2AE6A

Crystal structure of acetyltransferase of gnat family from enterococcus faecalis v583
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
161
structure length
148
Chain Sequence
MSTSLTIRLVAEADWPALHALDQIISLAAYQEKMKDETIFVAISGQQLAGFIEVHPPTSLAAHQKQWLLSIGVSPDFQDQGIGGSLLSYIKDMAEISGIHKLSLRVMATNQEAIRFYEKHGFVQEAHFKEEFYINGHYCDDYQYAYFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acetyltransferase, GNAT family
publication title Crystal Structure of Acetyltransferase of GNAT family from Enterococcus faecalis V583
rcsb
source organism Enterococcus faecalis
molecule tags Transferase
total genus 33
structure length 148
sequence length 161
chains with identical sequence B, C, D
ec nomenclature ec 2.3.-.-:
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2ae6A00
2PDOA 4JWPA 3GYAA 5CNPA 3EC4A 4XPKA 2VEZA 4ONUA 2I79A 4NXYA 4MY0A 4KOTA 2GANA 2PRBA 1M1DA 3CXSA 1QSOA 4PK2A 3R9EA 2B3UA 4H6UA 4KUAA 1Z9UA 4YGOA 2BL1A 4FD7A 4EVYA 1MJ9A 2FT0A 1XIXA 1NMTA 2WPWA 3OWCA 2FL4A 3EY5A 3K9UA 3D3SA 1IB1E 3PZJA 4MJ8A 3P2FA 4PSWA 1PUAA 2EVNA 2CNMA 1B87A 3EXNA 3R95A 4JD6A 1YLEA 2F5IA 3D8PA 3WR7A 3R9FA 2ATRA 3TO6A 4R9MA 3FBUA 5J8CA 1Q2YA 3R1KA 5DWNA 1S7FA 3TOAA 4CRZB 3GY9A 4OADA 4HNXB 3PGPA 1RXTA 2AJ6A 4M85A 3TE4A 1Q2DA 2WPXA 2PSWA 3R96A 4YFJA 4CS0B 3VWDA 5IB0A 1QSTA 3I3GA 3H4QA 2VXKA 4XPLA 4NEXA 4MBUA 4IF5A 2D4OA 2GIVA 2B5GB 4AVAA 1MJAA 2KCWA 1BO4A 4DNCA 4E0AA 1RO5A 4QB9A 4KOWA 1IYKA 5EC4A 3S6HA 2R1IA 2P0WA 4U5YA 1YR0A 1ON0A 3V8IA 2PR1A 2G0BA 3JUWA 1YGHA 2A4NA 3FNCA 2B5GA 2BSWA 1MJBA 2REFA 4XNHC 4F0YA 1S7LA 3S6KA 4KVXA 4UBRA 4Y49C 1P4NA 4CAWA 2O28A 3LD2A 1TIQA 1S5KA 5EBVA 3D2PA 3W91A 5C82A 1K4JA 1I1DA 3C26A 5IV0A 5JQ4A 1WK4A 1BOBA 2FE7A 3ZJ0A 1QSMA 2PC1A 4KORA 1Z4EA 5HMNA 1GHEA 4ZBGA 3DNSA 1FY7A 3G8WA 1M4IA 2B4DB 2CY2A 2OH1A 4NCZA 4XPDB 4MHDA 2P6FA 4R87A 2R7HA 3IWGA 4IUSA 2BEIA 2FS5A 2QMLA 1XE4A 3F8KA 4XPDC 5J8FA 2B4DA 2JDCA 2B58A 3SXOA 3FB3A 1Q2CA 1YREA 2OB0A 2DXQA 2ZW6A 4CRYB 3DR6A 3FRMA 4UWJA 1Y9WA 1QSRA 4QVTA 1Z4RA 4AVCA 4OAEA 2NMTA 3KKWA 4JXRA 2EUIA 1KUYA 4JLYA 3TO9A 4UWIA 4NSQA 4L8AA 3TT2A 2B4BA 1M44A 1CJWA 4R57A 1PU9A 5KTAA 3DR8A 4HNYB 3IGRA 1IYLA 4NF1A 2R8VA 4E2AA 2J8RA 2OZGA 3SHPA 5DWMA 4X5KA 3TTHA 2ZW4A 2B3VA 2VQYA 4U9ZA 1IIDA 4QBJA 5IX3A 4KOYA 4PK3A 4KZTA 3TOBA 2FIWA 1P0HA 2Z0ZA 1WWZA 3CXPA 3TFYA 5ISVA 3FYNA 4HNWB 4XNHB 2CNSA 1LRZA 2FIAA 1S60A 5F46A 1B6BA 4M3SA 4Y49B 1L0CA 4LX9A 1OZPA 2IL4A 2REEA 1S7NA 1U6MA 1YVOA 3F5BA 4AG9A 3TO7A 1KUXA 2K5TA 3ZZIA 1XEBA 2VBQA 4PSXA 2C27A 4YRHA 3D2MA 2HQYA 2OZUA 2VZZA 5HH1A 2CNTA 2BUEA 3DSBA 4OLLA 3QB8A 3F0AA 2PQ8A 4LUAA 1NSLA 3VWEA 1I12A 4F6AA 2OZHA 2Q4VA 4KOUA 4AB7A 4FD5A 2Q4YA 4I49A 1UFHA 4H89A 3N7ZA 1YK3A 2AE6A 2ZW5A 2VZYA 1I21A 4KVME 1YVKA 3G3SA 4JXQA 4KLWA 1SQHA 1Y9KA 2FCKA 4GS4A 1VHSA 4R3LA 1XF8A 3TCVA 5FVJA 5C88A 5KTCA 2QECA 4L89A 1YX0A 5KTDA 3QAHA 3T9YA 4FD6A 3SXNA 4BMHA 2HUZA 3BJ7A 2Y0MA 2QIRA 3W6SA 4RI1A 4AVBA 3I9SA 4II9A 3P2HA 1S3ZA 3NE7A 2ARHA 2Q04A 3EFAA 4B5PB 3E0KA 2X7BA 2ZXVA 5I0CA 5F48A 4CAVA 3T90A 2R98A 2JLMA 3W6XA 2PR8A 1XMTA 4JJXA 2OU2A 1M4GA 1KUVA 1CM0A 1QSNA 1N71A 2Z10A 3GKRA 4KLVA 2ZW7A 2Q44A 1J4JA 4CAXA 3CXQA 5F47A 4B5PA 5F49A 4QUSA 2D4PA 4UA3A 4KUBA 2G3AA 4J3GA 1M4DA 5H84A 3R9GA 2J8NA 3S6GA 4KOVA 2GE3A 3B8GA 2JEVA 4R3KA 2HV2A 1IICA 3FIXA 3BJ8A 4KOSA 3FXTA 2G3TA 2I00A 3LODA 2J8MA 3RYOA 4KVOE 1S7KA 4ORFA 2VI7A 5E96A 1KZFA 1R57A 2ZPAA 5JPHA 3S6FA 4H6ZA 4KOXA 2RC4A 5GCNA 3BLNA 4E8OA 2Z11A 2FSRA 4RS2A 2JDDA 3JVNA 4MY3A 2P6GA 4K30A 2Q7BA 2P6EA 2H5MA 4MI4A 1V0CA 4PV6A 4U9YA 3PP9A 4B5OA 4AG7A 3DDDA 3EO4A 1MK4A 4QC6A 2FXFA 3UY5A 4FD4A 4HKFA 1NE9A 1Y7RA 1VKCA 3MGDA 2Q0YA 5H86A
chains in the Genus database with same CATH superfamily
4KSIA 2PDOA 4JWPA 2QJ8A 3SI1A 3KL9A 3RAMA 4ZY2A 3GYAA 5CNPA 3EC4A 4XPKA 4X8IA 4A31A 2VEZA 4ONUA 2PJ4A 2I79A 5LRGA 4NXYA 4MY0A 1XJOA 2AFSA 1TF8A 2I3CA 3NH8A 4KOTA 3CZXA 1EE3P 2GANA 3S9LA 4ZY1A 2PRBA 1M1DA 1H8LA 3B3SA 2Z3KA 1ZLIA 1FNOA 2BCOA 1QSOA 3CXSA 4PK2A 1PCAA 3R9EA 2B3UA 4H6UA 2PE3A 5AG4A 3BXMA 4KUAA 1Z9UA 4C7IA 4WJBA 4MMOA 2Z3NA 4WWVA 4YGOA 2BL1A 2IQ6A 4CGMA 4FD7A 2ZEEA 3FVLA 3PB7X 2PJ5A 4EVYA 1MJ9A 2FT0A 1IY7A 1XIXA 2AFZA 1NMTA 5DS0A 2WPWA 3SJFA 3NE8A 3OWCA 3IU1A 2FL4A 1ZG9A 3EY5A 2POKA 3GLJA 5CBMA 3K9UA 3D3SA 1IB1E 3PZJA 4MJ8A 4MFPA 5G21A 3P2FA 4MCPA 4PSWA 3V38A 4CPAA 1PUAA 2OR4A 2EVNA 2JBJA 2CNMA 4OC3A 3N5FA 1B87A 3A9LA 3EXNA 3R95A 3KQXA 4R6TA 4JD6A 1YLEA 2F5IA 3D8PA 4CAEA 1NSAA 3R9FA 3WR7A 4A33A 2ATRA 2VL1A 4A37A 3TO6A 4DUKA 1M4LA 2XEFA 3FBUA 4R9MA 5J8CA 1Q2YA 3R1KA 4PPZA 5DWNA 1S7FA 5JGFA 3H8FA 3TOAA 3D7FA 3KZWA 4CRZB 1UWYA 3GY9A 2V77A 4NGRA 4OADA 5LRKA 3T8WA 4P6YA 4B12A 4HNXB 4JZ0A 2QVPA 3PGPA 4MFQA 1RXTA 2AJ6A 4IK2A 4M85A 3D4UA 1PYTB 3TE4A 1HDQA 3FMCA 4RUHA 4ZI6A 4A38A 2FVGA 2O4HA 1Q2DA 2WPXA 1BAVA 2PSWA 1F2OA 3R96A 4MCRA 4CS0B 4YFJA 3VWDA 2PJ9A 5LYDA 5IB0A 1ARMA 5I4MA 1QSTA 3I3GA 3H4QA 4EFDA 1Z8LA 3B3CA 2YNDA 2VXKA 4XPLA 4F8ZA 5LYFA 4NEXA 4C2ZA 4Z65A 4MBUA 4TNUA 4PXBA 4IF5A 2BOAA 1YW6A 2CTCA 2CIJA 2D4OA 3B3TA 2GIVA 2B5GB 4CYNA 4AVAA 4CGLA 1YW4A 1QQ9A 4JYWA 1ELLP 3S9NA 1MJAA 2KCWA 4O23A 1TKHA 4MFJA 3BI0A 1BO4A 2XEIA 1LCPA 4DNCA 4E0AA 1RO5A 4G1PA 4QB9A 3D7DA 4KOWA 1IYKA 5EC4A 3S9MA 1GYTA 2CXAA 4YU9A 2YGWA 3S6HA 1TXRA 2R1IA 3D67A 2ZEDA 2P0WA 2GU2A 4U5YA 1CG2A 5AG5A 1RTQA 4EWTA 2WYRA 1LAPA 3B2YA 1YR0A 1ON0A 2OOTA 3V8IA 4B13A 5K8NA 1AMPA 3FH4A 3IEHA 1IOIA 2PR1A 2G0BA 4OMEA 2IJZA 3JUWA 4OC4A 4CGNA 1YGHA 2A4NA 3FNCA 3FEDA 2B5GA 3I1UA 2BSWA 1MJBA 2REFA 4R76A 4XNHC 2AFXA 2IMOA 2PJ6A 3SI2A 1VHOA 3FECA 4A94A 4F0YA 1S7LA 2YNCC 3S6KA 1YSJA 4KVXA 4UBRA 4Y49C 1P4NA 4ZX9A 4PXCA 4CAWA 2CF4A 2O28A 3LD2A 3VARA 1TIQA 1S5KA 4GXHA 3QAYA 2Q7SA 5LYLA 3K2KA 4FUUA 5EMIA 4CYPA 5K8PA 2AFOA 5EBVA 5D8NA 4ZX8A 3D2PA 3W91A 5C82A 1K4JA 1I1DA 1ZG8A 3C26A 5IV0A 5JQ4A 1WK4A 3IWWA 4R7MA 5HVGA 5AGEA 3GIUA 4B6ZA 1BOBA 2FE7A 1AUGA 2Z3OA 1BPNA 2PJBA 3ZJ0A 1JWQA 1QSMA 2PC1A 4KORA 1Z4EA 5HMNA 1BPMA 1GHEA 4ZBGA 4UCMA 4OC5A 1DE4C 1XOVA 3LWUA 3DNSA 3IFEA 1FY7A 4F9UA 3G8WA 1R43A 1M4IA 2B4DB 2CY2A 4CYQA 2OH1A 2EK9A 4NCZA 4UCNA 1ZG7A 4MHPA 4MHDA 4XPDB 4NGQA 4CAFA 3CPAA 2PJ2A 5G1ZA 3SI0A 2P6FA 4R87A 2R7HA 5A27A 2Q43A 2Z3PA 1VIXA 4ONWA 3IWGA 2ZELA 1YQEA 4UF4A 2ZEGA 4IUSA 2V8HA 2BEIA 2FS5A 2QMLA 4NGNA 1XE4A 4A32A 1Y0RA 3F8KA 2JBKA 2PJ1A 2J9AA 3QNVA 4XPDC 1XRYA 3VH9A 5J8FA 2B4DA 2JDCA 2B58A 4P4BA 4ZGYB 3IJ3A 3SXOA 3FB3A 5HVHA 5K8OA 1Q2CA 1YREA 2OB0A 2DXQA 2ZW6A 5BWAB 7CPAA 4HPSA 5CPAA 3DR6A 4CRYB 1Z2LA 3FRMA 1QSRA 1Y9WA 3B3WA 2C1CA 4MCSA 1Z4RA 4QVTA 4UCPA 4AVCA 4OAEA 4UFWA 4NGPA 2NMTA 3JRUA 3KKWA 4JXRA 5G22A 3PB8X 2EUIA 4PXEA 1KUYA 4JLYA 1IU8A 4M6IA 4UFVA 3TO9A 1HEEA 2C6PA 4UWIA 1YLOA 4NSQA 4DYOA 3VATA 3PBEA 2EO8A 4F9VA 4L8AA 1ZLHA 2PJ0A 4P4IA 3SJGA 3TT2A 3KGQA 3ISXA 2B4BA 1HDUA 4NJQA 1M44A 1CJWA 4R57A 1PU9A 5KTAA 1LFWA 2O53A 3DR8A 4HNYB 3KHXA 3IGRA 1IYLA 3PEIA 2PJ8A 4P4DA 3FX6A 2R8VA 1CP6A 4NF1A 2J8RA 4E2AA 4KS9A 2OZGA 3KR5A 3PRTA 4OP4A 3SHPA 1JQGA 4DJLA 1AYEA 3KR4A 5DWMA 3LMSA 4NGMA 4X5KA 3JTKA 2ZW4A 3TTHA 2B3VA 3RO0A 2VQYA 1DTDA 4U9ZA 4IAVA 1IIDA 5ELYA 4P4FA 2Z3LA 4QBJA 5IX3A 1IOFA 3B35A 4KOYA 4PK3A 4KZTA 3RZAA 3TOBA 2FIWA 1P0HA 2Z0ZA 4P4JA 1WWZA 3CXPA 3TFYA 4RN7A 5ISVA 3FYNA 4HNWB 4XNHB 2CNSA 1LRZA 2FIAA 1S60A 1BLLE 4UFXA 1B6BA 4M3SA 5F46A 4P10A 5AG7A 2DPSA 4OIWA 4Y49B 4BBHA 4X2TA 1L0CA 1TF9A 4P4EA 3TC8A 4A95A 4LX9A 2V8VA 1OZPA 2IL4A 3D7GA 2REEA 2HB6A 1ELMP 2V8GA 4NJRA 3ISZA 1S7NA 1U6MA 3NA6A 1YVOA 4CGPA 3F5BA 4UWJA 4AG9A 3TO7A 1KUXA 2K5TA 3ZZIA 1XEBA 2VBQA 4PSXA 3FJUA 4FBEA 4B14A 2ZEPA 2C27A 1CPXA 2GLFA 3B7IA 6CPAA 1XMBA 4OIDA 2PJAA 4OKOA 1LOKA 3D2MA 2ZEHA 4YRHA 2HQYA 2OZUA 4Q7AA 2VZZA 2YNCA 5HH1A 4C7HA 2CNTA 4K3NA 2BUEA 4CGOA 3FEEA 2DF5A 2PVWA 3DSBA 4YWYA 4OLLA 4EMEA 3QB8A 3F0AA 4LQ6A 4W9YA 1ARLA 2PJCA 1LANA 2PQ8A 3MRUA 4LUAA 4MCQA 1NSLA 3VWEA 3CT9A 1I12A 4MFZA 4KSAA 4F6AA 2OZHA 4KSFA 3B3VA 2Q4VA 4OC1A 5HXDA 4P44A 2PIYA 3GB0A 2CTBA 4KOUA 1CX8A 4Q38A 3WT4A 4AB7A 4FD5A 3SJEA 2Q4YA 1CP7A 1VHEA 4H2KA 1Z8XA 3TX8A 3IIBA 4I49A 1UFHA 1LAMA 4H89A 2JEWA 3N7ZA 1YK3A 2AE6A 2RFHA 2VZYA 1I21A 1YVKA 2ZW5A 3G3SA 3NH5A 4JXQA 4KVME 3V7ZA 4KLWA 4FAIA 1SQHA 3H5ZA 4OC0A 4FWUA 5A28A 1Y9KA 3RNZA 2Q4ZA 5F09A 2ANPA 3IC1A 2FCKA 4GS4A 4C68A 2PCUA 1VHSA 4R3LA 8CPAA 1F2PA 1Y7EA 1TKFA 1XF8A 2Z3MA 4MHNA 3IO1A 2WUUA 2XEGA 3FF3A 3TCVA 5FVJA 5LYIA 4ZYQA 5C88A 1X12A 5KTCA 1R3NA 2QECA 4L89A 4R8FA 2GLJA 2EWBA 1YX0A 5KTDA 2NYQA 3QAHA 2PRQA 5AG6A 4FD6A 4UEZA 3T9YA 3SXNA 3H8EA 4BMHA 2HUZA 3LACA 3BJ7A 3RBUA 4X3RA 2Y0MA 2QIRA 3PB4X 4B10A 3W6SA 2F7VA 4RI1A 4AVBA 5D29A 2PJ3A 3I9SA 2AFWA 4F0XA 4II9A 4BD9A 3CDXA 4UIBA 1FT7A 1X10A 2PIZA 3P2HA 1S3ZA 2GFQA 2Q0YA 3NE7A 5THWA 2ARHA 2AFMA 2Q04A 3BHXA 4M6HA 3D68A 3EFAA 2PJ7A 4B5PB 1IGBA 2ODFA 3E0KA 4ZY0A 2X7BA 2ZXVA 5I0CA 1TKJA 2ZOFA 1KWMA 5F48A 4CAVA 3T90A 2ZEOA 3WC5A 2EK8A 2JLMA 2R98A 4M6GA 4UEFA 5IB9A 3W6XA 2PR8A 1XMTA 4JJXA 1XFOA 1A2ZA 2OU2A 3CPXA 1M4GA 3WABA 1Z8TA 1KUVA 2WZNA 1CM0A 1QSNA 1N71A 2BO9A 2Z10A 3GKRA 3DGVA 4IHMA 3WC6A 2XEJA 4KLVA 2ZW7A 2Q44A 3PFEA 1J4JA 2NSMA 4CAXA 4B11A 3CXQA 5F47A 4B5PA 5F49A 4MXUA 2DEAA 4QUSA 3D7HA 1OBRA 4OC2A 5JM6A 2D4PA 3MN8A 3PFOA 4UA3A 2AFUA 4KUBA 3GUXA 3PBBA 2G3AA 2C6GA 1Z5RA 4UEEA 4J3GA 1M4DA 5H84A 2F8HA 2ZEFA 3R9GA 2EBJA 2J8NA 4MRIA 3WC7A 4MHYA 4C2XA 3S6GA 4A2ZA 4KOVA 2GE3A 3B8GA 2JEVA 3K9TA 4R3KA 1VGYA 3NH4A 1YMEA 2HV2A 4BINA 2PVVA 2C6CA 2ZOGA 3BI1A 2ZENA 1IICA 3FIXA 3BJ8A 3IU2A 4KOSA 4MHZA 2DPTA 1CBXA 3FXTA 3HLPA 4GM5A 4PXDA 4Q36A 2G9DA 5JH9A 2HC9A 2G3TA 2I00A 5G20A 3KI9A 1CPSA 3LODA 2GREA 2WSAA 3NFZA 4LQGA 4C2YA 4A39A 5K8MA 2J8MA 4P45A 5LRJA 3KHZA 2Q51A 4MFKA 3DLJA 4KVOE 3RYOA 1S7KA 4ORFA 2QYVA 2VI7A 5E96A 3IWEA 1KZFA 1R57A 2ZPAA 5JPHA 3S6FA 4H6ZA 4PQAA 4KOXA 2RC4A 5GCNA 2RB7A 3BLNA 3D66A 4E8OA 1Z8WA 2Z11A 2FSRA 5J1QA 4RS2A 2JDDA 3JVNA 4MY3A 2P6GA 4K30A 2YNEA 2Q7BA 2P6EA 2H5MA 4MI4A 1V0CA 4PV6A 1XBUA 4MFLA 4U9YA 2ZEMA 3PP9A 4B5OA 3HUVA 4AG7A 4UIAA 4NFRA 3DDDA 3EO4A 4A30A 1MK4A 4QC6A 1Y0YA 5HVFA 2FXFA 3PB9X 4TWEA 3UY5A 3PB6X 4CYOA 4NGSA 3SJXA 4FD4A 4HKFA 4NGTA 3H8GA 3L2NA 1NE9A 4AXVA 1Y7RA 2ABZA 3KQZA 3KASA 1VKCA 3MGDA 1F57A 1ZO0A 1Q7LA 2V8DA 1QMUA 5H86A
chains in the Genus database with same CATH topology
2PDOA 4JWPA 3GYAA 5CNPA 3EC4A 4XPKA 4A31A 2VEZA 4ONUA 2I79A 4NXYA 4MY0A 4KOTA 2GANA 2PRBA 1M1DA 2Z3KA 3CXSA 1QSOA 4PK2A 3R9EA 2B3UA 4H6UA 5AG4A 4KUAA 1Z9UA 4C7IA 2Z3NA 4YGOA 2BL1A 4CGMA 4FD7A 4EVYA 1MJ9A 2FT0A 1XIXA 1NMTA 2WPWA 3OWCA 3IU1A 2FL4A 3EY5A 3K9UA 3D3SA 1IB1E 3PZJA 4MJ8A 4MFPA 5G21A 3P2FA 4PSWA 1PUAA 2EVNA 2CNMA 1B87A 3A9LA 3EXNA 3R95A 4JD6A 1YLEA 2F5IA 3D8PA 4CAEA 3WR7A 3R9FA 4A33A 2ATRA 3TO6A 4R9MA 3FBUA 5J8CA 1Q2YA 3R1KA 5DWNA 1S7FA 3TOAA 4CRZB 3GY9A 4OADA 4B12A 4HNXB 3PGPA 4MFQA 1RXTA 2AJ6A 4M85A 3TE4A 1Q2DA 2WPXA 2PSWA 3R96A 4YFJA 4CS0B 3VWDA 5IB0A 1QSTA 3I3GA 3H4QA 2YNDA 2VXKA 4XPLA 4NEXA 4C2ZA 4MBUA 4IF5A 2D4OA 2GIVA 2B5GB 4CYNA 4AVAA 4CGLA 1MJAA 2KCWA 4MFJA 1BO4A 4DNCA 4E0AA 1RO5A 4QB9A 4KOWA 1IYKA 5EC4A 2CXAA 2YGWA 3S6HA 2R1IA 2P0WA 4U5YA 5AG5A 1YR0A 1ON0A 3V8IA 4B13A 2PR1A 2G0BA 3JUWA 4CGNA 1YGHA 2A4NA 3FNCA 2B5GA 2BSWA 1MJBA 2REFA 4XNHC 4F0YA 1S7LA 2YNCC 3S6KA 4KVXA 4UBRA 4Y49C 1P4NA 4CAWA 2O28A 3LD2A 1TIQA 1S5KA 4CYPA 5EBVA 3D2PA 3W91A 5C82A 1K4JA 1I1DA 3C26A 5IV0A 5JQ4A 1WK4A 5AGEA 1BOBA 2FE7A 2Z3OA 3ZJ0A 1QSMA 2PC1A 4KORA 1Z4EA 5HMNA 1GHEA 4ZBGA 4UCMA 3DNSA 1FY7A 3G8WA 1M4IA 2B4DB 2CY2A 4CYQA 2OH1A 4NCZA 4UCNA 4XPDB 4MHDA 4CAFA 5G1ZA 2P6FA 4R87A 2R7HA 5A27A 2Z3PA 3IWGA 4IUSA 2BEIA 2FS5A 2QMLA 1XE4A 4A32A 3F8KA 4XPDC 5J8FA 2B4DA 2JDCA 2B58A 4ZGYB 3SXOA 3FB3A 1Q2CA 1YREA 2OB0A 2DXQA 2ZW6A 5BWAB 4CRYB 3DR6A 3FRMA 4UWJA 1Y9WA 1QSRA 4QVTA 4UCPA 1Z4RA 4AVCA 4OAEA 4UFWA 2NMTA 3KKWA 4JXRA 5G22A 2EUIA 1KUYA 4JLYA 4UFVA 3TO9A 4UWIA 4NSQA 4L8AA 3TT2A 2B4BA 1M44A 1CJWA 4R57A 1PU9A 5KTAA 3DR8A 4HNYB 3IGRA 1IYLA 4NF1A 2R8VA 4E2AA 2J8RA 4KS9A 2OZGA 3SHPA 5DWMA 4X5KA 3TTHA 3JTKA 2ZW4A 2B3VA 2VQYA 4U9ZA 1IIDA 2Z3LA 4QBJA 5IX3A 4KOYA 4PK3A 4KZTA 3TOBA 2FIWA 1P0HA 2Z0ZA 1WWZA 3CXPA 3TFYA 5ISVA 3FYNA 4HNWB 4XNHB 2CNSA 1LRZA 2FIAA 1S60A 4UFXA 5F46A 1B6BA 4M3SA 5AG7A 2DPSA 4Y49B 4BBHA 1L0CA 4A95A 4LX9A 1OZPA 2IL4A 2REEA 1S7NA 1U6MA 4CGPA 1YVOA 3F5BA 4AG9A 3TO7A 1KUXA 2K5TA 3ZZIA 1XEBA 2VBQA 4PSXA 4B14A 2C27A 4YRHA 3D2MA 2HQYA 2OZUA 4C7HA 2VZZA 2YNCA 5HH1A 2CNTA 2BUEA 4CGOA 3DSBA 4OLLA 3QB8A 3F0AA 2PQ8A 4LUAA 1NSLA 3VWEA 1I12A 4MFZA 4KSAA 4F6AA 2OZHA 4KSFA 2Q4VA 4KOUA 4Q38A 4AB7A 4FD5A 2Q4YA 4I49A 1UFHA 4H89A 3N7ZA 1YK3A 2AE6A 2ZW5A 2VZYA 1I21A 1YVKA 3G3SA 4JXQA 4KVME 4KLWA 1SQHA 3H5ZA 5A28A 1Y9KA 2FCKA 4GS4A 4C68A 1VHSA 4R3LA 1XF8A 2Z3MA 2WUUA 3TCVA 5FVJA 5C88A 5KTCA 2QECA 4L89A 1YX0A 5KTDA 3QAHA 5AG6A 4FD6A 3T9YA 3SXNA 4BMHA 2HUZA 3BJ7A 2Y0MA 2QIRA 4B10A 3W6SA 4RI1A 4AVBA 3I9SA 4F0XA 4II9A 3P2HA 1S3ZA 3NE7A 2ARHA 2Q04A 3EFAA 4B5PB 3E0KA 2X7BA 2ZXVA 5I0CA 5F48A 4CAVA 3T90A 2R98A 2JLMA 3W6XA 2PR8A 1XMTA 4JJXA 2OU2A 1M4GA 1KUVA 1CM0A 1QSNA 1N71A 2Z10A 3GKRA 4KLVA 2ZW7A 2Q44A 1J4JA 4CAXA 4B11A 3CXQA 5F47A 4B5PA 5F49A 4QUSA 2D4PA 4UA3A 4KUBA 2G3AA 4J3GA 1M4DA 5H84A 3R9GA 2J8NA 4C2XA 3S6GA 4A2ZA 4KOVA 2GE3A 3B8GA 2JEVA 4R3KA 2HV2A 1IICA 3FIXA 3BJ8A 3IU2A 4KOSA 2DPTA 3FXTA 4Q36A 2G3TA 2I00A 5G20A 3LODA 2WSAA 4C2YA 2J8MA 3RYOA 4MFKA 4KVOE 1S7KA 4ORFA 2VI7A 5E96A 3IWEA 1KZFA 1R57A 2ZPAA 5JPHA 3S6FA 4H6ZA 4KOXA 2RC4A 5GCNA 3BLNA 4E8OA 2Z11A 2FSRA 4RS2A 2JDDA 3JVNA 4MY3A 2P6GA 4K30A 2YNEA 2Q7BA 2P6EA 2H5MA 4MI4A 1V0CA 4PV6A 4MFLA 4U9YA 3PP9A 4B5OA 4AG7A 3DDDA 3EO4A 4A30A 1MK4A 4QC6A 4CYOA 2FXFA 3UY5A 4FD4A 4HKFA 1NE9A 1Y7RA 1VKCA 3MGDA 1ZO0A 2Q0YA 5H86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PDO A;  4JWP A;  3GYA A;  5CNP A;  3EC4 A;  4XPK A;  2VEZ A;  4ONU A;  2I79 A;  4NXY A;  4MY0 A;  4KOT A;  2GAN A;  2PRB A;  1M1D A;  3CXS A;  1QSO A;  4PK2 A;  3R9E A;  2B3U A;  4H6U A;  4KUA A;  1Z9U A;  4YGO A;  2BL1 A;  4FD7 A;  4EVY A;  1MJ9 A;  2FT0 A;  1XIX A;  1NMT A;  2WPW A;  3OWC A;  2FL4 A;  3EY5 A;  3K9U A;  3D3S A;  1IB1 E;  3PZJ A;  4MJ8 A;  3P2F A;  4PSW A;  1PUA A;  2EVN A;  2CNM A;  1B87 A;  3EXN A;  3R95 A;  4JD6 A;  1YLE A;  2F5I A;  3D8P A;  3WR7 A;  3R9F A;  2ATR A;  3TO6 A;  4R9M A;  3FBU A;  5J8C A;  1Q2Y A;  3R1K A;  5DWN A;  1S7F A;  3TOA A;  4CRZ B;  3GY9 A;  4OAD A;  4HNX B;  3PGP A;  1RXT A;  2AJ6 A;  4M85 A;  3TE4 A;  1Q2D A;  2WPX A;  2PSW A;  3R96 A;  4YFJ A;  4CS0 B;  3VWD A;  5IB0 A;  1QST A;  3I3G A;  3H4Q A;  2VXK A;  4XPL A;  4NEX A;  4MBU A;  4IF5 A;  2D4O A;  2GIV A;  2B5G B;  4AVA A;  1MJA A;  2KCW A;  1BO4 A;  4DNC A;  4E0A A;  1RO5 A;  4QB9 A;  4KOW A;  1IYK A;  5EC4 A;  3S6H A;  2R1I A;  2P0W A;  4U5Y A;  1YR0 A;  1ON0 A;  3V8I A;  2PR1 A;  2G0B A;  3JUW A;  1YGH A;  2A4N A;  3FNC A;  2B5G A;  2BSW A;  1MJB A;  2REF A;  4XNH C;  4F0Y A;  1S7L A;  3S6K A;  4KVX A;  4UBR A;  4Y49 C;  1P4N A;  4CAW A;  2O28 A;  3LD2 A;  1TIQ A;  1S5K A;  5EBV A;  3D2P A;  3W91 A;  5C82 A;  1K4J A;  1I1D A;  3C26 A;  5IV0 A;  5JQ4 A;  1WK4 A;  1BOB A;  2FE7 A;  3ZJ0 A;  1QSM A;  2PC1 A;  4KOR A;  1Z4E A;  5HMN A;  1GHE A;  4ZBG A;  3DNS A;  1FY7 A;  3G8W A;  1M4I A;  2B4D B;  2CY2 A;  2OH1 A;  4NCZ A;  4XPD B;  4MHD A;  2P6F A;  4R87 A;  2R7H A;  3IWG A;  4IUS A;  2BEI A;  2FS5 A;  2QML A;  1XE4 A;  3F8K A;  4XPD C;  5J8F A;  2B4D A;  2JDC A;  2B58 A;  3SXO A;  3FB3 A;  1Q2C A;  1YRE A;  2OB0 A;  2DXQ A;  2ZW6 A;  4CRY B;  3DR6 A;  3FRM A;  4UWJ A;  1Y9W A;  1QSR A;  4QVT A;  1Z4R A;  4AVC A;  4OAE A;  2NMT A;  3KKW A;  4JXR A;  2EUI A;  1KUY A;  4JLY A;  3TO9 A;  4UWI A;  4NSQ A;  4L8A A;  3TT2 A;  2B4B A;  1M44 A;  1CJW A;  4R57 A;  1PU9 A;  5KTA A;  3DR8 A;  4HNY B;  3IGR A;  1IYL A;  4NF1 A;  2R8V A;  4E2A A;  2J8R A;  2OZG A;  3SHP A;  5DWM A;  4X5K A;  3TTH A;  2ZW4 A;  2B3V A;  2VQY A;  4U9Z A;  1IID A;  4QBJ A;  5IX3 A;  4KOY A;  4PK3 A;  4KZT A;  3TOB A;  2FIW A;  1P0H A;  2Z0Z A;  1WWZ A;  3CXP A;  3TFY A;  5ISV A;  3FYN A;  4HNW B;  4XNH B;  2CNS A;  1LRZ A;  2FIA A;  1S60 A;  5F46 A;  1B6B A;  4M3S A;  4Y49 B;  1L0C A;  4LX9 A;  1OZP A;  2IL4 A;  2REE A;  1S7N A;  1U6M A;  1YVO A;  3F5B A;  4AG9 A;  3TO7 A;  1KUX A;  2K5T A;  3ZZI A;  1XEB A;  2VBQ A;  4PSX A;  2C27 A;  4YRH A;  3D2M A;  2HQY A;  2OZU A;  2VZZ A;  5HH1 A;  2CNT A;  2BUE A;  3DSB A;  4OLL A;  3QB8 A;  3F0A A;  2PQ8 A;  4LUA A;  1NSL A;  3VWE A;  1I12 A;  4F6A A;  2OZH A;  2Q4V A;  4KOU A;  4AB7 A;  4FD5 A;  2Q4Y A;  4I49 A;  1UFH A;  4H89 A;  3N7Z A;  1YK3 A;  2AE6 A;  2ZW5 A;  2VZY A;  1I21 A;  4KVM E;  1YVK A;  3G3S A;  4JXQ A;  4KLW A;  1SQH A;  1Y9K A;  2FCK A;  4GS4 A;  1VHS A;  4R3L A;  1XF8 A;  3TCV A;  5FVJ A;  5C88 A;  5KTC A;  2QEC A;  4L89 A;  1YX0 A;  5KTD A;  3QAH A;  3T9Y A;  4FD6 A;  3SXN A;  4BMH A;  2HUZ A;  3BJ7 A;  2Y0M A;  2QIR A;  3W6S A;  4RI1 A;  4AVB A;  3I9S A;  4II9 A;  3P2H A;  1S3Z A;  3NE7 A;  2ARH A;  2Q04 A;  3EFA A;  4B5P B;  3E0K A;  2X7B A;  2ZXV A;  5I0C A;  5F48 A;  4CAV A;  3T90 A;  2R98 A;  2JLM A;  3W6X A;  2PR8 A;  1XMT A;  4JJX A;  2OU2 A;  1M4G A;  1KUV A;  1CM0 A;  1QSN A;  1N71 A;  2Z10 A;  3GKR A;  4KLV A;  2ZW7 A;  2Q44 A;  1J4J A;  4CAX A;  3CXQ A;  5F47 A;  4B5P A;  5F49 A;  4QUS A;  2D4P A;  4UA3 A;  4KUB A;  2G3A A;  4J3G A;  1M4D A;  5H84 A;  3R9G A;  2J8N A;  3S6G A;  4KOV A;  2GE3 A;  3B8G A;  2JEV A;  4R3K A;  2HV2 A;  1IIC A;  3FIX A;  3BJ8 A;  4KOS A;  3FXT A;  2G3T A;  2I00 A;  3LOD A;  2J8M A;  3RYO A;  4KVO E;  1S7K A;  4ORF A;  2VI7 A;  5E96 A;  1KZF A;  1R57 A;  2ZPA A;  5JPH A;  3S6F A;  4H6Z A;  4KOX A;  2RC4 A;  5GCN A;  3BLN A;  4E8O A;  2Z11 A;  2FSR A;  4RS2 A;  2JDD A;  3JVN A;  4MY3 A;  2P6G A;  4K30 A;  2Q7B A;  2P6E A;  2H5M A;  4MI4 A;  1V0C A;  4PV6 A;  4U9Y A;  3PP9 A;  4B5O A;  4AG7 A;  3DDD A;  3EO4 A;  1MK4 A;  4QC6 A;  2FXF A;  3UY5 A;  4FD4 A;  4HKF A;  1NE9 A;  1Y7R A;  1VKC A;  3MGD A;  2Q0Y A;  5H86 A; 
#chains in the Genus database with same CATH topology
 4KSI A;  2PDO A;  4JWP A;  2QJ8 A;  3SI1 A;  3KL9 A;  3RAM A;  4ZY2 A;  3GYA A;  5CNP A;  3EC4 A;  4XPK A;  4X8I A;  4A31 A;  2VEZ A;  4ONU A;  2PJ4 A;  2I79 A;  5LRG A;  4NXY A;  4MY0 A;  1XJO A;  2AFS A;  1TF8 A;  2I3C A;  3NH8 A;  4KOT A;  3CZX A;  1EE3 P;  2GAN A;  3S9L A;  4ZY1 A;  2PRB A;  1M1D A;  1H8L A;  3B3S A;  2Z3K A;  1ZLI A;  1FNO A;  2BCO A;  1QSO A;  3CXS A;  4PK2 A;  1PCA A;  3R9E A;  2B3U A;  4H6U A;  2PE3 A;  5AG4 A;  3BXM A;  4KUA A;  1Z9U A;  4C7I A;  4WJB A;  4MMO A;  2Z3N A;  4WWV A;  4YGO A;  2BL1 A;  2IQ6 A;  4CGM A;  4FD7 A;  2ZEE A;  3FVL A;  3PB7 X;  2PJ5 A;  4EVY A;  1MJ9 A;  2FT0 A;  1IY7 A;  1XIX A;  2AFZ A;  1NMT A;  5DS0 A;  2WPW A;  3SJF A;  3NE8 A;  3OWC A;  3IU1 A;  2FL4 A;  1ZG9 A;  3EY5 A;  2POK A;  3GLJ A;  5CBM A;  3K9U A;  3D3S A;  1IB1 E;  3PZJ A;  4MJ8 A;  4MFP A;  5G21 A;  3P2F A;  4MCP A;  4PSW A;  3V38 A;  4CPA A;  1PUA A;  2OR4 A;  2EVN A;  2JBJ A;  2CNM A;  4OC3 A;  3N5F A;  1B87 A;  3A9L A;  3EXN A;  3R95 A;  3KQX A;  4R6T A;  4JD6 A;  1YLE A;  2F5I A;  3D8P A;  4CAE A;  1NSA A;  3R9F A;  3WR7 A;  4A33 A;  2ATR A;  2VL1 A;  4A37 A;  3TO6 A;  4DUK A;  1M4L A;  2XEF A;  3FBU A;  4R9M A;  5J8C A;  1Q2Y A;  3R1K A;  4PPZ A;  5DWN A;  1S7F A;  5JGF A;  3H8F A;  3TOA A;  3D7F A;  3KZW A;  4CRZ B;  1UWY A;  3GY9 A;  2V77 A;  4NGR A;  4OAD A;  5LRK A;  3T8W A;  4P6Y A;  4B12 A;  4HNX B;  4JZ0 A;  2QVP A;  3PGP A;  4MFQ A;  1RXT A;  2AJ6 A;  4IK2 A;  4M85 A;  3D4U A;  1PYT B;  3TE4 A;  1HDQ A;  3FMC A;  4RUH A;  4ZI6 A;  4A38 A;  2FVG A;  2O4H A;  1Q2D A;  2WPX A;  1BAV A;  2PSW A;  1F2O A;  3R96 A;  4MCR A;  4CS0 B;  4YFJ A;  3VWD A;  2PJ9 A;  5LYD A;  5IB0 A;  1ARM A;  5I4M A;  1QST A;  3I3G A;  3H4Q A;  4EFD A;  1Z8L A;  3B3C A;  2YND A;  2VXK A;  4XPL A;  4F8Z A;  5LYF A;  4NEX A;  4C2Z A;  4Z65 A;  4MBU A;  4TNU A;  4PXB A;  4IF5 A;  2BOA A;  1YW6 A;  2CTC A;  2CIJ A;  2D4O A;  3B3T A;  2GIV A;  2B5G B;  4CYN A;  4AVA A;  4CGL A;  1YW4 A;  1QQ9 A;  4JYW A;  1ELL P;  3S9N A;  1MJA A;  2KCW A;  4O23 A;  1TKH A;  4MFJ A;  3BI0 A;  1BO4 A;  2XEI A;  1LCP A;  4DNC A;  4E0A A;  1RO5 A;  4G1P A;  4QB9 A;  3D7D A;  4KOW A;  1IYK A;  5EC4 A;  3S9M A;  1GYT A;  2CXA A;  4YU9 A;  2YGW A;  3S6H A;  1TXR A;  2R1I A;  3D67 A;  2ZED A;  2P0W A;  2GU2 A;  4U5Y A;  1CG2 A;  5AG5 A;  1RTQ A;  4EWT A;  2WYR A;  1LAP A;  3B2Y A;  1YR0 A;  1ON0 A;  2OOT A;  3V8I A;  4B13 A;  5K8N A;  1AMP A;  3FH4 A;  3IEH A;  1IOI A;  2PR1 A;  2G0B A;  4OME A;  2IJZ A;  3JUW A;  4OC4 A;  4CGN A;  1YGH A;  2A4N A;  3FNC A;  3FED A;  2B5G A;  3I1U A;  2BSW A;  1MJB A;  2REF A;  4R76 A;  4XNH C;  2AFX A;  2IMO A;  2PJ6 A;  3SI2 A;  1VHO A;  3FEC A;  4A94 A;  4F0Y A;  1S7L A;  2YNC C;  3S6K A;  1YSJ A;  4KVX A;  4UBR A;  4Y49 C;  1P4N A;  4ZX9 A;  4PXC A;  4CAW A;  2CF4 A;  2O28 A;  3LD2 A;  3VAR A;  1TIQ A;  1S5K A;  4GXH A;  3QAY A;  2Q7S A;  5LYL A;  3K2K A;  4FUU A;  5EMI A;  4CYP A;  5K8P A;  2AFO A;  5EBV A;  5D8N A;  4ZX8 A;  3D2P A;  3W91 A;  5C82 A;  1K4J A;  1I1D A;  1ZG8 A;  3C26 A;  5IV0 A;  5JQ4 A;  1WK4 A;  3IWW A;  4R7M A;  5HVG A;  5AGE A;  3GIU A;  4B6Z A;  1BOB A;  2FE7 A;  1AUG A;  2Z3O A;  1BPN A;  2PJB A;  3ZJ0 A;  1JWQ A;  1QSM A;  2PC1 A;  4KOR A;  1Z4E A;  5HMN A;  1BPM A;  1GHE A;  4ZBG A;  4UCM A;  4OC5 A;  1DE4 C;  1XOV A;  3LWU A;  3DNS A;  3IFE A;  1FY7 A;  4F9U A;  3G8W A;  1R43 A;  1M4I A;  2B4D B;  2CY2 A;  4CYQ A;  2OH1 A;  2EK9 A;  4NCZ A;  4UCN A;  1ZG7 A;  4MHP A;  4MHD A;  4XPD B;  4NGQ A;  4CAF A;  3CPA A;  2PJ2 A;  5G1Z A;  3SI0 A;  2P6F A;  4R87 A;  2R7H A;  5A27 A;  2Q43 A;  2Z3P A;  1VIX A;  4ONW A;  3IWG A;  2ZEL A;  1YQE A;  4UF4 A;  2ZEG A;  4IUS A;  2V8H A;  2BEI A;  2FS5 A;  2QML A;  4NGN A;  1XE4 A;  4A32 A;  1Y0R A;  3F8K A;  2JBK A;  2PJ1 A;  2J9A A;  3QNV A;  4XPD C;  1XRY A;  3VH9 A;  5J8F A;  2B4D A;  2JDC A;  2B58 A;  4P4B A;  4ZGY B;  3IJ3 A;  3SXO A;  3FB3 A;  5HVH A;  5K8O A;  1Q2C A;  1YRE A;  2OB0 A;  2DXQ A;  2ZW6 A;  5BWA B;  7CPA A;  4HPS A;  5CPA A;  3DR6 A;  4CRY B;  1Z2L A;  3FRM A;  1QSR A;  1Y9W A;  3B3W A;  2C1C A;  4MCS A;  1Z4R A;  4QVT A;  4UCP A;  4AVC A;  4OAE A;  4UFW A;  4NGP A;  2NMT A;  3JRU A;  3KKW A;  4JXR A;  5G22 A;  3PB8 X;  2EUI A;  4PXE A;  1KUY A;  4JLY A;  1IU8 A;  4M6I A;  4UFV A;  3TO9 A;  1HEE A;  2C6P A;  4UWI A;  1YLO A;  4NSQ A;  4DYO A;  3VAT A;  3PBE A;  2EO8 A;  4F9V A;  4L8A A;  1ZLH A;  2PJ0 A;  4P4I A;  3SJG A;  3TT2 A;  3KGQ A;  3ISX A;  2B4B A;  1HDU A;  4NJQ A;  1M44 A;  1CJW A;  4R57 A;  1PU9 A;  5KTA A;  1LFW A;  2O53 A;  3DR8 A;  4HNY B;  3KHX A;  3IGR A;  1IYL A;  3PEI A;  2PJ8 A;  4P4D A;  3FX6 A;  2R8V A;  1CP6 A;  4NF1 A;  2J8R A;  4E2A A;  4KS9 A;  2OZG A;  3KR5 A;  3PRT A;  4OP4 A;  3SHP A;  1JQG A;  4DJL A;  1AYE A;  3KR4 A;  5DWM A;  3LMS A;  4NGM A;  4X5K A;  3JTK A;  2ZW4 A;  3TTH A;  2B3V A;  3RO0 A;  2VQY A;  1DTD A;  4U9Z A;  4IAV A;  1IID A;  5ELY A;  4P4F A;  2Z3L A;  4QBJ A;  5IX3 A;  1IOF A;  3B35 A;  4KOY A;  4PK3 A;  4KZT A;  3RZA A;  3TOB A;  2FIW A;  1P0H A;  2Z0Z A;  4P4J A;  1WWZ A;  3CXP A;  3TFY A;  4RN7 A;  5ISV A;  3FYN A;  4HNW B;  4XNH B;  2CNS A;  1LRZ A;  2FIA A;  1S60 A;  1BLL E;  4UFX A;  1B6B A;  4M3S A;  5F46 A;  4P10 A;  5AG7 A;  2DPS A;  4OIW A;  4Y49 B;  4BBH A;  4X2T A;  1L0C A;  1TF9 A;  4P4E A;  3TC8 A;  4A95 A;  4LX9 A;  2V8V A;  1OZP A;  2IL4 A;  3D7G A;  2REE A;  2HB6 A;  1ELM P;  2V8G A;  4NJR A;  3ISZ A;  1S7N A;  1U6M A;  3NA6 A;  1YVO A;  4CGP A;  3F5B A;  4UWJ A;  4AG9 A;  3TO7 A;  1KUX A;  2K5T A;  3ZZI A;  1XEB A;  2VBQ A;  4PSX A;  3FJU A;  4FBE A;  4B14 A;  2ZEP A;  2C27 A;  1CPX A;  2GLF A;  3B7I A;  6CPA A;  1XMB A;  4OID A;  2PJA A;  4OKO A;  1LOK A;  3D2M A;  2ZEH A;  4YRH A;  2HQY A;  2OZU A;  4Q7A A;  2VZZ A;  2YNC A;  5HH1 A;  4C7H A;  2CNT A;  4K3N A;  2BUE A;  4CGO A;  3FEE A;  2DF5 A;  2PVW A;  3DSB A;  4YWY A;  4OLL A;  4EME A;  3QB8 A;  3F0A A;  4LQ6 A;  4W9Y A;  1ARL A;  2PJC A;  1LAN A;  2PQ8 A;  3MRU A;  4LUA A;  4MCQ A;  1NSL A;  3VWE A;  3CT9 A;  1I12 A;  4MFZ A;  4KSA A;  4F6A A;  2OZH A;  4KSF A;  3B3V A;  2Q4V A;  4OC1 A;  5HXD A;  4P44 A;  2PIY A;  3GB0 A;  2CTB A;  4KOU A;  1CX8 A;  4Q38 A;  3WT4 A;  4AB7 A;  4FD5 A;  3SJE A;  2Q4Y A;  1CP7 A;  1VHE A;  4H2K A;  1Z8X A;  3TX8 A;  3IIB A;  4I49 A;  1UFH A;  1LAM A;  4H89 A;  2JEW A;  3N7Z A;  1YK3 A;  2AE6 A;  2RFH A;  2VZY A;  1I21 A;  1YVK A;  2ZW5 A;  3G3S A;  3NH5 A;  4JXQ A;  4KVM E;  3V7Z A;  4KLW A;  4FAI A;  1SQH A;  3H5Z A;  4OC0 A;  4FWU A;  5A28 A;  1Y9K A;  3RNZ A;  2Q4Z A;  5F09 A;  2ANP A;  3IC1 A;  2FCK A;  4GS4 A;  4C68 A;  2PCU A;  1VHS A;  4R3L A;  8CPA A;  1F2P A;  1Y7E A;  1TKF A;  1XF8 A;  2Z3M A;  4MHN A;  3IO1 A;  2WUU A;  2XEG A;  3FF3 A;  3TCV A;  5FVJ A;  5LYI A;  4ZYQ A;  5C88 A;  1X12 A;  5KTC A;  1R3N A;  2QEC A;  4L89 A;  4R8F A;  2GLJ A;  2EWB A;  1YX0 A;  5KTD A;  2NYQ A;  3QAH A;  2PRQ A;  5AG6 A;  4FD6 A;  4UEZ A;  3T9Y A;  3SXN A;  3H8E A;  4BMH A;  2HUZ A;  3LAC A;  3BJ7 A;  3RBU A;  4X3R A;  2Y0M A;  2QIR A;  3PB4 X;  4B10 A;  3W6S A;  2F7V A;  4RI1 A;  4AVB A;  5D29 A;  2PJ3 A;  3I9S A;  2AFW A;  4F0X A;  4II9 A;  4BD9 A;  3CDX A;  4UIB A;  1FT7 A;  1X10 A;  2PIZ A;  3P2H A;  1S3Z A;  2GFQ A;  2Q0Y A;  3NE7 A;  5THW A;  2ARH A;  2AFM A;  2Q04 A;  3BHX A;  4M6H A;  3D68 A;  3EFA A;  2PJ7 A;  4B5P B;  1IGB A;  2ODF A;  3E0K A;  4ZY0 A;  2X7B A;  2ZXV A;  5I0C A;  1TKJ A;  2ZOF A;  1KWM A;  5F48 A;  4CAV A;  3T90 A;  2ZEO A;  3WC5 A;  2EK8 A;  2JLM A;  2R98 A;  4M6G A;  4UEF A;  5IB9 A;  3W6X A;  2PR8 A;  1XMT A;  4JJX A;  1XFO A;  1A2Z A;  2OU2 A;  3CPX A;  1M4G A;  3WAB A;  1Z8T A;  1KUV A;  2WZN A;  1CM0 A;  1QSN A;  1N71 A;  2BO9 A;  2Z10 A;  3GKR A;  3DGV A;  4IHM A;  3WC6 A;  2XEJ A;  4KLV A;  2ZW7 A;  2Q44 A;  3PFE A;  1J4J A;  2NSM A;  4CAX A;  4B11 A;  3CXQ A;  5F47 A;  4B5P A;  5F49 A;  4MXU A;  2DEA A;  4QUS A;  3D7H A;  1OBR A;  4OC2 A;  5JM6 A;  2D4P A;  3MN8 A;  3PFO A;  4UA3 A;  2AFU A;  4KUB A;  3GUX A;  3PBB A;  2G3A A;  2C6G A;  1Z5R A;  4UEE A;  4J3G A;  1M4D A;  5H84 A;  2F8H A;  2ZEF A;  3R9G A;  2EBJ A;  2J8N A;  4MRI A;  3WC7 A;  4MHY A;  4C2X A;  3S6G A;  4A2Z A;  4KOV A;  2GE3 A;  3B8G A;  2JEV A;  3K9T A;  4R3K A;  1VGY A;  3NH4 A;  1YME A;  2HV2 A;  4BIN A;  2PVV A;  2C6C A;  2ZOG A;  3BI1 A;  2ZEN A;  1IIC A;  3FIX A;  3BJ8 A;  3IU2 A;  4KOS A;  4MHZ A;  2DPT A;  1CBX A;  3FXT A;  3HLP A;  4GM5 A;  4PXD A;  4Q36 A;  2G9D A;  5JH9 A;  2HC9 A;  2G3T A;  2I00 A;  5G20 A;  3KI9 A;  1CPS A;  3LOD A;  2GRE A;  2WSA A;  3NFZ A;  4LQG A;  4C2Y A;  4A39 A;  5K8M A;  2J8M A;  4P45 A;  5LRJ A;  3KHZ A;  2Q51 A;  4MFK A;  3DLJ A;  4KVO E;  3RYO A;  1S7K A;  4ORF A;  2QYV A;  2VI7 A;  5E96 A;  3IWE A;  1KZF A;  1R57 A;  2ZPA A;  5JPH A;  3S6F A;  4H6Z A;  4PQA A;  4KOX A;  2RC4 A;  5GCN A;  2RB7 A;  3BLN A;  3D66 A;  4E8O A;  1Z8W A;  2Z11 A;  2FSR A;  5J1Q A;  4RS2 A;  2JDD A;  3JVN A;  4MY3 A;  2P6G A;  4K30 A;  2YNE A;  2Q7B A;  2P6E A;  2H5M A;  4MI4 A;  1V0C A;  4PV6 A;  1XBU A;  4MFL A;  4U9Y A;  2ZEM A;  3PP9 A;  4B5O A;  3HUV A;  4AG7 A;  4UIA A;  4NFR A;  3DDD A;  3EO4 A;  4A30 A;  1MK4 A;  4QC6 A;  1Y0Y A;  5HVF A;  2FXF A;  3PB9 X;  4TWE A;  3UY5 A;  3PB6 X;  4CYO A;  4NGS A;  3SJX A;  4FD4 A;  4HKF A;  4NGT A;  3H8G A;  3L2N A;  1NE9 A;  4AXV A;  1Y7R A;  2ABZ A;  3KQZ A;  3KAS A;  1VKC A;  3MGD A;  1F57 A;  1ZO0 A;  1Q7L A;  2V8D A;  1QMU A;  5H86 A; 
#chains in the Genus database with same CATH homology
 2PDO A;  4JWP A;  3GYA A;  5CNP A;  3EC4 A;  4XPK A;  4A31 A;  2VEZ A;  4ONU A;  2I79 A;  4NXY A;  4MY0 A;  4KOT A;  2GAN A;  2PRB A;  1M1D A;  2Z3K A;  3CXS A;  1QSO A;  4PK2 A;  3R9E A;  2B3U A;  4H6U A;  5AG4 A;  4KUA A;  1Z9U A;  4C7I A;  2Z3N A;  4YGO A;  2BL1 A;  4CGM A;  4FD7 A;  4EVY A;  1MJ9 A;  2FT0 A;  1XIX A;  1NMT A;  2WPW A;  3OWC A;  3IU1 A;  2FL4 A;  3EY5 A;  3K9U A;  3D3S A;  1IB1 E;  3PZJ A;  4MJ8 A;  4MFP A;  5G21 A;  3P2F A;  4PSW A;  1PUA A;  2EVN A;  2CNM A;  1B87 A;  3A9L A;  3EXN A;  3R95 A;  4JD6 A;  1YLE A;  2F5I A;  3D8P A;  4CAE A;  3WR7 A;  3R9F A;  4A33 A;  2ATR A;  3TO6 A;  4R9M A;  3FBU A;  5J8C A;  1Q2Y A;  3R1K A;  5DWN A;  1S7F A;  3TOA A;  4CRZ B;  3GY9 A;  4OAD A;  4B12 A;  4HNX B;  3PGP A;  4MFQ A;  1RXT A;  2AJ6 A;  4M85 A;  3TE4 A;  1Q2D A;  2WPX A;  2PSW A;  3R96 A;  4YFJ A;  4CS0 B;  3VWD A;  5IB0 A;  1QST A;  3I3G A;  3H4Q A;  2YND A;  2VXK A;  4XPL A;  4NEX A;  4C2Z A;  4MBU A;  4IF5 A;  2D4O A;  2GIV A;  2B5G B;  4CYN A;  4AVA A;  4CGL A;  1MJA A;  2KCW A;  4MFJ A;  1BO4 A;  4DNC A;  4E0A A;  1RO5 A;  4QB9 A;  4KOW A;  1IYK A;  5EC4 A;  2CXA A;  2YGW A;  3S6H A;  2R1I A;  2P0W A;  4U5Y A;  5AG5 A;  1YR0 A;  1ON0 A;  3V8I A;  4B13 A;  2PR1 A;  2G0B A;  3JUW A;  4CGN A;  1YGH A;  2A4N A;  3FNC A;  2B5G A;  2BSW A;  1MJB A;  2REF A;  4XNH C;  4F0Y A;  1S7L A;  2YNC C;  3S6K A;  4KVX A;  4UBR A;  4Y49 C;  1P4N A;  4CAW A;  2O28 A;  3LD2 A;  1TIQ A;  1S5K A;  4CYP A;  5EBV A;  3D2P A;  3W91 A;  5C82 A;  1K4J A;  1I1D A;  3C26 A;  5IV0 A;  5JQ4 A;  1WK4 A;  5AGE A;  1BOB A;  2FE7 A;  2Z3O A;  3ZJ0 A;  1QSM A;  2PC1 A;  4KOR A;  1Z4E A;  5HMN A;  1GHE A;  4ZBG A;  4UCM A;  3DNS A;  1FY7 A;  3G8W A;  1M4I A;  2B4D B;  2CY2 A;  4CYQ A;  2OH1 A;  4NCZ A;  4UCN A;  4XPD B;  4MHD A;  4CAF A;  5G1Z A;  2P6F A;  4R87 A;  2R7H A;  5A27 A;  2Z3P A;  3IWG A;  4IUS A;  2BEI A;  2FS5 A;  2QML A;  1XE4 A;  4A32 A;  3F8K A;  4XPD C;  5J8F A;  2B4D A;  2JDC A;  2B58 A;  4ZGY B;  3SXO A;  3FB3 A;  1Q2C A;  1YRE A;  2OB0 A;  2DXQ A;  2ZW6 A;  5BWA B;  4CRY B;  3DR6 A;  3FRM A;  4UWJ A;  1Y9W A;  1QSR A;  4QVT A;  4UCP A;  1Z4R A;  4AVC A;  4OAE A;  4UFW A;  2NMT A;  3KKW A;  4JXR A;  5G22 A;  2EUI A;  1KUY A;  4JLY A;  4UFV A;  3TO9 A;  4UWI A;  4NSQ A;  4L8A A;  3TT2 A;  2B4B A;  1M44 A;  1CJW A;  4R57 A;  1PU9 A;  5KTA A;  3DR8 A;  4HNY B;  3IGR A;  1IYL A;  4NF1 A;  2R8V A;  4E2A A;  2J8R A;  4KS9 A;  2OZG A;  3SHP A;  5DWM A;  4X5K A;  3TTH A;  3JTK A;  2ZW4 A;  2B3V A;  2VQY A;  4U9Z A;  1IID A;  2Z3L A;  4QBJ A;  5IX3 A;  4KOY A;  4PK3 A;  4KZT A;  3TOB A;  2FIW A;  1P0H A;  2Z0Z A;  1WWZ A;  3CXP A;  3TFY A;  5ISV A;  3FYN A;  4HNW B;  4XNH B;  2CNS A;  1LRZ A;  2FIA A;  1S60 A;  4UFX A;  5F46 A;  1B6B A;  4M3S A;  5AG7 A;  2DPS A;  4Y49 B;  4BBH A;  1L0C A;  4A95 A;  4LX9 A;  1OZP A;  2IL4 A;  2REE A;  1S7N A;  1U6M A;  4CGP A;  1YVO A;  3F5B A;  4AG9 A;  3TO7 A;  1KUX A;  2K5T A;  3ZZI A;  1XEB A;  2VBQ A;  4PSX A;  4B14 A;  2C27 A;  4YRH A;  3D2M A;  2HQY A;  2OZU A;  4C7H A;  2VZZ A;  2YNC A;  5HH1 A;  2CNT A;  2BUE A;  4CGO A;  3DSB A;  4OLL A;  3QB8 A;  3F0A A;  2PQ8 A;  4LUA A;  1NSL A;  3VWE A;  1I12 A;  4MFZ A;  4KSA A;  4F6A A;  2OZH A;  4KSF A;  2Q4V A;  4KOU A;  4Q38 A;  4AB7 A;  4FD5 A;  2Q4Y A;  4I49 A;  1UFH A;  4H89 A;  3N7Z A;  1YK3 A;  2AE6 A;  2ZW5 A;  2VZY A;  1I21 A;  1YVK A;  3G3S A;  4JXQ A;  4KVM E;  4KLW A;  1SQH A;  3H5Z A;  5A28 A;  1Y9K A;  2FCK A;  4GS4 A;  4C68 A;  1VHS A;  4R3L A;  1XF8 A;  2Z3M A;  2WUU A;  3TCV A;  5FVJ A;  5C88 A;  5KTC A;  2QEC A;  4L89 A;  1YX0 A;  5KTD A;  3QAH A;  5AG6 A;  4FD6 A;  3T9Y A;  3SXN A;  4BMH A;  2HUZ A;  3BJ7 A;  2Y0M A;  2QIR A;  4B10 A;  3W6S A;  4RI1 A;  4AVB A;  3I9S A;  4F0X A;  4II9 A;  3P2H A;  1S3Z A;  3NE7 A;  2ARH A;  2Q04 A;  3EFA A;  4B5P B;  3E0K A;  2X7B A;  2ZXV A;  5I0C A;  5F48 A;  4CAV A;  3T90 A;  2R98 A;  2JLM A;  3W6X A;  2PR8 A;  1XMT A;  4JJX A;  2OU2 A;  1M4G A;  1KUV A;  1CM0 A;  1QSN A;  1N71 A;  2Z10 A;  3GKR A;  4KLV A;  2ZW7 A;  2Q44 A;  1J4J A;  4CAX A;  4B11 A;  3CXQ A;  5F47 A;  4B5P A;  5F49 A;  4QUS A;  2D4P A;  4UA3 A;  4KUB A;  2G3A A;  4J3G A;  1M4D A;  5H84 A;  3R9G A;  2J8N A;  4C2X A;  3S6G A;  4A2Z A;  4KOV A;  2GE3 A;  3B8G A;  2JEV A;  4R3K A;  2HV2 A;  1IIC A;  3FIX A;  3BJ8 A;  3IU2 A;  4KOS A;  2DPT A;  3FXT A;  4Q36 A;  2G3T A;  2I00 A;  5G20 A;  3LOD A;  2WSA A;  4C2Y A;  2J8M A;  3RYO A;  4MFK A;  4KVO E;  1S7K A;  4ORF A;  2VI7 A;  5E96 A;  3IWE A;  1KZF A;  1R57 A;  2ZPA A;  5JPH A;  3S6F A;  4H6Z A;  4KOX A;  2RC4 A;  5GCN A;  3BLN A;  4E8O A;  2Z11 A;  2FSR A;  4RS2 A;  2JDD A;  3JVN A;  4MY3 A;  2P6G A;  4K30 A;  2YNE A;  2Q7B A;  2P6E A;  2H5M A;  4MI4 A;  1V0C A;  4PV6 A;  4MFL A;  4U9Y A;  3PP9 A;  4B5O A;  4AG7 A;  3DDD A;  3EO4 A;  4A30 A;  1MK4 A;  4QC6 A;  4CYO A;  2FXF A;  3UY5 A;  4FD4 A;  4HKF A;  1NE9 A;  1Y7R A;  1VKC A;  3MGD A;  1ZO0 A;  2Q0Y A;  5H86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...