3LACA

Crystal structure of bacillus anthracis pyrrolidone-carboxylate peptidase, pcp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
204
structure length
203
Chain Sequence
MKTVLLTGFDPFGGESINPAWEVAKSLHEKTIGEYKIISKQVPTVFHKSISVLKEYIEELAPEFIICIGQAGGRPDITIERVAINIDDARIADNEGNQPVDVPVVEEGPAAYWSTLPMKAIVKKLQEEGIPASVSQTAGTFVNHLFYGLMHELEKHDTKMKGGFIHIPFLPEQASNYPGQPSMSLSTIRKGIELAVEVTTTVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrrolidone-carboxylate peptidase
publication title Crystal structure of Bacillus anthracis pyrrolidone-carboxylate peptidase, pcP
rcsb
source organism Bacillus anthracis
molecule tags Hydrolase
total genus 64
structure length 203
sequence length 204
chains with identical sequence B
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 3lacA00
4HPSA 3LACA 1Z8XA 3RNZA 2DF5A 3GIUA 1AUGA 1X10A 1IOFA 1IU8A 1IOIA 1X12A 4GXHA 3RO0A 1Z8WA 2EO8A 2EBJA 1A2ZA 1Z8TA
chains in the Genus database with same CATH superfamily
3EO4A 3CZXA 6CPAA 1Z9UA 4A95A 3RNZA 4X5KA 3B3WA 4ZI6A 1CG2A 3L2NA 2AFUA 1HEEA 1RO5A 2PJ0A 4IHMA 3PEIA 2CXAA 3MRUA 4CGMA 4L89A 2XEFA 2EVNA 3JVNA 4PXBA 1NE9A 1JWQA 2EK9A 3FECA 5HXDA 2IMOA 2V77A 3WR7A 4MMOA 4MCRA 1R43A 4R76A 4Y49C 2G3TA 1I21A 5H84A 2Z0ZA 4AVBA 2DPSA 2Q0YA 3W6SA 2EK8A 3D3SA 2AFSA 4XPDC 3TTHA 1YLOA 1S7KA 2F5IA 3R9FA 4J3GA 1CP6A 4NSQA 3F5BA 4Q38A 3TX8A 2ZEHA 4CYOA 4A39A 4B14A 4R87A 2OZGA 1RXTA 2ANPA 2OZHA 3DSBA 5JM6A 2VQYA 2YNCA 2QECA 4R3LA 4OC4A 1BPNA 4WWVA 1Y9WA 1LCPA 4R8FA 2Z3OA 1S7LA 3KR5A 4NEXA 5F09A 2PE3A 3RAMA 4MHPA 4CS0B 4JZ0A 2PIZA 5EC4A 2O53A 2RFHA 4PV6A 5LYDA 1VKCA 4K30A 4GM5A 3CXPA 4PXCA 1Z2LA 4NJQA 4YGOA 4F0YA 4P45A 2PIYA 2ZXVA 2QMLA 3S9LA 2BSWA 5JGFA 3VARA 4PSXA 1LAPA 5AG7A 4MY0A 3F8KA 1IYKA 1XRYA 4BD9A 3I9SA 3CXSA 1KZFA 3D7FA 4IK2A 5KTAA 1KUXA 1AMPA 2P0WA 4QVTA 1BPMA 4P4EA 4QB9A 2PDOA 3CXQA 5D8NA 1OZPA 3ISZA 2V8DA 3B8GA 4KOUA 4P10A 4CGPA 3RYOA 3DNSA 3IU1A 2B5GA 2V8GA 1YMEA 4H6UA 4DJLA 4M85A 4ZY0A 4F0XA 4UFXA 2WZNA 4B5PB 1CM0A 2JDDA 1KUYA 3EY5A 2B3VA 2QVPA 2WPXA 5BWAB 4KVME 4P4FA 4NGSA 3OWCA 5CPAA 5DS0A 1S7FA 4M6GA 2Q4ZA 3HUVA 1YX0A 1LFWA 4CRYB 2ZEMA 3H5ZA 4OIWA 3PRTA 5J1QA 2EBJA 4FD7A 4CGNA 4Z65A 1ZLHA 4RS2A 2FIAA 5KTCA 5A27A 4WJBA 4CAVA 2PRBA 2PRQA 4W9YA 5THWA 2C6CA 3D4UA 4A32A 4EWTA 2GFQA 1QSTA 1QSMA 3PB8X 3PB9X 5LRGA 4DUKA 4EVYA 4FAIA 2C1CA 5K8OA 4MBUA 5J8CA 5IX3A 3B7IA 1IICA 3K2KA 1M4DA 2GU2A 4UCPA 1IOIA 3F0AA 3DR6A 5LRKA 4KLWA 3FEEA 3G8WA 4KOXA 1S60A 4UFWA 2I79A 2ZW5A 4KUBA 2VI7A 4OC3A 2OB0A 3SXNA 4A94A 5F48A 3SI2A 2HB6A 2ZELA 3I1UA 3BI1A 2ATRA 5G20A 3RZAA 4MFPA 2YNEA 2CNTA 1IIDA 1Q2YA 1N71A 1Y9KA 4MCSA 4DYOA 1UWYA 1ZO0A 3T9YA 3IWEA 1K4JA 5LYLA 2BL1A 2PJCA 4MXUA 3LD2A 4MHDA 3T8WA 1CP7A 1BO4A 1Y7EA 2NYQA 5F49A 2QIRA 4ZX9A 2VL1A 1IB1E 4ORFA 1Q2CA 1KUVA 5DWNA 3H8GA 4BBHA 2GREA 3G3SA 4CAXA 4CAFA 1X12A 3NE7A 2HC9A 4P44A 1IYLA 3CPAA 2GE3A 2ZEFA 3H4QA 3P2FA 4G1PA 2PJ4A 1M44A 4NJRA 4PXDA 1MK4A 1XMBA 4FWUA 4Y49B 4FD5A 2R98A 2PJ5A 4XPDB 5C82A 4UCMA 4PXEA 3TCVA 2ZW4A 1Z8TA 4OAEA 3IWWA 2PJAA 2RB7A 2VBQA 2YGWA 4HPSA 2Q4YA 3R9EA 4B11A 4E2AA 4CAWA 2DF5A 2Z3KA 3VWDA 3WC5A 1YK3A 3FMCA 4BMHA 4AVCA 4P4IA 3FJUA 1S3ZA 1ZG9A 1OBRA 2O4HA 3PZJA 4JD6A 4M6HA 2D4OA 4NGPA 1ELLP 3D7HA 4XPLA 2HV2A 2G9DA 2D4PA 3NA6A 1TXRA 3PB6X 4CYPA 3D7DA 1XMTA 1YW6A 1ON0A 3JUWA 3QNVA 3FEDA 3EFAA 1QSOA 2Q43A 3IJ3A 4HKFA 4KSFA 4B5OA 3E0KA 4II9A 3TO9A 2C27A 2BEIA 1SQHA 3MGDA 4HNXB 4KVXA 2C6PA 3C26A 4OC0A 2FIWA 3JTKA 1M1DA 4C7IA 2FVGA 4AG7A 4NFRA 2AJ6A 3TFYA 1PYTB 3SXOA 1ZLIA 3LACA 5LYIA 4OC2A 3VWEA 4UF4A 1P0HA 4B13A 1PCAA 1R3NA 5I4MA 4HNYB 1AUGA 2RC4A 1X10A 4UWIA 4C68A 4MFZA 3KQXA 4XNHC 2R7HA 1QMUA 2REFA 4FD4A 1VIXA 1ARLA 4P4JA 3GLJA 2B5GB 2FS5A 2PQ8A 3PBBA 3S6FA 1HDQA 1PU9A 2NMTA 4CGOA 5H86A 2ZW6A 5DWMA 3H8EA 4GXHA 4TWEA 2J8NA 4YU9A 4KSIA 4U9YA 3CDXA 1U6MA 1XF8A 1BOBA 1TF9A 2DPTA 4B10A 8CPAA 2Z11A 2GLJA 4CGLA 3JRUA 2P6GA 3D2PA 4H89A 3EC4A 4P4BA 4UA3A 1LRZA 4L8AA 2J8MA 3KL9A 5G1ZA 3KR4A 3KQZA 4MCQA 3LODA 3TC8A 4CPAA 1Z8LA 5LYFA 2OU2A 1XBUA 2GANA 3TO7A 3VH9A 4PSWA 3W6XA 1M4IA 4JYWA 1BAVA 1Y0YA 5FVJA 2Z10A 2F8HA 1TKJA 3LWUA 4R3KA 5G21A 2Z3LA 2Z3PA 1ELMP 4OP4A 1IU8A 2XEIA 4OC5A 5HVGA 3SJGA 3BJ7A 3W91A 4UIAA 4F9VA 1F57A 2ZEDA 4MFLA 4YWYA 2PR8A 2NSMA 2HUZA 1ARMA 1VHEA 3DLJA 3PFOA 3FIXA 2Z3NA 4KOSA 1S5KA 4FUUA 4P6YA 5E96A 3TOAA 4EMEA 2J8RA 2FE7A 2ZOFA 2PSWA 4JLYA 3FX6A 2Q44A 3GUXA 3R95A 3FYNA 4QBJA 4AVAA 4R57A 2QJ8A 3FVLA 3IO1A 1L0CA 2ODFA 5KTDA 4F6AA 2GIVA 4PK2A 2XEGA 3B35A 2IL4A 1XE4A 4X3RA 2FSRA 2JEVA 3SHPA 1AYEA 4OKOA 3SJEA 7CPAA 4XPKA 5GCNA 2ZOGA 5HMNA 2CNSA 4UFVA 3VATA 4DNCA 1ZG8A 2ZEGA 3BLNA 4A38A 1TKFA 2X7BA 3KI9A 3PFEA 3SJXA 2PJ3A 2Y0MA 1FNOA 1WK4A 3K9UA 4H6ZA 3GB0A 2VEZA 4UIBA 4U5YA 2C6GA 4NGTA 5J8FA 3WC6A 1Z4RA 1CBXA 3B3TA 2CNMA 1LOKA 2ABZA 2G3AA 2R1IA 3FRMA 4KOYA 2AFWA 1Z8XA 5I0CA 1TIQA 4MCPA 3KHZA 2OOTA 4Q7AA 5K8MA 3PGPA 4MRIA 2FXFA 3SJFA 4ZGYB 1TF8A 2P6EA 1QSRA 4YFJA 4OC1A 3KASA 2J9AA 3TE4A 4UEZA 5F47A 4Q36A 4RI1A 4ZBGA 2JDCA 4LX9A 5AG5A 2FL4A 3RO0A 4PQAA 4JXQA 2B4BA 3D67A 2VXKA 2Q04A 1VHOA 1Z8WA 1YGHA 4MHZA 2FCKA 3PB4X 5D29A 4AXVA 1KWMA 3FF3A 3GY9A 2IJZA 3SI0A 4GS4A 1GHEA 3QB8A 4E0AA 2G0BA 1J4JA 5JH9A 5K8NA 1YQEA 4A30A 2VZZA 3D68A 2DEAA 2PJ6A 2B3UA 3GYAA 3R9GA 4IAVA 1PUAA 4KOWA 2ZEPA 4UWJA 2EUIA 5IV0A 4E8OA 2Q7SA 1VHSA 4A31A 4XNHB 2PJ7A 1NSAA 2CTCA 2JBJA 4ONWA 3IIBA 2Q7BA 4FD6A 4HNWB 4NGMA 4QC6A 4UEFA 1S7NA 4UEEA 4A37A 2I3CA 3N5FA 1B6BA 4R7MA 4CYNA 3IWGA 3KHXA 4UCNA 3PBEA 2ZPAA 4U9ZA 3NH4A 1EE3P 4MFQA 1YREA 3KGQA 3V7ZA 1Z5RA 1YVOA 2BCOA 4X2TA 2V8HA 4IUSA 4MHYA 5CNPA 2JBKA 4EFDA 1IOFA 1MJ9A 2OR4A 3BJ8A 3FXTA 3I3GA 2GLFA 3BHXA 3B3CA 1XIXA 1JQGA 4I49A 4NGQA 4OIDA 2Q51A 2HQYA 2WUUA 1DE4C 4MJ8A 3WT4A 1DTDA 1YVKA 1V0CA 1CPXA 1CJWA 2YNCC 4NGRA 1BLLE 2VZYA 4KOTA 2CTBA 4LQGA 2POKA 2ZW7A 1Y7RA 2B58A 2FT0A 3NH8A 5G22A 2K5TA 4JWPA 1LAMA 2Q4VA 3K9TA 1MJAA 4M6IA 4ZYQA 3TOBA 1VGYA 4IF5A 2PR1A 4C2XA 3S6GA 4AG9A 1QQ9A 5AG6A 4C7HA 3QAYA 4MY3A 3D66A 3ISXA 3IGRA 4RUHA 3B2YA 3WC7A 4ZX8A 1XOVA 3V38A 1Q7LA 4OMEA 4RN7A 4KSAA 3DDDA 4M3SA 4AB7A 3NH5A 3D8PA 4F8ZA 2YNDA 1A2ZA 4TNUA 5AG4A 5IB0A 1I1DA 2PJBA 5HVHA 4KS9A 4P4DA 1XFOA 3SI1A 3GIUA 2P6FA 5JPHA 3WABA 4PPZA 4F9UA 3GKRA 4K3NA 1LANA 3B3VA 4QUSA 2ZEEA 1XJOA 4KVOE 1Z4EA 4OADA 4MI4A 4O23A 1M4GA 2CIJA 2I00A 1F2OA 5EMIA 3UY5A 3H8FA 3R96A 3BXMA 3ZZIA 3FNCA 5K8PA 3S6KA 4B6ZA 4H2KA 2WYRA 3NE8A 1B87A 1NSLA 2PCUA 5EBVA 1YSJA 3RBUA 1Y0RA 4R9MA 4A33A 2AE6A 1YLEA 3LMSA 2PC1A 3IFEA 2Z3MA 2AFZA 5F46A 3MN8A 5CBMA 5ELYA 1FT7A 1F2PA 1I12A 2PVWA 4KLVA 3HLPA 2EO8A 4MHNA 3T90A 4FBEA 5A28A 5LRJA 4KUAA 2BOAA 4CAEA 2BUEA 4KZTA 2QYVA 3D2MA 4JJXA 4B12A 4C2ZA 2B4DB 4JXRA 1YW4A 2CF4A 1CPSA 1M4LA 3CT9A 1QSNA 4LUAA 2KCWA 2DXQA 3PB7X 2WSAA 2REEA 2OZUA 3KZWA 3P2HA 4KOVA 4YRHA 2F7VA 4NXYA 4B5PA 3TO6A 1RTQA 4X8IA 2H5MA 3S9NA 1H8LA 2AFMA 2ZEOA 3B3SA 3N7ZA 2IQ6A 2R8VA 4ZY2A 4PK3A 1R57A 5ISVA 1MJBA 1UFHA 2WPWA 5C88A 4NCZA 3S6HA 2BO9A 1YR0A 2PJ1A 3NFZA 5IB9A 1IGBA 5AGEA 5HH1A 1P4NA 2AFXA 2XEJA 3BI0A 3IEHA 4MFJA 4MFKA 4R6TA 4A2ZA 2B4DA 3FBUA 2JEWA 3IU2A 1FY7A 3FH4A 4NF1A 4BINA 4NGNA 3PP9A 2V8VA 1XEBA 2PVVA 3A9LA 2ZENA 2AFOA 4C2YA 1HDUA 3DR8A 2OH1A 4KORA 3QAHA 4OLLA 3S9MA 4UBRA 1ZG7A 2A4NA 3EXNA 3FB3A 2EWBA 4ONUA 3CPXA 5JQ4A 3IC1A 2PJ8A 2JLMA 2PJ2A 3V8IA 2PJ9A 3KKWA 1CX8A 4CYQA 1IY7A 2ARHA 1GYTA 1Q2DA 1TKHA 2O28A 5HVFA 3R1KA 2CY2A 4LQ6A 3DGVA 3ZJ0A 4CRZB 4ZY1A 1WWZA 3TT2A 3D7GA 1NMTA
chains in the Genus database with same CATH topology
4HPSA 3LACA 1Z8XA 3RNZA 2DF5A 3GIUA 1AUGA 1X10A 1IOFA 1IU8A 1IOIA 1X12A 4GXHA 3RO0A 1Z8WA 2EO8A 2EBJA 1A2ZA 1Z8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HPS A;  3LAC A;  1Z8X A;  3RNZ A;  2DF5 A;  3GIU A;  1AUG A;  1X10 A;  1IOF A;  1IU8 A;  1IOI A;  1X12 A;  4GXH A;  3RO0 A;  1Z8W A;  2EO8 A;  2EBJ A;  1A2Z A;  1Z8T A; 
#chains in the Genus database with same CATH topology
 3EO4 A;  3CZX A;  6CPA A;  1Z9U A;  4A95 A;  3RNZ A;  4X5K A;  3B3W A;  4ZI6 A;  1CG2 A;  3L2N A;  2AFU A;  1HEE A;  1RO5 A;  2PJ0 A;  4IHM A;  3PEI A;  2CXA A;  3MRU A;  4CGM A;  4L89 A;  2XEF A;  2EVN A;  3JVN A;  4PXB A;  1NE9 A;  1JWQ A;  2EK9 A;  3FEC A;  5HXD A;  2IMO A;  2V77 A;  3WR7 A;  4MMO A;  4MCR A;  1R43 A;  4R76 A;  4Y49 C;  2G3T A;  1I21 A;  5H84 A;  2Z0Z A;  4AVB A;  2DPS A;  2Q0Y A;  3W6S A;  2EK8 A;  3D3S A;  2AFS A;  4XPD C;  3TTH A;  1YLO A;  1S7K A;  2F5I A;  3R9F A;  4J3G A;  1CP6 A;  4NSQ A;  3F5B A;  4Q38 A;  3TX8 A;  2ZEH A;  4CYO A;  4A39 A;  4B14 A;  4R87 A;  2OZG A;  1RXT A;  2ANP A;  2OZH A;  3DSB A;  5JM6 A;  2VQY A;  2YNC A;  2QEC A;  4R3L A;  4OC4 A;  1BPN A;  4WWV A;  1Y9W A;  1LCP A;  4R8F A;  2Z3O A;  1S7L A;  3KR5 A;  4NEX A;  5F09 A;  2PE3 A;  3RAM A;  4MHP A;  4CS0 B;  4JZ0 A;  2PIZ A;  5EC4 A;  2O53 A;  2RFH A;  4PV6 A;  5LYD A;  1VKC A;  4K30 A;  4GM5 A;  3CXP A;  4PXC A;  1Z2L A;  4NJQ A;  4YGO A;  4F0Y A;  4P45 A;  2PIY A;  2ZXV A;  2QML A;  3S9L A;  2BSW A;  5JGF A;  3VAR A;  4PSX A;  1LAP A;  5AG7 A;  4MY0 A;  3F8K A;  1IYK A;  1XRY A;  4BD9 A;  3I9S A;  3CXS A;  1KZF A;  3D7F A;  4IK2 A;  5KTA A;  1KUX A;  1AMP A;  2P0W A;  4QVT A;  1BPM A;  4P4E A;  4QB9 A;  2PDO A;  3CXQ A;  5D8N A;  1OZP A;  3ISZ A;  2V8D A;  3B8G A;  4KOU A;  4P10 A;  4CGP A;  3RYO A;  3DNS A;  3IU1 A;  2B5G A;  2V8G A;  1YME A;  4H6U A;  4DJL A;  4M85 A;  4ZY0 A;  4F0X A;  4UFX A;  2WZN A;  4B5P B;  1CM0 A;  2JDD A;  1KUY A;  3EY5 A;  2B3V A;  2QVP A;  2WPX A;  5BWA B;  4KVM E;  4P4F A;  4NGS A;  3OWC A;  5CPA A;  5DS0 A;  1S7F A;  4M6G A;  2Q4Z A;  3HUV A;  1YX0 A;  1LFW A;  4CRY B;  2ZEM A;  3H5Z A;  4OIW A;  3PRT A;  5J1Q A;  2EBJ A;  4FD7 A;  4CGN A;  4Z65 A;  1ZLH A;  4RS2 A;  2FIA A;  5KTC A;  5A27 A;  4WJB A;  4CAV A;  2PRB A;  2PRQ A;  4W9Y A;  5THW A;  2C6C A;  3D4U A;  4A32 A;  4EWT A;  2GFQ A;  1QST A;  1QSM A;  3PB8 X;  3PB9 X;  5LRG A;  4DUK A;  4EVY A;  4FAI A;  2C1C A;  5K8O A;  4MBU A;  5J8C A;  5IX3 A;  3B7I A;  1IIC A;  3K2K A;  1M4D A;  2GU2 A;  4UCP A;  1IOI A;  3F0A A;  3DR6 A;  5LRK A;  4KLW A;  3FEE A;  3G8W A;  4KOX A;  1S60 A;  4UFW A;  2I79 A;  2ZW5 A;  4KUB A;  2VI7 A;  4OC3 A;  2OB0 A;  3SXN A;  4A94 A;  5F48 A;  3SI2 A;  2HB6 A;  2ZEL A;  3I1U A;  3BI1 A;  2ATR A;  5G20 A;  3RZA A;  4MFP A;  2YNE A;  2CNT A;  1IID A;  1Q2Y A;  1N71 A;  1Y9K A;  4MCS A;  4DYO A;  1UWY A;  1ZO0 A;  3T9Y A;  3IWE A;  1K4J A;  5LYL A;  2BL1 A;  2PJC A;  4MXU A;  3LD2 A;  4MHD A;  3T8W A;  1CP7 A;  1BO4 A;  1Y7E A;  2NYQ A;  5F49 A;  2QIR A;  4ZX9 A;  2VL1 A;  1IB1 E;  4ORF A;  1Q2C A;  1KUV A;  5DWN A;  3H8G A;  4BBH A;  2GRE A;  3G3S A;  4CAX A;  4CAF A;  1X12 A;  3NE7 A;  2HC9 A;  4P44 A;  1IYL A;  3CPA A;  2GE3 A;  2ZEF A;  3H4Q A;  3P2F A;  4G1P A;  2PJ4 A;  1M44 A;  4NJR A;  4PXD A;  1MK4 A;  1XMB A;  4FWU A;  4Y49 B;  4FD5 A;  2R98 A;  2PJ5 A;  4XPD B;  5C82 A;  4UCM A;  4PXE A;  3TCV A;  2ZW4 A;  1Z8T A;  4OAE A;  3IWW A;  2PJA A;  2RB7 A;  2VBQ A;  2YGW A;  4HPS A;  2Q4Y A;  3R9E A;  4B11 A;  4E2A A;  4CAW A;  2DF5 A;  2Z3K A;  3VWD A;  3WC5 A;  1YK3 A;  3FMC A;  4BMH A;  4AVC A;  4P4I A;  3FJU A;  1S3Z A;  1ZG9 A;  1OBR A;  2O4H A;  3PZJ A;  4JD6 A;  4M6H A;  2D4O A;  4NGP A;  1ELL P;  3D7H A;  4XPL A;  2HV2 A;  2G9D A;  2D4P A;  3NA6 A;  1TXR A;  3PB6 X;  4CYP A;  3D7D A;  1XMT A;  1YW6 A;  1ON0 A;  3JUW A;  3QNV A;  3FED A;  3EFA A;  1QSO A;  2Q43 A;  3IJ3 A;  4HKF A;  4KSF A;  4B5O A;  3E0K A;  4II9 A;  3TO9 A;  2C27 A;  2BEI A;  1SQH A;  3MGD A;  4HNX B;  4KVX A;  2C6P A;  3C26 A;  4OC0 A;  2FIW A;  3JTK A;  1M1D A;  4C7I A;  2FVG A;  4AG7 A;  4NFR A;  2AJ6 A;  3TFY A;  1PYT B;  3SXO A;  1ZLI A;  3LAC A;  5LYI A;  4OC2 A;  3VWE A;  4UF4 A;  1P0H A;  4B13 A;  1PCA A;  1R3N A;  5I4M A;  4HNY B;  1AUG A;  2RC4 A;  1X10 A;  4UWI A;  4C68 A;  4MFZ A;  3KQX A;  4XNH C;  2R7H A;  1QMU A;  2REF A;  4FD4 A;  1VIX A;  1ARL A;  4P4J A;  3GLJ A;  2B5G B;  2FS5 A;  2PQ8 A;  3PBB A;  3S6F A;  1HDQ A;  1PU9 A;  2NMT A;  4CGO A;  5H86 A;  2ZW6 A;  5DWM A;  3H8E A;  4GXH A;  4TWE A;  2J8N A;  4YU9 A;  4KSI A;  4U9Y A;  3CDX A;  1U6M A;  1XF8 A;  1BOB A;  1TF9 A;  2DPT A;  4B10 A;  8CPA A;  2Z11 A;  2GLJ A;  4CGL A;  3JRU A;  2P6G A;  3D2P A;  4H89 A;  3EC4 A;  4P4B A;  4UA3 A;  1LRZ A;  4L8A A;  2J8M A;  3KL9 A;  5G1Z A;  3KR4 A;  3KQZ A;  4MCQ A;  3LOD A;  3TC8 A;  4CPA A;  1Z8L A;  5LYF A;  2OU2 A;  1XBU A;  2GAN A;  3TO7 A;  3VH9 A;  4PSW A;  3W6X A;  1M4I A;  4JYW A;  1BAV A;  1Y0Y A;  5FVJ A;  2Z10 A;  2F8H A;  1TKJ A;  3LWU A;  4R3K A;  5G21 A;  2Z3L A;  2Z3P A;  1ELM P;  4OP4 A;  1IU8 A;  2XEI A;  4OC5 A;  5HVG A;  3SJG A;  3BJ7 A;  3W91 A;  4UIA A;  4F9V A;  1F57 A;  2ZED A;  4MFL A;  4YWY A;  2PR8 A;  2NSM A;  2HUZ A;  1ARM A;  1VHE A;  3DLJ A;  3PFO A;  3FIX A;  2Z3N A;  4KOS A;  1S5K A;  4FUU A;  4P6Y A;  5E96 A;  3TOA A;  4EME A;  2J8R A;  2FE7 A;  2ZOF A;  2PSW A;  4JLY A;  3FX6 A;  2Q44 A;  3GUX A;  3R95 A;  3FYN A;  4QBJ A;  4AVA A;  4R57 A;  2QJ8 A;  3FVL A;  3IO1 A;  1L0C A;  2ODF A;  5KTD A;  4F6A A;  2GIV A;  4PK2 A;  2XEG A;  3B35 A;  2IL4 A;  1XE4 A;  4X3R A;  2FSR A;  2JEV A;  3SHP A;  1AYE A;  4OKO A;  3SJE A;  7CPA A;  4XPK A;  5GCN A;  2ZOG A;  5HMN A;  2CNS A;  4UFV A;  3VAT A;  4DNC A;  1ZG8 A;  2ZEG A;  3BLN A;  4A38 A;  1TKF A;  2X7B A;  3KI9 A;  3PFE A;  3SJX A;  2PJ3 A;  2Y0M A;  1FNO A;  1WK4 A;  3K9U A;  4H6Z A;  3GB0 A;  2VEZ A;  4UIB A;  4U5Y A;  2C6G A;  4NGT A;  5J8F A;  3WC6 A;  1Z4R A;  1CBX A;  3B3T A;  2CNM A;  1LOK A;  2ABZ A;  2G3A A;  2R1I A;  3FRM A;  4KOY A;  2AFW A;  1Z8X A;  5I0C A;  1TIQ A;  4MCP A;  3KHZ A;  2OOT A;  4Q7A A;  5K8M A;  3PGP A;  4MRI A;  2FXF A;  3SJF A;  4ZGY B;  1TF8 A;  2P6E A;  1QSR A;  4YFJ A;  4OC1 A;  3KAS A;  2J9A A;  3TE4 A;  4UEZ A;  5F47 A;  4Q36 A;  4RI1 A;  4ZBG A;  2JDC A;  4LX9 A;  5AG5 A;  2FL4 A;  3RO0 A;  4PQA A;  4JXQ A;  2B4B A;  3D67 A;  2VXK A;  2Q04 A;  1VHO A;  1Z8W A;  1YGH A;  4MHZ A;  2FCK A;  3PB4 X;  5D29 A;  4AXV A;  1KWM A;  3FF3 A;  3GY9 A;  2IJZ A;  3SI0 A;  4GS4 A;  1GHE A;  3QB8 A;  4E0A A;  2G0B A;  1J4J A;  5JH9 A;  5K8N A;  1YQE A;  4A30 A;  2VZZ A;  3D68 A;  2DEA A;  2PJ6 A;  2B3U A;  3GYA A;  3R9G A;  4IAV A;  1PUA A;  4KOW A;  2ZEP A;  4UWJ A;  2EUI A;  5IV0 A;  4E8O A;  2Q7S A;  1VHS A;  4A31 A;  4XNH B;  2PJ7 A;  1NSA A;  2CTC A;  2JBJ A;  4ONW A;  3IIB A;  2Q7B A;  4FD6 A;  4HNW B;  4NGM A;  4QC6 A;  4UEF A;  1S7N A;  4UEE A;  4A37 A;  2I3C A;  3N5F A;  1B6B A;  4R7M A;  4CYN A;  3IWG A;  3KHX A;  4UCN A;  3PBE A;  2ZPA A;  4U9Z A;  3NH4 A;  1EE3 P;  4MFQ A;  1YRE A;  3KGQ A;  3V7Z A;  1Z5R A;  1YVO A;  2BCO A;  4X2T A;  2V8H A;  4IUS A;  4MHY A;  5CNP A;  2JBK A;  4EFD A;  1IOF A;  1MJ9 A;  2OR4 A;  3BJ8 A;  3FXT A;  3I3G A;  2GLF A;  3BHX A;  3B3C A;  1XIX A;  1JQG A;  4I49 A;  4NGQ A;  4OID A;  2Q51 A;  2HQY A;  2WUU A;  1DE4 C;  4MJ8 A;  3WT4 A;  1DTD A;  1YVK A;  1V0C A;  1CPX A;  1CJW A;  2YNC C;  4NGR A;  1BLL E;  2VZY A;  4KOT A;  2CTB A;  4LQG A;  2POK A;  2ZW7 A;  1Y7R A;  2B58 A;  2FT0 A;  3NH8 A;  5G22 A;  2K5T A;  4JWP A;  1LAM A;  2Q4V A;  3K9T A;  1MJA A;  4M6I A;  4ZYQ A;  3TOB A;  1VGY A;  4IF5 A;  2PR1 A;  4C2X A;  3S6G A;  4AG9 A;  1QQ9 A;  5AG6 A;  4C7H A;  3QAY A;  4MY3 A;  3D66 A;  3ISX A;  3IGR A;  4RUH A;  3B2Y A;  3WC7 A;  4ZX8 A;  1XOV A;  3V38 A;  1Q7L A;  4OME A;  4RN7 A;  4KSA A;  3DDD A;  4M3S A;  4AB7 A;  3NH5 A;  3D8P A;  4F8Z A;  2YND A;  1A2Z A;  4TNU A;  5AG4 A;  5IB0 A;  1I1D A;  2PJB A;  5HVH A;  4KS9 A;  4P4D A;  1XFO A;  3SI1 A;  3GIU A;  2P6F A;  5JPH A;  3WAB A;  4PPZ A;  4F9U A;  3GKR A;  4K3N A;  1LAN A;  3B3V A;  4QUS A;  2ZEE A;  1XJO A;  4KVO E;  1Z4E A;  4OAD A;  4MI4 A;  4O23 A;  1M4G A;  2CIJ A;  2I00 A;  1F2O A;  5EMI A;  3UY5 A;  3H8F A;  3R96 A;  3BXM A;  3ZZI A;  3FNC A;  5K8P A;  3S6K A;  4B6Z A;  4H2K A;  2WYR A;  3NE8 A;  1B87 A;  1NSL A;  2PCU A;  5EBV A;  1YSJ A;  3RBU A;  1Y0R A;  4R9M A;  4A33 A;  2AE6 A;  1YLE A;  3LMS A;  2PC1 A;  3IFE A;  2Z3M A;  2AFZ A;  5F46 A;  3MN8 A;  5CBM A;  5ELY A;  1FT7 A;  1F2P A;  1I12 A;  2PVW A;  4KLV A;  3HLP A;  2EO8 A;  4MHN A;  3T90 A;  4FBE A;  5A28 A;  5LRJ A;  4KUA A;  2BOA A;  4CAE A;  2BUE A;  4KZT A;  2QYV A;  3D2M A;  4JJX A;  4B12 A;  4C2Z A;  2B4D B;  4JXR A;  1YW4 A;  2CF4 A;  1CPS A;  1M4L A;  3CT9 A;  1QSN A;  4LUA A;  2KCW A;  2DXQ A;  3PB7 X;  2WSA A;  2REE A;  2OZU A;  3KZW A;  3P2H A;  4KOV A;  4YRH A;  2F7V A;  4NXY A;  4B5P A;  3TO6 A;  1RTQ A;  4X8I A;  2H5M A;  3S9N A;  1H8L A;  2AFM A;  2ZEO A;  3B3S A;  3N7Z A;  2IQ6 A;  2R8V A;  4ZY2 A;  4PK3 A;  1R57 A;  5ISV A;  1MJB A;  1UFH A;  2WPW A;  5C88 A;  4NCZ A;  3S6H A;  2BO9 A;  1YR0 A;  2PJ1 A;  3NFZ A;  5IB9 A;  1IGB A;  5AGE A;  5HH1 A;  1P4N A;  2AFX A;  2XEJ A;  3BI0 A;  3IEH A;  4MFJ A;  4MFK A;  4R6T A;  4A2Z A;  2B4D A;  3FBU A;  2JEW A;  3IU2 A;  1FY7 A;  3FH4 A;  4NF1 A;  4BIN A;  4NGN A;  3PP9 A;  2V8V A;  1XEB A;  2PVV A;  3A9L A;  2ZEN A;  2AFO A;  4C2Y A;  1HDU A;  3DR8 A;  2OH1 A;  4KOR A;  3QAH A;  4OLL A;  3S9M A;  4UBR A;  1ZG7 A;  2A4N A;  3EXN A;  3FB3 A;  2EWB A;  4ONU A;  3CPX A;  5JQ4 A;  3IC1 A;  2PJ8 A;  2JLM A;  2PJ2 A;  3V8I A;  2PJ9 A;  3KKW A;  1CX8 A;  4CYQ A;  1IY7 A;  2ARH A;  1GYT A;  1Q2D A;  1TKH A;  2O28 A;  5HVF A;  3R1K A;  2CY2 A;  4LQ6 A;  3DGV A;  3ZJ0 A;  4CRZ B;  4ZY1 A;  1WWZ A;  3TT2 A;  3D7G A;  1NMT A; 
#chains in the Genus database with same CATH homology
 4HPS A;  3LAC A;  1Z8X A;  3RNZ A;  2DF5 A;  3GIU A;  1AUG A;  1X10 A;  1IOF A;  1IU8 A;  1IOI A;  1X12 A;  4GXH A;  3RO0 A;  1Z8W A;  2EO8 A;  2EBJ A;  1A2Z A;  1Z8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...