 2FE7A 2HB6A 1S3ZA 2REFA 1HEEA 2YNCC 4KOUA 1YX0A 4MFPA 4OIDA 2Z3LA 3S6HA 3D7DA 4CGMA 4W9YA 5DWNA 2QIRA 3GIUA 3WR7A 4KSIA 5A27A 1YW6A 2F7VA 2Q4YA 3IWEA 3BJ7A 5LYIA 5KTCA 1CJWA 1TKHA 3DR8A 1AUGA 4RS2A 4XPLA 4YU9A 4ZY0A 4FUUA 4M6IA 4B6ZA 1IU8A 5EMIA 4C2YA 4DUKA 4LQGA 3R9FA 2DPSA 2CTBA 1VHEA 3EY5A 4C7HA 4KOXA 3PBBA 1XRYA 3V8IA 1LCPA 1BLLE 2GE3A 4KOVA 4KSAA 1BPMA 3FYNA 4CRYB 5AG6A 3TOBA 4NCZA 2JDCA 2ZEEA 4DNCA 5GCNA 4P4DA 4F9UA 2JBJA 3KR5A 2OZGA 3D7HA 3B3TA 4XPKA 1Q2DA 2IMOA 2OR4A 4E8OA 2CTCA 3TT2A 1YGHA 3CT9A 2BOAA 1K4JA 2B4DB 2J8NA 1XFOA 4R9MA 1FT7A 2V8HA 2Z0ZA 4WJBA 4ZY2A 2RFHA 5H84A 3FEEA 4NGMA 4KORA 4A95A 4EFDA 2OH1A 4NGPA 1LOKA 3B7IA 2PR8A 2PDOA 5K8NA 4UWJA 4B13A 3TE4A 2CNTA 3PZJA 3CPAA 1GHEA 4OADA 4K30A 2C6CA 3W91A 4JLYA 3CPXA 2ZW7A 2V8DA 3SJEA 2BUEA 4AVAA 3IEHA 3FJUA 2GIVA 2B3VA 1M44A 2PJ5A 3CXQA 2A4NA 3QAYA 2ABZA 2OU2A 1IB1E 4B5PA 4C2ZA 5C82A 2F8HA 5AG7A 5JGFA 3PFOA 4OC3A 1KZFA 3EXNA 2PC1A 4E0AA 2ZW6A 3F5BA 2ZPAA 3CZXA 4IHMA 2V77A 3CXPA 4MY0A 2PVVA 4C2XA 4CPAA 1KUVA 3FIXA 4H89A 2ZW4A 4UFXA 2FXFA 3H4QA 2PJ6A 2EWBA 4HNWB 5HVHA 2YNEA 2WZNA 2ZEHA 2F5IA 4KLVA 3W6SA 3FB3A 1AMPA 1UWYA 1QMUA 3FVLA 3NH4A 1TF9A 1I12A 4F6AA 4UFWA 4Y49C 5E96A 1BAVA 3DLJA 1ZG9A 3I3GA 2Q43A 4MRIA 3KHXA 1S7LA 1F57A 2QYVA 3H8EA 1N71A 1RTQA 3D68A 3GY9A 5AG5A 3B35A 1PU9A 2AFWA 2R98A 1QSOA 5I0CA 2PE3A 1YLEA 4ORFA 2ZEMA 5HH1A 2PQ8A 4BBHA 3I9SA 3RO0A 4B5OA 4BMHA 4P10A 2Q04A 4JXRA 4RN7A 3SI2A 3B2YA 2RC4A 3V38A 3VWEA 2JBKA 3SJGA 4XNHC 3PGPA 4MCPA 2CNSA 2PJAA 3DR6A 4PK2A 2ZOFA 3ISXA 1TKFA 1Z4EA 3MN8A 5A28A 4NGTA 4CS0B 4UEFA 2AE6A 3T90A 1M4GA 5DS0A 4JJXA 4K3NA 4R3LA 2Y0MA 2IJZA 4YWYA 5IB9A 2NSMA 1KUXA 2OOTA 3T9YA 1Y9WA 3BLNA 1Q2CA 5G21A 4TNUA 2B5GA 2C27A 2WSAA 4EMEA 2Z3PA 3N5FA 3P2FA 4ZY1A 3KGQA 1QSRA 1MJ9A 1I1DA 2VEZA 2D4PA 3UY5A 1R43A 1CG2A 2P6EA 2BSWA 3LWUA 2FSRA 4M6GA 3SXNA 3GLJA 4C7IA 1BPNA 4XPDC 3TO7A 4A38A 4MHYA 2PJBA 5F49A 3QNVA 4MJ8A 4CAXA 4OLLA 1ARLA 3D3SA 3SJFA 2Q4ZA 2QECA 4RI1A 3PB8X 2JDDA 2DPTA 1PUAA 2I3CA 1Y0YA 4IK2A 2I00A 3T8WA 1YLOA 3B8GA 3FF3A 1ELLP 4F0YA 2QVPA 2PJ1A 4AG9A 3DDDA 4U9ZA 3KQXA 4KUBA 4Y49B 2VBQA 1WWZA 3IFEA 3FMCA 3B3SA 3VARA 1Z9UA 2OZHA 3D7GA 4M85A 2DF5A 3VH9A 3FBUA 4QBJA 2O53A 4MI4A 4IUSA 2PVWA 1FY7A 4IAVA 1U6MA 5LYFA 4CGNA 2ZEFA 3OWCA 3ZJ0A 1IICA 3GKRA 4MBUA 2O4HA 3GYAA 3PB4X 5F47A 3RNZA 2K5TA 1YW4A 4R57A 4BINA 2H5MA 4XNHB 1X10A 4MMOA 1YMEA 5JPHA 4PPZA 3D2PA 3FRMA 5HVFA 4ONWA 2POKA 5D8NA 1DE4C 5THWA 4NF1A 3S6FA 4Q7AA 2VZZA 3CDXA 3W6XA 2Q7SA 3R95A 4CAEA 5CBMA 4PXEA 2GU2A 3IC1A 3L2NA 4G1PA 5ELYA 1IOIA 2Q44A 3S9LA 4CYPA 3IU2A 4FBEA 1XBUA 2B4DA 2G0BA 1ZO0A 2Z10A 4RUHA 2B58A 2REEA 3BHXA 2AFUA 4H6UA 2BL1A 4MHZA 4FD5A 4P45A 1VGYA 3TFYA 4OMEA 2QMLA 4KS9A 1NSLA 2RB7A 3K9TA 4MCQA 2ZW5A 4XPDB 2CXAA 4UIBA 1XE4A 4KVXA 1Y7RA 2CF4A 1S7NA 3R1KA 1Q7LA 3FH4A 3V7ZA 2FCKA 4KVME 4MFJA 4ZGYB 1Y0RA 4ZBGA 2XEGA 4MFLA 2YNCA 2FIWA 4OP4A 2NYQA 1CPXA 2ARHA 2ZXVA 3HLPA 4PXDA 2Q51A 2AFMA 2G9DA 2AFZA 3D7FA 2Q0YA 3MGDA 4R6TA 4R7MA 4H6ZA 4MXUA 3PEIA 4LQ6A 3S6KA 1ELMP 1JQGA 4QVTA 5G20A 5J8CA 2WPXA 4YRHA 3S9NA 3FEDA 3PFEA 3KKWA 2DXQA 5ISVA 4JZ0A 1I21A 4I49A 1TXRA 3ZZIA 3B3CA 3WC7A 3ISZA 6CPAA 3FX6A 3VATA 5CNPA 3TO9A 4CYNA 4ZI6A 4P44A 2R1IA 3PB7X 5KTAA 4GM5A 1S7KA 2GANA 2P6GA 4IF5A 3SI1A 4L89A 1VIXA 4KSFA 4NJRA 1OBRA 2GREA 2NMTA 1ZLIA 2AFSA 1IGBA 3DNSA 1TF8A 4P4BA 2VL1A 4AVCA 4OC5A 5H86A 2PSWA 3K9UA 4CAWA 2V8VA 2J9AA 3RBUA 3F0AA 2VI7A 4NGNA 1YVOA 5AG4A 2EO8A 4NXYA 4JXQA 3SHPA 1P4NA 4CGLA 4II9A 3S9MA 1H8LA 1S7FA 4JWPA 3IWWA 2YGWA 4KOWA 4MHDA 3RAMA 3TX8A 1XIXA 2PJCA 4FD4A 1J4JA 3WC6A 3E0KA 4FD6A 1RO5A 2EVNA 2EK8A 4X5KA 3RZAA 5IX3A 1ON0A 1B6BA 3BI0A 1CP6A 1YQEA 1F2OA 1CX8A 4JD6A 4Q38A 7CPAA 4M3SA 2P6FA 5JM6A 3P2HA 1HDUA 1IYLA 5CPAA 3WC5A 4L8AA 4TWEA 1Y7EA 2R7HA 4ZYQA 1LANA 3HUVA 1NSAA 2OB0A 5FVJA 1XJOA 1KUYA 3S6GA 2JLMA 5K8PA 4R76A 1M1DA 4OAEA 3JUWA 5F48A 4P4JA 1WK4A 4P6YA 4P4EA 4X2TA 3KL9A 1IIDA 4HNYB 2KCWA 2PIYA 5LYLA 2GLFA 2X7BA 1LAPA 3D4UA 1QSNA 1Q2YA 3F8KA 4R8FA 2PJ3A 2HV2A 4UA3A 3IJ3A 3K2KA 4BD9A 2P0WA 4NGQA 4UFVA 2C6PA 1S60A 1SQHA 1R3NA 4NSQA 3DSBA 5HMNA 3JTKA 4A33A 2J8RA 2J8MA 4YFJA 4LX9A 3PRTA 3B3WA 4A31A 2B5GB 4UCMA 1LRZA 3CXSA 2Q4VA 4DJLA 1YREA 3BJ8A 4OKOA 4B11A 5EC4A 4UCPA 5IV0A 3R9EA 1JWQA 1KWMA 1DTDA 2HQYA 4OC0A 5G22A 3LD2A 3TOAA 1ZLHA 3D66A 1YVKA 3D2MA 3H8FA 2PJ2A 3IU1A 3MRUA 2V8GA 4PK3A 1L0CA 2C6GA 4QUSA 4A32A 4H2KA 4MCSA 4OC4A 3R9GA 5BWAB 1GYTA 4O23A 1MK4A 1FNOA 4UWIA 3SI0A 3JVNA 2BCOA 2IL4A 4PSXA 2HC9A 2WYRA 4AXVA 4EVYA 3NH8A 5J8FA 4C68A 1Z2LA 4CGOA 4KOSA 2PRQA 3KQZA 2ZEDA 5AGEA 2XEIA 2B4BA 5D29A 1Z8TA 4A2ZA 1Z4RA 4CAFA 5LRGA 4HKFA 3TCVA 4E2AA 4KVOE 2CNMA 4X8IA 5K8MA 2Z3OA 1Z8WA 4FD7A 4PXCA 3H5ZA 4YGOA 2IQ6A 4DYOA 3KHZA 1IYKA 1TKJA 4JYWA 2ZENA 4F9VA 1VHSA 2EUIA 1ARMA 1PYTB 2O28A 3BI1A 4Q36A 2G3TA 2HUZA 1CPSA 1Z5RA 4U9YA 3NE7A 1BOBA 1XMBA 4UCNA 5I4MA 4CYQA 2B3UA 2VXKA 2JEVA 1CBXA 5LRKA 4CAVA 1RXTA 2Z3NA 3PB6X 5EBVA 1CM0A 1M4IA 4R3KA 2PJ4A 2Z3KA
chains in the Genus database with same CATH topology
2DF5A 1Z8TA 1AUGA 3RO0A 4GXHA 2EO8A 1Z8XA 1IU8A 1Z8WA 1X12A 3RNZA 2EBJA 3LACA 1IOFA 1X10A 1A2ZA 4HPSA 3GIUA 1IOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DF5 A;  1Z8T A;  1AUG A;  3RO0 A;  4GXH A;  2EO8 A;  1Z8X A;  1IU8 A;  1Z8W A;  1X12 A;  3RNZ A;  2EBJ A;  3LAC A;  1IOF A;  1X10 A;  1A2Z A;  4HPS A;  3GIU A;  1IOI A; 
#chains in the Genus database with same CATH topology
 1LAM A;  3NE8 A;  4MHN A;  4KUA A;  2ZEG A;  3BXM A;  3PP9 A;  5IB0 A;  3EO4 A;  2EK9 A;  4FAI A;  3TO6 A;  5F46 A;  1HDQ A;  5J1Q A;  3IIB A;  2FT0 A;  4UF4 A;  1P0H A;  1ZG7 A;  1OZP A;  4B14 A;  3KI9 A;  3KZW A;  4PSW A;  4KZT A;  1IOF A;  4A39 A;  2FS5 A;  2ODF A;  1B87 A;  1V0C A;  2R8V A;  2CY2 A;  5C88 A;  1R57 A;  2DEA A;  1M4D A;  3D8P A;  4HPS A;  4ZX8 A;  5HVG A;  2PR1 A;  4WWV A;  3R96 A;  2PJ7 A;  4KOT A;  1VHO A;  3SXO A;  3KR4 A;  3IGR A;  2PCU A;  4CRZ B;  4B5P B;  2FL4 A;  1YR0 A;  1XOV A;  1BO4 A;  3D67 A;  4P4I A;  2QJ8 A;  2VQY A;  3LMS A;  3NFZ A;  5HXD A;  1NMT A;  2D4O A;  4AVB A;  2ATR A;  3B3V A;  3DGV A;  5G1Z A;  4GXH A;  4OC2 A;  3NH5 A;  2Z3M A;  4LUA A;  1Z8X A;  4MFQ A;  1M4L A;  2C1C A;  1YK3 A;  2AFX A;  3A9L A;  4MY3 A;  4NEX A;  4NGS A;  3IWG A;  2ZEO A;  1F2P A;  5KTD A;  1XMT A;  2CIJ A;  4UEZ A;  5LRJ A;  4KOY A;  2BO9 A;  1XF8 A;  2BEI A;  3JRU A;  3C26 A;  5F09 A;  4MHP A;  3KAS A;  2GLJ A;  3H8G A;  4NJQ A;  3EFA A;  4EWT A;  4FWU A;  2AFO A;  4GS4 A;  2OZU A;  2AJ6 A;  2GFQ A;  3SJX A;  4A37 A;  4A30 A;  2ZOG A;  2XEJ A;  4MFK A;  4B10 A;  4CGP A;  1AYE A;  1PCA A;  3PBE A;  8CPA A;  3FNC A;  2ANP A;  4P4F A;  5JQ4 A;  1NE9 A;  4AG7 A;  4KLW A;  2WUU A;  3PB9 X;  2FIA A;  3N7Z A;  4UBR A;  4UIA A;  1IY7 A;  2VZY A;  2PIZ A;  3G3S A;  4U5Y A;  3I1U A;  5JH9 A;  1EE3 P;  2Z11 A;  1CP7 A;  3FXT A;  3FEC A;  4PV6 A;  4UEE A;  3LAC A;  2PJ8 A;  4HNX B;  2G3A A;  4OC1 A;  4B12 A;  1QSM A;  4X3R A;  4R87 A;  1A2Z A;  1MJB A;  3GB0 A;  5K8O A;  1LFW A;  4F8Z A;  3QB8 A;  3LOD A;  4OIW A;  3TTH A;  4MCR A;  3EC4 A;  3WAB A;  1VKC A;  4MFZ A;  1Y9K A;  2I79 A;  1QQ9 A;  3TC8 A;  2JEW A;  4PXB A;  2ZEP A;  1XEB A;  2PJ9 A;  3RYO A;  4F0X A;  1YSJ A;  2FVG A;  2PRB A;  2ZEL A;  3NA6 A;  1QST A;  5DWM A;  3VWD A;  4AB7 A;  2YND A;  2Q7B A;  3G8W A;  1ZG8 A;  4PQA A;  1TIQ A;  4QB9 A;  4CYO A;  1UFH A;  2XEF A;  4M6H A;  4NGR A;  1X12 A;  4J3G A;  4ZX9 A;  3WT4 A;  3QAH A;  1S5K A;  3IO1 A;  2WPW A;  2EBJ A;  1Z8L A;  1MJA A;  5LYD A;  4QC6 A;  4Z65 A;  4ONU A;  4A94 A;  4NFR A;  3GUX A;  2PJ0 A;  2FE7 A;  2HB6 A;  1S3Z A;  2REF A;  1HEE A;  2YNC C;  4KOU A;  1YX0 A;  4MFP A;  4OID A;  2Z3L A;  3S6H A;  3D7D A;  4CGM A;  4W9Y A;  5DWN A;  2QIR A;  3GIU A;  3WR7 A;  4KSI A;  5A27 A;  1YW6 A;  2F7V A;  2Q4Y A;  3IWE A;  3BJ7 A;  5LYI A;  5KTC A;  1CJW A;  1TKH A;  3DR8 A;  1AUG A;  4RS2 A;  4XPL A;  4YU9 A;  4ZY0 A;  4FUU A;  4M6I A;  4B6Z A;  1IU8 A;  5EMI A;  4C2Y A;  4DUK A;  4LQG A;  3R9F A;  2DPS A;  2CTB A;  1VHE A;  3EY5 A;  4C7H A;  4KOX A;  3PBB A;  1XRY A;  3V8I A;  1LCP A;  1BLL E;  2GE3 A;  4KOV A;  4KSA A;  1BPM A;  3FYN A;  4CRY B;  5AG6 A;  3TOB A;  4NCZ A;  2JDC A;  2ZEE A;  4DNC A;  5GCN A;  4P4D A;  4F9U A;  2JBJ A;  3KR5 A;  2OZG A;  3D7H A;  3B3T A;  4XPK A;  1Q2D A;  2IMO A;  2OR4 A;  4E8O A;  2CTC A;  3TT2 A;  1YGH A;  3CT9 A;  2BOA A;  1K4J A;  2B4D B;  2J8N A;  1XFO A;  4R9M A;  1FT7 A;  2V8H A;  2Z0Z A;  4WJB A;  4ZY2 A;  2RFH A;  5H84 A;  3FEE A;  4NGM A;  4KOR A;  4A95 A;  4EFD A;  2OH1 A;  4NGP A;  1LOK A;  3B7I A;  2PR8 A;  2PDO A;  5K8N A;  4UWJ A;  4B13 A;  3TE4 A;  2CNT A;  3PZJ A;  3CPA A;  1GHE A;  4OAD A;  4K30 A;  2C6C A;  3W91 A;  4JLY A;  3CPX A;  2ZW7 A;  2V8D A;  3SJE A;  2BUE A;  4AVA A;  3IEH A;  3FJU A;  2GIV A;  2B3V A;  1M44 A;  2PJ5 A;  3CXQ A;  2A4N A;  3QAY A;  2ABZ A;  2OU2 A;  1IB1 E;  4B5P A;  4C2Z A;  5C82 A;  2F8H A;  5AG7 A;  5JGF A;  3PFO A;  4OC3 A;  1KZF A;  3EXN A;  2PC1 A;  4E0A A;  2ZW6 A;  3F5B A;  2ZPA A;  3CZX A;  4IHM A;  2V77 A;  3CXP A;  4MY0 A;  2PVV A;  4C2X A;  4CPA A;  1KUV A;  3FIX A;  4H89 A;  2ZW4 A;  4UFX A;  2FXF A;  3H4Q A;  2PJ6 A;  2EWB A;  4HNW B;  5HVH A;  2YNE A;  2WZN A;  2ZEH A;  2F5I A;  4KLV A;  3W6S A;  3FB3 A;  1AMP A;  1UWY A;  1QMU A;  3FVL A;  3NH4 A;  1TF9 A;  1I12 A;  4F6A A;  4UFW A;  4Y49 C;  5E96 A;  1BAV A;  3DLJ A;  1ZG9 A;  3I3G A;  2Q43 A;  4MRI A;  3KHX A;  1S7L A;  1F57 A;  2QYV A;  3H8E A;  1N71 A;  1RTQ A;  3D68 A;  3GY9 A;  5AG5 A;  3B35 A;  1PU9 A;  2AFW A;  2R98 A;  1QSO A;  5I0C A;  2PE3 A;  1YLE A;  4ORF A;  2ZEM A;  5HH1 A;  2PQ8 A;  4BBH A;  3I9S A;  3RO0 A;  4B5O A;  4BMH A;  4P10 A;  2Q04 A;  4JXR A;  4RN7 A;  3SI2 A;  3B2Y A;  2RC4 A;  3V38 A;  3VWE A;  2JBK A;  3SJG A;  4XNH C;  3PGP A;  4MCP A;  2CNS A;  2PJA A;  3DR6 A;  4PK2 A;  2ZOF A;  3ISX A;  1TKF A;  1Z4E A;  3MN8 A;  5A28 A;  4NGT A;  4CS0 B;  4UEF A;  2AE6 A;  3T90 A;  1M4G A;  5DS0 A;  4JJX A;  4K3N A;  4R3L A;  2Y0M A;  2IJZ A;  4YWY A;  5IB9 A;  2NSM A;  1KUX A;  2OOT A;  3T9Y A;  1Y9W A;  3BLN A;  1Q2C A;  5G21 A;  4TNU A;  2B5G A;  2C27 A;  2WSA A;  4EME A;  2Z3P A;  3N5F A;  3P2F A;  4ZY1 A;  3KGQ A;  1QSR A;  1MJ9 A;  1I1D A;  2VEZ A;  2D4P A;  3UY5 A;  1R43 A;  1CG2 A;  2P6E A;  2BSW A;  3LWU A;  2FSR A;  4M6G A;  3SXN A;  3GLJ A;  4C7I A;  1BPN A;  4XPD C;  3TO7 A;  4A38 A;  4MHY A;  2PJB A;  5F49 A;  3QNV A;  4MJ8 A;  4CAX A;  4OLL A;  1ARL A;  3D3S A;  3SJF A;  2Q4Z A;  2QEC A;  4RI1 A;  3PB8 X;  2JDD A;  2DPT A;  1PUA A;  2I3C A;  1Y0Y A;  4IK2 A;  2I00 A;  3T8W A;  1YLO A;  3B8G A;  3FF3 A;  1ELL P;  4F0Y A;  2QVP A;  2PJ1 A;  4AG9 A;  3DDD A;  4U9Z A;  3KQX A;  4KUB A;  4Y49 B;  2VBQ A;  1WWZ A;  3IFE A;  3FMC A;  3B3S A;  3VAR A;  1Z9U A;  2OZH A;  3D7G A;  4M85 A;  2DF5 A;  3VH9 A;  3FBU A;  4QBJ A;  2O53 A;  4MI4 A;  4IUS A;  2PVW A;  1FY7 A;  4IAV A;  1U6M A;  5LYF A;  4CGN A;  2ZEF A;  3OWC A;  3ZJ0 A;  1IIC A;  3GKR A;  4MBU A;  2O4H A;  3GYA A;  3PB4 X;  5F47 A;  3RNZ A;  2K5T A;  1YW4 A;  4R57 A;  4BIN A;  2H5M A;  4XNH B;  1X10 A;  4MMO A;  1YME A;  5JPH A;  4PPZ A;  3D2P A;  3FRM A;  5HVF A;  4ONW A;  2POK A;  5D8N A;  1DE4 C;  5THW A;  4NF1 A;  3S6F A;  4Q7A A;  2VZZ A;  3CDX A;  3W6X A;  2Q7S A;  3R95 A;  4CAE A;  5CBM A;  4PXE A;  2GU2 A;  3IC1 A;  3L2N A;  4G1P A;  5ELY A;  1IOI A;  2Q44 A;  3S9L A;  4CYP A;  3IU2 A;  4FBE A;  1XBU A;  2B4D A;  2G0B A;  1ZO0 A;  2Z10 A;  4RUH A;  2B58 A;  2REE A;  3BHX A;  2AFU A;  4H6U A;  2BL1 A;  4MHZ A;  4FD5 A;  4P45 A;  1VGY A;  3TFY A;  4OME A;  2QML A;  4KS9 A;  1NSL A;  2RB7 A;  3K9T A;  4MCQ A;  2ZW5 A;  4XPD B;  2CXA A;  4UIB A;  1XE4 A;  4KVX A;  1Y7R A;  2CF4 A;  1S7N A;  3R1K A;  1Q7L A;  3FH4 A;  3V7Z A;  2FCK A;  4KVM E;  4MFJ A;  4ZGY B;  1Y0R A;  4ZBG A;  2XEG A;  4MFL A;  2YNC A;  2FIW A;  4OP4 A;  2NYQ A;  1CPX A;  2ARH A;  2ZXV A;  3HLP A;  4PXD A;  2Q51 A;  2AFM A;  2G9D A;  2AFZ A;  3D7F A;  2Q0Y A;  3MGD A;  4R6T A;  4R7M A;  4H6Z A;  4MXU A;  3PEI A;  4LQ6 A;  3S6K A;  1ELM P;  1JQG A;  4QVT A;  5G20 A;  5J8C A;  2WPX A;  4YRH A;  3S9N A;  3FED A;  3PFE A;  3KKW A;  2DXQ A;  5ISV A;  4JZ0 A;  1I21 A;  4I49 A;  1TXR A;  3ZZI A;  3B3C A;  3WC7 A;  3ISZ A;  6CPA A;  3FX6 A;  3VAT A;  5CNP A;  3TO9 A;  4CYN A;  4ZI6 A;  4P44 A;  2R1I A;  3PB7 X;  5KTA A;  4GM5 A;  1S7K A;  2GAN A;  2P6G A;  4IF5 A;  3SI1 A;  4L89 A;  1VIX A;  4KSF A;  4NJR A;  1OBR A;  2GRE A;  2NMT A;  1ZLI A;  2AFS A;  1IGB A;  3DNS A;  1TF8 A;  4P4B A;  2VL1 A;  4AVC A;  4OC5 A;  5H86 A;  2PSW A;  3K9U A;  4CAW A;  2V8V A;  2J9A A;  3RBU A;  3F0A A;  2VI7 A;  4NGN A;  1YVO A;  5AG4 A;  2EO8 A;  4NXY A;  4JXQ A;  3SHP A;  1P4N A;  4CGL A;  4II9 A;  3S9M A;  1H8L A;  1S7F A;  4JWP A;  3IWW A;  2YGW A;  4KOW A;  4MHD A;  3RAM A;  3TX8 A;  1XIX A;  2PJC A;  4FD4 A;  1J4J A;  3WC6 A;  3E0K A;  4FD6 A;  1RO5 A;  2EVN A;  2EK8 A;  4X5K A;  3RZA A;  5IX3 A;  1ON0 A;  1B6B A;  3BI0 A;  1CP6 A;  1YQE A;  1F2O A;  1CX8 A;  4JD6 A;  4Q38 A;  7CPA A;  4M3S A;  2P6F A;  5JM6 A;  3P2H A;  1HDU A;  1IYL A;  5CPA A;  3WC5 A;  4L8A A;  4TWE A;  1Y7E A;  2R7H A;  4ZYQ A;  1LAN A;  3HUV A;  1NSA A;  2OB0 A;  5FVJ A;  1XJO A;  1KUY A;  3S6G A;  2JLM A;  5K8P A;  4R76 A;  1M1D A;  4OAE A;  3JUW A;  5F48 A;  4P4J A;  1WK4 A;  4P6Y A;  4P4E A;  4X2T A;  3KL9 A;  1IID A;  4HNY B;  2KCW A;  2PIY A;  5LYL A;  2GLF A;  2X7B A;  1LAP A;  3D4U A;  1QSN A;  1Q2Y A;  3F8K A;  4R8F A;  2PJ3 A;  2HV2 A;  4UA3 A;  3IJ3 A;  3K2K A;  4BD9 A;  2P0W A;  4NGQ A;  4UFV A;  2C6P A;  1S60 A;  1SQH A;  1R3N A;  4NSQ A;  3DSB A;  5HMN A;  3JTK A;  4A33 A;  2J8R A;  2J8M A;  4YFJ A;  4LX9 A;  3PRT A;  3B3W A;  4A31 A;  2B5G B;  4UCM A;  1LRZ A;  3CXS A;  2Q4V A;  4DJL A;  1YRE A;  3BJ8 A;  4OKO A;  4B11 A;  5EC4 A;  4UCP A;  5IV0 A;  3R9E A;  1JWQ A;  1KWM A;  1DTD A;  2HQY A;  4OC0 A;  5G22 A;  3LD2 A;  3TOA A;  1ZLH A;  3D66 A;  1YVK A;  3D2M A;  3H8F A;  2PJ2 A;  3IU1 A;  3MRU A;  2V8G A;  4PK3 A;  1L0C A;  2C6G A;  4QUS A;  4A32 A;  4H2K A;  4MCS A;  4OC4 A;  3R9G A;  5BWA B;  1GYT A;  4O23 A;  1MK4 A;  1FNO A;  4UWI A;  3SI0 A;  3JVN A;  2BCO A;  2IL4 A;  4PSX A;  2HC9 A;  2WYR A;  4AXV A;  4EVY A;  3NH8 A;  5J8F A;  4C68 A;  1Z2L A;  4CGO A;  4KOS A;  2PRQ A;  3KQZ A;  2ZED A;  5AGE A;  2XEI A;  2B4B A;  5D29 A;  1Z8T A;  4A2Z A;  1Z4R A;  4CAF A;  5LRG A;  4HKF A;  3TCV A;  4E2A A;  4KVO E;  2CNM A;  4X8I A;  5K8M A;  2Z3O A;  1Z8W A;  4FD7 A;  4PXC A;  3H5Z A;  4YGO A;  2IQ6 A;  4DYO A;  3KHZ A;  1IYK A;  1TKJ A;  4JYW A;  2ZEN A;  4F9V A;  1VHS A;  2EUI A;  1ARM A;  1PYT B;  2O28 A;  3BI1 A;  4Q36 A;  2G3T A;  2HUZ A;  1CPS A;  1Z5R A;  4U9Y A;  3NE7 A;  1BOB A;  1XMB A;  4UCN A;  5I4M A;  4CYQ A;  2B3U A;  2VXK A;  2JEV A;  1CBX A;  5LRK A;  4CAV A;  1RXT A;  2Z3N A;  3PB6 X;  5EBV A;  1CM0 A;  1M4I A;  4R3K A;  2PJ4 A;  2Z3K A; 
#chains in the Genus database with same CATH homology
 2DF5 A;  1Z8T A;  1AUG A;  3RO0 A;  4GXH A;  2EO8 A;  1Z8X A;  1IU8 A;  1Z8W A;  1X12 A;  3RNZ A;  2EBJ A;  3LAC A;  1IOF A;  1X10 A;  1A2Z A;  4HPS A;  3GIU A;  1IOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...