2AE6A

Crystal structure of acetyltransferase of gnat family from enterococcus faecalis v583
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
161
structure length
148
Chain Sequence
b'MSTSLTIRLVAEADWPALHALDQIISLAAYQEKMKDETIFVAISGQQLAGFIEVHPPTSLAAHQKQWLLSIGVSPDFQDQGIGGSLLSYIKDMAEISGIHKLSLRVMATNQEAIRFYEKHGFVQEAHFKEEFYINGHYCDDYQYAYFI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acetyltransferase, GNAT family
molecule tags Transferase
source organism Enterococcus faecalis
publication title Crystal Structure of Acetyltransferase of GNAT family from Enterococcus faecalis V583
rcsb
total genus 33
structure length 148
sequence length 161
chains with identical sequence B, C, D
ec nomenclature ec 2.3.-.-:
pdb deposition date 2005-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2ae6A00
3KKWA 4JJXA 5C82A 1BOBA 2ZW4A 1Y7RA 2B58A 2FS5A 2PRBA 2PSWA 4CAWA 2FE7A 2VXKA 4R3LA 4MBUA 2JDCA 2FSRA 3PGPA 2QECA 2Z0ZA 1YGHA 2J8NA 3DSBA 4NCZA 2P6GA 2R8VA 2ATRA 2R98A 2K5TA 3R1KA 2P6EA 1ON0A 3EFAA 3UY5A 2NMTA 4OLLA 3VWEA 2PQ8A 1S7KA 2PC1A 1S3ZA 4ONUA 3R95A 2I00A 2O28A 1RO5A 4PSXA 2ZW7A 1S7NA 5ISVA 1YR0A 2FIAA 3PZJA 2CNMA 1NE9A 1Z4EA 1VHSA 1IICA 3TCVA 1OZPA 4HKFA 1RXTA 3SXNA 1B87A 2HQYA 2OZHA 2VZYA 4JLYA 4ZBGA 5JQ4A 2PR8A 3S6FA 1M4DA 2KCWA 4FD7A 4AG7A 2CY2A 1WWZA 4EVYA 4E8OA 4FD6A 1KUYA 2B5GB 2WPXA 4HNXB 1MK4A 2AE6A 2BUEA 1J4JA 2BEIA 1XIXA 1KUXA 3FIXA 4GS4A 2AJ6A 4X5KA 2ZW5A 5H84A 1MJ9A 2B3UA 2FT0A 4PK3A 2FIWA 2VEZA 3DNSA 2P0WA 4J3GA 2P6FA 2EUIA 3FNCA 5F47A 5IB0A 3S6GA 2B3VA 4CAVA 3GKRA 4II9A 2JEVA 1TIQA 4YFJA 5F46A 1I21A 3IGRA 3TFYA 3W6SA 3F0AA 1IYLA 4KVXA 3SXOA 3TO6A 4MHDA 4R9MA 1Q2DA 3W6XA 3S6KA 4XPDC 2FXFA 3R9GA 4UBRA 4BMHA 1S5KA 1XF8A 2VBQA 2JDDA 4U5YA 4KOTA 4IUSA 4RI1A 5F48A 4OADA 2BL1A 4KOWA 3T9YA 1B6BA 3C26A 4KLVA 5DWMA 1YLEA 4U9ZA 4XPLA 3TE4A 2J8MA 3SHPA 4F6AA 4LUAA 4AVCA 2R1IA 3R9FA 4Y49B 1V0CA 4XPDB 1YVKA 2ARHA 5KTAA 3D2MA 2OZGA 3EC4A 2G0BA 4MJ8A 4KOXA 4H6ZA 4OAEA 1SQHA 2Q4VA 2ZXVA 4M3SA 2A4NA 4PK2A 3P2FA 3CXSA 4QC6A 3NE7A 3B8GA 4UWJA 4KLWA 2Q4YA 4H89A 1QSNA 4CAXA 4E0AA 1XE4A 3TTHA 4MY3A 1I12A 1UFHA 3K9UA 2Q0YA 2FL4A 1WK4A 2B5GA 1K4JA 3I9SA 1NSLA 2OZUA 4PSWA 4JXQA 2Z10A 4AB7A 3I3GA 3BLNA 2DXQA 4KUAA 2VI7A 1KZFA 1IB1E 1XEBA 5CNPA 2WPWA 3R96A 4E2AA 4XNHB 5HMNA 2QIRA 4FD5A 2Q44A 1Z9UA 5GCNA 1MJAA 2ZPAA 3DR6A 2GANA 4KOUA 4JXRA 3ZJ0A 3FBUA 3TOAA 2REFA 3PP9A 3EO4A 2R7HA 3MGDA 5EC4A 2REEA 4PV6A 2Z11A 3FYNA 1YX0A 1Y9KA 3H4QA 3FXTA 2JLMA 4Y49C 4KVOE 4B5PA 4AG9A 4I49A 4QBJA 3DR8A 4L8AA 4B5PB 2ZW6A 1QSOA 2C27A 4F0YA 1PU9A 4L89A 4RS2A 3E0KA 5IV0A 4H6UA 1QSRA 2CNSA 4NXYA 4UA3A 5F49A 2J8RA 1Y9WA 3QB8A 1KUVA 2QMLA 4NEXA 3BJ8A 5FVJA 1Q2CA 2IL4A 1CM0A 5JPHA 1PUAA 3GYAA 5KTCA 1L0CA 2OB0A 1M4GA 1QSTA 2GIVA 1I1DA 4CS0B 2GE3A 3S6HA 3TO9A 1M4IA 1YREA 3CXPA 4KUBA 3BJ7A 4B5OA 2PDOA 5DWNA 1GHEA 2FCKA 3D8PA 5EBVA 4IF5A 4KZTA 1VKCA 4R57A 4KOVA 4YRHA 2G3AA 5HH1A 4JWPA 4CRYB 3JUWA 1S7LA 3ZZIA 1S60A 3RYOA 2OU2A 1IYKA 1S7FA 3QAHA 2G3TA 3FRMA 3IWGA 3JVNA 3R9EA 1P0HA 1FY7A 3T90A 2HV2A 2VQYA 3LODA 1XMTA 1IIDA 4M85A 3OWCA 1QSMA 3TT2A 3FB3A 4KOYA 2X7BA 2Q04A 1U6MA 3D3SA 4K30A 4MY0A 4R3KA 3W91A 3F8KA 4CRZB 1YK3A 2CNTA 2F5IA 4QUSA 1P4NA 3DDDA 5J8FA 5KTDA 2BSWA 4XNHC 3TOBA 3G8WA 2I79A 3F5BA 4YGOA 1BO4A 3TO7A 4NSQA 3P2HA 1MJBA 2B4DA 4FD4A 1M1DA 4JD6A 3V8IA 2PR1A 1Q2YA 5IX3A 2VZZA 4AVAA 1NMTA 1R57A 2D4OA 4HNYB 4AVBA 2B4DB 4KVME 3GY9A 3EY5A 2Q7BA 3EXNA 4QVTA 4MI4A 5H86A 1M44A 4R87A 3VWDA 3N7ZA 1YVOA 4UWIA 4KOSA 5C88A 2B4BA 5E96A 1Z4RA 2H5MA 4ORFA 3CXQA 2HUZA 4U9YA 3WR7A 4DNCA 4KORA 5I0CA 3LD2A 4XPKA 1LRZA 4HNWB 2RC4A 2EVNA 3D2PA 2D4PA 4LX9A 4NF1A 2Y0MA 3G3SA 5J8CA 1CJWA 4QB9A 2OH1A 1N71A
chains in the Genus database with same CATH superfamily
3KKWA 4JJXA 4PXCA 1BOBA 1ARLA 4GXHA 2ZW4A 5C82A 5AG6A 1Y7RA 2B58A 4MFKA 4UF4A 2IQ6A 4KSFA 2FS5A 4O23A 2G9DA 2PRBA 3GIUA 4OMEA 2CIJA 4ZGYB 2PSWA 2AFXA 3SI1A 4CAWA 4OIWA 2FE7A 3CPXA 3SJFA 5AG4A 2Q43A 5IB9A 3MRUA 4OC0A 3PB6X 2VXKA 4R3LA 2PE3A 4MBUA 4X8IA 4B12A 4WWVA 2JDCA 2FSRA 3IU2A 3PGPA 2QECA 2Z0ZA 1YGHA 2PJCA 3D7HA 2ZEHA 5DS0A 2J8NA 3DSBA 3A9LA 4NCZA 2FVGA 2P6GA 2R8VA 1XRYA 3SI2A 2ATRA 4MCPA 2PRQA 2R98A 4R7MA 3LMSA 2K5TA 3R1KA 2P6EA 1ON0A 3EFAA 2Z3PA 1H8LA 2XEJA 2XEIA 2Z3MA 4UFWA 3UY5A 3PFEA 2NMTA 4OLLA 3VWEA 2PQ8A 2ZELA 3FJUA 5LRKA 1QMUA 1S7KA 2PC1A 4IK2A 2GREA 1S3ZA 2AFUA 4ONUA 5J1QA 4FBEA 3D4UA 3R95A 2I00A 2O28A 3WC5A 1AMPA 3GLJA 1RO5A 1ELMP 2V8HA 2Z3OA 4LQ6A 4PSXA 2ZW7A 4ZY2A 1S7NA 5ISVA 1TF9A 1YR0A 1YQEA 2FIAA 3PZJA 2PJ2A 2CNMA 2Q7SA 1NE9A 1Z4EA 3NH5A 1VHSA 4OC1A 3TX8A 4UFVA 3FX6A 2Q51A 4UEEA 4OC5A 1IICA 2YNCA 3TCVA 4CGLA 1OZPA 4HKFA 5LRGA 4MFQA 1RXTA 3IEHA 3SXNA 1B87A 2HQYA 2OZHA 2VZYA 4JLYA 4ZBGA 5LRJA 5JQ4A 2PR8A 2NSMA 3S6FA 1M4DA 2KCWA 4FD7A 4ZX8A 4AG7A 5G1ZA 1OBRA 2CY2A 1WWZA 4EVYA 4E8OA 4FD6A 1KUYA 2B5GB 2WPXA 4HNXB 2C6PA 1MK4A 2AE6A 4B14A 2BUEA 3KHZA 1J4JA 4B13A 2BEIA 1XIXA 1KUXA 2Q4ZA 3FIXA 3BI1A 2AJ6A 4GS4A 4X5KA 2WUUA 2ZW5A 1F2PA 1Y0RA 2VL1A 5H84A 1MJ9A 2B3UA 2FT0A 3V7ZA 2PJ3A 2PVVA 4PK3A 1IOFA 1ZLHA 4OKOA 2FIWA 2VEZA 1Q7LA 3DNSA 3KQXA 2P0WA 4J3GA 2ZEMA 3B3WA 2Z3NA 2P6FA 2EUIA 3FNCA 3FEDA 5F47A 5IB0A 3IWWA 3FVLA 4A33A 5K8NA 3S6GA 4YU9A 5JH9A 2B3VA 4CAVA 3QNVA 4P4BA 4TNUA 3GKRA 3NFZA 5THWA 4II9A 2JEVA 1TIQA 4MFLA 4YFJA 4CYPA 5F46A 1Z8TA 3FH4A 3KQZA 1I21A 2XEGA 3IGRA 3SJXA 3W6SA 4OC3A 5JM6A 3TFYA 2BCOA 3FMCA 3F0AA 4RN7A 4A30A 3IWEA 4NGNA 4BBHA 1VHOA 4PXEA 1BLLE 1IYLA 2HC9A 3NH8A 4P4EA 1VIXA 4KVXA 3SXOA 3PEIA 1XMBA 3I1UA 5D29A 4C2ZA 3TO6A 3B3SA 3MN8A 4MHDA 2AFZA 4R9MA 1Q2DA 2PIYA 4GM5A 4XPDC 4P4DA 3S6KA 4M6HA 2FXFA 3W6XA 4BINA 3FEEA 4P44A 3CPAA 3R9GA 3K2KA 4UBRA 3KL9A 4BMHA 3SJGA 1S5KA 1XF8A 2RFHA 4MCQA 1NSAA 4Z65A 4ZI6A 2F7VA 2VBQA 2JDDA 4A37A 4U5YA 3BI0A 1DE4C 2PJ9A 3QAYA 4KOTA 4IUSA 4MFJA 4NGTA 4RI1A 1YW4A 3RBUA 2ZEOA 3DLJA 4P10A 2EO8A 1IY7A 1JWQA 5F48A 1CPSA 1X10A 4OADA 4KSAA 2BL1A 1Z8LA 4KOWA 3T9YA 2YNCC 3PB8X 5LYIA 3CDXA 1B6BA 2ABZA 3C26A 3RO0A 4KLVA 5DWMA 3T8WA 4A31A 4P4IA 1YLEA 4U9ZA 1PYTB 4XPLA 4A39A 5LYDA 4CYNA 5JGFA 3TE4A 2J8MA 3SHPA 1XBUA 4LUAA 4OIDA 4R76A 4AVCA 4F6AA 2I3CA 2R1IA 3R9FA 4Y49B 4UEFA 1V0CA 4XPDB 1YVKA 2ARHA 1CX8A 5KTAA 3D2MA 4LQGA 5G22A 2OZGA 4EFDA 3EC4A 2G0BA 4DUKA 2ZOGA 4MJ8A 4KOXA 2V8DA 4H6ZA 3CZXA 4ZX9A 4OAEA 1SQHA 4UCMA 2Q4VA 3BXMA 4ZY1A 2ZXVA 2PVWA 4M3SA 4W9YA 4MMOA 1Z8XA 2A4NA 2ZEDA 4A32A 4PK2A 3P2FA 1VHEA 3CXSA 4QC6A 3NE7A 4EMEA 3B8GA 5LYFA 4A2ZA 4UWJA 2PJ1A 3LACA 4HPSA 3B35A 4M6IA 4KLWA 1M4LA 2Q4YA 1QSNA 2WSAA 4H89A 4Q7AA 4CAXA 3H8EA 4E0AA 1PCAA 4MFPA 1XE4A 4WJBA 3TTHA 1I12A 4MY3A 4C2XA 1UFHA 3K9UA 3TC8A 2Q0YA 3WT4A 3RAMA 2FL4A 4NFRA 1WK4A 3JRUA 2B5GA 1K4JA 1CP6A 4MHPA 3I9SA 1NSLA 2OZUA 2PCUA 3N5FA 1XFOA 4PSWA 4JXQA 2Z10A 2EK8A 4AB7A 1TXRA 3BLNA 2GFQA 3I3GA 2OOTA 2DXQA 4CYOA 4UEZA 4KUAA 4CPAA 2WYRA 2VI7A 1A2ZA 2Z3LA 1KZFA 3NA6A 4PQAA 5A28A 2IMOA 2ZEPA 1IB1E 2PJ4A 4PPZA 4F8ZA 1XEBA 5CNPA 4NJQA 2WPWA 2YNEA 2HB6A 3R96A 2PJAA 4R8FA 5G21A 4XNHB 4E2AA 2AFOA 5HMNA 3D7FA 2C6GA 2QIRA 4FD5A 4P4FA 2Q44A 1Z9UA 5GCNA 1ARMA 1MJAA 2OR4A 2ZPAA 1AUGA 4H2KA 3DR6A 1HDQA 4NJRA 1Y0YA 2GANA 4KOUA 2DEAA 2O4HA 2PJ5A 4JXRA 1HEEA 3ZJ0A 2IJZA 3FBUA 3TOAA 4BD9A 3B3TA 3KR4A 4MHZA 2REFA 3HLPA 3PP9A 3KI9A 1ZG9A 4B10A 3PB7X 3EO4A 2R7HA 1UWYA 3D7GA 3KZWA 3B3CA 4AXVA 2ZEFA 3KHXA 1GYTA 5K8MA 1DTDA 2JBJA 1LCPA 3MGDA 2NYQA 5EC4A 2REEA 4TWEA 4PV6A 2AFWA 3D66A 3PB4X 2Z11A 3FYNA 1YX0A 1QQ9A 1Y9KA 4MHNA 2WZNA 3H4QA 2BO9A 3FXTA 2JLMA 4ONWA 4Y49C 4CAFA 4CGPA 1KWMA 4KVOE 3B2YA 3S9NA 4B5PA 4AG9A 1LANA 4P45A 4A95A 4I49A 4QBJA 3DGVA 1AYEA 3DR8A 2ZOFA 4L8AA 4B5PB 2GLJA 2ZW6A 1QSOA 3IFEA 4B11A 1IU8A 4G1PA 4DJLA 5BWAB 2C27A 2ZEGA 4F0YA 1PU9A 4L89A 4RS2A 3E0KA 5IV0A 4H6UA 1QSRA 2CNSA 4FUUA 4NXYA 1BPNA 4UA3A 2CXAA 5F49A 2J8RA 1Y9WA 2PJ0A 3QB8A 4IAVA 1KUVA 2DPSA 2QMLA 2PIZA 4UCPA 4F0XA 4NEXA 3BJ8A 4P6YA 5FVJA 5G20A 1Q2CA 2IL4A 5LYLA 1CM0A 2ANPA 5JPHA 5AG7A 1PUAA 4FWUA 3GYAA 5EMIA 5KTCA 1L0CA 3SJEA 2OB0A 2PJ7A 3IJ3A 4X3RA 1M4GA 2POKA 4P4JA 4C7IA 1QSTA 2GIVA 3PBBA 1XJOA 1I1DA 3PBEA 2CTBA 1IGBA 4MCRA 4OC4A 4CS0B 2GE3A 3H8GA 3S6HA 3TO9A 1M4IA 1YREA 2O53A 2PJ8A 3WABA 3CXPA 3HUVA 8CPAA 1YMEA 2EWBA 3JTKA 4KUBA 1FNOA 1VGYA 4MFZA 3BJ7A 4OC2A 4B5OA 1TKJA 2PDOA 5DWNA 1BPMA 1GHEA 2V8GA 2FCKA 1ELLP 3IU1A 3K9TA 3ISXA 3D8PA 5EBVA 4IF5A 4KZTA 4MXUA 4UCNA 4C2YA 1ZG7A 1VKCA 4M6GA 4R57A 1ZO0A 3S9LA 2GLFA 4KOVA 3VH9A 3RZAA 3PFOA 3FECA 5F09A 2ZEEA 7CPAA 1BAVA 3ISZA 4CAEA 2RB7A 3D7DA 4YRHA 2G3AA 3H5ZA 2DF5A 1YLOA 4PXBA 5HH1A 3RNZA 2PJBA 1YSJA 3B7IA 4JWPA 4CRYB 4ZY0A 3JUWA 1S7LA 3ZZIA 1S60A 3SI0A 3RYOA 1CP7A 3VATA 3NE8A 4OP4A 2OU2A 1IYKA 1S7FA 3QAHA 2EBJA 2G3TA 3FRMA 3IWGA 3JVNA 1CBXA 3PRTA 2QYVA 3BHXA 4UFXA 3R9EA 1P0HA 4F9UA 4NGPA 1FY7A 2F8HA 3IC1A 3T90A 4B6ZA 2HV2A 4NGRA 2VQYA 3LODA 1XMTA 4PXDA 1IIDA 3WC7A 1EE3P 4M85A 3OWCA 1QSMA 2C6CA 1Z2LA 4UIBA 3TT2A 1X12A 3FB3A 1TKFA 4KOYA 1ZG8A 2PJ6A 4CYQA 2X7BA 2Q04A 1U6MA 3D3SA 1IOIA 5K8OA 1F57A 4K30A 4MY0A 4R3KA 5ELYA 3W91A 4YWYA 3F8KA 3GUXA 4CGMA 4CRZB 1YK3A 2CNTA 2F5IA 4QUSA 1P4NA 3DDDA 5CPAA 5CBMA 5J8FA 2BSWA 3KGQA 5KTDA 1R3NA 4XNHC 2AFMA 4NGQA 4NGMA 3TOBA 3G8WA 2I79A 4FAIA 1ZLIA 2C1CA 3F5BA 4YGOA 1BO4A 5HVHA 3TO7A 4NSQA 1LFWA 3P2HA 2QJ8A 1MJBA 2B4DA 1TKHA 4FD4A 4UIAA 1M1DA 4EWTA 4JD6A 5I4MA 3V8IA 2PR1A 2V8VA 1Q2YA 1LAMA 1F2OA 3IIBA 2ODFA 2YGWA 1CG2A 5IX3A 1Z5RA 4IHMA 2VZZA 3S9MA 3B3VA 4AVAA 1NMTA 1R57A 2D4OA 2ZENA 4HNYB 4AVBA 4NGSA 2B4DB 3H8FA 4KVME 3KASA 1LAPA 3GY9A 3EY5A 2Q7BA 3EXNA 4QVTA 1YW6A 2BOAA 4MI4A 1R43A 5H86A 1M44A 1JQGA 4R87A 3VWDA 4X2TA 1Y7EA 3N7ZA 2GU2A 1LOKA 3D68A 4R6TA 1XOVA 2J9AA 1YVOA 4UWIA 4KOSA 5C88A 2B4BA 2JBKA 3PB9X 4Q36A 4MCSA 1TF8A 5E96A 1Z4RA 1FT7A 5AG5A 4K3NA 5A27A 2DPTA 3LWUA 2Z3KA 4KSIA 2H5MA 4C7HA 4ORFA 3CXQA 2V77A 4MRIA 5I0CA 1CPXA 2HUZA 2YNDA 4U9YA 3CT9A 2AFSA 3WR7A 4DNCA 4KORA 2CF4A 2JEWA 2QVPA 3LD2A 4CGNA 2CTCA 4A38A 4MHYA 4F9VA 4RUHA 4KS9A 5D8NA 4CGOA 4Q38A 3L2NA 5HXDA 3IO1A 4XPKA 1Z8WA 2EK9A 3KR5A 3NH4A 1LRZA 4ZYQA 1HDUA 4HNWB 6CPAA 3D67A 4JYWA 2RC4A 5HVFA 5AGEA 2EVNA 4C68A 3D2PA 2D4PA 4LX9A 5HVGA 4NF1A 5K8PA 2Y0MA 4DYOA 4JZ0A 3G3SA 3FF3A 5J8CA 1CJWA 2XEFA 4QB9A 2OH1A 1RTQA 3V38A 3VARA 3WC6A 1N71A 4A94A 3GB0A
chains in the Genus database with same CATH topology
3KKWA 4JJXA 5C82A 1BOBA 2ZW4A 5AG6A 1Y7RA 2B58A 4MFKA 4KSFA 2FS5A 2PRBA 4ZGYB 2PSWA 4CAWA 2FE7A 5AG4A 2VXKA 4R3LA 4MBUA 4B12A 2JDCA 2FSRA 3IU2A 3PGPA 2QECA 2Z0ZA 1YGHA 2J8NA 3DSBA 3A9LA 4NCZA 2P6GA 2R8VA 2ATRA 2R98A 2K5TA 3R1KA 2P6EA 1ON0A 3EFAA 2Z3PA 4UFWA 2Z3MA 3UY5A 2NMTA 4OLLA 3VWEA 2PQ8A 1S7KA 2PC1A 1S3ZA 4ONUA 3R95A 2I00A 2O28A 1RO5A 2Z3OA 4PSXA 2ZW7A 1S7NA 5ISVA 1YR0A 2FIAA 3PZJA 2CNMA 1NE9A 1Z4EA 1VHSA 4UFVA 1IICA 2YNCA 3TCVA 4CGLA 1OZPA 4HKFA 4MFQA 1RXTA 3SXNA 1B87A 2HQYA 2OZHA 2VZYA 4JLYA 4ZBGA 5JQ4A 2PR8A 3S6FA 1M4DA 2KCWA 4FD7A 4AG7A 5G1ZA 2CY2A 1WWZA 4EVYA 4E8OA 4FD6A 1KUYA 2B5GB 4HNXB 2WPXA 1MK4A 2AE6A 4B14A 2BUEA 1J4JA 4B13A 2BEIA 1XIXA 1KUXA 3FIXA 4GS4A 2AJ6A 4X5KA 2WUUA 2ZW5A 5H84A 1MJ9A 2B3UA 2FT0A 4PK3A 2FIWA 2VEZA 3DNSA 2P0WA 4J3GA 2Z3NA 2P6FA 2EUIA 3FNCA 5F47A 5IB0A 4A33A 3S6GA 2B3VA 4CAVA 3GKRA 4II9A 2JEVA 1TIQA 4MFLA 4YFJA 4CYPA 5F46A 1I21A 3IGRA 3TFYA 3W6SA 3F0AA 4A30A 3IWEA 4BBHA 1IYLA 4KVXA 3SXOA 4C2ZA 3TO6A 4MHDA 4R9MA 1Q2DA 3W6XA 3S6KA 4XPDC 2FXFA 3R9GA 4UBRA 4BMHA 1S5KA 1XF8A 2VBQA 2JDDA 4U5YA 4MFJA 4KOTA 4IUSA 4RI1A 5F48A 4OADA 4KSAA 2BL1A 4KOWA 3T9YA 2YNCC 1B6BA 3C26A 4KLVA 5DWMA 4A31A 4CYNA 1YLEA 4U9ZA 4XPLA 3TE4A 2J8MA 3SHPA 4F6AA 4LUAA 4AVCA 2R1IA 3R9FA 4Y49B 1V0CA 4XPDB 1YVKA 2ARHA 5KTAA 3D2MA 5G22A 2OZGA 3EC4A 2G0BA 4MJ8A 4KOXA 4H6ZA 4OAEA 1SQHA 4UCMA 2Q4VA 2ZXVA 4M3SA 2A4NA 4A32A 4PK2A 3P2FA 3CXSA 4QC6A 3NE7A 3B8GA 4A2ZA 4UWJA 4KLWA 4H89A 2Q4YA 1QSNA 2WSAA 4CAXA 4E0AA 4MFPA 1XE4A 3TTHA 1I12A 4MY3A 4C2XA 1UFHA 3K9UA 2Q0YA 2FL4A 1WK4A 2B5GA 1K4JA 3I9SA 1NSLA 2OZUA 4PSWA 4JXQA 2Z10A 4AB7A 3I3GA 3BLNA 4CYOA 2DXQA 4KUAA 2VI7A 5A28A 2Z3LA 1KZFA 1IB1E 1XEBA 5CNPA 2WPWA 2YNEA 3R96A 5G21A 4E2AA 4XNHB 5HMNA 2QIRA 4FD5A 2Q44A 1Z9UA 5GCNA 1MJAA 2ZPAA 3DR6A 2GANA 4KOUA 4JXRA 3ZJ0A 3FBUA 3TOAA 2REFA 3PP9A 4B10A 3EO4A 2R7HA 3MGDA 5EC4A 2REEA 4PV6A 2Z11A 3FYNA 1YX0A 1Y9KA 3H4QA 3FXTA 2JLMA 4CGPA 4Y49C 4CAFA 4KVOE 4B5PA 4AG9A 4A95A 4I49A 4QBJA 3DR8A 4L8AA 4B5PB 2ZW6A 1QSOA 4B11A 5BWAB 2C27A 4F0YA 1PU9A 4L89A 4RS2A 3E0KA 5IV0A 4H6UA 1QSRA 2CNSA 4NXYA 4UA3A 2CXAA 5F49A 2J8RA 1Y9WA 3QB8A 1KUVA 2DPSA 2QMLA 4UCPA 4F0XA 4NEXA 3BJ8A 5FVJA 5G20A 1Q2CA 2IL4A 1CM0A 5JPHA 5AG7A 1PUAA 3GYAA 5KTCA 1L0CA 2OB0A 1M4GA 4C7IA 1QSTA 2GIVA 1I1DA 4CS0B 2GE3A 3S6HA 3TO9A 1M4IA 1YREA 3CXPA 3JTKA 4KUBA 4MFZA 3BJ7A 4B5OA 2PDOA 5DWNA 1GHEA 2FCKA 3IU1A 3D8PA 5EBVA 4IF5A 4KZTA 4C2YA 4UCNA 1VKCA 4R57A 1ZO0A 4KOVA 4CAEA 4YRHA 2G3AA 3H5ZA 5HH1A 4JWPA 4CRYB 3JUWA 1S7LA 3ZZIA 1S60A 3RYOA 2OU2A 1IYKA 1S7FA 3QAHA 2G3TA 3FRMA 3IWGA 3JVNA 4UFXA 3R9EA 1P0HA 1FY7A 3T90A 2HV2A 2VQYA 3LODA 1XMTA 1IIDA 4M85A 3OWCA 1QSMA 3TT2A 3FB3A 4KOYA 4CYQA 2X7BA 2Q04A 1U6MA 3D3SA 4K30A 4MY0A 4R3KA 3W91A 3F8KA 4CGMA 4CRZB 1YK3A 2CNTA 2F5IA 4QUSA 1P4NA 3DDDA 5J8FA 5KTDA 2BSWA 4XNHC 3TOBA 3G8WA 2I79A 3F5BA 4YGOA 1BO4A 3TO7A 4NSQA 3P2HA 1MJBA 2B4DA 4FD4A 1M1DA 4JD6A 3V8IA 2PR1A 1Q2YA 2YGWA 5IX3A 2VZZA 4AVAA 1NMTA 1R57A 2D4OA 4HNYB 4AVBA 2B4DB 4KVME 3GY9A 3EY5A 2Q7BA 3EXNA 4QVTA 4MI4A 5H86A 1M44A 4R87A 3VWDA 3N7ZA 1YVOA 4UWIA 4KOSA 5C88A 2B4BA 4Q36A 5E96A 1Z4RA 5AG5A 5A27A 2DPTA 2Z3KA 2H5MA 4C7HA 4ORFA 3CXQA 2HUZA 2YNDA 4U9YA 3WR7A 4DNCA 4KORA 5I0CA 3LD2A 4CGNA 4KS9A 4CGOA 4Q38A 4XPKA 1LRZA 4HNWB 2RC4A 5AGEA 2EVNA 4C68A 3D2PA 2D4PA 4LX9A 4NF1A 2Y0MA 3G3SA 5J8CA 1CJWA 4QB9A 2OH1A 1N71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KKW A;  4JJX A;  5C82 A;  1BOB A;  2ZW4 A;  1Y7R A;  2B58 A;  2FS5 A;  2PRB A;  2PSW A;  4CAW A;  2FE7 A;  2VXK A;  4R3L A;  4MBU A;  2JDC A;  2FSR A;  3PGP A;  2QEC A;  2Z0Z A;  1YGH A;  2J8N A;  3DSB A;  4NCZ A;  2P6G A;  2R8V A;  2ATR A;  2R98 A;  2K5T A;  3R1K A;  2P6E A;  1ON0 A;  3EFA A;  3UY5 A;  2NMT A;  4OLL A;  3VWE A;  2PQ8 A;  1S7K A;  2PC1 A;  1S3Z A;  4ONU A;  3R95 A;  2I00 A;  2O28 A;  1RO5 A;  4PSX A;  2ZW7 A;  1S7N A;  5ISV A;  1YR0 A;  2FIA A;  3PZJ A;  2CNM A;  1NE9 A;  1Z4E A;  1VHS A;  1IIC A;  3TCV A;  1OZP A;  4HKF A;  1RXT A;  3SXN A;  1B87 A;  2HQY A;  2OZH A;  2VZY A;  4JLY A;  4ZBG A;  5JQ4 A;  2PR8 A;  3S6F A;  1M4D A;  2KCW A;  4FD7 A;  4AG7 A;  2CY2 A;  1WWZ A;  4EVY A;  4E8O A;  4FD6 A;  1KUY A;  2B5G B;  2WPX A;  4HNX B;  1MK4 A;  2AE6 A;  2BUE A;  1J4J A;  2BEI A;  1XIX A;  1KUX A;  3FIX A;  4GS4 A;  2AJ6 A;  4X5K A;  2ZW5 A;  5H84 A;  1MJ9 A;  2B3U A;  2FT0 A;  4PK3 A;  2FIW A;  2VEZ A;  3DNS A;  2P0W A;  4J3G A;  2P6F A;  2EUI A;  3FNC A;  5F47 A;  5IB0 A;  3S6G A;  2B3V A;  4CAV A;  3GKR A;  4II9 A;  2JEV A;  1TIQ A;  4YFJ A;  5F46 A;  1I21 A;  3IGR A;  3TFY A;  3W6S A;  3F0A A;  1IYL A;  4KVX A;  3SXO A;  3TO6 A;  4MHD A;  4R9M A;  1Q2D A;  3W6X A;  3S6K A;  4XPD C;  2FXF A;  3R9G A;  4UBR A;  4BMH A;  1S5K A;  1XF8 A;  2VBQ A;  2JDD A;  4U5Y A;  4KOT A;  4IUS A;  4RI1 A;  5F48 A;  4OAD A;  2BL1 A;  4KOW A;  3T9Y A;  1B6B A;  3C26 A;  4KLV A;  5DWM A;  1YLE A;  4U9Z A;  4XPL A;  3TE4 A;  2J8M A;  3SHP A;  4F6A A;  4LUA A;  4AVC A;  2R1I A;  3R9F A;  4Y49 B;  1V0C A;  4XPD B;  1YVK A;  2ARH A;  5KTA A;  3D2M A;  2OZG A;  3EC4 A;  2G0B A;  4MJ8 A;  4KOX A;  4H6Z A;  4OAE A;  1SQH A;  2Q4V A;  2ZXV A;  4M3S A;  2A4N A;  4PK2 A;  3P2F A;  3CXS A;  4QC6 A;  3NE7 A;  3B8G A;  4UWJ A;  4KLW A;  2Q4Y A;  4H89 A;  1QSN A;  4CAX A;  4E0A A;  1XE4 A;  3TTH A;  4MY3 A;  1I12 A;  1UFH A;  3K9U A;  2Q0Y A;  2FL4 A;  1WK4 A;  2B5G A;  1K4J A;  3I9S A;  1NSL A;  2OZU A;  4PSW A;  4JXQ A;  2Z10 A;  4AB7 A;  3I3G A;  3BLN A;  2DXQ A;  4KUA A;  2VI7 A;  1KZF A;  1IB1 E;  1XEB A;  5CNP A;  2WPW A;  3R96 A;  4E2A A;  4XNH B;  5HMN A;  2QIR A;  4FD5 A;  2Q44 A;  1Z9U A;  5GCN A;  1MJA A;  2ZPA A;  3DR6 A;  2GAN A;  4KOU A;  4JXR A;  3ZJ0 A;  3FBU A;  3TOA A;  2REF A;  3PP9 A;  3EO4 A;  2R7H A;  3MGD A;  5EC4 A;  2REE A;  4PV6 A;  2Z11 A;  3FYN A;  1YX0 A;  1Y9K A;  3H4Q A;  3FXT A;  2JLM A;  4Y49 C;  4KVO E;  4B5P A;  4AG9 A;  4I49 A;  4QBJ A;  3DR8 A;  4L8A A;  4B5P B;  2ZW6 A;  1QSO A;  2C27 A;  4F0Y A;  1PU9 A;  4L89 A;  4RS2 A;  3E0K A;  5IV0 A;  4H6U A;  1QSR A;  2CNS A;  4NXY A;  4UA3 A;  5F49 A;  2J8R A;  1Y9W A;  3QB8 A;  1KUV A;  2QML A;  4NEX A;  3BJ8 A;  5FVJ A;  1Q2C A;  2IL4 A;  1CM0 A;  5JPH A;  1PUA A;  3GYA A;  5KTC A;  1L0C A;  2OB0 A;  1M4G A;  1QST A;  2GIV A;  1I1D A;  4CS0 B;  2GE3 A;  3S6H A;  3TO9 A;  1M4I A;  1YRE A;  3CXP A;  4KUB A;  3BJ7 A;  4B5O A;  2PDO A;  5DWN A;  1GHE A;  2FCK A;  3D8P A;  5EBV A;  4IF5 A;  4KZT A;  1VKC A;  4R57 A;  4KOV A;  4YRH A;  2G3A A;  5HH1 A;  4JWP A;  4CRY B;  3JUW A;  1S7L A;  3ZZI A;  1S60 A;  3RYO A;  2OU2 A;  1IYK A;  1S7F A;  3QAH A;  2G3T A;  3FRM A;  3IWG A;  3JVN A;  3R9E A;  1P0H A;  1FY7 A;  3T90 A;  2HV2 A;  2VQY A;  3LOD A;  1XMT A;  1IID A;  4M85 A;  3OWC A;  1QSM A;  3TT2 A;  3FB3 A;  4KOY A;  2X7B A;  2Q04 A;  1U6M A;  3D3S A;  4K30 A;  4MY0 A;  4R3K A;  3W91 A;  3F8K A;  4CRZ B;  1YK3 A;  2CNT A;  2F5I A;  4QUS A;  1P4N A;  3DDD A;  5J8F A;  5KTD A;  2BSW A;  4XNH C;  3TOB A;  3G8W A;  2I79 A;  3F5B A;  4YGO A;  1BO4 A;  3TO7 A;  4NSQ A;  3P2H A;  1MJB A;  2B4D A;  4FD4 A;  1M1D A;  4JD6 A;  3V8I A;  2PR1 A;  1Q2Y A;  5IX3 A;  2VZZ A;  4AVA A;  1NMT A;  1R57 A;  2D4O A;  4HNY B;  4AVB A;  2B4D B;  4KVM E;  3GY9 A;  3EY5 A;  2Q7B A;  3EXN A;  4QVT A;  4MI4 A;  5H86 A;  1M44 A;  4R87 A;  3VWD A;  3N7Z A;  1YVO A;  4UWI A;  4KOS A;  5C88 A;  2B4B A;  5E96 A;  1Z4R A;  2H5M A;  4ORF A;  3CXQ A;  2HUZ A;  4U9Y A;  3WR7 A;  4DNC A;  4KOR A;  5I0C A;  3LD2 A;  4XPK A;  1LRZ A;  4HNW B;  2RC4 A;  2EVN A;  3D2P A;  2D4P A;  4LX9 A;  4NF1 A;  2Y0M A;  3G3S A;  5J8C A;  1CJW A;  4QB9 A;  2OH1 A;  1N71 A; 
#chains in the Genus database with same CATH topology
 3KKW A;  4JJX A;  4PXC A;  1BOB A;  1ARL A;  4GXH A;  2ZW4 A;  5C82 A;  5AG6 A;  1Y7R A;  2B58 A;  4MFK A;  4UF4 A;  2IQ6 A;  4KSF A;  2FS5 A;  4O23 A;  2G9D A;  2PRB A;  3GIU A;  4OME A;  2CIJ A;  4ZGY B;  2PSW A;  2AFX A;  3SI1 A;  4CAW A;  4OIW A;  2FE7 A;  3CPX A;  3SJF A;  5AG4 A;  2Q43 A;  5IB9 A;  3MRU A;  4OC0 A;  3PB6 X;  2VXK A;  4R3L A;  2PE3 A;  4MBU A;  4X8I A;  4B12 A;  4WWV A;  2JDC A;  2FSR A;  3IU2 A;  3PGP A;  2QEC A;  2Z0Z A;  1YGH A;  2PJC A;  3D7H A;  2ZEH A;  5DS0 A;  2J8N A;  3DSB A;  3A9L A;  4NCZ A;  2FVG A;  2P6G A;  2R8V A;  1XRY A;  3SI2 A;  2ATR A;  4MCP A;  2PRQ A;  2R98 A;  4R7M A;  3LMS A;  2K5T A;  3R1K A;  2P6E A;  1ON0 A;  3EFA A;  2Z3P A;  1H8L A;  2XEJ A;  2XEI A;  2Z3M A;  4UFW A;  3UY5 A;  3PFE A;  2NMT A;  4OLL A;  3VWE A;  2PQ8 A;  2ZEL A;  3FJU A;  5LRK A;  1QMU A;  1S7K A;  2PC1 A;  4IK2 A;  2GRE A;  1S3Z A;  2AFU A;  4ONU A;  5J1Q A;  4FBE A;  3D4U A;  3R95 A;  2I00 A;  2O28 A;  3WC5 A;  1AMP A;  3GLJ A;  1RO5 A;  1ELM P;  2V8H A;  2Z3O A;  4LQ6 A;  4PSX A;  2ZW7 A;  4ZY2 A;  1S7N A;  5ISV A;  1TF9 A;  1YR0 A;  1YQE A;  2FIA A;  3PZJ A;  2PJ2 A;  2CNM A;  2Q7S A;  1NE9 A;  1Z4E A;  3NH5 A;  1VHS A;  4OC1 A;  3TX8 A;  4UFV A;  3FX6 A;  2Q51 A;  4UEE A;  4OC5 A;  1IIC A;  2YNC A;  3TCV A;  4CGL A;  1OZP A;  4HKF A;  5LRG A;  4MFQ A;  1RXT A;  3IEH A;  3SXN A;  1B87 A;  2HQY A;  2OZH A;  2VZY A;  4JLY A;  4ZBG A;  5LRJ A;  5JQ4 A;  2PR8 A;  2NSM A;  3S6F A;  1M4D A;  2KCW A;  4FD7 A;  4ZX8 A;  4AG7 A;  5G1Z A;  1OBR A;  2CY2 A;  1WWZ A;  4EVY A;  4E8O A;  4FD6 A;  1KUY A;  2B5G B;  2WPX A;  4HNX B;  2C6P A;  1MK4 A;  2AE6 A;  4B14 A;  2BUE A;  3KHZ A;  1J4J A;  4B13 A;  2BEI A;  1XIX A;  1KUX A;  2Q4Z A;  3FIX A;  3BI1 A;  2AJ6 A;  4GS4 A;  4X5K A;  2WUU A;  2ZW5 A;  1F2P A;  1Y0R A;  2VL1 A;  5H84 A;  1MJ9 A;  2B3U A;  2FT0 A;  3V7Z A;  2PJ3 A;  2PVV A;  4PK3 A;  1IOF A;  1ZLH A;  4OKO A;  2FIW A;  2VEZ A;  1Q7L A;  3DNS A;  3KQX A;  2P0W A;  4J3G A;  2ZEM A;  3B3W A;  2Z3N A;  2P6F A;  2EUI A;  3FNC A;  3FED A;  5F47 A;  5IB0 A;  3IWW A;  3FVL A;  4A33 A;  5K8N A;  3S6G A;  4YU9 A;  5JH9 A;  2B3V A;  4CAV A;  3QNV A;  4P4B A;  4TNU A;  3GKR A;  3NFZ A;  5THW A;  4II9 A;  2JEV A;  1TIQ A;  4MFL A;  4YFJ A;  4CYP A;  5F46 A;  1Z8T A;  3FH4 A;  3KQZ A;  1I21 A;  2XEG A;  3IGR A;  3SJX A;  3W6S A;  4OC3 A;  5JM6 A;  3TFY A;  2BCO A;  3FMC A;  3F0A A;  4RN7 A;  4A30 A;  3IWE A;  4NGN A;  4BBH A;  1VHO A;  4PXE A;  1BLL E;  1IYL A;  2HC9 A;  3NH8 A;  4P4E A;  1VIX A;  4KVX A;  3SXO A;  3PEI A;  1XMB A;  3I1U A;  5D29 A;  4C2Z A;  3TO6 A;  3B3S A;  3MN8 A;  4MHD A;  2AFZ A;  4R9M A;  1Q2D A;  2PIY A;  4GM5 A;  4XPD C;  4P4D A;  3S6K A;  4M6H A;  2FXF A;  3W6X A;  4BIN A;  3FEE A;  4P44 A;  3CPA A;  3R9G A;  3K2K A;  4UBR A;  3KL9 A;  4BMH A;  3SJG A;  1S5K A;  1XF8 A;  2RFH A;  4MCQ A;  1NSA A;  4Z65 A;  4ZI6 A;  2F7V A;  2VBQ A;  2JDD A;  4A37 A;  4U5Y A;  3BI0 A;  1DE4 C;  2PJ9 A;  3QAY A;  4KOT A;  4IUS A;  4MFJ A;  4NGT A;  4RI1 A;  1YW4 A;  3RBU A;  2ZEO A;  3DLJ A;  4P10 A;  2EO8 A;  1IY7 A;  1JWQ A;  5F48 A;  1CPS A;  1X10 A;  4OAD A;  4KSA A;  2BL1 A;  1Z8L A;  4KOW A;  3T9Y A;  2YNC C;  3PB8 X;  5LYI A;  3CDX A;  1B6B A;  2ABZ A;  3C26 A;  3RO0 A;  4KLV A;  5DWM A;  3T8W A;  4A31 A;  4P4I A;  1YLE A;  4U9Z A;  1PYT B;  4XPL A;  4A39 A;  5LYD A;  4CYN A;  5JGF A;  3TE4 A;  2J8M A;  3SHP A;  1XBU A;  4LUA A;  4OID A;  4R76 A;  4AVC A;  4F6A A;  2I3C A;  2R1I A;  3R9F A;  4Y49 B;  4UEF A;  1V0C A;  4XPD B;  1YVK A;  2ARH A;  1CX8 A;  5KTA A;  3D2M A;  4LQG A;  5G22 A;  2OZG A;  4EFD A;  3EC4 A;  2G0B A;  4DUK A;  2ZOG A;  4MJ8 A;  4KOX A;  2V8D A;  4H6Z A;  3CZX A;  4ZX9 A;  4OAE A;  1SQH A;  4UCM A;  2Q4V A;  3BXM A;  4ZY1 A;  2ZXV A;  2PVW A;  4M3S A;  4W9Y A;  4MMO A;  1Z8X A;  2A4N A;  2ZED A;  4A32 A;  4PK2 A;  3P2F A;  1VHE A;  3CXS A;  4QC6 A;  3NE7 A;  4EME A;  3B8G A;  5LYF A;  4A2Z A;  4UWJ A;  2PJ1 A;  3LAC A;  4HPS A;  3B35 A;  4M6I A;  4KLW A;  1M4L A;  2Q4Y A;  1QSN A;  2WSA A;  4H89 A;  4Q7A A;  4CAX A;  3H8E A;  4E0A A;  1PCA A;  4MFP A;  1XE4 A;  4WJB A;  3TTH A;  1I12 A;  4MY3 A;  4C2X A;  1UFH A;  3K9U A;  3TC8 A;  2Q0Y A;  3WT4 A;  3RAM A;  2FL4 A;  4NFR A;  1WK4 A;  3JRU A;  2B5G A;  1K4J A;  1CP6 A;  4MHP A;  3I9S A;  1NSL A;  2OZU A;  2PCU A;  3N5F A;  1XFO A;  4PSW A;  4JXQ A;  2Z10 A;  2EK8 A;  4AB7 A;  1TXR A;  3BLN A;  2GFQ A;  3I3G A;  2OOT A;  2DXQ A;  4CYO A;  4UEZ A;  4KUA A;  4CPA A;  2WYR A;  2VI7 A;  1A2Z A;  2Z3L A;  1KZF A;  3NA6 A;  4PQA A;  5A28 A;  2IMO A;  2ZEP A;  1IB1 E;  2PJ4 A;  4PPZ A;  4F8Z A;  1XEB A;  5CNP A;  4NJQ A;  2WPW A;  2YNE A;  2HB6 A;  3R96 A;  2PJA A;  4R8F A;  5G21 A;  4XNH B;  4E2A A;  2AFO A;  5HMN A;  3D7F A;  2C6G A;  2QIR A;  4FD5 A;  4P4F A;  2Q44 A;  1Z9U A;  5GCN A;  1ARM A;  1MJA A;  2OR4 A;  2ZPA A;  1AUG A;  4H2K A;  3DR6 A;  1HDQ A;  4NJR A;  1Y0Y A;  2GAN A;  4KOU A;  2DEA A;  2O4H A;  2PJ5 A;  4JXR A;  1HEE A;  3ZJ0 A;  2IJZ A;  3FBU A;  3TOA A;  4BD9 A;  3B3T A;  3KR4 A;  4MHZ A;  2REF A;  3HLP A;  3PP9 A;  3KI9 A;  1ZG9 A;  4B10 A;  3PB7 X;  3EO4 A;  2R7H A;  1UWY A;  3D7G A;  3KZW A;  3B3C A;  4AXV A;  2ZEF A;  3KHX A;  1GYT A;  5K8M A;  1DTD A;  2JBJ A;  1LCP A;  3MGD A;  2NYQ A;  5EC4 A;  2REE A;  4TWE A;  4PV6 A;  2AFW A;  3D66 A;  3PB4 X;  2Z11 A;  3FYN A;  1YX0 A;  1QQ9 A;  1Y9K A;  4MHN A;  2WZN A;  3H4Q A;  2BO9 A;  3FXT A;  2JLM A;  4ONW A;  4Y49 C;  4CAF A;  4CGP A;  1KWM A;  4KVO E;  3B2Y A;  3S9N A;  4B5P A;  4AG9 A;  1LAN A;  4P45 A;  4A95 A;  4I49 A;  4QBJ A;  3DGV A;  1AYE A;  3DR8 A;  2ZOF A;  4L8A A;  4B5P B;  2GLJ A;  2ZW6 A;  1QSO A;  3IFE A;  4B11 A;  1IU8 A;  4G1P A;  4DJL A;  5BWA B;  2C27 A;  2ZEG A;  4F0Y A;  1PU9 A;  4L89 A;  4RS2 A;  3E0K A;  5IV0 A;  4H6U A;  1QSR A;  2CNS A;  4FUU A;  4NXY A;  1BPN A;  4UA3 A;  2CXA A;  5F49 A;  2J8R A;  1Y9W A;  2PJ0 A;  3QB8 A;  4IAV A;  1KUV A;  2DPS A;  2QML A;  2PIZ A;  4UCP A;  4F0X A;  4NEX A;  3BJ8 A;  4P6Y A;  5FVJ A;  5G20 A;  1Q2C A;  2IL4 A;  5LYL A;  1CM0 A;  2ANP A;  5JPH A;  5AG7 A;  1PUA A;  4FWU A;  3GYA A;  5EMI A;  5KTC A;  1L0C A;  3SJE A;  2OB0 A;  2PJ7 A;  3IJ3 A;  4X3R A;  1M4G A;  2POK A;  4P4J A;  4C7I A;  1QST A;  2GIV A;  3PBB A;  1XJO A;  1I1D A;  3PBE A;  2CTB A;  1IGB A;  4MCR A;  4OC4 A;  4CS0 B;  2GE3 A;  3H8G A;  3S6H A;  3TO9 A;  1M4I A;  1YRE A;  2O53 A;  2PJ8 A;  3WAB A;  3CXP A;  3HUV A;  8CPA A;  1YME A;  2EWB A;  3JTK A;  4KUB A;  1FNO A;  1VGY A;  4MFZ A;  3BJ7 A;  4OC2 A;  4B5O A;  1TKJ A;  2PDO A;  5DWN A;  1BPM A;  1GHE A;  2V8G A;  2FCK A;  1ELL P;  3IU1 A;  3K9T A;  3ISX A;  3D8P A;  5EBV A;  4IF5 A;  4KZT A;  4MXU A;  4UCN A;  4C2Y A;  1ZG7 A;  1VKC A;  4M6G A;  4R57 A;  1ZO0 A;  3S9L A;  2GLF A;  4KOV A;  3VH9 A;  3RZA A;  3PFO A;  3FEC A;  5F09 A;  2ZEE A;  7CPA A;  1BAV A;  3ISZ A;  4CAE A;  2RB7 A;  3D7D A;  4YRH A;  2G3A A;  3H5Z A;  2DF5 A;  1YLO A;  4PXB A;  5HH1 A;  3RNZ A;  2PJB A;  1YSJ A;  3B7I A;  4JWP A;  4CRY B;  4ZY0 A;  3JUW A;  1S7L A;  3ZZI A;  1S60 A;  3SI0 A;  3RYO A;  1CP7 A;  3VAT A;  3NE8 A;  4OP4 A;  2OU2 A;  1IYK A;  1S7F A;  3QAH A;  2EBJ A;  2G3T A;  3FRM A;  3IWG A;  3JVN A;  1CBX A;  3PRT A;  2QYV A;  3BHX A;  4UFX A;  3R9E A;  1P0H A;  4F9U A;  4NGP A;  1FY7 A;  2F8H A;  3IC1 A;  3T90 A;  4B6Z A;  2HV2 A;  4NGR A;  2VQY A;  3LOD A;  1XMT A;  4PXD A;  1IID A;  3WC7 A;  1EE3 P;  4M85 A;  3OWC A;  1QSM A;  2C6C A;  1Z2L A;  4UIB A;  3TT2 A;  1X12 A;  3FB3 A;  1TKF A;  4KOY A;  1ZG8 A;  2PJ6 A;  4CYQ A;  2X7B A;  2Q04 A;  1U6M A;  3D3S A;  1IOI A;  5K8O A;  1F57 A;  4K30 A;  4MY0 A;  4R3K A;  5ELY A;  3W91 A;  4YWY A;  3F8K A;  3GUX A;  4CGM A;  4CRZ B;  1YK3 A;  2CNT A;  2F5I A;  4QUS A;  1P4N A;  3DDD A;  5CPA A;  5CBM A;  5J8F A;  2BSW A;  3KGQ A;  5KTD A;  1R3N A;  4XNH C;  2AFM A;  4NGQ A;  4NGM A;  3TOB A;  3G8W A;  2I79 A;  4FAI A;  1ZLI A;  2C1C A;  3F5B A;  4YGO A;  1BO4 A;  5HVH A;  3TO7 A;  4NSQ A;  1LFW A;  3P2H A;  2QJ8 A;  1MJB A;  2B4D A;  1TKH A;  4FD4 A;  4UIA A;  1M1D A;  4EWT A;  4JD6 A;  5I4M A;  3V8I A;  2PR1 A;  2V8V A;  1Q2Y A;  1LAM A;  1F2O A;  3IIB A;  2ODF A;  2YGW A;  1CG2 A;  5IX3 A;  1Z5R A;  4IHM A;  2VZZ A;  3S9M A;  3B3V A;  4AVA A;  1NMT A;  1R57 A;  2D4O A;  2ZEN A;  4HNY B;  4AVB A;  4NGS A;  2B4D B;  3H8F A;  4KVM E;  3KAS A;  1LAP A;  3GY9 A;  3EY5 A;  2Q7B A;  3EXN A;  4QVT A;  1YW6 A;  2BOA A;  4MI4 A;  1R43 A;  5H86 A;  1M44 A;  1JQG A;  4R87 A;  3VWD A;  4X2T A;  1Y7E A;  3N7Z A;  2GU2 A;  1LOK A;  3D68 A;  4R6T A;  1XOV A;  2J9A A;  1YVO A;  4UWI A;  4KOS A;  5C88 A;  2B4B A;  2JBK A;  3PB9 X;  4Q36 A;  4MCS A;  1TF8 A;  5E96 A;  1Z4R A;  1FT7 A;  5AG5 A;  4K3N A;  5A27 A;  2DPT A;  3LWU A;  2Z3K A;  4KSI A;  2H5M A;  4C7H A;  4ORF A;  3CXQ A;  2V77 A;  4MRI A;  5I0C A;  1CPX A;  2HUZ A;  2YND A;  4U9Y A;  3CT9 A;  2AFS A;  3WR7 A;  4DNC A;  4KOR A;  2CF4 A;  2JEW A;  2QVP A;  3LD2 A;  4CGN A;  2CTC A;  4A38 A;  4MHY A;  4F9V A;  4RUH A;  4KS9 A;  5D8N A;  4CGO A;  4Q38 A;  3L2N A;  5HXD A;  3IO1 A;  4XPK A;  1Z8W A;  2EK9 A;  3KR5 A;  3NH4 A;  1LRZ A;  4ZYQ A;  1HDU A;  4HNW B;  6CPA A;  3D67 A;  4JYW A;  2RC4 A;  5HVF A;  5AGE A;  2EVN A;  4C68 A;  3D2P A;  2D4P A;  4LX9 A;  5HVG A;  4NF1 A;  5K8P A;  2Y0M A;  4DYO A;  4JZ0 A;  3G3S A;  3FF3 A;  5J8C A;  1CJW A;  2XEF A;  4QB9 A;  2OH1 A;  1RTQ A;  3V38 A;  3VAR A;  3WC6 A;  1N71 A;  4A94 A;  3GB0 A; 
#chains in the Genus database with same CATH homology
 3KKW A;  4JJX A;  5C82 A;  1BOB A;  2ZW4 A;  5AG6 A;  1Y7R A;  2B58 A;  4MFK A;  4KSF A;  2FS5 A;  2PRB A;  4ZGY B;  2PSW A;  4CAW A;  2FE7 A;  5AG4 A;  2VXK A;  4R3L A;  4MBU A;  4B12 A;  2JDC A;  2FSR A;  3IU2 A;  3PGP A;  2QEC A;  2Z0Z A;  1YGH A;  2J8N A;  3DSB A;  3A9L A;  4NCZ A;  2P6G A;  2R8V A;  2ATR A;  2R98 A;  2K5T A;  3R1K A;  2P6E A;  1ON0 A;  3EFA A;  2Z3P A;  4UFW A;  2Z3M A;  3UY5 A;  2NMT A;  4OLL A;  3VWE A;  2PQ8 A;  1S7K A;  2PC1 A;  1S3Z A;  4ONU A;  3R95 A;  2I00 A;  2O28 A;  1RO5 A;  2Z3O A;  4PSX A;  2ZW7 A;  1S7N A;  5ISV A;  1YR0 A;  2FIA A;  3PZJ A;  2CNM A;  1NE9 A;  1Z4E A;  1VHS A;  4UFV A;  1IIC A;  2YNC A;  3TCV A;  4CGL A;  1OZP A;  4HKF A;  4MFQ A;  1RXT A;  3SXN A;  1B87 A;  2HQY A;  2OZH A;  2VZY A;  4JLY A;  4ZBG A;  5JQ4 A;  2PR8 A;  3S6F A;  1M4D A;  2KCW A;  4FD7 A;  4AG7 A;  5G1Z A;  2CY2 A;  1WWZ A;  4EVY A;  4E8O A;  4FD6 A;  1KUY A;  2B5G B;  4HNX B;  2WPX A;  1MK4 A;  2AE6 A;  4B14 A;  2BUE A;  1J4J A;  4B13 A;  2BEI A;  1XIX A;  1KUX A;  3FIX A;  4GS4 A;  2AJ6 A;  4X5K A;  2WUU A;  2ZW5 A;  5H84 A;  1MJ9 A;  2B3U A;  2FT0 A;  4PK3 A;  2FIW A;  2VEZ A;  3DNS A;  2P0W A;  4J3G A;  2Z3N A;  2P6F A;  2EUI A;  3FNC A;  5F47 A;  5IB0 A;  4A33 A;  3S6G A;  2B3V A;  4CAV A;  3GKR A;  4II9 A;  2JEV A;  1TIQ A;  4MFL A;  4YFJ A;  4CYP A;  5F46 A;  1I21 A;  3IGR A;  3TFY A;  3W6S A;  3F0A A;  4A30 A;  3IWE A;  4BBH A;  1IYL A;  4KVX A;  3SXO A;  4C2Z A;  3TO6 A;  4MHD A;  4R9M A;  1Q2D A;  3W6X A;  3S6K A;  4XPD C;  2FXF A;  3R9G A;  4UBR A;  4BMH A;  1S5K A;  1XF8 A;  2VBQ A;  2JDD A;  4U5Y A;  4MFJ A;  4KOT A;  4IUS A;  4RI1 A;  5F48 A;  4OAD A;  4KSA A;  2BL1 A;  4KOW A;  3T9Y A;  2YNC C;  1B6B A;  3C26 A;  4KLV A;  5DWM A;  4A31 A;  4CYN A;  1YLE A;  4U9Z A;  4XPL A;  3TE4 A;  2J8M A;  3SHP A;  4F6A A;  4LUA A;  4AVC A;  2R1I A;  3R9F A;  4Y49 B;  1V0C A;  4XPD B;  1YVK A;  2ARH A;  5KTA A;  3D2M A;  5G22 A;  2OZG A;  3EC4 A;  2G0B A;  4MJ8 A;  4KOX A;  4H6Z A;  4OAE A;  1SQH A;  4UCM A;  2Q4V A;  2ZXV A;  4M3S A;  2A4N A;  4A32 A;  4PK2 A;  3P2F A;  3CXS A;  4QC6 A;  3NE7 A;  3B8G A;  4A2Z A;  4UWJ A;  4KLW A;  4H89 A;  2Q4Y A;  1QSN A;  2WSA A;  4CAX A;  4E0A A;  4MFP A;  1XE4 A;  3TTH A;  1I12 A;  4MY3 A;  4C2X A;  1UFH A;  3K9U A;  2Q0Y A;  2FL4 A;  1WK4 A;  2B5G A;  1K4J A;  3I9S A;  1NSL A;  2OZU A;  4PSW A;  4JXQ A;  2Z10 A;  4AB7 A;  3I3G A;  3BLN A;  4CYO A;  2DXQ A;  4KUA A;  2VI7 A;  5A28 A;  2Z3L A;  1KZF A;  1IB1 E;  1XEB A;  5CNP A;  2WPW A;  2YNE A;  3R96 A;  5G21 A;  4E2A A;  4XNH B;  5HMN A;  2QIR A;  4FD5 A;  2Q44 A;  1Z9U A;  5GCN A;  1MJA A;  2ZPA A;  3DR6 A;  2GAN A;  4KOU A;  4JXR A;  3ZJ0 A;  3FBU A;  3TOA A;  2REF A;  3PP9 A;  4B10 A;  3EO4 A;  2R7H A;  3MGD A;  5EC4 A;  2REE A;  4PV6 A;  2Z11 A;  3FYN A;  1YX0 A;  1Y9K A;  3H4Q A;  3FXT A;  2JLM A;  4CGP A;  4Y49 C;  4CAF A;  4KVO E;  4B5P A;  4AG9 A;  4A95 A;  4I49 A;  4QBJ A;  3DR8 A;  4L8A A;  4B5P B;  2ZW6 A;  1QSO A;  4B11 A;  5BWA B;  2C27 A;  4F0Y A;  1PU9 A;  4L89 A;  4RS2 A;  3E0K A;  5IV0 A;  4H6U A;  1QSR A;  2CNS A;  4NXY A;  4UA3 A;  2CXA A;  5F49 A;  2J8R A;  1Y9W A;  3QB8 A;  1KUV A;  2DPS A;  2QML A;  4UCP A;  4F0X A;  4NEX A;  3BJ8 A;  5FVJ A;  5G20 A;  1Q2C A;  2IL4 A;  1CM0 A;  5JPH A;  5AG7 A;  1PUA A;  3GYA A;  5KTC A;  1L0C A;  2OB0 A;  1M4G A;  4C7I A;  1QST A;  2GIV A;  1I1D A;  4CS0 B;  2GE3 A;  3S6H A;  3TO9 A;  1M4I A;  1YRE A;  3CXP A;  3JTK A;  4KUB A;  4MFZ A;  3BJ7 A;  4B5O A;  2PDO A;  5DWN A;  1GHE A;  2FCK A;  3IU1 A;  3D8P A;  5EBV A;  4IF5 A;  4KZT A;  4C2Y A;  4UCN A;  1VKC A;  4R57 A;  1ZO0 A;  4KOV A;  4CAE A;  4YRH A;  2G3A A;  3H5Z A;  5HH1 A;  4JWP A;  4CRY B;  3JUW A;  1S7L A;  3ZZI A;  1S60 A;  3RYO A;  2OU2 A;  1IYK A;  1S7F A;  3QAH A;  2G3T A;  3FRM A;  3IWG A;  3JVN A;  4UFX A;  3R9E A;  1P0H A;  1FY7 A;  3T90 A;  2HV2 A;  2VQY A;  3LOD A;  1XMT A;  1IID A;  4M85 A;  3OWC A;  1QSM A;  3TT2 A;  3FB3 A;  4KOY A;  4CYQ A;  2X7B A;  2Q04 A;  1U6M A;  3D3S A;  4K30 A;  4MY0 A;  4R3K A;  3W91 A;  3F8K A;  4CGM A;  4CRZ B;  1YK3 A;  2CNT A;  2F5I A;  4QUS A;  1P4N A;  3DDD A;  5J8F A;  5KTD A;  2BSW A;  4XNH C;  3TOB A;  3G8W A;  2I79 A;  3F5B A;  4YGO A;  1BO4 A;  3TO7 A;  4NSQ A;  3P2H A;  1MJB A;  2B4D A;  4FD4 A;  1M1D A;  4JD6 A;  3V8I A;  2PR1 A;  1Q2Y A;  2YGW A;  5IX3 A;  2VZZ A;  4AVA A;  1NMT A;  1R57 A;  2D4O A;  4HNY B;  4AVB A;  2B4D B;  4KVM E;  3GY9 A;  3EY5 A;  2Q7B A;  3EXN A;  4QVT A;  4MI4 A;  5H86 A;  1M44 A;  4R87 A;  3VWD A;  3N7Z A;  1YVO A;  4UWI A;  4KOS A;  5C88 A;  2B4B A;  4Q36 A;  5E96 A;  1Z4R A;  5AG5 A;  5A27 A;  2DPT A;  2Z3K A;  2H5M A;  4C7H A;  4ORF A;  3CXQ A;  2HUZ A;  2YND A;  4U9Y A;  3WR7 A;  4DNC A;  4KOR A;  5I0C A;  3LD2 A;  4CGN A;  4KS9 A;  4CGO A;  4Q38 A;  4XPK A;  1LRZ A;  4HNW B;  2RC4 A;  5AGE A;  2EVN A;  4C68 A;  3D2P A;  2D4P A;  4LX9 A;  4NF1 A;  2Y0M A;  3G3S A;  5J8C A;  1CJW A;  4QB9 A;  2OH1 A;  1N71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...