5IB0A

Pa4534: acetyl coa complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
137
structure length
137
Chain Sequence
MQLRSVIAADHPALFALWSRTPGIRLRAEDAYPFFLAYLQRNPGLSLLVETEGEVIACLMAGHDGRRGYLQHLVVDPGYRGLGLARRMLDEVLARLAREGIGKSHVFVLDAAEEAQAFWRAQSDWERRKDIQVFSTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein PA4534
publication title Structure of PA4534
rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
molecule tags Transferase
total genus 36
structure length 137
sequence length 137
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ib0A00
4DNCA 2IL4A 4U5YA 2B3VA 1BO4A 4MHDA 1K4JA 1M4DA 4J3GA 1RXTA 2HV2A 4CRYB 1M4IA 3EC4A 1WWZA 1Z4RA 2OZGA 3DR6A 1R57A 2O28A 2FIAA 1Q2DA 2I79A 2Q4YA 2REEA 4F0YA 4F6AA 3TO6A 1VKCA 4MJ8A 5I0CA 2P6GA 3CXSA 4JXRA 3TO7A 2JEVA 1Z4EA 2A4NA 3VWDA 2AJ6A 4YGOA 3SHPA 1B87A 2C27A 4KUBA 1IYKA 3KKWA 2P6EA 5H84A 3I3GA 3LODA 2GE3A 2JLMA 1KZFA 3FBUA 2VBQA 3IGRA 1L0CA 4YRHA 5EC4A 2FS5A 3D2MA 3WR7A 2R98A 2B4DB 4M85A 1KUVA 1KUYA 2VZYA 3ZZIA 5J8CA 1IICA 4KZTA 4CS0B 1NSLA 2PRBA 4KOXA 1MJBA 1Q2CA 4U9ZA 4KLWA 4II9A 2X7BA 3TOAA 2H5MA 4R87A 1I21A 4E0AA 5FVJA 4HNWB 2ATRA 1QSMA 1WK4A 2B4BA 3MGDA 5F46A 1FY7A 4M3SA 3S6HA 5KTAA 2Z10A 4PSWA 1LRZA 1CM0A 2D4OA 4EVYA 2Q0YA 2PQ8A 2HUZA 3I9SA 4KOUA 2OZHA 4QVTA 1PU9A 3GKRA 1S60A 3IWGA 3TCVA 1M4GA 4XNHB 4NXYA 5E96A 3RYOA 2F5IA 1YX0A 4R3KA 1Q2YA 3F8KA 2B4DA 1V0CA 2QIRA 1XF8A 1S5KA 3R95A 4KVOE 3LD2A 1RO5A 1ON0A 1S7KA 5KTCA 1XIXA 4KLVA 1QSNA 1S3ZA 2HQYA 3FNCA 3EFAA 1YK3A 4QBJA 1I12A 3FYNA 4NCZA 4MY3A 2JDDA 4KVME 1P0HA 3S6GA 1S7NA 2DXQA 4XNHC 2FCKA 2J8MA 4CAWA 2FIWA 5IX3A 3W91A 2AE6A 3OWCA 4H6UA 1QSOA 2G0BA 4XPDB 4JLYA 2VXKA 3EY5A 2EUIA 4XPKA 3PZJA 4QB9A 5C88A 3TO9A 1Y9WA 2FT0A 1P4NA 1Z9UA 2R7HA 4KOVA 4HKFA 1SQHA 2I00A 3P2FA 4L8AA 3T90A 4K30A 1BOBA 3W6XA 5HH1A 1Y7RA 4FD7A 4KOYA 4CAVA 2R1IA 2RC4A 3BLNA 4BMHA 3BJ7A 3F0AA 4L89A 3G8WA 5CNPA 1I1DA 2G3AA 3UY5A 4AVBA 2Y0MA 3DR8A 4UWJA 4OLLA 3R1KA 2PDOA 1MJ9A 3H4QA 4H6ZA 2B5GB 4KUAA 4KOSA 4QUSA 1MJAA 2VI7A 2OU2A 5C82A 3R9EA 5HMNA 4NEXA 4AVCA 3R96A 4ZBGA 5GCNA 2J8NA 4E8OA 1N71A 1VHSA 4YFJA 4I49A 4JD6A 1B6BA 4Y49B 4UWIA 5F48A 3R9GA 3FXTA 1S7LA 1CJWA 2OZUA 3TE4A 2PR1A 2WPWA 4AG9A 1YR0A 4JXQA 3FB3A 4PV6A 1YREA 3T9YA 3GYAA 3ZJ0A 4CAXA 4XPLA 2Q4VA 2ZXVA 5DWMA 5IB0A 2G3TA 2FXFA 2Z11A 3S6FA 2B58A 1UFHA 1XEBA 3JVNA 4IF5A 3PP9A 2FL4A 4Y49C 1IYLA 3P2HA 5J8FA 3VWEA 2PC1A 2BSWA 4IUSA 3QB8A 3DNSA 2QECA 3FIXA 2GIVA 4KORA 2ARHA 2QMLA 3G3SA 5ISVA 1YVKA 3EO4A 1NE9A 3B8GA 4PSXA 3CXPA 2KCWA 2CNSA 2P6FA 4B5OA 4B5PA 1XE4A 4KVXA 4CRZB 3TT2A 4E2AA 3FRMA 1YGHA 4GS4A 3S6KA 2CNTA 2ZW6A 4OAEA 2VQYA 4R3LA 4ONUA 2JDCA 2CY2A 2CNMA 1IIDA 2REFA 4MI4A 3W6SA 1S7FA 2FSRA 2Q04A 2BEIA 4AVAA 3D3SA 1NMTA 3R9FA 3V8IA 5KTDA 2BL1A 2FE7A 3D8PA 4LUAA 3SXNA 3PGPA 4MBUA 4XPDC 2ZW7A 2B3UA 4JJXA 1KUXA 2OH1A 2Q44A 2D4PA 3CXQA 5F49A 3N7ZA 1GHEA 3GY9A 3TFYA 2PR8A 2PSWA 2R8VA 3BJ8A 1MK4A 4R57A 4HNXB 1Y9KA 3SXOA 5DWNA 3TTHA 2B5GA 2BUEA 2GANA 1YLEA 1YVOA 2K5TA 3DSBA 4JWPA 4RI1A 5JPHA 2ZPAA 1M44A 4UBRA 2J8RA 4PK3A 1PUAA 3NE7A 1OZPA 2EVNA 4AG7A 4FD6A 4FD4A 1J4JA 2P0WA 5F47A 3E0KA 2NMTA 5IV0A 4KOWA 1QSTA 4NF1A 4OADA 1TIQA 4R9MA 4B5PB 3DDDA 2ZW5A 3D2PA 4AB7A 1QSRA 4H89A 4MY0A 4KOTA 3JUWA 3C26A 3TOBA 3F5BA 4ORFA 5H86A 3K9UA 2VEZA 4PK2A 1U6MA 5JQ4A 5EBVA 1IB1E 4X5KA 4HNYB 4U9YA 2WPXA 3EXNA 2Q7BA 2VZZA 4NSQA 2ZW4A 4FD5A 2Z0ZA 4UA3A 4RS2A 1M1DA 2OB0A 4QC6A 4LX9A 3QAHA 1XMTA
chains in the Genus database with same CATH superfamily
4ONWA 4DNCA 3IJ3A 2GLJA 2IL4A 4X8IA 4U5YA 2B3VA 4ZX9A 1BO4A 4MHDA 1K4JA 1M4DA 2AFUA 2QVPA 2V8GA 4J3GA 3NA6A 1IOIA 1RXTA 2HV2A 3SJXA 2PJ6A 3IU1A 4KSAA 4C2ZA 4CRYB 1BPMA 1M4IA 3EC4A 2F8HA 1WWZA 2PCUA 1ARMA 1Z4RA 5DS0A 2IMOA 2OZGA 3FVLA 5F09A 3DR6A 4CYOA 1R57A 4MHNA 1HEEA 3S9NA 2O28A 4ZGYB 4NGTA 2FIAA 2Q4ZA 2I79A 1Q2DA 2AFWA 2Q4YA 2REEA 2WSAA 4BD9A 4C2YA 3TO6A 1VKCA 4MJ8A 3PB9X 1XRYA 4F0YA 4F6AA 3GIUA 3D67A 5LYDA 5I0CA 2P6GA 2ZEDA 4P45A 4F9VA 3CXSA 4PQAA 3V38A 4JXRA 3TO7A 2JEVA 4Q38A 1Z4EA 2A4NA 3VWDA 1Y0YA 2POKA 2AJ6A 4YGOA 3SHPA 1B87A 2C27A 4KUBA 4A30A 1F57A 3DGVA 1IYKA 3KKWA 2P6EA 2BCOA 3I3GA 5H84A 3HLPA 3T8WA 3LODA 1A2ZA 2GE3A 3B3CA 2JLMA 3CPAA 1BAVA 1KZFA 2YNDA 4PXBA 3FBUA 4UIBA 2VBQA 3WABA 3BHXA 4CYNA 3IGRA 1L0CA 2RFHA 4RUHA 4YRHA 5EC4A 2ZENA 2FS5A 3D2MA 3WR7A 2F7VA 2R98A 2B4DB 2C1CA 4WJBA 2PJ1A 3H8GA 1Z8LA 4M85A 3FH4A 5CPAA 4CPAA 2GREA 1KUVA 1KUYA 2VZYA 3ZZIA 5J8CA 4A2ZA 1IICA 4KZTA 4MHZA 4CS0B 1NSLA 4ZI6A 2PRBA 4UEZA 5THWA 4KOXA 1MJBA 1Q2CA 4U9ZA 4KLWA 4II9A 2X7BA 4A95A 4H2KA 3CT9A 3TOAA 3WC7A 2H5MA 4CGLA 1UWYA 5K8OA 2Q7SA 4R87A 4KS9A 1IY7A 3TC8A 8CPAA 4A38A 1I21A 4E0AA 5IB9A 5FVJA 4HNWB 4Q36A 5J1QA 2ATRA 3PB4X 1QSMA 2O4HA 1ARLA 4OIWA 2PJAA 1YW6A 2Z3OA 3NH5A 1WK4A 2B4BA 3HUVA 3IEHA 3MGDA 4MMOA 1JWQA 4NGNA 1CP7A 1LAMA 5F46A 3FX6A 3DLJA 3GB0A 1AYEA 1FY7A 2ZOFA 3WT4A 4M3SA 3FEDA 3S6HA 5KTAA 3L2NA 1CP6A 2PJCA 2BOAA 4R7MA 2Z10A 2PRQA 3H8FA 4YU9A 4PSWA 4A32A 1LRZA 1LFWA 3KI9A 4B10A 4P4JA 5G21A 1CM0A 2D4OA 2EK8A 3CDXA 3PFEA 4EVYA 2Q0YA 4NFRA 2PQ8A 2HUZA 3I9SA 4KOUA 2OZHA 4QVTA 3KHXA 1PU9A 3GKRA 3KGQA 1S60A 1X12A 3IWGA 3TCVA 4C2XA 1M4GA 3D4UA 2PJ5A 1YLOA 3JRUA 4XNHB 4NXYA 5E96A 3RYOA 3K9TA 3B3TA 4A31A 2F5IA 2AFSA 1YX0A 4R3KA 1Y7EA 2BO9A 5K8NA 1Q2YA 3D7HA 3F8KA 3KQZA 2B4DA 3BI1A 4P4BA 5G20A 1V0CA 3NH4A 3V7ZA 2DF5A 4MFPA 2QIRA 3FF3A 4R76A 2V8VA 1XF8A 2Z3PA 1S5KA 3LMSA 3R95A 4KVOE 1Y0RA 4CYQA 3LD2A 2PJ0A 1RO5A 2PVWA 1ZG8A 1ON0A 1S7KA 5KTCA 2GFQA 1XIXA 4C7HA 4UEEA 2I3CA 2HB6A 4CGMA 4MCQA 4KLVA 1QSNA 4A33A 1S3ZA 2HQYA 3IWWA 4ZY1A 3ISXA 3FNCA 3EFAA 2AFMA 4FWUA 1YK3A 2YNEA 4IAVA 4MCSA 4QBJA 1I12A 3FYNA 3RNZA 4FBEA 2CF4A 3I1UA 4NGMA 4NCZA 5BWAB 2J9AA 4MY3A 4OC3A 2JDDA 3K2KA 2ODFA 4MFJA 3FEEA 3IU2A 4PXCA 4KVME 1P0HA 3S6GA 1S7NA 2DXQA 5JH9A 4R8FA 4XNHC 3KZWA 2FCKA 2J8MA 2IQ6A 4BINA 4NGQA 4G1PA 4CGOA 4CAWA 2FIWA 3B3WA 3W91A 5IX3A 2AE6A 1IOFA 3QNVA 3OWCA 2AFZA 2HC9A 4MRIA 4K3NA 5LRJA 3KHZA 4H6UA 4UF4A 1QSOA 3PRTA 2G0BA 4XPDB 2QJ8A 5G1ZA 4JLYA 2VXKA 3EY5A 1X10A 2EUIA 4PXEA 1QQ9A 4XPKA 3PZJA 4QB9A 5C88A 3TO9A 1Y9WA 3IFEA 2FT0A 1P4NA 1Z9UA 1HDUA 2R7HA 4B13A 4KOVA 1PCAA 4HKFA 1SQHA 2I00A 3P2FA 4L8AA 3T90A 3NFZA 3LWUA 3KL9A 4K30A 4CGPA 1BOBA 1DE4C 3W6XA 2PJ2A 2C6CA 2Z3MA 1QMUA 2XEGA 5HH1A 1Y7RA 4FD7A 4OC0A 4RN7A 4TNUA 4KOYA 4BBHA 3PB6X 2PJ8A 4CAVA 3KR4A 4DUKA 2ZEGA 3PEIA 2R1IA 3QAHA 5CBMA 5LRGA 2EWBA 4MFLA 2RC4A 4UCPA 3BXMA 4DJLA 3BLNA 3ISZA 4BMHA 4NJRA 3BJ7A 1RTQA 3F0AA 4L89A 4OKOA 3G8WA 4LQ6A 5CNPA 1I1DA 2G3AA 3UY5A 3B7IA 4AVBA 2Y0MA 3DR8A 4UWJA 4OLLA 4C7IA 3R1KA 3TFYA 3TX8A 2PDOA 1MJ9A 1NSAA 3H4QA 4H6ZA 5I4MA 4KUAA 1YW4A 4KOSA 4QUSA 1CBXA 2JEWA 4MFQA 4OMEA 4C68A 4FAIA 2AFXA 1MJAA 2VI7A 3IIBA 1AMPA 2YNCA 3CZXA 4ZY0A 2ABZA 2PE3A 2OU2A 4EFDA 5C82A 3R9EA 1TKHA 5HMNA 4NEXA 4AVCA 3R96A 4P4IA 4ZBGA 5GCNA 5HXDA 2EO8A 2J8NA 4UFWA 4E8OA 3VARA 1N71A 3MN8A 1VHSA 4NJQA 4YFJA 2PJ3A 5JM6A 3SJFA 2ZEEA 4I49A 1ZLIA 4JD6A 2XEJA 3PBEA 3FECA 1B6BA 4Y49B 5A28A 2C6GA 3BI0A 4LQGA 4UWIA 5F48A 1FT7A 2ZEPA 2G9DA 4MHPA 3R9GA 3FXTA 1S7LA 2XEFA 1CJWA 3PB8X 1Z8XA 2OZUA 3RAMA 3TE4A 3FJUA 2PR1A 2WPWA 2FVGA 4ZY2A 3VATA 4AG9A 1YR0A 4MCPA 4X2TA 1LCPA 4JXQA 2ZEMA 3FB3A 4PV6A 4YWYA 1LAPA 2JBKA 2WZNA 5AG7A 3KASA 1YREA 4A94A 1H8LA 1Z8WA 3T9YA 3RZAA 1ELLP 3GYAA 2ZEOA 1JQGA 2PIZA 2EBJA 4P6YA 5AG5A 3ZJ0A 1XBUA 2Q43A 4CAXA 4XPLA 5AG6A 4EMEA 2PVVA 2Q4VA 2ZXVA 5DWMA 5IB0A 1XMBA 2G3TA 1VGYA 1EE3P 4B6ZA 2FXFA 2Z11A 2ZOGA 2B58A 3S6FA 1UFHA 1XEBA 3D7FA 3JVNA 1XFOA 1YSJA 4IF5A 3PB7X 1HDQA 2XEIA 3NH8A 1XOVA 1ELMP 4UFVA 4F8ZA 3PP9A 2FL4A 4Y49C 1IYLA 1VHEA 1XJOA 4B11A 1Z2LA 3P2HA 2EK9A 3RO0A 4UEFA 5ELYA 4P44A 3VWEA 5J8FA 2PC1A 2BSWA 3H8EA 5HVHA 4IUSA 4ZYQA 3QB8A 3SI2A 3DNSA 2NYQA 4DYOA 2QECA 3FIXA 3IO1A 4P10A 1CG2A 2GIVA 2ZEHA 4Q7AA 4KORA 2PJ9A 4F9UA 1TF9A 2ARHA 2QMLA 3G3SA 2CXAA 5ISVA 1YVKA 3EO4A 2WYRA 1NE9A 3KR5A 1CX8A 5LYIA 2RB7A 3B8GA 4M6IA 3IWEA 4PSXA 4X3RA 1ZG7A 1CPXA 1ZLHA 4NGRA 4R6TA 4AXVA 3D68A 4PXDA 3CXPA 3SJEA 4EWTA 3GLJA 4MHYA 2KCWA 1TKJA 4OC5A 1GYTA 6CPAA 2CNSA 5LYFA 4OC4A 1FNOA 2P6FA 2V8DA 4B5OA 5EMIA 4B5PA 5LYLA 1XE4A 4KVXA 4CRZB 2DEAA 1R43A 4IK2A 3TT2A 3FRMA 4E2AA 5D29A 1YGHA 4GS4A 4MFZA 2V77A 3S6KA 4A37A 3LACA 2CNTA 2ZW6A 4OAEA 2VQYA 4R3LA 2QYVA 3SJGA 4ONUA 2JDCA 3WC5A 5K8MA 2CY2A 4CAEA 4A39A 2CNMA 2DPSA 5K8PA 1IIDA 2REFA 4MI4A 3SI1A 1VIXA 3W6SA 1S7FA 2FSRA 2Q04A 2BEIA 1DTDA 2YNCC 4IHMA 3S9MA 4AVAA 3D3SA 5HVFA 1NMTA 3R9FA 3V8IA 1TF8A 2V8HA 1F2PA 2Z3LA 5KTDA 4O23A 5AGEA 2ANPA 2BL1A 1BPNA 2FE7A 3D8PA 2CTBA 4LUAA 3SXNA 3PGPA 4MBUA 4NGPA 4XPDC 2ZW7A 2B3UA 4JJXA 1KUXA 2OH1A 2Q44A 1LANA 2D4PA 3MRUA 3CXQA 5F49A 1Z8TA 2CTCA 2OR4A 3N7ZA 5LRKA 1GHEA 3GY9A 1BLLE 2PR8A 3D66A 4PPZA 5D8NA 2PSWA 2R8VA 4ZX8A 3B35A 3BJ8A 4JYWA 1IGBA 1MK4A 4R57A 4HNXB 1Y9KA 4GM5A 1M4LA 2JBJA 2Z3KA 3SI0A 3SXOA 5DWNA 3TTHA 2VL1A 4B14A 1YQEA 1LOKA 2B5GA 2BUEA 1YLEA 1YVOA 2GANA 2K5TA 2O53A 3DSBA 3D7GA 4JWPA 4RI1A 2ZPAA 2OOTA 5JPHA 1M44A 4WWVA 4MXUA 1Q7LA 1Z5RA 4UBRA 3QAYA 1VHOA 2J8RA 3PBBA 4PK3A 1PUAA 5A27A 4CGNA 2C6PA 3NE7A 3B3VA 4OC1A 7CPAA 1IU8A 1R3NA 1OZPA 2EVNA 3FMCA 4OIDA 4CYPA 4AG7A 3D7DA 4TWEA 4FD6A 4FD4A 1J4JA 2P0WA 3CPXA 3KQXA 5G22A 5F47A 2AFOA 4P4EA 5JGFA 2Z3NA 4B12A 3E0KA 2NMTA 3IC1A 1F2OA 4UIAA 3JTKA 3N5FA 4KOWA 1QSTA 5IV0A 3A9LA 4NF1A 4OADA 1TIQA 4R9MA 2PJ4A 4B5PB 3DDDA 1KWMA 2GU2A 2ZW5A 2PJBA 4JZ0A 3D2PA 4KSFA 2DPTA 2NSMA 4KSIA 1QSRA 4AB7A 4P4FA 4UCMA 4CAFA 4H89A 4NGSA 4MY0A 4UFXA 5AG4A 2IJZA 1OBRA 4KOTA 3WC6A 1YMEA 3JUWA 3RBUA 3C26A 3TOBA 3F5BA 4ORFA 5H86A 1CPSA 2GLFA 3K9UA 1PYTB 2VEZA 4Z65A 4PK2A 3B2YA 3H5ZA 4MFKA 4P4DA 1U6MA 2PJ7A 4M6HA 5JQ4A 2ZEFA 5EBVA 1IB1E 3NE8A 3PFOA 4X5KA 4HNYB 3VH9A 4U9YA 4MCRA 2PIYA 2WPXA 3EXNA 2Q7BA 1TKFA 2VZZA 2YGWA 4W9YA 3S9LA 4NSQA 4M6GA 2Q51A 3B3SA 4GXHA 2ZW4A 4FD5A 2Z0ZA 4UA3A 4FUUA 2WUUA 4HPSA 1TXRA 4RS2A 3GUXA 2CIJA 2ZELA 1M1DA 2OB0A 5HVGA 4QC6A 4UCNA 4OP4A 4OC2A 1ZG9A 1AUGA 4F0XA 4LX9A 2B5GB 1ZO0A 1XMTA
chains in the Genus database with same CATH topology
4DNCA 2IL4A 4U5YA 2B3VA 1BO4A 4MHDA 1K4JA 1M4DA 4J3GA 1RXTA 2HV2A 4CRYB 3IU1A 4KSAA 4C2ZA 1M4IA 3EC4A 1WWZA 1Z4RA 2OZGA 3DR6A 4CYOA 1R57A 2O28A 4ZGYB 2FIAA 1Q2DA 2I79A 2Q4YA 2REEA 2WSAA 4F0YA 4C2YA 4F6AA 3TO6A 1VKCA 4MJ8A 5I0CA 2P6GA 3CXSA 4JXRA 3TO7A 2JEVA 4Q38A 1Z4EA 2A4NA 3VWDA 2AJ6A 4YGOA 3SHPA 1B87A 2C27A 4KUBA 4A30A 1IYKA 3KKWA 2P6EA 5H84A 3I3GA 3LODA 2GE3A 2JLMA 1KZFA 2YNDA 4CYNA 3FBUA 2VBQA 3IGRA 1L0CA 4YRHA 5EC4A 2FS5A 3D2MA 3WR7A 2R98A 2B4DB 4M85A 1KUVA 1KUYA 2VZYA 3ZZIA 5J8CA 4A2ZA 1IICA 4KZTA 4CS0B 1NSLA 2PRBA 4KOXA 1MJBA 1Q2CA 4U9ZA 4KLWA 4II9A 2X7BA 4A95A 3TOAA 2H5MA 4CGLA 4R87A 4KS9A 1I21A 4E0AA 5FVJA 4HNWB 4Q36A 2ATRA 1QSMA 2Z3OA 1WK4A 2B4BA 3MGDA 5F46A 1FY7A 4M3SA 3S6HA 5KTAA 2Z10A 4B10A 4A32A 4PSWA 1LRZA 5G21A 1CM0A 2D4OA 4EVYA 2Q0YA 2PQ8A 2HUZA 3I9SA 4KOUA 2OZHA 4QVTA 1PU9A 3GKRA 1S60A 3IWGA 3TCVA 4C2XA 1M4GA 4XNHB 4NXYA 5E96A 3RYOA 4A31A 2F5IA 1YX0A 4R3KA 1Q2YA 3F8KA 5G20A 2B4DA 1V0CA 4MFPA 2QIRA 1XF8A 2Z3PA 1S5KA 3R95A 4KVOE 4CYQA 3LD2A 1RO5A 1ON0A 1S7KA 5KTCA 1XIXA 4C7HA 4CGMA 4KLVA 1QSNA 4A33A 1S3ZA 2HQYA 3FNCA 3EFAA 1YK3A 2YNEA 4QBJA 1I12A 3FYNA 4NCZA 5BWAB 4MY3A 2JDDA 4MFJA 3IU2A 4KVME 1P0HA 3S6GA 1S7NA 2DXQA 4XNHC 2FCKA 2J8MA 4CGOA 4CAWA 2FIWA 5IX3A 3W91A 2AE6A 3OWCA 4H6UA 1QSOA 2G0BA 4XPDB 5G1ZA 4JLYA 2VXKA 3EY5A 2EUIA 4XPKA 3PZJA 4QB9A 5C88A 3TO9A 1Y9WA 2FT0A 1P4NA 1Z9UA 2R7HA 4B13A 4KOVA 4HKFA 1SQHA 2I00A 3P2FA 4L8AA 3T90A 4K30A 4CGPA 1BOBA 3W6XA 2Z3MA 5HH1A 1Y7RA 4FD7A 4BBHA 4KOYA 4CAVA 2R1IA 4MFLA 2RC4A 4UCPA 3BLNA 4BMHA 3BJ7A 3F0AA 4L89A 3G8WA 5CNPA 1I1DA 2G3AA 3UY5A 4AVBA 2Y0MA 3DR8A 4UWJA 4OLLA 4C7IA 3R1KA 2PDOA 1MJ9A 3H4QA 4H6ZA 2B5GB 4KUAA 4KOSA 4QUSA 4MFQA 4C68A 1MJAA 2VI7A 2YNCA 2OU2A 5C82A 3R9EA 5HMNA 4NEXA 4AVCA 3R96A 4ZBGA 5GCNA 4UFWA 2J8NA 4E8OA 1N71A 1VHSA 4YFJA 4I49A 4JD6A 1B6BA 4Y49B 5A28A 4UWIA 5F48A 3R9GA 3FXTA 1S7LA 1CJWA 2OZUA 3TE4A 2PR1A 2WPWA 4AG9A 1YR0A 4JXQA 3FB3A 4PV6A 5AG7A 1YREA 3T9YA 3GYAA 5AG5A 3ZJ0A 4CAXA 4XPLA 5AG6A 2Q4VA 2ZXVA 5DWMA 5IB0A 2G3TA 2FXFA 2Z11A 3S6FA 2B58A 1UFHA 1XEBA 3JVNA 4IF5A 4UFVA 3PP9A 2FL4A 4Y49C 1IYLA 4B11A 3P2HA 5J8FA 3VWEA 2PC1A 2BSWA 4IUSA 3QB8A 3DNSA 2QECA 3FIXA 2GIVA 4KORA 2ARHA 2QMLA 3G3SA 2CXAA 5ISVA 1YVKA 3EO4A 1NE9A 3B8GA 3IWEA 4PSXA 3CXPA 2KCWA 2CNSA 2P6FA 4B5OA 4B5PA 1XE4A 4KVXA 4CRZB 3TT2A 4E2AA 3FRMA 1YGHA 4GS4A 4MFZA 3S6KA 2CNTA 2ZW6A 4OAEA 2VQYA 4R3LA 4ONUA 2JDCA 2CY2A 4CAEA 2CNMA 2DPSA 1IIDA 2REFA 4MI4A 3W6SA 1S7FA 2FSRA 2Q04A 2BEIA 2YNCC 4AVAA 3D3SA 1NMTA 3R9FA 3V8IA 2Z3LA 5KTDA 5AGEA 2BL1A 2FE7A 3D8PA 4LUAA 3SXNA 3PGPA 4MBUA 4XPDC 2ZW7A 2B3UA 4JJXA 1KUXA 2OH1A 2Q44A 2D4PA 3CXQA 5F49A 3N7ZA 1GHEA 3GY9A 3TFYA 2PR8A 2PSWA 2R8VA 3BJ8A 1MK4A 4R57A 4HNXB 1Y9KA 3SXOA 2Z3KA 5DWNA 3TTHA 4B14A 2B5GA 2BUEA 2GANA 1YLEA 1YVOA 2K5TA 3DSBA 4JWPA 4RI1A 5JPHA 2ZPAA 1M44A 4UBRA 2J8RA 4PK3A 1PUAA 5A27A 4CGNA 3NE7A 1OZPA 2EVNA 4CYPA 4AG7A 4FD6A 4FD4A 1J4JA 2P0WA 5G22A 5F47A 2Z3NA 4B12A 3E0KA 2NMTA 3JTKA 5IV0A 4KOWA 1QSTA 3A9LA 4NF1A 4OADA 1TIQA 4R9MA 4B5PB 3DDDA 2ZW5A 4KSFA 3D2PA 2DPTA 4AB7A 1QSRA 4UCMA 4CAFA 4H89A 4UFXA 4MY0A 5AG4A 4KOTA 3JUWA 3C26A 3TOBA 3F5BA 4ORFA 5H86A 3K9UA 2VEZA 4PK2A 3H5ZA 4MFKA 1U6MA 5JQ4A 5EBVA 1IB1E 4X5KA 4HNYB 4U9YA 2WPXA 3EXNA 2Q7BA 2VZZA 2YGWA 4NSQA 2ZW4A 4FD5A 2Z0ZA 4UA3A 2WUUA 4RS2A 1M1DA 2OB0A 4QC6A 4UCNA 4F0XA 4LX9A 3QAHA 1ZO0A 1XMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DNC A;  2IL4 A;  4U5Y A;  2B3V A;  1BO4 A;  4MHD A;  1K4J A;  1M4D A;  4J3G A;  1RXT A;  2HV2 A;  4CRY B;  1M4I A;  3EC4 A;  1WWZ A;  1Z4R A;  2OZG A;  3DR6 A;  1R57 A;  2O28 A;  2FIA A;  1Q2D A;  2I79 A;  2Q4Y A;  2REE A;  4F0Y A;  4F6A A;  3TO6 A;  1VKC A;  4MJ8 A;  5I0C A;  2P6G A;  3CXS A;  4JXR A;  3TO7 A;  2JEV A;  1Z4E A;  2A4N A;  3VWD A;  2AJ6 A;  4YGO A;  3SHP A;  1B87 A;  2C27 A;  4KUB A;  1IYK A;  3KKW A;  2P6E A;  5H84 A;  3I3G A;  3LOD A;  2GE3 A;  2JLM A;  1KZF A;  3FBU A;  2VBQ A;  3IGR A;  1L0C A;  4YRH A;  5EC4 A;  2FS5 A;  3D2M A;  3WR7 A;  2R98 A;  2B4D B;  4M85 A;  1KUV A;  1KUY A;  2VZY A;  3ZZI A;  5J8C A;  1IIC A;  4KZT A;  4CS0 B;  1NSL A;  2PRB A;  4KOX A;  1MJB A;  1Q2C A;  4U9Z A;  4KLW A;  4II9 A;  2X7B A;  3TOA A;  2H5M A;  4R87 A;  1I21 A;  4E0A A;  5FVJ A;  4HNW B;  2ATR A;  1QSM A;  1WK4 A;  2B4B A;  3MGD A;  5F46 A;  1FY7 A;  4M3S A;  3S6H A;  5KTA A;  2Z10 A;  4PSW A;  1LRZ A;  1CM0 A;  2D4O A;  4EVY A;  2Q0Y A;  2PQ8 A;  2HUZ A;  3I9S A;  4KOU A;  2OZH A;  4QVT A;  1PU9 A;  3GKR A;  1S60 A;  3IWG A;  3TCV A;  1M4G A;  4XNH B;  4NXY A;  5E96 A;  3RYO A;  2F5I A;  1YX0 A;  4R3K A;  1Q2Y A;  3F8K A;  2B4D A;  1V0C A;  2QIR A;  1XF8 A;  1S5K A;  3R95 A;  4KVO E;  3LD2 A;  1RO5 A;  1ON0 A;  1S7K A;  5KTC A;  1XIX A;  4KLV A;  1QSN A;  1S3Z A;  2HQY A;  3FNC A;  3EFA A;  1YK3 A;  4QBJ A;  1I12 A;  3FYN A;  4NCZ A;  4MY3 A;  2JDD A;  4KVM E;  1P0H A;  3S6G A;  1S7N A;  2DXQ A;  4XNH C;  2FCK A;  2J8M A;  4CAW A;  2FIW A;  5IX3 A;  3W91 A;  2AE6 A;  3OWC A;  4H6U A;  1QSO A;  2G0B A;  4XPD B;  4JLY A;  2VXK A;  3EY5 A;  2EUI A;  4XPK A;  3PZJ A;  4QB9 A;  5C88 A;  3TO9 A;  1Y9W A;  2FT0 A;  1P4N A;  1Z9U A;  2R7H A;  4KOV A;  4HKF A;  1SQH A;  2I00 A;  3P2F A;  4L8A A;  3T90 A;  4K30 A;  1BOB A;  3W6X A;  5HH1 A;  1Y7R A;  4FD7 A;  4KOY A;  4CAV A;  2R1I A;  2RC4 A;  3BLN A;  4BMH A;  3BJ7 A;  3F0A A;  4L89 A;  3G8W A;  5CNP A;  1I1D A;  2G3A A;  3UY5 A;  4AVB A;  2Y0M A;  3DR8 A;  4UWJ A;  4OLL A;  3R1K A;  2PDO A;  1MJ9 A;  3H4Q A;  4H6Z A;  2B5G B;  4KUA A;  4KOS A;  4QUS A;  1MJA A;  2VI7 A;  2OU2 A;  5C82 A;  3R9E A;  5HMN A;  4NEX A;  4AVC A;  3R96 A;  4ZBG A;  5GCN A;  2J8N A;  4E8O A;  1N71 A;  1VHS A;  4YFJ A;  4I49 A;  4JD6 A;  1B6B A;  4Y49 B;  4UWI A;  5F48 A;  3R9G A;  3FXT A;  1S7L A;  1CJW A;  2OZU A;  3TE4 A;  2PR1 A;  2WPW A;  4AG9 A;  1YR0 A;  4JXQ A;  3FB3 A;  4PV6 A;  1YRE A;  3T9Y A;  3GYA A;  3ZJ0 A;  4CAX A;  4XPL A;  2Q4V A;  2ZXV A;  5DWM A;  5IB0 A;  2G3T A;  2FXF A;  2Z11 A;  3S6F A;  2B58 A;  1UFH A;  1XEB A;  3JVN A;  4IF5 A;  3PP9 A;  2FL4 A;  4Y49 C;  1IYL A;  3P2H A;  5J8F A;  3VWE A;  2PC1 A;  2BSW A;  4IUS A;  3QB8 A;  3DNS A;  2QEC A;  3FIX A;  2GIV A;  4KOR A;  2ARH A;  2QML A;  3G3S A;  5ISV A;  1YVK A;  3EO4 A;  1NE9 A;  3B8G A;  4PSX A;  3CXP A;  2KCW A;  2CNS A;  2P6F A;  4B5O A;  4B5P A;  1XE4 A;  4KVX A;  4CRZ B;  3TT2 A;  4E2A A;  3FRM A;  1YGH A;  4GS4 A;  3S6K A;  2CNT A;  2ZW6 A;  4OAE A;  2VQY A;  4R3L A;  4ONU A;  2JDC A;  2CY2 A;  2CNM A;  1IID A;  2REF A;  4MI4 A;  3W6S A;  1S7F A;  2FSR A;  2Q04 A;  2BEI A;  4AVA A;  3D3S A;  1NMT A;  3R9F A;  3V8I A;  5KTD A;  2BL1 A;  2FE7 A;  3D8P A;  4LUA A;  3SXN A;  3PGP A;  4MBU A;  4XPD C;  2ZW7 A;  2B3U A;  4JJX A;  1KUX A;  2OH1 A;  2Q44 A;  2D4P A;  3CXQ A;  5F49 A;  3N7Z A;  1GHE A;  3GY9 A;  3TFY A;  2PR8 A;  2PSW A;  2R8V A;  3BJ8 A;  1MK4 A;  4R57 A;  4HNX B;  1Y9K A;  3SXO A;  5DWN A;  3TTH A;  2B5G A;  2BUE A;  2GAN A;  1YLE A;  1YVO A;  2K5T A;  3DSB A;  4JWP A;  4RI1 A;  5JPH A;  2ZPA A;  1M44 A;  4UBR A;  2J8R A;  4PK3 A;  1PUA A;  3NE7 A;  1OZP A;  2EVN A;  4AG7 A;  4FD6 A;  4FD4 A;  1J4J A;  2P0W A;  5F47 A;  3E0K A;  2NMT A;  5IV0 A;  4KOW A;  1QST A;  4NF1 A;  4OAD A;  1TIQ A;  4R9M A;  4B5P B;  3DDD A;  2ZW5 A;  3D2P A;  4AB7 A;  1QSR A;  4H89 A;  4MY0 A;  4KOT A;  3JUW A;  3C26 A;  3TOB A;  3F5B A;  4ORF A;  5H86 A;  3K9U A;  2VEZ A;  4PK2 A;  1U6M A;  5JQ4 A;  5EBV A;  1IB1 E;  4X5K A;  4HNY B;  4U9Y A;  2WPX A;  3EXN A;  2Q7B A;  2VZZ A;  4NSQ A;  2ZW4 A;  4FD5 A;  2Z0Z A;  4UA3 A;  4RS2 A;  1M1D A;  2OB0 A;  4QC6 A;  4LX9 A;  3QAH A;  1XMT A; 
#chains in the Genus database with same CATH topology
 4ONW A;  4DNC A;  3IJ3 A;  2GLJ A;  2IL4 A;  4X8I A;  4U5Y A;  2B3V A;  4ZX9 A;  1BO4 A;  4MHD A;  1K4J A;  1M4D A;  2AFU A;  2QVP A;  2V8G A;  4J3G A;  3NA6 A;  1IOI A;  1RXT A;  2HV2 A;  3SJX A;  2PJ6 A;  3IU1 A;  4KSA A;  4C2Z A;  4CRY B;  1BPM A;  1M4I A;  3EC4 A;  2F8H A;  1WWZ A;  2PCU A;  1ARM A;  1Z4R A;  5DS0 A;  2IMO A;  2OZG A;  3FVL A;  5F09 A;  3DR6 A;  4CYO A;  1R57 A;  4MHN A;  1HEE A;  3S9N A;  2O28 A;  4ZGY B;  4NGT A;  2FIA A;  2Q4Z A;  2I79 A;  1Q2D A;  2AFW A;  2Q4Y A;  2REE A;  2WSA A;  4BD9 A;  4C2Y A;  3TO6 A;  1VKC A;  4MJ8 A;  3PB9 X;  1XRY A;  4F0Y A;  4F6A A;  3GIU A;  3D67 A;  5LYD A;  5I0C A;  2P6G A;  2ZED A;  4P45 A;  4F9V A;  3CXS A;  4PQA A;  3V38 A;  4JXR A;  3TO7 A;  2JEV A;  4Q38 A;  1Z4E A;  2A4N A;  3VWD A;  1Y0Y A;  2POK A;  2AJ6 A;  4YGO A;  3SHP A;  1B87 A;  2C27 A;  4KUB A;  4A30 A;  1F57 A;  3DGV A;  1IYK A;  3KKW A;  2P6E A;  2BCO A;  3I3G A;  5H84 A;  3HLP A;  3T8W A;  3LOD A;  1A2Z A;  2GE3 A;  3B3C A;  2JLM A;  3CPA A;  1BAV A;  1KZF A;  2YND A;  4PXB A;  3FBU A;  4UIB A;  2VBQ A;  3WAB A;  3BHX A;  4CYN A;  3IGR A;  1L0C A;  2RFH A;  4RUH A;  4YRH A;  5EC4 A;  2ZEN A;  2FS5 A;  3D2M A;  3WR7 A;  2F7V A;  2R98 A;  2B4D B;  2C1C A;  4WJB A;  2PJ1 A;  3H8G A;  1Z8L A;  4M85 A;  3FH4 A;  5CPA A;  4CPA A;  2GRE A;  1KUV A;  1KUY A;  2VZY A;  3ZZI A;  5J8C A;  4A2Z A;  1IIC A;  4KZT A;  4MHZ A;  4CS0 B;  1NSL A;  4ZI6 A;  2PRB A;  4UEZ A;  5THW A;  4KOX A;  1MJB A;  1Q2C A;  4U9Z A;  4KLW A;  4II9 A;  2X7B A;  4A95 A;  4H2K A;  3CT9 A;  3TOA A;  3WC7 A;  2H5M A;  4CGL A;  1UWY A;  5K8O A;  2Q7S A;  4R87 A;  4KS9 A;  1IY7 A;  3TC8 A;  8CPA A;  4A38 A;  1I21 A;  4E0A A;  5IB9 A;  5FVJ A;  4HNW B;  4Q36 A;  5J1Q A;  2ATR A;  3PB4 X;  1QSM A;  2O4H A;  1ARL A;  4OIW A;  2PJA A;  1YW6 A;  2Z3O A;  3NH5 A;  1WK4 A;  2B4B A;  3HUV A;  3IEH A;  3MGD A;  4MMO A;  1JWQ A;  4NGN A;  1CP7 A;  1LAM A;  5F46 A;  3FX6 A;  3DLJ A;  3GB0 A;  1AYE A;  1FY7 A;  2ZOF A;  3WT4 A;  4M3S A;  3FED A;  3S6H A;  5KTA A;  3L2N A;  1CP6 A;  2PJC A;  2BOA A;  4R7M A;  2Z10 A;  2PRQ A;  3H8F A;  4YU9 A;  4PSW A;  4A32 A;  1LRZ A;  1LFW A;  3KI9 A;  4B10 A;  4P4J A;  5G21 A;  1CM0 A;  2D4O A;  2EK8 A;  3CDX A;  3PFE A;  4EVY A;  2Q0Y A;  4NFR A;  2PQ8 A;  2HUZ A;  3I9S A;  4KOU A;  2OZH A;  4QVT A;  3KHX A;  1PU9 A;  3GKR A;  3KGQ A;  1S60 A;  1X12 A;  3IWG A;  3TCV A;  4C2X A;  1M4G A;  3D4U A;  2PJ5 A;  1YLO A;  3JRU A;  4XNH B;  4NXY A;  5E96 A;  3RYO A;  3K9T A;  3B3T A;  4A31 A;  2F5I A;  2AFS A;  1YX0 A;  4R3K A;  1Y7E A;  2BO9 A;  5K8N A;  1Q2Y A;  3D7H A;  3F8K A;  3KQZ A;  2B4D A;  3BI1 A;  4P4B A;  5G20 A;  1V0C A;  3NH4 A;  3V7Z A;  2DF5 A;  4MFP A;  2QIR A;  3FF3 A;  4R76 A;  2V8V A;  1XF8 A;  2Z3P A;  1S5K A;  3LMS A;  3R95 A;  4KVO E;  1Y0R A;  4CYQ A;  3LD2 A;  2PJ0 A;  1RO5 A;  2PVW A;  1ZG8 A;  1ON0 A;  1S7K A;  5KTC A;  2GFQ A;  1XIX A;  4C7H A;  4UEE A;  2I3C A;  2HB6 A;  4CGM A;  4MCQ A;  4KLV A;  1QSN A;  4A33 A;  1S3Z A;  2HQY A;  3IWW A;  4ZY1 A;  3ISX A;  3FNC A;  3EFA A;  2AFM A;  4FWU A;  1YK3 A;  2YNE A;  4IAV A;  4MCS A;  4QBJ A;  1I12 A;  3FYN A;  3RNZ A;  4FBE A;  2CF4 A;  3I1U A;  4NGM A;  4NCZ A;  5BWA B;  2J9A A;  4MY3 A;  4OC3 A;  2JDD A;  3K2K A;  2ODF A;  4MFJ A;  3FEE A;  3IU2 A;  4PXC A;  4KVM E;  1P0H A;  3S6G A;  1S7N A;  2DXQ A;  5JH9 A;  4R8F A;  4XNH C;  3KZW A;  2FCK A;  2J8M A;  2IQ6 A;  4BIN A;  4NGQ A;  4G1P A;  4CGO A;  4CAW A;  2FIW A;  3B3W A;  3W91 A;  5IX3 A;  2AE6 A;  1IOF A;  3QNV A;  3OWC A;  2AFZ A;  2HC9 A;  4MRI A;  4K3N A;  5LRJ A;  3KHZ A;  4H6U A;  4UF4 A;  1QSO A;  3PRT A;  2G0B A;  4XPD B;  2QJ8 A;  5G1Z A;  4JLY A;  2VXK A;  3EY5 A;  1X10 A;  2EUI A;  4PXE A;  1QQ9 A;  4XPK A;  3PZJ A;  4QB9 A;  5C88 A;  3TO9 A;  1Y9W A;  3IFE A;  2FT0 A;  1P4N A;  1Z9U A;  1HDU A;  2R7H A;  4B13 A;  4KOV A;  1PCA A;  4HKF A;  1SQH A;  2I00 A;  3P2F A;  4L8A A;  3T90 A;  3NFZ A;  3LWU A;  3KL9 A;  4K30 A;  4CGP A;  1BOB A;  1DE4 C;  3W6X A;  2PJ2 A;  2C6C A;  2Z3M A;  1QMU A;  2XEG A;  5HH1 A;  1Y7R A;  4FD7 A;  4OC0 A;  4RN7 A;  4TNU A;  4KOY A;  4BBH A;  3PB6 X;  2PJ8 A;  4CAV A;  3KR4 A;  4DUK A;  2ZEG A;  3PEI A;  2R1I A;  3QAH A;  5CBM A;  5LRG A;  2EWB A;  4MFL A;  2RC4 A;  4UCP A;  3BXM A;  4DJL A;  3BLN A;  3ISZ A;  4BMH A;  4NJR A;  3BJ7 A;  1RTQ A;  3F0A A;  4L89 A;  4OKO A;  3G8W A;  4LQ6 A;  5CNP A;  1I1D A;  2G3A A;  3UY5 A;  3B7I A;  4AVB A;  2Y0M A;  3DR8 A;  4UWJ A;  4OLL A;  4C7I A;  3R1K A;  3TFY A;  3TX8 A;  2PDO A;  1MJ9 A;  1NSA A;  3H4Q A;  4H6Z A;  5I4M A;  4KUA A;  1YW4 A;  4KOS A;  4QUS A;  1CBX A;  2JEW A;  4MFQ A;  4OME A;  4C68 A;  4FAI A;  2AFX A;  1MJA A;  2VI7 A;  3IIB A;  1AMP A;  2YNC A;  3CZX A;  4ZY0 A;  2ABZ A;  2PE3 A;  2OU2 A;  4EFD A;  5C82 A;  3R9E A;  1TKH A;  5HMN A;  4NEX A;  4AVC A;  3R96 A;  4P4I A;  4ZBG A;  5GCN A;  5HXD A;  2EO8 A;  2J8N A;  4UFW A;  4E8O A;  3VAR A;  1N71 A;  3MN8 A;  1VHS A;  4NJQ A;  4YFJ A;  2PJ3 A;  5JM6 A;  3SJF A;  2ZEE A;  4I49 A;  1ZLI A;  4JD6 A;  2XEJ A;  3PBE A;  3FEC A;  1B6B A;  4Y49 B;  5A28 A;  2C6G A;  3BI0 A;  4LQG A;  4UWI A;  5F48 A;  1FT7 A;  2ZEP A;  2G9D A;  4MHP A;  3R9G A;  3FXT A;  1S7L A;  2XEF A;  1CJW A;  3PB8 X;  1Z8X A;  2OZU A;  3RAM A;  3TE4 A;  3FJU A;  2PR1 A;  2WPW A;  2FVG A;  4ZY2 A;  3VAT A;  4AG9 A;  1YR0 A;  4MCP A;  4X2T A;  1LCP A;  4JXQ A;  2ZEM A;  3FB3 A;  4PV6 A;  4YWY A;  1LAP A;  2JBK A;  2WZN A;  5AG7 A;  3KAS A;  1YRE A;  4A94 A;  1H8L A;  1Z8W A;  3T9Y A;  3RZA A;  1ELL P;  3GYA A;  2ZEO A;  1JQG A;  2PIZ A;  2EBJ A;  4P6Y A;  5AG5 A;  3ZJ0 A;  1XBU A;  2Q43 A;  4CAX A;  4XPL A;  5AG6 A;  4EME A;  2PVV A;  2Q4V A;  2ZXV A;  5DWM A;  5IB0 A;  1XMB A;  2G3T A;  1VGY A;  1EE3 P;  4B6Z A;  2FXF A;  2Z11 A;  2ZOG A;  2B58 A;  3S6F A;  1UFH A;  1XEB A;  3D7F A;  3JVN A;  1XFO A;  1YSJ A;  4IF5 A;  3PB7 X;  1HDQ A;  2XEI A;  3NH8 A;  1XOV A;  1ELM P;  4UFV A;  4F8Z A;  3PP9 A;  2FL4 A;  4Y49 C;  1IYL A;  1VHE A;  1XJO A;  4B11 A;  1Z2L A;  3P2H A;  2EK9 A;  3RO0 A;  4UEF A;  5ELY A;  4P44 A;  3VWE A;  5J8F A;  2PC1 A;  2BSW A;  3H8E A;  5HVH A;  4IUS A;  4ZYQ A;  3QB8 A;  3SI2 A;  3DNS A;  2NYQ A;  4DYO A;  2QEC A;  3FIX A;  3IO1 A;  4P10 A;  1CG2 A;  2GIV A;  2ZEH A;  4Q7A A;  4KOR A;  2PJ9 A;  4F9U A;  1TF9 A;  2ARH A;  2QML A;  3G3S A;  2CXA A;  5ISV A;  1YVK A;  3EO4 A;  2WYR A;  1NE9 A;  3KR5 A;  1CX8 A;  5LYI A;  2RB7 A;  3B8G A;  4M6I A;  3IWE A;  4PSX A;  4X3R A;  1ZG7 A;  1CPX A;  1ZLH A;  4NGR A;  4R6T A;  4AXV A;  3D68 A;  4PXD A;  3CXP A;  3SJE A;  4EWT A;  3GLJ A;  4MHY A;  2KCW A;  1TKJ A;  4OC5 A;  1GYT A;  6CPA A;  2CNS A;  5LYF A;  4OC4 A;  1FNO A;  2P6F A;  2V8D A;  4B5O A;  5EMI A;  4B5P A;  5LYL A;  1XE4 A;  4KVX A;  4CRZ B;  2DEA A;  1R43 A;  4IK2 A;  3TT2 A;  3FRM A;  4E2A A;  5D29 A;  1YGH A;  4GS4 A;  4MFZ A;  2V77 A;  3S6K A;  4A37 A;  3LAC A;  2CNT A;  2ZW6 A;  4OAE A;  2VQY A;  4R3L A;  2QYV A;  3SJG A;  4ONU A;  2JDC A;  3WC5 A;  5K8M A;  2CY2 A;  4CAE A;  4A39 A;  2CNM A;  2DPS A;  5K8P A;  1IID A;  2REF A;  4MI4 A;  3SI1 A;  1VIX A;  3W6S A;  1S7F A;  2FSR A;  2Q04 A;  2BEI A;  1DTD A;  2YNC C;  4IHM A;  3S9M A;  4AVA A;  3D3S A;  5HVF A;  1NMT A;  3R9F A;  3V8I A;  1TF8 A;  2V8H A;  1F2P A;  2Z3L A;  5KTD A;  4O23 A;  5AGE A;  2ANP A;  2BL1 A;  1BPN A;  2FE7 A;  3D8P A;  2CTB A;  4LUA A;  3SXN A;  3PGP A;  4MBU A;  4NGP A;  4XPD C;  2ZW7 A;  2B3U A;  4JJX A;  1KUX A;  2OH1 A;  2Q44 A;  1LAN A;  2D4P A;  3MRU A;  3CXQ A;  5F49 A;  1Z8T A;  2CTC A;  2OR4 A;  3N7Z A;  5LRK A;  1GHE A;  3GY9 A;  1BLL E;  2PR8 A;  3D66 A;  4PPZ A;  5D8N A;  2PSW A;  2R8V A;  4ZX8 A;  3B35 A;  3BJ8 A;  4JYW A;  1IGB A;  1MK4 A;  4R57 A;  4HNX B;  1Y9K A;  4GM5 A;  1M4L A;  2JBJ A;  2Z3K A;  3SI0 A;  3SXO A;  5DWN A;  3TTH A;  2VL1 A;  4B14 A;  1YQE A;  1LOK A;  2B5G A;  2BUE A;  1YLE A;  1YVO A;  2GAN A;  2K5T A;  2O53 A;  3DSB A;  3D7G A;  4JWP A;  4RI1 A;  2ZPA A;  2OOT A;  5JPH A;  1M44 A;  4WWV A;  4MXU A;  1Q7L A;  1Z5R A;  4UBR A;  3QAY A;  1VHO A;  2J8R A;  3PBB A;  4PK3 A;  1PUA A;  5A27 A;  4CGN A;  2C6P A;  3NE7 A;  3B3V A;  4OC1 A;  7CPA A;  1IU8 A;  1R3N A;  1OZP A;  2EVN A;  3FMC A;  4OID A;  4CYP A;  4AG7 A;  3D7D A;  4TWE A;  4FD6 A;  4FD4 A;  1J4J A;  2P0W A;  3CPX A;  3KQX A;  5G22 A;  5F47 A;  2AFO A;  4P4E A;  5JGF A;  2Z3N A;  4B12 A;  3E0K A;  2NMT A;  3IC1 A;  1F2O A;  4UIA A;  3JTK A;  3N5F A;  4KOW A;  1QST A;  5IV0 A;  3A9L A;  4NF1 A;  4OAD A;  1TIQ A;  4R9M A;  2PJ4 A;  4B5P B;  3DDD A;  1KWM A;  2GU2 A;  2ZW5 A;  2PJB A;  4JZ0 A;  3D2P A;  4KSF A;  2DPT A;  2NSM A;  4KSI A;  1QSR A;  4AB7 A;  4P4F A;  4UCM A;  4CAF A;  4H89 A;  4NGS A;  4MY0 A;  4UFX A;  5AG4 A;  2IJZ A;  1OBR A;  4KOT A;  3WC6 A;  1YME A;  3JUW A;  3RBU A;  3C26 A;  3TOB A;  3F5B A;  4ORF A;  5H86 A;  1CPS A;  2GLF A;  3K9U A;  1PYT B;  2VEZ A;  4Z65 A;  4PK2 A;  3B2Y A;  3H5Z A;  4MFK A;  4P4D A;  1U6M A;  2PJ7 A;  4M6H A;  5JQ4 A;  2ZEF A;  5EBV A;  1IB1 E;  3NE8 A;  3PFO A;  4X5K A;  4HNY B;  3VH9 A;  4U9Y A;  4MCR A;  2PIY A;  2WPX A;  3EXN A;  2Q7B A;  1TKF A;  2VZZ A;  2YGW A;  4W9Y A;  3S9L A;  4NSQ A;  4M6G A;  2Q51 A;  3B3S A;  4GXH A;  2ZW4 A;  4FD5 A;  2Z0Z A;  4UA3 A;  4FUU A;  2WUU A;  4HPS A;  1TXR A;  4RS2 A;  3GUX A;  2CIJ A;  2ZEL A;  1M1D A;  2OB0 A;  5HVG A;  4QC6 A;  4UCN A;  4OP4 A;  4OC2 A;  1ZG9 A;  1AUG A;  4F0X A;  4LX9 A;  2B5G B;  1ZO0 A;  1XMT A; 
#chains in the Genus database with same CATH homology
 4DNC A;  2IL4 A;  4U5Y A;  2B3V A;  1BO4 A;  4MHD A;  1K4J A;  1M4D A;  4J3G A;  1RXT A;  2HV2 A;  4CRY B;  3IU1 A;  4KSA A;  4C2Z A;  1M4I A;  3EC4 A;  1WWZ A;  1Z4R A;  2OZG A;  3DR6 A;  4CYO A;  1R57 A;  2O28 A;  4ZGY B;  2FIA A;  1Q2D A;  2I79 A;  2Q4Y A;  2REE A;  2WSA A;  4F0Y A;  4C2Y A;  4F6A A;  3TO6 A;  1VKC A;  4MJ8 A;  5I0C A;  2P6G A;  3CXS A;  4JXR A;  3TO7 A;  2JEV A;  4Q38 A;  1Z4E A;  2A4N A;  3VWD A;  2AJ6 A;  4YGO A;  3SHP A;  1B87 A;  2C27 A;  4KUB A;  4A30 A;  1IYK A;  3KKW A;  2P6E A;  5H84 A;  3I3G A;  3LOD A;  2GE3 A;  2JLM A;  1KZF A;  2YND A;  4CYN A;  3FBU A;  2VBQ A;  3IGR A;  1L0C A;  4YRH A;  5EC4 A;  2FS5 A;  3D2M A;  3WR7 A;  2R98 A;  2B4D B;  4M85 A;  1KUV A;  1KUY A;  2VZY A;  3ZZI A;  5J8C A;  4A2Z A;  1IIC A;  4KZT A;  4CS0 B;  1NSL A;  2PRB A;  4KOX A;  1MJB A;  1Q2C A;  4U9Z A;  4KLW A;  4II9 A;  2X7B A;  4A95 A;  3TOA A;  2H5M A;  4CGL A;  4R87 A;  4KS9 A;  1I21 A;  4E0A A;  5FVJ A;  4HNW B;  4Q36 A;  2ATR A;  1QSM A;  2Z3O A;  1WK4 A;  2B4B A;  3MGD A;  5F46 A;  1FY7 A;  4M3S A;  3S6H A;  5KTA A;  2Z10 A;  4B10 A;  4A32 A;  4PSW A;  1LRZ A;  5G21 A;  1CM0 A;  2D4O A;  4EVY A;  2Q0Y A;  2PQ8 A;  2HUZ A;  3I9S A;  4KOU A;  2OZH A;  4QVT A;  1PU9 A;  3GKR A;  1S60 A;  3IWG A;  3TCV A;  4C2X A;  1M4G A;  4XNH B;  4NXY A;  5E96 A;  3RYO A;  4A31 A;  2F5I A;  1YX0 A;  4R3K A;  1Q2Y A;  3F8K A;  5G20 A;  2B4D A;  1V0C A;  4MFP A;  2QIR A;  1XF8 A;  2Z3P A;  1S5K A;  3R95 A;  4KVO E;  4CYQ A;  3LD2 A;  1RO5 A;  1ON0 A;  1S7K A;  5KTC A;  1XIX A;  4C7H A;  4CGM A;  4KLV A;  1QSN A;  4A33 A;  1S3Z A;  2HQY A;  3FNC A;  3EFA A;  1YK3 A;  2YNE A;  4QBJ A;  1I12 A;  3FYN A;  4NCZ A;  5BWA B;  4MY3 A;  2JDD A;  4MFJ A;  3IU2 A;  4KVM E;  1P0H A;  3S6G A;  1S7N A;  2DXQ A;  4XNH C;  2FCK A;  2J8M A;  4CGO A;  4CAW A;  2FIW A;  5IX3 A;  3W91 A;  2AE6 A;  3OWC A;  4H6U A;  1QSO A;  2G0B A;  4XPD B;  5G1Z A;  4JLY A;  2VXK A;  3EY5 A;  2EUI A;  4XPK A;  3PZJ A;  4QB9 A;  5C88 A;  3TO9 A;  1Y9W A;  2FT0 A;  1P4N A;  1Z9U A;  2R7H A;  4B13 A;  4KOV A;  4HKF A;  1SQH A;  2I00 A;  3P2F A;  4L8A A;  3T90 A;  4K30 A;  4CGP A;  1BOB A;  3W6X A;  2Z3M A;  5HH1 A;  1Y7R A;  4FD7 A;  4BBH A;  4KOY A;  4CAV A;  2R1I A;  4MFL A;  2RC4 A;  4UCP A;  3BLN A;  4BMH A;  3BJ7 A;  3F0A A;  4L89 A;  3G8W A;  5CNP A;  1I1D A;  2G3A A;  3UY5 A;  4AVB A;  2Y0M A;  3DR8 A;  4UWJ A;  4OLL A;  4C7I A;  3R1K A;  2PDO A;  1MJ9 A;  3H4Q A;  4H6Z A;  2B5G B;  4KUA A;  4KOS A;  4QUS A;  4MFQ A;  4C68 A;  1MJA A;  2VI7 A;  2YNC A;  2OU2 A;  5C82 A;  3R9E A;  5HMN A;  4NEX A;  4AVC A;  3R96 A;  4ZBG A;  5GCN A;  4UFW A;  2J8N A;  4E8O A;  1N71 A;  1VHS A;  4YFJ A;  4I49 A;  4JD6 A;  1B6B A;  4Y49 B;  5A28 A;  4UWI A;  5F48 A;  3R9G A;  3FXT A;  1S7L A;  1CJW A;  2OZU A;  3TE4 A;  2PR1 A;  2WPW A;  4AG9 A;  1YR0 A;  4JXQ A;  3FB3 A;  4PV6 A;  5AG7 A;  1YRE A;  3T9Y A;  3GYA A;  5AG5 A;  3ZJ0 A;  4CAX A;  4XPL A;  5AG6 A;  2Q4V A;  2ZXV A;  5DWM A;  5IB0 A;  2G3T A;  2FXF A;  2Z11 A;  3S6F A;  2B58 A;  1UFH A;  1XEB A;  3JVN A;  4IF5 A;  4UFV A;  3PP9 A;  2FL4 A;  4Y49 C;  1IYL A;  4B11 A;  3P2H A;  5J8F A;  3VWE A;  2PC1 A;  2BSW A;  4IUS A;  3QB8 A;  3DNS A;  2QEC A;  3FIX A;  2GIV A;  4KOR A;  2ARH A;  2QML A;  3G3S A;  2CXA A;  5ISV A;  1YVK A;  3EO4 A;  1NE9 A;  3B8G A;  3IWE A;  4PSX A;  3CXP A;  2KCW A;  2CNS A;  2P6F A;  4B5O A;  4B5P A;  1XE4 A;  4KVX A;  4CRZ B;  3TT2 A;  4E2A A;  3FRM A;  1YGH A;  4GS4 A;  4MFZ A;  3S6K A;  2CNT A;  2ZW6 A;  4OAE A;  2VQY A;  4R3L A;  4ONU A;  2JDC A;  2CY2 A;  4CAE A;  2CNM A;  2DPS A;  1IID A;  2REF A;  4MI4 A;  3W6S A;  1S7F A;  2FSR A;  2Q04 A;  2BEI A;  2YNC C;  4AVA A;  3D3S A;  1NMT A;  3R9F A;  3V8I A;  2Z3L A;  5KTD A;  5AGE A;  2BL1 A;  2FE7 A;  3D8P A;  4LUA A;  3SXN A;  3PGP A;  4MBU A;  4XPD C;  2ZW7 A;  2B3U A;  4JJX A;  1KUX A;  2OH1 A;  2Q44 A;  2D4P A;  3CXQ A;  5F49 A;  3N7Z A;  1GHE A;  3GY9 A;  3TFY A;  2PR8 A;  2PSW A;  2R8V A;  3BJ8 A;  1MK4 A;  4R57 A;  4HNX B;  1Y9K A;  3SXO A;  2Z3K A;  5DWN A;  3TTH A;  4B14 A;  2B5G A;  2BUE A;  2GAN A;  1YLE A;  1YVO A;  2K5T A;  3DSB A;  4JWP A;  4RI1 A;  5JPH A;  2ZPA A;  1M44 A;  4UBR A;  2J8R A;  4PK3 A;  1PUA A;  5A27 A;  4CGN A;  3NE7 A;  1OZP A;  2EVN A;  4CYP A;  4AG7 A;  4FD6 A;  4FD4 A;  1J4J A;  2P0W A;  5G22 A;  5F47 A;  2Z3N A;  4B12 A;  3E0K A;  2NMT A;  3JTK A;  5IV0 A;  4KOW A;  1QST A;  3A9L A;  4NF1 A;  4OAD A;  1TIQ A;  4R9M A;  4B5P B;  3DDD A;  2ZW5 A;  4KSF A;  3D2P A;  2DPT A;  4AB7 A;  1QSR A;  4UCM A;  4CAF A;  4H89 A;  4UFX A;  4MY0 A;  5AG4 A;  4KOT A;  3JUW A;  3C26 A;  3TOB A;  3F5B A;  4ORF A;  5H86 A;  3K9U A;  2VEZ A;  4PK2 A;  3H5Z A;  4MFK A;  1U6M A;  5JQ4 A;  5EBV A;  1IB1 E;  4X5K A;  4HNY B;  4U9Y A;  2WPX A;  3EXN A;  2Q7B A;  2VZZ A;  2YGW A;  4NSQ A;  2ZW4 A;  4FD5 A;  2Z0Z A;  4UA3 A;  2WUU A;  4RS2 A;  1M1D A;  2OB0 A;  4QC6 A;  4UCN A;  4F0X A;  4LX9 A;  3QAH A;  1ZO0 A;  1XMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...