3LODA

The crystal structure of the putative acyl-coa n-acyltransferase from klebsiella pneumoniae subsp.pneumoniae mgh 78578
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
154
structure length
145
Chain Sequence
NAMYTITDIAPTDAEFIALIAALDAWQETLDLSQLPPQTVIALAIRSPQGEAVGCGAIVLSEEGFGEMKRVYIDPQHRGQQLGEKLLAALEAKARQRDCHTLRLETGIHQHAAIALYTRNGYQTRCAFAPYQPDPLSVFMEKPLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative acyl-CoA N-acyltransferase
publication title The crystal structure of the putative acyl-CoA N-acyltransferase from Klebsiella pneumoniae
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
total genus 43
structure length 145
sequence length 154
ec nomenclature
pdb deposition date 2010-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3lodA00
1J4JA 1NMTA 4KLVA 4KOUA 2P6GA 1QSOA 2EVNA 1GHEA 5KTCA 3DSBA 3EXNA 2WPWA 1Y9WA 2AJ6A 3T9YA 1M4GA 3KKWA 1IYLA 5IV0A 1M1DA 3DNSA 3SXOA 1K4JA 1NSLA 4JJXA 3NE7A 2JLMA 4CAWA 3GYAA 1Q2DA 2B5GB 4EVYA 2ZW4A 5GCNA 5JPHA 4NXYA 4DNCA 3R1KA 4AG9A 1IICA 1OZPA 2JDDA 3FBUA 4CRZB 2OH1A 4E2AA 4OADA 2FCKA 1YVKA 4BMHA 4IF5A 1S7LA 4MY0A 4XPDB 2J8NA 4XPLA 1XMTA 5F47A 5J8CA 2ATRA 2R8VA 2HQYA 3TTHA 4KOTA 4R57A 5FVJA 4AVBA 2Z10A 4L8AA 2REFA 2OZUA 3ZJ0A 5I0CA 2I79A 2FL4A 3CXSA 4XNHC 4QC6A 4NEXA 1P0HA 1S3ZA 4PK2A 3D2MA 3TO7A 1S7NA 1Z4RA 5H84A 2Q7BA 2HUZA 3D2PA 4KOSA 4FD6A 5CNPA 1IYKA 4Y49C 2QMLA 1QSNA 3BJ8A 1Y7RA 3TOAA 3TOBA 4H89A 4XPKA 2P6EA 2PR8A 3H4QA 4ORFA 2G3AA 5E96A 4NF1A 2IL4A 5EBVA 1YX0A 1KUXA 4UWIA 2KCWA 3FNCA 1S60A 3JUWA 4B5PB 3W6XA 2D4PA 2PDOA 1KUYA 4AVAA 4U9YA 3JVNA 1RXTA 4OAEA 4UA3A 1FY7A 1Y9KA 4ONUA 2CNSA 2I00A 4F0YA 4PSWA 2FXFA 5EC4A 1YR0A 4OLLA 4QUSA 4II9A 3R9GA 3F0AA 2B4DB 2ARHA 1M4DA 4LX9A 2OZHA 4KOVA 4PV6A 1YLEA 4JLYA 4AB7A 4JXRA 1WK4A 1M4IA 1SQHA 1B87A 3R9EA 4GS4A 2QECA 2VBQA 4KVOE 4KUBA 4HNYB 3GKRA 2GE3A 2X7BA 1I21A 3K9UA 3VWDA 4R3LA 2VQYA 3QAHA 3FXTA 5KTAA 3DR8A 4AG7A 2BEIA 3TCVA 1Q2YA 1TIQA 4XNHB 2Z0ZA 3S6FA 2R98A 4KVXA 1IB1E 4X5KA 3R9FA 1VKCA 1V0CA 1XE4A 1VHSA 3P2FA 1S7KA 5DWNA 4CRYB 4KZTA 4M3SA 4KOYA 1YVOA 1NE9A 2OB0A 2VZYA 1BO4A 3S6KA 4U5YA 1QSTA 4Y49B 1MK4A 3TO9A 3N7ZA 3UY5A 2OU2A 4NSQA 3V8IA 4QBJA 2O28A 5DWMA 2FE7A 2J8MA 3EC4A 1XEBA 3G8WA 2PC1A 2H5MA 1QSRA 4MY3A 3S6GA 4IUSA 4I49A 4CAXA 2R7HA 3G3SA 2VXKA 2ZW7A 5F49A 3SXNA 4E8OA 1M44A 1Z4EA 2HV2A 2JEVA 4F6AA 5IB0A 2Z11A 4YRHA 2P0WA 3FIXA 4YFJA 2R1IA 2Q04A 3I9SA 4CS0B 2QIRA 3S6HA 5J8FA 3TO6A 2PQ8A 3W91A 5F46A 1QSMA 1KUVA 2EUIA 4JD6A 5IX3A 4RI1A 3EFAA 1MJBA 1S5KA 2ZW6A 4PK3A 2D4OA 4NCZA 2FS5A 3OWCA 1BOBA 4B5PA 2OZGA 4HNWB 2RC4A 1I12A 2VEZA 1XF8A 2ZW5A 4JWPA 2PRBA 4KLWA 3W6SA 4K30A 2Q0YA 2VI7A 3MGDA 1RO5A 4L89A 2B58A 2BSWA 4KORA 4HNXB 1ON0A 4KOWA 3TT2A 3QB8A 2Y0MA 3DR6A 2GANA 4MBUA 4B5OA 3EO4A 1YGHA 4RS2A 4QB9A 1S7FA 2Q4VA 4U9ZA 4H6ZA 3IWGA 1WWZA 2CNTA 3I3GA 1I1DA 2B5GA 2G3TA 1IIDA 1PUAA 3B8GA 4JXQA 2PR1A 3R96A 1MJAA 3D8PA 1CM0A 2J8RA 2WPXA 2PSWA 3D3SA 2B3VA 1MJ9A 1U6MA 1P4NA 4KVME 3GY9A 5H86A 2BL1A 2FIAA 2DXQA 1UFHA 4UWJA 2NMTA 1CJWA 4FD7A 2CNMA 4PSXA 2VZZA 4CAVA 2BUEA 1N71A 3PZJA 3R95A 3TFYA 3E0KA 3RYOA 4LUAA 4R3KA 3C26A 2G0BA 1LRZA 4H6UA 4FD5A 1L0CA 2F5IA 1YK3A 4MI4A 4M85A 4E0AA 2CY2A 2K5TA 4QVTA 4MHDA 2AE6A 1PU9A 3TE4A 3SHPA 3T90A 3F8KA 3DDDA 1R57A 3EY5A 1KZFA 2Q4YA 3PGPA 2FT0A 4XPDC 2REEA 4KOXA 5F48A 5KTDA 2ZPAA 3VWEA 3P2HA 5C82A 3CXPA 3WR7A 4HKFA 4YGOA 5JQ4A 3FRMA 4R87A 5HMNA 3ZZIA 3FYNA 2GIVA 5ISVA 3BLNA 2B3UA 2ZXVA 2JDCA 5C88A 1Z9UA 1Q2CA 4AVCA 4MJ8A 2C27A 2P6FA 4ZBGA 2A4NA 3FB3A 2B4BA 4FD4A 2B4DA 1XIXA 3LODA 1YREA 1B6BA 4J3GA 3PP9A 2FSRA 4UBRA 2FIWA 3F5BA 4R9MA 5HH1A 2Q44A 3BJ7A 3IGRA 4KUAA 3CXQA 3LD2A
chains in the Genus database with same CATH superfamily
1J4JA 2ZEPA 4NGMA 1NMTA 4KLVA 4KOUA 2PVVA 2P6GA 4IHMA 5AG4A 1CP6A 1QSOA 2PJBA 2EVNA 1GHEA 5KTCA 4B14A 3DSBA 3SI0A 1YMEA 2PIYA 2WPWA 1Y9WA 2ZOGA 3EXNA 4B10A 4ZGYB 2AJ6A 2JBJA 5G1ZA 3IU1A 1XMBA 3T9YA 4BBHA 2JBKA 4MRIA 1HDQA 1M4GA 1YSJA 1XOVA 3KKWA 3PB7X 4ZY0A 1IYLA 2PJ7A 5IV0A 3SJFA 1M1DA 2Q43A 3DNSA 4B12A 3WC6A 3SXOA 1K4JA 4WWVA 4NFRA 4JJXA 4MXUA 1NSLA 2DPSA 5K8NA 2ZELA 2PJ4A 3B3TA 3NE7A 2JLMA 4UWIA 1H8LA 1A2ZA 2GFQA 4CAWA 4MFLA 2Z3KA 1LAMA 3D4UA 3GYAA 4MCPA 2PRQA 1Q2DA 2B5GB 2HB6A 3FX6A 4A39A 4EVYA 4Q7AA 2ZW4A 5HVHA 5K8OA 5GCNA 4UCNA 3MRUA 5JPHA 4C7IA 4NGNA 4AXVA 1PYTB 1TXRA 4NXYA 5F09A 4DNCA 3R1KA 4AG9A 4ZY1A 1IICA 1NSAA 1QQ9A 2EWBA 1CX8A 2AFSA 1LCPA 1ZO0A 1OZPA 5LRJA 2JDDA 3FBUA 4MFQA 4CRZB 2OH1A 4E2AA 3KQZA 3DGVA 4OADA 2Q51A 2C6PA 2FCKA 1XBUA 1YVKA 2F8HA 4IF5A 1S7LA 4BMHA 4G1PA 4MY0A 4XPDB 3GIUA 2J8NA 2PIZA 4MFJA 4XPLA 1XMTA 2V8VA 5F47A 1X12A 5J8CA 2ATRA 2IMOA 3NE8A 4X2TA 2R8VA 4UWJA 2HQYA 3TTHA 2I3CA 4KOTA 4LQ6A 4R57A 5FVJA 2Z10A 4AVBA 4P10A 1Z5RA 2WUUA 4L8AA 1ZLIA 2REFA 2Z3MA 2OZUA 3ZJ0A 5I0CA 1ELLP 3TC8A 4C2ZA 2I79A 4UFWA 3RAMA 3CZXA 2PJ2A 4OC4A 4Q38A 2EBJA 2FL4A 2CTBA 4C68A 2IJZA 3CXSA 4XNHC 1BPMA 4KSIA 2O53A 2PJ8A 1BPNA 4QC6A 1Z8WA 4NEXA 1P0HA 5EMIA 5ELYA 1S3ZA 3H8GA 3KASA 3KZWA 4PK2A 4EMEA 5K8MA 3D2MA 3TO7A 1S7NA 2PCUA 4MCQA 1Z4RA 2AFMA 4F8ZA 5HXDA 2FVGA 5H84A 4M6GA 4CPAA 4P44A 2Q7BA 2HUZA 3D2PA 4KOSA 4A32A 4FD6A 5CNPA 1IYKA 3KHXA 4MCSA 3GUXA 4Y49C 4X8IA 2Q4ZA 4OC3A 4EFDA 5K8PA 2QMLA 1QSNA 3BJ8A 1Y7RA 1PCAA 3D7FA 3TOAA 3B3WA 3D67A 4ZX8A 3FH4A 4PXEA 2QVPA 3PBBA 3TOBA 4H89A 4XPKA 1VHOA 2P6EA 5HVGA 2PR8A 5JH9A 5LRKA 3H4QA 1ZG9A 4ORFA 4CAFA 5J1QA 3KQXA 4MFPA 2G3AA 5E96A 2PVWA 2IL4A 3IWEA 4NF1A 4P4EA 4NGPA 2DF5A 2PJ9A 5EBVA 1YX0A 1KUXA 2Z3OA 2KCWA 3FNCA 1S60A 2C1CA 3I1UA 2PJ5A 3JUWA 4B5PB 3W6XA 2D4PA 2PDOA 1KUYA 3FECA 4U9YA 4AVAA 1Z8LA 2G9DA 2YNEA 2ZEFA 3JVNA 1RXTA 4O23A 4OAEA 4UA3A 2XEGA 4UFVA 1FY7A 1Y9KA 2OR4A 1VIXA 3PB6X 4ONUA 2YGWA 2CNSA 1Y0RA 3FJUA 2I00A 2XEFA 4F0YA 1LAPA 5CBMA 4PSWA 3MN8A 4PXCA 1FT7A 2FXFA 5EC4A 4JZ0A 3VATA 1YR0A 1DTDA 1ARLA 1F2OA 2BCOA 3KI9A 4OLLA 4MHNA 4QUSA 4MHYA 4II9A 3R9GA 3F0AA 2V8GA 2B4DB 4HPSA 4Q36A 3JRUA 3PB4X 4UEZA 3RZAA 2ARHA 3JTKA 1M4DA 2GLJA 2OZHA 4LX9A 4KOVA 4PV6A 1YLEA 1BAVA 2ZENA 4IAVA 4JLYA 2ZEGA 5LYLA 3SI2A 1YW4A 4JXRA 4P6YA 1RTQA 3FF3A 1WK4A 3PB9X 4P4DA 4AB7A 1M4IA 3IJ3A 1SQHA 1B87A 2AFZA 4NGQA 3R9EA 4FWUA 1YLOA 3HUVA 2BOAA 2OOTA 2ODFA 4GS4A 2QECA 2VBQA 3KL9A 4KVOE 1ELMP 2V8DA 2EK9A 1Y0YA 3B3VA 4GM5A 4KUBA 3IFEA 4HNYB 3GKRA 3IO1A 4MFKA 4KSAA 2GE3A 2Q7SA 2V77A 2X7BA 3PB8X 1I21A 3K9UA 3VWDA 2WYRA 4R3LA 1JWQA 2VQYA 2POKA 2XEIA 3PBEA 3FXTA 1XRYA 3FMCA 3QAHA 4CYOA 4Z65A 5KTAA 3DR8A 3SJEA 2BEIA 4AG7A 1CPSA 2IQ6A 3TCVA 1Q2YA 1TIQA 4XNHB 1CBXA 3K2KA 2Z0ZA 2GREA 3WABA 3DLJA 4MHPA 3S6FA 7CPAA 2R98A 4KVXA 1IB1E 3KR5A 2PJCA 1VKCA 1V0CA 4X5KA 3R9FA 1XE4A 1VHSA 3P2FA 1S7KA 5DWNA 3D7DA 4OKOA 4KZTA 4R6TA 2PJAA 4M3SA 1XJOA 4KOYA 4CRYB 2AFXA 2HC9A 1YVOA 4W9YA 3NH5A 2OB0A 1NE9A 1Y7EA 2VZYA 1BO4A 3S6KA 4U5YA 1QSTA 4OC0A 1MK4A 4Y49B 3TO9A 3N7ZA 3UY5A 3QNVA 2OU2A 4H2KA 3V38A 3NH4A 5IB9A 4NSQA 1FNOA 2PE3A 3V8IA 4QBJA 2O28A 5DWMA 2FE7A 1ZG7A 2J8MA 4UF4A 3EC4A 1IY7A 1XEBA 3G8WA 4A38A 1CP7A 2PC1A 4UCPA 5LYDA 3RNZA 2YNDA 2H5MA 1QSRA 2NYQA 2PJ1A 4MY3A 3S6GA 4UFXA 1LFWA 4IUSA 4I49A 4CAXA 3A9LA 5BWAB 2R7HA 2Z3LA 3G3SA 4CYPA 2VXKA 2ZW7A 4RN7A 5F49A 3NFZA 1EE3P 2QYVA 3SXNA 4WJBA 4F9UA 4KSFA 4DUKA 5G22A 4JYWA 4E8OA 3CDXA 1M44A 3WC7A 1Z4EA 2HV2A 1R3NA 1M4LA 4M6HA 2JEVA 4F6AA 4OC1A 5IB0A 2Z11A 4YRHA 2P0WA 3FIXA 4YFJA 3PFEA 3KR4A 4LQGA 3S9LA 2R1IA 2Q04A 1TKFA 3I9SA 3PEIA 4CS0B 2QIRA 3S6HA 1HEEA 4NGSA 3TO6A 5J8FA 2PQ8A 3W91A 1GYTA 4IK2A 1LOKA 4CAEA 5F46A 5AG7A 1IOIA 1KUVA 1QSMA 2PJ6A 2EUIA 4JD6A 4X3RA 4CYNA 5IX3A 4RI1A 1UWYA 1VGYA 3EFAA 1MJBA 1S5KA 2WZNA 2ZW6A 3SI1A 5AG6A 3D68A 3H8EA 4B11A 5AG5A 4PK3A 2D4OA 2VL1A 4NCZA 4FBEA 2FS5A 3OWCA 1IU8A 2YNCA 1BOBA 4NJRA 4B5PA 2OZGA 4M6IA 4ONWA 4HNWB 2RC4A 3VARA 4CGNA 3WT4A 1I12A 3T8WA 3VH9A 3GB0A 2AFWA 4TWEA 4ZX9A 3IC1A 3BI1A 2VEZA 1XF8A 2ZW5A 4JWPA 4PQAA 4A30A 2PRBA 2C6CA 4TNUA 4KLWA 3W6SA 2F7VA 4K30A 2Q0YA 2C6GA 2Z3NA 2VI7A 3QAYA 4UIAA 4ZI6A 3MGDA 1RO5A 3BXMA 4L89A 2B58A 1IOFA 2BSWA 4KORA 1LANA 1XFOA 2QJ8A 4HNXB 4CGPA 4OP4A 1ON0A 1AMPA 1R43A 1TF9A 1TF8A 4KOWA 4OMEA 3TT2A 5G21A 5DS0A 3KHZA 3D7GA 3QB8A 3PFOA 2Y0MA 3DR6A 2GANA 4MBUA 3B3SA 4B5OA 3EO4A 4PXBA 1YGHA 2V8HA 4RS2A 4QB9A 1S7FA 2Q4VA 3ISZA 4U9ZA 4PPZA 4R8FA 4H6ZA 4P45A 1Q7LA 3IWGA 4CGOA 2ABZA 4BINA 2RFHA 1WWZA 3IIBA 4RUHA 4MHZA 4UEFA 4CYQA 4DYOA 4OIDA 2CNTA 3I3GA 1CPXA 1I1DA 2B5GA 2G3TA 1IIDA 1PUAA 2YNCC 3LMSA 2NSMA 2Z3PA 2CXAA 3B2YA 3CPAA 1QMUA 5LYFA 3B8GA 2ZEHA 4JXQA 2PR1A 1Z2LA 4P4FA 4YU9A 3R96A 3FVLA 6CPAA 1MJAA 3D8PA 4MMOA 4A33A 1YW6A 1CM0A 3CT9A 2J8RA 2DPTA 2WPXA 2PSWA 4GXHA 3BI0A 3D3SA 3NH8A 4F0XA 2B3VA 3B35A 3RBUA 1MJ9A 1U6MA 1P4NA 3PRTA 3LACA 4KVME 5HVFA 3TX8A 2PJ0A 3GY9A 5H86A 4FAIA 2BL1A 2FIAA 2ZEOA 2DXQA 4ZYQA 1UFHA 1TKHA 3H5ZA 3IEHA 4P4BA 2NMTA 1CJWA 2CIJA 2CNMA 3KGQA 3FEEA 4FD7A 4PSXA 4A37A 3IU2A 2VZZA 4CAVA 4UIBA 4OC2A 2BUEA 5JM6A 1N71A 1ZG8A 2GLFA 3HLPA 3H8FA 4FUUA 1ARMA 4MCRA 4OC5A 2O4HA 1Z8TA 3PZJA 4CGMA 3R95A 3TFYA 3E0KA 2AFOA 3RYOA 1CG2A 4LUAA 4OIWA 5G20A 4R3KA 4PXDA 3L2NA 4A31A 3C26A 2G0BA 1LRZA 2EK8A 5LRGA 3V7ZA 3NA6A 1Z8XA 2DEAA 4YWYA 4H6UA 4FD5A 1L0CA 1BLLE 2F5IA 2JEWA 4R7MA 3LWUA 2J9AA 1YK3A 4MI4A 4R76A 4M85A 4UEEA 4E0AA 3N5FA 2CY2A 2GU2A 4B13A 2K5TA 2PJ3A 4QVTA 4NGRA 4MHDA 2AE6A 1TKJA 1PU9A 3TE4A 4MFZA 4P4JA 4C7HA 5THWA 3SHPA 5A27A 2ANPA 4A95A 3T90A 5AGEA 4K3NA 3F8KA 3DDDA 1R57A 3EY5A 3WC5A 1KZFA 2Q4YA 1AYEA 3PGPA 4P4IA 2AFUA 4B6ZA 5CPAA 2FT0A 2ZOFA 3SJXA 4NJQA 4XPDC 2EO8A 3D7HA 2REEA 3IWWA 1F57A 3D66A 4NGTA 4F9VA 4KOXA 1YQEA 5F48A 8CPAA 5KTDA 1DE4C 1F2PA 2ZPAA 5A28A 3VWEA 4CGLA 2ZEDA 3P2HA 5C82A 3CXPA 3WR7A 4HKFA 4YGOA 5JQ4A 1JQGA 2BO9A 1X10A 3SJGA 1HDUA 3FRMA 4ZY2A 1VHEA 4R87A 5HMNA 2CF4A 3ZZIA 1KWMA 5D8NA 3FYNA 2GIVA 5ISVA 3BLNA 2B3UA 2ZXVA 4EWTA 3B7IA 2JDCA 2CTCA 2WSAA 5C88A 1Z9UA 4DJLA 1AUGA 2ZEMA 4A94A 1IGBA 1Q2CA 2ZEEA 5LYIA 4C2XA 3CPXA 4AVCA 4MJ8A 2C27A 5D29A 5JGFA 2P6FA 3ISXA 3RO0A 4ZBGA 2A4NA 2RB7A 3FB3A 2B4BA 3LD2A 4C2YA 4FD4A 2B4DA 1XIXA 3LODA 4A2ZA 1YREA 2XEJA 1B6BA 3GLJA 4J3GA 3PP9A 4KS9A 1OBRA 2FSRA 1ZLHA 4BD9A 3S9NA 3BHXA 4UBRA 4UCMA 2FIWA 3B3CA 5I4MA 3F5BA 4R9MA 5HH1A 3FEDA 2Q44A 3BJ7A 3IGRA 3S9MA 4KUAA 3CXQA 3K9TA
chains in the Genus database with same CATH topology
1J4JA 1NMTA 4KLVA 4KOUA 2P6GA 5AG4A 1QSOA 2EVNA 1GHEA 5KTCA 4B14A 3DSBA 3EXNA 2WPWA 1Y9WA 4B10A 4ZGYB 2AJ6A 5G1ZA 3IU1A 4BBHA 3T9YA 1M4GA 3KKWA 1IYLA 5IV0A 4B12A 1M1DA 3DNSA 3SXOA 1K4JA 1NSLA 4JJXA 2DPSA 3NE7A 2JLMA 4CAWA 4MFLA 2Z3KA 3GYAA 1Q2DA 2B5GB 4EVYA 2ZW4A 5GCNA 4UCNA 5JPHA 4C7IA 4NXYA 4DNCA 3R1KA 4AG9A 1IICA 1ZO0A 1OZPA 2JDDA 3FBUA 4MFQA 4CRZB 2OH1A 4E2AA 4OADA 2FCKA 1YVKA 4BMHA 4IF5A 1S7LA 4MY0A 4XPDB 2J8NA 4MFJA 4XPLA 1XMTA 5F47A 5J8CA 2ATRA 2R8VA 2HQYA 3TTHA 4KOTA 4R57A 5FVJA 4AVBA 2Z10A 2WUUA 4L8AA 2REFA 2Z3MA 2OZUA 3ZJ0A 5I0CA 4C2ZA 2I79A 4UFWA 4Q38A 2FL4A 4C68A 3CXSA 4XNHC 4QC6A 4NEXA 1P0HA 1S3ZA 4PK2A 3D2MA 3TO7A 1S7NA 1Z4RA 5H84A 2Q7BA 2HUZA 3D2PA 4KOSA 4A32A 4FD6A 5CNPA 1IYKA 4Y49C 2QMLA 1QSNA 3BJ8A 1Y7RA 3TOAA 3TOBA 4H89A 4XPKA 2P6EA 2PR8A 3H4QA 4CAFA 4ORFA 4MFPA 2G3AA 5E96A 4NF1A 2IL4A 3IWEA 5EBVA 1YX0A 1KUXA 2Z3OA 2KCWA 3FNCA 1S60A 3JUWA 4UWIA 4B5PB 3W6XA 2D4PA 2PDOA 1KUYA 4AVAA 4U9YA 2YNEA 3JVNA 1RXTA 4OAEA 4UA3A 4UFVA 1FY7A 1Y9KA 4ONUA 2YGWA 2CNSA 2I00A 4F0YA 4PSWA 2FXFA 5EC4A 1YR0A 4OLLA 4QUSA 4II9A 3R9GA 3F0AA 2B4DB 4Q36A 2ARHA 3JTKA 1M4DA 4LX9A 2OZHA 4KOVA 4PV6A 1YLEA 4JLYA 4AB7A 4JXRA 1WK4A 1M4IA 1SQHA 1B87A 3R9EA 4GS4A 2QECA 2VBQA 4KVOE 4KUBA 4HNYB 3GKRA 4MFKA 4KSAA 2GE3A 2X7BA 1I21A 3K9UA 3VWDA 4R3LA 2VQYA 3QAHA 3FXTA 4CYOA 5KTAA 3DR8A 4AG7A 2BEIA 3TCVA 1Q2YA 1TIQA 4XNHB 2Z0ZA 3S6FA 2R98A 4KVXA 1IB1E 4X5KA 3R9FA 1VKCA 1V0CA 1XE4A 1VHSA 3P2FA 1S7KA 5DWNA 4CRYB 4KZTA 4M3SA 4KOYA 1YVOA 1NE9A 2OB0A 2VZYA 1BO4A 3S6KA 4U5YA 1QSTA 4Y49B 1MK4A 3TO9A 3N7ZA 3UY5A 2OU2A 4NSQA 3V8IA 4QBJA 2O28A 5DWMA 2FE7A 2J8MA 3EC4A 1XEBA 3G8WA 2PC1A 4UCPA 2YNDA 2H5MA 1QSRA 4MY3A 3S6GA 4UFXA 4IUSA 4I49A 4CAXA 3A9LA 5BWAB 2R7HA 2Z3LA 3G3SA 4CYPA 2VXKA 2ZW7A 5F49A 3SXNA 4KSFA 5G22A 4E8OA 1M44A 1Z4EA 2HV2A 2JEVA 4F6AA 5IB0A 2Z11A 4YRHA 2P0WA 3FIXA 4YFJA 2R1IA 2Q04A 3I9SA 4CS0B 2QIRA 3S6HA 5J8FA 3TO6A 2PQ8A 3W91A 4CAEA 5F46A 5AG7A 1QSMA 1KUVA 2EUIA 4JD6A 4CYNA 5IX3A 4RI1A 3EFAA 1MJBA 1S5KA 2ZW6A 4B11A 5AG6A 5AG5A 4PK3A 2D4OA 4NCZA 2FS5A 3OWCA 2YNCA 1BOBA 4B5PA 2OZGA 4HNWB 2RC4A 4CGNA 1I12A 2VEZA 1XF8A 2ZW5A 4JWPA 4A30A 2PRBA 4KLWA 3W6SA 4K30A 2Q0YA 2Z3NA 2VI7A 3MGDA 1RO5A 4L89A 2B58A 2BSWA 4KORA 4HNXB 4CGPA 1ON0A 4KOWA 4B13A 3TT2A 5G21A 3QB8A 2Y0MA 3DR6A 2GANA 4MBUA 4B5OA 3EO4A 1YGHA 4RS2A 4QB9A 1S7FA 2Q4VA 4U9ZA 4H6ZA 3IWGA 4CGOA 1WWZA 4CYQA 2CNTA 3I3GA 1I1DA 2B5GA 2YNCC 1IIDA 1PUAA 2G3TA 2Z3PA 2CXAA 3B8GA 4JXQA 2PR1A 3R96A 1MJAA 3D8PA 4A33A 1CM0A 2J8RA 2DPTA 2WPXA 2PSWA 3D3SA 4F0XA 2B3VA 1MJ9A 1U6MA 1P4NA 4KVME 3GY9A 5H86A 2BL1A 2FIAA 2DXQA 1UFHA 4UWJA 3H5ZA 2NMTA 1CJWA 4FD7A 2CNMA 4PSXA 3IU2A 2VZZA 4CAVA 2BUEA 1N71A 3PZJA 4CGMA 3R95A 3TFYA 3E0KA 3RYOA 4LUAA 5G20A 4R3KA 4A31A 3C26A 2G0BA 1LRZA 4H6UA 4FD5A 1L0CA 2F5IA 1YK3A 4MI4A 4M85A 4E0AA 2CY2A 2K5TA 4QVTA 4MHDA 2AE6A 1PU9A 3TE4A 4MFZA 4C7HA 3SHPA 5A27A 4A95A 3T90A 5AGEA 3F8KA 3DDDA 1R57A 3EY5A 1KZFA 2Q4YA 3PGPA 2FT0A 4XPDC 2REEA 4KOXA 5F48A 5KTDA 2ZPAA 5A28A 3VWEA 4CGLA 3P2HA 5C82A 3CXPA 3WR7A 4HKFA 4YGOA 5JQ4A 3FRMA 4R87A 5HMNA 3ZZIA 3FYNA 2GIVA 5ISVA 3BLNA 2B3UA 2ZXVA 2JDCA 2WSAA 5C88A 1Z9UA 1Q2CA 4C2XA 4AVCA 4MJ8A 2C27A 2P6FA 4ZBGA 2A4NA 3FB3A 2B4BA 4C2YA 4FD4A 2B4DA 1XIXA 3LODA 4A2ZA 1YREA 1B6BA 4J3GA 3PP9A 4KS9A 2FSRA 4UBRA 4UCMA 2FIWA 3F5BA 4R9MA 5HH1A 2Q44A 3BJ7A 3IGRA 4KUAA 3CXQA 3LD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J4J A;  1NMT A;  4KLV A;  4KOU A;  2P6G A;  1QSO A;  2EVN A;  1GHE A;  5KTC A;  3DSB A;  3EXN A;  2WPW A;  1Y9W A;  2AJ6 A;  3T9Y A;  1M4G A;  3KKW A;  1IYL A;  5IV0 A;  1M1D A;  3DNS A;  3SXO A;  1K4J A;  1NSL A;  4JJX A;  3NE7 A;  2JLM A;  4CAW A;  3GYA A;  1Q2D A;  2B5G B;  4EVY A;  2ZW4 A;  5GCN A;  5JPH A;  4NXY A;  4DNC A;  3R1K A;  4AG9 A;  1IIC A;  1OZP A;  2JDD A;  3FBU A;  4CRZ B;  2OH1 A;  4E2A A;  4OAD A;  2FCK A;  1YVK A;  4BMH A;  4IF5 A;  1S7L A;  4MY0 A;  4XPD B;  2J8N A;  4XPL A;  1XMT A;  5F47 A;  5J8C A;  2ATR A;  2R8V A;  2HQY A;  3TTH A;  4KOT A;  4R57 A;  5FVJ A;  4AVB A;  2Z10 A;  4L8A A;  2REF A;  2OZU A;  3ZJ0 A;  5I0C A;  2I79 A;  2FL4 A;  3CXS A;  4XNH C;  4QC6 A;  4NEX A;  1P0H A;  1S3Z A;  4PK2 A;  3D2M A;  3TO7 A;  1S7N A;  1Z4R A;  5H84 A;  2Q7B A;  2HUZ A;  3D2P A;  4KOS A;  4FD6 A;  5CNP A;  1IYK A;  4Y49 C;  2QML A;  1QSN A;  3BJ8 A;  1Y7R A;  3TOA A;  3TOB A;  4H89 A;  4XPK A;  2P6E A;  2PR8 A;  3H4Q A;  4ORF A;  2G3A A;  5E96 A;  4NF1 A;  2IL4 A;  5EBV A;  1YX0 A;  1KUX A;  4UWI A;  2KCW A;  3FNC A;  1S60 A;  3JUW A;  4B5P B;  3W6X A;  2D4P A;  2PDO A;  1KUY A;  4AVA A;  4U9Y A;  3JVN A;  1RXT A;  4OAE A;  4UA3 A;  1FY7 A;  1Y9K A;  4ONU A;  2CNS A;  2I00 A;  4F0Y A;  4PSW A;  2FXF A;  5EC4 A;  1YR0 A;  4OLL A;  4QUS A;  4II9 A;  3R9G A;  3F0A A;  2B4D B;  2ARH A;  1M4D A;  4LX9 A;  2OZH A;  4KOV A;  4PV6 A;  1YLE A;  4JLY A;  4AB7 A;  4JXR A;  1WK4 A;  1M4I A;  1SQH A;  1B87 A;  3R9E A;  4GS4 A;  2QEC A;  2VBQ A;  4KVO E;  4KUB A;  4HNY B;  3GKR A;  2GE3 A;  2X7B A;  1I21 A;  3K9U A;  3VWD A;  4R3L A;  2VQY A;  3QAH A;  3FXT A;  5KTA A;  3DR8 A;  4AG7 A;  2BEI A;  3TCV A;  1Q2Y A;  1TIQ A;  4XNH B;  2Z0Z A;  3S6F A;  2R98 A;  4KVX A;  1IB1 E;  4X5K A;  3R9F A;  1VKC A;  1V0C A;  1XE4 A;  1VHS A;  3P2F A;  1S7K A;  5DWN A;  4CRY B;  4KZT A;  4M3S A;  4KOY A;  1YVO A;  1NE9 A;  2OB0 A;  2VZY A;  1BO4 A;  3S6K A;  4U5Y A;  1QST A;  4Y49 B;  1MK4 A;  3TO9 A;  3N7Z A;  3UY5 A;  2OU2 A;  4NSQ A;  3V8I A;  4QBJ A;  2O28 A;  5DWM A;  2FE7 A;  2J8M A;  3EC4 A;  1XEB A;  3G8W A;  2PC1 A;  2H5M A;  1QSR A;  4MY3 A;  3S6G A;  4IUS A;  4I49 A;  4CAX A;  2R7H A;  3G3S A;  2VXK A;  2ZW7 A;  5F49 A;  3SXN A;  4E8O A;  1M44 A;  1Z4E A;  2HV2 A;  2JEV A;  4F6A A;  5IB0 A;  2Z11 A;  4YRH A;  2P0W A;  3FIX A;  4YFJ A;  2R1I A;  2Q04 A;  3I9S A;  4CS0 B;  2QIR A;  3S6H A;  5J8F A;  3TO6 A;  2PQ8 A;  3W91 A;  5F46 A;  1QSM A;  1KUV A;  2EUI A;  4JD6 A;  5IX3 A;  4RI1 A;  3EFA A;  1MJB A;  1S5K A;  2ZW6 A;  4PK3 A;  2D4O A;  4NCZ A;  2FS5 A;  3OWC A;  1BOB A;  4B5P A;  2OZG A;  4HNW B;  2RC4 A;  1I12 A;  2VEZ A;  1XF8 A;  2ZW5 A;  4JWP A;  2PRB A;  4KLW A;  3W6S A;  4K30 A;  2Q0Y A;  2VI7 A;  3MGD A;  1RO5 A;  4L89 A;  2B58 A;  2BSW A;  4KOR A;  4HNX B;  1ON0 A;  4KOW A;  3TT2 A;  3QB8 A;  2Y0M A;  3DR6 A;  2GAN A;  4MBU A;  4B5O A;  3EO4 A;  1YGH A;  4RS2 A;  4QB9 A;  1S7F A;  2Q4V A;  4U9Z A;  4H6Z A;  3IWG A;  1WWZ A;  2CNT A;  3I3G A;  1I1D A;  2B5G A;  2G3T A;  1IID A;  1PUA A;  3B8G A;  4JXQ A;  2PR1 A;  3R96 A;  1MJA A;  3D8P A;  1CM0 A;  2J8R A;  2WPX A;  2PSW A;  3D3S A;  2B3V A;  1MJ9 A;  1U6M A;  1P4N A;  4KVM E;  3GY9 A;  5H86 A;  2BL1 A;  2FIA A;  2DXQ A;  1UFH A;  4UWJ A;  2NMT A;  1CJW A;  4FD7 A;  2CNM A;  4PSX A;  2VZZ A;  4CAV A;  2BUE A;  1N71 A;  3PZJ A;  3R95 A;  3TFY A;  3E0K A;  3RYO A;  4LUA A;  4R3K A;  3C26 A;  2G0B A;  1LRZ A;  4H6U A;  4FD5 A;  1L0C A;  2F5I A;  1YK3 A;  4MI4 A;  4M85 A;  4E0A A;  2CY2 A;  2K5T A;  4QVT A;  4MHD A;  2AE6 A;  1PU9 A;  3TE4 A;  3SHP A;  3T90 A;  3F8K A;  3DDD A;  1R57 A;  3EY5 A;  1KZF A;  2Q4Y A;  3PGP A;  2FT0 A;  4XPD C;  2REE A;  4KOX A;  5F48 A;  5KTD A;  2ZPA A;  3VWE A;  3P2H A;  5C82 A;  3CXP A;  3WR7 A;  4HKF A;  4YGO A;  5JQ4 A;  3FRM A;  4R87 A;  5HMN A;  3ZZI A;  3FYN A;  2GIV A;  5ISV A;  3BLN A;  2B3U A;  2ZXV A;  2JDC A;  5C88 A;  1Z9U A;  1Q2C A;  4AVC A;  4MJ8 A;  2C27 A;  2P6F A;  4ZBG A;  2A4N A;  3FB3 A;  2B4B A;  4FD4 A;  2B4D A;  1XIX A;  3LOD A;  1YRE A;  1B6B A;  4J3G A;  3PP9 A;  2FSR A;  4UBR A;  2FIW A;  3F5B A;  4R9M A;  5HH1 A;  2Q44 A;  3BJ7 A;  3IGR A;  4KUA A;  3CXQ A;  3LD2 A; 
#chains in the Genus database with same CATH topology
 1J4J A;  2ZEP A;  4NGM A;  1NMT A;  4KLV A;  4KOU A;  2PVV A;  2P6G A;  4IHM A;  5AG4 A;  1CP6 A;  1QSO A;  2PJB A;  2EVN A;  1GHE A;  5KTC A;  4B14 A;  3DSB A;  3SI0 A;  1YME A;  2PIY A;  2WPW A;  1Y9W A;  2ZOG A;  3EXN A;  4B10 A;  4ZGY B;  2AJ6 A;  2JBJ A;  5G1Z A;  3IU1 A;  1XMB A;  3T9Y A;  4BBH A;  2JBK A;  4MRI A;  1HDQ A;  1M4G A;  1YSJ A;  1XOV A;  3KKW A;  3PB7 X;  4ZY0 A;  1IYL A;  2PJ7 A;  5IV0 A;  3SJF A;  1M1D A;  2Q43 A;  3DNS A;  4B12 A;  3WC6 A;  3SXO A;  1K4J A;  4WWV A;  4NFR A;  4JJX A;  4MXU A;  1NSL A;  2DPS A;  5K8N A;  2ZEL A;  2PJ4 A;  3B3T A;  3NE7 A;  2JLM A;  4UWI A;  1H8L A;  1A2Z A;  2GFQ A;  4CAW A;  4MFL A;  2Z3K A;  1LAM A;  3D4U A;  3GYA A;  4MCP A;  2PRQ A;  1Q2D A;  2B5G B;  2HB6 A;  3FX6 A;  4A39 A;  4EVY A;  4Q7A A;  2ZW4 A;  5HVH A;  5K8O A;  5GCN A;  4UCN A;  3MRU A;  5JPH A;  4C7I A;  4NGN A;  4AXV A;  1PYT B;  1TXR A;  4NXY A;  5F09 A;  4DNC A;  3R1K A;  4AG9 A;  4ZY1 A;  1IIC A;  1NSA A;  1QQ9 A;  2EWB A;  1CX8 A;  2AFS A;  1LCP A;  1ZO0 A;  1OZP A;  5LRJ A;  2JDD A;  3FBU A;  4MFQ A;  4CRZ B;  2OH1 A;  4E2A A;  3KQZ A;  3DGV A;  4OAD A;  2Q51 A;  2C6P A;  2FCK A;  1XBU A;  1YVK A;  2F8H A;  4IF5 A;  1S7L A;  4BMH A;  4G1P A;  4MY0 A;  4XPD B;  3GIU A;  2J8N A;  2PIZ A;  4MFJ A;  4XPL A;  1XMT A;  2V8V A;  5F47 A;  1X12 A;  5J8C A;  2ATR A;  2IMO A;  3NE8 A;  4X2T A;  2R8V A;  4UWJ A;  2HQY A;  3TTH A;  2I3C A;  4KOT A;  4LQ6 A;  4R57 A;  5FVJ A;  2Z10 A;  4AVB A;  4P10 A;  1Z5R A;  2WUU A;  4L8A A;  1ZLI A;  2REF A;  2Z3M A;  2OZU A;  3ZJ0 A;  5I0C A;  1ELL P;  3TC8 A;  4C2Z A;  2I79 A;  4UFW A;  3RAM A;  3CZX A;  2PJ2 A;  4OC4 A;  4Q38 A;  2EBJ A;  2FL4 A;  2CTB A;  4C68 A;  2IJZ A;  3CXS A;  4XNH C;  1BPM A;  4KSI A;  2O53 A;  2PJ8 A;  1BPN A;  4QC6 A;  1Z8W A;  4NEX A;  1P0H A;  5EMI A;  5ELY A;  1S3Z A;  3H8G A;  3KAS A;  3KZW A;  4PK2 A;  4EME A;  5K8M A;  3D2M A;  3TO7 A;  1S7N A;  2PCU A;  4MCQ A;  1Z4R A;  2AFM A;  4F8Z A;  5HXD A;  2FVG A;  5H84 A;  4M6G A;  4CPA A;  4P44 A;  2Q7B A;  2HUZ A;  3D2P A;  4KOS A;  4A32 A;  4FD6 A;  5CNP A;  1IYK A;  3KHX A;  4MCS A;  3GUX A;  4Y49 C;  4X8I A;  2Q4Z A;  4OC3 A;  4EFD A;  5K8P A;  2QML A;  1QSN A;  3BJ8 A;  1Y7R A;  1PCA A;  3D7F A;  3TOA A;  3B3W A;  3D67 A;  4ZX8 A;  3FH4 A;  4PXE A;  2QVP A;  3PBB A;  3TOB A;  4H89 A;  4XPK A;  1VHO A;  2P6E A;  5HVG A;  2PR8 A;  5JH9 A;  5LRK A;  3H4Q A;  1ZG9 A;  4ORF A;  4CAF A;  5J1Q A;  3KQX A;  4MFP A;  2G3A A;  5E96 A;  2PVW A;  2IL4 A;  3IWE A;  4NF1 A;  4P4E A;  4NGP A;  2DF5 A;  2PJ9 A;  5EBV A;  1YX0 A;  1KUX A;  2Z3O A;  2KCW A;  3FNC A;  1S60 A;  2C1C A;  3I1U A;  2PJ5 A;  3JUW A;  4B5P B;  3W6X A;  2D4P A;  2PDO A;  1KUY A;  3FEC A;  4U9Y A;  4AVA A;  1Z8L A;  2G9D A;  2YNE A;  2ZEF A;  3JVN A;  1RXT A;  4O23 A;  4OAE A;  4UA3 A;  2XEG A;  4UFV A;  1FY7 A;  1Y9K A;  2OR4 A;  1VIX A;  3PB6 X;  4ONU A;  2YGW A;  2CNS A;  1Y0R A;  3FJU A;  2I00 A;  2XEF A;  4F0Y A;  1LAP A;  5CBM A;  4PSW A;  3MN8 A;  4PXC A;  1FT7 A;  2FXF A;  5EC4 A;  4JZ0 A;  3VAT A;  1YR0 A;  1DTD A;  1ARL A;  1F2O A;  2BCO A;  3KI9 A;  4OLL A;  4MHN A;  4QUS A;  4MHY A;  4II9 A;  3R9G A;  3F0A A;  2V8G A;  2B4D B;  4HPS A;  4Q36 A;  3JRU A;  3PB4 X;  4UEZ A;  3RZA A;  2ARH A;  3JTK A;  1M4D A;  2GLJ A;  2OZH A;  4LX9 A;  4KOV A;  4PV6 A;  1YLE A;  1BAV A;  2ZEN A;  4IAV A;  4JLY A;  2ZEG A;  5LYL A;  3SI2 A;  1YW4 A;  4JXR A;  4P6Y A;  1RTQ A;  3FF3 A;  1WK4 A;  3PB9 X;  4P4D A;  4AB7 A;  1M4I A;  3IJ3 A;  1SQH A;  1B87 A;  2AFZ A;  4NGQ A;  3R9E A;  4FWU A;  1YLO A;  3HUV A;  2BOA A;  2OOT A;  2ODF A;  4GS4 A;  2QEC A;  2VBQ A;  3KL9 A;  4KVO E;  1ELM P;  2V8D A;  2EK9 A;  1Y0Y A;  3B3V A;  4GM5 A;  4KUB A;  3IFE A;  4HNY B;  3GKR A;  3IO1 A;  4MFK A;  4KSA A;  2GE3 A;  2Q7S A;  2V77 A;  2X7B A;  3PB8 X;  1I21 A;  3K9U A;  3VWD A;  2WYR A;  4R3L A;  1JWQ A;  2VQY A;  2POK A;  2XEI A;  3PBE A;  3FXT A;  1XRY A;  3FMC A;  3QAH A;  4CYO A;  4Z65 A;  5KTA A;  3DR8 A;  3SJE A;  2BEI A;  4AG7 A;  1CPS A;  2IQ6 A;  3TCV A;  1Q2Y A;  1TIQ A;  4XNH B;  1CBX A;  3K2K A;  2Z0Z A;  2GRE A;  3WAB A;  3DLJ A;  4MHP A;  3S6F A;  7CPA A;  2R98 A;  4KVX A;  1IB1 E;  3KR5 A;  2PJC A;  1VKC A;  1V0C A;  4X5K A;  3R9F A;  1XE4 A;  1VHS A;  3P2F A;  1S7K A;  5DWN A;  3D7D A;  4OKO A;  4KZT A;  4R6T A;  2PJA A;  4M3S A;  1XJO A;  4KOY A;  4CRY B;  2AFX A;  2HC9 A;  1YVO A;  4W9Y A;  3NH5 A;  2OB0 A;  1NE9 A;  1Y7E A;  2VZY A;  1BO4 A;  3S6K A;  4U5Y A;  1QST A;  4OC0 A;  1MK4 A;  4Y49 B;  3TO9 A;  3N7Z A;  3UY5 A;  3QNV A;  2OU2 A;  4H2K A;  3V38 A;  3NH4 A;  5IB9 A;  4NSQ A;  1FNO A;  2PE3 A;  3V8I A;  4QBJ A;  2O28 A;  5DWM A;  2FE7 A;  1ZG7 A;  2J8M A;  4UF4 A;  3EC4 A;  1IY7 A;  1XEB A;  3G8W A;  4A38 A;  1CP7 A;  2PC1 A;  4UCP A;  5LYD A;  3RNZ A;  2YND A;  2H5M A;  1QSR A;  2NYQ A;  2PJ1 A;  4MY3 A;  3S6G A;  4UFX A;  1LFW A;  4IUS A;  4I49 A;  4CAX A;  3A9L A;  5BWA B;  2R7H A;  2Z3L A;  3G3S A;  4CYP A;  2VXK A;  2ZW7 A;  4RN7 A;  5F49 A;  3NFZ A;  1EE3 P;  2QYV A;  3SXN A;  4WJB A;  4F9U A;  4KSF A;  4DUK A;  5G22 A;  4JYW A;  4E8O A;  3CDX A;  1M44 A;  3WC7 A;  1Z4E A;  2HV2 A;  1R3N A;  1M4L A;  4M6H A;  2JEV A;  4F6A A;  4OC1 A;  5IB0 A;  2Z11 A;  4YRH A;  2P0W A;  3FIX A;  4YFJ A;  3PFE A;  3KR4 A;  4LQG A;  3S9L A;  2R1I A;  2Q04 A;  1TKF A;  3I9S A;  3PEI A;  4CS0 B;  2QIR A;  3S6H A;  1HEE A;  4NGS A;  3TO6 A;  5J8F A;  2PQ8 A;  3W91 A;  1GYT A;  4IK2 A;  1LOK A;  4CAE A;  5F46 A;  5AG7 A;  1IOI A;  1KUV A;  1QSM A;  2PJ6 A;  2EUI A;  4JD6 A;  4X3R A;  4CYN A;  5IX3 A;  4RI1 A;  1UWY A;  1VGY A;  3EFA A;  1MJB A;  1S5K A;  2WZN A;  2ZW6 A;  3SI1 A;  5AG6 A;  3D68 A;  3H8E A;  4B11 A;  5AG5 A;  4PK3 A;  2D4O A;  2VL1 A;  4NCZ A;  4FBE A;  2FS5 A;  3OWC A;  1IU8 A;  2YNC A;  1BOB A;  4NJR A;  4B5P A;  2OZG A;  4M6I A;  4ONW A;  4HNW B;  2RC4 A;  3VAR A;  4CGN A;  3WT4 A;  1I12 A;  3T8W A;  3VH9 A;  3GB0 A;  2AFW A;  4TWE A;  4ZX9 A;  3IC1 A;  3BI1 A;  2VEZ A;  1XF8 A;  2ZW5 A;  4JWP A;  4PQA A;  4A30 A;  2PRB A;  2C6C A;  4TNU A;  4KLW A;  3W6S A;  2F7V A;  4K30 A;  2Q0Y A;  2C6G A;  2Z3N A;  2VI7 A;  3QAY A;  4UIA A;  4ZI6 A;  3MGD A;  1RO5 A;  3BXM A;  4L89 A;  2B58 A;  1IOF A;  2BSW A;  4KOR A;  1LAN A;  1XFO A;  2QJ8 A;  4HNX B;  4CGP A;  4OP4 A;  1ON0 A;  1AMP A;  1R43 A;  1TF9 A;  1TF8 A;  4KOW A;  4OME A;  3TT2 A;  5G21 A;  5DS0 A;  3KHZ A;  3D7G A;  3QB8 A;  3PFO A;  2Y0M A;  3DR6 A;  2GAN A;  4MBU A;  3B3S A;  4B5O A;  3EO4 A;  4PXB A;  1YGH A;  2V8H A;  4RS2 A;  4QB9 A;  1S7F A;  2Q4V A;  3ISZ A;  4U9Z A;  4PPZ A;  4R8F A;  4H6Z A;  4P45 A;  1Q7L A;  3IWG A;  4CGO A;  2ABZ A;  4BIN A;  2RFH A;  1WWZ A;  3IIB A;  4RUH A;  4MHZ A;  4UEF A;  4CYQ A;  4DYO A;  4OID A;  2CNT A;  3I3G A;  1CPX A;  1I1D A;  2B5G A;  2G3T A;  1IID A;  1PUA A;  2YNC C;  3LMS A;  2NSM A;  2Z3P A;  2CXA A;  3B2Y A;  3CPA A;  1QMU A;  5LYF A;  3B8G A;  2ZEH A;  4JXQ A;  2PR1 A;  1Z2L A;  4P4F A;  4YU9 A;  3R96 A;  3FVL A;  6CPA A;  1MJA A;  3D8P A;  4MMO A;  4A33 A;  1YW6 A;  1CM0 A;  3CT9 A;  2J8R A;  2DPT A;  2WPX A;  2PSW A;  4GXH A;  3BI0 A;  3D3S A;  3NH8 A;  4F0X A;  2B3V A;  3B35 A;  3RBU A;  1MJ9 A;  1U6M A;  1P4N A;  3PRT A;  3LAC A;  4KVM E;  5HVF A;  3TX8 A;  2PJ0 A;  3GY9 A;  5H86 A;  4FAI A;  2BL1 A;  2FIA A;  2ZEO A;  2DXQ A;  4ZYQ A;  1UFH A;  1TKH A;  3H5Z A;  3IEH A;  4P4B A;  2NMT A;  1CJW A;  2CIJ A;  2CNM A;  3KGQ A;  3FEE A;  4FD7 A;  4PSX A;  4A37 A;  3IU2 A;  2VZZ A;  4CAV A;  4UIB A;  4OC2 A;  2BUE A;  5JM6 A;  1N71 A;  1ZG8 A;  2GLF A;  3HLP A;  3H8F A;  4FUU A;  1ARM A;  4MCR A;  4OC5 A;  2O4H A;  1Z8T A;  3PZJ A;  4CGM A;  3R95 A;  3TFY A;  3E0K A;  2AFO A;  3RYO A;  1CG2 A;  4LUA A;  4OIW A;  5G20 A;  4R3K A;  4PXD A;  3L2N A;  4A31 A;  3C26 A;  2G0B A;  1LRZ A;  2EK8 A;  5LRG A;  3V7Z A;  3NA6 A;  1Z8X A;  2DEA A;  4YWY A;  4H6U A;  4FD5 A;  1L0C A;  1BLL E;  2F5I A;  2JEW A;  4R7M A;  3LWU A;  2J9A A;  1YK3 A;  4MI4 A;  4R76 A;  4M85 A;  4UEE A;  4E0A A;  3N5F A;  2CY2 A;  2GU2 A;  4B13 A;  2K5T A;  2PJ3 A;  4QVT A;  4NGR A;  4MHD A;  2AE6 A;  1TKJ A;  1PU9 A;  3TE4 A;  4MFZ A;  4P4J A;  4C7H A;  5THW A;  3SHP A;  5A27 A;  2ANP A;  4A95 A;  3T90 A;  5AGE A;  4K3N A;  3F8K A;  3DDD A;  1R57 A;  3EY5 A;  3WC5 A;  1KZF A;  2Q4Y A;  1AYE A;  3PGP A;  4P4I A;  2AFU A;  4B6Z A;  5CPA A;  2FT0 A;  2ZOF A;  3SJX A;  4NJQ A;  4XPD C;  2EO8 A;  3D7H A;  2REE A;  3IWW A;  1F57 A;  3D66 A;  4NGT A;  4F9V A;  4KOX A;  1YQE A;  5F48 A;  8CPA A;  5KTD A;  1DE4 C;  1F2P A;  2ZPA A;  5A28 A;  3VWE A;  4CGL A;  2ZED A;  3P2H A;  5C82 A;  3CXP A;  3WR7 A;  4HKF A;  4YGO A;  5JQ4 A;  1JQG A;  2BO9 A;  1X10 A;  3SJG A;  1HDU A;  3FRM A;  4ZY2 A;  1VHE A;  4R87 A;  5HMN A;  2CF4 A;  3ZZI A;  1KWM A;  5D8N A;  3FYN A;  2GIV A;  5ISV A;  3BLN A;  2B3U A;  2ZXV A;  4EWT A;  3B7I A;  2JDC A;  2CTC A;  2WSA A;  5C88 A;  1Z9U A;  4DJL A;  1AUG A;  2ZEM A;  4A94 A;  1IGB A;  1Q2C A;  2ZEE A;  5LYI A;  4C2X A;  3CPX A;  4AVC A;  4MJ8 A;  2C27 A;  5D29 A;  5JGF A;  2P6F A;  3ISX A;  3RO0 A;  4ZBG A;  2A4N A;  2RB7 A;  3FB3 A;  2B4B A;  3LD2 A;  4C2Y A;  4FD4 A;  2B4D A;  1XIX A;  3LOD A;  4A2Z A;  1YRE A;  2XEJ A;  1B6B A;  3GLJ A;  4J3G A;  3PP9 A;  4KS9 A;  1OBR A;  2FSR A;  1ZLH A;  4BD9 A;  3S9N A;  3BHX A;  4UBR A;  4UCM A;  2FIW A;  3B3C A;  5I4M A;  3F5B A;  4R9M A;  5HH1 A;  3FED A;  2Q44 A;  3BJ7 A;  3IGR A;  3S9M A;  4KUA A;  3CXQ A;  3K9T A; 
#chains in the Genus database with same CATH homology
 1J4J A;  1NMT A;  4KLV A;  4KOU A;  2P6G A;  5AG4 A;  1QSO A;  2EVN A;  1GHE A;  5KTC A;  4B14 A;  3DSB A;  3EXN A;  2WPW A;  1Y9W A;  4B10 A;  4ZGY B;  2AJ6 A;  5G1Z A;  3IU1 A;  4BBH A;  3T9Y A;  1M4G A;  3KKW A;  1IYL A;  5IV0 A;  4B12 A;  1M1D A;  3DNS A;  3SXO A;  1K4J A;  1NSL A;  4JJX A;  2DPS A;  3NE7 A;  2JLM A;  4CAW A;  4MFL A;  2Z3K A;  3GYA A;  1Q2D A;  2B5G B;  4EVY A;  2ZW4 A;  5GCN A;  4UCN A;  5JPH A;  4C7I A;  4NXY A;  4DNC A;  3R1K A;  4AG9 A;  1IIC A;  1ZO0 A;  1OZP A;  2JDD A;  3FBU A;  4MFQ A;  4CRZ B;  2OH1 A;  4E2A A;  4OAD A;  2FCK A;  1YVK A;  4BMH A;  4IF5 A;  1S7L A;  4MY0 A;  4XPD B;  2J8N A;  4MFJ A;  4XPL A;  1XMT A;  5F47 A;  5J8C A;  2ATR A;  2R8V A;  2HQY A;  3TTH A;  4KOT A;  4R57 A;  5FVJ A;  4AVB A;  2Z10 A;  2WUU A;  4L8A A;  2REF A;  2Z3M A;  2OZU A;  3ZJ0 A;  5I0C A;  4C2Z A;  2I79 A;  4UFW A;  4Q38 A;  2FL4 A;  4C68 A;  3CXS A;  4XNH C;  4QC6 A;  4NEX A;  1P0H A;  1S3Z A;  4PK2 A;  3D2M A;  3TO7 A;  1S7N A;  1Z4R A;  5H84 A;  2Q7B A;  2HUZ A;  3D2P A;  4KOS A;  4A32 A;  4FD6 A;  5CNP A;  1IYK A;  4Y49 C;  2QML A;  1QSN A;  3BJ8 A;  1Y7R A;  3TOA A;  3TOB A;  4H89 A;  4XPK A;  2P6E A;  2PR8 A;  3H4Q A;  4CAF A;  4ORF A;  4MFP A;  2G3A A;  5E96 A;  4NF1 A;  2IL4 A;  3IWE A;  5EBV A;  1YX0 A;  1KUX A;  2Z3O A;  2KCW A;  3FNC A;  1S60 A;  3JUW A;  4UWI A;  4B5P B;  3W6X A;  2D4P A;  2PDO A;  1KUY A;  4AVA A;  4U9Y A;  2YNE A;  3JVN A;  1RXT A;  4OAE A;  4UA3 A;  4UFV A;  1FY7 A;  1Y9K A;  4ONU A;  2YGW A;  2CNS A;  2I00 A;  4F0Y A;  4PSW A;  2FXF A;  5EC4 A;  1YR0 A;  4OLL A;  4QUS A;  4II9 A;  3R9G A;  3F0A A;  2B4D B;  4Q36 A;  2ARH A;  3JTK A;  1M4D A;  4LX9 A;  2OZH A;  4KOV A;  4PV6 A;  1YLE A;  4JLY A;  4AB7 A;  4JXR A;  1WK4 A;  1M4I A;  1SQH A;  1B87 A;  3R9E A;  4GS4 A;  2QEC A;  2VBQ A;  4KVO E;  4KUB A;  4HNY B;  3GKR A;  4MFK A;  4KSA A;  2GE3 A;  2X7B A;  1I21 A;  3K9U A;  3VWD A;  4R3L A;  2VQY A;  3QAH A;  3FXT A;  4CYO A;  5KTA A;  3DR8 A;  4AG7 A;  2BEI A;  3TCV A;  1Q2Y A;  1TIQ A;  4XNH B;  2Z0Z A;  3S6F A;  2R98 A;  4KVX A;  1IB1 E;  4X5K A;  3R9F A;  1VKC A;  1V0C A;  1XE4 A;  1VHS A;  3P2F A;  1S7K A;  5DWN A;  4CRY B;  4KZT A;  4M3S A;  4KOY A;  1YVO A;  1NE9 A;  2OB0 A;  2VZY A;  1BO4 A;  3S6K A;  4U5Y A;  1QST A;  4Y49 B;  1MK4 A;  3TO9 A;  3N7Z A;  3UY5 A;  2OU2 A;  4NSQ A;  3V8I A;  4QBJ A;  2O28 A;  5DWM A;  2FE7 A;  2J8M A;  3EC4 A;  1XEB A;  3G8W A;  2PC1 A;  4UCP A;  2YND A;  2H5M A;  1QSR A;  4MY3 A;  3S6G A;  4UFX A;  4IUS A;  4I49 A;  4CAX A;  3A9L A;  5BWA B;  2R7H A;  2Z3L A;  3G3S A;  4CYP A;  2VXK A;  2ZW7 A;  5F49 A;  3SXN A;  4KSF A;  5G22 A;  4E8O A;  1M44 A;  1Z4E A;  2HV2 A;  2JEV A;  4F6A A;  5IB0 A;  2Z11 A;  4YRH A;  2P0W A;  3FIX A;  4YFJ A;  2R1I A;  2Q04 A;  3I9S A;  4CS0 B;  2QIR A;  3S6H A;  5J8F A;  3TO6 A;  2PQ8 A;  3W91 A;  4CAE A;  5F46 A;  5AG7 A;  1QSM A;  1KUV A;  2EUI A;  4JD6 A;  4CYN A;  5IX3 A;  4RI1 A;  3EFA A;  1MJB A;  1S5K A;  2ZW6 A;  4B11 A;  5AG6 A;  5AG5 A;  4PK3 A;  2D4O A;  4NCZ A;  2FS5 A;  3OWC A;  2YNC A;  1BOB A;  4B5P A;  2OZG A;  4HNW B;  2RC4 A;  4CGN A;  1I12 A;  2VEZ A;  1XF8 A;  2ZW5 A;  4JWP A;  4A30 A;  2PRB A;  4KLW A;  3W6S A;  4K30 A;  2Q0Y A;  2Z3N A;  2VI7 A;  3MGD A;  1RO5 A;  4L89 A;  2B58 A;  2BSW A;  4KOR A;  4HNX B;  4CGP A;  1ON0 A;  4KOW A;  4B13 A;  3TT2 A;  5G21 A;  3QB8 A;  2Y0M A;  3DR6 A;  2GAN A;  4MBU A;  4B5O A;  3EO4 A;  1YGH A;  4RS2 A;  4QB9 A;  1S7F A;  2Q4V A;  4U9Z A;  4H6Z A;  3IWG A;  4CGO A;  1WWZ A;  4CYQ A;  2CNT A;  3I3G A;  1I1D A;  2B5G A;  2YNC C;  1IID A;  1PUA A;  2G3T A;  2Z3P A;  2CXA A;  3B8G A;  4JXQ A;  2PR1 A;  3R96 A;  1MJA A;  3D8P A;  4A33 A;  1CM0 A;  2J8R A;  2DPT A;  2WPX A;  2PSW A;  3D3S A;  4F0X A;  2B3V A;  1MJ9 A;  1U6M A;  1P4N A;  4KVM E;  3GY9 A;  5H86 A;  2BL1 A;  2FIA A;  2DXQ A;  1UFH A;  4UWJ A;  3H5Z A;  2NMT A;  1CJW A;  4FD7 A;  2CNM A;  4PSX A;  3IU2 A;  2VZZ A;  4CAV A;  2BUE A;  1N71 A;  3PZJ A;  4CGM A;  3R95 A;  3TFY A;  3E0K A;  3RYO A;  4LUA A;  5G20 A;  4R3K A;  4A31 A;  3C26 A;  2G0B A;  1LRZ A;  4H6U A;  4FD5 A;  1L0C A;  2F5I A;  1YK3 A;  4MI4 A;  4M85 A;  4E0A A;  2CY2 A;  2K5T A;  4QVT A;  4MHD A;  2AE6 A;  1PU9 A;  3TE4 A;  4MFZ A;  4C7H A;  3SHP A;  5A27 A;  4A95 A;  3T90 A;  5AGE A;  3F8K A;  3DDD A;  1R57 A;  3EY5 A;  1KZF A;  2Q4Y A;  3PGP A;  2FT0 A;  4XPD C;  2REE A;  4KOX A;  5F48 A;  5KTD A;  2ZPA A;  5A28 A;  3VWE A;  4CGL A;  3P2H A;  5C82 A;  3CXP A;  3WR7 A;  4HKF A;  4YGO A;  5JQ4 A;  3FRM A;  4R87 A;  5HMN A;  3ZZI A;  3FYN A;  2GIV A;  5ISV A;  3BLN A;  2B3U A;  2ZXV A;  2JDC A;  2WSA A;  5C88 A;  1Z9U A;  1Q2C A;  4C2X A;  4AVC A;  4MJ8 A;  2C27 A;  2P6F A;  4ZBG A;  2A4N A;  3FB3 A;  2B4B A;  4C2Y A;  4FD4 A;  2B4D A;  1XIX A;  3LOD A;  4A2Z A;  1YRE A;  1B6B A;  4J3G A;  3PP9 A;  4KS9 A;  2FSR A;  4UBR A;  4UCM A;  2FIW A;  3F5B A;  4R9M A;  5HH1 A;  2Q44 A;  3BJ7 A;  3IGR A;  4KUA A;  3CXQ A;  3LD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...