2AE6A

Crystal structure of acetyltransferase of gnat family from enterococcus faecalis v583
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
161
structure length
148
Chain Sequence
MSTSLTIRLVAEADWPALHALDQIISLAAYQEKMKDETIFVAISGQQLAGFIEVHPPTSLAAHQKQWLLSIGVSPDFQDQGIGGSLLSYIKDMAEISGIHKLSLRVMATNQEAIRFYEKHGFVQEAHFKEEFYINGHYCDDYQYAYFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords acetyltransferase, GNAT family
publication title Crystal Structure of Acetyltransferase of GNAT family from Enterococcus faecalis V583
rcsb
source organism Enterococcus faecalis
total genus 33
structure length 148
sequence length 161
chains with identical sequence B, C, D
ec nomenclature ec 2.3.-.-:
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2ae6A00
1S5KA 3G3SA 3D8PA 4M3SA 4QBJA 2OZUA 1PU9A 4CRYB 2BEIA 3EO4A 1XE4A 2J8RA 1MJAA 3DSBA 2ZXVA 3FRMA 4HNWB 2CY2A 3MGDA 4PSXA 1TIQA 4PSWA 4KOYA 1UFHA 4HKFA 2EVNA 1I12A 3TOAA 3R9GA 4X5KA 2FXFA 2R7HA 5J8FA 2K5TA 3H4QA 3JUWA 4R3KA 3T90A 1B6BA 2Q4VA 3I9SA 3IWGA 2Z0ZA 1M1DA 2B3UA 4FD6A 2JDCA 4RI1A 4YFJA 1S7LA 4LUAA 2FIAA 2VZZA 1QSOA 3CXSA 5F47A 3TO9A 2G0BA 3G8WA 4XNHC 4HNYB 4R87A 5F49A 4NSQA 4IUSA 2Q44A 5CNPA 4R9MA 3ZZIA 5C82A 2PSWA 2Z10A 2B3VA 2WPWA 3R1KA 2JDDA 2CNSA 3R96A 3BLNA 4KLVA 3F5BA 5KTDA 5EBVA 4KOWA 4JXRA 3PGPA 4R3LA 4K30A 5I0CA 2D4OA 2ZW6A 5F46A 2OZHA 4LX9A 2REFA 1ON0A 4FD7A 4E0AA 2VI7A 5H86A 2F5IA 3DDDA 2B5GB 1QSNA 2C27A 2AE6A 3S6KA 1M4DA 2AJ6A 1M4IA 3PZJA 4KVXA 1KUYA 2R98A 3BJ8A 2O28A 4MY0A 2X7BA 5KTCA 3WR7A 4XPLA 3S6FA 1P4NA 2OB0A 5JPHA 2R1IA 1PUAA 5JQ4A 5HMNA 3D2PA 3JVNA 5KTAA 5J8CA 1CJWA 1Q2YA 1P0HA 1RXTA 5GCNA 4KUBA 3R9EA 2OU2A 1L0CA 3N7ZA 3R95A 2VEZA 1BOBA 3NE7A 1RO5A 2G3TA 5F48A 1V0CA 4MI4A 4II9A 2PC1A 2NMTA 2VXKA 1VKCA 2P6FA 2FSRA 4UWJA 4B5PB 1NE9A 3PP9A 5HH1A 1YREA 2PR8A 2B58A 2VBQA 4E8OA 4R57A 2B4DB 4I49A 1MJBA 3EC4A 1B87A 3D2MA 4OLLA 4XPDB 5DWNA 2B4BA 3W6XA 4KOSA 4Y49B 2ZW4A 1YX0A 2OZGA 4ONUA 3F0AA 4OAEA 4KOUA 3IGRA 4JLYA 2BL1A 1Y9WA 4OADA 1M44A 1S3ZA 3P2FA 1Q2DA 4EVYA 2JEVA 1S60A 1WWZA 2P6EA 4U9ZA 4MY3A 3GKRA 1S7KA 4KORA 1Z4EA 2KCWA 3TTHA 1N71A 2IL4A 4UBRA 3R9FA 1IB1E 1I21A 3E0KA 2FE7A 2WPXA 3VWDA 3TO6A 3SXNA 4NXYA 4H6ZA 4UWIA 1YK3A 3TCVA 3K9UA 2GE3A 3SHPA 4AVBA 4MJ8A 1KUXA 2Z11A 3TO7A 4B5OA 3FYNA 4H6UA 2PQ8A 2Y0MA 3OWCA 3T9YA 3FNCA 4KOXA 5C88A 2REEA 1M4GA 1IYLA 2FS5A 4CAXA 2P0WA 4CAVA 4CAWA 2I79A 2VZYA 3P2HA 1OZPA 3KKWA 5IX3A 3DR6A 1Y9KA 2QECA 4BMHA 4QVTA 4CS0B 4ORFA 2PRBA 4XNHB 5EC4A 2VQYA 2D4PA 1KUVA 2DXQA 4KOVA 2GANA 1XMTA 2P6GA 4KVME 1BO4A 2HV2A 1YVKA 4JJXA 1Z4RA 1MK4A 2HUZA 4KUAA 4YRHA 2BUEA 4AG7A 5ISVA 4L89A 4XPDC 1QSTA 4IF5A 1QSMA 3TT2A 4H89A 4AG9A 2Q7BA 4Y49C 3CXQA 4GS4A 4AB7A 2ZPAA 2ARHA 2CNTA 2B5GA 4MHDA 1J4JA 1YLEA 1QSRA 1IICA 2H5MA 4JD6A 2QMLA 2J8NA 4U9YA 4AVAA 1IYKA 1VHSA 4CRZB 1S7NA 4XPKA 2ZW7A 3W91A 3DNSA 4NF1A 4F0YA 4PK2A 3QAHA 2FL4A 2Q0YA 3CXPA 4RS2A 2RC4A 3I3GA 1KZFA 2Q4YA 1I1DA 1Z9UA 5H84A 4KLWA 3EY5A 1NMTA 3TE4A 4AVCA 3UY5A 3FXTA 3GY9A 4QUSA 2J8MA 2FCKA 4E2AA 2HQYA 3RYOA 4UA3A 4B5PA 2BSWA 5IV0A 1WK4A 3D3SA 3SXOA 1U6MA 2CNMA 4DNCA 2FIWA 1XEBA 2B4DA 4KOTA 4PK3A 1FY7A 3BJ7A 5E96A 3W6SA 2ATRA 1YVOA 2I00A 1NSLA 2JLMA 4KVOE 2OH1A 4JXQA 1Q2CA 4NEXA 3LD2A 2R8VA 4ZBGA 4NCZA 4J3GA 1XF8A 4MBUA 3B8GA 3GYAA 5DWMA 2QIRA 1SQHA 3FIXA 4U5YA 3C26A 2EUIA 2PR1A 1XIXA 5FVJA 3F8KA 4KZTA 1YGHA 3TOBA 1K4JA 3LODA 3VWEA 1Y7RA 2PDOA 4QB9A 2GIVA 4L8AA 1S7FA 1CM0A 3S6HA 3ZJ0A 3V8IA 3QB8A 4HNXB 1MJ9A 1YR0A 3FB3A 2A4NA 3EXNA 3FBUA 4PV6A 1R57A 2ZW5A 4FD5A 4QC6A 3TFYA 4FD4A 3EFAA 3DR8A 2G3AA 4YGOA 1LRZA 5IB0A 3S6GA 4F6AA 1IIDA 2Q04A 2FT0A 4JWPA 4M85A 1GHEA
chains in the Genus database with same CATH superfamily
1S5KA 2VL1A 3G3SA 4OIWA 3D8PA 3S9MA 1Q7LA 2PJ8A 3S9NA 3H8GA 4M3SA 4QBJA 2OZUA 1PU9A 3SJEA 4CRYB 2BEIA 5THWA 3EO4A 1XE4A 2J8RA 1MJAA 3DSBA 1BLLE 2ZXVA 3FRMA 4Q36A 4HNWB 2JEWA 1AUGA 3FMCA 2PE3A 2CY2A 2PJ2A 4LQGA 3SJGA 3T8WA 4C68A 3MGDA 1LCPA 7CPAA 1OBRA 4PSXA 1TIQA 4UFWA 2YNCC 3BI0A 3PB7X 4BD9A 4FBEA 4PSWA 4KOYA 4Q38A 1X12A 4C2ZA 1UFHA 4HKFA 2PJ7A 3LMSA 2V8GA 1Y0YA 2EVNA 4A33A 1I12A 3TOAA 4C2XA 3R9GA 4X5KA 2FXFA 2AFUA 2R7HA 1XJOA 4NGTA 1LANA 3B2YA 4NGMA 5J8FA 5JGFA 2AFMA 2AFXA 2K5TA 3H4QA 1ARLA 4A32A 4P4FA 3S9LA 3JUWA 3LWUA 2XEFA 4R3KA 3T90A 1B6BA 5LYDA 4A2ZA 2PJCA 2Q4VA 3I9SA 3IWGA 2Z0ZA 1M1DA 1Z8XA 2B3UA 4P6YA 4FD6A 4X8IA 4A30A 5HVHA 2JDCA 4RI1A 4YFJA 1S7LA 4LUAA 2FIAA 2NYQA 3SJFA 1ZG9A 2VZZA 3QNVA 4UIBA 1QSOA 3CXSA 4CGLA 5F47A 2F7VA 5HVGA 3TO9A 3D4UA 4ZI6A 3D66A 2G0BA 3G8WA 1IGBA 3NFZA 3FEEA 4MCSA 4XNHC 1CP6A 4UCNA 4HNYB 4R87A 3FJUA 5F49A 4NSQA 2ZEHA 4IUSA 2Q44A 2BOAA 1YQEA 5CNPA 4R9MA 3ZZIA 5C82A 2PSWA 4PXEA 1VGYA 3PBEA 2Z10A 2YNDA 2DEAA 5K8MA 4DYOA 4CGNA 4WJBA 2B3VA 2WPWA 3B35A 3R1KA 2JDDA 2O53A 2CNSA 3R96A 2ANPA 4M6IA 4PXCA 3VH9A 4CAEA 3B7IA 3BLNA 4KLVA 5IB9A 3F5BA 5KTDA 1ELMP 4KOWA 5EBVA 4JXRA 4EMEA 3PGPA 4R3LA 1Y0RA 4K30A 4ZYQA 5I0CA 3BHXA 2D4OA 2ZW6A 5F46A 2OZHA 3PB9X 1FNOA 4LX9A 2PJ9A 1M4LA 2REFA 1BPNA 1ON0A 4FD7A 1ZG8A 1CX8A 3IC1A 4R7MA 4E0AA 2VI7A 2YNCA 4P4DA 5H86A 2F5IA 5LRGA 2Z3NA 3DDDA 2QJ8A 2B5GB 1PYTB 1QSNA 1IU8A 3L2NA 4JYWA 4OC3A 2C27A 2AE6A 4OP4A 2Z3OA 4OC4A 5LRJA 2HB6A 3S6KA 1M4DA 2AJ6A 3QAYA 1M4IA 1RTQA 3PZJA 1R43A 3H8FA 4KVXA 2QYVA 1KUYA 4OIDA 2PJ0A 3PB8X 2R98A 3BJ8A 4M6GA 2O28A 4MCPA 4MY0A 4NFRA 4UEEA 1Z5RA 2X7BA 4NGQA 4MFQA 4UFVA 5KTCA 3RNZA 3WR7A 2Q51A 2PJ6A 4XPLA 3S6FA 4R6TA 1P4NA 1GYTA 1QQ9A 5I4MA 2OB0A 5JPHA 1LOKA 2R1IA 1PUAA 4O23A 5JQ4A 3KASA 5LYIA 5HMNA 3D2PA 3JVNA 3IJ3A 4B11A 2IQ6A 5KTAA 5J8CA 1CJWA 1Q2YA 1P0HA 4H2KA 1RXTA 5GCNA 4P44A 5G22A 3RO0A 4KUBA 3R9EA 2OU2A 1L0CA 1KWMA 4DUKA 4IAVA 3N7ZA 3R95A 1QMUA 3KHXA 4PPZA 3FX6A 2VEZA 1BOBA 3NE7A 4GM5A 2O4HA 3B3TA 1RO5A 2Z3KA 2G3TA 5F48A 1V0CA 4MI4A 3D7DA 4II9A 2PC1A 4CYNA 4YU9A 2NMTA 3FEDA 2VXKA 1VKCA 5HXDA 1DTDA 2P6FA 4BINA 5K8NA 2FSRA 4UWJA 4B5PB 1NE9A 3PP9A 3DLJA 5HH1A 3IO1A 1YREA 4P4EA 3NA6A 4EFDA 3CZXA 2PR8A 2ABZA 2CIJA 2B58A 3KQXA 4IK2A 4DJLA 2VBQA 1BPMA 4E8OA 2C6GA 4R57A 4F0XA 4ZGYB 5LRKA 4Z65A 2B4DB 4I49A 1MJBA 4MCRA 1IOFA 3EC4A 1B87A 1JQGA 3D2MA 5G1ZA 3PB4X 6CPAA 2GFQA 1AYEA 4RN7A 4UCPA 2EK9A 4OLLA 4CYPA 4XPDB 3SI0A 5DWNA 2B4BA 3W6XA 4KOSA 4Y49B 3D7FA 2ZW4A 1YX0A 3ISXA 5CPAA 4M6HA 2OZGA 2Q43A 4ONUA 3F0AA 3PB6X 4OAEA 1IOIA 4KOUA 3IU2A 4MHYA 3IGRA 4MFKA 4JLYA 1IY7A 2DPSA 2C6PA 2EWBA 2BL1A 1Y9WA 4F9VA 4OADA 5AG4A 4P10A 1M44A 1S3ZA 4B12A 1YLOA 1Q2DA 3P2FA 2JEVA 4EVYA 2PCUA 3H5ZA 1S60A 2ZEOA 1WWZA 2J9AA 2P6EA 3FH4A 4U9ZA 4MY3A 3WC6A 3GKRA 1S7KA 4KORA 1Z4EA 4YWYA 2KCWA 2ZOFA 4UEFA 3TTHA 4A39A 1N71A 2IL4A 4UBRA 4FAIA 1YW4A 4CAFA 2YGWA 3R9FA 4CGPA 2OOTA 1IB1E 1I21A 3E0KA 1VHEA 2FE7A 4RUHA 2PVVA 4KSAA 2WPXA 3PEIA 4MFPA 1ZLHA 1CPXA 4NJRA 5G20A 3VWDA 3TO6A 3V38A 1AMPA 5A28A 3SXNA 4NXYA 1A2ZA 4PXDA 4UIAA 4H6ZA 1XBUA 3FECA 4CGOA 5J1QA 4MMOA 4UWIA 2JBJA 3ISZA 1YK3A 3TCVA 3K9UA 2GE3A 4OC0A 2ZEDA 3D68A 3B3SA 3NH5A 3SHPA 3NH8A 5AG5A 4AVBA 4MJ8A 1KUXA 2IJZA 1XFOA 2Z11A 3RAMA 5CBMA 4UF4A 4MFLA 3TO7A 4B5OA 4CPAA 3FYNA 3HUVA 1TKHA 4H6UA 2PQ8A 3IU1A 1TF8A 2PIYA 3GLJA 2C6CA 2Y0MA 4B6ZA 3OWCA 3T9YA 3FNCA 4KOXA 3IWEA 5C88A 1F2PA 2FVGA 1M4GA 2REEA 1IYLA 2FS5A 4CAXA 2P0WA 3PFOA 5K8PA 1Y7EA 4CAVA 2ZEGA 4CAWA 1TKJA 2I79A 2CF4A 2VZYA 3P2HA 3RBUA 5LYFA 1OZPA 2V8DA 2AFOA 2PJ5A 3KKWA 5LYLA 5IX3A 4CYOA 3DR6A 4MHNA 1Y9KA 1BAVA 2QECA 4BMHA 4QVTA 3TC8A 4CS0B 1R3NA 4ORFA 2WUUA 4MFJA 4MFZA 2PRBA 4XNHB 4NGSA 5EC4A 4B13A 4A37A 2VQYA 2D4PA 4ZY0A 1KUVA 1TXRA 2DXQA 2F8HA 4KOVA 2DPTA 4JZ0A 2GANA 2XEJA 4NJQA 1XMTA 3CPAA 2P6GA 3IFEA 4KVME 2DF5A 2PIZA 1VIXA 2ZEPA 4KS9A 1BO4A 1HEEA 2HV2A 1YVKA 2ZOGA 4OC5A 3KGQA 1Z4RA 2YNEA 4JJXA 5A27A 1H8LA 1MK4A 2HUZA 1ELLP 4KUAA 1Z8LA 2BUEA 4YRHA 4AG7A 2GLJA 3H8EA 3FVLA 3WT4A 5ISVA 5K8OA 2BO9A 5EMIA 3I1UA 3VATA 4CGMA 4L89A 3JTKA 1JWQA 1QSTA 4IF5A 1QSMA 2WSAA 4XPDC 4OC1A 3TT2A 4H89A 4AG9A 2Z3MA 2Q7BA 2Q4ZA 4Y49C 2GLFA 4P4IA 3KR5A 3CXQA 3K9TA 3KL9A 4GS4A 3GIUA 4NGNA 2CTCA 4OMEA 2ZENA 4TNUA 4AB7A 2ZPAA 4BBHA 2ARHA 2CNTA 1HDUA 3KZWA 4OKOA 2B5GA 4MHDA 1NSAA 4PXBA 4X2TA 2XEIA 1J4JA 3BI1A 2PVWA 1YLEA 3IIBA 4Q7AA 5F09A 2AFSA 2NSMA 2PJAA 1QSRA 1IICA 2H5MA 4JD6A 3GUXA 2BCOA 2QMLA 2J8NA 4U9YA 3VARA 4B14A 4AVAA 1IYKA 1VHSA 4CRZB 1S7NA 4XPKA 1DE4C 4R76A 2ZW7A 3W91A 1UWYA 3B3VA 4MCQA 3DNSA 3KHZA 4ONWA 2GU2A 4NF1A 1CPSA 3PRTA 3D7GA 4F0YA 4PK2A 5ELYA 3BXMA 2CTBA 2FL4A 2Q0YA 3QAHA 4NGPA 2RB7A 3CXPA 3KR4A 4RS2A 3TX8A 2RC4A 4FWUA 3DGVA 5AG7A 3I3GA 4P4JA 1KZFA 2Q4YA 1I1DA 1Z9UA 2PJ3A 3NE8A 1CBXA 3MN8A 5H84A 3IWWA 4KLWA 3EY5A 2PJ1A 1NMTA 3TE4A 1VHOA 8CPAA 3N5FA 4AVCA 3UY5A 1YW6A 2PJ4A 2I3CA 2XEGA 3FXTA 3GY9A 4QUSA 2J8MA 2PRQA 1X10A 2FCKA 2QVPA 4E2AA 2HQYA 3RYOA 2AFZA 4LQ6A 2V8VA 4UCMA 4UA3A 3KQZA 5AGEA 4B5PA 4P45A 5G21A 2BSWA 5IV0A 1WK4A 3D3SA 2EBJA 4TWEA 4A94A 4F8ZA 3B3CA 3SXOA 1ZLIA 4ZX9A 2Q7SA 2ODFA 4C2YA 5D29A 1U6MA 2CNMA 4DNCA 2FIWA 1XEBA 2B4DA 5DS0A 4KOTA 2EK8A 1TKFA 4PK3A 1FY7A 3K2KA 4ZY1A 2PJBA 3BJ7A 5E96A 1XOVA 4WWVA 4MXUA 3W6SA 2ATRA 2V77A 3PFEA 4MRIA 3JRUA 4MHZA 2WZNA 2WYRA 1YVOA 2I00A 2ZEMA 2JLMA 3FF3A 4MHPA 4P4BA 1NSLA 4ZX8A 4KVOE 3V7ZA 2OH1A 3SI2A 5JM6A 4JXQA 1Q2CA 2EO8A 4NEXA 3LD2A 2R8VA 4ZY2A 4KSIA 4ZBGA 3IEHA 2JBKA 4NCZA 3B3WA 3PBBA 4J3GA 1XF8A 1ZG7A 4IHMA 4MBUA 4NGRA 4UFXA 3RZAA 2ZEFA 3CT9A 3B8GA 3GYAA 2CXAA 1YSJA 4KSFA 3GB0A 4B10A 5DWMA 2QIRA 1SQHA 1XMBA 3FIXA 4U5YA 3C26A 4F9UA 2IMOA 4A38A 2EUIA 2PR1A 4K3NA 3D67A 4CYQA 3KI9A 2G9DA 1XIXA 5FVJA 5AG6A 1EE3P 3F8KA 3CDXA 1YGHA 4KZTA 3TOBA 3WABA 1K4JA 4X3RA 4AXVA 3LODA 1F57A 3VWEA 3WC5A 1HDQA 2OR4A 1PCAA 3HLPA 2ZELA 1LAPA 4W9YA 3WC7A 1Y7RA 2PDOA 2V8HA 4QB9A 2GIVA 1YMEA 4L8AA 2AFWA 1S7FA 1CM0A 3S6HA 3ZJ0A 2Z3LA 3V8IA 3QB8A 2POKA 4HNXB 4PQAA 3SJXA 3MRUA 1MJ9A 1Z8TA 3NH4A 1ZO0A 1YR0A 1CP7A 3FB3A 2A4NA 3EXNA 3FBUA 4A95A 3A9LA 4PV6A 1R57A 2ZW5A 5D8NA 4FD5A 1FT7A 4QC6A 1Z2LA 4R8FA 5BWAB 3TFYA 2ZEEA 2GREA 4FD4A 5JH9A 3EFAA 4HPSA 4OC2A 2HC9A 3CPXA 3DR8A 1F2OA 3SI1A 2G3AA 4GXHA 4YGOA 4EWTA 3D7HA 5HVFA 1LRZA 4UEZA 3LACA 4A31A 2Z3PA 1XRYA 1ARMA 1LFWA 5IB0A 3S6GA 4F6AA 4FUUA 1IIDA 4C7IA 1TF9A 1LAMA 4C7HA 2RFHA 2Q04A 2FT0A 4JWPA 1Z8WA 4M85A 1GHEA 4G1PA 2C1CA 1CG2A
chains in the Genus database with same CATH topology
1S5KA 3G3SA 3D8PA 4M3SA 4QBJA 2OZUA 1PU9A 4CRYB 2BEIA 3EO4A 1XE4A 2J8RA 1MJAA 3DSBA 2ZXVA 3FRMA 4Q36A 4HNWB 2CY2A 4C68A 3MGDA 4PSXA 1TIQA 4UFWA 2YNCC 4PSWA 4KOYA 4Q38A 4C2ZA 1UFHA 4HKFA 2EVNA 4A33A 1I12A 3TOAA 4C2XA 3R9GA 4X5KA 2FXFA 2R7HA 5J8FA 2K5TA 3H4QA 4A32A 3JUWA 4R3KA 3T90A 1B6BA 4A2ZA 2Q4VA 3I9SA 3IWGA 2Z0ZA 1M1DA 2B3UA 4FD6A 4A30A 2JDCA 4RI1A 4YFJA 1S7LA 4LUAA 2FIAA 2VZZA 4CGLA 1QSOA 3CXSA 5F47A 3TO9A 2G0BA 3G8WA 4XNHC 4UCNA 4HNYB 4R87A 5F49A 4NSQA 4IUSA 2Q44A 5CNPA 4R9MA 3ZZIA 5C82A 2PSWA 2Z10A 2YNDA 4CGNA 2B3VA 2WPWA 3R1KA 2JDDA 2CNSA 3R96A 4CAEA 3BLNA 4KLVA 3F5BA 5KTDA 5EBVA 4KOWA 4JXRA 3PGPA 4R3LA 4K30A 5I0CA 2D4OA 2ZW6A 5F46A 2OZHA 4LX9A 2REFA 1ON0A 4FD7A 4E0AA 2VI7A 2YNCA 5H86A 2F5IA 2Z3NA 3DDDA 2B5GB 1QSNA 2C27A 2AE6A 2Z3OA 3S6KA 1M4DA 2AJ6A 1M4IA 3PZJA 4KVXA 1KUYA 2R98A 3BJ8A 2O28A 4MY0A 2X7BA 5KTCA 4UFVA 4MFQA 3WR7A 4XPLA 3S6FA 1P4NA 2OB0A 5JPHA 2R1IA 1PUAA 5JQ4A 5HMNA 3D2PA 3JVNA 4B11A 5KTAA 5J8CA 1CJWA 1Q2YA 1P0HA 1RXTA 5GCNA 5G22A 4KUBA 3R9EA 2OU2A 1L0CA 3N7ZA 3R95A 2VEZA 1BOBA 3NE7A 1RO5A 2Z3KA 2G3TA 5F48A 1V0CA 4MI4A 4II9A 2PC1A 4CYNA 2NMTA 2VXKA 1VKCA 2P6FA 2FSRA 4UWJA 4B5PB 1NE9A 3PP9A 5HH1A 1YREA 2PR8A 2B58A 2VBQA 4E8OA 4R57A 4F0XA 4ZGYB 2B4DB 4I49A 1MJBA 3EC4A 1B87A 3D2MA 5G1ZA 4UCPA 4OLLA 4CYPA 4XPDB 5DWNA 2B4BA 3W6XA 4KOSA 4Y49B 2ZW4A 1YX0A 2OZGA 4ONUA 3F0AA 4OAEA 4KOUA 3IU2A 3IGRA 4MFKA 4JLYA 2DPSA 2BL1A 1Y9WA 4OADA 5AG4A 1M44A 1S3ZA 4B12A 3P2FA 1Q2DA 4EVYA 2JEVA 3H5ZA 1S60A 1WWZA 2P6EA 4U9ZA 4MY3A 3GKRA 1S7KA 4KORA 1Z4EA 2KCWA 3TTHA 1N71A 2IL4A 4UBRA 4CAFA 2YGWA 3R9FA 4CGPA 1IB1E 1I21A 3E0KA 2FE7A 4KSAA 2WPXA 4MFPA 3VWDA 5G20A 3TO6A 5A28A 3SXNA 4NXYA 4H6ZA 4UWIA 1YK3A 3TCVA 3K9UA 2GE3A 3SHPA 5AG5A 4AVBA 4MJ8A 1KUXA 2Z11A 4MFLA 3TO7A 4B5OA 3FYNA 4H6UA 2PQ8A 3IU1A 2Y0MA 3OWCA 3T9YA 3FNCA 4KOXA 3IWEA 5C88A 2REEA 1M4GA 1IYLA 2FS5A 4CAXA 2P0WA 4CAVA 4CAWA 2I79A 2VZYA 3P2HA 1OZPA 3KKWA 5IX3A 4CYOA 3DR6A 1Y9KA 2QECA 4BMHA 4QVTA 4CS0B 4ORFA 2WUUA 4MFJA 4MFZA 2PRBA 4XNHB 5EC4A 4B13A 2VQYA 2D4PA 1KUVA 2DXQA 4KOVA 2DPTA 2GANA 1XMTA 2P6GA 4KVME 4KS9A 1BO4A 2HV2A 1YVKA 4JJXA 1Z4RA 2YNEA 5A27A 1MK4A 2HUZA 4KUAA 4YRHA 2BUEA 4AG7A 5ISVA 4CGMA 4L89A 3JTKA 1QSTA 4IF5A 4XPDC 1QSMA 2WSAA 3TT2A 4H89A 4AG9A 2Z3MA 2Q7BA 4Y49C 3CXQA 4GS4A 4AB7A 2ZPAA 4BBHA 2ARHA 2CNTA 2B5GA 4MHDA 1J4JA 1YLEA 1QSRA 1IICA 2H5MA 4JD6A 2QMLA 2J8NA 4U9YA 4B14A 4AVAA 1IYKA 1VHSA 4CRZB 1S7NA 4XPKA 2ZW7A 3W91A 3DNSA 4NF1A 4F0YA 4PK2A 3QAHA 2FL4A 2Q0YA 3CXPA 4RS2A 2RC4A 5AG7A 3I3GA 1KZFA 2Q4YA 1I1DA 1Z9UA 5H84A 4KLWA 3EY5A 1NMTA 3TE4A 4AVCA 3UY5A 3FXTA 3GY9A 4QUSA 2J8MA 2FCKA 4E2AA 2HQYA 3RYOA 4UCMA 4UA3A 5AGEA 4B5PA 5G21A 2BSWA 5IV0A 1WK4A 3D3SA 3SXOA 4C2YA 1U6MA 2CNMA 4DNCA 2FIWA 1XEBA 2B4DA 4KOTA 4PK3A 1FY7A 3BJ7A 5E96A 3W6SA 2ATRA 1YVOA 2I00A 1NSLA 2JLMA 4KVOE 2OH1A 4JXQA 1Q2CA 4NEXA 3LD2A 2R8VA 4ZBGA 4NCZA 4J3GA 1XF8A 4UFXA 4MBUA 3B8GA 3GYAA 2CXAA 4KSFA 4B10A 5DWMA 2QIRA 1SQHA 3FIXA 4U5YA 3C26A 4CYQA 2EUIA 2PR1A 1XIXA 5FVJA 5AG6A 3F8KA 4KZTA 1YGHA 3TOBA 1K4JA 3LODA 3VWEA 1Y7RA 2PDOA 4QB9A 2GIVA 4L8AA 1S7FA 1CM0A 3S6HA 3ZJ0A 2Z3LA 3V8IA 3QB8A 4HNXB 1MJ9A 1ZO0A 1YR0A 3FB3A 2A4NA 3EXNA 3FBUA 4A95A 3A9LA 4PV6A 1R57A 2ZW5A 4FD5A 4QC6A 5BWAB 3TFYA 4FD4A 3EFAA 3DR8A 2G3AA 4YGOA 1LRZA 4A31A 2Z3PA 5IB0A 3S6GA 4F6AA 1IIDA 4C7IA 4C7HA 2Q04A 2FT0A 4JWPA 4M85A 1GHEA 4CGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5K A;  3G3S A;  3D8P A;  4M3S A;  4QBJ A;  2OZU A;  1PU9 A;  4CRY B;  2BEI A;  3EO4 A;  1XE4 A;  2J8R A;  1MJA A;  3DSB A;  2ZXV A;  3FRM A;  4HNW B;  2CY2 A;  3MGD A;  4PSX A;  1TIQ A;  4PSW A;  4KOY A;  1UFH A;  4HKF A;  2EVN A;  1I12 A;  3TOA A;  3R9G A;  4X5K A;  2FXF A;  2R7H A;  5J8F A;  2K5T A;  3H4Q A;  3JUW A;  4R3K A;  3T90 A;  1B6B A;  2Q4V A;  3I9S A;  3IWG A;  2Z0Z A;  1M1D A;  2B3U A;  4FD6 A;  2JDC A;  4RI1 A;  4YFJ A;  1S7L A;  4LUA A;  2FIA A;  2VZZ A;  1QSO A;  3CXS A;  5F47 A;  3TO9 A;  2G0B A;  3G8W A;  4XNH C;  4HNY B;  4R87 A;  5F49 A;  4NSQ A;  4IUS A;  2Q44 A;  5CNP A;  4R9M A;  3ZZI A;  5C82 A;  2PSW A;  2Z10 A;  2B3V A;  2WPW A;  3R1K A;  2JDD A;  2CNS A;  3R96 A;  3BLN A;  4KLV A;  3F5B A;  5KTD A;  5EBV A;  4KOW A;  4JXR A;  3PGP A;  4R3L A;  4K30 A;  5I0C A;  2D4O A;  2ZW6 A;  5F46 A;  2OZH A;  4LX9 A;  2REF A;  1ON0 A;  4FD7 A;  4E0A A;  2VI7 A;  5H86 A;  2F5I A;  3DDD A;  2B5G B;  1QSN A;  2C27 A;  2AE6 A;  3S6K A;  1M4D A;  2AJ6 A;  1M4I A;  3PZJ A;  4KVX A;  1KUY A;  2R98 A;  3BJ8 A;  2O28 A;  4MY0 A;  2X7B A;  5KTC A;  3WR7 A;  4XPL A;  3S6F A;  1P4N A;  2OB0 A;  5JPH A;  2R1I A;  1PUA A;  5JQ4 A;  5HMN A;  3D2P A;  3JVN A;  5KTA A;  5J8C A;  1CJW A;  1Q2Y A;  1P0H A;  1RXT A;  5GCN A;  4KUB A;  3R9E A;  2OU2 A;  1L0C A;  3N7Z A;  3R95 A;  2VEZ A;  1BOB A;  3NE7 A;  1RO5 A;  2G3T A;  5F48 A;  1V0C A;  4MI4 A;  4II9 A;  2PC1 A;  2NMT A;  2VXK A;  1VKC A;  2P6F A;  2FSR A;  4UWJ A;  4B5P B;  1NE9 A;  3PP9 A;  5HH1 A;  1YRE A;  2PR8 A;  2B58 A;  2VBQ A;  4E8O A;  4R57 A;  2B4D B;  4I49 A;  1MJB A;  3EC4 A;  1B87 A;  3D2M A;  4OLL A;  4XPD B;  5DWN A;  2B4B A;  3W6X A;  4KOS A;  4Y49 B;  2ZW4 A;  1YX0 A;  2OZG A;  4ONU A;  3F0A A;  4OAE A;  4KOU A;  3IGR A;  4JLY A;  2BL1 A;  1Y9W A;  4OAD A;  1M44 A;  1S3Z A;  3P2F A;  1Q2D A;  4EVY A;  2JEV A;  1S60 A;  1WWZ A;  2P6E A;  4U9Z A;  4MY3 A;  3GKR A;  1S7K A;  4KOR A;  1Z4E A;  2KCW A;  3TTH A;  1N71 A;  2IL4 A;  4UBR A;  3R9F A;  1IB1 E;  1I21 A;  3E0K A;  2FE7 A;  2WPX A;  3VWD A;  3TO6 A;  3SXN A;  4NXY A;  4H6Z A;  4UWI A;  1YK3 A;  3TCV A;  3K9U A;  2GE3 A;  3SHP A;  4AVB A;  4MJ8 A;  1KUX A;  2Z11 A;  3TO7 A;  4B5O A;  3FYN A;  4H6U A;  2PQ8 A;  2Y0M A;  3OWC A;  3T9Y A;  3FNC A;  4KOX A;  5C88 A;  2REE A;  1M4G A;  1IYL A;  2FS5 A;  4CAX A;  2P0W A;  4CAV A;  4CAW A;  2I79 A;  2VZY A;  3P2H A;  1OZP A;  3KKW A;  5IX3 A;  3DR6 A;  1Y9K A;  2QEC A;  4BMH A;  4QVT A;  4CS0 B;  4ORF A;  2PRB A;  4XNH B;  5EC4 A;  2VQY A;  2D4P A;  1KUV A;  2DXQ A;  4KOV A;  2GAN A;  1XMT A;  2P6G A;  4KVM E;  1BO4 A;  2HV2 A;  1YVK A;  4JJX A;  1Z4R A;  1MK4 A;  2HUZ A;  4KUA A;  4YRH A;  2BUE A;  4AG7 A;  5ISV A;  4L89 A;  4XPD C;  1QST A;  4IF5 A;  1QSM A;  3TT2 A;  4H89 A;  4AG9 A;  2Q7B A;  4Y49 C;  3CXQ A;  4GS4 A;  4AB7 A;  2ZPA A;  2ARH A;  2CNT A;  2B5G A;  4MHD A;  1J4J A;  1YLE A;  1QSR A;  1IIC A;  2H5M A;  4JD6 A;  2QML A;  2J8N A;  4U9Y A;  4AVA A;  1IYK A;  1VHS A;  4CRZ B;  1S7N A;  4XPK A;  2ZW7 A;  3W91 A;  3DNS A;  4NF1 A;  4F0Y A;  4PK2 A;  3QAH A;  2FL4 A;  2Q0Y A;  3CXP A;  4RS2 A;  2RC4 A;  3I3G A;  1KZF A;  2Q4Y A;  1I1D A;  1Z9U A;  5H84 A;  4KLW A;  3EY5 A;  1NMT A;  3TE4 A;  4AVC A;  3UY5 A;  3FXT A;  3GY9 A;  4QUS A;  2J8M A;  2FCK A;  4E2A A;  2HQY A;  3RYO A;  4UA3 A;  4B5P A;  2BSW A;  5IV0 A;  1WK4 A;  3D3S A;  3SXO A;  1U6M A;  2CNM A;  4DNC A;  2FIW A;  1XEB A;  2B4D A;  4KOT A;  4PK3 A;  1FY7 A;  3BJ7 A;  5E96 A;  3W6S A;  2ATR A;  1YVO A;  2I00 A;  1NSL A;  2JLM A;  4KVO E;  2OH1 A;  4JXQ A;  1Q2C A;  4NEX A;  3LD2 A;  2R8V A;  4ZBG A;  4NCZ A;  4J3G A;  1XF8 A;  4MBU A;  3B8G A;  3GYA A;  5DWM A;  2QIR A;  1SQH A;  3FIX A;  4U5Y A;  3C26 A;  2EUI A;  2PR1 A;  1XIX A;  5FVJ A;  3F8K A;  4KZT A;  1YGH A;  3TOB A;  1K4J A;  3LOD A;  3VWE A;  1Y7R A;  2PDO A;  4QB9 A;  2GIV A;  4L8A A;  1S7F A;  1CM0 A;  3S6H A;  3ZJ0 A;  3V8I A;  3QB8 A;  4HNX B;  1MJ9 A;  1YR0 A;  3FB3 A;  2A4N A;  3EXN A;  3FBU A;  4PV6 A;  1R57 A;  2ZW5 A;  4FD5 A;  4QC6 A;  3TFY A;  4FD4 A;  3EFA A;  3DR8 A;  2G3A A;  4YGO A;  1LRZ A;  5IB0 A;  3S6G A;  4F6A A;  1IID A;  2Q04 A;  2FT0 A;  4JWP A;  4M85 A;  1GHE A; 
#chains in the Genus database with same CATH topology
 1S5K A;  2VL1 A;  3G3S A;  4OIW A;  3D8P A;  3S9M A;  1Q7L A;  2PJ8 A;  3S9N A;  3H8G A;  4M3S A;  4QBJ A;  2OZU A;  1PU9 A;  3SJE A;  4CRY B;  2BEI A;  5THW A;  3EO4 A;  1XE4 A;  2J8R A;  1MJA A;  3DSB A;  1BLL E;  2ZXV A;  3FRM A;  4Q36 A;  4HNW B;  2JEW A;  1AUG A;  3FMC A;  2PE3 A;  2CY2 A;  2PJ2 A;  4LQG A;  3SJG A;  3T8W A;  4C68 A;  3MGD A;  1LCP A;  7CPA A;  1OBR A;  4PSX A;  1TIQ A;  4UFW A;  2YNC C;  3BI0 A;  3PB7 X;  4BD9 A;  4FBE A;  4PSW A;  4KOY A;  4Q38 A;  1X12 A;  4C2Z A;  1UFH A;  4HKF A;  2PJ7 A;  3LMS A;  2V8G A;  1Y0Y A;  2EVN A;  4A33 A;  1I12 A;  3TOA A;  4C2X A;  3R9G A;  4X5K A;  2FXF A;  2AFU A;  2R7H A;  1XJO A;  4NGT A;  1LAN A;  3B2Y A;  4NGM A;  5J8F A;  5JGF A;  2AFM A;  2AFX A;  2K5T A;  3H4Q A;  1ARL A;  4A32 A;  4P4F A;  3S9L A;  3JUW A;  3LWU A;  2XEF A;  4R3K A;  3T90 A;  1B6B A;  5LYD A;  4A2Z A;  2PJC A;  2Q4V A;  3I9S A;  3IWG A;  2Z0Z A;  1M1D A;  1Z8X A;  2B3U A;  4P6Y A;  4FD6 A;  4X8I A;  4A30 A;  5HVH A;  2JDC A;  4RI1 A;  4YFJ A;  1S7L A;  4LUA A;  2FIA A;  2NYQ A;  3SJF A;  1ZG9 A;  2VZZ A;  3QNV A;  4UIB A;  1QSO A;  3CXS A;  4CGL A;  5F47 A;  2F7V A;  5HVG A;  3TO9 A;  3D4U A;  4ZI6 A;  3D66 A;  2G0B A;  3G8W A;  1IGB A;  3NFZ A;  3FEE A;  4MCS A;  4XNH C;  1CP6 A;  4UCN A;  4HNY B;  4R87 A;  3FJU A;  5F49 A;  4NSQ A;  2ZEH A;  4IUS A;  2Q44 A;  2BOA A;  1YQE A;  5CNP A;  4R9M A;  3ZZI A;  5C82 A;  2PSW A;  4PXE A;  1VGY A;  3PBE A;  2Z10 A;  2YND A;  2DEA A;  5K8M A;  4DYO A;  4CGN A;  4WJB A;  2B3V A;  2WPW A;  3B35 A;  3R1K A;  2JDD A;  2O53 A;  2CNS A;  3R96 A;  2ANP A;  4M6I A;  4PXC A;  3VH9 A;  4CAE A;  3B7I A;  3BLN A;  4KLV A;  5IB9 A;  3F5B A;  5KTD A;  1ELM P;  4KOW A;  5EBV A;  4JXR A;  4EME A;  3PGP A;  4R3L A;  1Y0R A;  4K30 A;  4ZYQ A;  5I0C A;  3BHX A;  2D4O A;  2ZW6 A;  5F46 A;  2OZH A;  3PB9 X;  1FNO A;  4LX9 A;  2PJ9 A;  1M4L A;  2REF A;  1BPN A;  1ON0 A;  4FD7 A;  1ZG8 A;  1CX8 A;  3IC1 A;  4R7M A;  4E0A A;  2VI7 A;  2YNC A;  4P4D A;  5H86 A;  2F5I A;  5LRG A;  2Z3N A;  3DDD A;  2QJ8 A;  2B5G B;  1PYT B;  1QSN A;  1IU8 A;  3L2N A;  4JYW A;  4OC3 A;  2C27 A;  2AE6 A;  4OP4 A;  2Z3O A;  4OC4 A;  5LRJ A;  2HB6 A;  3S6K A;  1M4D A;  2AJ6 A;  3QAY A;  1M4I A;  1RTQ A;  3PZJ A;  1R43 A;  3H8F A;  4KVX A;  2QYV A;  1KUY A;  4OID A;  2PJ0 A;  3PB8 X;  2R98 A;  3BJ8 A;  4M6G A;  2O28 A;  4MCP A;  4MY0 A;  4NFR A;  4UEE A;  1Z5R A;  2X7B A;  4NGQ A;  4MFQ A;  4UFV A;  5KTC A;  3RNZ A;  3WR7 A;  2Q51 A;  2PJ6 A;  4XPL A;  3S6F A;  4R6T A;  1P4N A;  1GYT A;  1QQ9 A;  5I4M A;  2OB0 A;  5JPH A;  1LOK A;  2R1I A;  1PUA A;  4O23 A;  5JQ4 A;  3KAS A;  5LYI A;  5HMN A;  3D2P A;  3JVN A;  3IJ3 A;  4B11 A;  2IQ6 A;  5KTA A;  5J8C A;  1CJW A;  1Q2Y A;  1P0H A;  4H2K A;  1RXT A;  5GCN A;  4P44 A;  5G22 A;  3RO0 A;  4KUB A;  3R9E A;  2OU2 A;  1L0C A;  1KWM A;  4DUK A;  4IAV A;  3N7Z A;  3R95 A;  1QMU A;  3KHX A;  4PPZ A;  3FX6 A;  2VEZ A;  1BOB A;  3NE7 A;  4GM5 A;  2O4H A;  3B3T A;  1RO5 A;  2Z3K A;  2G3T A;  5F48 A;  1V0C A;  4MI4 A;  3D7D A;  4II9 A;  2PC1 A;  4CYN A;  4YU9 A;  2NMT A;  3FED A;  2VXK A;  1VKC A;  5HXD A;  1DTD A;  2P6F A;  4BIN A;  5K8N A;  2FSR A;  4UWJ A;  4B5P B;  1NE9 A;  3PP9 A;  3DLJ A;  5HH1 A;  3IO1 A;  1YRE A;  4P4E A;  3NA6 A;  4EFD A;  3CZX A;  2PR8 A;  2ABZ A;  2CIJ A;  2B58 A;  3KQX A;  4IK2 A;  4DJL A;  2VBQ A;  1BPM A;  4E8O A;  2C6G A;  4R57 A;  4F0X A;  4ZGY B;  5LRK A;  4Z65 A;  2B4D B;  4I49 A;  1MJB A;  4MCR A;  1IOF A;  3EC4 A;  1B87 A;  1JQG A;  3D2M A;  5G1Z A;  3PB4 X;  6CPA A;  2GFQ A;  1AYE A;  4RN7 A;  4UCP A;  2EK9 A;  4OLL A;  4CYP A;  4XPD B;  3SI0 A;  5DWN A;  2B4B A;  3W6X A;  4KOS A;  4Y49 B;  3D7F A;  2ZW4 A;  1YX0 A;  3ISX A;  5CPA A;  4M6H A;  2OZG A;  2Q43 A;  4ONU A;  3F0A A;  3PB6 X;  4OAE A;  1IOI A;  4KOU A;  3IU2 A;  4MHY A;  3IGR A;  4MFK A;  4JLY A;  1IY7 A;  2DPS A;  2C6P A;  2EWB A;  2BL1 A;  1Y9W A;  4F9V A;  4OAD A;  5AG4 A;  4P10 A;  1M44 A;  1S3Z A;  4B12 A;  1YLO A;  1Q2D A;  3P2F A;  2JEV A;  4EVY A;  2PCU A;  3H5Z A;  1S60 A;  2ZEO A;  1WWZ A;  2J9A A;  2P6E A;  3FH4 A;  4U9Z A;  4MY3 A;  3WC6 A;  3GKR A;  1S7K A;  4KOR A;  1Z4E A;  4YWY A;  2KCW A;  2ZOF A;  4UEF A;  3TTH A;  4A39 A;  1N71 A;  2IL4 A;  4UBR A;  4FAI A;  1YW4 A;  4CAF A;  2YGW A;  3R9F A;  4CGP A;  2OOT A;  1IB1 E;  1I21 A;  3E0K A;  1VHE A;  2FE7 A;  4RUH A;  2PVV A;  4KSA A;  2WPX A;  3PEI A;  4MFP A;  1ZLH A;  1CPX A;  4NJR A;  5G20 A;  3VWD A;  3TO6 A;  3V38 A;  1AMP A;  5A28 A;  3SXN A;  4NXY A;  1A2Z A;  4PXD A;  4UIA A;  4H6Z A;  1XBU A;  3FEC A;  4CGO A;  5J1Q A;  4MMO A;  4UWI A;  2JBJ A;  3ISZ A;  1YK3 A;  3TCV A;  3K9U A;  2GE3 A;  4OC0 A;  2ZED A;  3D68 A;  3B3S A;  3NH5 A;  3SHP A;  3NH8 A;  5AG5 A;  4AVB A;  4MJ8 A;  1KUX A;  2IJZ A;  1XFO A;  2Z11 A;  3RAM A;  5CBM A;  4UF4 A;  4MFL A;  3TO7 A;  4B5O A;  4CPA A;  3FYN A;  3HUV A;  1TKH A;  4H6U A;  2PQ8 A;  3IU1 A;  1TF8 A;  2PIY A;  3GLJ A;  2C6C A;  2Y0M A;  4B6Z A;  3OWC A;  3T9Y A;  3FNC A;  4KOX A;  3IWE A;  5C88 A;  1F2P A;  2FVG A;  1M4G A;  2REE A;  1IYL A;  2FS5 A;  4CAX A;  2P0W A;  3PFO A;  5K8P A;  1Y7E A;  4CAV A;  2ZEG A;  4CAW A;  1TKJ A;  2I79 A;  2CF4 A;  2VZY A;  3P2H A;  3RBU A;  5LYF A;  1OZP A;  2V8D A;  2AFO A;  2PJ5 A;  3KKW A;  5LYL A;  5IX3 A;  4CYO A;  3DR6 A;  4MHN A;  1Y9K A;  1BAV A;  2QEC A;  4BMH A;  4QVT A;  3TC8 A;  4CS0 B;  1R3N A;  4ORF A;  2WUU A;  4MFJ A;  4MFZ A;  2PRB A;  4XNH B;  4NGS A;  5EC4 A;  4B13 A;  4A37 A;  2VQY A;  2D4P A;  4ZY0 A;  1KUV A;  1TXR A;  2DXQ A;  2F8H A;  4KOV A;  2DPT A;  4JZ0 A;  2GAN A;  2XEJ A;  4NJQ A;  1XMT A;  3CPA A;  2P6G A;  3IFE A;  4KVM E;  2DF5 A;  2PIZ A;  1VIX A;  2ZEP A;  4KS9 A;  1BO4 A;  1HEE A;  2HV2 A;  1YVK A;  2ZOG A;  4OC5 A;  3KGQ A;  1Z4R A;  2YNE A;  4JJX A;  5A27 A;  1H8L A;  1MK4 A;  2HUZ A;  1ELL P;  4KUA A;  1Z8L A;  2BUE A;  4YRH A;  4AG7 A;  2GLJ A;  3H8E A;  3FVL A;  3WT4 A;  5ISV A;  5K8O A;  2BO9 A;  5EMI A;  3I1U A;  3VAT A;  4CGM A;  4L89 A;  3JTK A;  1JWQ A;  1QST A;  4IF5 A;  1QSM A;  2WSA A;  4XPD C;  4OC1 A;  3TT2 A;  4H89 A;  4AG9 A;  2Z3M A;  2Q7B A;  2Q4Z A;  4Y49 C;  2GLF A;  4P4I A;  3KR5 A;  3CXQ A;  3K9T A;  3KL9 A;  4GS4 A;  3GIU A;  4NGN A;  2CTC A;  4OME A;  2ZEN A;  4TNU A;  4AB7 A;  2ZPA A;  4BBH A;  2ARH A;  2CNT A;  1HDU A;  3KZW A;  4OKO A;  2B5G A;  4MHD A;  1NSA A;  4PXB A;  4X2T A;  2XEI A;  1J4J A;  3BI1 A;  2PVW A;  1YLE A;  3IIB A;  4Q7A A;  5F09 A;  2AFS A;  2NSM A;  2PJA A;  1QSR A;  1IIC A;  2H5M A;  4JD6 A;  3GUX A;  2BCO A;  2QML A;  2J8N A;  4U9Y A;  3VAR A;  4B14 A;  4AVA A;  1IYK A;  1VHS A;  4CRZ B;  1S7N A;  4XPK A;  1DE4 C;  4R76 A;  2ZW7 A;  3W91 A;  1UWY A;  3B3V A;  4MCQ A;  3DNS A;  3KHZ A;  4ONW A;  2GU2 A;  4NF1 A;  1CPS A;  3PRT A;  3D7G A;  4F0Y A;  4PK2 A;  5ELY A;  3BXM A;  2CTB A;  2FL4 A;  2Q0Y A;  3QAH A;  4NGP A;  2RB7 A;  3CXP A;  3KR4 A;  4RS2 A;  3TX8 A;  2RC4 A;  4FWU A;  3DGV A;  5AG7 A;  3I3G A;  4P4J A;  1KZF A;  2Q4Y A;  1I1D A;  1Z9U A;  2PJ3 A;  3NE8 A;  1CBX A;  3MN8 A;  5H84 A;  3IWW A;  4KLW A;  3EY5 A;  2PJ1 A;  1NMT A;  3TE4 A;  1VHO A;  8CPA A;  3N5F A;  4AVC A;  3UY5 A;  1YW6 A;  2PJ4 A;  2I3C A;  2XEG A;  3FXT A;  3GY9 A;  4QUS A;  2J8M A;  2PRQ A;  1X10 A;  2FCK A;  2QVP A;  4E2A A;  2HQY A;  3RYO A;  2AFZ A;  4LQ6 A;  2V8V A;  4UCM A;  4UA3 A;  3KQZ A;  5AGE A;  4B5P A;  4P45 A;  5G21 A;  2BSW A;  5IV0 A;  1WK4 A;  3D3S A;  2EBJ A;  4TWE A;  4A94 A;  4F8Z A;  3B3C A;  3SXO A;  1ZLI A;  4ZX9 A;  2Q7S A;  2ODF A;  4C2Y A;  5D29 A;  1U6M A;  2CNM A;  4DNC A;  2FIW A;  1XEB A;  2B4D A;  5DS0 A;  4KOT A;  2EK8 A;  1TKF A;  4PK3 A;  1FY7 A;  3K2K A;  4ZY1 A;  2PJB A;  3BJ7 A;  5E96 A;  1XOV A;  4WWV A;  4MXU A;  3W6S A;  2ATR A;  2V77 A;  3PFE A;  4MRI A;  3JRU A;  4MHZ A;  2WZN A;  2WYR A;  1YVO A;  2I00 A;  2ZEM A;  2JLM A;  3FF3 A;  4MHP A;  4P4B A;  1NSL A;  4ZX8 A;  4KVO E;  3V7Z A;  2OH1 A;  3SI2 A;  5JM6 A;  4JXQ A;  1Q2C A;  2EO8 A;  4NEX A;  3LD2 A;  2R8V A;  4ZY2 A;  4KSI A;  4ZBG A;  3IEH A;  2JBK A;  4NCZ A;  3B3W A;  3PBB A;  4J3G A;  1XF8 A;  1ZG7 A;  4IHM A;  4MBU A;  4NGR A;  4UFX A;  3RZA A;  2ZEF A;  3CT9 A;  3B8G A;  3GYA A;  2CXA A;  1YSJ A;  4KSF A;  3GB0 A;  4B10 A;  5DWM A;  2QIR A;  1SQH A;  1XMB A;  3FIX A;  4U5Y A;  3C26 A;  4F9U A;  2IMO A;  4A38 A;  2EUI A;  2PR1 A;  4K3N A;  3D67 A;  4CYQ A;  3KI9 A;  2G9D A;  1XIX A;  5FVJ A;  5AG6 A;  1EE3 P;  3F8K A;  3CDX A;  1YGH A;  4KZT A;  3TOB A;  3WAB A;  1K4J A;  4X3R A;  4AXV A;  3LOD A;  1F57 A;  3VWE A;  3WC5 A;  1HDQ A;  2OR4 A;  1PCA A;  3HLP A;  2ZEL A;  1LAP A;  4W9Y A;  3WC7 A;  1Y7R A;  2PDO A;  2V8H A;  4QB9 A;  2GIV A;  1YME A;  4L8A A;  2AFW A;  1S7F A;  1CM0 A;  3S6H A;  3ZJ0 A;  2Z3L A;  3V8I A;  3QB8 A;  2POK A;  4HNX B;  4PQA A;  3SJX A;  3MRU A;  1MJ9 A;  1Z8T A;  3NH4 A;  1ZO0 A;  1YR0 A;  1CP7 A;  3FB3 A;  2A4N A;  3EXN A;  3FBU A;  4A95 A;  3A9L A;  4PV6 A;  1R57 A;  2ZW5 A;  5D8N A;  4FD5 A;  1FT7 A;  4QC6 A;  1Z2L A;  4R8F A;  5BWA B;  3TFY A;  2ZEE A;  2GRE A;  4FD4 A;  5JH9 A;  3EFA A;  4HPS A;  4OC2 A;  2HC9 A;  3CPX A;  3DR8 A;  1F2O A;  3SI1 A;  2G3A A;  4GXH A;  4YGO A;  4EWT A;  3D7H A;  5HVF A;  1LRZ A;  4UEZ A;  3LAC A;  4A31 A;  2Z3P A;  1XRY A;  1ARM A;  1LFW A;  5IB0 A;  3S6G A;  4F6A A;  4FUU A;  1IID A;  4C7I A;  1TF9 A;  1LAM A;  4C7H A;  2RFH A;  2Q04 A;  2FT0 A;  4JWP A;  1Z8W A;  4M85 A;  1GHE A;  4G1P A;  2C1C A;  1CG2 A; 
#chains in the Genus database with same CATH homology
 1S5K A;  3G3S A;  3D8P A;  4M3S A;  4QBJ A;  2OZU A;  1PU9 A;  4CRY B;  2BEI A;  3EO4 A;  1XE4 A;  2J8R A;  1MJA A;  3DSB A;  2ZXV A;  3FRM A;  4Q36 A;  4HNW B;  2CY2 A;  4C68 A;  3MGD A;  4PSX A;  1TIQ A;  4UFW A;  2YNC C;  4PSW A;  4KOY A;  4Q38 A;  4C2Z A;  1UFH A;  4HKF A;  2EVN A;  4A33 A;  1I12 A;  3TOA A;  4C2X A;  3R9G A;  4X5K A;  2FXF A;  2R7H A;  5J8F A;  2K5T A;  3H4Q A;  4A32 A;  3JUW A;  4R3K A;  3T90 A;  1B6B A;  4A2Z A;  2Q4V A;  3I9S A;  3IWG A;  2Z0Z A;  1M1D A;  2B3U A;  4FD6 A;  4A30 A;  2JDC A;  4RI1 A;  4YFJ A;  1S7L A;  4LUA A;  2FIA A;  2VZZ A;  4CGL A;  1QSO A;  3CXS A;  5F47 A;  3TO9 A;  2G0B A;  3G8W A;  4XNH C;  4UCN A;  4HNY B;  4R87 A;  5F49 A;  4NSQ A;  4IUS A;  2Q44 A;  5CNP A;  4R9M A;  3ZZI A;  5C82 A;  2PSW A;  2Z10 A;  2YND A;  4CGN A;  2B3V A;  2WPW A;  3R1K A;  2JDD A;  2CNS A;  3R96 A;  4CAE A;  3BLN A;  4KLV A;  3F5B A;  5KTD A;  5EBV A;  4KOW A;  4JXR A;  3PGP A;  4R3L A;  4K30 A;  5I0C A;  2D4O A;  2ZW6 A;  5F46 A;  2OZH A;  4LX9 A;  2REF A;  1ON0 A;  4FD7 A;  4E0A A;  2VI7 A;  2YNC A;  5H86 A;  2F5I A;  2Z3N A;  3DDD A;  2B5G B;  1QSN A;  2C27 A;  2AE6 A;  2Z3O A;  3S6K A;  1M4D A;  2AJ6 A;  1M4I A;  3PZJ A;  4KVX A;  1KUY A;  2R98 A;  3BJ8 A;  2O28 A;  4MY0 A;  2X7B A;  5KTC A;  4UFV A;  4MFQ A;  3WR7 A;  4XPL A;  3S6F A;  1P4N A;  2OB0 A;  5JPH A;  2R1I A;  1PUA A;  5JQ4 A;  5HMN A;  3D2P A;  3JVN A;  4B11 A;  5KTA A;  5J8C A;  1CJW A;  1Q2Y A;  1P0H A;  1RXT A;  5GCN A;  5G22 A;  4KUB A;  3R9E A;  2OU2 A;  1L0C A;  3N7Z A;  3R95 A;  2VEZ A;  1BOB A;  3NE7 A;  1RO5 A;  2Z3K A;  2G3T A;  5F48 A;  1V0C A;  4MI4 A;  4II9 A;  2PC1 A;  4CYN A;  2NMT A;  2VXK A;  1VKC A;  2P6F A;  2FSR A;  4UWJ A;  4B5P B;  1NE9 A;  3PP9 A;  5HH1 A;  1YRE A;  2PR8 A;  2B58 A;  2VBQ A;  4E8O A;  4R57 A;  4F0X A;  4ZGY B;  2B4D B;  4I49 A;  1MJB A;  3EC4 A;  1B87 A;  3D2M A;  5G1Z A;  4UCP A;  4OLL A;  4CYP A;  4XPD B;  5DWN A;  2B4B A;  3W6X A;  4KOS A;  4Y49 B;  2ZW4 A;  1YX0 A;  2OZG A;  4ONU A;  3F0A A;  4OAE A;  4KOU A;  3IU2 A;  3IGR A;  4MFK A;  4JLY A;  2DPS A;  2BL1 A;  1Y9W A;  4OAD A;  5AG4 A;  1M44 A;  1S3Z A;  4B12 A;  3P2F A;  1Q2D A;  4EVY A;  2JEV A;  3H5Z A;  1S60 A;  1WWZ A;  2P6E A;  4U9Z A;  4MY3 A;  3GKR A;  1S7K A;  4KOR A;  1Z4E A;  2KCW A;  3TTH A;  1N71 A;  2IL4 A;  4UBR A;  4CAF A;  2YGW A;  3R9F A;  4CGP A;  1IB1 E;  1I21 A;  3E0K A;  2FE7 A;  4KSA A;  2WPX A;  4MFP A;  3VWD A;  5G20 A;  3TO6 A;  5A28 A;  3SXN A;  4NXY A;  4H6Z A;  4UWI A;  1YK3 A;  3TCV A;  3K9U A;  2GE3 A;  3SHP A;  5AG5 A;  4AVB A;  4MJ8 A;  1KUX A;  2Z11 A;  4MFL A;  3TO7 A;  4B5O A;  3FYN A;  4H6U A;  2PQ8 A;  3IU1 A;  2Y0M A;  3OWC A;  3T9Y A;  3FNC A;  4KOX A;  3IWE A;  5C88 A;  2REE A;  1M4G A;  1IYL A;  2FS5 A;  4CAX A;  2P0W A;  4CAV A;  4CAW A;  2I79 A;  2VZY A;  3P2H A;  1OZP A;  3KKW A;  5IX3 A;  4CYO A;  3DR6 A;  1Y9K A;  2QEC A;  4BMH A;  4QVT A;  4CS0 B;  4ORF A;  2WUU A;  4MFJ A;  4MFZ A;  2PRB A;  4XNH B;  5EC4 A;  4B13 A;  2VQY A;  2D4P A;  1KUV A;  2DXQ A;  4KOV A;  2DPT A;  2GAN A;  1XMT A;  2P6G A;  4KVM E;  4KS9 A;  1BO4 A;  2HV2 A;  1YVK A;  4JJX A;  1Z4R A;  2YNE A;  5A27 A;  1MK4 A;  2HUZ A;  4KUA A;  4YRH A;  2BUE A;  4AG7 A;  5ISV A;  4CGM A;  4L89 A;  3JTK A;  1QST A;  4IF5 A;  4XPD C;  1QSM A;  2WSA A;  3TT2 A;  4H89 A;  4AG9 A;  2Z3M A;  2Q7B A;  4Y49 C;  3CXQ A;  4GS4 A;  4AB7 A;  2ZPA A;  4BBH A;  2ARH A;  2CNT A;  2B5G A;  4MHD A;  1J4J A;  1YLE A;  1QSR A;  1IIC A;  2H5M A;  4JD6 A;  2QML A;  2J8N A;  4U9Y A;  4B14 A;  4AVA A;  1IYK A;  1VHS A;  4CRZ B;  1S7N A;  4XPK A;  2ZW7 A;  3W91 A;  3DNS A;  4NF1 A;  4F0Y A;  4PK2 A;  3QAH A;  2FL4 A;  2Q0Y A;  3CXP A;  4RS2 A;  2RC4 A;  5AG7 A;  3I3G A;  1KZF A;  2Q4Y A;  1I1D A;  1Z9U A;  5H84 A;  4KLW A;  3EY5 A;  1NMT A;  3TE4 A;  4AVC A;  3UY5 A;  3FXT A;  3GY9 A;  4QUS A;  2J8M A;  2FCK A;  4E2A A;  2HQY A;  3RYO A;  4UCM A;  4UA3 A;  5AGE A;  4B5P A;  5G21 A;  2BSW A;  5IV0 A;  1WK4 A;  3D3S A;  3SXO A;  4C2Y A;  1U6M A;  2CNM A;  4DNC A;  2FIW A;  1XEB A;  2B4D A;  4KOT A;  4PK3 A;  1FY7 A;  3BJ7 A;  5E96 A;  3W6S A;  2ATR A;  1YVO A;  2I00 A;  1NSL A;  2JLM A;  4KVO E;  2OH1 A;  4JXQ A;  1Q2C A;  4NEX A;  3LD2 A;  2R8V A;  4ZBG A;  4NCZ A;  4J3G A;  1XF8 A;  4UFX A;  4MBU A;  3B8G A;  3GYA A;  2CXA A;  4KSF A;  4B10 A;  5DWM A;  2QIR A;  1SQH A;  3FIX A;  4U5Y A;  3C26 A;  4CYQ A;  2EUI A;  2PR1 A;  1XIX A;  5FVJ A;  5AG6 A;  3F8K A;  4KZT A;  1YGH A;  3TOB A;  1K4J A;  3LOD A;  3VWE A;  1Y7R A;  2PDO A;  4QB9 A;  2GIV A;  4L8A A;  1S7F A;  1CM0 A;  3S6H A;  3ZJ0 A;  2Z3L A;  3V8I A;  3QB8 A;  4HNX B;  1MJ9 A;  1ZO0 A;  1YR0 A;  3FB3 A;  2A4N A;  3EXN A;  3FBU A;  4A95 A;  3A9L A;  4PV6 A;  1R57 A;  2ZW5 A;  4FD5 A;  4QC6 A;  5BWA B;  3TFY A;  4FD4 A;  3EFA A;  3DR8 A;  2G3A A;  4YGO A;  1LRZ A;  4A31 A;  2Z3P A;  5IB0 A;  3S6G A;  4F6A A;  1IID A;  4C7I A;  4C7H A;  2Q04 A;  2FT0 A;  4JWP A;  4M85 A;  1GHE A;  4CGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...