5IB0A

Pa4534: acetyl coa complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
137
structure length
137
Chain Sequence
MQLRSVIAADHPALFALWSRTPGIRLRAEDAYPFFLAYLQRNPGLSLLVETEGEVIACLMAGHDGRRGYLQHLVVDPGYRGLGLARRMLDEVLARLAREGIGKSHVFVLDAAEEAQAFWRAQSDWERRKDIQVFSTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein PA4534
publication title Structure of PA4534
rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
molecule tags Transferase
total genus 36
structure length 137
sequence length 137
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ib0A00
4KVXA 1WWZA 1LRZA 2I00A 4GS4A 2VEZA 1PU9A 4ORFA 4ONUA 3JUWA 2P6EA 4KOTA 3TO6A 2REFA 1M4IA 2Z11A 2REEA 2GIVA 3QAHA 4CAVA 2B4DB 2ZW5A 1XE4A 5EBVA 1QSOA 1IIDA 2HUZA 2J8NA 2PQ8A 5HH1A 4B5OA 1QSMA 4DNCA 1MJAA 2CNTA 1S7KA 4OADA 2QMLA 3W6SA 4NSQA 2BUEA 3TTHA 4U9ZA 4U5YA 2JEVA 4MI4A 1XEBA 3SHPA 3P2FA 4HNYB 2HV2A 1XF8A 2BL1A 3BLNA 4PSWA 2Q44A 2B4DA 4PK3A 3W91A 2WPWA 4XNHB 4KZTA 4EVYA 2R98A 2Q4YA 3FRMA 2B4BA 2EUIA 3CXSA 2GANA 5CNPA 3PZJA 5KTCA 4Y49B 2CNSA 4LX9A 4CS0B 3OWCA 4KUBA 4J3GA 4KORA 4AG7A 1BOBA 1YVOA 1UFHA 1U6MA 4JJXA 5KTDA 3UY5A 3DNSA 4HNWB 1YR0A 4FD6A 2ZW6A 2Q7BA 2FS5A 4I49A 4NF1A 4II9A 1QSNA 2FE7A 4AG9A 3P2HA 2FIAA 1MJBA 4RS2A 1Q2DA 1NMTA 1M44A 4QVTA 3EC4A 4YRHA 3TOAA 5JQ4A 2G3TA 2WPXA 4E2AA 4MY3A 5IV0A 4JLYA 4Y49C 3LD2A 4MHDA 3TFYA 3R95A 2D4OA 2JDDA 3N7ZA 4JXRA 2P6FA 1VKCA 1M4GA 4HNXB 3TO7A 4F6AA 4BMHA 4FD5A 4KOUA 2RC4A 3F0AA 4KVOE 4NEXA 5DWNA 1S5KA 2OZUA 2ZW4A 3ZZIA 1KUVA 1IYKA 2AJ6A 2DXQA 4XPDB 3PP9A 4QB9A 4B5PB 1NE9A 2ZXVA 2NMTA 3E0KA 1RO5A 4JXQA 1IYLA 3T90A 1XIXA 2AE6A 3FXTA 1B6BA 4ZBGA 3GY9A 1Z9UA 2K5TA 3FYNA 4R87A 1YK3A 4NXYA 4MBUA 4KLWA 4MY0A 2OB0A 1S60A 4R3LA 1B87A 3MGDA 3R1KA 4AVBA 3DSBA 4B5PA 2HQYA 2G0BA 2VZZA 3EO4A 3G8WA 3WR7A 2KCWA 4IF5A 4L8AA 3KKWA 4IUSA 1NSLA 1Z4EA 5GCNA 3R96A 3TE4A 3R9EA 4XPDC 4PSXA 4L89A 2PR1A 3R9GA 1MK4A 5HMNA 1VHSA 3C26A 4H6ZA 1KUYA 4QBJA 3IGRA 2FL4A 3SXNA 4FD4A 3TCVA 3PGPA 4JD6A 2CY2A 4X5KA 4OLLA 2VBQA 3I9SA 4R57A 1KUXA 1QSRA 4AB7A 2FSRA 3T9YA 2H5MA 1XMTA 3ZJ0A 1I1DA 3DR8A 1S7FA 2Q0YA 4KOVA 1N71A 3B8GA 1S7NA 3V8IA 3EFAA 5EC4A 2PDOA 2GE3A 3GYAA 3K9UA 3S6HA 1IICA 5E96A 1YGHA 2FIWA 2ZPAA 4PK2A 1Q2YA 2I79A 4FD7A 1TIQA 4KVME 4PV6A 2G3AA 2VXKA 2VQYA 2ARHA 3TT2A 4UWIA 2OZGA 5H84A 2BEIA 2QECA 3DR6A 5F49A 1YVKA 4KOXA 1Z4RA 3FIXA 4QUSA 2JLMA 4CAXA 1I21A 4JWPA 4QC6A 1PUAA 3QB8A 5F48A 3DDDA 5F47A 3G3SA 1Y7RA 4CRYB 3D2PA 1M1DA 1YX0A 2FXFA 2OH1A 5DWMA 2EVNA 4KOYA 3JVNA 4H89A 1FY7A 4RI1A 3LODA 1R57A 4K30A 2OZHA 3D8PA 3RYOA 1L0CA 3CXQA 2Q4VA 1ON0A 1M4DA 2CNMA 1SQHA 2Z0ZA 3H4QA 4CAWA 3TO9A 4HKFA 5ISVA 3D3SA 5FVJA 4AVCA 5J8FA 3VWDA 3I3GA 2C27A 2PC1A 2PSWA 3FNCA 3IWGA 2QIRA 2B5GA 2Y0MA 4LUAA 3F5BA 2B3VA 4KOSA 1BO4A 5JPHA 1Y9WA 2D4PA 3VWEA 3EXNA 5KTAA 1J4JA 4YFJA 4UBRA 1V0CA 4MJ8A 5H86A 3TOBA 3CXPA 2P0WA 2Q04A 1QSTA 4H6UA 4M3SA 3GKRA 4KOWA 4OAEA 2J8RA 2PR8A 4U9YA 4E8OA 4UA3A 5C88A 1IB1E 5IB0A 1OZPA 1P0HA 4AVAA 3S6GA 2FT0A 1S7LA 3S6FA 2B58A 4YGOA 2B3UA 2J8MA 2JDCA 3FB3A 2X7BA 2IL4A 3SXOA 2R1IA 3FBUA 1Y9KA 4CRZB 3BJ8A 2ZW7A 3F8KA 1YREA 2FCKA 5J8CA 5F46A 1RXTA 4KLVA 3R9FA 2R7HA 1S3ZA 1GHEA 5C82A 1MJ9A 3EY5A 2O28A 2F5IA 2A4NA 3D2MA 2VZYA 4R3KA 4KUAA 3W6XA 1Q2CA 3NE7A 2BSWA 4UWJA 4M85A 1CM0A 4XPLA 2P6GA 4NCZA 5I0CA 1I12A 4R9MA 1KZFA 4E0AA 3S6KA 1CJWA 1P4NA 4XPKA 2PRBA 5IX3A 2OU2A 4XNHC 2R8VA 2VI7A 1YLEA 1WK4A 2B5GB 4F0YA 3BJ7A 1K4JA 2Z10A 2ATRA
chains in the Genus database with same CATH superfamily
4KVXA 2WZNA 2Z3PA 2ZEFA 4C2ZA 2AFXA 2PVWA 1WWZA 1LRZA 1TF8A 2I00A 4GS4A 2ZELA 2VEZA 3H8EA 5AG5A 1HEEA 4OMEA 1PU9A 4CPAA 2C6PA 4NJRA 4ORFA 4ONUA 3JUWA 3RZAA 2P6EA 4IK2A 1BPMA 2HC9A 4KOTA 3TO6A 4F8ZA 2WSAA 5HVGA 2OR4A 1CP6A 3NA6A 2REFA 1M4IA 4P4BA 4P4EA 2Z11A 2REEA 2QVPA 4PQAA 1YSJA 2XEGA 2ZEGA 5J1QA 2GIVA 2PVVA 3QAHA 4A2ZA 4C2XA 4CAVA 2ZEEA 2B4DB 3KHZA 4DJLA 3FEDA 4LQGA 1OBRA 2ZW5A 4UF4A 4Q7AA 1XE4A 1F2PA 3JTKA 5EBVA 1QSOA 4JYWA 2AFOA 3KASA 2JEWA 3RBUA 4A37A 1IIDA 2EWBA 2HUZA 5I4MA 5LYLA 4MCPA 5F09A 4ZX9A 2J8NA 2PQ8A 5HH1A 4B5OA 5BWAB 1TKHA 2V8VA 1QSMA 3FMCA 4B14A 2WYRA 4KSFA 4DNCA 1MJAA 3PBEA 2CNTA 3MN8A 4R6TA 5JM6A 4NGRA 1S7KA 4GXHA 4OADA 1ARLA 1YW4A 2QMLA 3LWUA 1R43A 2JBKA 5DS0A 3WC6A 2XEJA 2Z3KA 4MXUA 5A27A 3W6SA 1CG2A 3JRUA 2EK8A 2YNDA 2BUEA 4NSQA 4P6YA 3TTHA 4U9ZA 4U5YA 2JEVA 1ELLP 4MI4A 2IMOA 1XEBA 3SHPA 3P2FA 4HNYB 2Z3NA 2CIJA 2HV2A 4JZ0A 3WT4A 1XF8A 4AXVA 2BL1A 3BLNA 1ZLIA 5ELYA 4R76A 5LRGA 3HUVA 3S9MA 4PSWA 2AFSA 2GLFA 2GREA 2Q44A 4LQ6A 4Q36A 2B4DA 4PK3A 3W91A 4FBEA 2PJ8A 4ZY2A 2ZEPA 3D7FA 4OP4A 1AYEA 2WPWA 4XNHB 4C68A 4MCQA 1LAMA 4KZTA 4EVYA 2R98A 2Q4YA 3FRMA 2B4BA 2EUIA 2G9DA 3SI2A 3ISXA 3CXSA 2DF5A 3L2NA 2DPSA 3DLJA 2GANA 2JBJA 5CNPA 3PZJA 5KTCA 4Y49B 2HB6A 2CNSA 4LX9A 4CS0B 2RFHA 3OWCA 5IB9A 4OC1A 4KUBA 4J3GA 4KORA 4AG7A 1TKJA 5AG7A 1BOBA 1YVOA 1UFHA 1U6MA 3B35A 4JJXA 5KTDA 3PEIA 3UY5A 3DNSA 4CGMA 1FT7A 3NH4A 3VATA 4HNWB 1YR0A 1XJOA 4RUHA 3SI1A 4FD6A 4RN7A 4DUKA 2PJ2A 2ZW6A 2Z10A 3DGVA 4YU9A 2Q7BA 3SJFA 2FVGA 4ZY0A 3TC8A 3KQZA 2FS5A 3V38A 4I49A 3PBBA 4NF1A 4II9A 3A9LA 2PIZA 7CPAA 3KZWA 2ZENA 5K8NA 4UCNA 1Y0YA 1QSNA 3B3SA 2PJBA 5THWA 2FE7A 4B11A 4AG9A 4EMEA 4UFXA 3IIBA 3P2HA 2ABZA 3I1UA 2BOAA 4MHPA 2FIAA 1MJBA 1BPNA 3PRTA 5LYDA 3B3VA 4RS2A 1Q2DA 4B13A 3FECA 1LOKA 1NMTA 4OIWA 2GFQA 4IAVA 4CGPA 1M44A 4QVTA 3EC4A 4YRHA 3TOAA 4UEZA 4B12A 5JQ4A 1CP7A 3KQXA 1YQEA 2G3TA 2WPXA 3GB0A 4MFPA 3B3TA 4E2AA 4MY3A 5IV0A 4JLYA 2IQ6A 3B2YA 3NH8A 4Y49C 3LD2A 3D68A 4MHDA 4ZGYB 1ZG8A 2PJCA 4X3RA 3TFYA 4PXBA 3R95A 4FUUA 2D4OA 2C6CA 1CX8A 4A39A 1Z2LA 1H8LA 2JDDA 3N7ZA 3D67A 4JXRA 2P6FA 2CF4A 3VH9A 1VKCA 4MHYA 1M4GA 3K9TA 4R7MA 2PJ0A 4HNXB 3SJGA 3B3WA 3TO7A 4F6AA 1EE3P 4BMHA 4NGPA 4KSAA 3PB6X 4FD5A 4CGLA 4MFLA 4KOUA 2RC4A 3F0AA 4KVOE 4NEXA 4Q38A 1YW6A 1UWYA 5DWNA 1S5KA 4BD9A 1GYTA 2OZUA 3ISZA 2ZW4A 2RB7A 4F9UA 1BAVA 2GU2A 1KUVA 2ZOFA 3D7GA 3ZZIA 4A32A 1IYKA 2AJ6A 2DXQA 4XPDB 3IC1A 3SJEA 3PP9A 4QB9A 4B5PB 4PXDA 2EO8A 1FNOA 5CPAA 1BLLE 1NE9A 2ZXVA 3BHXA 1RTQA 2OOTA 1Z5RA 1JWQA 1X12A 3GIUA 2NMTA 3E0KA 4A95A 1RO5A 4JXQA 1IYLA 3T90A 1VHEA 1XIXA 2AE6A 4FWUA 5JGFA 1R3NA 1B6BA 3FXTA 1PCAA 4ZBGA 4NGNA 3GY9A 2PJ4A 4OIDA 4GM5A 6CPAA 3CPAA 1Z9UA 1DTDA 2K5TA 2V8GA 3FYNA 4FAIA 4NJQA 4MRIA 2ANPA 4R87A 1YK3A 3H8FA 4NXYA 3IJ3A 3IU2A 4KLWA 2IJZA 4MBUA 4MY0A 4KS9A 3KR5A 2OB0A 1S60A 4R3LA 1B87A 3IFEA 3MGDA 3R1KA 2C1CA 4PXCA 3LACA 4AVBA 3DSBA 4EFDA 3KGQA 4C7IA 4B5PA 2HQYA 4F9VA 2G0BA 2VZZA 3EO4A 3G8WA 3LMSA 4P44A 3WR7A 2KCWA 5LYFA 2Z3MA 4IF5A 4L8AA 4B10A 3S9LA 3KKWA 2Q43A 3WABA 1ZG9A 3D66A 1QQ9A 4IUSA 1NSLA 1F2OA 1Z4EA 1NSAA 5GCNA 3R96A 3FVLA 2DPTA 3TE4A 4UFWA 3R9EA 1TKFA 4XPDC 5G22A 4PSXA 2YNCA 3KI9A 3B3CA 3NH5A 5K8MA 4CYPA 3KHXA 4L89A 2PR1A 1TXRA 3R9GA 1MK4A 4UCPA 4MFJA 4WJBA 4ZY1A 5HMNA 1VHSA 3C26A 2WUUA 4H6ZA 1KUYA 5AGEA 4QBJA 3IGRA 2FL4A 3SXNA 4FD4A 3TCVA 4CYNA 1IOIA 3PGPA 3K2KA 3PB8X 4JD6A 2CY2A 1AMPA 4OLLA 4X5KA 3PB4X 1Z8WA 3IU1A 2VBQA 3I9SA 4R57A 1KUXA 2YNEA 3FX6A 1QSRA 4AB7A 2FSRA 4X2TA 1A2ZA 3PB9X 3BXMA 5LYIA 3T9YA 2H5MA 1XMTA 3ZJ0A 1I1DA 3DR8A 1S7FA 2Q0YA 4M6IA 4KOVA 4NGSA 1N71A 4CGNA 1YMEA 4NGQA 3FF3A 3B8GA 2XEIA 1S7NA 3V8IA 2Z3LA 4A30A 3EFAA 1X10A 1XBUA 4G1PA 2PDOA 5EC4A 2PIYA 2V8DA 4P45A 3PFOA 2GE3A 4UEEA 2Q4ZA 3GYAA 2YGWA 3K9UA 3S6HA 2Z3OA 4P4JA 4OKOA 1IICA 5E96A 4P4IA 1YGHA 4P4FA 2FIWA 4MHZA 4HPSA 1LAPA 4MHNA 2ZPAA 4PK2A 4TNUA 1Q2YA 2I3CA 2I79A 3NFZA 4FD7A 5AG4A 1TIQA 2V77A 4KVME 4PV6A 4OC4A 2G3AA 2VXKA 5JH9A 2VQYA 4NGTA 2ARHA 3TT2A 2F7VA 4UWIA 4A31A 2NYQA 3RAMA 2OZGA 1LFWA 4PXEA 3KL9A 2F8HA 1Y7EA 4OC0A 5H84A 4MFKA 4UIBA 2BEIA 2QECA 3DR6A 5F49A 1YVKA 4KOXA 1PYTB 1Z4RA 3FIXA 4MFQA 4QUSA 2JLMA 4CAXA 1I21A 2PJ3A 4UFVA 3PB7X 4JWPA 1F57A 1IOFA 4QC6A 1PUAA 2QJ8A 3QB8A 5F48A 3DDDA 4WWVA 4Z65A 5F47A 1XRYA 1QMUA 1Y7RA 3G3SA 3D7DA 4MMOA 1M4LA 4M6HA 4CRYB 3D2PA 1M1DA 2ZEOA 1YX0A 2FXFA 2OH1A 4O23A 4CAFA 5DWMA 2EVNA 4KOYA 3JVNA 5K8OA 3CDXA 3RO0A 4H89A 4OC2A 1FY7A 4RI1A 2CTCA 3IO1A 3H8GA 3LODA 4NFRA 1R57A 3RNZA 2O4HA 4K30A 2OZHA 3D8PA 3D4UA 1TF9A 5K8PA 2O53A 5HVFA 3RYOA 1LANA 1L0CA 2CXAA 2J9AA 3FEEA 1ARMA 2Q4VA 3CXQA 1ON0A 4MCSA 4OC3A 1M4DA 4A33A 4KSIA 2CNMA 2VL1A 3HLPA 1SQHA 2Z0ZA 3H4QA 4CAWA 2Q51A 4HKFA 4PPZA 3TO9A 5ISVA 2C6GA 3N5FA 3D3SA 4B6ZA 5FVJA 4AVCA 8CPAA 2EBJA 5J8FA 1ELMP 5LRJA 3VWDA 4W9YA 3D7HA 3I3GA 1CBXA 1ZO0A 2C27A 5LRKA 2PC1A 2PSWA 3FNCA 2GLJA 3IWGA 2QIRA 2ZEMA 4OC5A 3QNVA 2B5GA 5G1ZA 2Y0MA 2ZEHA 3FH4A 4LUAA 3F5BA 4TWEA 5AG6A 4ONWA 4ZYQA 2B3VA 4F0XA 1HDUA 2AFWA 3CPXA 2V8HA 4KOSA 1Z8TA 3BI1A 1BO4A 5JPHA 1Y9WA 2D4PA 3VWEA 1HDQA 2PE3A 3EXNA 5HXDA 5KTAA 4YFJA 4UBRA 1V0CA 4MJ8A 1IGBA 1ZG7A 2XEFA 5H86A 1Q7LA 3TOBA 3CXPA 2P0WA 3IWEA 2Q04A 1QSTA 4H6UA 3WC5A 3BI0A 2NSMA 1LCPA 1AUGA 3GKRA 4KOWA 4M3SA 1IU8A 4OAEA 3TX8A 4ZX8A 2J8RA 2AFMA 3QAYA 4BINA 2PR8A 4U9YA 4E8OA 4UA3A 5C88A 1IB1E 5IB0A 2PJ7A 1XOVA 5D8NA 1Y0RA 2PCUA 1OZPA 5D29A 4IHMA 1P0HA 4ZI6A 4AVAA 3S9NA 3S6GA 2FT0A 1S7LA 3S6FA 1CPXA 2B58A 4YGOA 2B3UA 2J8MA 5CBMA 3V7ZA 4A38A 4DYOA 2JDCA 3FB3A 2X7BA 2Q7SA 2IL4A 3GLJA 3SXOA 2R1IA 3B7IA 4P4DA 3FBUA 2PJ6A 1Y9KA 4CRZB 3BJ8A 2ODFA 2YNCC 2ZW7A 3F8KA 1YREA 2FCKA 5J8CA 2DEAA 5F46A 4MFZA 1RXTA 1XFOA 2PJ5A 2ZEDA 4KLVA 4YWYA 2R7HA 3R9FA 1XMBA 2BCOA 1S3ZA 2PJ1A 4CAEA 2AFUA 1GHEA 3MRUA 3IWWA 2BO9A 5C82A 1MJ9A 1KWMA 1VGYA 2PRQA 4EWTA 3EY5A 4BBHA 4A94A 1IY7A 4H2KA 2CTBA 2O28A 3SJXA 4R8FA 3IEHA 5HVHA 1DE4C 4CGOA 1Z8XA 2F5IA 2PJAA 2A4NA 4UIAA 3SI0A 3D2MA 2VZYA 2PJ9A 4R3KA 3GUXA 4KUAA 4UCMA 1Q2CA 3W6XA 2EK9A 4X8IA 2AFZA 4MCRA 3VARA 3NE7A 4CYOA 1CPSA 2POKA 3T8WA 2BSWA 4M6GA 1VIXA 4UWJA 4M85A 4C7HA 3CT9A 1CM0A 4XPLA 4C2YA 4UEFA 1YLOA 2P6GA 4NCZA 1Z8LA 1I12A 3H5ZA 5I0CA 3PFEA 4R9MA 1VHOA 5EMIA 1ZLHA 1KZFA 4E0AA 3NE8A 3S6KA 1CJWA 3CZXA 1P4NA 4P10A 4K3NA 4XPKA 2PRBA 1JQGA 5A28A 2ZOGA 5IX3A 2OU2A 2QYVA 4NGMA 4XNHC 5G20A 2R8VA 2VI7A 5G21A 3FJUA 1YLEA 1WK4A 2B5GB 4F0YA 3BJ7A 3KR4A 4CYQA 1K4JA 1J4JA 3WC7A 2ATRA
chains in the Genus database with same CATH topology
4KVXA 2Z3PA 4C2ZA 1WWZA 1LRZA 2I00A 4GS4A 5AG5A 2VEZA 1PU9A 4ORFA 4ONUA 3JUWA 2P6EA 4KOTA 3TO6A 2WSAA 2REFA 1M4IA 2Z11A 2REEA 2GIVA 3QAHA 4A2ZA 4C2XA 4CAVA 2B4DB 2ZW5A 1XE4A 3JTKA 5EBVA 1QSOA 1IIDA 2HUZA 2J8NA 2PQ8A 5HH1A 4B5OA 5BWAB 1QSMA 4B14A 4KSFA 4DNCA 1MJAA 2CNTA 1S7KA 4OADA 2QMLA 2Z3KA 5A27A 3W6SA 2YNDA 2BUEA 4NSQA 3TTHA 4U9ZA 4U5YA 2JEVA 4MI4A 1XEBA 3SHPA 3P2FA 4HNYB 2Z3NA 2HV2A 1XF8A 2BL1A 3BLNA 4PSWA 2Q44A 4Q36A 2B4DA 4PK3A 3W91A 2WPWA 4XNHB 4C68A 4KZTA 4EVYA 2R98A 2Q4YA 3FRMA 2B4BA 2EUIA 3CXSA 2DPSA 2GANA 5CNPA 3PZJA 5KTCA 4Y49B 2CNSA 4LX9A 4CS0B 3OWCA 4KUBA 4J3GA 4KORA 4AG7A 5AG7A 1BOBA 1YVOA 1UFHA 1U6MA 4JJXA 5KTDA 3UY5A 3DNSA 4CGMA 4HNWB 1YR0A 4FD6A 2ZW6A 2Q7BA 2FS5A 4I49A 4NF1A 4II9A 3A9LA 4UCNA 1QSNA 2FE7A 4B11A 4AG9A 4UFXA 3P2HA 2FIAA 1MJBA 4RS2A 1Q2DA 4B13A 1NMTA 4CGPA 1M44A 4QVTA 3EC4A 4YRHA 3TOAA 4B12A 5JQ4A 2G3TA 2WPXA 4MFPA 4E2AA 4MY3A 5IV0A 4JLYA 4Y49C 3LD2A 4MHDA 4ZGYB 3TFYA 3R95A 2D4OA 2JDDA 3N7ZA 4JXRA 2P6FA 1VKCA 1M4GA 4HNXB 3TO7A 4F6AA 4BMHA 4KSAA 4CGLA 4FD5A 4MFLA 4KOUA 2RC4A 3F0AA 4KVOE 4NEXA 4Q38A 5DWNA 1S5KA 2OZUA 2ZW4A 3ZZIA 1KUVA 4A32A 1IYKA 2AJ6A 2DXQA 4XPDB 3PP9A 4QB9A 4B5PB 1NE9A 2ZXVA 2NMTA 3E0KA 4A95A 1RO5A 4JXQA 1IYLA 3T90A 1XIXA 2AE6A 3FXTA 1B6BA 4ZBGA 3GY9A 1Z9UA 2K5TA 3FYNA 4R87A 1YK3A 4NXYA 3IU2A 4KLWA 4MBUA 4MY0A 4KS9A 2OB0A 1S60A 4R3LA 1B87A 3MGDA 3R1KA 4AVBA 3DSBA 4C7IA 4B5PA 2HQYA 2G0BA 2VZZA 3EO4A 3G8WA 3WR7A 2KCWA 4IF5A 2Z3MA 4L8AA 4B10A 3KKWA 4IUSA 1NSLA 1Z4EA 5GCNA 3R96A 2DPTA 3TE4A 4UFWA 3R9EA 4XPDC 5G22A 4PSXA 2YNCA 4CYPA 4L89A 2PR1A 3R9GA 1MK4A 4UCPA 4MFJA 5HMNA 1VHSA 3C26A 2WUUA 4H6ZA 1KUYA 5AGEA 4QBJA 3IGRA 2FL4A 3SXNA 4FD4A 3TCVA 4CYNA 3PGPA 4JD6A 2CY2A 4X5KA 4OLLA 3IU1A 2VBQA 3I9SA 4R57A 1KUXA 2YNEA 1QSRA 4AB7A 2FSRA 3T9YA 2H5MA 1XMTA 3ZJ0A 1I1DA 3DR8A 1S7FA 2Q0YA 4KOVA 1N71A 4CGNA 3B8GA 1S7NA 3V8IA 2Z3LA 4A30A 3EFAA 5EC4A 2PDOA 2GE3A 3GYAA 2YGWA 3K9UA 3S6HA 2Z3OA 1IICA 5E96A 1YGHA 2FIWA 2ZPAA 4PK2A 1Q2YA 2I79A 4FD7A 5AG4A 1TIQA 4KVME 4PV6A 2G3AA 2VXKA 2VQYA 2ARHA 3TT2A 4UWIA 4A31A 2OZGA 5H84A 4MFKA 2BEIA 2QECA 3DR6A 5F49A 1YVKA 4KOXA 1Z4RA 3FIXA 4MFQA 4QUSA 2JLMA 4CAXA 1I21A 4UFVA 4JWPA 4QC6A 1PUAA 3QB8A 5F48A 3DDDA 5F47A 3G3SA 1Y7RA 4CRYB 3D2PA 1M1DA 1YX0A 2FXFA 2OH1A 4CAFA 5DWMA 2EVNA 4KOYA 3JVNA 4H89A 1FY7A 4RI1A 3LODA 1R57A 4K30A 2OZHA 3D8PA 3RYOA 1L0CA 2CXAA 3CXQA 2Q4VA 1ON0A 1M4DA 4A33A 2CNMA 1SQHA 2Z0ZA 3H4QA 4CAWA 3TO9A 4HKFA 5ISVA 3D3SA 5FVJA 4AVCA 5J8FA 3VWDA 3I3GA 2C27A 1ZO0A 2PC1A 2PSWA 3FNCA 3IWGA 2QIRA 2B5GA 5G1ZA 2Y0MA 4LUAA 3F5BA 5AG6A 2B3VA 4F0XA 4KOSA 1BO4A 5JPHA 1Y9WA 2D4PA 3VWEA 3EXNA 5KTAA 1J4JA 4YFJA 4UBRA 1V0CA 4MJ8A 5H86A 3TOBA 3CXPA 2P0WA 3IWEA 2Q04A 1QSTA 4H6UA 4M3SA 3GKRA 4KOWA 4OAEA 2J8RA 2PR8A 4U9YA 4E8OA 4UA3A 5C88A 1IB1E 5IB0A 1OZPA 1P0HA 4AVAA 3S6GA 2FT0A 1S7LA 3S6FA 2B58A 4YGOA 2B3UA 2J8MA 2JDCA 3FB3A 2X7BA 2IL4A 3SXOA 2R1IA 3FBUA 1Y9KA 4CRZB 3BJ8A 2ZW7A 2YNCC 3F8KA 1YREA 2FCKA 5J8CA 5F46A 4MFZA 1RXTA 4KLVA 3R9FA 2R7HA 1S3ZA 4CAEA 1GHEA 5C82A 1MJ9A 3EY5A 4BBHA 2O28A 4CGOA 2F5IA 2A4NA 3D2MA 2VZYA 4R3KA 4KUAA 4UCMA 1Q2CA 3W6XA 3NE7A 4CYOA 2BSWA 4UWJA 4M85A 4C7HA 1CM0A 4XPLA 4C2YA 2P6GA 4NCZA 5I0CA 1I12A 3H5ZA 4R9MA 1KZFA 4E0AA 3S6KA 1CJWA 1P4NA 4XPKA 2PRBA 5A28A 5IX3A 2OU2A 5G20A 4XNHC 2R8VA 2VI7A 5G21A 1YLEA 1WK4A 2B5GB 4F0YA 3BJ7A 4CYQA 1K4JA 2Z10A 2ATRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KVX A;  1WWZ A;  1LRZ A;  2I00 A;  4GS4 A;  2VEZ A;  1PU9 A;  4ORF A;  4ONU A;  3JUW A;  2P6E A;  4KOT A;  3TO6 A;  2REF A;  1M4I A;  2Z11 A;  2REE A;  2GIV A;  3QAH A;  4CAV A;  2B4D B;  2ZW5 A;  1XE4 A;  5EBV A;  1QSO A;  1IID A;  2HUZ A;  2J8N A;  2PQ8 A;  5HH1 A;  4B5O A;  1QSM A;  4DNC A;  1MJA A;  2CNT A;  1S7K A;  4OAD A;  2QML A;  3W6S A;  4NSQ A;  2BUE A;  3TTH A;  4U9Z A;  4U5Y A;  2JEV A;  4MI4 A;  1XEB A;  3SHP A;  3P2F A;  4HNY B;  2HV2 A;  1XF8 A;  2BL1 A;  3BLN A;  4PSW A;  2Q44 A;  2B4D A;  4PK3 A;  3W91 A;  2WPW A;  4XNH B;  4KZT A;  4EVY A;  2R98 A;  2Q4Y A;  3FRM A;  2B4B A;  2EUI A;  3CXS A;  2GAN A;  5CNP A;  3PZJ A;  5KTC A;  4Y49 B;  2CNS A;  4LX9 A;  4CS0 B;  3OWC A;  4KUB A;  4J3G A;  4KOR A;  4AG7 A;  1BOB A;  1YVO A;  1UFH A;  1U6M A;  4JJX A;  5KTD A;  3UY5 A;  3DNS A;  4HNW B;  1YR0 A;  4FD6 A;  2ZW6 A;  2Q7B A;  2FS5 A;  4I49 A;  4NF1 A;  4II9 A;  1QSN A;  2FE7 A;  4AG9 A;  3P2H A;  2FIA A;  1MJB A;  4RS2 A;  1Q2D A;  1NMT A;  1M44 A;  4QVT A;  3EC4 A;  4YRH A;  3TOA A;  5JQ4 A;  2G3T A;  2WPX A;  4E2A A;  4MY3 A;  5IV0 A;  4JLY A;  4Y49 C;  3LD2 A;  4MHD A;  3TFY A;  3R95 A;  2D4O A;  2JDD A;  3N7Z A;  4JXR A;  2P6F A;  1VKC A;  1M4G A;  4HNX B;  3TO7 A;  4F6A A;  4BMH A;  4FD5 A;  4KOU A;  2RC4 A;  3F0A A;  4KVO E;  4NEX A;  5DWN A;  1S5K A;  2OZU A;  2ZW4 A;  3ZZI A;  1KUV A;  1IYK A;  2AJ6 A;  2DXQ A;  4XPD B;  3PP9 A;  4QB9 A;  4B5P B;  1NE9 A;  2ZXV A;  2NMT A;  3E0K A;  1RO5 A;  4JXQ A;  1IYL A;  3T90 A;  1XIX A;  2AE6 A;  3FXT A;  1B6B A;  4ZBG A;  3GY9 A;  1Z9U A;  2K5T A;  3FYN A;  4R87 A;  1YK3 A;  4NXY A;  4MBU A;  4KLW A;  4MY0 A;  2OB0 A;  1S60 A;  4R3L A;  1B87 A;  3MGD A;  3R1K A;  4AVB A;  3DSB A;  4B5P A;  2HQY A;  2G0B A;  2VZZ A;  3EO4 A;  3G8W A;  3WR7 A;  2KCW A;  4IF5 A;  4L8A A;  3KKW A;  4IUS A;  1NSL A;  1Z4E A;  5GCN A;  3R96 A;  3TE4 A;  3R9E A;  4XPD C;  4PSX A;  4L89 A;  2PR1 A;  3R9G A;  1MK4 A;  5HMN A;  1VHS A;  3C26 A;  4H6Z A;  1KUY A;  4QBJ A;  3IGR A;  2FL4 A;  3SXN A;  4FD4 A;  3TCV A;  3PGP A;  4JD6 A;  2CY2 A;  4X5K A;  4OLL A;  2VBQ A;  3I9S A;  4R57 A;  1KUX A;  1QSR A;  4AB7 A;  2FSR A;  3T9Y A;  2H5M A;  1XMT A;  3ZJ0 A;  1I1D A;  3DR8 A;  1S7F A;  2Q0Y A;  4KOV A;  1N71 A;  3B8G A;  1S7N A;  3V8I A;  3EFA A;  5EC4 A;  2PDO A;  2GE3 A;  3GYA A;  3K9U A;  3S6H A;  1IIC A;  5E96 A;  1YGH A;  2FIW A;  2ZPA A;  4PK2 A;  1Q2Y A;  2I79 A;  4FD7 A;  1TIQ A;  4KVM E;  4PV6 A;  2G3A A;  2VXK A;  2VQY A;  2ARH A;  3TT2 A;  4UWI A;  2OZG A;  5H84 A;  2BEI A;  2QEC A;  3DR6 A;  5F49 A;  1YVK A;  4KOX A;  1Z4R A;  3FIX A;  4QUS A;  2JLM A;  4CAX A;  1I21 A;  4JWP A;  4QC6 A;  1PUA A;  3QB8 A;  5F48 A;  3DDD A;  5F47 A;  3G3S A;  1Y7R A;  4CRY B;  3D2P A;  1M1D A;  1YX0 A;  2FXF A;  2OH1 A;  5DWM A;  2EVN A;  4KOY A;  3JVN A;  4H89 A;  1FY7 A;  4RI1 A;  3LOD A;  1R57 A;  4K30 A;  2OZH A;  3D8P A;  3RYO A;  1L0C A;  3CXQ A;  2Q4V A;  1ON0 A;  1M4D A;  2CNM A;  1SQH A;  2Z0Z A;  3H4Q A;  4CAW A;  3TO9 A;  4HKF A;  5ISV A;  3D3S A;  5FVJ A;  4AVC A;  5J8F A;  3VWD A;  3I3G A;  2C27 A;  2PC1 A;  2PSW A;  3FNC A;  3IWG A;  2QIR A;  2B5G A;  2Y0M A;  4LUA A;  3F5B A;  2B3V A;  4KOS A;  1BO4 A;  5JPH A;  1Y9W A;  2D4P A;  3VWE A;  3EXN A;  5KTA A;  1J4J A;  4YFJ A;  4UBR A;  1V0C A;  4MJ8 A;  5H86 A;  3TOB A;  3CXP A;  2P0W A;  2Q04 A;  1QST A;  4H6U A;  4M3S A;  3GKR A;  4KOW A;  4OAE A;  2J8R A;  2PR8 A;  4U9Y A;  4E8O A;  4UA3 A;  5C88 A;  1IB1 E;  5IB0 A;  1OZP A;  1P0H A;  4AVA A;  3S6G A;  2FT0 A;  1S7L A;  3S6F A;  2B58 A;  4YGO A;  2B3U A;  2J8M A;  2JDC A;  3FB3 A;  2X7B A;  2IL4 A;  3SXO A;  2R1I A;  3FBU A;  1Y9K A;  4CRZ B;  3BJ8 A;  2ZW7 A;  3F8K A;  1YRE A;  2FCK A;  5J8C A;  5F46 A;  1RXT A;  4KLV A;  3R9F A;  2R7H A;  1S3Z A;  1GHE A;  5C82 A;  1MJ9 A;  3EY5 A;  2O28 A;  2F5I A;  2A4N A;  3D2M A;  2VZY A;  4R3K A;  4KUA A;  3W6X A;  1Q2C A;  3NE7 A;  2BSW A;  4UWJ A;  4M85 A;  1CM0 A;  4XPL A;  2P6G A;  4NCZ A;  5I0C A;  1I12 A;  4R9M A;  1KZF A;  4E0A A;  3S6K A;  1CJW A;  1P4N A;  4XPK A;  2PRB A;  5IX3 A;  2OU2 A;  4XNH C;  2R8V A;  2VI7 A;  1YLE A;  1WK4 A;  2B5G B;  4F0Y A;  3BJ7 A;  1K4J A;  2Z10 A;  2ATR A; 
#chains in the Genus database with same CATH topology
 4KVX A;  2WZN A;  2Z3P A;  2ZEF A;  4C2Z A;  2AFX A;  2PVW A;  1WWZ A;  1LRZ A;  1TF8 A;  2I00 A;  4GS4 A;  2ZEL A;  2VEZ A;  3H8E A;  5AG5 A;  1HEE A;  4OME A;  1PU9 A;  4CPA A;  2C6P A;  4NJR A;  4ORF A;  4ONU A;  3JUW A;  3RZA A;  2P6E A;  4IK2 A;  1BPM A;  2HC9 A;  4KOT A;  3TO6 A;  4F8Z A;  2WSA A;  5HVG A;  2OR4 A;  1CP6 A;  3NA6 A;  2REF A;  1M4I A;  4P4B A;  4P4E A;  2Z11 A;  2REE A;  2QVP A;  4PQA A;  1YSJ A;  2XEG A;  2ZEG A;  5J1Q A;  2GIV A;  2PVV A;  3QAH A;  4A2Z A;  4C2X A;  4CAV A;  2ZEE A;  2B4D B;  3KHZ A;  4DJL A;  3FED A;  4LQG A;  1OBR A;  2ZW5 A;  4UF4 A;  4Q7A A;  1XE4 A;  1F2P A;  3JTK A;  5EBV A;  1QSO A;  4JYW A;  2AFO A;  3KAS A;  2JEW A;  3RBU A;  4A37 A;  1IID A;  2EWB A;  2HUZ A;  5I4M A;  5LYL A;  4MCP A;  5F09 A;  4ZX9 A;  2J8N A;  2PQ8 A;  5HH1 A;  4B5O A;  5BWA B;  1TKH A;  2V8V A;  1QSM A;  3FMC A;  4B14 A;  2WYR A;  4KSF A;  4DNC A;  1MJA A;  3PBE A;  2CNT A;  3MN8 A;  4R6T A;  5JM6 A;  4NGR A;  1S7K A;  4GXH A;  4OAD A;  1ARL A;  1YW4 A;  2QML A;  3LWU A;  1R43 A;  2JBK A;  5DS0 A;  3WC6 A;  2XEJ A;  2Z3K A;  4MXU A;  5A27 A;  3W6S A;  1CG2 A;  3JRU A;  2EK8 A;  2YND A;  2BUE A;  4NSQ A;  4P6Y A;  3TTH A;  4U9Z A;  4U5Y A;  2JEV A;  1ELL P;  4MI4 A;  2IMO A;  1XEB A;  3SHP A;  3P2F A;  4HNY B;  2Z3N A;  2CIJ A;  2HV2 A;  4JZ0 A;  3WT4 A;  1XF8 A;  4AXV A;  2BL1 A;  3BLN A;  1ZLI A;  5ELY A;  4R76 A;  5LRG A;  3HUV A;  3S9M A;  4PSW A;  2AFS A;  2GLF A;  2GRE A;  2Q44 A;  4LQ6 A;  4Q36 A;  2B4D A;  4PK3 A;  3W91 A;  4FBE A;  2PJ8 A;  4ZY2 A;  2ZEP A;  3D7F A;  4OP4 A;  1AYE A;  2WPW A;  4XNH B;  4C68 A;  4MCQ A;  1LAM A;  4KZT A;  4EVY A;  2R98 A;  2Q4Y A;  3FRM A;  2B4B A;  2EUI A;  2G9D A;  3SI2 A;  3ISX A;  3CXS A;  2DF5 A;  3L2N A;  2DPS A;  3DLJ A;  2GAN A;  2JBJ A;  5CNP A;  3PZJ A;  5KTC A;  4Y49 B;  2HB6 A;  2CNS A;  4LX9 A;  4CS0 B;  2RFH A;  3OWC A;  5IB9 A;  4OC1 A;  4KUB A;  4J3G A;  4KOR A;  4AG7 A;  1TKJ A;  5AG7 A;  1BOB A;  1YVO A;  1UFH A;  1U6M A;  3B35 A;  4JJX A;  5KTD A;  3PEI A;  3UY5 A;  3DNS A;  4CGM A;  1FT7 A;  3NH4 A;  3VAT A;  4HNW B;  1YR0 A;  1XJO A;  4RUH A;  3SI1 A;  4FD6 A;  4RN7 A;  4DUK A;  2PJ2 A;  2ZW6 A;  2Z10 A;  3DGV A;  4YU9 A;  2Q7B A;  3SJF A;  2FVG A;  4ZY0 A;  3TC8 A;  3KQZ A;  2FS5 A;  3V38 A;  4I49 A;  3PBB A;  4NF1 A;  4II9 A;  3A9L A;  2PIZ A;  7CPA A;  3KZW A;  2ZEN A;  5K8N A;  4UCN A;  1Y0Y A;  1QSN A;  3B3S A;  2PJB A;  5THW A;  2FE7 A;  4B11 A;  4AG9 A;  4EME A;  4UFX A;  3IIB A;  3P2H A;  2ABZ A;  3I1U A;  2BOA A;  4MHP A;  2FIA A;  1MJB A;  1BPN A;  3PRT A;  5LYD A;  3B3V A;  4RS2 A;  1Q2D A;  4B13 A;  3FEC A;  1LOK A;  1NMT A;  4OIW A;  2GFQ A;  4IAV A;  4CGP A;  1M44 A;  4QVT A;  3EC4 A;  4YRH A;  3TOA A;  4UEZ A;  4B12 A;  5JQ4 A;  1CP7 A;  3KQX A;  1YQE A;  2G3T A;  2WPX A;  3GB0 A;  4MFP A;  3B3T A;  4E2A A;  4MY3 A;  5IV0 A;  4JLY A;  2IQ6 A;  3B2Y A;  3NH8 A;  4Y49 C;  3LD2 A;  3D68 A;  4MHD A;  4ZGY B;  1ZG8 A;  2PJC A;  4X3R A;  3TFY A;  4PXB A;  3R95 A;  4FUU A;  2D4O A;  2C6C A;  1CX8 A;  4A39 A;  1Z2L A;  1H8L A;  2JDD A;  3N7Z A;  3D67 A;  4JXR A;  2P6F A;  2CF4 A;  3VH9 A;  1VKC A;  4MHY A;  1M4G A;  3K9T A;  4R7M A;  2PJ0 A;  4HNX B;  3SJG A;  3B3W A;  3TO7 A;  4F6A A;  1EE3 P;  4BMH A;  4NGP A;  4KSA A;  3PB6 X;  4FD5 A;  4CGL A;  4MFL A;  4KOU A;  2RC4 A;  3F0A A;  4KVO E;  4NEX A;  4Q38 A;  1YW6 A;  1UWY A;  5DWN A;  1S5K A;  4BD9 A;  1GYT A;  2OZU A;  3ISZ A;  2ZW4 A;  2RB7 A;  4F9U A;  1BAV A;  2GU2 A;  1KUV A;  2ZOF A;  3D7G A;  3ZZI A;  4A32 A;  1IYK A;  2AJ6 A;  2DXQ A;  4XPD B;  3IC1 A;  3SJE A;  3PP9 A;  4QB9 A;  4B5P B;  4PXD A;  2EO8 A;  1FNO A;  5CPA A;  1BLL E;  1NE9 A;  2ZXV A;  3BHX A;  1RTQ A;  2OOT A;  1Z5R A;  1JWQ A;  1X12 A;  3GIU A;  2NMT A;  3E0K A;  4A95 A;  1RO5 A;  4JXQ A;  1IYL A;  3T90 A;  1VHE A;  1XIX A;  2AE6 A;  4FWU A;  5JGF A;  1R3N A;  1B6B A;  3FXT A;  1PCA A;  4ZBG A;  4NGN A;  3GY9 A;  2PJ4 A;  4OID A;  4GM5 A;  6CPA A;  3CPA A;  1Z9U A;  1DTD A;  2K5T A;  2V8G A;  3FYN A;  4FAI A;  4NJQ A;  4MRI A;  2ANP A;  4R87 A;  1YK3 A;  3H8F A;  4NXY A;  3IJ3 A;  3IU2 A;  4KLW A;  2IJZ A;  4MBU A;  4MY0 A;  4KS9 A;  3KR5 A;  2OB0 A;  1S60 A;  4R3L A;  1B87 A;  3IFE A;  3MGD A;  3R1K A;  2C1C A;  4PXC A;  3LAC A;  4AVB A;  3DSB A;  4EFD A;  3KGQ A;  4C7I A;  4B5P A;  2HQY A;  4F9V A;  2G0B A;  2VZZ A;  3EO4 A;  3G8W A;  3LMS A;  4P44 A;  3WR7 A;  2KCW A;  5LYF A;  2Z3M A;  4IF5 A;  4L8A A;  4B10 A;  3S9L A;  3KKW A;  2Q43 A;  3WAB A;  1ZG9 A;  3D66 A;  1QQ9 A;  4IUS A;  1NSL A;  1F2O A;  1Z4E A;  1NSA A;  5GCN A;  3R96 A;  3FVL A;  2DPT A;  3TE4 A;  4UFW A;  3R9E A;  1TKF A;  4XPD C;  5G22 A;  4PSX A;  2YNC A;  3KI9 A;  3B3C A;  3NH5 A;  5K8M A;  4CYP A;  3KHX A;  4L89 A;  2PR1 A;  1TXR A;  3R9G A;  1MK4 A;  4UCP A;  4MFJ A;  4WJB A;  4ZY1 A;  5HMN A;  1VHS A;  3C26 A;  2WUU A;  4H6Z A;  1KUY A;  5AGE A;  4QBJ A;  3IGR A;  2FL4 A;  3SXN A;  4FD4 A;  3TCV A;  4CYN A;  1IOI A;  3PGP A;  3K2K A;  3PB8 X;  4JD6 A;  2CY2 A;  1AMP A;  4OLL A;  4X5K A;  3PB4 X;  1Z8W A;  3IU1 A;  2VBQ A;  3I9S A;  4R57 A;  1KUX A;  2YNE A;  3FX6 A;  1QSR A;  4AB7 A;  2FSR A;  4X2T A;  1A2Z A;  3PB9 X;  3BXM A;  5LYI A;  3T9Y A;  2H5M A;  1XMT A;  3ZJ0 A;  1I1D A;  3DR8 A;  1S7F A;  2Q0Y A;  4M6I A;  4KOV A;  4NGS A;  1N71 A;  4CGN A;  1YME A;  4NGQ A;  3FF3 A;  3B8G A;  2XEI A;  1S7N A;  3V8I A;  2Z3L A;  4A30 A;  3EFA A;  1X10 A;  1XBU A;  4G1P A;  2PDO A;  5EC4 A;  2PIY A;  2V8D A;  4P45 A;  3PFO A;  2GE3 A;  4UEE A;  2Q4Z A;  3GYA A;  2YGW A;  3K9U A;  3S6H A;  2Z3O A;  4P4J A;  4OKO A;  1IIC A;  5E96 A;  4P4I A;  1YGH A;  4P4F A;  2FIW A;  4MHZ A;  4HPS A;  1LAP A;  4MHN A;  2ZPA A;  4PK2 A;  4TNU A;  1Q2Y A;  2I3C A;  2I79 A;  3NFZ A;  4FD7 A;  5AG4 A;  1TIQ A;  2V77 A;  4KVM E;  4PV6 A;  4OC4 A;  2G3A A;  2VXK A;  5JH9 A;  2VQY A;  4NGT A;  2ARH A;  3TT2 A;  2F7V A;  4UWI A;  4A31 A;  2NYQ A;  3RAM A;  2OZG A;  1LFW A;  4PXE A;  3KL9 A;  2F8H A;  1Y7E A;  4OC0 A;  5H84 A;  4MFK A;  4UIB A;  2BEI A;  2QEC A;  3DR6 A;  5F49 A;  1YVK A;  4KOX A;  1PYT B;  1Z4R A;  3FIX A;  4MFQ A;  4QUS A;  2JLM A;  4CAX A;  1I21 A;  2PJ3 A;  4UFV A;  3PB7 X;  4JWP A;  1F57 A;  1IOF A;  4QC6 A;  1PUA A;  2QJ8 A;  3QB8 A;  5F48 A;  3DDD A;  4WWV A;  4Z65 A;  5F47 A;  1XRY A;  1QMU A;  1Y7R A;  3G3S A;  3D7D A;  4MMO A;  1M4L A;  4M6H A;  4CRY B;  3D2P A;  1M1D A;  2ZEO A;  1YX0 A;  2FXF A;  2OH1 A;  4O23 A;  4CAF A;  5DWM A;  2EVN A;  4KOY A;  3JVN A;  5K8O A;  3CDX A;  3RO0 A;  4H89 A;  4OC2 A;  1FY7 A;  4RI1 A;  2CTC A;  3IO1 A;  3H8G A;  3LOD A;  4NFR A;  1R57 A;  3RNZ A;  2O4H A;  4K30 A;  2OZH A;  3D8P A;  3D4U A;  1TF9 A;  5K8P A;  2O53 A;  5HVF A;  3RYO A;  1LAN A;  1L0C A;  2CXA A;  2J9A A;  3FEE A;  1ARM A;  2Q4V A;  3CXQ A;  1ON0 A;  4MCS A;  4OC3 A;  1M4D A;  4A33 A;  4KSI A;  2CNM A;  2VL1 A;  3HLP A;  1SQH A;  2Z0Z A;  3H4Q A;  4CAW A;  2Q51 A;  4HKF A;  4PPZ A;  3TO9 A;  5ISV A;  2C6G A;  3N5F A;  3D3S A;  4B6Z A;  5FVJ A;  4AVC A;  8CPA A;  2EBJ A;  5J8F A;  1ELM P;  5LRJ A;  3VWD A;  4W9Y A;  3D7H A;  3I3G A;  1CBX A;  1ZO0 A;  2C27 A;  5LRK A;  2PC1 A;  2PSW A;  3FNC A;  2GLJ A;  3IWG A;  2QIR A;  2ZEM A;  4OC5 A;  3QNV A;  2B5G A;  5G1Z A;  2Y0M A;  2ZEH A;  3FH4 A;  4LUA A;  3F5B A;  4TWE A;  5AG6 A;  4ONW A;  4ZYQ A;  2B3V A;  4F0X A;  1HDU A;  2AFW A;  3CPX A;  2V8H A;  4KOS A;  1Z8T A;  3BI1 A;  1BO4 A;  5JPH A;  1Y9W A;  2D4P A;  3VWE A;  1HDQ A;  2PE3 A;  3EXN A;  5HXD A;  5KTA A;  4YFJ A;  4UBR A;  1V0C A;  4MJ8 A;  1IGB A;  1ZG7 A;  2XEF A;  5H86 A;  1Q7L A;  3TOB A;  3CXP A;  2P0W A;  3IWE A;  2Q04 A;  1QST A;  4H6U A;  3WC5 A;  3BI0 A;  2NSM A;  1LCP A;  1AUG A;  3GKR A;  4KOW A;  4M3S A;  1IU8 A;  4OAE A;  3TX8 A;  4ZX8 A;  2J8R A;  2AFM A;  3QAY A;  4BIN A;  2PR8 A;  4U9Y A;  4E8O A;  4UA3 A;  5C88 A;  1IB1 E;  5IB0 A;  2PJ7 A;  1XOV A;  5D8N A;  1Y0R A;  2PCU A;  1OZP A;  5D29 A;  4IHM A;  1P0H A;  4ZI6 A;  4AVA A;  3S9N A;  3S6G A;  2FT0 A;  1S7L A;  3S6F A;  1CPX A;  2B58 A;  4YGO A;  2B3U A;  2J8M A;  5CBM A;  3V7Z A;  4A38 A;  4DYO A;  2JDC A;  3FB3 A;  2X7B A;  2Q7S A;  2IL4 A;  3GLJ A;  3SXO A;  2R1I A;  3B7I A;  4P4D A;  3FBU A;  2PJ6 A;  1Y9K A;  4CRZ B;  3BJ8 A;  2ODF A;  2YNC C;  2ZW7 A;  3F8K A;  1YRE A;  2FCK A;  5J8C A;  2DEA A;  5F46 A;  4MFZ A;  1RXT A;  1XFO A;  2PJ5 A;  2ZED A;  4KLV A;  4YWY A;  2R7H A;  3R9F A;  1XMB A;  2BCO A;  1S3Z A;  2PJ1 A;  4CAE A;  2AFU A;  1GHE A;  3MRU A;  3IWW A;  2BO9 A;  5C82 A;  1MJ9 A;  1KWM A;  1VGY A;  2PRQ A;  4EWT A;  3EY5 A;  4BBH A;  4A94 A;  1IY7 A;  4H2K A;  2CTB A;  2O28 A;  3SJX A;  4R8F A;  3IEH A;  5HVH A;  1DE4 C;  4CGO A;  1Z8X A;  2F5I A;  2PJA A;  2A4N A;  4UIA A;  3SI0 A;  3D2M A;  2VZY A;  2PJ9 A;  4R3K A;  3GUX A;  4KUA A;  4UCM A;  1Q2C A;  3W6X A;  2EK9 A;  4X8I A;  2AFZ A;  4MCR A;  3VAR A;  3NE7 A;  4CYO A;  1CPS A;  2POK A;  3T8W A;  2BSW A;  4M6G A;  1VIX A;  4UWJ A;  4M85 A;  4C7H A;  3CT9 A;  1CM0 A;  4XPL A;  4C2Y A;  4UEF A;  1YLO A;  2P6G A;  4NCZ A;  1Z8L A;  1I12 A;  3H5Z A;  5I0C A;  3PFE A;  4R9M A;  1VHO A;  5EMI A;  1ZLH A;  1KZF A;  4E0A A;  3NE8 A;  3S6K A;  1CJW A;  3CZX A;  1P4N A;  4P10 A;  4K3N A;  4XPK A;  2PRB A;  1JQG A;  5A28 A;  2ZOG A;  5IX3 A;  2OU2 A;  2QYV A;  4NGM A;  4XNH C;  5G20 A;  2R8V A;  2VI7 A;  5G21 A;  3FJU A;  1YLE A;  1WK4 A;  2B5G B;  4F0Y A;  3BJ7 A;  3KR4 A;  4CYQ A;  1K4J A;  1J4J A;  3WC7 A;  2ATR A; 
#chains in the Genus database with same CATH homology
 4KVX A;  2Z3P A;  4C2Z A;  1WWZ A;  1LRZ A;  2I00 A;  4GS4 A;  5AG5 A;  2VEZ A;  1PU9 A;  4ORF A;  4ONU A;  3JUW A;  2P6E A;  4KOT A;  3TO6 A;  2WSA A;  2REF A;  1M4I A;  2Z11 A;  2REE A;  2GIV A;  3QAH A;  4A2Z A;  4C2X A;  4CAV A;  2B4D B;  2ZW5 A;  1XE4 A;  3JTK A;  5EBV A;  1QSO A;  1IID A;  2HUZ A;  2J8N A;  2PQ8 A;  5HH1 A;  4B5O A;  5BWA B;  1QSM A;  4B14 A;  4KSF A;  4DNC A;  1MJA A;  2CNT A;  1S7K A;  4OAD A;  2QML A;  2Z3K A;  5A27 A;  3W6S A;  2YND A;  2BUE A;  4NSQ A;  3TTH A;  4U9Z A;  4U5Y A;  2JEV A;  4MI4 A;  1XEB A;  3SHP A;  3P2F A;  4HNY B;  2Z3N A;  2HV2 A;  1XF8 A;  2BL1 A;  3BLN A;  4PSW A;  2Q44 A;  4Q36 A;  2B4D A;  4PK3 A;  3W91 A;  2WPW A;  4XNH B;  4C68 A;  4KZT A;  4EVY A;  2R98 A;  2Q4Y A;  3FRM A;  2B4B A;  2EUI A;  3CXS A;  2DPS A;  2GAN A;  5CNP A;  3PZJ A;  5KTC A;  4Y49 B;  2CNS A;  4LX9 A;  4CS0 B;  3OWC A;  4KUB A;  4J3G A;  4KOR A;  4AG7 A;  5AG7 A;  1BOB A;  1YVO A;  1UFH A;  1U6M A;  4JJX A;  5KTD A;  3UY5 A;  3DNS A;  4CGM A;  4HNW B;  1YR0 A;  4FD6 A;  2ZW6 A;  2Q7B A;  2FS5 A;  4I49 A;  4NF1 A;  4II9 A;  3A9L A;  4UCN A;  1QSN A;  2FE7 A;  4B11 A;  4AG9 A;  4UFX A;  3P2H A;  2FIA A;  1MJB A;  4RS2 A;  1Q2D A;  4B13 A;  1NMT A;  4CGP A;  1M44 A;  4QVT A;  3EC4 A;  4YRH A;  3TOA A;  4B12 A;  5JQ4 A;  2G3T A;  2WPX A;  4MFP A;  4E2A A;  4MY3 A;  5IV0 A;  4JLY A;  4Y49 C;  3LD2 A;  4MHD A;  4ZGY B;  3TFY A;  3R95 A;  2D4O A;  2JDD A;  3N7Z A;  4JXR A;  2P6F A;  1VKC A;  1M4G A;  4HNX B;  3TO7 A;  4F6A A;  4BMH A;  4KSA A;  4CGL A;  4FD5 A;  4MFL A;  4KOU A;  2RC4 A;  3F0A A;  4KVO E;  4NEX A;  4Q38 A;  5DWN A;  1S5K A;  2OZU A;  2ZW4 A;  3ZZI A;  1KUV A;  4A32 A;  1IYK A;  2AJ6 A;  2DXQ A;  4XPD B;  3PP9 A;  4QB9 A;  4B5P B;  1NE9 A;  2ZXV A;  2NMT A;  3E0K A;  4A95 A;  1RO5 A;  4JXQ A;  1IYL A;  3T90 A;  1XIX A;  2AE6 A;  3FXT A;  1B6B A;  4ZBG A;  3GY9 A;  1Z9U A;  2K5T A;  3FYN A;  4R87 A;  1YK3 A;  4NXY A;  3IU2 A;  4KLW A;  4MBU A;  4MY0 A;  4KS9 A;  2OB0 A;  1S60 A;  4R3L A;  1B87 A;  3MGD A;  3R1K A;  4AVB A;  3DSB A;  4C7I A;  4B5P A;  2HQY A;  2G0B A;  2VZZ A;  3EO4 A;  3G8W A;  3WR7 A;  2KCW A;  4IF5 A;  2Z3M A;  4L8A A;  4B10 A;  3KKW A;  4IUS A;  1NSL A;  1Z4E A;  5GCN A;  3R96 A;  2DPT A;  3TE4 A;  4UFW A;  3R9E A;  4XPD C;  5G22 A;  4PSX A;  2YNC A;  4CYP A;  4L89 A;  2PR1 A;  3R9G A;  1MK4 A;  4UCP A;  4MFJ A;  5HMN A;  1VHS A;  3C26 A;  2WUU A;  4H6Z A;  1KUY A;  5AGE A;  4QBJ A;  3IGR A;  2FL4 A;  3SXN A;  4FD4 A;  3TCV A;  4CYN A;  3PGP A;  4JD6 A;  2CY2 A;  4X5K A;  4OLL A;  3IU1 A;  2VBQ A;  3I9S A;  4R57 A;  1KUX A;  2YNE A;  1QSR A;  4AB7 A;  2FSR A;  3T9Y A;  2H5M A;  1XMT A;  3ZJ0 A;  1I1D A;  3DR8 A;  1S7F A;  2Q0Y A;  4KOV A;  1N71 A;  4CGN A;  3B8G A;  1S7N A;  3V8I A;  2Z3L A;  4A30 A;  3EFA A;  5EC4 A;  2PDO A;  2GE3 A;  3GYA A;  2YGW A;  3K9U A;  3S6H A;  2Z3O A;  1IIC A;  5E96 A;  1YGH A;  2FIW A;  2ZPA A;  4PK2 A;  1Q2Y A;  2I79 A;  4FD7 A;  5AG4 A;  1TIQ A;  4KVM E;  4PV6 A;  2G3A A;  2VXK A;  2VQY A;  2ARH A;  3TT2 A;  4UWI A;  4A31 A;  2OZG A;  5H84 A;  4MFK A;  2BEI A;  2QEC A;  3DR6 A;  5F49 A;  1YVK A;  4KOX A;  1Z4R A;  3FIX A;  4MFQ A;  4QUS A;  2JLM A;  4CAX A;  1I21 A;  4UFV A;  4JWP A;  4QC6 A;  1PUA A;  3QB8 A;  5F48 A;  3DDD A;  5F47 A;  3G3S A;  1Y7R A;  4CRY B;  3D2P A;  1M1D A;  1YX0 A;  2FXF A;  2OH1 A;  4CAF A;  5DWM A;  2EVN A;  4KOY A;  3JVN A;  4H89 A;  1FY7 A;  4RI1 A;  3LOD A;  1R57 A;  4K30 A;  2OZH A;  3D8P A;  3RYO A;  1L0C A;  2CXA A;  3CXQ A;  2Q4V A;  1ON0 A;  1M4D A;  4A33 A;  2CNM A;  1SQH A;  2Z0Z A;  3H4Q A;  4CAW A;  3TO9 A;  4HKF A;  5ISV A;  3D3S A;  5FVJ A;  4AVC A;  5J8F A;  3VWD A;  3I3G A;  2C27 A;  1ZO0 A;  2PC1 A;  2PSW A;  3FNC A;  3IWG A;  2QIR A;  2B5G A;  5G1Z A;  2Y0M A;  4LUA A;  3F5B A;  5AG6 A;  2B3V A;  4F0X A;  4KOS A;  1BO4 A;  5JPH A;  1Y9W A;  2D4P A;  3VWE A;  3EXN A;  5KTA A;  1J4J A;  4YFJ A;  4UBR A;  1V0C A;  4MJ8 A;  5H86 A;  3TOB A;  3CXP A;  2P0W A;  3IWE A;  2Q04 A;  1QST A;  4H6U A;  4M3S A;  3GKR A;  4KOW A;  4OAE A;  2J8R A;  2PR8 A;  4U9Y A;  4E8O A;  4UA3 A;  5C88 A;  1IB1 E;  5IB0 A;  1OZP A;  1P0H A;  4AVA A;  3S6G A;  2FT0 A;  1S7L A;  3S6F A;  2B58 A;  4YGO A;  2B3U A;  2J8M A;  2JDC A;  3FB3 A;  2X7B A;  2IL4 A;  3SXO A;  2R1I A;  3FBU A;  1Y9K A;  4CRZ B;  3BJ8 A;  2ZW7 A;  2YNC C;  3F8K A;  1YRE A;  2FCK A;  5J8C A;  5F46 A;  4MFZ A;  1RXT A;  4KLV A;  3R9F A;  2R7H A;  1S3Z A;  4CAE A;  1GHE A;  5C82 A;  1MJ9 A;  3EY5 A;  4BBH A;  2O28 A;  4CGO A;  2F5I A;  2A4N A;  3D2M A;  2VZY A;  4R3K A;  4KUA A;  4UCM A;  1Q2C A;  3W6X A;  3NE7 A;  4CYO A;  2BSW A;  4UWJ A;  4M85 A;  4C7H A;  1CM0 A;  4XPL A;  4C2Y A;  2P6G A;  4NCZ A;  5I0C A;  1I12 A;  3H5Z A;  4R9M A;  1KZF A;  4E0A A;  3S6K A;  1CJW A;  1P4N A;  4XPK A;  2PRB A;  5A28 A;  5IX3 A;  2OU2 A;  5G20 A;  4XNH C;  2R8V A;  2VI7 A;  5G21 A;  1YLE A;  1WK4 A;  2B5G B;  4F0Y A;  3BJ7 A;  4CYQ A;  1K4J A;  2Z10 A;  2ATR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...