3LACA

Crystal structure of bacillus anthracis pyrrolidone-carboxylate peptidase, pcp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
204
structure length
203
Chain Sequence
MKTVLLTGFDPFGGESINPAWEVAKSLHEKTIGEYKIISKQVPTVFHKSISVLKEYIEELAPEFIICIGQAGGRPDITIERVAINIDDARIADNEGNQPVDVPVVEEGPAAYWSTLPMKAIVKKLQEEGIPASVSQTAGTFVNHLFYGLMHELEKHDTKMKGGFIHIPFLPEQASNYPGQPSMSLSTIRKGIELAVEVTTTVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Pyrrolidone-carboxylate peptidase
publication title Crystal structure of Bacillus anthracis pyrrolidone-carboxylate peptidase, pcP
rcsb
source organism Bacillus anthracis
total genus 64
structure length 203
sequence length 204
chains with identical sequence B
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 3lacA00
1X10A 3GIUA 1IOFA 1X12A 3LACA 1IOIA 1A2ZA 1Z8WA 1Z8XA 2EBJA 2DF5A 4HPSA 3RNZA 2EO8A 1AUGA 1Z8TA 1IU8A 4GXHA 3RO0A
chains in the Genus database with same CATH superfamily
2CF4A 1XMTA 1MJ9A 5ELYA 2HV2A 4JJXA 2Z3OA 1X12A 2GFQA 4R87A 3NFZA 4PXCA 4TNUA 3BI1A 4FD5A 1S7FA 2CY2A 4KLWA 1K4JA 3D7FA 1HDUA 3DNSA 2NYQA 3PB7X 1ELMP 1ON0A 3B3VA 1R43A 2Z3MA 3H8EA 4F9VA 3EXNA 3ISZA 4AG9A 3TT2A 1ZLIA 2NSMA 4HPSA 4A39A 2ZW4A 3B8GA 5LRKA 4EFDA 1P0HA 4F6AA 1YQEA 3TTHA 1B87A 3RO0A 3R9FA 1VKCA 1VIXA 4ZX9A 3D8PA 4QVTA 5I4MA 2G0BA 4HKFA 4RI1A 4RS2A 4XPKA 3W91A 3CPAA 5C88A 4BBHA 6CPAA 2QJ8A 4IUSA 3T8WA 4OC4A 5AG4A 3TO9A 1YR0A 1I21A 1U6MA 4ZY0A 1XOVA 1Y7EA 3IFEA 4M6GA 2X7BA 4CYPA 4AVBA 4DJLA 3LD2A 8CPAA 3V8IA 5KTDA 2QMLA 1NSLA 3E0KA 3PEIA 4B6ZA 5DWMA 3PBBA 4CGMA 2P6FA 4B5PB 1IYLA 4LUAA 4MCPA 2HC9A 3H8GA 3SI2A 1S7LA 1IIDA 2EUIA 1Q2YA 3B3SA 3NH5A 4U9YA 2CNTA 1BAVA 1LCPA 2WSAA 4JWPA 1XIXA 4NGSA 4NEXA 2ODFA 2V8VA 4R9MA 1V0CA 3DGVA 3I9SA 2OU2A 2PCUA 1B6BA 3MN8A 2GE3A 2WYRA 3VWEA 1M44A 4MHDA 1CJWA 1Y7RA 4PQAA 1XJOA 2B3VA 1KZFA 3T90A 4NF1A 1BLLE 5HVHA 5JH9A 3PRTA 4KUBA 3F8KA 5AGEA 4P10A 2P0WA 4F9UA 4ZYQA 4H6ZA 2FL4A 2PSWA 2VL1A 2ZEHA 2ZXVA 3QB8A 4MRIA 2FE7A 4ONWA 4A2ZA 4MFJA 2C6CA 2DEAA 2CNSA 2Q4VA 4PK3A 3TC8A 4EWTA 2YNCC 4CAVA 1AYEA 4UCMA 4UFXA 4X3RA 2PIYA 2ZEEA 3TO6A 5AG6A 1LAMA 1S3ZA 1JQGA 1TF9A 2B4BA 1LANA 1IICA 3LWUA 2YNCA 3I3GA 1XF8A 3SJGA 1DTDA 3GLJA 4DUKA 4MBUA 4X5KA 4ZX8A 2PJCA 3TE4A 2JLMA 4OC5A 4UCPA 1FNOA 2V77A 4L89A 2BEIA 2XEFA 3NH8A 2ZW6A 3EFAA 4FUUA 2PJAA 4OC2A 3FJUA 5A28A 4MCSA 1Z8WA 4HNYB 1S60A 2DF5A 4YWYA 4MFZA 1AUGA 3QNVA 1NSAA 1TXRA 1Z8TA 1BOBA 2BL1A 2GREA 2IJZA 1Y9KA 4ONUA 1F2PA 3VATA 5JGFA 2YNDA 3CXQA 2J8NA 2Z0ZA 5G22A 2Z10A 4FD6A 5D8NA 5I0CA 3FMCA 3D7HA 3IU2A 2AFSA 1ZLHA 4KSAA 4KUAA 4B11A 4W9YA 1OBRA 4CGNA 2PVWA 4P4BA 3PBEA 1N71A 3N7ZA 2ATRA 2RC4A 1NE9A 3CXPA 4GS4A 4AVCA 2AFMA 4RUHA 4ZY2A 3S9LA 5BWAB 4ZGYB 2PR1A 4KSIA 1FT7A 3PZJA 2O53A 4LQ6A 3JVNA 4ZBGA 3NE8A 1UWYA 1Q2DA 1MJBA 3BLNA 4CAEA 3DLJA 3OWCA 2EBJA 3I1UA 4JYWA 4U9ZA 5HH1A 3R9EA 2DXQA 3KGQA 3FBUA 3WC5A 1YMEA 3N5FA 2JDDA 5KTCA 1Y9WA 1M4GA 3WR7A 5KTAA 2AFUA 3B35A 2FIWA 2AFWA 4NGRA 5C82A 2PJ0A 5HXDA 4IK2A 3R96A 3QAYA 5K8OA 4UFWA 2PJ8A 2C27A 4Q7AA 2ZEMA 5DS0A 2K5TA 5E96A 1XEBA 4QB9A 3W6SA 5DWNA 1YREA 2QVPA 2YGWA 2ZW5A 4KOUA 4YGOA 1RXTA 3V7ZA 4CYQA 4MY0A 2PJ2A 3B7IA 2R98A 5THWA 1S5KA 3L2NA 4O23A 4DYOA 1YW6A 1I1DA 3GUXA 2Z11A 4B5OA 2XEIA 3PB4X 4R8FA 3SI1A 4AVAA 3BXMA 2IMOA 3SI0A 3KR5A 4CRYB 3ZJ0A 3SJFA 1CPSA 3KKWA 4P4JA 5HMNA 4A33A 2ZEOA 4JXQA 3ZZIA 4OC3A 5JPHA 1LFWA 3D7DA 4NJRA 4P6YA 4PPZA 1Y0YA 2J8MA 4OKOA 2JDCA 3D66A 1YW4A 2D4OA 3JRUA 1WWZA 4JLYA 3S6KA 3V38A 2AFXA 3FXTA 1YGHA 3LACA 3CT9A 5FVJA 2F7VA 4E2AA 1UFHA 1XFOA 3IGRA 3TCVA 2VI7A 2XEGA 1DE4C 2G3TA 3FB3A 3KHZA 3TO7A 2B4DA 2BUEA 1M4IA 1TKJA 2B4DB 4MCQA 4FAIA 2AJ6A 1A2ZA 4IAVA 3FNCA 2R7HA 3GB0A 3KQXA 2C6GA 4F0XA 2EO8A 1HDQA 1QMUA 2REFA 1IU8A 1YVOA 3H4QA 4GXHA 2BCOA 4UEEA 5CNPA 7CPAA 2PJ7A 1H8LA 4YFJA 4YU9A 1L0CA 2OR4A 3JTKA 4UIAA 1CP7A 5LRGA 2JEVA 2G9DA 3KR4A 3NE7A 1BPMA 1X10A 4H6UA 5HVFA 4Q36A 4HNWB 2ABZA 3VH9A 1GHEA 3IWGA 1ZG8A 1S7KA 1M4DA 4P4IA 4WWVA 3SXNA 2ZEPA 2ZEFA 1QQ9A 2YNEA 3DDDA 4OADA 1BO4A 2AE6A 2VZZA 2Q0YA 4CRZB 4H89A 1Z8XA 1ZG9A 4UEZA 5F49A 4ZY1A 1EE3P 4G1PA 4B12A 3KL9A 4WJBA 3H5ZA 4R3LA 4KLVA 1MK4A 3KQZA 4PXBA 4R7MA 2Q4ZA 3D2MA 3K9UA 5AG7A 3SXOA 3S9NA 3GYAA 3S9MA 1IB1E 1YX0A 3IO1A 3PFOA 3P2HA 3R9GA 2AFOA 1F57A 4KORA 3NH4A 5F48A 4OP4A 4C2YA 3H8FA 4Z65A 2R1IA 1KUVA 3IJ3A 4KOWA 1KUYA 2C6PA 3IEHA 4KZTA 1CX8A 2Z3KA 4CGPA 3T9YA 1ELLP 1Z4EA 2F5IA 2HQYA 2ZENA 4CAFA 1QSTA 3TFYA 2B3UA 4M3SA 4AG7A 1HEEA 1KUXA 1RO5A 4MHPA 2GLJA 2PJ5A 3IU1A 2QYVA 5J1QA 1IOIA 1VHEA 3BI0A 3B3CA 2EK9A 4A31A 4Y49C 2CTCA 5LYFA 3KASA 4CS0B 2CTBA 3CDXA 2JBKA 1QSMA 3B3TA 4A37A 1TIQA 2C1CA 2WUUA 3ISXA 3PB6X 2BSWA 4XNHC 3WABA 3MRUA 4CAXA 3GY9A 4E8OA 3S6HA 3FX6A 3WC7A 2PIZA 2PQ8A 2VQYA 2ZOFA 3TX8A 4QUSA 5G20A 4PSXA 4OC0A 4BMHA 4R6TA 3NA6A 1PCAA 2PJ4A 1CP6A 4MHYA 4R76A 4MFKA 1M1DA 5F46A 2Z3NA 3EO4A 2POKA 1MJAA 1CM0A 4M6IA 4CYOA 4GM5A 1XE4A 4MFQA 4UEFA 5IX3A 3MGDA 4KS9A 4P45A 2FXFA 4JD6A 2Y0MA 1YVKA 3BHXA 3RAMA 2B5GA 4PSWA 2FSRA 4KOVA 2FT0A 4X2TA 1BPNA 4NGQA 5CBMA 3PB8X 2DPTA 3TOAA 4KVOE 4IF5A 5CPAA 3FVLA 5JQ4A 5H86A 2DPSA 4JZ0A 4KSFA 1PYTB 3IIBA 5K8PA 4AB7A 2ARHA 2FVGA 4P44A 4MMOA 4B13A 4MFPA 2WPWA 4NGTA 2EWBA 1RTQA 4C2XA 3FF3A 4UA3A 4P4DA 1KWMA 1XBUA 4FWUA 2EVNA 5IV0A 3PB9X 3EY5A 1Q2CA 1IGBA 3EC4A 4E0AA 2P6EA 3IWWA 4II9A 5ISVA 1Z2LA 3FRMA 3HLPA 1Q7LA 2ZW7A 4A38A 1YSJA 2G3AA 4NGPA 3BJ8A 4NGMA 4CGOA 4ZI6A 2D4PA 1VHOA 1TKHA 2EK8A 2PRBA 3SJEA 2ZEGA 4A32A 1PU9A 4XPDC 2ANPA 4XPLA 3PFEA 4AXVA 2IL4A 2J8RA 3SHPA 2VXKA 2PR8A 5LYIA 2QIRA 4KOYA 4F8ZA 1QSNA 1S7NA 3CZXA 3GIUA 4OIWA 4UF4A 2VBQA 2Q44A 4PV6A 4B10A 3D2PA 1Y0RA 4R3KA 2QECA 3K9TA 2Q43A 4MJ8A 5D29A 5F47A 4K3NA 4XPDB 1ARLA 1QSOA 2PRQA 4P4EA 4M6HA 2Q7BA 4OAEA 4CGLA 2B58A 4MCRA 1YLEA 2KCWA 2OH1A 3D4UA 5G1ZA 3DR6A 4CPAA 5K8MA 4H2KA 3KHXA 2CXAA 4MXUA 5EMIA 3FEDA 2PE3A 1CPXA 2RFHA 2ZPAA 1WK4A 4F0YA 1IY7A 2HUZA 2Z3LA 3CPXA 4OIDA 3F0AA 3RBUA 1LRZA 2CIJA 3F5BA 3KZWA 3LODA 4NGNA 4C2ZA 3D67A 2J9AA 2VZYA 2PDOA 1TF8A 4UWJA 4UFVA 1SQHA 5J8FA 3S6GA 3W6XA 2PJ6A 1TKFA 4C7HA 1Z9UA 4HNXB 4NCZA 4B5PA 2XEJA 2ZEDA 2PJ3A 4NFRA 3RNZA 4KOXA 4BINA 1NMTA 2I00A 4A94A 2FCKA 2OZGA 4J3GA 3SJXA 4OMEA 4ORFA 2REEA 3R95A 4OLLA 4PXDA 5IB9A 1LAPA 2WPXA 4YRHA 2HB6A 4A30A 1VGYA 1ZG7A 3RZAA 2F8HA 4IHMA 1I12A 3DSBA 5EBVA 3TOBA 3VWDA 4CYNA 5F09A 1OZPA 1LOKA 3VARA 3JUWA 4QC6A 4MHNA 3D68A 3G3SA 5LRJA 1Z8LA 2Q04A 2RB7A 3FYNA 3PGPA 2JEWA 2FS5A 2GANA 4M85A 4UIBA 1Z5RA 5G21A 2PJBA 2JBJA 3P2FA 4KOTA 3B3WA 5LYDA 4C7IA 2GLFA 1Z4RA 2IQ6A 4P4FA 2Q51A 2AFZA 1ZO0A 1F2OA 3D3SA 2H5MA 4TWEA 5GCNA 4LX9A 3S6FA 3FIXA 3UY5A 2PJ1A 3IC1A 2ZOGA 1FY7A 2Q4YA 3R1KA 4NXYA 4Y49B 1IOFA 3G8WA 2ZELA 3A9LA 2PC1A 5HVGA 1AMPA 2OB0A 2PVVA 1YLOA 3HUVA 3KI9A 3FEEA 4I49A 4XNHB 5EC4A 3DR8A 2PJ9A 3BJ7A 2BO9A 3FH4A 4NJQA 1R3NA 5IB0A 3PP9A 2I3CA 4MY3A 2I79A 2OZUA 1PUAA 4KVXA 1J4JA 4MI4A 4U5YA 2V8GA 2R8VA 2WZNA 4X8IA 5J8CA 2GIVA 4KVME 3CXSA 2B5GB 4RN7A 5H84A 4A95A 4C68A 1VHSA 4DNCA 4LQGA 3GKRA 4NSQA 4EMEA 2NMTA 4Q38A 1M4LA 2VEZA 2BOAA 1R57A 3B2YA 4FD7A 4UBRA 3RYOA 1GYTA 2A4NA 4FD4A 1ARMA 4OC1A 2OOTA 4K30A 3WT4A 4FBEA 4PK2A 4UWIA 2FIAA 5A27A 5JM6A 3C26A 2O28A 2V8DA 3QAHA 3FECA 1YK3A 4UCNA 2OZHA 4MFLA 1JWQA 4MHZA 3IWEA 5LYLA 1XRYA 2O4HA 1P4NA 4B14A 1CG2A 2V8HA 1IYKA 3K2KA 5AG5A 4QBJA 2GU2A 2P6GA 2Z3PA 4L8AA 4PXEA 4R57A 4CAWA 5K8NA 4EVYA 1CBXA 4BD9A 4KOSA 3LMSA 1QSRA 2CNMA 1XMBA 3D7GA 4JXRA 3WC6A 2Q7SA
chains in the Genus database with same CATH topology
1X10A 3GIUA 1IOFA 1X12A 3LACA 1IOIA 1A2ZA 1Z8WA 1Z8XA 2EBJA 2DF5A 4HPSA 3RNZA 2EO8A 1AUGA 1Z8TA 1IU8A 4GXHA 3RO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X10 A;  3GIU A;  1IOF A;  1X12 A;  3LAC A;  1IOI A;  1A2Z A;  1Z8W A;  1Z8X A;  2EBJ A;  2DF5 A;  4HPS A;  3RNZ A;  2EO8 A;  1AUG A;  1Z8T A;  1IU8 A;  4GXH A;  3RO0 A; 
#chains in the Genus database with same CATH topology
 2CF4 A;  1XMT A;  1MJ9 A;  5ELY A;  2HV2 A;  4JJX A;  2Z3O A;  1X12 A;  2GFQ A;  4R87 A;  3NFZ A;  4PXC A;  4TNU A;  3BI1 A;  4FD5 A;  1S7F A;  2CY2 A;  4KLW A;  1K4J A;  3D7F A;  1HDU A;  3DNS A;  2NYQ A;  3PB7 X;  1ELM P;  1ON0 A;  3B3V A;  1R43 A;  2Z3M A;  3H8E A;  4F9V A;  3EXN A;  3ISZ A;  4AG9 A;  3TT2 A;  1ZLI A;  2NSM A;  4HPS A;  4A39 A;  2ZW4 A;  3B8G A;  5LRK A;  4EFD A;  1P0H A;  4F6A A;  1YQE A;  3TTH A;  1B87 A;  3RO0 A;  3R9F A;  1VKC A;  1VIX A;  4ZX9 A;  3D8P A;  4QVT A;  5I4M A;  2G0B A;  4HKF A;  4RI1 A;  4RS2 A;  4XPK A;  3W91 A;  3CPA A;  5C88 A;  4BBH A;  6CPA A;  2QJ8 A;  4IUS A;  3T8W A;  4OC4 A;  5AG4 A;  3TO9 A;  1YR0 A;  1I21 A;  1U6M A;  4ZY0 A;  1XOV A;  1Y7E A;  3IFE A;  4M6G A;  2X7B A;  4CYP A;  4AVB A;  4DJL A;  3LD2 A;  8CPA A;  3V8I A;  5KTD A;  2QML A;  1NSL A;  3E0K A;  3PEI A;  4B6Z A;  5DWM A;  3PBB A;  4CGM A;  2P6F A;  4B5P B;  1IYL A;  4LUA A;  4MCP A;  2HC9 A;  3H8G A;  3SI2 A;  1S7L A;  1IID A;  2EUI A;  1Q2Y A;  3B3S A;  3NH5 A;  4U9Y A;  2CNT A;  1BAV A;  1LCP A;  2WSA A;  4JWP A;  1XIX A;  4NGS A;  4NEX A;  2ODF A;  2V8V A;  4R9M A;  1V0C A;  3DGV A;  3I9S A;  2OU2 A;  2PCU A;  1B6B A;  3MN8 A;  2GE3 A;  2WYR A;  3VWE A;  1M44 A;  4MHD A;  1CJW A;  1Y7R A;  4PQA A;  1XJO A;  2B3V A;  1KZF A;  3T90 A;  4NF1 A;  1BLL E;  5HVH A;  5JH9 A;  3PRT A;  4KUB A;  3F8K A;  5AGE A;  4P10 A;  2P0W A;  4F9U A;  4ZYQ A;  4H6Z A;  2FL4 A;  2PSW A;  2VL1 A;  2ZEH A;  2ZXV A;  3QB8 A;  4MRI A;  2FE7 A;  4ONW A;  4A2Z A;  4MFJ A;  2C6C A;  2DEA A;  2CNS A;  2Q4V A;  4PK3 A;  3TC8 A;  4EWT A;  2YNC C;  4CAV A;  1AYE A;  4UCM A;  4UFX A;  4X3R A;  2PIY A;  2ZEE A;  3TO6 A;  5AG6 A;  1LAM A;  1S3Z A;  1JQG A;  1TF9 A;  2B4B A;  1LAN A;  1IIC A;  3LWU A;  2YNC A;  3I3G A;  1XF8 A;  3SJG A;  1DTD A;  3GLJ A;  4DUK A;  4MBU A;  4X5K A;  4ZX8 A;  2PJC A;  3TE4 A;  2JLM A;  4OC5 A;  4UCP A;  1FNO A;  2V77 A;  4L89 A;  2BEI A;  2XEF A;  3NH8 A;  2ZW6 A;  3EFA A;  4FUU A;  2PJA A;  4OC2 A;  3FJU A;  5A28 A;  4MCS A;  1Z8W A;  4HNY B;  1S60 A;  2DF5 A;  4YWY A;  4MFZ A;  1AUG A;  3QNV A;  1NSA A;  1TXR A;  1Z8T A;  1BOB A;  2BL1 A;  2GRE A;  2IJZ A;  1Y9K A;  4ONU A;  1F2P A;  3VAT A;  5JGF A;  2YND A;  3CXQ A;  2J8N A;  2Z0Z A;  5G22 A;  2Z10 A;  4FD6 A;  5D8N A;  5I0C A;  3FMC A;  3D7H A;  3IU2 A;  2AFS A;  1ZLH A;  4KSA A;  4KUA A;  4B11 A;  4W9Y A;  1OBR A;  4CGN A;  2PVW A;  4P4B A;  3PBE A;  1N71 A;  3N7Z A;  2ATR A;  2RC4 A;  1NE9 A;  3CXP A;  4GS4 A;  4AVC A;  2AFM A;  4RUH A;  4ZY2 A;  3S9L A;  5BWA B;  4ZGY B;  2PR1 A;  4KSI A;  1FT7 A;  3PZJ A;  2O53 A;  4LQ6 A;  3JVN A;  4ZBG A;  3NE8 A;  1UWY A;  1Q2D A;  1MJB A;  3BLN A;  4CAE A;  3DLJ A;  3OWC A;  2EBJ A;  3I1U A;  4JYW A;  4U9Z A;  5HH1 A;  3R9E A;  2DXQ A;  3KGQ A;  3FBU A;  3WC5 A;  1YME A;  3N5F A;  2JDD A;  5KTC A;  1Y9W A;  1M4G A;  3WR7 A;  5KTA A;  2AFU A;  3B35 A;  2FIW A;  2AFW A;  4NGR A;  5C82 A;  2PJ0 A;  5HXD A;  4IK2 A;  3R96 A;  3QAY A;  5K8O A;  4UFW A;  2PJ8 A;  2C27 A;  4Q7A A;  2ZEM A;  5DS0 A;  2K5T A;  5E96 A;  1XEB A;  4QB9 A;  3W6S A;  5DWN A;  1YRE A;  2QVP A;  2YGW A;  2ZW5 A;  4KOU A;  4YGO A;  1RXT A;  3V7Z A;  4CYQ A;  4MY0 A;  2PJ2 A;  3B7I A;  2R98 A;  5THW A;  1S5K A;  3L2N A;  4O23 A;  4DYO A;  1YW6 A;  1I1D A;  3GUX A;  2Z11 A;  4B5O A;  2XEI A;  3PB4 X;  4R8F A;  3SI1 A;  4AVA A;  3BXM A;  2IMO A;  3SI0 A;  3KR5 A;  4CRY B;  3ZJ0 A;  3SJF A;  1CPS A;  3KKW A;  4P4J A;  5HMN A;  4A33 A;  2ZEO A;  4JXQ A;  3ZZI A;  4OC3 A;  5JPH A;  1LFW A;  3D7D A;  4NJR A;  4P6Y A;  4PPZ A;  1Y0Y A;  2J8M A;  4OKO A;  2JDC A;  3D66 A;  1YW4 A;  2D4O A;  3JRU A;  1WWZ A;  4JLY A;  3S6K A;  3V38 A;  2AFX A;  3FXT A;  1YGH A;  3LAC A;  3CT9 A;  5FVJ A;  2F7V A;  4E2A A;  1UFH A;  1XFO A;  3IGR A;  3TCV A;  2VI7 A;  2XEG A;  1DE4 C;  2G3T A;  3FB3 A;  3KHZ A;  3TO7 A;  2B4D A;  2BUE A;  1M4I A;  1TKJ A;  2B4D B;  4MCQ A;  4FAI A;  2AJ6 A;  1A2Z A;  4IAV A;  3FNC A;  2R7H A;  3GB0 A;  3KQX A;  2C6G A;  4F0X A;  2EO8 A;  1HDQ A;  1QMU A;  2REF A;  1IU8 A;  1YVO A;  3H4Q A;  4GXH A;  2BCO A;  4UEE A;  5CNP A;  7CPA A;  2PJ7 A;  1H8L A;  4YFJ A;  4YU9 A;  1L0C A;  2OR4 A;  3JTK A;  4UIA A;  1CP7 A;  5LRG A;  2JEV A;  2G9D A;  3KR4 A;  3NE7 A;  1BPM A;  1X10 A;  4H6U A;  5HVF A;  4Q36 A;  4HNW B;  2ABZ A;  3VH9 A;  1GHE A;  3IWG A;  1ZG8 A;  1S7K A;  1M4D A;  4P4I A;  4WWV A;  3SXN A;  2ZEP A;  2ZEF A;  1QQ9 A;  2YNE A;  3DDD A;  4OAD A;  1BO4 A;  2AE6 A;  2VZZ A;  2Q0Y A;  4CRZ B;  4H89 A;  1Z8X A;  1ZG9 A;  4UEZ A;  5F49 A;  4ZY1 A;  1EE3 P;  4G1P A;  4B12 A;  3KL9 A;  4WJB A;  3H5Z A;  4R3L A;  4KLV A;  1MK4 A;  3KQZ A;  4PXB A;  4R7M A;  2Q4Z A;  3D2M A;  3K9U A;  5AG7 A;  3SXO A;  3S9N A;  3GYA A;  3S9M A;  1IB1 E;  1YX0 A;  3IO1 A;  3PFO A;  3P2H A;  3R9G A;  2AFO A;  1F57 A;  4KOR A;  3NH4 A;  5F48 A;  4OP4 A;  4C2Y A;  3H8F A;  4Z65 A;  2R1I A;  1KUV A;  3IJ3 A;  4KOW A;  1KUY A;  2C6P A;  3IEH A;  4KZT A;  1CX8 A;  2Z3K A;  4CGP A;  3T9Y A;  1ELL P;  1Z4E A;  2F5I A;  2HQY A;  2ZEN A;  4CAF A;  1QST A;  3TFY A;  2B3U A;  4M3S A;  4AG7 A;  1HEE A;  1KUX A;  1RO5 A;  4MHP A;  2GLJ A;  2PJ5 A;  3IU1 A;  2QYV A;  5J1Q A;  1IOI A;  1VHE A;  3BI0 A;  3B3C A;  2EK9 A;  4A31 A;  4Y49 C;  2CTC A;  5LYF A;  3KAS A;  4CS0 B;  2CTB A;  3CDX A;  2JBK A;  1QSM A;  3B3T A;  4A37 A;  1TIQ A;  2C1C A;  2WUU A;  3ISX A;  3PB6 X;  2BSW A;  4XNH C;  3WAB A;  3MRU A;  4CAX A;  3GY9 A;  4E8O A;  3S6H A;  3FX6 A;  3WC7 A;  2PIZ A;  2PQ8 A;  2VQY A;  2ZOF A;  3TX8 A;  4QUS A;  5G20 A;  4PSX A;  4OC0 A;  4BMH A;  4R6T A;  3NA6 A;  1PCA A;  2PJ4 A;  1CP6 A;  4MHY A;  4R76 A;  4MFK A;  1M1D A;  5F46 A;  2Z3N A;  3EO4 A;  2POK A;  1MJA A;  1CM0 A;  4M6I A;  4CYO A;  4GM5 A;  1XE4 A;  4MFQ A;  4UEF A;  5IX3 A;  3MGD A;  4KS9 A;  4P45 A;  2FXF A;  4JD6 A;  2Y0M A;  1YVK A;  3BHX A;  3RAM A;  2B5G A;  4PSW A;  2FSR A;  4KOV A;  2FT0 A;  4X2T A;  1BPN A;  4NGQ A;  5CBM A;  3PB8 X;  2DPT A;  3TOA A;  4KVO E;  4IF5 A;  5CPA A;  3FVL A;  5JQ4 A;  5H86 A;  2DPS A;  4JZ0 A;  4KSF A;  1PYT B;  3IIB A;  5K8P A;  4AB7 A;  2ARH A;  2FVG A;  4P44 A;  4MMO A;  4B13 A;  4MFP A;  2WPW A;  4NGT A;  2EWB A;  1RTQ A;  4C2X A;  3FF3 A;  4UA3 A;  4P4D A;  1KWM A;  1XBU A;  4FWU A;  2EVN A;  5IV0 A;  3PB9 X;  3EY5 A;  1Q2C A;  1IGB A;  3EC4 A;  4E0A A;  2P6E A;  3IWW A;  4II9 A;  5ISV A;  1Z2L A;  3FRM A;  3HLP A;  1Q7L A;  2ZW7 A;  4A38 A;  1YSJ A;  2G3A A;  4NGP A;  3BJ8 A;  4NGM A;  4CGO A;  4ZI6 A;  2D4P A;  1VHO A;  1TKH A;  2EK8 A;  2PRB A;  3SJE A;  2ZEG A;  4A32 A;  1PU9 A;  4XPD C;  2ANP A;  4XPL A;  3PFE A;  4AXV A;  2IL4 A;  2J8R A;  3SHP A;  2VXK A;  2PR8 A;  5LYI A;  2QIR A;  4KOY A;  4F8Z A;  1QSN A;  1S7N A;  3CZX A;  3GIU A;  4OIW A;  4UF4 A;  2VBQ A;  2Q44 A;  4PV6 A;  4B10 A;  3D2P A;  1Y0R A;  4R3K A;  2QEC A;  3K9T A;  2Q43 A;  4MJ8 A;  5D29 A;  5F47 A;  4K3N A;  4XPD B;  1ARL A;  1QSO A;  2PRQ A;  4P4E A;  4M6H A;  2Q7B A;  4OAE A;  4CGL A;  2B58 A;  4MCR A;  1YLE A;  2KCW A;  2OH1 A;  3D4U A;  5G1Z A;  3DR6 A;  4CPA A;  5K8M A;  4H2K A;  3KHX A;  2CXA A;  4MXU A;  5EMI A;  3FED A;  2PE3 A;  1CPX A;  2RFH A;  2ZPA A;  1WK4 A;  4F0Y A;  1IY7 A;  2HUZ A;  2Z3L A;  3CPX A;  4OID A;  3F0A A;  3RBU A;  1LRZ A;  2CIJ A;  3F5B A;  3KZW A;  3LOD A;  4NGN A;  4C2Z A;  3D67 A;  2J9A A;  2VZY A;  2PDO A;  1TF8 A;  4UWJ A;  4UFV A;  1SQH A;  5J8F A;  3S6G A;  3W6X A;  2PJ6 A;  1TKF A;  4C7H A;  1Z9U A;  4HNX B;  4NCZ A;  4B5P A;  2XEJ A;  2ZED A;  2PJ3 A;  4NFR A;  3RNZ A;  4KOX A;  4BIN A;  1NMT A;  2I00 A;  4A94 A;  2FCK A;  2OZG A;  4J3G A;  3SJX A;  4OME A;  4ORF A;  2REE A;  3R95 A;  4OLL A;  4PXD A;  5IB9 A;  1LAP A;  2WPX A;  4YRH A;  2HB6 A;  4A30 A;  1VGY A;  1ZG7 A;  3RZA A;  2F8H A;  4IHM A;  1I12 A;  3DSB A;  5EBV A;  3TOB A;  3VWD A;  4CYN A;  5F09 A;  1OZP A;  1LOK A;  3VAR A;  3JUW A;  4QC6 A;  4MHN A;  3D68 A;  3G3S A;  5LRJ A;  1Z8L A;  2Q04 A;  2RB7 A;  3FYN A;  3PGP A;  2JEW A;  2FS5 A;  2GAN A;  4M85 A;  4UIB A;  1Z5R A;  5G21 A;  2PJB A;  2JBJ A;  3P2F A;  4KOT A;  3B3W A;  5LYD A;  4C7I A;  2GLF A;  1Z4R A;  2IQ6 A;  4P4F A;  2Q51 A;  2AFZ A;  1ZO0 A;  1F2O A;  3D3S A;  2H5M A;  4TWE A;  5GCN A;  4LX9 A;  3S6F A;  3FIX A;  3UY5 A;  2PJ1 A;  3IC1 A;  2ZOG A;  1FY7 A;  2Q4Y A;  3R1K A;  4NXY A;  4Y49 B;  1IOF A;  3G8W A;  2ZEL A;  3A9L A;  2PC1 A;  5HVG A;  1AMP A;  2OB0 A;  2PVV A;  1YLO A;  3HUV A;  3KI9 A;  3FEE A;  4I49 A;  4XNH B;  5EC4 A;  3DR8 A;  2PJ9 A;  3BJ7 A;  2BO9 A;  3FH4 A;  4NJQ A;  1R3N A;  5IB0 A;  3PP9 A;  2I3C A;  4MY3 A;  2I79 A;  2OZU A;  1PUA A;  4KVX A;  1J4J A;  4MI4 A;  4U5Y A;  2V8G A;  2R8V A;  2WZN A;  4X8I A;  5J8C A;  2GIV A;  4KVM E;  3CXS A;  2B5G B;  4RN7 A;  5H84 A;  4A95 A;  4C68 A;  1VHS A;  4DNC A;  4LQG A;  3GKR A;  4NSQ A;  4EME A;  2NMT A;  4Q38 A;  1M4L A;  2VEZ A;  2BOA A;  1R57 A;  3B2Y A;  4FD7 A;  4UBR A;  3RYO A;  1GYT A;  2A4N A;  4FD4 A;  1ARM A;  4OC1 A;  2OOT A;  4K30 A;  3WT4 A;  4FBE A;  4PK2 A;  4UWI A;  2FIA A;  5A27 A;  5JM6 A;  3C26 A;  2O28 A;  2V8D A;  3QAH A;  3FEC A;  1YK3 A;  4UCN A;  2OZH A;  4MFL A;  1JWQ A;  4MHZ A;  3IWE A;  5LYL A;  1XRY A;  2O4H A;  1P4N A;  4B14 A;  1CG2 A;  2V8H A;  1IYK A;  3K2K A;  5AG5 A;  4QBJ A;  2GU2 A;  2P6G A;  2Z3P A;  4L8A A;  4PXE A;  4R57 A;  4CAW A;  5K8N A;  4EVY A;  1CBX A;  4BD9 A;  4KOS A;  3LMS A;  1QSR A;  2CNM A;  1XMB A;  3D7G A;  4JXR A;  3WC6 A;  2Q7S A; 
#chains in the Genus database with same CATH homology
 1X10 A;  3GIU A;  1IOF A;  1X12 A;  3LAC A;  1IOI A;  1A2Z A;  1Z8W A;  1Z8X A;  2EBJ A;  2DF5 A;  4HPS A;  3RNZ A;  2EO8 A;  1AUG A;  1Z8T A;  1IU8 A;  4GXH A;  3RO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...