3LODA

The crystal structure of the putative acyl-coa n-acyltransferase from klebsiella pneumoniae subsp.pneumoniae mgh 78578
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
154
structure length
145
Chain Sequence
NAMYTITDIAPTDAEFIALIAALDAWQETLDLSQLPPQTVIALAIRSPQGEAVGCGAIVLSEEGFGEMKRVYIDPQHRGQQLGEKLLAALEAKARQRDCHTLRLETGIHQHAAIALYTRNGYQTRCAFAPYQPDPLSVFMEKPLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative acyl-CoA N-acyltransferase
publication title The crystal structure of the putative acyl-CoA N-acyltransferase from Klebsiella pneumoniae
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Transferase
total genus 43
structure length 145
sequence length 154
ec nomenclature
pdb deposition date 2010-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3lodA00
1M4IA 3FRMA 2PC1A 1MJ9A 4JLYA 4UWJA 1BO4A 2PQ8A 1BOBA 4FD6A 2J8RA 2JEVA 2VXKA 3P2FA 4KOSA 4HKFA 4KLWA 1KUVA 2ZW4A 2VZZA 3EO4A 1Q2YA 1YVOA 4Y49B 4CS0B 3NE7A 3G8WA 1P4NA 1R57A 4NF1A 3D3SA 2ARHA 1S60A 4JD6A 4YRHA 1XF8A 1IIDA 2FT0A 4CRZB 2CNMA 1UFHA 2OH1A 3G3SA 4XNHB 2EUIA 1WWZA 5KTCA 1Q2CA 5IX3A 2AE6A 3R1KA 3IWGA 4AB7A 4QVTA 3WR7A 4H89A 4U9ZA 2G0BA 3EY5A 4CAXA 1M4DA 3TTHA 1ON0A 4UWIA 3B8GA 2Q7BA 5EBVA 2FSRA 2VI7A 2C27A 4K30A 5DWNA 1PU9A 1S7NA 4KOVA 3D2MA 4KLVA 3QB8A 2OZHA 4YGOA 4J3GA 4XPDC 1KUYA 1NMTA 1XIXA 4MJ8A 1QSOA 2Q4VA 4FD7A 2B4DB 5HH1A 2GANA 4B5PA 2P6EA 3CXSA 2Z10A 4JXRA 4KVME 4FD5A 4PSWA 4KVXA 4QUSA 5J8FA 3W91A 2WPWA 5IB0A 4ORFA 3R96A 1RXTA 4E8OA 2J8NA 2AJ6A 1SQHA 3PZJA 4AG9A 4GS4A 2PR1A 2QECA 3FB3A 4B5OA 3DDDA 4M85A 3GY9A 5C88A 4IUSA 4E2AA 5H86A 2KCWA 4R57A 1Y9KA 4AVBA 5E96A 1LRZA 3GKRA 4KOWA 3DNSA 4LUAA 5CNPA 2CNTA 3E0KA 5KTDA 2PRBA 3QAHA 3N7ZA 1S3ZA 2O28A 3BLNA 1V0CA 1IYKA 1Z4RA 2R8VA 3TO6A 5JQ4A 2J8MA 1M1DA 3CXQA 4FD4A 1Q2DA 1B6BA 1YREA 5F49A 3SHPA 3DR6A 3D2PA 2B3UA 4BMHA 1GHEA 3TOAA 3FYNA 1N71A 4QC6A 2HUZA 1U6MA 4H6ZA 2B5GB 2IL4A 3T90A 4U5YA 4XPKA 1FY7A 3VWDA 2VZYA 3PGPA 1XMTA 4DNCA 1XEBA 4L89A 2ZW7A 4HNYB 3SXNA 2Q04A 4XNHC 1YK3A 2ATRA 4MY0A 4KOTA 2G3AA 4KVOE 4OLLA 1M44A 4KORA 1Y9WA 1IB1E 3F0AA 4R9MA 3V8IA 3I3GA 1Z9UA 2EVNA 4U9YA 4MBUA 1B87A 1YLEA 2ZPAA 2F5IA 2FXFA 1QSTA 3TO7A 5KTAA 5FVJA 4MY3A 1CM0A 3W6XA 4KOUA 3R9FA 1L0CA 4KOYA 3VWEA 3H4QA 4X5KA 3ZZIA 2D4OA 3FIXA 3TE4A 2X7BA 3EC4A 4NEXA 1IYLA 1OZPA 3F5BA 1QSNA 1PUAA 2FCKA 3W6SA 1MJBA 4XPDB 4E0AA 4AG7A 2B4BA 3JUWA 5C82A 1YX0A 4AVAA 1VHSA 4PK2A 2G3TA 4R3KA 2Z11A 1YVKA 5JPHA 1S7KA 2REEA 2VBQA 4LX9A 3I9SA 1P0HA 3C26A 4KOXA 2R1IA 3FBUA 4XPLA 5EC4A 2BEIA 4NSQA 3T9YA 1IICA 2Q4YA 4H6UA 3TOBA 4R87A 3FNCA 3ZJ0A 3JVNA 5F48A 2B5GA 5I0CA 1Z4EA 2PSWA 1M4GA 4ONUA 2BUEA 4II9A 5F47A 4KZTA 3S6FA 4B5PB 5HMNA 4CAWA 3S6HA 4RS2A 5H84A 1CJWA 1VKCA 3EXNA 2VQYA 4R3LA 2D4PA 4UBRA 5IV0A 4Y49C 3BJ8A 2OB0A 3S6GA 2CNSA 2P6FA 2CY2A 4JJXA 3LODA 4L8AA 4HNXB 3MGDA 2Y0MA 2R7HA 3R9EA 4F6AA 2FS5A 3TT2A 1XE4A 2HV2A 5J8CA 1S7FA 2FIAA 3KKWA 3TCVA 1K4JA 4NCZA 2GE3A 4I49A 4AVCA 2GIVA 1Y7RA 3GYAA 3P2HA 4CAVA 3BJ7A 4PV6A 1I1DA 2HQYA 4MHDA 2B4DA 2OZGA 3FXTA 2JLMA 2JDCA 2QIRA 2ZW6A 3DR8A 2B3VA 1I12A 3PP9A 4QBJA 3D8PA 4F0YA 3K9UA 2I00A 2Q0YA 2BL1A 2A4NA 2BSWA 2Z0ZA 1KUXA 4EVYA 5GCNA 3TFYA 4QB9A 1YR0A 1NSLA 1TIQA 5ISVA 1WK4A 4OAEA 3UY5A 1J4JA 1KZFA 2JDDA 3DSBA 3TO9A 1S5KA 2PDOA 4IF5A 3IGRA 1QSRA 2I79A 3EFAA 4PSXA 1RO5A 3F8KA 4MI4A 2QMLA 2ZW5A 1YGHA 2RC4A 2FIWA 1MJAA 2VEZA 4RI1A 2FL4A 3S6KA 4JXQA 2ZXVA 2NMTA 4CRYB 2H5MA 4OADA 5DWMA 1NE9A 3SXOA 3LD2A 2REFA 1S7LA 3R95A 3R9GA 1MK4A 4KUAA 4NXYA 4M3SA 4ZBGA 3CXPA 4JWPA 4YFJA 1I21A 2DXQA 5F46A 3OWCA 2OU2A 4UA3A 2P6GA 2R98A 2Q44A 2WPXA 2B58A 1QSMA 4KUBA 2FE7A 2K5TA 2OZUA 4PK3A 2PR8A 4HNWB 3RYOA 2P0WA
chains in the Genus database with same CATH superfamily
1M4IA 2O4HA 3FRMA 2OR4A 2EO8A 2PC1A 1MJ9A 3BHXA 4JLYA 8CPAA 3VATA 1TF9A 4UWJA 1Z8XA 1BO4A 2PQ8A 3I1UA 4OC2A 4F0XA 4A94A 1BOBA 4FD6A 3NA6A 4ZY2A 2J8RA 2JEVA 5JGFA 2AFXA 5ELYA 2VXKA 3P2FA 4KOSA 4HKFA 2F7VA 1KUVA 2AFSA 2ZW4A 4KLWA 2VZZA 3EO4A 4OMEA 2J9AA 1Q2YA 2YNCC 3CPXA 5THWA 1YVOA 5AG7A 4BD9A 3BI1A 4M6GA 4Y49B 4CS0B 4MMOA 3SJFA 3NE7A 1XJOA 2PJBA 3G8WA 4CGMA 5AG6A 1P4NA 2WZNA 1R57A 4NF1A 3D3SA 2ARHA 4Q36A 1S60A 4JD6A 4YRHA 1XF8A 1IIDA 2FT0A 4CRZB 2WUUA 2CNMA 2Q7SA 3L2NA 4Q38A 1UFHA 2OH1A 1HDUA 5HXDA 3G3SA 4XNHB 5K8MA 4B12A 1BPMA 2EUIA 5G21A 1WWZA 2WSAA 1HDQA 4IK2A 4C2XA 2PJCA 3SI0A 4OIDA 5KTCA 1Z8WA 2GREA 4JYWA 1Q2CA 5IX3A 2AE6A 3R1KA 2ZOFA 1Y0RA 3DGVA 3IWGA 4B11A 2EK8A 4AB7A 4C7HA 3IWEA 1A2ZA 4PQAA 2OOTA 1Z8LA 4QVTA 2C6GA 3WR7A 2ZEDA 1NSAA 3HLPA 3LWUA 4H89A 4PXDA 4UIBA 4U9ZA 4ZX8A 4EFDA 2G0BA 3EY5A 4B14A 4CAXA 1M4DA 3KASA 3TTHA 5HVHA 4P4IA 4FUUA 1ON0A 2ZEEA 2I3CA 3DLJA 3LMSA 4UWIA 2XEJA 4P4EA 3B8GA 3GUXA 2Q7BA 3NH4A 4PXCA 2BCOA 7CPAA 5EBVA 3QAYA 2PJ3A 4GXHA 2FSRA 2QVPA 2VI7A 4MRIA 2ZEGA 2JEWA 4EMEA 2C27A 4MHYA 2RB7A 1IOIA 3K2KA 1CPXA 3QNVA 4K30A 4WJBA 1PU9A 1S7NA 5DWNA 4KOVA 4UFWA 3PB9X 3IC1A 5HVFA 1CBXA 4A37A 2RFHA 4CYQA 1CX8A 3D2MA 4KLVA 3QB8A 2OZHA 4YGOA 4NJQA 4J3GA 4XPDC 1KUYA 1NMTA 4F9UA 1XIXA 4NGMA 5K8NA 1ZG9A 3IO1A 4MJ8A 4ZI6A 2PIZA 1QSOA 1IY7A 2Q4VA 4FD7A 2B4DB 2EK9A 3JTKA 4NGSA 5HH1A 2GANA 3SI2A 2P6EA 5LYDA 4B5PA 1BLLE 3CXSA 2Z10A 4P44A 4JXRA 4PXBA 1R3NA 1XMBA 2CTCA 4KVME 2IJZA 4FD5A 5CPAA 1GYTA 4PSWA 2V8DA 4KVXA 4QUSA 5J8FA 3W91A 5EMIA 4MCQA 2EWBA 2PJ0A 4F9VA 2WPWA 5IB0A 1JWQA 4ORFA 2CF4A 4EWTA 3R96A 4JZ0A 1RXTA 3NFZA 3MRUA 5K8OA 4E8OA 2J8NA 3NH5A 1AMPA 3WT4A 2AJ6A 1ARLA 1SQHA 3PZJA 4NJRA 1TKHA 2PR1A 2QECA 3FB3A 4GS4A 4AG9A 4B5OA 3DDDA 4M85A 3GY9A 4W9YA 5C88A 4IUSA 1PYTB 2BO9A 4E2AA 4NGTA 2PE3A 1UWYA 1ZLHA 5H86A 3RO0A 1LANA 3B7IA 2KCWA 1QMUA 4R57A 1Y9KA 4AVBA 5E96A 1LRZA 2POKA 3GKRA 4A31A 1TKFA 4MXUA 1ZG7A 4B10A 4KOWA 3DNSA 4LUAA 4IAVA 1IU8A 1X10A 1CP6A 1H8LA 2CNTA 4P45A 5CNPA 2Q43A 3E0KA 4NGNA 3GIUA 3FF3A 1JQGA 4C7IA 5KTDA 4P10A 1DE4C 2PRBA 1LCPA 3N7ZA 3QAHA 4C2ZA 3B2YA 1S3ZA 5F09A 2O28A 4KS9A 1ZG8A 2ODFA 1BAVA 3PBBA 3BLNA 4M6IA 4YU9A 3RNZA 1V0CA 3TX8A 4A32A 1IYKA 1Z4RA 1PCAA 1YQEA 2R8VA 3TO6A 5JQ4A 2J8MA 4P6YA 1M1DA 1YW6A 3CXQA 3LACA 4FD4A 1Q2DA 2CTBA 5AG4A 2HC9A 1B6BA 1YREA 5F49A 3SHPA 4B13A 4OC4A 3DR6A 4X3RA 4GM5A 3D2PA 2B3UA 4BMHA 1GHEA 3TOAA 3FYNA 5D8NA 4CGNA 3KZWA 4TWEA 1N71A 4QC6A 1VIXA 2HUZA 1R43A 2PVWA 1U6MA 4H6ZA 2IMOA 2ZENA 2B5GB 2IL4A 3T90A 3FECA 5I4MA 4PXEA 5JH9A 5LYFA 2CIJA 4U5YA 4XPKA 1FY7A 3VWDA 2VZYA 4CGOA 3V7ZA 5JM6A 3PGPA 3ISXA 1XMTA 4DNCA 1XEBA 4L89A 2V77A 2ZW7A 4UEZA 1AUGA 4HNYB 4UCPA 3SXNA 2Q04A 3PB6X 4XNHC 1YK3A 2ATRA 4MY0A 2IQ6A 4KOTA 4MHNA 5LYIA 2G3AA 4KVOE 4OLLA 1M44A 4LQ6A 4KORA 3RZAA 1Q7LA 1Z8TA 1Y9WA 3CDXA 5CBMA 5K8PA 1IB1E 3H8FA 2PRQA 3PBEA 3IIBA 3F0AA 3H8EA 2Z3NA 4BINA 4R9MA 3SJGA 3V8IA 4UF4A 3I3GA 1Z9UA 4M6HA 1YMEA 3IWWA 3WC6A 5LRGA 4A39A 2EVNA 1LFWA 4U9YA 3BI0A 2WYRA 4MBUA 1B87A 1YLEA 3SJEA 2ZPAA 4NFRA 5G22A 2F5IA 2FXFA 1QSTA 5DS0A 3TO7A 5FVJA 4MY3A 5KTAA 2PJAA 1CM0A 2QYVA 3W6XA 1ZO0A 1TKJA 4KOUA 3FX6A 4B6ZA 3RAMA 3R9FA 1L0CA 3B3WA 4KOYA 3VWEA 3H4QA 4X5KA 1FT7A 2ZEOA 2D4OA 3ZZIA 3FIXA 3FEEA 2AFMA 2AFOA 1HEEA 3TE4A 2PJ1A 2X7BA 1ELMP 1XRYA 2VL1A 3EC4A 4NEXA 1IYLA 1OZPA 4P4JA 2O53A 1F2OA 4UIAA 5D29A 3F5BA 2FVGA 1QSNA 3CZXA 1PUAA 2F8HA 2FCKA 3W6SA 3A9LA 4Q7AA 1XFOA 1MJBA 4XPDB 4E0AA 4YWYA 2C6PA 2PIYA 4AG7A 4A2ZA 3KGQA 3CT9A 2B4BA 3JUWA 4R76A 1RTQA 1YX0A 4A30A 4AVAA 4CPAA 5C82A 3PB8X 1VHSA 4MHZA 4PK2A 4ZY1A 3GLJA 3FMCA 1TF8A 2NYQA 2G3TA 5LYLA 4R3KA 4MFZA 2Z11A 1YVKA 4X8IA 5JPHA 2Z3MA 1ARMA 1S7KA 2REEA 4A95A 4OC1A 3K9TA 4KSIA 4R8FA 2VBQA 4LX9A 3I9SA 1P0HA 3C26A 1OBRA 4KOXA 4OP4A 2R1IA 3FBUA 4XPLA 3T8WA 3KR4A 2EBJA 3SJXA 4CYNA 4X2TA 5EC4A 4CYPA 2BEIA 1LAPA 4NSQA 3S9NA 4CYOA 1BPNA 4MCSA 2ZOGA 3T9YA 1IICA 2Q4YA 4H6UA 2PJ2A 4FAIA 4LQGA 1YLOA 2YNCA 3TOBA 4R87A 5IB9A 2PJ7A 1F2PA 1EE3P 2YGWA 3FNCA 3JVNA 3ZJ0A 3IU1A 5F48A 2B5GA 4G1PA 3ISZA 5BWAB 2PJ5A 5I0CA 1Z4EA 4ZYQA 4TNUA 1F57A 3KQXA 4MFKA 3D7HA 4CAEA 2PSWA 4O23A 4PPZA 1M4GA 4ONUA 3RBUA 1VHEA 2ABZA 2BUEA 4II9A 2DEAA 5F47A 4KZTA 3S6FA 4B5PB 2V8VA 2Z3LA 3IEHA 5HMNA 4CAWA 3D68A 3S6HA 2PJ6A 2ANPA 4RS2A 3S9MA 4NGPA 1CJWA 5H84A 2Q4ZA 3HUVA 4OC0A 1CG2A 4IHMA 1VKCA 3EXNA 3FEDA 2VQYA 4R3LA 5A27A 1DTDA 2D4PA 2DPSA 4MCPA 1YSJA 4UBRA 2YNEA 5IV0A 4Y49C 3JRUA 2DPTA 3BJ8A 2OB0A 3S6GA 1CPSA 3B3VA 2CNSA 1Y0YA 3B35A 2P6FA 4UCMA 3IU2A 4K3NA 2NSMA 1Z2LA 2CY2A 2G9DA 4JJXA 4ZY0A 3LODA 4L8AA 2ZELA 4HNXB 3PFOA 4CGLA 1IOFA 3MGDA 2V8HA 2R7HA 2Y0MA 4NGRA 3R9EA 4BBHA 4F6AA 3IJ3A 4OC5A 3D4UA 2FS5A 2PVVA 3TT2A 4R6TA 4CGPA 1XE4A 2HV2A 4Z65A 5J8CA 3S9LA 1S7FA 2FIAA 3VARA 4OC3A 3KKWA 3TCVA 1K4JA 2ZEFA 3D67A 4NCZA 1CP7A 2XEFA 2GE3A 4I49A 3V38A 4AVCA 2GIVA 4MFJA 1Y7RA 3GYAA 1M4LA 3P2HA 3B3CA 2AFZA 4CAVA 3BJ7A 4PV6A 4C68A 5HVGA 1I1DA 2HQYA 4MHDA 2B4DA 4FWUA 2OZGA 3NH8A 1YW4A 1IGBA 3FXTA 4OIWA 2JLMA 4RN7A 2JDCA 3MN8A 2HB6A 2QIRA 2ZW6A 3DR8A 3TC8A 2GLJA 2B3VA 1I12A 1FNOA 3BXMA 3PP9A 3FJUA 1XBUA 4QBJA 3D8PA 2Z3PA 3D7DA 2ZEHA 4H2KA 5LRJA 3FH4A 4F0YA 3H8GA 2QJ8A 5AGEA 4RUHA 6CPAA 2GLFA 3K9UA 2I00A 2Q0YA 2AFUA 2BL1A 1LAMA 2AFWA 3KI9A 4MCRA 3VH9A 3WC5A 2A4NA 2BSWA 1QQ9A 1KUXA 1XOVA 2Z0ZA 3KHXA 4UFXA 5GCNA 4EVYA 3TFYA 4QB9A 1YR0A 1NSLA 3H5ZA 1TIQA 5ISVA 1WK4A 2Z3KA 4OAEA 3N5FA 4P4BA 3UY5A 5G20A 1J4JA 1KZFA 2PJ4A 1TXRA 2JDDA 3DSBA 1ZLIA 3KL9A 3TO9A 4FBEA 1LOKA 1S5KA 2PDOA 4IF5A 4F8ZA 3IGRA 1QSRA 2I79A 1VGYA 3EFAA 3IFEA 4PSXA 4MFQA 1Y7EA 4WWVA 1RO5A 3F8KA 3FVLA 4MI4A 1KWMA 2QMLA 2ZW5A 1YGHA 2RC4A 2FIWA 4MHPA 1MJAA 4ONWA 2VEZA 3D7FA 4RI1A 4KSAA 2FL4A 3S6KA 4JXQA 2C6CA 3D66A 3PRTA 2ZXVA 4MFLA 2NMTA 3D7GA 4A38A 4CRYB 3SI1A 2PCUA 2DF5A 3PB4X 2H5MA 4NGQA 5AG5A 4OADA 2C1CA 5DWMA 4C2YA 4ZX9A 1NE9A 3SXOA 2BOAA 3LD2A 3CPAA 3PEIA 2ZEMA 2REFA 3KR5A 4ZGYB 1S7LA 3B3SA 4OKOA 3R95A 3R9GA 3PB7X 1MK4A 3WC7A 1Z5RA 1X12A 2V8GA 1ELLP 4KUAA 4CAFA 4NXYA 4M3SA 4ZBGA 3B3TA 3CXPA 4JWPA 4DUKA 4DYOA 5A28A 4HPSA 4YFJA 3GB0A 4KSFA 2Q51A 3KHZA 3PFEA 1I21A 2DXQA 2Z3OA 5F46A 4MFPA 3OWCA 2PJ9A 4R7MA 2PJ8A 2CXAA 2OU2A 2JBKA 4UA3A 2P6GA 2R98A 3WABA 2GFQA 2XEGA 1AYEA 2Q44A 4A33A 3KQZA 2JBJA 2WPXA 4P4DA 1VHOA 2B58A 4UCNA 1QSMA 4KUBA 2FE7A 3NE8A 4AXVA 2K5TA 2OZUA 4PK3A 2PR8A 4UFVA 2YNDA 5G1ZA 2ZEPA 4HNWB 5J1QA 4UEEA 4UEFA 4P4FA 4DJLA 3RYOA 5LRKA 2P0WA 2XEIA 2GU2A
chains in the Genus database with same CATH topology
1M4IA 3FRMA 2PC1A 1MJ9A 4JLYA 4UWJA 1BO4A 2PQ8A 4F0XA 1BOBA 4FD6A 2J8RA 2JEVA 2VXKA 3P2FA 4KOSA 4HKFA 4KLWA 1KUVA 2ZW4A 2VZZA 3EO4A 4C68A 5AG4A 1Q2YA 2YNCC 1YVOA 5AG7A 4Y49B 4CS0B 3NE7A 3G8WA 4CGMA 5AG6A 1P4NA 1R57A 4NF1A 3D3SA 2ARHA 4Q36A 1S60A 4JD6A 4YRHA 1XF8A 1IIDA 2FT0A 4CRZB 2WUUA 2CNMA 4Q38A 1UFHA 2OH1A 3G3SA 4XNHB 4B12A 2EUIA 5G21A 1WWZA 2WSAA 4C2XA 5KTCA 1Q2CA 5IX3A 2AE6A 3R1KA 3IWGA 4B11A 4AB7A 4C7HA 3IWEA 4QVTA 3WR7A 4H89A 4U9ZA 2G0BA 3EY5A 4B14A 4CAXA 1M4DA 3TTHA 1ON0A 4UWIA 3B8GA 2Q7BA 5EBVA 2FSRA 2VI7A 2C27A 4C7IA 4K30A 5DWNA 1PU9A 1S7NA 4KOVA 4UFWA 4CYQA 3D2MA 4KLVA 3QB8A 2OZHA 4YGOA 4J3GA 4XPDC 1KUYA 1NMTA 1XIXA 4MJ8A 1QSOA 2Q4VA 4FD7A 2B4DB 3JTKA 5HH1A 2GANA 4B5PA 2P6EA 3CXSA 2Z10A 4JXRA 4KVME 4FD5A 4PSWA 4KVXA 4QUSA 5J8FA 3W91A 2WPWA 5IB0A 4ORFA 3R96A 1RXTA 4E8OA 2J8NA 2AJ6A 1SQHA 3PZJA 4AG9A 4GS4A 2PR1A 2QECA 3FB3A 4B5OA 3DDDA 4M85A 3GY9A 5C88A 4IUSA 4E2AA 5H86A 2KCWA 4R57A 1Y9KA 4AVBA 5E96A 1LRZA 3GKRA 4A31A 4B10A 4KOWA 3DNSA 4LUAA 5CNPA 2CNTA 3E0KA 5KTDA 2PRBA 3QAHA 3N7ZA 4C2ZA 1S3ZA 2O28A 4KS9A 4A32A 3BLNA 1V0CA 1IYKA 1Z4RA 2R8VA 3TO6A 5JQ4A 2J8MA 1M1DA 3CXQA 4FD4A 1Q2DA 1B6BA 1YREA 5F49A 3SHPA 4B13A 3DR6A 3D2PA 2B3UA 4BMHA 1GHEA 3TOAA 3FYNA 4CGNA 1N71A 4QC6A 2HUZA 1U6MA 4H6ZA 2B5GB 2IL4A 3T90A 4U5YA 4XPKA 1FY7A 3VWDA 2VZYA 4CGOA 3PGPA 1XMTA 4DNCA 1XEBA 4L89A 2ZW7A 4HNYB 4UCPA 3SXNA 2Q04A 4XNHC 1YK3A 2ATRA 4MY0A 4KOTA 2G3AA 4KVOE 4OLLA 1M44A 4KORA 1Y9WA 1IB1E 3F0AA 2Z3NA 4R9MA 3V8IA 3I3GA 1Z9UA 2EVNA 4U9YA 4MBUA 1B87A 1YLEA 2ZPAA 5G22A 2F5IA 2FXFA 1QSTA 3TO7A 5KTAA 5FVJA 4MY3A 1CM0A 3W6XA 1ZO0A 4KOUA 3R9FA 1L0CA 4KOYA 3VWEA 3H4QA 4X5KA 3ZZIA 2D4OA 3FIXA 3TE4A 2X7BA 3EC4A 4NEXA 1IYLA 1OZPA 3F5BA 1QSNA 1PUAA 2FCKA 3W6SA 3A9LA 1MJBA 4XPDB 4E0AA 4AG7A 4A2ZA 2B4BA 3JUWA 5C82A 4A30A 1YX0A 4AVAA 1VHSA 4PK2A 2G3TA 4R3KA 4MFZA 2Z11A 1YVKA 5JPHA 2Z3MA 1S7KA 2REEA 4A95A 2VBQA 4LX9A 3I9SA 1P0HA 3C26A 4KOXA 2R1IA 3FBUA 4XPLA 4CYNA 5EC4A 4CYPA 2BEIA 4NSQA 4CYOA 3T9YA 1IICA 2Q4YA 4H6UA 2YNCA 3TOBA 4R87A 2YGWA 3FNCA 3ZJ0A 3JVNA 3IU1A 5F48A 2B5GA 5BWAB 5I0CA 1Z4EA 4MFKA 4CAEA 2PSWA 1M4GA 4ONUA 2BUEA 4II9A 5F47A 4KZTA 3S6FA 4B5PB 2Z3LA 5HMNA 4CAWA 3S6HA 4RS2A 5H84A 1CJWA 1VKCA 3EXNA 2VQYA 4R3LA 5A27A 2D4PA 2DPSA 4UBRA 2YNEA 5IV0A 4Y49C 2DPTA 3BJ8A 2OB0A 3S6GA 2CNSA 4UCMA 2P6FA 3IU2A 2CY2A 4JJXA 3LODA 4L8AA 4HNXB 4CGLA 3MGDA 2Y0MA 2R7HA 3R9EA 4BBHA 4F6AA 2FS5A 3TT2A 4CGPA 1XE4A 2HV2A 5J8CA 1S7FA 2FIAA 3KKWA 3TCVA 1K4JA 4NCZA 2GE3A 4I49A 4AVCA 2GIVA 4MFJA 1Y7RA 3GYAA 3P2HA 4CAVA 3BJ7A 4PV6A 1I1DA 2HQYA 4MHDA 2B4DA 2OZGA 3FXTA 2JLMA 2JDCA 2QIRA 2ZW6A 3DR8A 2B3VA 1I12A 3PP9A 4QBJA 3D8PA 2Z3PA 4F0YA 5AGEA 3K9UA 2I00A 2Q0YA 2BL1A 2A4NA 2BSWA 2Z0ZA 1KUXA 4EVYA 4UFXA 5GCNA 3TFYA 4QB9A 1YR0A 1NSLA 3H5ZA 1TIQA 5ISVA 1WK4A 2Z3KA 4OAEA 3UY5A 5G20A 1J4JA 1KZFA 2JDDA 3DSBA 3TO9A 1S5KA 2PDOA 4IF5A 3IGRA 1QSRA 2I79A 3EFAA 4PSXA 4MFQA 1RO5A 3F8KA 4MI4A 2QMLA 2ZW5A 1YGHA 2RC4A 2FIWA 1MJAA 2VEZA 4RI1A 4KSAA 2FL4A 3S6KA 4JXQA 4MFLA 2ZXVA 2NMTA 4CRYB 2H5MA 5AG5A 4OADA 5DWMA 4C2YA 1NE9A 3SXOA 3LD2A 2REFA 4ZGYB 1S7LA 3R95A 3R9GA 1MK4A 4KUAA 4CAFA 4NXYA 4M3SA 4ZBGA 3CXPA 4JWPA 5A28A 4YFJA 4KSFA 1I21A 2DXQA 2Z3OA 5F46A 4MFPA 3OWCA 2CXAA 2OU2A 4UA3A 2P6GA 2R98A 2Q44A 4A33A 2WPXA 4UCNA 2B58A 1QSMA 4KUBA 2FE7A 2K5TA 2OZUA 4PK3A 2PR8A 4UFVA 2YNDA 5G1ZA 4HNWB 3RYOA 2P0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M4I A;  3FRM A;  2PC1 A;  1MJ9 A;  4JLY A;  4UWJ A;  1BO4 A;  2PQ8 A;  1BOB A;  4FD6 A;  2J8R A;  2JEV A;  2VXK A;  3P2F A;  4KOS A;  4HKF A;  4KLW A;  1KUV A;  2ZW4 A;  2VZZ A;  3EO4 A;  1Q2Y A;  1YVO A;  4Y49 B;  4CS0 B;  3NE7 A;  3G8W A;  1P4N A;  1R57 A;  4NF1 A;  3D3S A;  2ARH A;  1S60 A;  4JD6 A;  4YRH A;  1XF8 A;  1IID A;  2FT0 A;  4CRZ B;  2CNM A;  1UFH A;  2OH1 A;  3G3S A;  4XNH B;  2EUI A;  1WWZ A;  5KTC A;  1Q2C A;  5IX3 A;  2AE6 A;  3R1K A;  3IWG A;  4AB7 A;  4QVT A;  3WR7 A;  4H89 A;  4U9Z A;  2G0B A;  3EY5 A;  4CAX A;  1M4D A;  3TTH A;  1ON0 A;  4UWI A;  3B8G A;  2Q7B A;  5EBV A;  2FSR A;  2VI7 A;  2C27 A;  4K30 A;  5DWN A;  1PU9 A;  1S7N A;  4KOV A;  3D2M A;  4KLV A;  3QB8 A;  2OZH A;  4YGO A;  4J3G A;  4XPD C;  1KUY A;  1NMT A;  1XIX A;  4MJ8 A;  1QSO A;  2Q4V A;  4FD7 A;  2B4D B;  5HH1 A;  2GAN A;  4B5P A;  2P6E A;  3CXS A;  2Z10 A;  4JXR A;  4KVM E;  4FD5 A;  4PSW A;  4KVX A;  4QUS A;  5J8F A;  3W91 A;  2WPW A;  5IB0 A;  4ORF A;  3R96 A;  1RXT A;  4E8O A;  2J8N A;  2AJ6 A;  1SQH A;  3PZJ A;  4AG9 A;  4GS4 A;  2PR1 A;  2QEC A;  3FB3 A;  4B5O A;  3DDD A;  4M85 A;  3GY9 A;  5C88 A;  4IUS A;  4E2A A;  5H86 A;  2KCW A;  4R57 A;  1Y9K A;  4AVB A;  5E96 A;  1LRZ A;  3GKR A;  4KOW A;  3DNS A;  4LUA A;  5CNP A;  2CNT A;  3E0K A;  5KTD A;  2PRB A;  3QAH A;  3N7Z A;  1S3Z A;  2O28 A;  3BLN A;  1V0C A;  1IYK A;  1Z4R A;  2R8V A;  3TO6 A;  5JQ4 A;  2J8M A;  1M1D A;  3CXQ A;  4FD4 A;  1Q2D A;  1B6B A;  1YRE A;  5F49 A;  3SHP A;  3DR6 A;  3D2P A;  2B3U A;  4BMH A;  1GHE A;  3TOA A;  3FYN A;  1N71 A;  4QC6 A;  2HUZ A;  1U6M A;  4H6Z A;  2B5G B;  2IL4 A;  3T90 A;  4U5Y A;  4XPK A;  1FY7 A;  3VWD A;  2VZY A;  3PGP A;  1XMT A;  4DNC A;  1XEB A;  4L89 A;  2ZW7 A;  4HNY B;  3SXN A;  2Q04 A;  4XNH C;  1YK3 A;  2ATR A;  4MY0 A;  4KOT A;  2G3A A;  4KVO E;  4OLL A;  1M44 A;  4KOR A;  1Y9W A;  1IB1 E;  3F0A A;  4R9M A;  3V8I A;  3I3G A;  1Z9U A;  2EVN A;  4U9Y A;  4MBU A;  1B87 A;  1YLE A;  2ZPA A;  2F5I A;  2FXF A;  1QST A;  3TO7 A;  5KTA A;  5FVJ A;  4MY3 A;  1CM0 A;  3W6X A;  4KOU A;  3R9F A;  1L0C A;  4KOY A;  3VWE A;  3H4Q A;  4X5K A;  3ZZI A;  2D4O A;  3FIX A;  3TE4 A;  2X7B A;  3EC4 A;  4NEX A;  1IYL A;  1OZP A;  3F5B A;  1QSN A;  1PUA A;  2FCK A;  3W6S A;  1MJB A;  4XPD B;  4E0A A;  4AG7 A;  2B4B A;  3JUW A;  5C82 A;  1YX0 A;  4AVA A;  1VHS A;  4PK2 A;  2G3T A;  4R3K A;  2Z11 A;  1YVK A;  5JPH A;  1S7K A;  2REE A;  2VBQ A;  4LX9 A;  3I9S A;  1P0H A;  3C26 A;  4KOX A;  2R1I A;  3FBU A;  4XPL A;  5EC4 A;  2BEI A;  4NSQ A;  3T9Y A;  1IIC A;  2Q4Y A;  4H6U A;  3TOB A;  4R87 A;  3FNC A;  3ZJ0 A;  3JVN A;  5F48 A;  2B5G A;  5I0C A;  1Z4E A;  2PSW A;  1M4G A;  4ONU A;  2BUE A;  4II9 A;  5F47 A;  4KZT A;  3S6F A;  4B5P B;  5HMN A;  4CAW A;  3S6H A;  4RS2 A;  5H84 A;  1CJW A;  1VKC A;  3EXN A;  2VQY A;  4R3L A;  2D4P A;  4UBR A;  5IV0 A;  4Y49 C;  3BJ8 A;  2OB0 A;  3S6G A;  2CNS A;  2P6F A;  2CY2 A;  4JJX A;  3LOD A;  4L8A A;  4HNX B;  3MGD A;  2Y0M A;  2R7H A;  3R9E A;  4F6A A;  2FS5 A;  3TT2 A;  1XE4 A;  2HV2 A;  5J8C A;  1S7F A;  2FIA A;  3KKW A;  3TCV A;  1K4J A;  4NCZ A;  2GE3 A;  4I49 A;  4AVC A;  2GIV A;  1Y7R A;  3GYA A;  3P2H A;  4CAV A;  3BJ7 A;  4PV6 A;  1I1D A;  2HQY A;  4MHD A;  2B4D A;  2OZG A;  3FXT A;  2JLM A;  2JDC A;  2QIR A;  2ZW6 A;  3DR8 A;  2B3V A;  1I12 A;  3PP9 A;  4QBJ A;  3D8P A;  4F0Y A;  3K9U A;  2I00 A;  2Q0Y A;  2BL1 A;  2A4N A;  2BSW A;  2Z0Z A;  1KUX A;  4EVY A;  5GCN A;  3TFY A;  4QB9 A;  1YR0 A;  1NSL A;  1TIQ A;  5ISV A;  1WK4 A;  4OAE A;  3UY5 A;  1J4J A;  1KZF A;  2JDD A;  3DSB A;  3TO9 A;  1S5K A;  2PDO A;  4IF5 A;  3IGR A;  1QSR A;  2I79 A;  3EFA A;  4PSX A;  1RO5 A;  3F8K A;  4MI4 A;  2QML A;  2ZW5 A;  1YGH A;  2RC4 A;  2FIW A;  1MJA A;  2VEZ A;  4RI1 A;  2FL4 A;  3S6K A;  4JXQ A;  2ZXV A;  2NMT A;  4CRY B;  2H5M A;  4OAD A;  5DWM A;  1NE9 A;  3SXO A;  3LD2 A;  2REF A;  1S7L A;  3R95 A;  3R9G A;  1MK4 A;  4KUA A;  4NXY A;  4M3S A;  4ZBG A;  3CXP A;  4JWP A;  4YFJ A;  1I21 A;  2DXQ A;  5F46 A;  3OWC A;  2OU2 A;  4UA3 A;  2P6G A;  2R98 A;  2Q44 A;  2WPX A;  2B58 A;  1QSM A;  4KUB A;  2FE7 A;  2K5T A;  2OZU A;  4PK3 A;  2PR8 A;  4HNW B;  3RYO A;  2P0W A; 
#chains in the Genus database with same CATH topology
 1M4I A;  2O4H A;  3FRM A;  2OR4 A;  2EO8 A;  2PC1 A;  1MJ9 A;  3BHX A;  4JLY A;  8CPA A;  3VAT A;  1TF9 A;  4UWJ A;  1Z8X A;  1BO4 A;  2PQ8 A;  3I1U A;  4OC2 A;  4F0X A;  4A94 A;  1BOB A;  4FD6 A;  3NA6 A;  4ZY2 A;  2J8R A;  2JEV A;  5JGF A;  2AFX A;  5ELY A;  2VXK A;  3P2F A;  4KOS A;  4HKF A;  2F7V A;  1KUV A;  2AFS A;  2ZW4 A;  4KLW A;  2VZZ A;  3EO4 A;  4OME A;  2J9A A;  1Q2Y A;  2YNC C;  3CPX A;  5THW A;  1YVO A;  5AG7 A;  4BD9 A;  3BI1 A;  4M6G A;  4Y49 B;  4CS0 B;  4MMO A;  3SJF A;  3NE7 A;  1XJO A;  2PJB A;  3G8W A;  4CGM A;  5AG6 A;  1P4N A;  2WZN A;  1R57 A;  4NF1 A;  3D3S A;  2ARH A;  4Q36 A;  1S60 A;  4JD6 A;  4YRH A;  1XF8 A;  1IID A;  2FT0 A;  4CRZ B;  2WUU A;  2CNM A;  2Q7S A;  3L2N A;  4Q38 A;  1UFH A;  2OH1 A;  1HDU A;  5HXD A;  3G3S A;  4XNH B;  5K8M A;  4B12 A;  1BPM A;  2EUI A;  5G21 A;  1WWZ A;  2WSA A;  1HDQ A;  4IK2 A;  4C2X A;  2PJC A;  3SI0 A;  4OID A;  5KTC A;  1Z8W A;  2GRE A;  4JYW A;  1Q2C A;  5IX3 A;  2AE6 A;  3R1K A;  2ZOF A;  1Y0R A;  3DGV A;  3IWG A;  4B11 A;  2EK8 A;  4AB7 A;  4C7H A;  3IWE A;  1A2Z A;  4PQA A;  2OOT A;  1Z8L A;  4QVT A;  2C6G A;  3WR7 A;  2ZED A;  1NSA A;  3HLP A;  3LWU A;  4H89 A;  4PXD A;  4UIB A;  4U9Z A;  4ZX8 A;  4EFD A;  2G0B A;  3EY5 A;  4B14 A;  4CAX A;  1M4D A;  3KAS A;  3TTH A;  5HVH A;  4P4I A;  4FUU A;  1ON0 A;  2ZEE A;  2I3C A;  3DLJ A;  3LMS A;  4UWI A;  2XEJ A;  4P4E A;  3B8G A;  3GUX A;  2Q7B A;  3NH4 A;  4PXC A;  2BCO A;  7CPA A;  5EBV A;  3QAY A;  2PJ3 A;  4GXH A;  2FSR A;  2QVP A;  2VI7 A;  4MRI A;  2ZEG A;  2JEW A;  4EME A;  2C27 A;  4MHY A;  2RB7 A;  1IOI A;  3K2K A;  1CPX A;  3QNV A;  4K30 A;  4WJB A;  1PU9 A;  1S7N A;  5DWN A;  4KOV A;  4UFW A;  3PB9 X;  3IC1 A;  5HVF A;  1CBX A;  4A37 A;  2RFH A;  4CYQ A;  1CX8 A;  3D2M A;  4KLV A;  3QB8 A;  2OZH A;  4YGO A;  4NJQ A;  4J3G A;  4XPD C;  1KUY A;  1NMT A;  4F9U A;  1XIX A;  4NGM A;  5K8N A;  1ZG9 A;  3IO1 A;  4MJ8 A;  4ZI6 A;  2PIZ A;  1QSO A;  1IY7 A;  2Q4V A;  4FD7 A;  2B4D B;  2EK9 A;  3JTK A;  4NGS A;  5HH1 A;  2GAN A;  3SI2 A;  2P6E A;  5LYD A;  4B5P A;  1BLL E;  3CXS A;  2Z10 A;  4P44 A;  4JXR A;  4PXB A;  1R3N A;  1XMB A;  2CTC A;  4KVM E;  2IJZ A;  4FD5 A;  5CPA A;  1GYT A;  4PSW A;  2V8D A;  4KVX A;  4QUS A;  5J8F A;  3W91 A;  5EMI A;  4MCQ A;  2EWB A;  2PJ0 A;  4F9V A;  2WPW A;  5IB0 A;  1JWQ A;  4ORF A;  2CF4 A;  4EWT A;  3R96 A;  4JZ0 A;  1RXT A;  3NFZ A;  3MRU A;  5K8O A;  4E8O A;  2J8N A;  3NH5 A;  1AMP A;  3WT4 A;  2AJ6 A;  1ARL A;  1SQH A;  3PZJ A;  4NJR A;  1TKH A;  2PR1 A;  2QEC A;  3FB3 A;  4GS4 A;  4AG9 A;  4B5O A;  3DDD A;  4M85 A;  3GY9 A;  4W9Y A;  5C88 A;  4IUS A;  1PYT B;  2BO9 A;  4E2A A;  4NGT A;  2PE3 A;  1UWY A;  1ZLH A;  5H86 A;  3RO0 A;  1LAN A;  3B7I A;  2KCW A;  1QMU A;  4R57 A;  1Y9K A;  4AVB A;  5E96 A;  1LRZ A;  2POK A;  3GKR A;  4A31 A;  1TKF A;  4MXU A;  1ZG7 A;  4B10 A;  4KOW A;  3DNS A;  4LUA A;  4IAV A;  1IU8 A;  1X10 A;  1CP6 A;  1H8L A;  2CNT A;  4P45 A;  5CNP A;  2Q43 A;  3E0K A;  4NGN A;  3GIU A;  3FF3 A;  1JQG A;  4C7I A;  5KTD A;  4P10 A;  1DE4 C;  2PRB A;  1LCP A;  3N7Z A;  3QAH A;  4C2Z A;  3B2Y A;  1S3Z A;  5F09 A;  2O28 A;  4KS9 A;  1ZG8 A;  2ODF A;  1BAV A;  3PBB A;  3BLN A;  4M6I A;  4YU9 A;  3RNZ A;  1V0C A;  3TX8 A;  4A32 A;  1IYK A;  1Z4R A;  1PCA A;  1YQE A;  2R8V A;  3TO6 A;  5JQ4 A;  2J8M A;  4P6Y A;  1M1D A;  1YW6 A;  3CXQ A;  3LAC A;  4FD4 A;  1Q2D A;  2CTB A;  5AG4 A;  2HC9 A;  1B6B A;  1YRE A;  5F49 A;  3SHP A;  4B13 A;  4OC4 A;  3DR6 A;  4X3R A;  4GM5 A;  3D2P A;  2B3U A;  4BMH A;  1GHE A;  3TOA A;  3FYN A;  5D8N A;  4CGN A;  3KZW A;  4TWE A;  1N71 A;  4QC6 A;  1VIX A;  2HUZ A;  1R43 A;  2PVW A;  1U6M A;  4H6Z A;  2IMO A;  2ZEN A;  2B5G B;  2IL4 A;  3T90 A;  3FEC A;  5I4M A;  4PXE A;  5JH9 A;  5LYF A;  2CIJ A;  4U5Y A;  4XPK A;  1FY7 A;  3VWD A;  2VZY A;  4CGO A;  3V7Z A;  5JM6 A;  3PGP A;  3ISX A;  1XMT A;  4DNC A;  1XEB A;  4L89 A;  2V77 A;  2ZW7 A;  4UEZ A;  1AUG A;  4HNY B;  4UCP A;  3SXN A;  2Q04 A;  3PB6 X;  4XNH C;  1YK3 A;  2ATR A;  4MY0 A;  2IQ6 A;  4KOT A;  4MHN A;  5LYI A;  2G3A A;  4KVO E;  4OLL A;  1M44 A;  4LQ6 A;  4KOR A;  3RZA A;  1Q7L A;  1Z8T A;  1Y9W A;  3CDX A;  5CBM A;  5K8P A;  1IB1 E;  3H8F A;  2PRQ A;  3PBE A;  3IIB A;  3F0A A;  3H8E A;  2Z3N A;  4BIN A;  4R9M A;  3SJG A;  3V8I A;  4UF4 A;  3I3G A;  1Z9U A;  4M6H A;  1YME A;  3IWW A;  3WC6 A;  5LRG A;  4A39 A;  2EVN A;  1LFW A;  4U9Y A;  3BI0 A;  2WYR A;  4MBU A;  1B87 A;  1YLE A;  3SJE A;  2ZPA A;  4NFR A;  5G22 A;  2F5I A;  2FXF A;  1QST A;  5DS0 A;  3TO7 A;  5FVJ A;  4MY3 A;  5KTA A;  2PJA A;  1CM0 A;  2QYV A;  3W6X A;  1ZO0 A;  1TKJ A;  4KOU A;  3FX6 A;  4B6Z A;  3RAM A;  3R9F A;  1L0C A;  3B3W A;  4KOY A;  3VWE A;  3H4Q A;  4X5K A;  1FT7 A;  2ZEO A;  2D4O A;  3ZZI A;  3FIX A;  3FEE A;  2AFM A;  2AFO A;  1HEE A;  3TE4 A;  2PJ1 A;  2X7B A;  1ELM P;  1XRY A;  2VL1 A;  3EC4 A;  4NEX A;  1IYL A;  1OZP A;  4P4J A;  2O53 A;  1F2O A;  4UIA A;  5D29 A;  3F5B A;  2FVG A;  1QSN A;  3CZX A;  1PUA A;  2F8H A;  2FCK A;  3W6S A;  3A9L A;  4Q7A A;  1XFO A;  1MJB A;  4XPD B;  4E0A A;  4YWY A;  2C6P A;  2PIY A;  4AG7 A;  4A2Z A;  3KGQ A;  3CT9 A;  2B4B A;  3JUW A;  4R76 A;  1RTQ A;  1YX0 A;  4A30 A;  4AVA A;  4CPA A;  5C82 A;  3PB8 X;  1VHS A;  4MHZ A;  4PK2 A;  4ZY1 A;  3GLJ A;  3FMC A;  1TF8 A;  2NYQ A;  2G3T A;  5LYL A;  4R3K A;  4MFZ A;  2Z11 A;  1YVK A;  4X8I A;  5JPH A;  2Z3M A;  1ARM A;  1S7K A;  2REE A;  4A95 A;  4OC1 A;  3K9T A;  4KSI A;  4R8F A;  2VBQ A;  4LX9 A;  3I9S A;  1P0H A;  3C26 A;  1OBR A;  4KOX A;  4OP4 A;  2R1I A;  3FBU A;  4XPL A;  3T8W A;  3KR4 A;  2EBJ A;  3SJX A;  4CYN A;  4X2T A;  5EC4 A;  4CYP A;  2BEI A;  1LAP A;  4NSQ A;  3S9N A;  4CYO A;  1BPN A;  4MCS A;  2ZOG A;  3T9Y A;  1IIC A;  2Q4Y A;  4H6U A;  2PJ2 A;  4FAI A;  4LQG A;  1YLO A;  2YNC A;  3TOB A;  4R87 A;  5IB9 A;  2PJ7 A;  1F2P A;  1EE3 P;  2YGW A;  3FNC A;  3JVN A;  3ZJ0 A;  3IU1 A;  5F48 A;  2B5G A;  4G1P A;  3ISZ A;  5BWA B;  2PJ5 A;  5I0C A;  1Z4E A;  4ZYQ A;  4TNU A;  1F57 A;  3KQX A;  4MFK A;  3D7H A;  4CAE A;  2PSW A;  4O23 A;  4PPZ A;  1M4G A;  4ONU A;  3RBU A;  1VHE A;  2ABZ A;  2BUE A;  4II9 A;  2DEA A;  5F47 A;  4KZT A;  3S6F A;  4B5P B;  2V8V A;  2Z3L A;  3IEH A;  5HMN A;  4CAW A;  3D68 A;  3S6H A;  2PJ6 A;  2ANP A;  4RS2 A;  3S9M A;  4NGP A;  1CJW A;  5H84 A;  2Q4Z A;  3HUV A;  4OC0 A;  1CG2 A;  4IHM A;  1VKC A;  3EXN A;  3FED A;  2VQY A;  4R3L A;  5A27 A;  1DTD A;  2D4P A;  2DPS A;  4MCP A;  1YSJ A;  4UBR A;  2YNE A;  5IV0 A;  4Y49 C;  3JRU A;  2DPT A;  3BJ8 A;  2OB0 A;  3S6G A;  1CPS A;  3B3V A;  2CNS A;  1Y0Y A;  3B35 A;  2P6F A;  4UCM A;  3IU2 A;  4K3N A;  2NSM A;  1Z2L A;  2CY2 A;  2G9D A;  4JJX A;  4ZY0 A;  3LOD A;  4L8A A;  2ZEL A;  4HNX B;  3PFO A;  4CGL A;  1IOF A;  3MGD A;  2V8H A;  2R7H A;  2Y0M A;  4NGR A;  3R9E A;  4BBH A;  4F6A A;  3IJ3 A;  4OC5 A;  3D4U A;  2FS5 A;  2PVV A;  3TT2 A;  4R6T A;  4CGP A;  1XE4 A;  2HV2 A;  4Z65 A;  5J8C A;  3S9L A;  1S7F A;  2FIA A;  3VAR A;  4OC3 A;  3KKW A;  3TCV A;  1K4J A;  2ZEF A;  3D67 A;  4NCZ A;  1CP7 A;  2XEF A;  2GE3 A;  4I49 A;  3V38 A;  4AVC A;  2GIV A;  4MFJ A;  1Y7R A;  3GYA A;  1M4L A;  3P2H A;  3B3C A;  2AFZ A;  4CAV A;  3BJ7 A;  4PV6 A;  4C68 A;  5HVG A;  1I1D A;  2HQY A;  4MHD A;  2B4D A;  4FWU A;  2OZG A;  3NH8 A;  1YW4 A;  1IGB A;  3FXT A;  4OIW A;  2JLM A;  4RN7 A;  2JDC A;  3MN8 A;  2HB6 A;  2QIR A;  2ZW6 A;  3DR8 A;  3TC8 A;  2GLJ A;  2B3V A;  1I12 A;  1FNO A;  3BXM A;  3PP9 A;  3FJU A;  1XBU A;  4QBJ A;  3D8P A;  2Z3P A;  3D7D A;  2ZEH A;  4H2K A;  5LRJ A;  3FH4 A;  4F0Y A;  3H8G A;  2QJ8 A;  5AGE A;  4RUH A;  6CPA A;  2GLF A;  3K9U A;  2I00 A;  2Q0Y A;  2AFU A;  2BL1 A;  1LAM A;  2AFW A;  3KI9 A;  4MCR A;  3VH9 A;  3WC5 A;  2A4N A;  2BSW A;  1QQ9 A;  1KUX A;  1XOV A;  2Z0Z A;  3KHX A;  4UFX A;  5GCN A;  4EVY A;  3TFY A;  4QB9 A;  1YR0 A;  1NSL A;  3H5Z A;  1TIQ A;  5ISV A;  1WK4 A;  2Z3K A;  4OAE A;  3N5F A;  4P4B A;  3UY5 A;  5G20 A;  1J4J A;  1KZF A;  2PJ4 A;  1TXR A;  2JDD A;  3DSB A;  1ZLI A;  3KL9 A;  3TO9 A;  4FBE A;  1LOK A;  1S5K A;  2PDO A;  4IF5 A;  4F8Z A;  3IGR A;  1QSR A;  2I79 A;  1VGY A;  3EFA A;  3IFE A;  4PSX A;  4MFQ A;  1Y7E A;  4WWV A;  1RO5 A;  3F8K A;  3FVL A;  4MI4 A;  1KWM A;  2QML A;  2ZW5 A;  1YGH A;  2RC4 A;  2FIW A;  4MHP A;  1MJA A;  4ONW A;  2VEZ A;  3D7F A;  4RI1 A;  4KSA A;  2FL4 A;  3S6K A;  4JXQ A;  2C6C A;  3D66 A;  3PRT A;  2ZXV A;  4MFL A;  2NMT A;  3D7G A;  4A38 A;  4CRY B;  3SI1 A;  2PCU A;  2DF5 A;  3PB4 X;  2H5M A;  4NGQ A;  5AG5 A;  4OAD A;  2C1C A;  5DWM A;  4C2Y A;  4ZX9 A;  1NE9 A;  3SXO A;  2BOA A;  3LD2 A;  3CPA A;  3PEI A;  2ZEM A;  2REF A;  3KR5 A;  4ZGY B;  1S7L A;  3B3S A;  4OKO A;  3R95 A;  3R9G A;  3PB7 X;  1MK4 A;  3WC7 A;  1Z5R A;  1X12 A;  2V8G A;  1ELL P;  4KUA A;  4CAF A;  4NXY A;  4M3S A;  4ZBG A;  3B3T A;  3CXP A;  4JWP A;  4DUK A;  4DYO A;  5A28 A;  4HPS A;  4YFJ A;  3GB0 A;  4KSF A;  2Q51 A;  3KHZ A;  3PFE A;  1I21 A;  2DXQ A;  2Z3O A;  5F46 A;  4MFP A;  3OWC A;  2PJ9 A;  4R7M A;  2PJ8 A;  2CXA A;  2OU2 A;  2JBK A;  4UA3 A;  2P6G A;  2R98 A;  3WAB A;  2GFQ A;  2XEG A;  1AYE A;  2Q44 A;  4A33 A;  3KQZ A;  2JBJ A;  2WPX A;  4P4D A;  1VHO A;  2B58 A;  4UCN A;  1QSM A;  4KUB A;  2FE7 A;  3NE8 A;  4AXV A;  2K5T A;  2OZU A;  4PK3 A;  2PR8 A;  4UFV A;  2YND A;  5G1Z A;  2ZEP A;  4HNW B;  5J1Q A;  4UEE A;  4UEF A;  4P4F A;  4DJL A;  3RYO A;  5LRK A;  2P0W A;  2XEI A;  2GU2 A; 
#chains in the Genus database with same CATH homology
 1M4I A;  3FRM A;  2PC1 A;  1MJ9 A;  4JLY A;  4UWJ A;  1BO4 A;  2PQ8 A;  4F0X A;  1BOB A;  4FD6 A;  2J8R A;  2JEV A;  2VXK A;  3P2F A;  4KOS A;  4HKF A;  4KLW A;  1KUV A;  2ZW4 A;  2VZZ A;  3EO4 A;  4C68 A;  5AG4 A;  1Q2Y A;  2YNC C;  1YVO A;  5AG7 A;  4Y49 B;  4CS0 B;  3NE7 A;  3G8W A;  4CGM A;  5AG6 A;  1P4N A;  1R57 A;  4NF1 A;  3D3S A;  2ARH A;  4Q36 A;  1S60 A;  4JD6 A;  4YRH A;  1XF8 A;  1IID A;  2FT0 A;  4CRZ B;  2WUU A;  2CNM A;  4Q38 A;  1UFH A;  2OH1 A;  3G3S A;  4XNH B;  4B12 A;  2EUI A;  5G21 A;  1WWZ A;  2WSA A;  4C2X A;  5KTC A;  1Q2C A;  5IX3 A;  2AE6 A;  3R1K A;  3IWG A;  4B11 A;  4AB7 A;  4C7H A;  3IWE A;  4QVT A;  3WR7 A;  4H89 A;  4U9Z A;  2G0B A;  3EY5 A;  4B14 A;  4CAX A;  1M4D A;  3TTH A;  1ON0 A;  4UWI A;  3B8G A;  2Q7B A;  5EBV A;  2FSR A;  2VI7 A;  2C27 A;  4C7I A;  4K30 A;  5DWN A;  1PU9 A;  1S7N A;  4KOV A;  4UFW A;  4CYQ A;  3D2M A;  4KLV A;  3QB8 A;  2OZH A;  4YGO A;  4J3G A;  4XPD C;  1KUY A;  1NMT A;  1XIX A;  4MJ8 A;  1QSO A;  2Q4V A;  4FD7 A;  2B4D B;  3JTK A;  5HH1 A;  2GAN A;  4B5P A;  2P6E A;  3CXS A;  2Z10 A;  4JXR A;  4KVM E;  4FD5 A;  4PSW A;  4KVX A;  4QUS A;  5J8F A;  3W91 A;  2WPW A;  5IB0 A;  4ORF A;  3R96 A;  1RXT A;  4E8O A;  2J8N A;  2AJ6 A;  1SQH A;  3PZJ A;  4AG9 A;  4GS4 A;  2PR1 A;  2QEC A;  3FB3 A;  4B5O A;  3DDD A;  4M85 A;  3GY9 A;  5C88 A;  4IUS A;  4E2A A;  5H86 A;  2KCW A;  4R57 A;  1Y9K A;  4AVB A;  5E96 A;  1LRZ A;  3GKR A;  4A31 A;  4B10 A;  4KOW A;  3DNS A;  4LUA A;  5CNP A;  2CNT A;  3E0K A;  5KTD A;  2PRB A;  3QAH A;  3N7Z A;  4C2Z A;  1S3Z A;  2O28 A;  4KS9 A;  4A32 A;  3BLN A;  1V0C A;  1IYK A;  1Z4R A;  2R8V A;  3TO6 A;  5JQ4 A;  2J8M A;  1M1D A;  3CXQ A;  4FD4 A;  1Q2D A;  1B6B A;  1YRE A;  5F49 A;  3SHP A;  4B13 A;  3DR6 A;  3D2P A;  2B3U A;  4BMH A;  1GHE A;  3TOA A;  3FYN A;  4CGN A;  1N71 A;  4QC6 A;  2HUZ A;  1U6M A;  4H6Z A;  2B5G B;  2IL4 A;  3T90 A;  4U5Y A;  4XPK A;  1FY7 A;  3VWD A;  2VZY A;  4CGO A;  3PGP A;  1XMT A;  4DNC A;  1XEB A;  4L89 A;  2ZW7 A;  4HNY B;  4UCP A;  3SXN A;  2Q04 A;  4XNH C;  1YK3 A;  2ATR A;  4MY0 A;  4KOT A;  2G3A A;  4KVO E;  4OLL A;  1M44 A;  4KOR A;  1Y9W A;  1IB1 E;  3F0A A;  2Z3N A;  4R9M A;  3V8I A;  3I3G A;  1Z9U A;  2EVN A;  4U9Y A;  4MBU A;  1B87 A;  1YLE A;  2ZPA A;  5G22 A;  2F5I A;  2FXF A;  1QST A;  3TO7 A;  5KTA A;  5FVJ A;  4MY3 A;  1CM0 A;  3W6X A;  1ZO0 A;  4KOU A;  3R9F A;  1L0C A;  4KOY A;  3VWE A;  3H4Q A;  4X5K A;  3ZZI A;  2D4O A;  3FIX A;  3TE4 A;  2X7B A;  3EC4 A;  4NEX A;  1IYL A;  1OZP A;  3F5B A;  1QSN A;  1PUA A;  2FCK A;  3W6S A;  3A9L A;  1MJB A;  4XPD B;  4E0A A;  4AG7 A;  4A2Z A;  2B4B A;  3JUW A;  5C82 A;  4A30 A;  1YX0 A;  4AVA A;  1VHS A;  4PK2 A;  2G3T A;  4R3K A;  4MFZ A;  2Z11 A;  1YVK A;  5JPH A;  2Z3M A;  1S7K A;  2REE A;  4A95 A;  2VBQ A;  4LX9 A;  3I9S A;  1P0H A;  3C26 A;  4KOX A;  2R1I A;  3FBU A;  4XPL A;  4CYN A;  5EC4 A;  4CYP A;  2BEI A;  4NSQ A;  4CYO A;  3T9Y A;  1IIC A;  2Q4Y A;  4H6U A;  2YNC A;  3TOB A;  4R87 A;  2YGW A;  3FNC A;  3ZJ0 A;  3JVN A;  3IU1 A;  5F48 A;  2B5G A;  5BWA B;  5I0C A;  1Z4E A;  4MFK A;  4CAE A;  2PSW A;  1M4G A;  4ONU A;  2BUE A;  4II9 A;  5F47 A;  4KZT A;  3S6F A;  4B5P B;  2Z3L A;  5HMN A;  4CAW A;  3S6H A;  4RS2 A;  5H84 A;  1CJW A;  1VKC A;  3EXN A;  2VQY A;  4R3L A;  5A27 A;  2D4P A;  2DPS A;  4UBR A;  2YNE A;  5IV0 A;  4Y49 C;  2DPT A;  3BJ8 A;  2OB0 A;  3S6G A;  2CNS A;  4UCM A;  2P6F A;  3IU2 A;  2CY2 A;  4JJX A;  3LOD A;  4L8A A;  4HNX B;  4CGL A;  3MGD A;  2Y0M A;  2R7H A;  3R9E A;  4BBH A;  4F6A A;  2FS5 A;  3TT2 A;  4CGP A;  1XE4 A;  2HV2 A;  5J8C A;  1S7F A;  2FIA A;  3KKW A;  3TCV A;  1K4J A;  4NCZ A;  2GE3 A;  4I49 A;  4AVC A;  2GIV A;  4MFJ A;  1Y7R A;  3GYA A;  3P2H A;  4CAV A;  3BJ7 A;  4PV6 A;  1I1D A;  2HQY A;  4MHD A;  2B4D A;  2OZG A;  3FXT A;  2JLM A;  2JDC A;  2QIR A;  2ZW6 A;  3DR8 A;  2B3V A;  1I12 A;  3PP9 A;  4QBJ A;  3D8P A;  2Z3P A;  4F0Y A;  5AGE A;  3K9U A;  2I00 A;  2Q0Y A;  2BL1 A;  2A4N A;  2BSW A;  2Z0Z A;  1KUX A;  4EVY A;  4UFX A;  5GCN A;  3TFY A;  4QB9 A;  1YR0 A;  1NSL A;  3H5Z A;  1TIQ A;  5ISV A;  1WK4 A;  2Z3K A;  4OAE A;  3UY5 A;  5G20 A;  1J4J A;  1KZF A;  2JDD A;  3DSB A;  3TO9 A;  1S5K A;  2PDO A;  4IF5 A;  3IGR A;  1QSR A;  2I79 A;  3EFA A;  4PSX A;  4MFQ A;  1RO5 A;  3F8K A;  4MI4 A;  2QML A;  2ZW5 A;  1YGH A;  2RC4 A;  2FIW A;  1MJA A;  2VEZ A;  4RI1 A;  4KSA A;  2FL4 A;  3S6K A;  4JXQ A;  4MFL A;  2ZXV A;  2NMT A;  4CRY B;  2H5M A;  5AG5 A;  4OAD A;  5DWM A;  4C2Y A;  1NE9 A;  3SXO A;  3LD2 A;  2REF A;  4ZGY B;  1S7L A;  3R95 A;  3R9G A;  1MK4 A;  4KUA A;  4CAF A;  4NXY A;  4M3S A;  4ZBG A;  3CXP A;  4JWP A;  5A28 A;  4YFJ A;  4KSF A;  1I21 A;  2DXQ A;  2Z3O A;  5F46 A;  4MFP A;  3OWC A;  2CXA A;  2OU2 A;  4UA3 A;  2P6G A;  2R98 A;  2Q44 A;  4A33 A;  2WPX A;  4UCN A;  2B58 A;  1QSM A;  4KUB A;  2FE7 A;  2K5T A;  2OZU A;  4PK3 A;  2PR8 A;  4UFV A;  2YND A;  5G1Z A;  4HNW B;  3RYO A;  2P0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...