3LODA

The crystal structure of the putative acyl-coa n-acyltransferase from klebsiella pneumoniae subsp.pneumoniae mgh 78578
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
154
structure length
145
Chain Sequence
b'NAMYTITDIAPTDAEFIALIAALDAWQETLDLSQLPPQTVIALAIRSPQGEAVGCGAIVLSEEGFGEMKRVYIDPQHRGQQLGEKLLAALEAKARQRDCHTLRLETGIHQHAAIALYTRNGYQTRCAFAPYQPDPLSVFMEKPLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative acyl-CoA N-acyltransferase
molecule tags Transferase
source organism Klebsiella pneumoniae subsp. pneumoniae
publication title The crystal structure of the putative acyl-CoA N-acyltransferase from Klebsiella pneumoniae
rcsb
total genus 43
structure length 145
sequence length 154
ec nomenclature
pdb deposition date 2010-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3lodA00
4E2AA 4NCZA 2ZW7A 2FIWA 2VZYA 2Z10A 2B4BA 1V0CA 4F6AA 2JDDA 4AG9A 1NMTA 4HKFA 2VQYA 4B5PA 1YLEA 1YR0A 2R8VA 4KUBA 5IX3A 2B3VA 3F0AA 2ZW4A 4AVBA 4NEXA 2OB0A 3GY9A 4RI1A 4KOWA 1CJWA 3QB8A 4KVME 2O28A 4E8OA 3TO9A 4AB7A 2REFA 4LUAA 4AVCA 4CRYB 3KKWA 4CAVA 3FBUA 2CNSA 3SHPA 1GHEA 1IYKA 2ATRA 2G0BA 2EUIA 2H5MA 3C26A 3VWDA 1XIXA 3UY5A 3D2MA 3R95A 3R9GA 2GANA 3TOAA 2BEIA 3S6FA 3N7ZA 4Y49B 2F5IA 3T90A 5I0CA 1S7KA 3R1KA 1M4GA 4AVAA 3F8KA 2ZW6A 1N71A 1WWZA 2D4PA 1Z4RA 4KOVA 2PSWA 3WR7A 2D4OA 1S3ZA 4YFJA 3FNCA 1YX0A 4U9YA 3BJ8A 5HMNA 4GS4A 2OZHA 1XE4A 4JXRA 4NXYA 1I21A 4QB9A 1Q2CA 3PP9A 3ZZIA 2J8NA 4IUSA 2AJ6A 2QIRA 2BUEA 1PU9A 3TO6A 3B8GA 3EO4A 4R3KA 4KVXA 4XPDB 1FY7A 2QMLA 4PSXA 3SXNA 3G8WA 4XPDC 4J3GA 4KZTA 3TTHA 1L0CA 1KUVA 3S6KA 4PK2A 2PDOA 1NSLA 2WPWA 4E0AA 3E0KA 2KCWA 4MY3A 3GYAA 4XNHC 2DXQA 3JVNA 3DSBA 4UWJA 2CNTA 2ARHA 2Q4VA 2PC1A 2B5GA 1M1DA 4JWPA 4JXQA 2PR1A 2EVNA 5IB0A 1MJAA 4PV6A 1MK4A 3EY5A 4QVTA 3K9UA 1Y7RA 4EVYA 2P6FA 4B5OA 1QSNA 5ISVA 1IIDA 5C82A 1YGHA 4RS2A 1B6BA 3V8IA 2G3TA 1QSRA 1BOBA 3T9YA 2J8MA 5C88A 4X5KA 4L8AA 2G3AA 4M3SA 1YK3A 3R9EA 1Z4EA 3R9FA 5J8FA 1K4JA 1Q2YA 2BSWA 4MBUA 5JQ4A 3D2PA 1XMTA 4OAEA 3D3SA 2OZGA 1YREA 2VBQA 5FVJA 5IV0A 1MJ9A 1I12A 4LX9A 4NSQA 4YGOA 3JUWA 4QC6A 4UBRA 1IICA 3CXQA 2Q4YA 3CXSA 3R96A 3LD2A 2AE6A 4U9ZA 4ORFA 3IWGA 3LODA 3I9SA 2JDCA 1RXTA 3MGDA 1TIQA 2I00A 5H86A 5JPHA 1VKCA 5F47A 4YRHA 3GKRA 3F5BA 4KLVA 4UA3A 5EC4A 4XNHB 3P2HA 4PK3A 5KTDA 3OWCA 4KORA 4L89A 3DR8A 3TFYA 4CRZB 4HNWB 1QSMA 4CS0B 2R7HA 4KVOE 3EC4A 3FIXA 3IGRA 1U6MA 5F49A 3TE4A 5J8CA 2B5GB 4KOUA 3RYOA 4HNXB 1XF8A 4IF5A 1IYLA 2P0WA 2PQ8A 2IL4A 2J8RA 4NF1A 3W91A 1P4NA 1RO5A 2REEA 3DR6A 4HNYB 4CAWA 3BLNA 2R98A 2FXFA 2FCKA 2FS5A 4PSWA 5F48A 4JLYA 2VI7A 2CY2A 5GCNA 2PRBA 2HV2A 4B5PB 1XEBA 2GE3A 2B58A 1ON0A 2FE7A 3NE7A 1NE9A 3QAHA 5DWNA 2Q7BA 2HQYA 4ONUA 5DWMA 1OZPA 3TT2A 3S6HA 1S60A 3TO7A 2FIAA 4KUAA 4U5YA 2I79A 2P6GA 1S7NA 3BJ7A 4M85A 4R9MA 2NMTA 3TOBA 4MY0A 4FD5A 2GIVA 2Y0MA 2B4DA 3W6SA 3H4QA 4OLLA 2P6EA 3PZJA 1YVOA 2Z0ZA 2QECA 1S7FA 4R57A 4UWIA 4DNCA 1QSTA 2Q44A 2JLMA 4MHDA 4KOYA 4JD6A 1Q2DA 4QUSA 3VWEA 4H6ZA 2X7BA 3FYNA 1I1DA 1YVKA 1P0HA 3W6XA 1S5KA 2Q0YA 2ZW5A 4AG7A 2ZXVA 5KTAA 3TCVA 3CXPA 3D8PA 2R1IA 4CAXA 1B87A 2C27A 1BO4A 2BL1A 1R57A 5F46A 1MJBA 2FT0A 1Y9KA 1M4IA 5EBVA 3SXOA 3FXTA 3P2FA 2WPXA 3FRMA 1QSOA 1VHSA 3S6GA 3DDDA 2HUZA 2VEZA 2ZPAA 4JJXA 4FD4A 3PGPA 2FL4A 3ZJ0A 1IB1E 1LRZA 4K30A 1CM0A 2B3UA 4XPKA 2OZUA 4R3LA 4QBJA 4I49A 1Z9UA 2VXKA 4II9A 3EFAA 2B4DB 1KUXA 1KUYA 1M44A 4FD6A 2JEVA 4OADA 4KOXA 4ZBGA 4H6UA 2FSRA 5H84A 3EXNA 2K5TA 3FB3A 5E96A 4R87A 2Z11A 5HH1A 4MJ8A 2RC4A 4MI4A 1S7LA 2CNMA 1KZFA 2VZZA 4BMHA 2OU2A 2PR8A 4KLWA 4H89A 3I3GA 1UFHA 4XPLA 2Q04A 4F0YA 1J4JA 2A4NA 3DNSA 3G3SA 1SQHA 1PUAA 5KTCA 4FD7A 2OH1A 1Y9WA 5CNPA 1WK4A 4KOSA 4KOTA 1M4DA 4Y49C
chains in the Genus database with same CATH superfamily
3KHXA 1NSAA 4PXCA 2HB6A 2PJ0A 4UEFA 3FEDA 5HVGA 4CGPA 4CYQA 4E2AA 1IGBA 4NCZA 2ZW7A 2FIWA 3RZAA 2Q51A 2VZYA 4P45A 2Z10A 2B4BA 4MMOA 1V0CA 3I1UA 3PB7X 4PXEA 4F6AA 2JDDA 2QJ8A 2ZENA 1YW6A 1NMTA 3RBUA 1XMBA 4A37A 4AG9A 4B6ZA 1AUGA 1DE4C 2ZEHA 4HKFA 5THWA 1Y0RA 1FNOA 3PB4X 2VQYA 4A33A 2XEJA 5K8PA 4OC2A 4B5PA 1YLEA 2AFXA 3IFEA 4B14A 2O53A 1YR0A 4P4BA 4WWVA 2R8VA 4KUBA 5IX3A 3B3SA 2B3VA 3F0AA 2ZW4A 4AVBA 2BOAA 4NEXA 2XEIA 2OR4A 1Z8TA 2OB0A 2ZEOA 3GY9A 2EO8A 4RI1A 2GLFA 2ZEPA 4KOWA 1CJWA 1YLOA 3QB8A 4KVME 1ARMA 2O28A 1ELMP 4NGQA 1Z2LA 4E8OA 2F8HA 3H8GA 4OIDA 4Q7AA 5JGFA 2AFSA 1TF9A 3D7HA 4KS9A 4X2TA 3TO9A 4AB7A 2REFA 4LUAA 1VHOA 4AVCA 3HLPA 3KKWA 4HPSA 4CGLA 4CRYB 2WZNA 4RN7A 2PRQA 4CAVA 2GU2A 3FBUA 1YMEA 2CNSA 3SHPA 4B12A 4RUHA 3NH8A 1GHEA 1GYTA 1LANA 1Z8WA 4MHPA 4UEZA 3FF3A 1IYKA 5K8NA 2ATRA 1Z8LA 4WJBA 2G0BA 3ISZA 5HVHA 2EUIA 4GXHA 2H5MA 3C26A 4OKOA 2DPTA 3CPXA 3VWDA 1F57A 5DS0A 1XIXA 3UY5A 3D2MA 3GB0A 3PBBA 5LRKA 1LAPA 3R95A 3R9GA 3BHXA 4K3NA 3CT9A 1CP7A 3GUXA 2GANA 4CPAA 3TOAA 5AG4A 2BEIA 3S6FA 3N7ZA 2EWBA 4Y49B 5CPAA 4MFKA 1ZG7A 2F5IA 1IU8A 4IHMA 3T90A 4TNUA 4B10A 5I0CA 1S7KA 3KL9A 3R1KA 4UCNA 1M4GA 4AVAA 3F8KA 4CYOA 2ZW6A 5G20A 4A31A 1N71A 1BPMA 3CPAA 1WWZA 2D4PA 3BI0A 4MCRA 1Z4RA 4KOVA 1LFWA 2PSWA 4NGTA 5G22A 3WR7A 2D4OA 2PVVA 1S3ZA 4YFJA 3FNCA 1YX0A 5HXDA 4U9YA 3W6XA 3BJ8A 1YQEA 3IC1A 4ZI6A 1XFOA 2IQ6A 3D68A 5G21A 3FECA 2DEAA 4IK2A 5HMNA 2PJ2A 4GS4A 2OZHA 1XE4A 3IU2A 6CPAA 4JXRA 4LQGA 4NXYA 1I21A 1TKFA 4QB9A 5LYDA 4CAEA 2GREA 4IAVA 1Q2CA 3IEHA 4B11A 3SJGA 3PP9A 3ZZIA 2J8NA 4IUSA 4FAIA 3FVLA 2V8HA 2AJ6A 2QIRA 2BUEA 3KGQA 1PU9A 3D7GA 3TO6A 4A38A 1PYTB 3B8GA 3S9MA 3EO4A 3D7FA 4KVXA 4R3KA 4XPDB 1XJOA 3H8FA 1FY7A 2PJBA 2QMLA 2ZOGA 3TX8A 2C6PA 1CP6A 4PSXA 3SXNA 4R7MA 3D7DA 3G8WA 4XPDC 1AYEA 5J1QA 2V8DA 4LQ6A 4J3GA 2PJCA 4KZTA 1UWYA 3GLJA 5BWAB 3TTHA 1L0CA 1KUVA 3QAYA 3S6KA 4PK2A 2PDOA 1NSLA 2WPWA 2ZOFA 4E0AA 3E0KA 2KCWA 3IJ3A 1QMUA 3ISXA 1AMPA 4YWYA 4MY3A 3GYAA 2I3CA 4XNHC 1VIXA 2DXQA 5D29A 3JVNA 1XRYA 4Q38A 3D66A 3DSBA 3NE8A 4CYNA 4UFWA 3NFZA 4UWJA 2PIZA 2CNTA 2HC9A 4A30A 2AFWA 2ARHA 2Q4VA 3PB8X 2PC1A 4A2ZA 2B5GA 1M1DA 4MFZA 1Q7LA 4JWPA 4JXQA 4A32A 2PR1A 2EVNA 4P6YA 5IB0A 1MJAA 3B3TA 1R3NA 2POKA 4PV6A 4UFVA 1MK4A 2Q4ZA 4MXUA 3EY5A 3D67A 4QVTA 4C7HA 3K9UA 4CYPA 1Y7RA 2C1CA 4EVYA 2P6FA 4B5OA 3V38A 1QSNA 1ZLIA 4GM5A 4P4DA 5ISVA 4NFRA 4AXVA 1IIDA 7CPAA 4UCPA 1XOVA 4OC4A 4NJRA 3MRUA 5C82A 1YGHA 4RS2A 1B6BA 3V8IA 1F2OA 2G3TA 3FEEA 4DJLA 1QSRA 3H5ZA 1BOBA 3T9YA 2J8MA 3SJFA 5C88A 4X5KA 3KQXA 4L8AA 4ZY1A 5LYFA 2G3AA 2AFOA 1LOKA 3BXMA 4EWTA 4JYWA 3B7IA 4M3SA 1YK3A 5AG7A 4NGMA 3R9EA 1Z4EA 5F09A 3R9FA 4NJQA 5J8FA 1CPSA 4MCQA 1K4JA 1KWMA 1X10A 5IB9A 4NGRA 1Q2YA 3KR4A 2BSWA 4MHNA 2QVPA 3FMCA 4MBUA 5JQ4A 3D2PA 1XMTA 4O23A 4OAEA 3D3SA 4R8FA 1F2PA 1CPXA 1ELLP 3WC5A 2OZGA 2CIJA 1EE3P 2ODFA 1YREA 2Z3LA 3CDXA 2VBQA 4OIWA 5FVJA 2BCOA 1IY7A 3KQZA 5IV0A 4F9UA 1MJ9A 3WC7A 1I12A 4LX9A 3RO0A 4NSQA 4YGOA 3JUWA 4QC6A 4UBRA 2RB7A 1IICA 5AG5A 2Q43A 3CXQA 1BAVA 2Q4YA 4Q36A 3CXSA 5HVFA 3R96A 3LD2A 2AE6A 4U9ZA 4ORFA 3IWGA 5EMIA 4ZYQA 3LODA 5JH9A 1HDQA 2DPSA 1H8LA 3I9SA 2JDCA 1RXTA 3MGDA 2FVGA 1TIQA 2I00A 2V8VA 4PXDA 5H86A 4KSIA 4OMEA 4CGNA 2AFUA 1VKCA 5F47A 5JPHA 4MHZA 2Z3KA 3B3VA 4P4EA 2EK9A 3GKRA 4YRHA 4C2ZA 4FBEA 3F5BA 4KLVA 2Q7SA 4UA3A 5EC4A 4XNHB 3P2HA 4PK3A 5KTDA 3OWCA 4KORA 4L89A 3DR8A 2EBJA 3TFYA 3BI1A 4CRZB 4HNWB 1ZLHA 1QSMA 5LYIA 3WT4A 3PFEA 4CS0B 5K8MA 2R7HA 4KVOE 3EC4A 3FIXA 3IGRA 3LMSA 4UF4A 1PCAA 1HEEA 1U6MA 4MCPA 4X3RA 5F49A 3DGVA 4ZY0A 3TE4A 2DF5A 1ZG9A 4OC1A 5J8CA 2ZEEA 2B5GB 4P10A 2F7VA 4KOUA 3RYOA 3DLJA 4HNXB 4UIBA 1XF8A 4IF5A 2ZEGA 1IYLA 2P0WA 1DTDA 2C6CA 2PQ8A 3CZXA 2IL4A 3KR5A 4EMEA 2AFMA 2J8RA 4DYOA 4MHYA 1X12A 1R43A 1ZO0A 4NGPA 3LWUA 4NF1A 2G9DA 4NGSA 4OC3A 2WYRA 3IIBA 3IO1A 4UEEA 1YSJA 2O4HA 3W91A 5A28A 1P4NA 2CF4A 2PJ5A 4JZ0A 1RO5A 2REEA 4H2KA 3DR6A 2Z3NA 3FJUA 4HNYB 3H8EA 4CAWA 3BLNA 1OBRA 3KZWA 2R98A 2FXFA 2FCKA 2FS5A 4PSWA 5F48A 4B13A 2RFHA 4UCMA 4PXBA 4MFLA 4OC0A 4JLYA 4CAFA 1XBUA 2VI7A 4UFXA 2CY2A 5GCNA 2J9AA 2PRBA 4P4FA 2HV2A 3K9TA 1XEBA 3JTKA 4B5PB 2GFQA 2BO9A 2YNCC 2GE3A 2B58A 1ON0A 2FE7A 2PJ8A 3NE7A 1NE9A 1JQGA 4OC5A 2WSAA 3QAHA 5DWNA 2Q7BA 2PIYA 3MN8A 3SJEA 2HQYA 2Z3PA 1TKJA 3LACA 4ONUA 1IOFA 5DWMA 1OZPA 3TT2A 3S6HA 1S60A 3TO7A 4BBHA 2FIAA 3B35A 4CGMA 3HUVA 2PJAA 2YNCA 4KUAA 4Z65A 2PJ1A 2Z3OA 3B2YA 4U5YA 3L2NA 2I79A 2YGWA 3A9LA 2NSMA 1TF8A 1BLLE 2P6GA 1S7NA 4R76A 4NGNA 4P44A 3BJ7A 3S9LA 1YW4A 1HDUA 2PE3A 4M85A 4R9MA 1ARLA 2NMTA 2PJ7A 2OOTA 5K8OA 4C2XA 3TOBA 2YNEA 3PB6X 4MY0A 3IU1A 3N5FA 4FD5A 2GIVA 2Y0MA 3IWWA 4CGOA 4ZY2A 2B4DA 3W6SA 1VHEA 3H4QA 4OLLA 2P6EA 3PZJA 1YVOA 2YNDA 2Z0ZA 4FUUA 3VATA 2QECA 1S7FA 1Z5RA 1M4LA 4R57A 4UWIA 2PCUA 2QYVA 4DNCA 4X8IA 1QSTA 2Q44A 2JLMA 4MHDA 4A39A 1FT7A 4KOYA 2PJ9A 4JD6A 1Q2DA 4QUSA 4M6HA 3VWEA 1CX8A 4H6ZA 2XEFA 1QQ9A 2X7BA 3FYNA 4A94A 1I1DA 1YVKA 1P0HA 2ABZA 2IJZA 1S5KA 2Z3MA 2Q0YA 3JRUA 5AGEA 4YU9A 2GLJA 4C2YA 5AG6A 5ELYA 1BPNA 2VL1A 2ZW5A 3FH4A 2C6GA 2ZXVA 4AG7A 5KTAA 3TCVA 8CPAA 3IWEA 2IMOA 3VH9A 3D4UA 1CBXA 4ZX9A 3CXPA 3D8PA 2R1IA 4CAXA 1B87A 2C27A 4MFPA 1BO4A 3T8WA 1IOIA 4Y49C 3PBEA 4FWUA 4MRIA 2BL1A 1R57A 4MFJA 5F46A 1MJBA 2FT0A 3VARA 3K2KA 1Y9KA 2JBJA 1M4IA 5EBVA 2ZELA 4MCSA 1TKHA 3KHZA 3SXOA 3RAMA 3FXTA 3P2FA 3S9NA 2WPXA 3FRMA 1QSOA 1CG2A 1VHSA 3S6GA 3DDDA 2HUZA 2VEZA 2ZPAA 3WABA 4JJXA 4FD4A 4TWEA 3PGPA 3WC6A 2FL4A 3ZJ0A 1IB1E 1LRZA 4ZX8A 2ZEMA 4K30A 3NH4A 2ANPA 4C68A 2CXAA 3NH5A 4F8ZA 1CM0A 2B3UA 1Z8XA 4M6IA 4UIAA 4XPKA 2OZUA 2PJ4A 2ZEDA 4MFQA 4EFDA 2WUUA 4R3LA 4QBJA 5CBMA 2JBKA 1Z9UA 4I49A 2VXKA 4KSAA 1RTQA 4II9A 1JWQA 3EFAA 1ZG8A 1LCPA 4OP4A 1TXRA 5LRGA 2B4DB 4A95A 3PB9X 1KUXA 3B3WA 1KUYA 2XEGA 1M44A 3SI2A 4FD6A 2JEVA 1LAMA 2EK8A 4M6GA 4OADA 4KOXA 4ZBGA 4H6UA 2ZEFA 3SI1A 4BINA 2FSRA 4P4JA 5H84A 3FX6A 2V77A 3KASA 3EXNA 2K5TA 3PFOA 4ONWA 3FB3A 4PQAA 5E96A 4R87A 4R6TA 3TC8A 2Z11A 5HH1A 4DUKA 3PRTA 5LRJA 1A2ZA 4MJ8A 2PJ3A 2RC4A 2CTBA 4MI4A 4W9YA 4G1PA 5LYLA 1S7LA 2NYQA 1VGYA 2CNMA 1KZFA 1Y0YA 3B3CA 2VZZA 3KI9A 4BMHA 3QNVA 2OU2A 2PR8A 4KLWA 4H89A 4BD9A 5G1ZA 3I3GA 5I4MA 2PJ6A 4F0XA 4PPZA 5JM6A 4ZGYB 3NA6A 1UFHA 1Y7EA 4XPLA 2V8GA 2JEWA 2Q04A 3RNZA 4F0YA 1J4JA 2A4NA 3DNSA 3G3SA 1SQHA 1PUAA 4C7IA 2CTCA 2PVWA 5KTCA 4P4IA 3SI0A 4FD7A 5D8NA 5A27A 2OH1A 4KSFA 1Y9WA 5CNPA 2AFZA 3GIUA 1WK4A 4F9VA 3SJXA 4KOSA 4KOTA 1M4DA 3V7ZA 3PEIA
chains in the Genus database with same CATH topology
4CGPA 4CYQA 4E2AA 4NCZA 2ZW7A 2FIWA 2VZYA 2Z10A 2B4BA 1V0CA 4F6AA 2JDDA 4AG9A 1NMTA 4HKFA 2VQYA 4A33A 4B5PA 1YLEA 4B14A 1YR0A 2R8VA 4KUBA 5IX3A 2B3VA 3F0AA 2ZW4A 4AVBA 4NEXA 2OB0A 3GY9A 4RI1A 4KOWA 1CJWA 3QB8A 4KVME 2O28A 4E8OA 4KS9A 3TO9A 4AB7A 2REFA 4LUAA 4AVCA 4CGLA 4CRYB 3KKWA 4CAVA 3FBUA 2CNSA 3SHPA 4B12A 1GHEA 1IYKA 2ATRA 2G0BA 2EUIA 2H5MA 3C26A 2DPTA 3VWDA 1XIXA 3UY5A 3D2MA 3R95A 3R9GA 2GANA 3TOAA 5AG4A 2BEIA 3S6FA 3N7ZA 4Y49B 4MFKA 2F5IA 3T90A 4B10A 5I0CA 1S7KA 3R1KA 4UCNA 1M4GA 4AVAA 3F8KA 4CYOA 2ZW6A 5G20A 4A31A 1N71A 1WWZA 2D4PA 1Z4RA 4KOVA 2PSWA 5G22A 3WR7A 2D4OA 1S3ZA 4YFJA 3FNCA 1YX0A 4U9YA 3BJ8A 5G21A 5HMNA 4GS4A 2OZHA 1XE4A 3IU2A 4JXRA 4NXYA 1I21A 4QB9A 4CAEA 1Q2CA 4B11A 3PP9A 3ZZIA 2J8NA 4IUSA 2AJ6A 2QIRA 2BUEA 1PU9A 3TO6A 3B8GA 3EO4A 4R3KA 4KVXA 4XPDB 1FY7A 2QMLA 4PSXA 3SXNA 3G8WA 4XPDC 4J3GA 4KZTA 5BWAB 3TTHA 1L0CA 1KUVA 3S6KA 4PK2A 2PDOA 1NSLA 2WPWA 4E0AA 3E0KA 2KCWA 4MY3A 3GYAA 4XNHC 2DXQA 3JVNA 4Q38A 3DSBA 4CYNA 4UFWA 4UWJA 4A30A 2CNTA 2ARHA 2Q4VA 4A2ZA 2PC1A 2B5GA 1M1DA 4MFZA 4JWPA 4JXQA 4A32A 2PR1A 2EVNA 5IB0A 1MJAA 4UFVA 4PV6A 1MK4A 3EY5A 4QVTA 4C7HA 3K9UA 4CYPA 1Y7RA 4EVYA 2P6FA 4B5OA 1QSNA 5ISVA 1IIDA 4UCPA 5C82A 1YGHA 4RS2A 1B6BA 3V8IA 2G3TA 1QSRA 3H5ZA 1BOBA 3T9YA 2J8MA 5C88A 4X5KA 4L8AA 2G3AA 4M3SA 1YK3A 5AG7A 3R9EA 1Z4EA 3R9FA 5J8FA 1K4JA 1Q2YA 2BSWA 4MBUA 5JQ4A 3D2PA 1XMTA 4OAEA 3D3SA 2OZGA 1YREA 2Z3LA 2VBQA 5FVJA 5IV0A 1MJ9A 1I12A 4LX9A 4NSQA 4YGOA 3JUWA 4QC6A 4UBRA 5AG5A 1IICA 3CXQA 2Q4YA 4Q36A 3CXSA 3R96A 3LD2A 2AE6A 4U9ZA 4ORFA 3IWGA 3LODA 2DPSA 3I9SA 2JDCA 1RXTA 3MGDA 1TIQA 2I00A 5H86A 4CGNA 5JPHA 1VKCA 5F47A 2Z3KA 4YRHA 3GKRA 4C2ZA 3F5BA 4KLVA 4UA3A 5EC4A 4XNHB 3P2HA 4PK3A 5KTDA 3OWCA 4KORA 4L89A 3DR8A 3TFYA 4CRZB 4HNWB 1QSMA 4CS0B 2R7HA 4KVOE 3EC4A 3FIXA 3IGRA 1U6MA 5F49A 3TE4A 5J8CA 2B5GB 4KOUA 3RYOA 4HNXB 1XF8A 4IF5A 1IYLA 2P0WA 2PQ8A 2IL4A 2J8RA 1ZO0A 4NF1A 3W91A 1P4NA 1RO5A 2REEA 3DR6A 2Z3NA 4HNYB 4CAWA 3BLNA 2R98A 2FXFA 2FCKA 2FS5A 4PSWA 5F48A 4B13A 4UCMA 4MFLA 4JLYA 4CAFA 2VI7A 4UFXA 2CY2A 5GCNA 2PRBA 2HV2A 4B5PB 1XEBA 3JTKA 2YNCC 2GE3A 2B58A 1ON0A 2FE7A 3NE7A 1NE9A 2WSAA 3QAHA 5DWNA 2Q7BA 2HQYA 2Z3PA 4ONUA 5DWMA 1OZPA 3TT2A 3S6HA 1S60A 3TO7A 4BBHA 2FIAA 4CGMA 2YNCA 4KUAA 2Z3OA 4U5YA 2I79A 2YGWA 3A9LA 2P6GA 1S7NA 3BJ7A 4M85A 4R9MA 2NMTA 4C2XA 3TOBA 2YNEA 4MY0A 3IU1A 4FD5A 2GIVA 2Y0MA 4CGOA 2B4DA 3W6SA 3H4QA 4OLLA 2P6EA 3PZJA 1YVOA 2YNDA 2Z0ZA 2QECA 1S7FA 4R57A 4UWIA 4DNCA 1QSTA 2Q44A 2JLMA 4MHDA 4KOYA 4JD6A 1Q2DA 4QUSA 3VWEA 4H6ZA 2X7BA 3FYNA 1I1DA 1YVKA 1P0HA 3W6XA 1S5KA 2Z3MA 2Q0YA 5AGEA 4C2YA 5AG6A 2ZW5A 4AG7A 2ZXVA 5KTAA 3TCVA 3IWEA 3CXPA 3D8PA 2R1IA 4CAXA 1B87A 2C27A 1BO4A 2BL1A 1R57A 4MFJA 5F46A 1MJBA 2FT0A 1Y9KA 1M4IA 5EBVA 3SXOA 3FXTA 3P2FA 2WPXA 3FRMA 1QSOA 1VHSA 3S6GA 3DDDA 2HUZA 2VEZA 2ZPAA 4JJXA 4FD4A 3PGPA 2FL4A 3ZJ0A 1IB1E 1LRZA 4K30A 4C68A 2CXAA 1M4DA 1CM0A 2B3UA 4XPKA 2OZUA 4MFQA 2WUUA 4R3LA 4QBJA 4I49A 1Z9UA 2VXKA 4KSAA 4II9A 3EFAA 4A95A 2B4DB 1KUXA 1KUYA 1M44A 4FD6A 2JEVA 4OADA 4KOXA 4ZBGA 4H6UA 2FSRA 5H84A 3EXNA 2K5TA 5A28A 3FB3A 5E96A 4R87A 2Z11A 5HH1A 4MJ8A 2RC4A 4MI4A 1S7LA 2CNMA 1KZFA 2VZZA 4BMHA 2OU2A 2PR8A 4KLWA 4H89A 5G1ZA 3I3GA 4F0XA 4ZGYB 1UFHA 4XPLA 2Q04A 4F0YA 1J4JA 3G3SA 2A4NA 3DNSA 1SQHA 1PUAA 4C7IA 5KTCA 4FD7A 5A27A 2OH1A 4KSFA 1Y9WA 5CNPA 1WK4A 4KOSA 4KOTA 4MFPA 4Y49C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E2A A;  4NCZ A;  2ZW7 A;  2FIW A;  2VZY A;  2Z10 A;  2B4B A;  1V0C A;  4F6A A;  2JDD A;  4AG9 A;  1NMT A;  4HKF A;  2VQY A;  4B5P A;  1YLE A;  1YR0 A;  2R8V A;  4KUB A;  5IX3 A;  2B3V A;  3F0A A;  2ZW4 A;  4AVB A;  4NEX A;  2OB0 A;  3GY9 A;  4RI1 A;  4KOW A;  1CJW A;  3QB8 A;  4KVM E;  2O28 A;  4E8O A;  3TO9 A;  4AB7 A;  2REF A;  4LUA A;  4AVC A;  4CRY B;  3KKW A;  4CAV A;  3FBU A;  2CNS A;  3SHP A;  1GHE A;  1IYK A;  2ATR A;  2G0B A;  2EUI A;  2H5M A;  3C26 A;  3VWD A;  1XIX A;  3UY5 A;  3D2M A;  3R95 A;  3R9G A;  2GAN A;  3TOA A;  2BEI A;  3S6F A;  3N7Z A;  4Y49 B;  2F5I A;  3T90 A;  5I0C A;  1S7K A;  3R1K A;  1M4G A;  4AVA A;  3F8K A;  2ZW6 A;  1N71 A;  1WWZ A;  2D4P A;  1Z4R A;  4KOV A;  2PSW A;  3WR7 A;  2D4O A;  1S3Z A;  4YFJ A;  3FNC A;  1YX0 A;  4U9Y A;  3BJ8 A;  5HMN A;  4GS4 A;  2OZH A;  1XE4 A;  4JXR A;  4NXY A;  1I21 A;  4QB9 A;  1Q2C A;  3PP9 A;  3ZZI A;  2J8N A;  4IUS A;  2AJ6 A;  2QIR A;  2BUE A;  1PU9 A;  3TO6 A;  3B8G A;  3EO4 A;  4R3K A;  4KVX A;  4XPD B;  1FY7 A;  2QML A;  4PSX A;  3SXN A;  3G8W A;  4XPD C;  4J3G A;  4KZT A;  3TTH A;  1L0C A;  1KUV A;  3S6K A;  4PK2 A;  2PDO A;  1NSL A;  2WPW A;  4E0A A;  3E0K A;  2KCW A;  4MY3 A;  3GYA A;  4XNH C;  2DXQ A;  3JVN A;  3DSB A;  4UWJ A;  2CNT A;  2ARH A;  2Q4V A;  2PC1 A;  2B5G A;  1M1D A;  4JWP A;  4JXQ A;  2PR1 A;  2EVN A;  5IB0 A;  1MJA A;  4PV6 A;  1MK4 A;  3EY5 A;  4QVT A;  3K9U A;  1Y7R A;  4EVY A;  2P6F A;  4B5O A;  1QSN A;  5ISV A;  1IID A;  5C82 A;  1YGH A;  4RS2 A;  1B6B A;  3V8I A;  2G3T A;  1QSR A;  1BOB A;  3T9Y A;  2J8M A;  5C88 A;  4X5K A;  4L8A A;  2G3A A;  4M3S A;  1YK3 A;  3R9E A;  1Z4E A;  3R9F A;  5J8F A;  1K4J A;  1Q2Y A;  2BSW A;  4MBU A;  5JQ4 A;  3D2P A;  1XMT A;  4OAE A;  3D3S A;  2OZG A;  1YRE A;  2VBQ A;  5FVJ A;  5IV0 A;  1MJ9 A;  1I12 A;  4LX9 A;  4NSQ A;  4YGO A;  3JUW A;  4QC6 A;  4UBR A;  1IIC A;  3CXQ A;  2Q4Y A;  3CXS A;  3R96 A;  3LD2 A;  2AE6 A;  4U9Z A;  4ORF A;  3IWG A;  3LOD A;  3I9S A;  2JDC A;  1RXT A;  3MGD A;  1TIQ A;  2I00 A;  5H86 A;  5JPH A;  1VKC A;  5F47 A;  4YRH A;  3GKR A;  3F5B A;  4KLV A;  4UA3 A;  5EC4 A;  4XNH B;  3P2H A;  4PK3 A;  5KTD A;  3OWC A;  4KOR A;  4L89 A;  3DR8 A;  3TFY A;  4CRZ B;  4HNW B;  1QSM A;  4CS0 B;  2R7H A;  4KVO E;  3EC4 A;  3FIX A;  3IGR A;  1U6M A;  5F49 A;  3TE4 A;  5J8C A;  2B5G B;  4KOU A;  3RYO A;  4HNX B;  1XF8 A;  4IF5 A;  1IYL A;  2P0W A;  2PQ8 A;  2IL4 A;  2J8R A;  4NF1 A;  3W91 A;  1P4N A;  1RO5 A;  2REE A;  3DR6 A;  4HNY B;  4CAW A;  3BLN A;  2R98 A;  2FXF A;  2FCK A;  2FS5 A;  4PSW A;  5F48 A;  4JLY A;  2VI7 A;  2CY2 A;  5GCN A;  2PRB A;  2HV2 A;  4B5P B;  1XEB A;  2GE3 A;  2B58 A;  1ON0 A;  2FE7 A;  3NE7 A;  1NE9 A;  3QAH A;  5DWN A;  2Q7B A;  2HQY A;  4ONU A;  5DWM A;  1OZP A;  3TT2 A;  3S6H A;  1S60 A;  3TO7 A;  2FIA A;  4KUA A;  4U5Y A;  2I79 A;  2P6G A;  1S7N A;  3BJ7 A;  4M85 A;  4R9M A;  2NMT A;  3TOB A;  4MY0 A;  4FD5 A;  2GIV A;  2Y0M A;  2B4D A;  3W6S A;  3H4Q A;  4OLL A;  2P6E A;  3PZJ A;  1YVO A;  2Z0Z A;  2QEC A;  1S7F A;  4R57 A;  4UWI A;  4DNC A;  1QST A;  2Q44 A;  2JLM A;  4MHD A;  4KOY A;  4JD6 A;  1Q2D A;  4QUS A;  3VWE A;  4H6Z A;  2X7B A;  3FYN A;  1I1D A;  1YVK A;  1P0H A;  3W6X A;  1S5K A;  2Q0Y A;  2ZW5 A;  4AG7 A;  2ZXV A;  5KTA A;  3TCV A;  3CXP A;  3D8P A;  2R1I A;  4CAX A;  1B87 A;  2C27 A;  1BO4 A;  2BL1 A;  1R57 A;  5F46 A;  1MJB A;  2FT0 A;  1Y9K A;  1M4I A;  5EBV A;  3SXO A;  3FXT A;  3P2F A;  2WPX A;  3FRM A;  1QSO A;  1VHS A;  3S6G A;  3DDD A;  2HUZ A;  2VEZ A;  2ZPA A;  4JJX A;  4FD4 A;  3PGP A;  2FL4 A;  3ZJ0 A;  1IB1 E;  1LRZ A;  4K30 A;  1CM0 A;  2B3U A;  4XPK A;  2OZU A;  4R3L A;  4QBJ A;  4I49 A;  1Z9U A;  2VXK A;  4II9 A;  3EFA A;  2B4D B;  1KUX A;  1KUY A;  1M44 A;  4FD6 A;  2JEV A;  4OAD A;  4KOX A;  4ZBG A;  4H6U A;  2FSR A;  5H84 A;  3EXN A;  2K5T A;  3FB3 A;  5E96 A;  4R87 A;  2Z11 A;  5HH1 A;  4MJ8 A;  2RC4 A;  4MI4 A;  1S7L A;  2CNM A;  1KZF A;  2VZZ A;  4BMH A;  2OU2 A;  2PR8 A;  4KLW A;  4H89 A;  3I3G A;  1UFH A;  4XPL A;  2Q04 A;  4F0Y A;  1J4J A;  2A4N A;  3DNS A;  3G3S A;  1SQH A;  1PUA A;  5KTC A;  4FD7 A;  2OH1 A;  1Y9W A;  5CNP A;  1WK4 A;  4KOS A;  4KOT A;  1M4D A;  4Y49 C; 
#chains in the Genus database with same CATH topology
 3KHX A;  1NSA A;  4PXC A;  2HB6 A;  2PJ0 A;  4UEF A;  3FED A;  5HVG A;  4CGP A;  4CYQ A;  4E2A A;  1IGB A;  4NCZ A;  2ZW7 A;  2FIW A;  3RZA A;  2Q51 A;  2VZY A;  4P45 A;  2Z10 A;  2B4B A;  4MMO A;  1V0C A;  3I1U A;  3PB7 X;  4PXE A;  4F6A A;  2JDD A;  2QJ8 A;  2ZEN A;  1YW6 A;  1NMT A;  3RBU A;  1XMB A;  4A37 A;  4AG9 A;  4B6Z A;  1AUG A;  1DE4 C;  2ZEH A;  4HKF A;  5THW A;  1Y0R A;  1FNO A;  3PB4 X;  2VQY A;  4A33 A;  2XEJ A;  5K8P A;  4OC2 A;  4B5P A;  1YLE A;  2AFX A;  3IFE A;  4B14 A;  2O53 A;  1YR0 A;  4P4B A;  4WWV A;  2R8V A;  4KUB A;  5IX3 A;  3B3S A;  2B3V A;  3F0A A;  2ZW4 A;  4AVB A;  2BOA A;  4NEX A;  2XEI A;  2OR4 A;  1Z8T A;  2OB0 A;  2ZEO A;  3GY9 A;  2EO8 A;  4RI1 A;  2GLF A;  2ZEP A;  4KOW A;  1CJW A;  1YLO A;  3QB8 A;  4KVM E;  1ARM A;  2O28 A;  1ELM P;  4NGQ A;  1Z2L A;  4E8O A;  2F8H A;  3H8G A;  4OID A;  4Q7A A;  5JGF A;  2AFS A;  1TF9 A;  3D7H A;  4KS9 A;  4X2T A;  3TO9 A;  4AB7 A;  2REF A;  4LUA A;  1VHO A;  4AVC A;  3HLP A;  3KKW A;  4HPS A;  4CGL A;  4CRY B;  2WZN A;  4RN7 A;  2PRQ A;  4CAV A;  2GU2 A;  3FBU A;  1YME A;  2CNS A;  3SHP A;  4B12 A;  4RUH A;  3NH8 A;  1GHE A;  1GYT A;  1LAN A;  1Z8W A;  4MHP A;  4UEZ A;  3FF3 A;  1IYK A;  5K8N A;  2ATR A;  1Z8L A;  4WJB A;  2G0B A;  3ISZ A;  5HVH A;  2EUI A;  4GXH A;  2H5M A;  3C26 A;  4OKO A;  2DPT A;  3CPX A;  3VWD A;  1F57 A;  5DS0 A;  1XIX A;  3UY5 A;  3D2M A;  3GB0 A;  3PBB A;  5LRK A;  1LAP A;  3R95 A;  3R9G A;  3BHX A;  4K3N A;  3CT9 A;  1CP7 A;  3GUX A;  2GAN A;  4CPA A;  3TOA A;  5AG4 A;  2BEI A;  3S6F A;  3N7Z A;  2EWB A;  4Y49 B;  5CPA A;  4MFK A;  1ZG7 A;  2F5I A;  1IU8 A;  4IHM A;  3T90 A;  4TNU A;  4B10 A;  5I0C A;  1S7K A;  3KL9 A;  3R1K A;  4UCN A;  1M4G A;  4AVA A;  3F8K A;  4CYO A;  2ZW6 A;  5G20 A;  4A31 A;  1N71 A;  1BPM A;  3CPA A;  1WWZ A;  2D4P A;  3BI0 A;  4MCR A;  1Z4R A;  4KOV A;  1LFW A;  2PSW A;  4NGT A;  5G22 A;  3WR7 A;  2D4O A;  2PVV A;  1S3Z A;  4YFJ A;  3FNC A;  1YX0 A;  5HXD A;  4U9Y A;  3W6X A;  3BJ8 A;  1YQE A;  3IC1 A;  4ZI6 A;  1XFO A;  2IQ6 A;  3D68 A;  5G21 A;  3FEC A;  2DEA A;  4IK2 A;  5HMN A;  2PJ2 A;  4GS4 A;  2OZH A;  1XE4 A;  3IU2 A;  6CPA A;  4JXR A;  4LQG A;  4NXY A;  1I21 A;  1TKF A;  4QB9 A;  5LYD A;  4CAE A;  2GRE A;  4IAV A;  1Q2C A;  3IEH A;  4B11 A;  3SJG A;  3PP9 A;  3ZZI A;  2J8N A;  4IUS A;  4FAI A;  3FVL A;  2V8H A;  2AJ6 A;  2QIR A;  2BUE A;  3KGQ A;  1PU9 A;  3D7G A;  3TO6 A;  4A38 A;  1PYT B;  3B8G A;  3S9M A;  3EO4 A;  3D7F A;  4KVX A;  4R3K A;  4XPD B;  1XJO A;  3H8F A;  1FY7 A;  2PJB A;  2QML A;  2ZOG A;  3TX8 A;  2C6P A;  1CP6 A;  4PSX A;  3SXN A;  4R7M A;  3D7D A;  3G8W A;  4XPD C;  1AYE A;  5J1Q A;  2V8D A;  4LQ6 A;  4J3G A;  2PJC A;  4KZT A;  1UWY A;  3GLJ A;  5BWA B;  3TTH A;  1L0C A;  1KUV A;  3QAY A;  3S6K A;  4PK2 A;  2PDO A;  1NSL A;  2WPW A;  2ZOF A;  4E0A A;  3E0K A;  2KCW A;  3IJ3 A;  1QMU A;  3ISX A;  1AMP A;  4YWY A;  4MY3 A;  3GYA A;  2I3C A;  4XNH C;  1VIX A;  2DXQ A;  5D29 A;  3JVN A;  1XRY A;  4Q38 A;  3D66 A;  3DSB A;  3NE8 A;  4CYN A;  4UFW A;  3NFZ A;  4UWJ A;  2PIZ A;  2CNT A;  2HC9 A;  4A30 A;  2AFW A;  2ARH A;  2Q4V A;  3PB8 X;  2PC1 A;  4A2Z A;  2B5G A;  1M1D A;  4MFZ A;  1Q7L A;  4JWP A;  4JXQ A;  4A32 A;  2PR1 A;  2EVN A;  4P6Y A;  5IB0 A;  1MJA A;  3B3T A;  1R3N A;  2POK A;  4PV6 A;  4UFV A;  1MK4 A;  2Q4Z A;  4MXU A;  3EY5 A;  3D67 A;  4QVT A;  4C7H A;  3K9U A;  4CYP A;  1Y7R A;  2C1C A;  4EVY A;  2P6F A;  4B5O A;  3V38 A;  1QSN A;  1ZLI A;  4GM5 A;  4P4D A;  5ISV A;  4NFR A;  4AXV A;  1IID A;  7CPA A;  4UCP A;  1XOV A;  4OC4 A;  4NJR A;  3MRU A;  5C82 A;  1YGH A;  4RS2 A;  1B6B A;  3V8I A;  1F2O A;  2G3T A;  3FEE A;  4DJL A;  1QSR A;  3H5Z A;  1BOB A;  3T9Y A;  2J8M A;  3SJF A;  5C88 A;  4X5K A;  3KQX A;  4L8A A;  4ZY1 A;  5LYF A;  2G3A A;  2AFO A;  1LOK A;  3BXM A;  4EWT A;  4JYW A;  3B7I A;  4M3S A;  1YK3 A;  5AG7 A;  4NGM A;  3R9E A;  1Z4E A;  5F09 A;  3R9F A;  4NJQ A;  5J8F A;  1CPS A;  4MCQ A;  1K4J A;  1KWM A;  1X10 A;  5IB9 A;  4NGR A;  1Q2Y A;  3KR4 A;  2BSW A;  4MHN A;  2QVP A;  3FMC A;  4MBU A;  5JQ4 A;  3D2P A;  1XMT A;  4O23 A;  4OAE A;  3D3S A;  4R8F A;  1F2P A;  1CPX A;  1ELL P;  3WC5 A;  2OZG A;  2CIJ A;  1EE3 P;  2ODF A;  1YRE A;  2Z3L A;  3CDX A;  2VBQ A;  4OIW A;  5FVJ A;  2BCO A;  1IY7 A;  3KQZ A;  5IV0 A;  4F9U A;  1MJ9 A;  3WC7 A;  1I12 A;  4LX9 A;  3RO0 A;  4NSQ A;  4YGO A;  3JUW A;  4QC6 A;  4UBR A;  2RB7 A;  1IIC A;  5AG5 A;  2Q43 A;  3CXQ A;  1BAV A;  2Q4Y A;  4Q36 A;  3CXS A;  5HVF A;  3R96 A;  3LD2 A;  2AE6 A;  4U9Z A;  4ORF A;  3IWG A;  5EMI A;  4ZYQ A;  3LOD A;  5JH9 A;  1HDQ A;  2DPS A;  1H8L A;  3I9S A;  2JDC A;  1RXT A;  3MGD A;  2FVG A;  1TIQ A;  2I00 A;  2V8V A;  4PXD A;  5H86 A;  4KSI A;  4OME A;  4CGN A;  2AFU A;  1VKC A;  5F47 A;  5JPH A;  4MHZ A;  2Z3K A;  3B3V A;  4P4E A;  2EK9 A;  3GKR A;  4YRH A;  4C2Z A;  4FBE A;  3F5B A;  4KLV A;  2Q7S A;  4UA3 A;  5EC4 A;  4XNH B;  3P2H A;  4PK3 A;  5KTD A;  3OWC A;  4KOR A;  4L89 A;  3DR8 A;  2EBJ A;  3TFY A;  3BI1 A;  4CRZ B;  4HNW B;  1ZLH A;  1QSM A;  5LYI A;  3WT4 A;  3PFE A;  4CS0 B;  5K8M A;  2R7H A;  4KVO E;  3EC4 A;  3FIX A;  3IGR A;  3LMS A;  4UF4 A;  1PCA A;  1HEE A;  1U6M A;  4MCP A;  4X3R A;  5F49 A;  3DGV A;  4ZY0 A;  3TE4 A;  2DF5 A;  1ZG9 A;  4OC1 A;  5J8C A;  2ZEE A;  2B5G B;  4P10 A;  2F7V A;  4KOU A;  3RYO A;  3DLJ A;  4HNX B;  4UIB A;  1XF8 A;  4IF5 A;  2ZEG A;  1IYL A;  2P0W A;  1DTD A;  2C6C A;  2PQ8 A;  3CZX A;  2IL4 A;  3KR5 A;  4EME A;  2AFM A;  2J8R A;  4DYO A;  4MHY A;  1X12 A;  1R43 A;  1ZO0 A;  4NGP A;  3LWU A;  4NF1 A;  2G9D A;  4NGS A;  4OC3 A;  2WYR A;  3IIB A;  3IO1 A;  4UEE A;  1YSJ A;  2O4H A;  3W91 A;  5A28 A;  1P4N A;  2CF4 A;  2PJ5 A;  4JZ0 A;  1RO5 A;  2REE A;  4H2K A;  3DR6 A;  2Z3N A;  3FJU A;  4HNY B;  3H8E A;  4CAW A;  3BLN A;  1OBR A;  3KZW A;  2R98 A;  2FXF A;  2FCK A;  2FS5 A;  4PSW A;  5F48 A;  4B13 A;  2RFH A;  4UCM A;  4PXB A;  4MFL A;  4OC0 A;  4JLY A;  4CAF A;  1XBU A;  2VI7 A;  4UFX A;  2CY2 A;  5GCN A;  2J9A A;  2PRB A;  4P4F A;  2HV2 A;  3K9T A;  1XEB A;  3JTK A;  4B5P B;  2GFQ A;  2BO9 A;  2YNC C;  2GE3 A;  2B58 A;  1ON0 A;  2FE7 A;  2PJ8 A;  3NE7 A;  1NE9 A;  1JQG A;  4OC5 A;  2WSA A;  3QAH A;  5DWN A;  2Q7B A;  2PIY A;  3MN8 A;  3SJE A;  2HQY A;  2Z3P A;  1TKJ A;  3LAC A;  4ONU A;  1IOF A;  5DWM A;  1OZP A;  3TT2 A;  3S6H A;  1S60 A;  3TO7 A;  4BBH A;  2FIA A;  3B35 A;  4CGM A;  3HUV A;  2PJA A;  2YNC A;  4KUA A;  4Z65 A;  2PJ1 A;  2Z3O A;  3B2Y A;  4U5Y A;  3L2N A;  2I79 A;  2YGW A;  3A9L A;  2NSM A;  1TF8 A;  1BLL E;  2P6G A;  1S7N A;  4R76 A;  4NGN A;  4P44 A;  3BJ7 A;  3S9L A;  1YW4 A;  1HDU A;  2PE3 A;  4M85 A;  4R9M A;  1ARL A;  2NMT A;  2PJ7 A;  2OOT A;  5K8O A;  4C2X A;  3TOB A;  2YNE A;  3PB6 X;  4MY0 A;  3IU1 A;  3N5F A;  4FD5 A;  2GIV A;  2Y0M A;  3IWW A;  4CGO A;  4ZY2 A;  2B4D A;  3W6S A;  1VHE A;  3H4Q A;  4OLL A;  2P6E A;  3PZJ A;  1YVO A;  2YND A;  2Z0Z A;  4FUU A;  3VAT A;  2QEC A;  1S7F A;  1Z5R A;  1M4L A;  4R57 A;  4UWI A;  2PCU A;  2QYV A;  4DNC A;  4X8I A;  1QST A;  2Q44 A;  2JLM A;  4MHD A;  4A39 A;  1FT7 A;  4KOY A;  2PJ9 A;  4JD6 A;  1Q2D A;  4QUS A;  4M6H A;  3VWE A;  1CX8 A;  4H6Z A;  2XEF A;  1QQ9 A;  2X7B A;  3FYN A;  4A94 A;  1I1D A;  1YVK A;  1P0H A;  2ABZ A;  2IJZ A;  1S5K A;  2Z3M A;  2Q0Y A;  3JRU A;  5AGE A;  4YU9 A;  2GLJ A;  4C2Y A;  5AG6 A;  5ELY A;  1BPN A;  2VL1 A;  2ZW5 A;  3FH4 A;  2C6G A;  2ZXV A;  4AG7 A;  5KTA A;  3TCV A;  8CPA A;  3IWE A;  2IMO A;  3VH9 A;  3D4U A;  1CBX A;  4ZX9 A;  3CXP A;  3D8P A;  2R1I A;  4CAX A;  1B87 A;  2C27 A;  4MFP A;  1BO4 A;  3T8W A;  1IOI A;  4Y49 C;  3PBE A;  4FWU A;  4MRI A;  2BL1 A;  1R57 A;  4MFJ A;  5F46 A;  1MJB A;  2FT0 A;  3VAR A;  3K2K A;  1Y9K A;  2JBJ A;  1M4I A;  5EBV A;  2ZEL A;  4MCS A;  1TKH A;  3KHZ A;  3SXO A;  3RAM A;  3FXT A;  3P2F A;  3S9N A;  2WPX A;  3FRM A;  1QSO A;  1CG2 A;  1VHS A;  3S6G A;  3DDD A;  2HUZ A;  2VEZ A;  2ZPA A;  3WAB A;  4JJX A;  4FD4 A;  4TWE A;  3PGP A;  3WC6 A;  2FL4 A;  3ZJ0 A;  1IB1 E;  1LRZ A;  4ZX8 A;  2ZEM A;  4K30 A;  3NH4 A;  2ANP A;  4C68 A;  2CXA A;  3NH5 A;  4F8Z A;  1CM0 A;  2B3U A;  1Z8X A;  4M6I A;  4UIA A;  4XPK A;  2OZU A;  2PJ4 A;  2ZED A;  4MFQ A;  4EFD A;  2WUU A;  4R3L A;  4QBJ A;  5CBM A;  2JBK A;  1Z9U A;  4I49 A;  2VXK A;  4KSA A;  1RTQ A;  4II9 A;  1JWQ A;  3EFA A;  1ZG8 A;  1LCP A;  4OP4 A;  1TXR A;  5LRG A;  2B4D B;  4A95 A;  3PB9 X;  1KUX A;  3B3W A;  1KUY A;  2XEG A;  1M44 A;  3SI2 A;  4FD6 A;  2JEV A;  1LAM A;  2EK8 A;  4M6G A;  4OAD A;  4KOX A;  4ZBG A;  4H6U A;  2ZEF A;  3SI1 A;  4BIN A;  2FSR A;  4P4J A;  5H84 A;  3FX6 A;  2V77 A;  3KAS A;  3EXN A;  2K5T A;  3PFO A;  4ONW A;  3FB3 A;  4PQA A;  5E96 A;  4R87 A;  4R6T A;  3TC8 A;  2Z11 A;  5HH1 A;  4DUK A;  3PRT A;  5LRJ A;  1A2Z A;  4MJ8 A;  2PJ3 A;  2RC4 A;  2CTB A;  4MI4 A;  4W9Y A;  4G1P A;  5LYL A;  1S7L A;  2NYQ A;  1VGY A;  2CNM A;  1KZF A;  1Y0Y A;  3B3C A;  2VZZ A;  3KI9 A;  4BMH A;  3QNV A;  2OU2 A;  2PR8 A;  4KLW A;  4H89 A;  4BD9 A;  5G1Z A;  3I3G A;  5I4M A;  2PJ6 A;  4F0X A;  4PPZ A;  5JM6 A;  4ZGY B;  3NA6 A;  1UFH A;  1Y7E A;  4XPL A;  2V8G A;  2JEW A;  2Q04 A;  3RNZ A;  4F0Y A;  1J4J A;  2A4N A;  3DNS A;  3G3S A;  1SQH A;  1PUA A;  4C7I A;  2CTC A;  2PVW A;  5KTC A;  4P4I A;  3SI0 A;  4FD7 A;  5D8N A;  5A27 A;  2OH1 A;  4KSF A;  1Y9W A;  5CNP A;  2AFZ A;  3GIU A;  1WK4 A;  4F9V A;  3SJX A;  4KOS A;  4KOT A;  1M4D A;  3V7Z A;  3PEI A; 
#chains in the Genus database with same CATH homology
 4CGP A;  4CYQ A;  4E2A A;  4NCZ A;  2ZW7 A;  2FIW A;  2VZY A;  2Z10 A;  2B4B A;  1V0C A;  4F6A A;  2JDD A;  4AG9 A;  1NMT A;  4HKF A;  2VQY A;  4A33 A;  4B5P A;  1YLE A;  4B14 A;  1YR0 A;  2R8V A;  4KUB A;  5IX3 A;  2B3V A;  3F0A A;  2ZW4 A;  4AVB A;  4NEX A;  2OB0 A;  3GY9 A;  4RI1 A;  4KOW A;  1CJW A;  3QB8 A;  4KVM E;  2O28 A;  4E8O A;  4KS9 A;  3TO9 A;  4AB7 A;  2REF A;  4LUA A;  4AVC A;  4CGL A;  4CRY B;  3KKW A;  4CAV A;  3FBU A;  2CNS A;  3SHP A;  4B12 A;  1GHE A;  1IYK A;  2ATR A;  2G0B A;  2EUI A;  2H5M A;  3C26 A;  2DPT A;  3VWD A;  1XIX A;  3UY5 A;  3D2M A;  3R95 A;  3R9G A;  2GAN A;  3TOA A;  5AG4 A;  2BEI A;  3S6F A;  3N7Z A;  4Y49 B;  4MFK A;  2F5I A;  3T90 A;  4B10 A;  5I0C A;  1S7K A;  3R1K A;  4UCN A;  1M4G A;  4AVA A;  3F8K A;  4CYO A;  2ZW6 A;  5G20 A;  4A31 A;  1N71 A;  1WWZ A;  2D4P A;  1Z4R A;  4KOV A;  2PSW A;  5G22 A;  3WR7 A;  2D4O A;  1S3Z A;  4YFJ A;  3FNC A;  1YX0 A;  4U9Y A;  3BJ8 A;  5G21 A;  5HMN A;  4GS4 A;  2OZH A;  1XE4 A;  3IU2 A;  4JXR A;  4NXY A;  1I21 A;  4QB9 A;  4CAE A;  1Q2C A;  4B11 A;  3PP9 A;  3ZZI A;  2J8N A;  4IUS A;  2AJ6 A;  2QIR A;  2BUE A;  1PU9 A;  3TO6 A;  3B8G A;  3EO4 A;  4R3K A;  4KVX A;  4XPD B;  1FY7 A;  2QML A;  4PSX A;  3SXN A;  3G8W A;  4XPD C;  4J3G A;  4KZT A;  5BWA B;  3TTH A;  1L0C A;  1KUV A;  3S6K A;  4PK2 A;  2PDO A;  1NSL A;  2WPW A;  4E0A A;  3E0K A;  2KCW A;  4MY3 A;  3GYA A;  4XNH C;  2DXQ A;  3JVN A;  4Q38 A;  3DSB A;  4CYN A;  4UFW A;  4UWJ A;  4A30 A;  2CNT A;  2ARH A;  2Q4V A;  4A2Z A;  2PC1 A;  2B5G A;  1M1D A;  4MFZ A;  4JWP A;  4JXQ A;  4A32 A;  2PR1 A;  2EVN A;  5IB0 A;  1MJA A;  4UFV A;  4PV6 A;  1MK4 A;  3EY5 A;  4QVT A;  4C7H A;  3K9U A;  4CYP A;  1Y7R A;  4EVY A;  2P6F A;  4B5O A;  1QSN A;  5ISV A;  1IID A;  4UCP A;  5C82 A;  1YGH A;  4RS2 A;  1B6B A;  3V8I A;  2G3T A;  1QSR A;  3H5Z A;  1BOB A;  3T9Y A;  2J8M A;  5C88 A;  4X5K A;  4L8A A;  2G3A A;  4M3S A;  1YK3 A;  5AG7 A;  3R9E A;  1Z4E A;  3R9F A;  5J8F A;  1K4J A;  1Q2Y A;  2BSW A;  4MBU A;  5JQ4 A;  3D2P A;  1XMT A;  4OAE A;  3D3S A;  2OZG A;  1YRE A;  2Z3L A;  2VBQ A;  5FVJ A;  5IV0 A;  1MJ9 A;  1I12 A;  4LX9 A;  4NSQ A;  4YGO A;  3JUW A;  4QC6 A;  4UBR A;  5AG5 A;  1IIC A;  3CXQ A;  2Q4Y A;  4Q36 A;  3CXS A;  3R96 A;  3LD2 A;  2AE6 A;  4U9Z A;  4ORF A;  3IWG A;  3LOD A;  2DPS A;  3I9S A;  2JDC A;  1RXT A;  3MGD A;  1TIQ A;  2I00 A;  5H86 A;  4CGN A;  5JPH A;  1VKC A;  5F47 A;  2Z3K A;  4YRH A;  3GKR A;  4C2Z A;  3F5B A;  4KLV A;  4UA3 A;  5EC4 A;  4XNH B;  3P2H A;  4PK3 A;  5KTD A;  3OWC A;  4KOR A;  4L89 A;  3DR8 A;  3TFY A;  4CRZ B;  4HNW B;  1QSM A;  4CS0 B;  2R7H A;  4KVO E;  3EC4 A;  3FIX A;  3IGR A;  1U6M A;  5F49 A;  3TE4 A;  5J8C A;  2B5G B;  4KOU A;  3RYO A;  4HNX B;  1XF8 A;  4IF5 A;  1IYL A;  2P0W A;  2PQ8 A;  2IL4 A;  2J8R A;  1ZO0 A;  4NF1 A;  3W91 A;  1P4N A;  1RO5 A;  2REE A;  3DR6 A;  2Z3N A;  4HNY B;  4CAW A;  3BLN A;  2R98 A;  2FXF A;  2FCK A;  2FS5 A;  4PSW A;  5F48 A;  4B13 A;  4UCM A;  4MFL A;  4JLY A;  4CAF A;  2VI7 A;  4UFX A;  2CY2 A;  5GCN A;  2PRB A;  2HV2 A;  4B5P B;  1XEB A;  3JTK A;  2YNC C;  2GE3 A;  2B58 A;  1ON0 A;  2FE7 A;  3NE7 A;  1NE9 A;  2WSA A;  3QAH A;  5DWN A;  2Q7B A;  2HQY A;  2Z3P A;  4ONU A;  5DWM A;  1OZP A;  3TT2 A;  3S6H A;  1S60 A;  3TO7 A;  4BBH A;  2FIA A;  4CGM A;  2YNC A;  4KUA A;  2Z3O A;  4U5Y A;  2I79 A;  2YGW A;  3A9L A;  2P6G A;  1S7N A;  3BJ7 A;  4M85 A;  4R9M A;  2NMT A;  4C2X A;  3TOB A;  2YNE A;  4MY0 A;  3IU1 A;  4FD5 A;  2GIV A;  2Y0M A;  4CGO A;  2B4D A;  3W6S A;  3H4Q A;  4OLL A;  2P6E A;  3PZJ A;  1YVO A;  2YND A;  2Z0Z A;  2QEC A;  1S7F A;  4R57 A;  4UWI A;  4DNC A;  1QST A;  2Q44 A;  2JLM A;  4MHD A;  4KOY A;  4JD6 A;  1Q2D A;  4QUS A;  3VWE A;  4H6Z A;  2X7B A;  3FYN A;  1I1D A;  1YVK A;  1P0H A;  3W6X A;  1S5K A;  2Z3M A;  2Q0Y A;  5AGE A;  4C2Y A;  5AG6 A;  2ZW5 A;  4AG7 A;  2ZXV A;  5KTA A;  3TCV A;  3IWE A;  3CXP A;  3D8P A;  2R1I A;  4CAX A;  1B87 A;  2C27 A;  1BO4 A;  2BL1 A;  1R57 A;  4MFJ A;  5F46 A;  1MJB A;  2FT0 A;  1Y9K A;  1M4I A;  5EBV A;  3SXO A;  3FXT A;  3P2F A;  2WPX A;  3FRM A;  1QSO A;  1VHS A;  3S6G A;  3DDD A;  2HUZ A;  2VEZ A;  2ZPA A;  4JJX A;  4FD4 A;  3PGP A;  2FL4 A;  3ZJ0 A;  1IB1 E;  1LRZ A;  4K30 A;  4C68 A;  2CXA A;  1M4D A;  1CM0 A;  2B3U A;  4XPK A;  2OZU A;  4MFQ A;  2WUU A;  4R3L A;  4QBJ A;  4I49 A;  1Z9U A;  2VXK A;  4KSA A;  4II9 A;  3EFA A;  4A95 A;  2B4D B;  1KUX A;  1KUY A;  1M44 A;  4FD6 A;  2JEV A;  4OAD A;  4KOX A;  4ZBG A;  4H6U A;  2FSR A;  5H84 A;  3EXN A;  2K5T A;  5A28 A;  3FB3 A;  5E96 A;  4R87 A;  2Z11 A;  5HH1 A;  4MJ8 A;  2RC4 A;  4MI4 A;  1S7L A;  2CNM A;  1KZF A;  2VZZ A;  4BMH A;  2OU2 A;  2PR8 A;  4KLW A;  4H89 A;  5G1Z A;  3I3G A;  4F0X A;  4ZGY B;  1UFH A;  4XPL A;  2Q04 A;  4F0Y A;  1J4J A;  3G3S A;  2A4N A;  3DNS A;  1SQH A;  1PUA A;  4C7I A;  5KTC A;  4FD7 A;  5A27 A;  2OH1 A;  4KSF A;  1Y9W A;  5CNP A;  1WK4 A;  4KOS A;  4KOT A;  4MFP A;  4Y49 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...