5IB0A

Pa4534: acetyl coa complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
137
structure length
137
Chain Sequence
MQLRSVIAADHPALFALWSRTPGIRLRAEDAYPFFLAYLQRNPGLSLLVETEGEVIACLMAGHDGRRGYLQHLVVDPGYRGLGLARRMLDEVLARLAREGIGKSHVFVLDAAEEAQAFWRAQSDWERRKDIQVFSTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uncharacterized protein PA4534
publication title Structure of PA4534
rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
total genus 36
structure length 137
sequence length 137
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ib0A00
2P6EA 3K9UA 2G3TA 2PR8A 1YVOA 1IYKA 2FE7A 3EY5A 5J8CA 2FL4A 1QSTA 5DWMA 2GANA 4CS0B 3D2PA 3TO6A 3R9GA 1M4DA 2REFA 4IUSA 4JXRA 2ATRA 4LUAA 3MGDA 4AVAA 4R57A 5DWNA 5F49A 4H6ZA 4KOUA 2Y0MA 1Y9KA 3F0AA 3TOBA 2ZW4A 2FCKA 3F8KA 4MHDA 1KZFA 4EVYA 3GYAA 4NF1A 1XMTA 1KUXA 1MK4A 2Z11A 3CXPA 3CXQA 3TFYA 3D8PA 4RI1A 1K4JA 2VEZA 3OWCA 2PDOA 2DXQA 4KOTA 4B5PB 2R7HA 3FB3A 4FD6A 4Y49B 3I9SA 4IF5A 4KUAA 1Z4RA 1M44A 4II9A 3CXSA 4BMHA 4GS4A 2O28A 2PQ8A 1M1DA 3PZJA 4L8AA 2FIAA 4U9ZA 5F46A 4AB7A 2BL1A 4NCZA 2HQYA 4PK2A 4U9YA 2WPXA 4H89A 3T90A 4QVTA 2G0BA 2ZPAA 2WPWA 2K5TA 2CNSA 1BOBA 4B5OA 2BUEA 3LODA 1N71A 2GIVA 3B8GA 4J3GA 3R1KA 2P6FA 4NEXA 3TCVA 4KOVA 4E8OA 2BEIA 2P6GA 2ZW5A 3LD2A 5C88A 5KTAA 4JWPA 1OZPA 5IX3A 1CJWA 2B5GB 5CNPA 4M85A 2OZUA 1CM0A 5ISVA 2RC4A 3TE4A 2I79A 4MBUA 3R9EA 2FXFA 4MY0A 5JPHA 1S7KA 2F5IA 5KTDA 1YR0A 1L0CA 1U6MA 1YX0A 5J8FA 3GY9A 5F48A 4FD5A 2JEVA 4CAWA 2ARHA 3P2FA 1IICA 2OU2A 4FD7A 4K30A 3EFAA 4KVXA 2B58A 1I12A 2AJ6A 4QC6A 2KCWA 4PK3A 2A4NA 4KVOE 2ZW7A 1QSNA 2PC1A 1BO4A 3JUWA 1TIQA 1NMTA 2PRBA 2VI7A 2VBQA 2IL4A 2QIRA 3FYNA 3VWDA 4YFJA 2ZXVA 1S7LA 1ON0A 4YRHA 2CY2A 2OB0A 2Z10A 1VKCA 3DR8A 3FXTA 2C27A 2G3AA 3EO4A 4R3KA 2R8VA 1Z4EA 2NMTA 1M4IA 1S7NA 2CNTA 4UBRA 2B3UA 2H5MA 2B4DA 4ZBGA 4UWJA 3TT2A 3DDDA 1SQHA 4F0YA 1GHEA 2QECA 4E0AA 4JLYA 3QB8A 3SHPA 1Q2CA 4QBJA 2J8MA 4CAXA 5H86A 1IB1E 3BJ8A 4L89A 4R87A 4U5YA 4XPKA 2AE6A 2OZHA 5F47A 4CRZB 3PGPA 2VXKA 1NE9A 1R57A 4DNCA 3N7ZA 2QMLA 5I0CA 4XPDC 4FD4A 4AG9A 2Q04A 3FIXA 4KOSA 3P2HA 2REEA 4PSXA 4PV6A 3W6SA 3SXNA 2J8RA 3IGRA 2FIWA 2JDCA 3S6GA 4HNXB 3BLNA 1KUVA 4XNHC 1B6BA 2Z0ZA 1Q2DA 4E2AA 5H84A 4YGOA 4KUBA 1V0CA 4MJ8A 3PP9A 4JJXA 4OADA 4M3SA 2B3VA 3W6XA 3QAHA 5IV0A 3UY5A 5C82A 1WWZA 2EVNA 1I21A 3S6HA 3NE7A 4I49A 3S6FA 5GCNA 1IYLA 4PSWA 2VZZA 2J8NA 1Z9UA 1RO5A 2Q4YA 2JLMA 1YGHA 1Y9WA 4H6UA 1S60A 4OLLA 1P4NA 1YVKA 4OAEA 3EXNA 4JD6A 4ORFA 5E96A 3W91A 3G8WA 3C26A 3IWGA 1PU9A 1Y7RA 1WK4A 4MY3A 2Q44A 3H4QA 3FNCA 3FBUA 4LX9A 3DR6A 3R9FA 2FSRA 2JDDA 2Q4VA 2P0WA 1YREA 1I1DA 1Q2YA 4XPLA 4ONUA 2FS5A 3SXOA 3WR7A 3S6KA 4B5PA 4KORA 5HMNA 1VHSA 3V8IA 4MI4A 1XE4A 3ZZIA 1B87A 4Y49C 2GE3A 2ZW6A 4KOWA 3D2MA 4RS2A 3KKWA 1NSLA 1QSOA 3JVNA 2R98A 4CAVA 3G3SA 1QSRA 5EC4A 4HNWB 1PUAA 1YLEA 4JXQA 3ZJ0A 4KVME 3R96A 1XEBA 5KTCA 1QSMA 1P0HA 2X7BA 4KLWA 4QB9A 2HV2A 5HH1A 4R3LA 3EC4A 4AVCA 2D4PA 2CNMA 1IIDA 3GKRA 2B4DB 2PR1A 3F5BA 4HKFA 1S7FA 4F6AA 4AG7A 3RYOA 1XIXA 4CRYB 1J4JA 4X5KA 1S5KA 3R95A 2EUIA 4UWIA 3FRMA 3BJ7A 2B5GA 3DNSA 5IB0A 1RXTA 2D4OA 2VZYA 3T9YA 4XPDB 4HNYB 1MJBA 4NXYA 5EBVA 4KOXA 1FY7A 2BSWA 4KOYA 4QUSA 3DSBA 1MJ9A 3I3GA 2R1IA 3TO9A 2OH1A 1MJAA 2HUZA 2FT0A 2VQYA 4KZTA 4XNHB 4R9MA 3TOAA 5JQ4A 2I00A 1YK3A 4AVBA 5FVJA 4KLVA 4UA3A 1LRZA 1S3ZA 1KUYA 2Q0YA 2PSWA 1UFHA 3VWEA 2OZGA 1XF8A 3TTHA 4NSQA 3TO7A 1M4GA 3E0KA 2Q7BA 3D3SA 2B4BA
chains in the Genus database with same CATH superfamily
2J9AA 2P6EA 2Z3LA 4ZY1A 1FT7A 3K9UA 3MN8A 3V7ZA 2G3TA 1EE3P 2PR8A 2Z3MA 4JYWA 4UFXA 1YVOA 1IYKA 2FE7A 3EY5A 5LYIA 5J8CA 1BLLE 2FL4A 1QSTA 3PBEA 3GLJA 5DWMA 2GANA 1XBUA 3VATA 4ZY0A 4GXHA 1ZLHA 4CS0B 3D2PA 3TO6A 4MCSA 3R9GA 1M4DA 2REFA 4IUSA 4JXRA 3WC6A 2ATRA 4LUAA 4X3RA 3MGDA 4AVAA 4R57A 5DWNA 5F49A 3SI1A 4FWUA 3CDXA 4H6ZA 2Z3KA 4KOUA 2PJAA 3IU2A 4MCPA 1VGYA 4UIBA 2AFZA 4CGNA 1Z8LA 1ZG7A 2Y0MA 1Y9KA 3F0AA 3TOBA 2ZW4A 4OIWA 5HVGA 4H2KA 4ONWA 4NGMA 2FCKA 3F8KA 2EK8A 3FECA 4PXDA 4UFWA 5BWAB 5LYLA 4MHDA 4W9YA 1KZFA 4NGRA 4FAIA 3B3TA 1TF8A 4EVYA 3A9LA 1HDUA 3GYAA 4NF1A 5DS0A 1XMTA 1KUXA 1XJOA 3K2KA 2Q7SA 1MK4A 2Z11A 3CXPA 2O53A 5LRKA 3CXQA 2C6CA 3TFYA 2PJ0A 3D8PA 4RI1A 1K4JA 2VEZA 3B3SA 2PIZA 3IWWA 1YMEA 1HEEA 2G9DA 3OWCA 4NGSA 3HUVA 1TKJA 2IMOA 2PDOA 2DXQA 4KOTA 4B5PB 2R7HA 3FB3A 3KQXA 4FD6A 4MMOA 4PXEA 4Y49B 3I9SA 5A28A 4IF5A 4KUAA 1Z4RA 1LOKA 1M44A 2PRQA 3PB7X 4II9A 2HC9A 1UWYA 3CXSA 4BMHA 4GS4A 4C7HA 2ZOFA 3KR5A 1IGBA 4UEEA 2RB7A 4P44A 2JBJA 2O28A 2PQ8A 4DJLA 1BAVA 1M1DA 3PZJA 2CIJA 4M6HA 4L8AA 2FIAA 3CPAA 2VL1A 4U9ZA 5F46A 3GUXA 4AB7A 2BL1A 4NCZA 2HQYA 4CGPA 1Z8XA 4PK2A 4U9YA 2WPXA 4C7IA 1AMPA 1ZLIA 4UEFA 5CPAA 4H89A 3T90A 4QVTA 2G0BA 5I4MA 3H8GA 2ZPAA 3ISZA 2C6PA 2WPWA 5THWA 2K5TA 4A30A 5AG7A 5HVHA 3RBUA 1Q7LA 1TKHA 1CBXA 1ZG8A 2CNSA 1BOBA 4UCMA 3N5FA 4B5OA 4CGLA 2AFMA 4UEZA 1H8LA 2BUEA 1YW4A 4CPAA 3LODA 4CAEA 2O4HA 1N71A 4NFRA 2GIVA 3B8GA 2V8VA 2Z3OA 5ELYA 3PB9X 4ZGYB 4J3GA 3R1KA 2P6FA 4R76A 4NEXA 3TCVA 4KOVA 3DLJA 4MHZA 4E8OA 2BEIA 3FH4A 4MFJA 4NGPA 2P6GA 5LRGA 2ZW5A 3IO1A 3LD2A 5C88A 1CP6A 2DF5A 3FJUA 3T8WA 1RTQA 5KTAA 2Q43A 3B3CA 4P45A 2NSMA 1OZPA 4JWPA 4B12A 3B3VA 3HLPA 3BHXA 3IU1A 5IX3A 5IB9A 1CJWA 2F7VA 1NSAA 2B5GB 2ANPA 1ZO0A 1IY7A 2PVVA 1LANA 4CAFA 5CNPA 4P10A 4P4IA 2POKA 4X8IA 4M85A 2OZUA 1CM0A 3KHXA 2PJ4A 5AGEA 5ISVA 2RC4A 3TE4A 4DYOA 2I79A 3L2NA 2YNCA 4MBUA 3R9EA 2XEGA 2FXFA 4MY0A 5JPHA 5AG6A 2YNCC 3RAMA 1S7KA 1VIXA 2F5IA 1PYTB 5KTDA 1YR0A 4CYPA 1L0CA 2RFHA 3V38A 4MFLA 4PQAA 1U6MA 1TF9A 2QJ8A 4R8FA 1LAMA 1YX0A 2IQ6A 5J8FA 1IU8A 3S9LA 2PIYA 3GY9A 2Z3PA 3FF3A 5F48A 2PCUA 4FD5A 2JEVA 4CAWA 2ARHA 3P2FA 3PFEA 4NJRA 1IICA 2EBJA 2OU2A 4FD7A 4K30A 3EFAA 4KVXA 4UCNA 4MRIA 2B58A 4CGMA 3JTKA 1I12A 2AJ6A 4QC6A 5F09A 2KCWA 4PK3A 1XRYA 2A4NA 4KVOE 2ZW7A 1QSNA 2PC1A 1BO4A 2WUUA 1TIQA 3JUWA 4IAVA 4MFKA 5D29A 4A2ZA 1NMTA 2PRBA 4ZX9A 2QYVA 5LYDA 2VI7A 3K9TA 2VBQA 2ODFA 3S9NA 2IL4A 1XMBA 2AFUA 2QIRA 3FYNA 3VWDA 4YFJA 2XEFA 1F57A 4NGQA 2GU2A 2ZXVA 1S7LA 1ON0A 3IFEA 1AUGA 2ZEPA 3GB0A 5AG5A 3IIBA 4YRHA 1OBRA 2WZNA 4BBHA 2CY2A 3KZWA 2OB0A 2Z10A 4UCPA 1VKCA 4Q36A 2PJ3A 3DR8A 3FXTA 1CPXA 2C27A 2G3AA 3KGQA 1ELLP 3EO4A 4MCRA 2R8VA 4R3KA 4MCQA 3DGVA 1Z4EA 2NMTA 4Q7AA 1M4IA 1S7NA 2CNTA 3KHZA 4PXBA 2ZEHA 4DUKA 1M4LA 4FUUA 4UBRA 1Y7EA 2B3UA 2ZEEA 2H5MA 1DE4C 2B4DA 5EMIA 4ZBGA 1PCAA 4IHMA 3D67A 4UWJA 3TT2A 3DDDA 1SQHA 1CP7A 1GHEA 3LWUA 4F0YA 2QECA 4E0AA 3I1UA 2PJ6A 4JLYA 3SJFA 3LACA 4K3NA 4MXUA 1ELMP 1YLOA 3QB8A 4MHYA 2ABZA 2AFXA 4EMEA 5JGFA 3SHPA 1Q2CA 4A95A 4QBJA 2WSAA 2J8MA 4OC2A 4CAXA 4OC3A 2QVPA 1IB1E 5H86A 3BJ8A 4L89A 1Z5RA 1QQ9A 3D68A 4P4FA 4R87A 2GFQA 3KASA 4FBEA 3D7DA 4U5YA 3SJEA 4XPKA 4ZYQA 2AE6A 2FVGA 4WWVA 2OZHA 3KL9A 5F47A 4CRZB 1LCPA 3PGPA 2VXKA 4MFQA 4ZI6A 1NE9A 1R57A 3ISXA 3NH5A 2Z3NA 4TWEA 4DNCA 4Q38A 3N7ZA 2C1CA 2QMLA 4X2TA 3WT4A 5I0CA 4F8ZA 4XPDC 4FD4A 4AG9A 1QMUA 2Q04A 1JQGA 2PVWA 3FIXA 1TXRA 2V8DA 4KOSA 3CT9A 3P2HA 4F9UA 2REEA 4B11A 3D7FA 4PSXA 4P4BA 4PV6A 4RN7A 3W6SA 3SXNA 3WC5A 2J8RA 3IGRA 1ARLA 2FIWA 2JDCA 4EWTA 2V8HA 3S6GA 2NYQA 4HNXB 2PJ2A 2V77A 3BLNA 1KUVA 4XNHC 3NA6A 1B6BA 2CTBA 2Z0ZA 1Q2DA 4OIDA 3NH8A 4UIAA 4E2AA 4P4JA 2DEAA 1CPSA 1GYTA 4YGOA 5H84A 3FX6A 1V0CA 4KUBA 4MHPA 4MJ8A 3PP9A 4JJXA 4M6IA 5D8NA 1ZG9A 4OADA 4ZY2A 4C2ZA 1ARMA 4M3SA 4R7MA 2B3VA 4B14A 1Z2LA 3W6XA 4A33A 1Y0RA 3QAHA 5IV0A 3UY5A 4HPSA 3CZXA 2ZEDA 5C82A 1WWZA 2EVNA 1I21A 3S6HA 3NE7A 3GIUA 4I49A 3VARA 3LMSA 3S6FA 1CG2A 4OKOA 5GCNA 1IYLA 4B6ZA 4PSWA 1X10A 2AFOA 3IJ3A 1FNOA 1HDQA 2VZZA 2J8NA 1Z9UA 3NH4A 2GLJA 1RO5A 2Q4YA 2JLMA 1YGHA 1JWQA 4R6TA 5HVFA 2PE3A 6CPAA 1YSJA 1Z8TA 3FEEA 4OP4A 4OMEA 4PPZA 4A32A 1Y9WA 4H6UA 5CBMA 1S60A 4GM5A 1XOVA 2GLFA 4OLLA 1P4NA 2ZEGA 1YVKA 3NFZA 4OAEA 2Q51A 2WYRA 5K8NA 3EXNA 3RO0A 4KSAA 2ZEFA 4CYOA 4JD6A 4PXCA 3D66A 1YQEA 3D7HA 3KR4A 4ORFA 4P4DA 5E96A 4C2YA 4KS9A 2EK9A 1TKFA 4UF4A 3TX8A 2BOAA 3W91A 1AYEA 3G8WA 3C26A 2PJ5A 2BCOA 3FEDA 1PU9A 3IWGA 3PB4X 5G20A 1Y7RA 1WK4A 4MY3A 1VHOA 3H8FA 2Q44A 3H4QA 4G1PA 2YNDA 4TNUA 3FNCA 4RUHA 4CGOA 3B3WA 3FBUA 4LX9A 4F9VA 4EFDA 3QNVA 3DR6A 3R9FA 2FSRA 2JDDA 2Q4VA 5HXDA 2P0WA 3WABA 1YREA 1I1DA 1Q2YA 1YW6A 2AFSA 2FS5A 1X12A 2JBKA 4ONUA 4XPLA 3SXOA 3WR7A 3S6KA 4B5PA 4KORA 5HMNA 4OC0A 4M6GA 1VHSA 3V8IA 3FMCA 3H8EA 4MI4A 3SJGA 4NGNA 1XE4A 3B35A 4KSFA 1Z8WA 4B13A 5G21A 3VH9A 4O23A 3ZZIA 1B87A 3BI0A 3PEIA 3BXMA 3FVLA 2GE3A 4Y49C 4A94A 1R3NA 5K8PA 2ZW6A 4KOWA 2OR4A 3D2MA 1F2PA 3RNZA 4F0XA 4RS2A 4C68A 3IWEA 3B2YA 2XEJA 1LFWA 3SI0A 4MFPA 3KKWA 1NSLA 1QSOA 2F8HA 2R98A 3JVNA 4CAVA 3G3SA 1QSRA 3QAYA 5EC4A 2Q4ZA 2CXAA 4HNWB 3CPXA 1PUAA 1YLEA 4JXQA 2HB6A 3ZJ0A 2EWBA 3H5ZA 4A38A 2DPSA 4KVME 2DPTA 3R96A 3RZAA 1KWMA 1XEBA 3NE8A 4BD9A 5KTCA 1QSMA 4AXVA 1P0HA 2X7BA 8CPAA 4OC5A 3D7GA 4KLWA 5K8OA 5LYFA 2BO9A 4QB9A 1XFOA 2HV2A 5HH1A 5JM6A 3PB8X 2PJ1A 1F2OA 3EC4A 4R3LA 1Y0YA 2D4PA 4AVCA 5A27A 4A37A 2CNMA 1IIDA 4OC4A 3GKRA 2OOTA 2B4DB 3B7IA 5JH9A 5K8MA 2PR1A 4NGTA 5J1QA 3S9MA 3F5BA 3KQZA 4HKFA 1BPMA 1S7FA 3JRUA 1R43A 4F6AA 1BPNA 4AG7A 3RYOA 1XIXA 2ZEMA 4YWYA 3PFOA 4CRYB 4NJQA 1VHEA 2PJCA 1J4JA 2PJ8A 4X5KA 2JEWA 1S5KA 4MHNA 3R95A 2EUIA 2PJ9A 4UWIA 4CYQA 3FRMA 3D4UA 2ZEOA 4P6YA 3BJ7A 2B5GA 3IC1A 3DNSA 3IEHA 5IB0A 1RXTA 3BI1A 3WC7A 3PRTA 1A2ZA 4IK2A 2D4OA 2VZYA 4MFZA 3T9YA 4XPDB 4WJBA 4HNYB 1MJBA 3MRUA 2ZENA 2I3CA 4NXYA 5EBVA 2ZOGA 4KOXA 1FY7A 1DTDA 2BSWA 4KOYA 4OC1A 4QUSA 3SJXA 2V8GA 5AG4A 4C2XA 2AFWA 4LQGA 2GREA 4Z65A 7CPAA 1LAPA 3DSBA 3PB6X 1MJ9A 2EO8A 2R1IA 3I3GA 3TO9A 2C6GA 3SI2A 5LRJA 2OH1A 1MJAA 2HUZA 2IJZA 5G1ZA 3PBBA 4JZ0A 2FT0A 2PJ7A 2VQYA 1CX8A 4A31A 4KZTA 4XNHB 4R9MA 5G22A 4LQ6A 3KI9A 3TOAA 5JQ4A 2I00A 1YK3A 4A39A 5FVJA 4AVBA 4KLVA 4UA3A 1LRZA 1S3ZA 4CYNA 1KUYA 4BINA 4YU9A 2ZELA 2CF4A 2Q0YA 1IOIA 2CTCA 2PSWA 1UFHA 4KSIA 3VWEA 2YGWA 3TC8A 2OZGA 4UFVA 1XF8A 2XEIA 4NSQA 3TTHA 3TO7A 2PJBA 4B10A 1M4GA 4P4EA 3E0KA 2Q7BA 3D3SA 4ZX8A 2B4BA 2YNEA 1IOFA
chains in the Genus database with same CATH topology
2P6EA 2Z3LA 3K9UA 2G3TA 2PR8A 4UFXA 2Z3MA 1YVOA 1IYKA 2FE7A 3EY5A 5J8CA 2FL4A 1QSTA 5DWMA 2GANA 4CS0B 3D2PA 3TO6A 3R9GA 1M4DA 2REFA 4IUSA 4JXRA 2ATRA 4LUAA 3MGDA 4AVAA 4R57A 5DWNA 5F49A 4H6ZA 2Z3KA 4KOUA 3IU2A 4CGNA 2Y0MA 1Y9KA 3F0AA 3TOBA 2ZW4A 2FCKA 3F8KA 4UFWA 5BWAB 4MHDA 1KZFA 4EVYA 3A9LA 3GYAA 4NF1A 1XMTA 1KUXA 1MK4A 2Z11A 3CXPA 3CXQA 3TFYA 3D8PA 4RI1A 1K4JA 2VEZA 3OWCA 2PDOA 2DXQA 4KOTA 4B5PB 2R7HA 3FB3A 4FD6A 4Y49B 3I9SA 5A28A 4IF5A 4KUAA 1Z4RA 1M44A 4II9A 3CXSA 4BMHA 4GS4A 4C7HA 2O28A 2PQ8A 1M1DA 3PZJA 4L8AA 2FIAA 4U9ZA 5F46A 4AB7A 2BL1A 4NCZA 2HQYA 4CGPA 4PK2A 4U9YA 2WPXA 4C7IA 4H89A 3T90A 4QVTA 2G0BA 2ZPAA 2WPWA 2K5TA 4A30A 5AG7A 2CNSA 1BOBA 4UCMA 4B5OA 4CGLA 2BUEA 3LODA 4CAEA 1N71A 2GIVA 3B8GA 2Z3OA 4ZGYB 4J3GA 3R1KA 2P6FA 4NEXA 3TCVA 4KOVA 4E8OA 2BEIA 4MFJA 2P6GA 2ZW5A 3LD2A 5C88A 5KTAA 4JWPA 1OZPA 4B12A 3IU1A 5IX3A 1CJWA 2B5GB 1ZO0A 4CAFA 5CNPA 4M85A 2OZUA 1CM0A 5AGEA 5ISVA 2RC4A 3TE4A 2I79A 2YNCA 4MBUA 3R9EA 2FXFA 4MY0A 5JPHA 5AG6A 2YNCC 1S7KA 2F5IA 5KTDA 1YR0A 4CYPA 1L0CA 4MFLA 1U6MA 1YX0A 5J8FA 3GY9A 2Z3PA 5F48A 4FD5A 2JEVA 4CAWA 2ARHA 3P2FA 1IICA 2OU2A 4FD7A 4K30A 3EFAA 4KVXA 4UCNA 4CGMA 2B58A 3JTKA 1I12A 2AJ6A 4QC6A 2KCWA 4PK3A 2A4NA 4KVOE 2ZW7A 1QSNA 2PC1A 1BO4A 2WUUA 1TIQA 3JUWA 4MFKA 4A2ZA 1NMTA 2PRBA 2VI7A 2VBQA 2IL4A 2QIRA 3FYNA 3VWDA 4YFJA 2ZXVA 1S7LA 1ON0A 5AG5A 4YRHA 4BBHA 2CY2A 2OB0A 2Z10A 4UCPA 1VKCA 4Q36A 3DR8A 3FXTA 2C27A 2G3AA 3EO4A 4R3KA 2R8VA 1Z4EA 2NMTA 1M4IA 1S7NA 2CNTA 4UBRA 2B3UA 2H5MA 2B4DA 4ZBGA 4UWJA 3TT2A 3DDDA 1SQHA 4F0YA 1GHEA 2QECA 4E0AA 4JLYA 3QB8A 3SHPA 1Q2CA 4A95A 4QBJA 2WSAA 2J8MA 4CAXA 5H86A 1IB1E 3BJ8A 4L89A 4R87A 4U5YA 4XPKA 2AE6A 2OZHA 5F47A 4CRZB 3PGPA 2VXKA 4MFQA 1NE9A 1R57A 2Z3NA 4DNCA 4Q38A 3N7ZA 2QMLA 5I0CA 4XPDC 4FD4A 4AG9A 2Q04A 3FIXA 4KOSA 3P2HA 2REEA 4B11A 4PSXA 4PV6A 3W6SA 3SXNA 2J8RA 3IGRA 2FIWA 2JDCA 3S6GA 4HNXB 3BLNA 1KUVA 4XNHC 1B6BA 2Z0ZA 1Q2DA 4E2AA 5H84A 4YGOA 4KUBA 1V0CA 4MJ8A 3PP9A 4JJXA 4C2ZA 4OADA 4M3SA 2B3VA 4B14A 3W6XA 4A33A 3QAHA 5IV0A 3UY5A 5C82A 1WWZA 2EVNA 1I21A 3S6HA 3NE7A 4I49A 3S6FA 5GCNA 1IYLA 4PSWA 2VZZA 2J8NA 1Z9UA 1RO5A 2Q4YA 2JLMA 1YGHA 4A32A 1Y9WA 4H6UA 1S60A 4OLLA 1P4NA 1YVKA 4OAEA 3EXNA 4CYOA 4KSAA 4JD6A 4ORFA 5E96A 4C2YA 4KS9A 3W91A 3G8WA 3C26A 3IWGA 1PU9A 5G20A 1Y7RA 1WK4A 4MY3A 2Q44A 3H4QA 2YNDA 3FNCA 4CGOA 3FBUA 4LX9A 3DR6A 3R9FA 2FSRA 2JDDA 2Q4VA 2P0WA 1YREA 1I1DA 1Q2YA 4XPLA 4ONUA 2FS5A 3SXOA 3WR7A 3S6KA 4B5PA 4KORA 5HMNA 1VHSA 3V8IA 4MI4A 1XE4A 4KSFA 4B13A 5G21A 3ZZIA 1B87A 4Y49C 2GE3A 2ZW6A 4KOWA 3D2MA 4F0XA 4RS2A 4C68A 3IWEA 4MFPA 3KKWA 1NSLA 1QSOA 3JVNA 2R98A 4CAVA 3G3SA 1QSRA 5EC4A 2CXAA 4HNWB 1PUAA 1YLEA 4JXQA 3ZJ0A 3H5ZA 2DPSA 4KVME 2DPTA 3R96A 1XEBA 5KTCA 1QSMA 1P0HA 2X7BA 4KLWA 4QB9A 2HV2A 5HH1A 4R3LA 5A27A 3EC4A 4AVCA 2D4PA 2CNMA 1IIDA 3GKRA 2B4DB 2PR1A 3F5BA 4HKFA 1S7FA 4F6AA 4AG7A 3RYOA 1XIXA 4CRYB 1J4JA 4X5KA 1S5KA 3R95A 2EUIA 4UWIA 4CYQA 3FRMA 3BJ7A 2B5GA 3DNSA 5IB0A 1RXTA 2D4OA 2VZYA 4MFZA 3T9YA 4XPDB 4HNYB 1MJBA 4NXYA 5EBVA 4KOXA 1FY7A 2BSWA 4KOYA 4QUSA 5AG4A 4C2XA 3DSBA 1MJ9A 3I3GA 2R1IA 3TO9A 2OH1A 1MJAA 2HUZA 5G1ZA 2FT0A 2VQYA 4A31A 4KZTA 4XNHB 4R9MA 5G22A 3TOAA 5JQ4A 2I00A 1YK3A 4AVBA 5FVJA 4KLVA 4UA3A 1LRZA 1S3ZA 4CYNA 1KUYA 2Q0YA 2PSWA 1UFHA 3VWEA 2YGWA 2OZGA 4UFVA 1XF8A 3TTHA 4NSQA 3TO7A 4B10A 1M4GA 3E0KA 2Q7BA 3D3SA 2B4BA 2YNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6E A;  3K9U A;  2G3T A;  2PR8 A;  1YVO A;  1IYK A;  2FE7 A;  3EY5 A;  5J8C A;  2FL4 A;  1QST A;  5DWM A;  2GAN A;  4CS0 B;  3D2P A;  3TO6 A;  3R9G A;  1M4D A;  2REF A;  4IUS A;  4JXR A;  2ATR A;  4LUA A;  3MGD A;  4AVA A;  4R57 A;  5DWN A;  5F49 A;  4H6Z A;  4KOU A;  2Y0M A;  1Y9K A;  3F0A A;  3TOB A;  2ZW4 A;  2FCK A;  3F8K A;  4MHD A;  1KZF A;  4EVY A;  3GYA A;  4NF1 A;  1XMT A;  1KUX A;  1MK4 A;  2Z11 A;  3CXP A;  3CXQ A;  3TFY A;  3D8P A;  4RI1 A;  1K4J A;  2VEZ A;  3OWC A;  2PDO A;  2DXQ A;  4KOT A;  4B5P B;  2R7H A;  3FB3 A;  4FD6 A;  4Y49 B;  3I9S A;  4IF5 A;  4KUA A;  1Z4R A;  1M44 A;  4II9 A;  3CXS A;  4BMH A;  4GS4 A;  2O28 A;  2PQ8 A;  1M1D A;  3PZJ A;  4L8A A;  2FIA A;  4U9Z A;  5F46 A;  4AB7 A;  2BL1 A;  4NCZ A;  2HQY A;  4PK2 A;  4U9Y A;  2WPX A;  4H89 A;  3T90 A;  4QVT A;  2G0B A;  2ZPA A;  2WPW A;  2K5T A;  2CNS A;  1BOB A;  4B5O A;  2BUE A;  3LOD A;  1N71 A;  2GIV A;  3B8G A;  4J3G A;  3R1K A;  2P6F A;  4NEX A;  3TCV A;  4KOV A;  4E8O A;  2BEI A;  2P6G A;  2ZW5 A;  3LD2 A;  5C88 A;  5KTA A;  4JWP A;  1OZP A;  5IX3 A;  1CJW A;  2B5G B;  5CNP A;  4M85 A;  2OZU A;  1CM0 A;  5ISV A;  2RC4 A;  3TE4 A;  2I79 A;  4MBU A;  3R9E A;  2FXF A;  4MY0 A;  5JPH A;  1S7K A;  2F5I A;  5KTD A;  1YR0 A;  1L0C A;  1U6M A;  1YX0 A;  5J8F A;  3GY9 A;  5F48 A;  4FD5 A;  2JEV A;  4CAW A;  2ARH A;  3P2F A;  1IIC A;  2OU2 A;  4FD7 A;  4K30 A;  3EFA A;  4KVX A;  2B58 A;  1I12 A;  2AJ6 A;  4QC6 A;  2KCW A;  4PK3 A;  2A4N A;  4KVO E;  2ZW7 A;  1QSN A;  2PC1 A;  1BO4 A;  3JUW A;  1TIQ A;  1NMT A;  2PRB A;  2VI7 A;  2VBQ A;  2IL4 A;  2QIR A;  3FYN A;  3VWD A;  4YFJ A;  2ZXV A;  1S7L A;  1ON0 A;  4YRH A;  2CY2 A;  2OB0 A;  2Z10 A;  1VKC A;  3DR8 A;  3FXT A;  2C27 A;  2G3A A;  3EO4 A;  4R3K A;  2R8V A;  1Z4E A;  2NMT A;  1M4I A;  1S7N A;  2CNT A;  4UBR A;  2B3U A;  2H5M A;  2B4D A;  4ZBG A;  4UWJ A;  3TT2 A;  3DDD A;  1SQH A;  4F0Y A;  1GHE A;  2QEC A;  4E0A A;  4JLY A;  3QB8 A;  3SHP A;  1Q2C A;  4QBJ A;  2J8M A;  4CAX A;  5H86 A;  1IB1 E;  3BJ8 A;  4L89 A;  4R87 A;  4U5Y A;  4XPK A;  2AE6 A;  2OZH A;  5F47 A;  4CRZ B;  3PGP A;  2VXK A;  1NE9 A;  1R57 A;  4DNC A;  3N7Z A;  2QML A;  5I0C A;  4XPD C;  4FD4 A;  4AG9 A;  2Q04 A;  3FIX A;  4KOS A;  3P2H A;  2REE A;  4PSX A;  4PV6 A;  3W6S A;  3SXN A;  2J8R A;  3IGR A;  2FIW A;  2JDC A;  3S6G A;  4HNX B;  3BLN A;  1KUV A;  4XNH C;  1B6B A;  2Z0Z A;  1Q2D A;  4E2A A;  5H84 A;  4YGO A;  4KUB A;  1V0C A;  4MJ8 A;  3PP9 A;  4JJX A;  4OAD A;  4M3S A;  2B3V A;  3W6X A;  3QAH A;  5IV0 A;  3UY5 A;  5C82 A;  1WWZ A;  2EVN A;  1I21 A;  3S6H A;  3NE7 A;  4I49 A;  3S6F A;  5GCN A;  1IYL A;  4PSW A;  2VZZ A;  2J8N A;  1Z9U A;  1RO5 A;  2Q4Y A;  2JLM A;  1YGH A;  1Y9W A;  4H6U A;  1S60 A;  4OLL A;  1P4N A;  1YVK A;  4OAE A;  3EXN A;  4JD6 A;  4ORF A;  5E96 A;  3W91 A;  3G8W A;  3C26 A;  3IWG A;  1PU9 A;  1Y7R A;  1WK4 A;  4MY3 A;  2Q44 A;  3H4Q A;  3FNC A;  3FBU A;  4LX9 A;  3DR6 A;  3R9F A;  2FSR A;  2JDD A;  2Q4V A;  2P0W A;  1YRE A;  1I1D A;  1Q2Y A;  4XPL A;  4ONU A;  2FS5 A;  3SXO A;  3WR7 A;  3S6K A;  4B5P A;  4KOR A;  5HMN A;  1VHS A;  3V8I A;  4MI4 A;  1XE4 A;  3ZZI A;  1B87 A;  4Y49 C;  2GE3 A;  2ZW6 A;  4KOW A;  3D2M A;  4RS2 A;  3KKW A;  1NSL A;  1QSO A;  3JVN A;  2R98 A;  4CAV A;  3G3S A;  1QSR A;  5EC4 A;  4HNW B;  1PUA A;  1YLE A;  4JXQ A;  3ZJ0 A;  4KVM E;  3R96 A;  1XEB A;  5KTC A;  1QSM A;  1P0H A;  2X7B A;  4KLW A;  4QB9 A;  2HV2 A;  5HH1 A;  4R3L A;  3EC4 A;  4AVC A;  2D4P A;  2CNM A;  1IID A;  3GKR A;  2B4D B;  2PR1 A;  3F5B A;  4HKF A;  1S7F A;  4F6A A;  4AG7 A;  3RYO A;  1XIX A;  4CRY B;  1J4J A;  4X5K A;  1S5K A;  3R95 A;  2EUI A;  4UWI A;  3FRM A;  3BJ7 A;  2B5G A;  3DNS A;  5IB0 A;  1RXT A;  2D4O A;  2VZY A;  3T9Y A;  4XPD B;  4HNY B;  1MJB A;  4NXY A;  5EBV A;  4KOX A;  1FY7 A;  2BSW A;  4KOY A;  4QUS A;  3DSB A;  1MJ9 A;  3I3G A;  2R1I A;  3TO9 A;  2OH1 A;  1MJA A;  2HUZ A;  2FT0 A;  2VQY A;  4KZT A;  4XNH B;  4R9M A;  3TOA A;  5JQ4 A;  2I00 A;  1YK3 A;  4AVB A;  5FVJ A;  4KLV A;  4UA3 A;  1LRZ A;  1S3Z A;  1KUY A;  2Q0Y A;  2PSW A;  1UFH A;  3VWE A;  2OZG A;  1XF8 A;  3TTH A;  4NSQ A;  3TO7 A;  1M4G A;  3E0K A;  2Q7B A;  3D3S A;  2B4B A; 
#chains in the Genus database with same CATH topology
 2J9A A;  2P6E A;  2Z3L A;  4ZY1 A;  1FT7 A;  3K9U A;  3MN8 A;  3V7Z A;  2G3T A;  1EE3 P;  2PR8 A;  2Z3M A;  4JYW A;  4UFX A;  1YVO A;  1IYK A;  2FE7 A;  3EY5 A;  5LYI A;  5J8C A;  1BLL E;  2FL4 A;  1QST A;  3PBE A;  3GLJ A;  5DWM A;  2GAN A;  1XBU A;  3VAT A;  4ZY0 A;  4GXH A;  1ZLH A;  4CS0 B;  3D2P A;  3TO6 A;  4MCS A;  3R9G A;  1M4D A;  2REF A;  4IUS A;  4JXR A;  3WC6 A;  2ATR A;  4LUA A;  4X3R A;  3MGD A;  4AVA A;  4R57 A;  5DWN A;  5F49 A;  3SI1 A;  4FWU A;  3CDX A;  4H6Z A;  2Z3K A;  4KOU A;  2PJA A;  3IU2 A;  4MCP A;  1VGY A;  4UIB A;  2AFZ A;  4CGN A;  1Z8L A;  1ZG7 A;  2Y0M A;  1Y9K A;  3F0A A;  3TOB A;  2ZW4 A;  4OIW A;  5HVG A;  4H2K A;  4ONW A;  4NGM A;  2FCK A;  3F8K A;  2EK8 A;  3FEC A;  4PXD A;  4UFW A;  5BWA B;  5LYL A;  4MHD A;  4W9Y A;  1KZF A;  4NGR A;  4FAI A;  3B3T A;  1TF8 A;  4EVY A;  3A9L A;  1HDU A;  3GYA A;  4NF1 A;  5DS0 A;  1XMT A;  1KUX A;  1XJO A;  3K2K A;  2Q7S A;  1MK4 A;  2Z11 A;  3CXP A;  2O53 A;  5LRK A;  3CXQ A;  2C6C A;  3TFY A;  2PJ0 A;  3D8P A;  4RI1 A;  1K4J A;  2VEZ A;  3B3S A;  2PIZ A;  3IWW A;  1YME A;  1HEE A;  2G9D A;  3OWC A;  4NGS A;  3HUV A;  1TKJ A;  2IMO A;  2PDO A;  2DXQ A;  4KOT A;  4B5P B;  2R7H A;  3FB3 A;  3KQX A;  4FD6 A;  4MMO A;  4PXE A;  4Y49 B;  3I9S A;  5A28 A;  4IF5 A;  4KUA A;  1Z4R A;  1LOK A;  1M44 A;  2PRQ A;  3PB7 X;  4II9 A;  2HC9 A;  1UWY A;  3CXS A;  4BMH A;  4GS4 A;  4C7H A;  2ZOF A;  3KR5 A;  1IGB A;  4UEE A;  2RB7 A;  4P44 A;  2JBJ A;  2O28 A;  2PQ8 A;  4DJL A;  1BAV A;  1M1D A;  3PZJ A;  2CIJ A;  4M6H A;  4L8A A;  2FIA A;  3CPA A;  2VL1 A;  4U9Z A;  5F46 A;  3GUX A;  4AB7 A;  2BL1 A;  4NCZ A;  2HQY A;  4CGP A;  1Z8X A;  4PK2 A;  4U9Y A;  2WPX A;  4C7I A;  1AMP A;  1ZLI A;  4UEF A;  5CPA A;  4H89 A;  3T90 A;  4QVT A;  2G0B A;  5I4M A;  3H8G A;  2ZPA A;  3ISZ A;  2C6P A;  2WPW A;  5THW A;  2K5T A;  4A30 A;  5AG7 A;  5HVH A;  3RBU A;  1Q7L A;  1TKH A;  1CBX A;  1ZG8 A;  2CNS A;  1BOB A;  4UCM A;  3N5F A;  4B5O A;  4CGL A;  2AFM A;  4UEZ A;  1H8L A;  2BUE A;  1YW4 A;  4CPA A;  3LOD A;  4CAE A;  2O4H A;  1N71 A;  4NFR A;  2GIV A;  3B8G A;  2V8V A;  2Z3O A;  5ELY A;  3PB9 X;  4ZGY B;  4J3G A;  3R1K A;  2P6F A;  4R76 A;  4NEX A;  3TCV A;  4KOV A;  3DLJ A;  4MHZ A;  4E8O A;  2BEI A;  3FH4 A;  4MFJ A;  4NGP A;  2P6G A;  5LRG A;  2ZW5 A;  3IO1 A;  3LD2 A;  5C88 A;  1CP6 A;  2DF5 A;  3FJU A;  3T8W A;  1RTQ A;  5KTA A;  2Q43 A;  3B3C A;  4P45 A;  2NSM A;  1OZP A;  4JWP A;  4B12 A;  3B3V A;  3HLP A;  3BHX A;  3IU1 A;  5IX3 A;  5IB9 A;  1CJW A;  2F7V A;  1NSA A;  2B5G B;  2ANP A;  1ZO0 A;  1IY7 A;  2PVV A;  1LAN A;  4CAF A;  5CNP A;  4P10 A;  4P4I A;  2POK A;  4X8I A;  4M85 A;  2OZU A;  1CM0 A;  3KHX A;  2PJ4 A;  5AGE A;  5ISV A;  2RC4 A;  3TE4 A;  4DYO A;  2I79 A;  3L2N A;  2YNC A;  4MBU A;  3R9E A;  2XEG A;  2FXF A;  4MY0 A;  5JPH A;  5AG6 A;  2YNC C;  3RAM A;  1S7K A;  1VIX A;  2F5I A;  1PYT B;  5KTD A;  1YR0 A;  4CYP A;  1L0C A;  2RFH A;  3V38 A;  4MFL A;  4PQA A;  1U6M A;  1TF9 A;  2QJ8 A;  4R8F A;  1LAM A;  1YX0 A;  2IQ6 A;  5J8F A;  1IU8 A;  3S9L A;  2PIY A;  3GY9 A;  2Z3P A;  3FF3 A;  5F48 A;  2PCU A;  4FD5 A;  2JEV A;  4CAW A;  2ARH A;  3P2F A;  3PFE A;  4NJR A;  1IIC A;  2EBJ A;  2OU2 A;  4FD7 A;  4K30 A;  3EFA A;  4KVX A;  4UCN A;  4MRI A;  2B58 A;  4CGM A;  3JTK A;  1I12 A;  2AJ6 A;  4QC6 A;  5F09 A;  2KCW A;  4PK3 A;  1XRY A;  2A4N A;  4KVO E;  2ZW7 A;  1QSN A;  2PC1 A;  1BO4 A;  2WUU A;  1TIQ A;  3JUW A;  4IAV A;  4MFK A;  5D29 A;  4A2Z A;  1NMT A;  2PRB A;  4ZX9 A;  2QYV A;  5LYD A;  2VI7 A;  3K9T A;  2VBQ A;  2ODF A;  3S9N A;  2IL4 A;  1XMB A;  2AFU A;  2QIR A;  3FYN A;  3VWD A;  4YFJ A;  2XEF A;  1F57 A;  4NGQ A;  2GU2 A;  2ZXV A;  1S7L A;  1ON0 A;  3IFE A;  1AUG A;  2ZEP A;  3GB0 A;  5AG5 A;  3IIB A;  4YRH A;  1OBR A;  2WZN A;  4BBH A;  2CY2 A;  3KZW A;  2OB0 A;  2Z10 A;  4UCP A;  1VKC A;  4Q36 A;  2PJ3 A;  3DR8 A;  3FXT A;  1CPX A;  2C27 A;  2G3A A;  3KGQ A;  1ELL P;  3EO4 A;  4MCR A;  2R8V A;  4R3K A;  4MCQ A;  3DGV A;  1Z4E A;  2NMT A;  4Q7A A;  1M4I A;  1S7N A;  2CNT A;  3KHZ A;  4PXB A;  2ZEH A;  4DUK A;  1M4L A;  4FUU A;  4UBR A;  1Y7E A;  2B3U A;  2ZEE A;  2H5M A;  1DE4 C;  2B4D A;  5EMI A;  4ZBG A;  1PCA A;  4IHM A;  3D67 A;  4UWJ A;  3TT2 A;  3DDD A;  1SQH A;  1CP7 A;  1GHE A;  3LWU A;  4F0Y A;  2QEC A;  4E0A A;  3I1U A;  2PJ6 A;  4JLY A;  3SJF A;  3LAC A;  4K3N A;  4MXU A;  1ELM P;  1YLO A;  3QB8 A;  4MHY A;  2ABZ A;  2AFX A;  4EME A;  5JGF A;  3SHP A;  1Q2C A;  4A95 A;  4QBJ A;  2WSA A;  2J8M A;  4OC2 A;  4CAX A;  4OC3 A;  2QVP A;  1IB1 E;  5H86 A;  3BJ8 A;  4L89 A;  1Z5R A;  1QQ9 A;  3D68 A;  4P4F A;  4R87 A;  2GFQ A;  3KAS A;  4FBE A;  3D7D A;  4U5Y A;  3SJE A;  4XPK A;  4ZYQ A;  2AE6 A;  2FVG A;  4WWV A;  2OZH A;  3KL9 A;  5F47 A;  4CRZ B;  1LCP A;  3PGP A;  2VXK A;  4MFQ A;  4ZI6 A;  1NE9 A;  1R57 A;  3ISX A;  3NH5 A;  2Z3N A;  4TWE A;  4DNC A;  4Q38 A;  3N7Z A;  2C1C A;  2QML A;  4X2T A;  3WT4 A;  5I0C A;  4F8Z A;  4XPD C;  4FD4 A;  4AG9 A;  1QMU A;  2Q04 A;  1JQG A;  2PVW A;  3FIX A;  1TXR A;  2V8D A;  4KOS A;  3CT9 A;  3P2H A;  4F9U A;  2REE A;  4B11 A;  3D7F A;  4PSX A;  4P4B A;  4PV6 A;  4RN7 A;  3W6S A;  3SXN A;  3WC5 A;  2J8R A;  3IGR A;  1ARL A;  2FIW A;  2JDC A;  4EWT A;  2V8H A;  3S6G A;  2NYQ A;  4HNX B;  2PJ2 A;  2V77 A;  3BLN A;  1KUV A;  4XNH C;  3NA6 A;  1B6B A;  2CTB A;  2Z0Z A;  1Q2D A;  4OID A;  3NH8 A;  4UIA A;  4E2A A;  4P4J A;  2DEA A;  1CPS A;  1GYT A;  4YGO A;  5H84 A;  3FX6 A;  1V0C A;  4KUB A;  4MHP A;  4MJ8 A;  3PP9 A;  4JJX A;  4M6I A;  5D8N A;  1ZG9 A;  4OAD A;  4ZY2 A;  4C2Z A;  1ARM A;  4M3S A;  4R7M A;  2B3V A;  4B14 A;  1Z2L A;  3W6X A;  4A33 A;  1Y0R A;  3QAH A;  5IV0 A;  3UY5 A;  4HPS A;  3CZX A;  2ZED A;  5C82 A;  1WWZ A;  2EVN A;  1I21 A;  3S6H A;  3NE7 A;  3GIU A;  4I49 A;  3VAR A;  3LMS A;  3S6F A;  1CG2 A;  4OKO A;  5GCN A;  1IYL A;  4B6Z A;  4PSW A;  1X10 A;  2AFO A;  3IJ3 A;  1FNO A;  1HDQ A;  2VZZ A;  2J8N A;  1Z9U A;  3NH4 A;  2GLJ A;  1RO5 A;  2Q4Y A;  2JLM A;  1YGH A;  1JWQ A;  4R6T A;  5HVF A;  2PE3 A;  6CPA A;  1YSJ A;  1Z8T A;  3FEE A;  4OP4 A;  4OME A;  4PPZ A;  4A32 A;  1Y9W A;  4H6U A;  5CBM A;  1S60 A;  4GM5 A;  1XOV A;  2GLF A;  4OLL A;  1P4N A;  2ZEG A;  1YVK A;  3NFZ A;  4OAE A;  2Q51 A;  2WYR A;  5K8N A;  3EXN A;  3RO0 A;  4KSA A;  2ZEF A;  4CYO A;  4JD6 A;  4PXC A;  3D66 A;  1YQE A;  3D7H A;  3KR4 A;  4ORF A;  4P4D A;  5E96 A;  4C2Y A;  4KS9 A;  2EK9 A;  1TKF A;  4UF4 A;  3TX8 A;  2BOA A;  3W91 A;  1AYE A;  3G8W A;  3C26 A;  2PJ5 A;  2BCO A;  3FED A;  1PU9 A;  3IWG A;  3PB4 X;  5G20 A;  1Y7R A;  1WK4 A;  4MY3 A;  1VHO A;  3H8F A;  2Q44 A;  3H4Q A;  4G1P A;  2YND A;  4TNU A;  3FNC A;  4RUH A;  4CGO A;  3B3W A;  3FBU A;  4LX9 A;  4F9V A;  4EFD A;  3QNV A;  3DR6 A;  3R9F A;  2FSR A;  2JDD A;  2Q4V A;  5HXD A;  2P0W A;  3WAB A;  1YRE A;  1I1D A;  1Q2Y A;  1YW6 A;  2AFS A;  2FS5 A;  1X12 A;  2JBK A;  4ONU A;  4XPL A;  3SXO A;  3WR7 A;  3S6K A;  4B5P A;  4KOR A;  5HMN A;  4OC0 A;  4M6G A;  1VHS A;  3V8I A;  3FMC A;  3H8E A;  4MI4 A;  3SJG A;  4NGN A;  1XE4 A;  3B35 A;  4KSF A;  1Z8W A;  4B13 A;  5G21 A;  3VH9 A;  4O23 A;  3ZZI A;  1B87 A;  3BI0 A;  3PEI A;  3BXM A;  3FVL A;  2GE3 A;  4Y49 C;  4A94 A;  1R3N A;  5K8P A;  2ZW6 A;  4KOW A;  2OR4 A;  3D2M A;  1F2P A;  3RNZ A;  4F0X A;  4RS2 A;  4C68 A;  3IWE A;  3B2Y A;  2XEJ A;  1LFW A;  3SI0 A;  4MFP A;  3KKW A;  1NSL A;  1QSO A;  2F8H A;  2R98 A;  3JVN A;  4CAV A;  3G3S A;  1QSR A;  3QAY A;  5EC4 A;  2Q4Z A;  2CXA A;  4HNW B;  3CPX A;  1PUA A;  1YLE A;  4JXQ A;  2HB6 A;  3ZJ0 A;  2EWB A;  3H5Z A;  4A38 A;  2DPS A;  4KVM E;  2DPT A;  3R96 A;  3RZA A;  1KWM A;  1XEB A;  3NE8 A;  4BD9 A;  5KTC A;  1QSM A;  4AXV A;  1P0H A;  2X7B A;  8CPA A;  4OC5 A;  3D7G A;  4KLW A;  5K8O A;  5LYF A;  2BO9 A;  4QB9 A;  1XFO A;  2HV2 A;  5HH1 A;  5JM6 A;  3PB8 X;  2PJ1 A;  1F2O A;  3EC4 A;  4R3L A;  1Y0Y A;  2D4P A;  4AVC A;  5A27 A;  4A37 A;  2CNM A;  1IID A;  4OC4 A;  3GKR A;  2OOT A;  2B4D B;  3B7I A;  5JH9 A;  5K8M A;  2PR1 A;  4NGT A;  5J1Q A;  3S9M A;  3F5B A;  3KQZ A;  4HKF A;  1BPM A;  1S7F A;  3JRU A;  1R43 A;  4F6A A;  1BPN A;  4AG7 A;  3RYO A;  1XIX A;  2ZEM A;  4YWY A;  3PFO A;  4CRY B;  4NJQ A;  1VHE A;  2PJC A;  1J4J A;  2PJ8 A;  4X5K A;  2JEW A;  1S5K A;  4MHN A;  3R95 A;  2EUI A;  2PJ9 A;  4UWI A;  4CYQ A;  3FRM A;  3D4U A;  2ZEO A;  4P6Y A;  3BJ7 A;  2B5G A;  3IC1 A;  3DNS A;  3IEH A;  5IB0 A;  1RXT A;  3BI1 A;  3WC7 A;  3PRT A;  1A2Z A;  4IK2 A;  2D4O A;  2VZY A;  4MFZ A;  3T9Y A;  4XPD B;  4WJB A;  4HNY B;  1MJB A;  3MRU A;  2ZEN A;  2I3C A;  4NXY A;  5EBV A;  2ZOG A;  4KOX A;  1FY7 A;  1DTD A;  2BSW A;  4KOY A;  4OC1 A;  4QUS A;  3SJX A;  2V8G A;  5AG4 A;  4C2X A;  2AFW A;  4LQG A;  2GRE A;  4Z65 A;  7CPA A;  1LAP A;  3DSB A;  3PB6 X;  1MJ9 A;  2EO8 A;  2R1I A;  3I3G A;  3TO9 A;  2C6G A;  3SI2 A;  5LRJ A;  2OH1 A;  1MJA A;  2HUZ A;  2IJZ A;  5G1Z A;  3PBB A;  4JZ0 A;  2FT0 A;  2PJ7 A;  2VQY A;  1CX8 A;  4A31 A;  4KZT A;  4XNH B;  4R9M A;  5G22 A;  4LQ6 A;  3KI9 A;  3TOA A;  5JQ4 A;  2I00 A;  1YK3 A;  4A39 A;  5FVJ A;  4AVB A;  4KLV A;  4UA3 A;  1LRZ A;  1S3Z A;  4CYN A;  1KUY A;  4BIN A;  4YU9 A;  2ZEL A;  2CF4 A;  2Q0Y A;  1IOI A;  2CTC A;  2PSW A;  1UFH A;  4KSI A;  3VWE A;  2YGW A;  3TC8 A;  2OZG A;  4UFV A;  1XF8 A;  2XEI A;  4NSQ A;  3TTH A;  3TO7 A;  2PJB A;  4B10 A;  1M4G A;  4P4E A;  3E0K A;  2Q7B A;  3D3S A;  4ZX8 A;  2B4B A;  2YNE A;  1IOF A; 
#chains in the Genus database with same CATH homology
 2P6E A;  2Z3L A;  3K9U A;  2G3T A;  2PR8 A;  4UFX A;  2Z3M A;  1YVO A;  1IYK A;  2FE7 A;  3EY5 A;  5J8C A;  2FL4 A;  1QST A;  5DWM A;  2GAN A;  4CS0 B;  3D2P A;  3TO6 A;  3R9G A;  1M4D A;  2REF A;  4IUS A;  4JXR A;  2ATR A;  4LUA A;  3MGD A;  4AVA A;  4R57 A;  5DWN A;  5F49 A;  4H6Z A;  2Z3K A;  4KOU A;  3IU2 A;  4CGN A;  2Y0M A;  1Y9K A;  3F0A A;  3TOB A;  2ZW4 A;  2FCK A;  3F8K A;  4UFW A;  5BWA B;  4MHD A;  1KZF A;  4EVY A;  3A9L A;  3GYA A;  4NF1 A;  1XMT A;  1KUX A;  1MK4 A;  2Z11 A;  3CXP A;  3CXQ A;  3TFY A;  3D8P A;  4RI1 A;  1K4J A;  2VEZ A;  3OWC A;  2PDO A;  2DXQ A;  4KOT A;  4B5P B;  2R7H A;  3FB3 A;  4FD6 A;  4Y49 B;  3I9S A;  5A28 A;  4IF5 A;  4KUA A;  1Z4R A;  1M44 A;  4II9 A;  3CXS A;  4BMH A;  4GS4 A;  4C7H A;  2O28 A;  2PQ8 A;  1M1D A;  3PZJ A;  4L8A A;  2FIA A;  4U9Z A;  5F46 A;  4AB7 A;  2BL1 A;  4NCZ A;  2HQY A;  4CGP A;  4PK2 A;  4U9Y A;  2WPX A;  4C7I A;  4H89 A;  3T90 A;  4QVT A;  2G0B A;  2ZPA A;  2WPW A;  2K5T A;  4A30 A;  5AG7 A;  2CNS A;  1BOB A;  4UCM A;  4B5O A;  4CGL A;  2BUE A;  3LOD A;  4CAE A;  1N71 A;  2GIV A;  3B8G A;  2Z3O A;  4ZGY B;  4J3G A;  3R1K A;  2P6F A;  4NEX A;  3TCV A;  4KOV A;  4E8O A;  2BEI A;  4MFJ A;  2P6G A;  2ZW5 A;  3LD2 A;  5C88 A;  5KTA A;  4JWP A;  1OZP A;  4B12 A;  3IU1 A;  5IX3 A;  1CJW A;  2B5G B;  1ZO0 A;  4CAF A;  5CNP A;  4M85 A;  2OZU A;  1CM0 A;  5AGE A;  5ISV A;  2RC4 A;  3TE4 A;  2I79 A;  2YNC A;  4MBU A;  3R9E A;  2FXF A;  4MY0 A;  5JPH A;  5AG6 A;  2YNC C;  1S7K A;  2F5I A;  5KTD A;  1YR0 A;  4CYP A;  1L0C A;  4MFL A;  1U6M A;  1YX0 A;  5J8F A;  3GY9 A;  2Z3P A;  5F48 A;  4FD5 A;  2JEV A;  4CAW A;  2ARH A;  3P2F A;  1IIC A;  2OU2 A;  4FD7 A;  4K30 A;  3EFA A;  4KVX A;  4UCN A;  4CGM A;  2B58 A;  3JTK A;  1I12 A;  2AJ6 A;  4QC6 A;  2KCW A;  4PK3 A;  2A4N A;  4KVO E;  2ZW7 A;  1QSN A;  2PC1 A;  1BO4 A;  2WUU A;  1TIQ A;  3JUW A;  4MFK A;  4A2Z A;  1NMT A;  2PRB A;  2VI7 A;  2VBQ A;  2IL4 A;  2QIR A;  3FYN A;  3VWD A;  4YFJ A;  2ZXV A;  1S7L A;  1ON0 A;  5AG5 A;  4YRH A;  4BBH A;  2CY2 A;  2OB0 A;  2Z10 A;  4UCP A;  1VKC A;  4Q36 A;  3DR8 A;  3FXT A;  2C27 A;  2G3A A;  3EO4 A;  4R3K A;  2R8V A;  1Z4E A;  2NMT A;  1M4I A;  1S7N A;  2CNT A;  4UBR A;  2B3U A;  2H5M A;  2B4D A;  4ZBG A;  4UWJ A;  3TT2 A;  3DDD A;  1SQH A;  4F0Y A;  1GHE A;  2QEC A;  4E0A A;  4JLY A;  3QB8 A;  3SHP A;  1Q2C A;  4A95 A;  4QBJ A;  2WSA A;  2J8M A;  4CAX A;  5H86 A;  1IB1 E;  3BJ8 A;  4L89 A;  4R87 A;  4U5Y A;  4XPK A;  2AE6 A;  2OZH A;  5F47 A;  4CRZ B;  3PGP A;  2VXK A;  4MFQ A;  1NE9 A;  1R57 A;  2Z3N A;  4DNC A;  4Q38 A;  3N7Z A;  2QML A;  5I0C A;  4XPD C;  4FD4 A;  4AG9 A;  2Q04 A;  3FIX A;  4KOS A;  3P2H A;  2REE A;  4B11 A;  4PSX A;  4PV6 A;  3W6S A;  3SXN A;  2J8R A;  3IGR A;  2FIW A;  2JDC A;  3S6G A;  4HNX B;  3BLN A;  1KUV A;  4XNH C;  1B6B A;  2Z0Z A;  1Q2D A;  4E2A A;  5H84 A;  4YGO A;  4KUB A;  1V0C A;  4MJ8 A;  3PP9 A;  4JJX A;  4C2Z A;  4OAD A;  4M3S A;  2B3V A;  4B14 A;  3W6X A;  4A33 A;  3QAH A;  5IV0 A;  3UY5 A;  5C82 A;  1WWZ A;  2EVN A;  1I21 A;  3S6H A;  3NE7 A;  4I49 A;  3S6F A;  5GCN A;  1IYL A;  4PSW A;  2VZZ A;  2J8N A;  1Z9U A;  1RO5 A;  2Q4Y A;  2JLM A;  1YGH A;  4A32 A;  1Y9W A;  4H6U A;  1S60 A;  4OLL A;  1P4N A;  1YVK A;  4OAE A;  3EXN A;  4CYO A;  4KSA A;  4JD6 A;  4ORF A;  5E96 A;  4C2Y A;  4KS9 A;  3W91 A;  3G8W A;  3C26 A;  3IWG A;  1PU9 A;  5G20 A;  1Y7R A;  1WK4 A;  4MY3 A;  2Q44 A;  3H4Q A;  2YND A;  3FNC A;  4CGO A;  3FBU A;  4LX9 A;  3DR6 A;  3R9F A;  2FSR A;  2JDD A;  2Q4V A;  2P0W A;  1YRE A;  1I1D A;  1Q2Y A;  4XPL A;  4ONU A;  2FS5 A;  3SXO A;  3WR7 A;  3S6K A;  4B5P A;  4KOR A;  5HMN A;  1VHS A;  3V8I A;  4MI4 A;  1XE4 A;  4KSF A;  4B13 A;  5G21 A;  3ZZI A;  1B87 A;  4Y49 C;  2GE3 A;  2ZW6 A;  4KOW A;  3D2M A;  4F0X A;  4RS2 A;  4C68 A;  3IWE A;  4MFP A;  3KKW A;  1NSL A;  1QSO A;  3JVN A;  2R98 A;  4CAV A;  3G3S A;  1QSR A;  5EC4 A;  2CXA A;  4HNW B;  1PUA A;  1YLE A;  4JXQ A;  3ZJ0 A;  3H5Z A;  2DPS A;  4KVM E;  2DPT A;  3R96 A;  1XEB A;  5KTC A;  1QSM A;  1P0H A;  2X7B A;  4KLW A;  4QB9 A;  2HV2 A;  5HH1 A;  4R3L A;  5A27 A;  3EC4 A;  4AVC A;  2D4P A;  2CNM A;  1IID A;  3GKR A;  2B4D B;  2PR1 A;  3F5B A;  4HKF A;  1S7F A;  4F6A A;  4AG7 A;  3RYO A;  1XIX A;  4CRY B;  1J4J A;  4X5K A;  1S5K A;  3R95 A;  2EUI A;  4UWI A;  4CYQ A;  3FRM A;  3BJ7 A;  2B5G A;  3DNS A;  5IB0 A;  1RXT A;  2D4O A;  2VZY A;  4MFZ A;  3T9Y A;  4XPD B;  4HNY B;  1MJB A;  4NXY A;  5EBV A;  4KOX A;  1FY7 A;  2BSW A;  4KOY A;  4QUS A;  5AG4 A;  4C2X A;  3DSB A;  1MJ9 A;  3I3G A;  2R1I A;  3TO9 A;  2OH1 A;  1MJA A;  2HUZ A;  5G1Z A;  2FT0 A;  2VQY A;  4A31 A;  4KZT A;  4XNH B;  4R9M A;  5G22 A;  3TOA A;  5JQ4 A;  2I00 A;  1YK3 A;  4AVB A;  5FVJ A;  4KLV A;  4UA3 A;  1LRZ A;  1S3Z A;  4CYN A;  1KUY A;  2Q0Y A;  2PSW A;  1UFH A;  3VWE A;  2YGW A;  2OZG A;  4UFV A;  1XF8 A;  3TTH A;  4NSQ A;  3TO7 A;  4B10 A;  1M4G A;  3E0K A;  2Q7B A;  3D3S A;  2B4B A;  2YNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...