4F9VA

Structure of c113a/c136a mutant variant of glycosylated glutaminyl cyclase from drosophila melanogaster
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
307
structure length
307
Chain Sequence
IGSQWRDDEVHFNRTLDSILVPRVVGSRGHQQVREYLVQSLNGLGFQTEVDEFKQRVPVFGELTFANVVGTINPQAQNFLALAAHYDSKYFPNDPGFVGATDSAVPAAILLNTAKTLGAYLQKEFRNRSDVGLMLIFFDGEEAFKEWTDADSVYGSKHLAAKLASKRSGSQAQLAPRNIDRIEVLVLLDLIGARNPKFSSFYENTDGLHSSLVQIEKSLRTAGQLEGNNNMFLSRVSGGLVDDDHRPFLDENVPVLHLVATPFPDVWHTPRDNAANLHWPSIRNFNRVFRNFVYQYLKRHTSPVNLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, hydrolase
molecule keywords CG32412
publication title Crystal Structures of Glutaminyl Cyclases (QCs) from Drosophila melanogaster Reveal Active Site Conservation between Insect and Mammalian QCs.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 107
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4f9vA00
4NGNA 2BO9A 1YMEA 2PCUA 2AFMA 2EK8A 4P4FA 3CT9A 4W9YA 1Z5RA 4P4DA 2CIJA 3D7FA 3BI1A 1FT7A 5K8NA 3GUXA 4OP4A 4A37A 2PJ4A 3MRUA 2CF4A 3BXMA 4P45A 1CBXA 2V77A 2ANPA 3WC6A 3T8WA 3NFZA 3PB4X 1R43A 2V8DA 3K2KA 4R76A 5K8OA 3IWWA 2XEFA 4OC2A 1TKFA 4OIDA 3MN8A 2PJ0A 1F2OA 3WC7A 2NYQA 3DLJA 3TC8A 3FF3A 3NA6A 1LOKA 3I1UA 2JEWA 2I3CA 1FNOA 1LAPA 4FWUA 2AFUA 2CTBA 2PJBA 3KASA 3D68A 3FH4A 4WJBA 2ZEHA 1UWYA 2IJZA 4IK2A 2OOTA 1ZLIA 2PJ1A 4FAIA 2ZELA 3N5FA 1YW6A 2PJ5A 2ZEEA 4AXVA 2GLJA 1ARMA 3PBBA 1QMUA 1F57A 3NH4A 2PIYA 3VH9A 4OC1A 5JM6A 1AYEA 4X3RA 4NGSA 4YWYA 3S9LA 1IGBA 5CBMA 1YSJA 3PRTA 1VHEA 2O53A 4LQGA 2DEAA 4DUKA 3B3CA 3KZWA 3KI9A 2C1CA 3HLPA 1XFOA 2VL1A 3H8GA 5DS0A 2PJ8A 4NJRA 1ZG9A 3SJXA 3FEEA 1NSAA 4FBEA 4B6ZA 1TXRA 4R8FA 3B3WA 4KSIA 5LYDA 2ABZA 2PVVA 3WABA 2AFXA 3CDXA 1BAVA 4OC0A 4OC3A 1VGYA 1JQGA 1HDUA 4P4EA 5HVGA 1LCPA 3FVLA 2F8HA 1VHOA 3SI2A 4MHZA 4UIAA 4ZX9A 5LRJA 4A38A 2IQ6A 2IMOA 4NGQA 5LRGA 1LAMA 1VIXA 4EFDA 1CP7A 2POKA 2AFZA 3ISZA 1Z2LA 1OBRA 1LANA 3KL9A 2ZEPA 4UIBA 1Y0RA 3LWUA 2PJ2A 4EWTA 5CPAA 4A94A 3GB0A 4TNUA 1ELMP 3PFOA 4OKOA 1RTQA 2PJ7A 2Q43A 1XMBA 3IJ3A 3FECA 2EK9A 2WZNA 4ZYQA 2PJ9A 2HB6A 3BHXA 1XRYA 2PVWA 4MHYA 4ONWA 4F9UA 8CPAA 2JBJA 3KHZA 5JH9A 4DJLA 1TF9A 2JBKA 3JRUA 2XEJA 4MCPA 3CPAA 4ZY1A 5IB9A 4MCSA 4P4IA 4P10A 4PQAA 2ZOGA 5HVFA 1CX8A 4FUUA 5LRKA 4IHMA 4YU9A 2PJAA 4NFRA 3RBUA 4P4BA 2ZOFA 4OC5A 2C6GA 2ZENA 4ZX8A 4DYOA 1KWMA 5ELYA 4UEEA 3ISXA 1BPMA 1CG2A 2ZEGA 1XJOA 3D67A 4K3NA 4MMOA 3KQXA 4P6YA 1AMPA 4CPAA 1TKJA 1HEEA 2ZEDA 5HXDA 2ZEOA 1XBUA 5K8MA 3SJGA 2ZEFA 3IFEA 3IEHA 4BD9A 3S9MA 4RUHA 4UEFA 4NJQA 2GU2A 3BI0A 2PE3A 3HUVA 1ARLA 2FVGA 4Z65A 3SJFA 2EWBA 2C6CA 2BOAA 4X2TA 1DE4C 3PB8X 1QQ9A 4NGTA 3B35A 2CTCA 2PIZA 3FJUA 3B3TA 5D29A 3KR5A 2F7VA 1PCAA 1CPXA 2QYVA 3RZAA 3IO1A 1CP6A 3FEDA 4MHPA 3SJEA 1Y7EA 2J9AA 1HDQA 3PFEA 1PYTB 6CPAA 3D66A 4O23A 1IY7A 1R3NA 2GREA 2ZEMA 2Q51A 1ZG7A 3SI0A 4NGRA 5I4MA 2PJ3A 5F09A 3H8FA 1ELLP 4P44A 1ZG8A 3D4UA 4ZY2A 5JGFA 4OMEA 3V7ZA 1TKHA 4MHNA 1YLOA 2WYRA 3PB7X 3NH5A 2G9DA 3CPXA 3D7GA 3DGVA 4H2KA 4JYWA 4MXUA 3VARA 3KR4A 3K9TA 4PPZA 3B3VA 5D8NA 4PXCA 4MRIA 4UF4A 3IIBA 3WT4A 3NH8A 4F9VA 2HC9A 2XEIA 2NSMA 4R6TA 4Q7AA 3LMSA 5LYLA 4X8IA 2AFWA 3GLJA 1M4LA 5J1QA 5K8PA 1EE3P 3KGQA 2QVPA 4MCRA 4OC4A 1YW4A 2BCOA 2AFSA 2O4HA 4WWVA 1BPNA 1Y0YA 5THWA 5HVHA 3FMCA 3PBEA 3L2NA 3VATA 4MCQA 2OR4A 4EMEA 2V8VA 3KQZA 4PXBA 4F8ZA 1Q7LA 3PEIA 2V8HA 4ZY0A 3PB9X 1GYTA 2GLFA 2PJ6A 3RAMA 2PRQA 3SI1A 4JZ0A 2XEGA 1F2PA 1LFWA 3IC1A 3FX6A 2AFOA 1Z8LA 3TX8A 3KHXA 5LYFA 1BLLE 1ZLHA 1H8LA 4PXEA 4IAVA 4OIWA 4ZI6A 4R7MA 3WC5A 7CPAA 4PXDA 4UEZA 4P4JA 2QJ8A 3D7HA 3V38A 3B7IA 2PJCA 4TWEA 4A39A 3H8EA 3B3SA 4G1PA 3S9NA 4NGMA 3PB6X 3QNVA 1DTDA 2RFHA 5LYIA 2Q4ZA 2V8GA 2C6PA 1TF8A 4NGPA 4GM5A 2RB7A 3B2YA 1CPSA 3D7DA
chains in the Genus database with same CATH superfamily
3D2PA 2PR8A 3KKWA 4HNYB 4NGNA 1ON0A 2BO9A 2Z3OA 1YMEA 2JDDA 2PCUA 3DR6A 1YK3A 3MGDA 2AFMA 1RO5A 1IB1E 4LX9A 2EK8A 4OLLA 4P4FA 3CT9A 4NEXA 2ZW6A 3G3SA 4W9YA 1QSNA 4B13A 1TIQA 3JUWA 4MFZA 5G21A 1Z5RA 2OZUA 1PU9A 2WSAA 5KTCA 4OADA 4P4DA 1YGHA 4KZTA 4C2ZA 1YVOA 2CIJA 3D7FA 2OU2A 1Y9WA 1FT7A 3BI1A 4UCNA 3UY5A 5K8NA 1KUYA 5IB0A 3IU1A 2GFQA 2VZZA 3GUXA 5AG5A 3S6HA 4OP4A 4A37A 4CAEA 2PJ4A 3MRUA 3F5BA 2CF4A 4JD6A 2KCWA 3BXMA 5CNPA 3QAHA 4P45A 2BSWA 1CBXA 2V77A 2ANPA 3IU2A 3WC6A 3T8WA 3NFZA 3BJ7A 2CNMA 3TO9A 3PB4X 1R43A 2V8DA 3DSBA 3K2KA 3WR7A 5H84A 1IOIA 1M4DA 1CJWA 4R76A 3IWWA 4MY3A 4F0YA 2BUEA 5K8OA 2XEFA 1KUVA 1YLEA 2FSRA 4B10A 2P6FA 4OC2A 4YRHA 4KOYA 4MFJA 1TKFA 4OIDA 3TE4A 5HH1A 3MN8A 2PJ0A 3TCVA 1M4GA 2REEA 1F2OA 2FXFA 3WC7A 3VWDA 4KVOE 2I79A 2NYQA 4MFLA 3CXPA 1RXTA 3DLJA 3TC8A 4CGNA 3FF3A 3NA6A 1I12A 4BMHA 4A2ZA 4CRYB 1LOKA 2JEWA 2I3CA 3I1UA 1FNOA 1LAPA 4FWUA 5J8FA 4CAWA 2AFUA 2CNSA 2CTBA 2PJBA 3KASA 5AG7A 2D4OA 2PR1A 4XNHB 5EMIA 5H86A 4JXQA 3D68A 3FH4A 4WJBA 1KUXA 5E96A 2J8RA 2ZEHA 5DWNA 4XPLA 2FCKA 1UWYA 4NF1A 1P4NA 2IJZA 4QC6A 4C7HA 4IK2A 4CYPA 2OOTA 1ZLIA 2B5GB 2GANA 3JTKA 1NSLA 2PJ1A 3S6GA 4FAIA 2ZXVA 1A2ZA 4OAEA 2ZELA 3N5FA 1YW6A 4A32A 2PJ5A 2ZEEA 1U6MA 4U9ZA 4KOVA 4AXVA 4QUSA 4C2YA 3FBUA 2GLJA 1ARMA 3PBBA 3TO6A 1QMUA 1F57A 2VBQA 3NH4A 4E8OA 2FE7A 2PIYA 2JLMA 3VH9A 1UFHA 2G3AA 1IU8A 3D2MA 1AYEA 2ZW5A 1I1DA 4KSFA 4OC1A 4X3RA 5GCNA 4NGSA 3T90A 4YWYA 3S9LA 1IGBA 4B5PA 4EVYA 5CBMA 1YSJA 4NSQA 3FNCA 3PRTA 1VHEA 2O53A 4QB9A 1S7KA 2DEAA 4LQGA 4IF5A 4DUKA 3B3CA 4FD7A 4HKFA 3KZWA 3R95A 5LYLA 2DF5A 2C1CA 3KI9A 3HLPA 4JJXA 1K4JA 3LACA 1XFOA 2OZHA 2VL1A 1WK4A 2J8NA 4R3KA 3H8GA 5DS0A 3R9GA 3GIUA 2PJ8A 4NJRA 1ZG9A 4UFXA 3SJXA 2CNTA 2Q7SA 1NSAA 3FEEA 4FBEA 4B6ZA 1TXRA 4R8FA 3B3WA 4KUAA 4KVME 4KSIA 5LYDA 1GHEA 4UFVA 4GXHA 4MHDA 1YX0A 3FRMA 2J8MA 4AVCA 4R57A 4E0AA 2ABZA 2AJ6A 2PVVA 2I00A 1S7NA 1XF8A 2AFXA 2Z3PA 3CDXA 3LD2A 3WABA 1BAVA 1XMTA 3ZJ0A 4OC0A 4E2AA 2Z0ZA 3DDDA 2VI7A 4OC3A 1VGYA 4KOUA 1JQGA 1HDUA 4P4EA 5HVGA 1LCPA 3FVLA 2F8HA 4CGMA 3IGRA 1VHOA 3SI2A 4XPDB 4MHZA 4UIAA 4ZX9A 5LRJA 4QBJA 4A38A 2YGWA 1YVKA 2IQ6A 2IMOA 3W91A 4NGQA 5LRGA 1LAMA 1VIXA 4HPSA 4XNHC 4EFDA 1CP7A 3SHPA 2POKA 2AFZA 1Z8XA 3ISZA 1J4JA 1Z2LA 1OBRA 3NE8A 3PP9A 1LANA 4MY0A 1B6BA 4Q36A 3KL9A 4L8AA 2Z11A 4CAVA 4PK3A 1YREA 4JLYA 2ZEPA 3SXOA 1M44A 4UIBA 1Y0RA 3LWUA 2PJ2A 1FY7A 5ISVA 2PC1A 5CPAA 2RC4A 1Q2DA 4RN7A 4EWTA 4A94A 5IV0A 3GB0A 2Q4VA 4J3GA 1ELMP 3PFOA 4TNUA 4OKOA 1RTQA 2PJ7A 4CGPA 2Q43A 2B58A 2Z3LA 5G20A 3TOBA 1XMBA 3IJ3A 3FECA 1IYKA 2EK9A 4R87A 3BLNA 4BBHA 2WZNA 2B4BA 4ZYQA 2PJ9A 2VEZA 2FS5A 2HB6A 5KTAA 3BHXA 1XRYA 2PVWA 4MHYA 4ONWA 4F9UA 8CPAA 3FYNA 3LODA 2JBJA 4CYQA 3KHZA 5JPHA 5JH9A 4UFWA 3P2FA 4DJLA 2QECA 1TF9A 4CAFA 2AE6A 2JBKA 3JRUA 2XEJA 3FIXA 3K9UA 4MCPA 3CPAA 4ZY1A 1Z9UA 4MCSA 5IB9A 4MJ8A 3D8PA 3SXNA 4P4IA 2R1IA 4P10A 4PQAA 5JQ4A 2YNCC 2ZOGA 2ZPAA 4H6UA 5A28A 5HVFA 1CX8A 1Y7RA 2FL4A 3DR8A 3I3GA 4ZGYB 2QMLA 4FUUA 1VHSA 5LRKA 5AG6A 3QB8A 2R7HA 3G8WA 4IHMA 4KS9A 1QSOA 4NCZA 3R96A 2BEIA 1S5KA 2ODFA 4YU9A 2PJAA 2ATRA 4M6IA 4NFRA 4JWPA 4QVTA 3S6FA 5EBVA 4JXRA 4P4BA 2PRBA 3RBUA 4YFJA 4B12A 1XOVA 2JDCA 2ZOFA 2C6GA 3NE7A 4LUAA 4OC5A 2EUIA 2ZENA 4ZX8A 3T9YA 2Q04A 3VWEA 4DYOA 1KWMA 4UA3A 5ELYA 5F46A 4KLWA 1XIXA 1KZFA 3ISXA 4UEEA 1BPMA 1CG2A 2ZEGA 1XJOA 3D67A 4K3NA 3EY5A 3F8KA 4MMOA 4KOTA 1S60A 2F5IA 1R57A 3KQXA 4P6YA 1AMPA 3CZXA 4CPAA 4C7IA 1TKJA 1HEEA 2ZEDA 5HXDA 2ZEOA 1XBUA 2WUUA 4L89A 1VKCA 5K8MA 2P0WA 4KUBA 2Y0MA 3SJGA 2ZEFA 3IFEA 2YNEA 2OB0A 3IEHA 4BD9A 3S9MA 3H4QA 1S7LA 2G0BA 4UEFA 2VZYA 3RYOA 4RUHA 1WWZA 2Q0YA 2B4DB 3EFAA 4Y49B 4NJQA 2GU2A 3BI0A 2P6GA 5A27A 2H5MA 1BO4A 2PE3A 3H5ZA 3HUVA 1ARLA 2FVGA 3CXSA 4FD4A 4CGLA 4DNCA 1I21A 2OZGA 4FD5A 3F0AA 3SJFA 2EWBA 4Z65A 2C6CA 2BOAA 4X2TA 2Q44A 5F49A 3RO0A 4AG7A 3TTHA 5G1ZA 1DE4C 1Z8WA 2K5TA 1M4IA 3PB8X 1QQ9A 3FB3A 4NGTA 3B35A 2CTCA 2C27A 2PIZA 3FJUA 2CXAA 3B3TA 2WPXA 4PSXA 3DNSA 4H6ZA 5D29A 1Y9KA 4ZBGA 3KR5A 1Q2CA 3N7ZA 4X5KA 1YQEA 4KOWA 2F7VA 1PCAA 1CPXA 2QYVA 2VXKA 3IWEA 3RZAA 2EO8A 3IO1A 1YR0A 1B87A 1CP6A 3FEDA 4MHPA 1QSMA 3SJEA 1IYLA 1NMTA 1Y7EA 2ZW7A 5JM6A 3EXNA 2J9AA 4HNXB 3R9FA 1HDQA 4U9YA 3PFEA 1PYTB 6CPAA 3P2HA 2DPTA 3D66A 4PK2A 4B5PB 4A31A 2PDOA 4M6HA 1SQHA 1XEBA 2EBJA 4M3SA 4O23A 4XPKA 1IY7A 1R3NA 2GREA 2IL4A 2ZEMA 1IIDA 1S3ZA 2Q51A 1ZG7A 3SI0A 4UCPA 4NGRA 2CY2A 3R9EA 5I4MA 2GE3A 2PJ3A 5F09A 5F48A 1L0CA 3H8FA 4CAXA 1ELLP 4CRZB 4P44A 4PSWA 2VQYA 1ZG8A 3D4UA 4MI4A 4ZY2A 5JGFA 4KSAA 4OMEA 3V7ZA 5EC4A 1TKHA 1NE9A 5FVJA 3W6XA 4MHNA 1YLOA 2WYRA 1IICA 2B5GA 3PB7X 4UBRA 4B5OA 1Z4EA 3NH5A 2G9DA 1X12A 3CPXA 2GIVA 3I9SA 3R1KA 3D7GA 3DGVA 1MK4A 4H2KA 4AG9A 4JYWA 4MXUA 3VARA 3GY9A 1M1DA 3KR4A 3K9TA 2FIWA 2Z3KA 4PPZA 4KLVA 4F0XA 4B14A 3A9LA 1Z4RA 1QSTA 4RI1A 3B3VA 2B3VA 5D8NA 1ZO0A 4Y49C 4KOXA 2A4NA 4PXCA 4MBUA 5J8CA 3IWGA 4MRIA 4UF4A 2Q4YA 3IIBA 4MFQA 4PV6A 3S6KA 3WT4A 3FXTA 3NH8A 4F9VA 2HC9A 3TFYA 2XEIA 4U5YA 2NSMA 4Q38A 4C68A 4R6TA 4II9A 2DPSA 2HUZA 1XE4A 3LMSA 4Q7AA 4X8IA 4I49A 2PSWA 2AFWA 4BINA 3GLJA 1M4LA 4B11A 5J1QA 2NMTA 4KVXA 5K8PA 4UWIA 1LRZA 1EE3P 3KGQA 5IX3A 2QVPA 4MCRA 2OH1A 2B4DA 2D4PA 4OC4A 1YW4A 2BCOA 2AFSA 1Z8TA 2O4HA 4M6GA 4WWVA 1BPNA 2YNCA 1Y0YA 5C88A 5THWA 5HVHA 2QIRA 3FMCA 3BJ8A 3L2NA 1PUAA 3PBEA 4K30A 4XPDC 3RNZA 4MCQA 2FIAA 3VATA 2B3UA 2OR4A 1CM0A 4EMEA 3E0KA 2G3TA 2Z3NA 2V8VA 2WPWA 4M85A 3KQZA 4PXBA 4LQ6A 4F8ZA 4NXYA 4HNWB 2REFA 5F47A 2P6EA 4CGOA 1MJAA 2YNDA 1Q7LA 3C26A 3PEIA 4KOSA 4UWJA 2V8HA 3W6SA 3CXQA 3PB9X 4AVBA 1GYTA 2GLFA 4F6AA 1Q2YA 4ZY0A 2PJ6A 2EVNA 3GYAA 5AGEA 4AVAA 3RAMA 2ZW4A 5KTDA 2PRQA 4R3LA 4A95A 3GKRA 4GS4A 1X10A 4MFPA 3SI1A 4FD6A 4JZ0A 2XEGA 5AG4A 3TOAA 1F2PA 1LFWA 3IC1A 3FX6A 2AFOA 1QSRA 1Z8LA 3B8GA 3TX8A 3KHXA 4MFKA 3JVNA 3ZZIA 4C2XA 5LYFA 1S7FA 1BLLE 1ZLHA 1H8LA 1N71A 4IAVA 4PXEA 2BL1A 3V8IA 2X7BA 2Q7BA 4OIWA 1MJBA 5C82A 3OWCA 2FT0A 4ZI6A 2R8VA 2DXQA 4R7MA 3WC5A 1MJ9A 7CPAA 2HV2A 4PXDA 4UEZA 4P4JA 4IUSA 4CYNA 4CYOA 2QJ8A 3D7HA 4AB7A 4CS0B 3V38A 3B7IA 4H89A 4A33A 2PJCA 2HQYA 2O28A 4TWEA 4YGOA 2PQ8A 3TO7A 3H8EA 4A39A 3B3SA 1P0HA 3PGPA 4G1PA 3S9NA 4NGMA 3PB6X 3QNVA 5DWMA 1JWQA 1OZPA 1DTDA 2RFHA 2Z3MA 5G22A 3EO4A 2JEVA 2Q4ZA 2Z10A 5LYIA 3QAYA 4ORFA 1IOFA 4UCMA 2V8GA 3PZJA 3TT2A 4KORA 2C6PA 1TF8A 4NGPA 4GM5A 4A30A 2RB7A 3B2YA 4ONUA 4RS2A 1CPSA 2ARHA 5HMNA 1V0CA 1AUGA 4R9MA 5BWAB 2R98A 5I0CA 1BOBA 3D7DA 3EC4A 3D3SA
chains in the Genus database with same CATH topology
4NGNA 2BO9A 1YMEA 2PCUA 2AFMA 2EK8A 4P4FA 3CT9A 4W9YA 1Z5RA 4P4DA 2CIJA 3D7FA 3BI1A 1FT7A 5K8NA 3GUXA 4OP4A 4A37A 2PJ4A 3MRUA 2CF4A 3BXMA 4P45A 1CBXA 2V77A 2ANPA 3WC6A 3T8WA 3NFZA 3PB4X 1R43A 2V8DA 3K2KA 4R76A 5K8OA 3IWWA 2XEFA 4OC2A 1TKFA 4OIDA 3MN8A 2PJ0A 1F2OA 3WC7A 2NYQA 3DLJA 3TC8A 3FF3A 3NA6A 1LOKA 3I1UA 2JEWA 2I3CA 1FNOA 1LAPA 4FWUA 2AFUA 2CTBA 2PJBA 3KASA 3D68A 3FH4A 4WJBA 2ZEHA 1UWYA 2IJZA 4IK2A 2OOTA 1ZLIA 2PJ1A 4FAIA 2ZELA 3N5FA 1YW6A 2PJ5A 2ZEEA 4AXVA 2GLJA 1ARMA 3PBBA 1QMUA 1F57A 3NH4A 2PIYA 3VH9A 4OC1A 5JM6A 1AYEA 4X3RA 4NGSA 4YWYA 3S9LA 1IGBA 5CBMA 1YSJA 3PRTA 1VHEA 2O53A 4LQGA 2DEAA 4DUKA 3B3CA 3KZWA 3KI9A 2C1CA 3HLPA 1XFOA 2VL1A 3H8GA 5DS0A 2PJ8A 4NJRA 1ZG9A 3SJXA 3FEEA 1NSAA 4FBEA 4B6ZA 1TXRA 4R8FA 3B3WA 4KSIA 5LYDA 2ABZA 2PVVA 3WABA 2AFXA 3CDXA 1BAVA 4OC0A 4OC3A 1VGYA 1JQGA 1HDUA 4P4EA 5HVGA 1LCPA 3FVLA 2F8HA 1VHOA 3SI2A 4MHZA 4UIAA 4ZX9A 5LRJA 4A38A 2IQ6A 2IMOA 4NGQA 5LRGA 1LAMA 1VIXA 4EFDA 1CP7A 2POKA 2AFZA 3ISZA 1Z2LA 1OBRA 1LANA 3KL9A 2ZEPA 4UIBA 1Y0RA 3LWUA 2PJ2A 4EWTA 5CPAA 4A94A 3GB0A 4TNUA 1ELMP 3PFOA 4OKOA 1RTQA 2PJ7A 2Q43A 1XMBA 3IJ3A 3FECA 2EK9A 2WZNA 4ZYQA 2PJ9A 2HB6A 3BHXA 1XRYA 2PVWA 4MHYA 4ONWA 4F9UA 8CPAA 2JBJA 3KHZA 5JH9A 4DJLA 1TF9A 2JBKA 3JRUA 2XEJA 4MCPA 3CPAA 4ZY1A 5IB9A 4MCSA 4P4IA 4P10A 4PQAA 2ZOGA 5HVFA 1CX8A 4FUUA 5LRKA 4IHMA 4YU9A 2PJAA 4NFRA 3RBUA 4P4BA 2ZOFA 4OC5A 2C6GA 2ZENA 4ZX8A 4DYOA 1KWMA 5ELYA 4UEEA 3ISXA 1BPMA 1CG2A 2ZEGA 1XJOA 3D67A 4K3NA 4MMOA 3KQXA 4P6YA 1AMPA 4CPAA 1TKJA 1HEEA 2ZEDA 5HXDA 2ZEOA 1XBUA 5K8MA 3SJGA 2ZEFA 3IFEA 3IEHA 4BD9A 3S9MA 4RUHA 4UEFA 4NJQA 2GU2A 3BI0A 2PE3A 3HUVA 1ARLA 2FVGA 4Z65A 3SJFA 2EWBA 2C6CA 2BOAA 4X2TA 1DE4C 3PB8X 1QQ9A 4NGTA 3B35A 2CTCA 2PIZA 3FJUA 3B3TA 5D29A 3KR5A 2F7VA 1PCAA 1CPXA 2QYVA 3RZAA 3IO1A 1CP6A 3FEDA 4MHPA 3SJEA 1Y7EA 2J9AA 1HDQA 3PFEA 1PYTB 6CPAA 3D66A 4O23A 1IY7A 1R3NA 2GREA 2ZEMA 2Q51A 1ZG7A 3SI0A 4NGRA 5I4MA 2PJ3A 5F09A 3H8FA 1ELLP 4P44A 1ZG8A 3D4UA 4ZY2A 5JGFA 4OMEA 3V7ZA 1TKHA 4MHNA 1YLOA 2WYRA 3PB7X 3NH5A 2G9DA 3CPXA 3D7GA 3DGVA 4H2KA 4JYWA 4MXUA 3VARA 3KR4A 3K9TA 4PPZA 3B3VA 5D8NA 4PXCA 4MRIA 4UF4A 3IIBA 3WT4A 3NH8A 4F9VA 2HC9A 2XEIA 2NSMA 4R6TA 4Q7AA 3LMSA 5LYLA 4X8IA 2AFWA 3GLJA 1M4LA 5J1QA 5K8PA 1EE3P 3KGQA 2QVPA 4MCRA 4OC4A 1YW4A 2BCOA 2AFSA 2O4HA 4WWVA 1BPNA 1Y0YA 5THWA 5HVHA 3FMCA 3PBEA 3L2NA 3VATA 4MCQA 2OR4A 4EMEA 2V8VA 3KQZA 4PXBA 4F8ZA 1Q7LA 3PEIA 2V8HA 4ZY0A 3PB9X 1GYTA 2GLFA 2PJ6A 3RAMA 2PRQA 3SI1A 4JZ0A 2XEGA 1F2PA 1LFWA 3IC1A 3FX6A 2AFOA 1Z8LA 3TX8A 3KHXA 5LYFA 1BLLE 1ZLHA 1H8LA 4PXEA 4IAVA 4OIWA 4ZI6A 4R7MA 3WC5A 7CPAA 4PXDA 4UEZA 4P4JA 2QJ8A 3D7HA 3V38A 3B7IA 2PJCA 4TWEA 4A39A 3H8EA 3B3SA 4G1PA 3S9NA 4NGMA 3PB6X 3QNVA 1DTDA 2RFHA 5LYIA 2Q4ZA 2V8GA 2C6PA 1TF8A 4NGPA 4GM5A 2RB7A 3B2YA 1CPSA 3D7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NGN A;  2BO9 A;  1YME A;  2PCU A;  2AFM A;  2EK8 A;  4P4F A;  3CT9 A;  4W9Y A;  1Z5R A;  4P4D A;  2CIJ A;  3D7F A;  3BI1 A;  1FT7 A;  5K8N A;  3GUX A;  4OP4 A;  4A37 A;  2PJ4 A;  3MRU A;  2CF4 A;  3BXM A;  4P45 A;  1CBX A;  2V77 A;  2ANP A;  3WC6 A;  3T8W A;  3NFZ A;  3PB4 X;  1R43 A;  2V8D A;  3K2K A;  4R76 A;  5K8O A;  3IWW A;  2XEF A;  4OC2 A;  1TKF A;  4OID A;  3MN8 A;  2PJ0 A;  1F2O A;  3WC7 A;  2NYQ A;  3DLJ A;  3TC8 A;  3FF3 A;  3NA6 A;  1LOK A;  3I1U A;  2JEW A;  2I3C A;  1FNO A;  1LAP A;  4FWU A;  2AFU A;  2CTB A;  2PJB A;  3KAS A;  3D68 A;  3FH4 A;  4WJB A;  2ZEH A;  1UWY A;  2IJZ A;  4IK2 A;  2OOT A;  1ZLI A;  2PJ1 A;  4FAI A;  2ZEL A;  3N5F A;  1YW6 A;  2PJ5 A;  2ZEE A;  4AXV A;  2GLJ A;  1ARM A;  3PBB A;  1QMU A;  1F57 A;  3NH4 A;  2PIY A;  3VH9 A;  4OC1 A;  5JM6 A;  1AYE A;  4X3R A;  4NGS A;  4YWY A;  3S9L A;  1IGB A;  5CBM A;  1YSJ A;  3PRT A;  1VHE A;  2O53 A;  4LQG A;  2DEA A;  4DUK A;  3B3C A;  3KZW A;  3KI9 A;  2C1C A;  3HLP A;  1XFO A;  2VL1 A;  3H8G A;  5DS0 A;  2PJ8 A;  4NJR A;  1ZG9 A;  3SJX A;  3FEE A;  1NSA A;  4FBE A;  4B6Z A;  1TXR A;  4R8F A;  3B3W A;  4KSI A;  5LYD A;  2ABZ A;  2PVV A;  3WAB A;  2AFX A;  3CDX A;  1BAV A;  4OC0 A;  4OC3 A;  1VGY A;  1JQG A;  1HDU A;  4P4E A;  5HVG A;  1LCP A;  3FVL A;  2F8H A;  1VHO A;  3SI2 A;  4MHZ A;  4UIA A;  4ZX9 A;  5LRJ A;  4A38 A;  2IQ6 A;  2IMO A;  4NGQ A;  5LRG A;  1LAM A;  1VIX A;  4EFD A;  1CP7 A;  2POK A;  2AFZ A;  3ISZ A;  1Z2L A;  1OBR A;  1LAN A;  3KL9 A;  2ZEP A;  4UIB A;  1Y0R A;  3LWU A;  2PJ2 A;  4EWT A;  5CPA A;  4A94 A;  3GB0 A;  4TNU A;  1ELM P;  3PFO A;  4OKO A;  1RTQ A;  2PJ7 A;  2Q43 A;  1XMB A;  3IJ3 A;  3FEC A;  2EK9 A;  2WZN A;  4ZYQ A;  2PJ9 A;  2HB6 A;  3BHX A;  1XRY A;  2PVW A;  4MHY A;  4ONW A;  4F9U A;  8CPA A;  2JBJ A;  3KHZ A;  5JH9 A;  4DJL A;  1TF9 A;  2JBK A;  3JRU A;  2XEJ A;  4MCP A;  3CPA A;  4ZY1 A;  5IB9 A;  4MCS A;  4P4I A;  4P10 A;  4PQA A;  2ZOG A;  5HVF A;  1CX8 A;  4FUU A;  5LRK A;  4IHM A;  4YU9 A;  2PJA A;  4NFR A;  3RBU A;  4P4B A;  2ZOF A;  4OC5 A;  2C6G A;  2ZEN A;  4ZX8 A;  4DYO A;  1KWM A;  5ELY A;  4UEE A;  3ISX A;  1BPM A;  1CG2 A;  2ZEG A;  1XJO A;  3D67 A;  4K3N A;  4MMO A;  3KQX A;  4P6Y A;  1AMP A;  4CPA A;  1TKJ A;  1HEE A;  2ZED A;  5HXD A;  2ZEO A;  1XBU A;  5K8M A;  3SJG A;  2ZEF A;  3IFE A;  3IEH A;  4BD9 A;  3S9M A;  4RUH A;  4UEF A;  4NJQ A;  2GU2 A;  3BI0 A;  2PE3 A;  3HUV A;  1ARL A;  2FVG A;  4Z65 A;  3SJF A;  2EWB A;  2C6C A;  2BOA A;  4X2T A;  1DE4 C;  3PB8 X;  1QQ9 A;  4NGT A;  3B35 A;  2CTC A;  2PIZ A;  3FJU A;  3B3T A;  5D29 A;  3KR5 A;  2F7V A;  1PCA A;  1CPX A;  2QYV A;  3RZA A;  3IO1 A;  1CP6 A;  3FED A;  4MHP A;  3SJE A;  1Y7E A;  2J9A A;  1HDQ A;  3PFE A;  1PYT B;  6CPA A;  3D66 A;  4O23 A;  1IY7 A;  1R3N A;  2GRE A;  2ZEM A;  2Q51 A;  1ZG7 A;  3SI0 A;  4NGR A;  5I4M A;  2PJ3 A;  5F09 A;  3H8F A;  1ELL P;  4P44 A;  1ZG8 A;  3D4U A;  4ZY2 A;  5JGF A;  4OME A;  3V7Z A;  1TKH A;  4MHN A;  1YLO A;  2WYR A;  3PB7 X;  3NH5 A;  2G9D A;  3CPX A;  3D7G A;  3DGV A;  4H2K A;  4JYW A;  4MXU A;  3VAR A;  3KR4 A;  3K9T A;  4PPZ A;  3B3V A;  5D8N A;  4PXC A;  4MRI A;  4UF4 A;  3IIB A;  3WT4 A;  3NH8 A;  4F9V A;  2HC9 A;  2XEI A;  2NSM A;  4R6T A;  4Q7A A;  3LMS A;  5LYL A;  4X8I A;  2AFW A;  3GLJ A;  1M4L A;  5J1Q A;  5K8P A;  1EE3 P;  3KGQ A;  2QVP A;  4MCR A;  4OC4 A;  1YW4 A;  2BCO A;  2AFS A;  2O4H A;  4WWV A;  1BPN A;  1Y0Y A;  5THW A;  5HVH A;  3FMC A;  3PBE A;  3L2N A;  3VAT A;  4MCQ A;  2OR4 A;  4EME A;  2V8V A;  3KQZ A;  4PXB A;  4F8Z A;  1Q7L A;  3PEI A;  2V8H A;  4ZY0 A;  3PB9 X;  1GYT A;  2GLF A;  2PJ6 A;  3RAM A;  2PRQ A;  3SI1 A;  4JZ0 A;  2XEG A;  1F2P A;  1LFW A;  3IC1 A;  3FX6 A;  2AFO A;  1Z8L A;  3TX8 A;  3KHX A;  5LYF A;  1BLL E;  1ZLH A;  1H8L A;  4PXE A;  4IAV A;  4OIW A;  4ZI6 A;  4R7M A;  3WC5 A;  7CPA A;  4PXD A;  4UEZ A;  4P4J A;  2QJ8 A;  3D7H A;  3V38 A;  3B7I A;  2PJC A;  4TWE A;  4A39 A;  3H8E A;  3B3S A;  4G1P A;  3S9N A;  4NGM A;  3PB6 X;  3QNV A;  1DTD A;  2RFH A;  5LYI A;  2Q4Z A;  2V8G A;  2C6P A;  1TF8 A;  4NGP A;  4GM5 A;  2RB7 A;  3B2Y A;  1CPS A;  3D7D A; 
#chains in the Genus database with same CATH topology
 3D2P A;  2PR8 A;  3KKW A;  4HNY B;  4NGN A;  1ON0 A;  2BO9 A;  2Z3O A;  1YME A;  2JDD A;  2PCU A;  3DR6 A;  1YK3 A;  3MGD A;  2AFM A;  1RO5 A;  1IB1 E;  4LX9 A;  2EK8 A;  4OLL A;  4P4F A;  3CT9 A;  4NEX A;  2ZW6 A;  3G3S A;  4W9Y A;  1QSN A;  4B13 A;  1TIQ A;  3JUW A;  4MFZ A;  5G21 A;  1Z5R A;  2OZU A;  1PU9 A;  2WSA A;  5KTC A;  4OAD A;  4P4D A;  1YGH A;  4KZT A;  4C2Z A;  1YVO A;  2CIJ A;  3D7F A;  2OU2 A;  1Y9W A;  1FT7 A;  3BI1 A;  4UCN A;  3UY5 A;  5K8N A;  1KUY A;  5IB0 A;  3IU1 A;  2GFQ A;  2VZZ A;  3GUX A;  5AG5 A;  3S6H A;  4OP4 A;  4A37 A;  4CAE A;  2PJ4 A;  3MRU A;  3F5B A;  2CF4 A;  4JD6 A;  2KCW A;  3BXM A;  5CNP A;  3QAH A;  4P45 A;  2BSW A;  1CBX A;  2V77 A;  2ANP A;  3IU2 A;  3WC6 A;  3T8W A;  3NFZ A;  3BJ7 A;  2CNM A;  3TO9 A;  3PB4 X;  1R43 A;  2V8D A;  3DSB A;  3K2K A;  3WR7 A;  5H84 A;  1IOI A;  1M4D A;  1CJW A;  4R76 A;  3IWW A;  4MY3 A;  4F0Y A;  2BUE A;  5K8O A;  2XEF A;  1KUV A;  1YLE A;  2FSR A;  4B10 A;  2P6F A;  4OC2 A;  4YRH A;  4KOY A;  4MFJ A;  1TKF A;  4OID A;  3TE4 A;  5HH1 A;  3MN8 A;  2PJ0 A;  3TCV A;  1M4G A;  2REE A;  1F2O A;  2FXF A;  3WC7 A;  3VWD A;  4KVO E;  2I79 A;  2NYQ A;  4MFL A;  3CXP A;  1RXT A;  3DLJ A;  3TC8 A;  4CGN A;  3FF3 A;  3NA6 A;  1I12 A;  4BMH A;  4A2Z A;  4CRY B;  1LOK A;  2JEW A;  2I3C A;  3I1U A;  1FNO A;  1LAP A;  4FWU A;  5J8F A;  4CAW A;  2AFU A;  2CNS A;  2CTB A;  2PJB A;  3KAS A;  5AG7 A;  2D4O A;  2PR1 A;  4XNH B;  5EMI A;  5H86 A;  4JXQ A;  3D68 A;  3FH4 A;  4WJB A;  1KUX A;  5E96 A;  2J8R A;  2ZEH A;  5DWN A;  4XPL A;  2FCK A;  1UWY A;  4NF1 A;  1P4N A;  2IJZ A;  4QC6 A;  4C7H A;  4IK2 A;  4CYP A;  2OOT A;  1ZLI A;  2B5G B;  2GAN A;  3JTK A;  1NSL A;  2PJ1 A;  3S6G A;  4FAI A;  2ZXV A;  1A2Z A;  4OAE A;  2ZEL A;  3N5F A;  1YW6 A;  4A32 A;  2PJ5 A;  2ZEE A;  1U6M A;  4U9Z A;  4KOV A;  4AXV A;  4QUS A;  4C2Y A;  3FBU A;  2GLJ A;  1ARM A;  3PBB A;  3TO6 A;  1QMU A;  1F57 A;  2VBQ A;  3NH4 A;  4E8O A;  2FE7 A;  2PIY A;  2JLM A;  3VH9 A;  1UFH A;  2G3A A;  1IU8 A;  3D2M A;  1AYE A;  2ZW5 A;  1I1D A;  4KSF A;  4OC1 A;  4X3R A;  5GCN A;  4NGS A;  3T90 A;  4YWY A;  3S9L A;  1IGB A;  4B5P A;  4EVY A;  5CBM A;  1YSJ A;  4NSQ A;  3FNC A;  3PRT A;  1VHE A;  2O53 A;  4QB9 A;  1S7K A;  2DEA A;  4LQG A;  4IF5 A;  4DUK A;  3B3C A;  4FD7 A;  4HKF A;  3KZW A;  3R95 A;  5LYL A;  2DF5 A;  2C1C A;  3KI9 A;  3HLP A;  4JJX A;  1K4J A;  3LAC A;  1XFO A;  2OZH A;  2VL1 A;  1WK4 A;  2J8N A;  4R3K A;  3H8G A;  5DS0 A;  3R9G A;  3GIU A;  2PJ8 A;  4NJR A;  1ZG9 A;  4UFX A;  3SJX A;  2CNT A;  2Q7S A;  1NSA A;  3FEE A;  4FBE A;  4B6Z A;  1TXR A;  4R8F A;  3B3W A;  4KUA A;  4KVM E;  4KSI A;  5LYD A;  1GHE A;  4UFV A;  4GXH A;  4MHD A;  1YX0 A;  3FRM A;  2J8M A;  4AVC A;  4R57 A;  4E0A A;  2ABZ A;  2AJ6 A;  2PVV A;  2I00 A;  1S7N A;  1XF8 A;  2AFX A;  2Z3P A;  3CDX A;  3LD2 A;  3WAB A;  1BAV A;  1XMT A;  3ZJ0 A;  4OC0 A;  4E2A A;  2Z0Z A;  3DDD A;  2VI7 A;  4OC3 A;  1VGY A;  4KOU A;  1JQG A;  1HDU A;  4P4E A;  5HVG A;  1LCP A;  3FVL A;  2F8H A;  4CGM A;  3IGR A;  1VHO A;  3SI2 A;  4XPD B;  4MHZ A;  4UIA A;  4ZX9 A;  5LRJ A;  4QBJ A;  4A38 A;  2YGW A;  1YVK A;  2IQ6 A;  2IMO A;  3W91 A;  4NGQ A;  5LRG A;  1LAM A;  1VIX A;  4HPS A;  4XNH C;  4EFD A;  1CP7 A;  3SHP A;  2POK A;  2AFZ A;  1Z8X A;  3ISZ A;  1J4J A;  1Z2L A;  1OBR A;  3NE8 A;  3PP9 A;  1LAN A;  4MY0 A;  1B6B A;  4Q36 A;  3KL9 A;  4L8A A;  2Z11 A;  4CAV A;  4PK3 A;  1YRE A;  4JLY A;  2ZEP A;  3SXO A;  1M44 A;  4UIB A;  1Y0R A;  3LWU A;  2PJ2 A;  1FY7 A;  5ISV A;  2PC1 A;  5CPA A;  2RC4 A;  1Q2D A;  4RN7 A;  4EWT A;  4A94 A;  5IV0 A;  3GB0 A;  2Q4V A;  4J3G A;  1ELM P;  3PFO A;  4TNU A;  4OKO A;  1RTQ A;  2PJ7 A;  4CGP A;  2Q43 A;  2B58 A;  2Z3L A;  5G20 A;  3TOB A;  1XMB A;  3IJ3 A;  3FEC A;  1IYK A;  2EK9 A;  4R87 A;  3BLN A;  4BBH A;  2WZN A;  2B4B A;  4ZYQ A;  2PJ9 A;  2VEZ A;  2FS5 A;  2HB6 A;  5KTA A;  3BHX A;  1XRY A;  2PVW A;  4MHY A;  4ONW A;  4F9U A;  8CPA A;  3FYN A;  3LOD A;  2JBJ A;  4CYQ A;  3KHZ A;  5JPH A;  5JH9 A;  4UFW A;  3P2F A;  4DJL A;  2QEC A;  1TF9 A;  4CAF A;  2AE6 A;  2JBK A;  3JRU A;  2XEJ A;  3FIX A;  3K9U A;  4MCP A;  3CPA A;  4ZY1 A;  1Z9U A;  4MCS A;  5IB9 A;  4MJ8 A;  3D8P A;  3SXN A;  4P4I A;  2R1I A;  4P10 A;  4PQA A;  5JQ4 A;  2YNC C;  2ZOG A;  2ZPA A;  4H6U A;  5A28 A;  5HVF A;  1CX8 A;  1Y7R A;  2FL4 A;  3DR8 A;  3I3G A;  4ZGY B;  2QML A;  4FUU A;  1VHS A;  5LRK A;  5AG6 A;  3QB8 A;  2R7H A;  3G8W A;  4IHM A;  4KS9 A;  1QSO A;  4NCZ A;  3R96 A;  2BEI A;  1S5K A;  2ODF A;  4YU9 A;  2PJA A;  2ATR A;  4M6I A;  4NFR A;  4JWP A;  4QVT A;  3S6F A;  5EBV A;  4JXR A;  4P4B A;  2PRB A;  3RBU A;  4YFJ A;  4B12 A;  1XOV A;  2JDC A;  2ZOF A;  2C6G A;  3NE7 A;  4LUA A;  4OC5 A;  2EUI A;  2ZEN A;  4ZX8 A;  3T9Y A;  2Q04 A;  3VWE A;  4DYO A;  1KWM A;  4UA3 A;  5ELY A;  5F46 A;  4KLW A;  1XIX A;  1KZF A;  3ISX A;  4UEE A;  1BPM A;  1CG2 A;  2ZEG A;  1XJO A;  3D67 A;  4K3N A;  3EY5 A;  3F8K A;  4MMO A;  4KOT A;  1S60 A;  2F5I A;  1R57 A;  3KQX A;  4P6Y A;  1AMP A;  3CZX A;  4CPA A;  4C7I A;  1TKJ A;  1HEE A;  2ZED A;  5HXD A;  2ZEO A;  1XBU A;  2WUU A;  4L89 A;  1VKC A;  5K8M A;  2P0W A;  4KUB A;  2Y0M A;  3SJG A;  2ZEF A;  3IFE A;  2YNE A;  2OB0 A;  3IEH A;  4BD9 A;  3S9M A;  3H4Q A;  1S7L A;  2G0B A;  4UEF A;  2VZY A;  3RYO A;  4RUH A;  1WWZ A;  2Q0Y A;  2B4D B;  3EFA A;  4Y49 B;  4NJQ A;  2GU2 A;  3BI0 A;  2P6G A;  5A27 A;  2H5M A;  1BO4 A;  2PE3 A;  3H5Z A;  3HUV A;  1ARL A;  2FVG A;  3CXS A;  4FD4 A;  4CGL A;  4DNC A;  1I21 A;  2OZG A;  4FD5 A;  3F0A A;  3SJF A;  2EWB A;  4Z65 A;  2C6C A;  2BOA A;  4X2T A;  2Q44 A;  5F49 A;  3RO0 A;  4AG7 A;  3TTH A;  5G1Z A;  1DE4 C;  1Z8W A;  2K5T A;  1M4I A;  3PB8 X;  1QQ9 A;  3FB3 A;  4NGT A;  3B35 A;  2CTC A;  2C27 A;  2PIZ A;  3FJU A;  2CXA A;  3B3T A;  2WPX A;  4PSX A;  3DNS A;  4H6Z A;  5D29 A;  1Y9K A;  4ZBG A;  3KR5 A;  1Q2C A;  3N7Z A;  4X5K A;  1YQE A;  4KOW A;  2F7V A;  1PCA A;  1CPX A;  2QYV A;  2VXK A;  3IWE A;  3RZA A;  2EO8 A;  3IO1 A;  1YR0 A;  1B87 A;  1CP6 A;  3FED A;  4MHP A;  1QSM A;  3SJE A;  1IYL A;  1NMT A;  1Y7E A;  2ZW7 A;  5JM6 A;  3EXN A;  2J9A A;  4HNX B;  3R9F A;  1HDQ A;  4U9Y A;  3PFE A;  1PYT B;  6CPA A;  3P2H A;  2DPT A;  3D66 A;  4PK2 A;  4B5P B;  4A31 A;  2PDO A;  4M6H A;  1SQH A;  1XEB A;  2EBJ A;  4M3S A;  4O23 A;  4XPK A;  1IY7 A;  1R3N A;  2GRE A;  2IL4 A;  2ZEM A;  1IID A;  1S3Z A;  2Q51 A;  1ZG7 A;  3SI0 A;  4UCP A;  4NGR A;  2CY2 A;  3R9E A;  5I4M A;  2GE3 A;  2PJ3 A;  5F09 A;  5F48 A;  1L0C A;  3H8F A;  4CAX A;  1ELL P;  4CRZ B;  4P44 A;  4PSW A;  2VQY A;  1ZG8 A;  3D4U A;  4MI4 A;  4ZY2 A;  5JGF A;  4KSA A;  4OME A;  3V7Z A;  5EC4 A;  1TKH A;  1NE9 A;  5FVJ A;  3W6X A;  4MHN A;  1YLO A;  2WYR A;  1IIC A;  2B5G A;  3PB7 X;  4UBR A;  4B5O A;  1Z4E A;  3NH5 A;  2G9D A;  1X12 A;  3CPX A;  2GIV A;  3I9S A;  3R1K A;  3D7G A;  3DGV A;  1MK4 A;  4H2K A;  4AG9 A;  4JYW A;  4MXU A;  3VAR A;  3GY9 A;  1M1D A;  3KR4 A;  3K9T A;  2FIW A;  2Z3K A;  4PPZ A;  4KLV A;  4F0X A;  4B14 A;  3A9L A;  1Z4R A;  1QST A;  4RI1 A;  3B3V A;  2B3V A;  5D8N A;  1ZO0 A;  4Y49 C;  4KOX A;  2A4N A;  4PXC A;  4MBU A;  5J8C A;  3IWG A;  4MRI A;  4UF4 A;  2Q4Y A;  3IIB A;  4MFQ A;  4PV6 A;  3S6K A;  3WT4 A;  3FXT A;  3NH8 A;  4F9V A;  2HC9 A;  3TFY A;  2XEI A;  4U5Y A;  2NSM A;  4Q38 A;  4C68 A;  4R6T A;  4II9 A;  2DPS A;  2HUZ A;  1XE4 A;  3LMS A;  4Q7A A;  4X8I A;  4I49 A;  2PSW A;  2AFW A;  4BIN A;  3GLJ A;  1M4L A;  4B11 A;  5J1Q A;  2NMT A;  4KVX A;  5K8P A;  4UWI A;  1LRZ A;  1EE3 P;  3KGQ A;  5IX3 A;  2QVP A;  4MCR A;  2OH1 A;  2B4D A;  2D4P A;  4OC4 A;  1YW4 A;  2BCO A;  2AFS A;  1Z8T A;  2O4H A;  4M6G A;  4WWV A;  1BPN A;  2YNC A;  1Y0Y A;  5C88 A;  5THW A;  5HVH A;  2QIR A;  3FMC A;  3BJ8 A;  3L2N A;  1PUA A;  3PBE A;  4K30 A;  4XPD C;  3RNZ A;  4MCQ A;  2FIA A;  3VAT A;  2B3U A;  2OR4 A;  1CM0 A;  4EME A;  3E0K A;  2G3T A;  2Z3N A;  2V8V A;  2WPW A;  4M85 A;  3KQZ A;  4PXB A;  4LQ6 A;  4F8Z A;  4NXY A;  4HNW B;  2REF A;  5F47 A;  2P6E A;  4CGO A;  1MJA A;  2YND A;  1Q7L A;  3C26 A;  3PEI A;  4KOS A;  4UWJ A;  2V8H A;  3W6S A;  3CXQ A;  3PB9 X;  4AVB A;  1GYT A;  2GLF A;  4F6A A;  1Q2Y A;  4ZY0 A;  2PJ6 A;  2EVN A;  3GYA A;  5AGE A;  4AVA A;  3RAM A;  2ZW4 A;  5KTD A;  2PRQ A;  4R3L A;  4A95 A;  3GKR A;  4GS4 A;  1X10 A;  4MFP A;  3SI1 A;  4FD6 A;  4JZ0 A;  2XEG A;  5AG4 A;  3TOA A;  1F2P A;  1LFW A;  3IC1 A;  3FX6 A;  2AFO A;  1QSR A;  1Z8L A;  3B8G A;  3TX8 A;  3KHX A;  4MFK A;  3JVN A;  3ZZI A;  4C2X A;  5LYF A;  1S7F A;  1BLL E;  1ZLH A;  1H8L A;  1N71 A;  4IAV A;  4PXE A;  2BL1 A;  3V8I A;  2X7B A;  2Q7B A;  4OIW A;  1MJB A;  5C82 A;  3OWC A;  2FT0 A;  4ZI6 A;  2R8V A;  2DXQ A;  4R7M A;  3WC5 A;  1MJ9 A;  7CPA A;  2HV2 A;  4PXD A;  4UEZ A;  4P4J A;  4IUS A;  4CYN A;  4CYO A;  2QJ8 A;  3D7H A;  4AB7 A;  4CS0 B;  3V38 A;  3B7I A;  4H89 A;  4A33 A;  2PJC A;  2HQY A;  2O28 A;  4TWE A;  4YGO A;  2PQ8 A;  3TO7 A;  3H8E A;  4A39 A;  3B3S A;  1P0H A;  3PGP A;  4G1P A;  3S9N A;  4NGM A;  3PB6 X;  3QNV A;  5DWM A;  1JWQ A;  1OZP A;  1DTD A;  2RFH A;  2Z3M A;  5G22 A;  3EO4 A;  2JEV A;  2Q4Z A;  2Z10 A;  5LYI A;  3QAY A;  4ORF A;  1IOF A;  4UCM A;  2V8G A;  3PZJ A;  3TT2 A;  4KOR A;  2C6P A;  1TF8 A;  4NGP A;  4GM5 A;  4A30 A;  2RB7 A;  3B2Y A;  4ONU A;  4RS2 A;  1CPS A;  2ARH A;  5HMN A;  1V0C A;  1AUG A;  4R9M A;  5BWA B;  2R98 A;  5I0C A;  1BOB A;  3D7D A;  3EC4 A;  3D3S A; 
#chains in the Genus database with same CATH homology
 4NGN A;  2BO9 A;  1YME A;  2PCU A;  2AFM A;  2EK8 A;  4P4F A;  3CT9 A;  4W9Y A;  1Z5R A;  4P4D A;  2CIJ A;  3D7F A;  3BI1 A;  1FT7 A;  5K8N A;  3GUX A;  4OP4 A;  4A37 A;  2PJ4 A;  3MRU A;  2CF4 A;  3BXM A;  4P45 A;  1CBX A;  2V77 A;  2ANP A;  3WC6 A;  3T8W A;  3NFZ A;  3PB4 X;  1R43 A;  2V8D A;  3K2K A;  4R76 A;  5K8O A;  3IWW A;  2XEF A;  4OC2 A;  1TKF A;  4OID A;  3MN8 A;  2PJ0 A;  1F2O A;  3WC7 A;  2NYQ A;  3DLJ A;  3TC8 A;  3FF3 A;  3NA6 A;  1LOK A;  3I1U A;  2JEW A;  2I3C A;  1FNO A;  1LAP A;  4FWU A;  2AFU A;  2CTB A;  2PJB A;  3KAS A;  3D68 A;  3FH4 A;  4WJB A;  2ZEH A;  1UWY A;  2IJZ A;  4IK2 A;  2OOT A;  1ZLI A;  2PJ1 A;  4FAI A;  2ZEL A;  3N5F A;  1YW6 A;  2PJ5 A;  2ZEE A;  4AXV A;  2GLJ A;  1ARM A;  3PBB A;  1QMU A;  1F57 A;  3NH4 A;  2PIY A;  3VH9 A;  4OC1 A;  5JM6 A;  1AYE A;  4X3R A;  4NGS A;  4YWY A;  3S9L A;  1IGB A;  5CBM A;  1YSJ A;  3PRT A;  1VHE A;  2O53 A;  4LQG A;  2DEA A;  4DUK A;  3B3C A;  3KZW A;  3KI9 A;  2C1C A;  3HLP A;  1XFO A;  2VL1 A;  3H8G A;  5DS0 A;  2PJ8 A;  4NJR A;  1ZG9 A;  3SJX A;  3FEE A;  1NSA A;  4FBE A;  4B6Z A;  1TXR A;  4R8F A;  3B3W A;  4KSI A;  5LYD A;  2ABZ A;  2PVV A;  3WAB A;  2AFX A;  3CDX A;  1BAV A;  4OC0 A;  4OC3 A;  1VGY A;  1JQG A;  1HDU A;  4P4E A;  5HVG A;  1LCP A;  3FVL A;  2F8H A;  1VHO A;  3SI2 A;  4MHZ A;  4UIA A;  4ZX9 A;  5LRJ A;  4A38 A;  2IQ6 A;  2IMO A;  4NGQ A;  5LRG A;  1LAM A;  1VIX A;  4EFD A;  1CP7 A;  2POK A;  2AFZ A;  3ISZ A;  1Z2L A;  1OBR A;  1LAN A;  3KL9 A;  2ZEP A;  4UIB A;  1Y0R A;  3LWU A;  2PJ2 A;  4EWT A;  5CPA A;  4A94 A;  3GB0 A;  4TNU A;  1ELM P;  3PFO A;  4OKO A;  1RTQ A;  2PJ7 A;  2Q43 A;  1XMB A;  3IJ3 A;  3FEC A;  2EK9 A;  2WZN A;  4ZYQ A;  2PJ9 A;  2HB6 A;  3BHX A;  1XRY A;  2PVW A;  4MHY A;  4ONW A;  4F9U A;  8CPA A;  2JBJ A;  3KHZ A;  5JH9 A;  4DJL A;  1TF9 A;  2JBK A;  3JRU A;  2XEJ A;  4MCP A;  3CPA A;  4ZY1 A;  5IB9 A;  4MCS A;  4P4I A;  4P10 A;  4PQA A;  2ZOG A;  5HVF A;  1CX8 A;  4FUU A;  5LRK A;  4IHM A;  4YU9 A;  2PJA A;  4NFR A;  3RBU A;  4P4B A;  2ZOF A;  4OC5 A;  2C6G A;  2ZEN A;  4ZX8 A;  4DYO A;  1KWM A;  5ELY A;  4UEE A;  3ISX A;  1BPM A;  1CG2 A;  2ZEG A;  1XJO A;  3D67 A;  4K3N A;  4MMO A;  3KQX A;  4P6Y A;  1AMP A;  4CPA A;  1TKJ A;  1HEE A;  2ZED A;  5HXD A;  2ZEO A;  1XBU A;  5K8M A;  3SJG A;  2ZEF A;  3IFE A;  3IEH A;  4BD9 A;  3S9M A;  4RUH A;  4UEF A;  4NJQ A;  2GU2 A;  3BI0 A;  2PE3 A;  3HUV A;  1ARL A;  2FVG A;  4Z65 A;  3SJF A;  2EWB A;  2C6C A;  2BOA A;  4X2T A;  1DE4 C;  3PB8 X;  1QQ9 A;  4NGT A;  3B35 A;  2CTC A;  2PIZ A;  3FJU A;  3B3T A;  5D29 A;  3KR5 A;  2F7V A;  1PCA A;  1CPX A;  2QYV A;  3RZA A;  3IO1 A;  1CP6 A;  3FED A;  4MHP A;  3SJE A;  1Y7E A;  2J9A A;  1HDQ A;  3PFE A;  1PYT B;  6CPA A;  3D66 A;  4O23 A;  1IY7 A;  1R3N A;  2GRE A;  2ZEM A;  2Q51 A;  1ZG7 A;  3SI0 A;  4NGR A;  5I4M A;  2PJ3 A;  5F09 A;  3H8F A;  1ELL P;  4P44 A;  1ZG8 A;  3D4U A;  4ZY2 A;  5JGF A;  4OME A;  3V7Z A;  1TKH A;  4MHN A;  1YLO A;  2WYR A;  3PB7 X;  3NH5 A;  2G9D A;  3CPX A;  3D7G A;  3DGV A;  4H2K A;  4JYW A;  4MXU A;  3VAR A;  3KR4 A;  3K9T A;  4PPZ A;  3B3V A;  5D8N A;  4PXC A;  4MRI A;  4UF4 A;  3IIB A;  3WT4 A;  3NH8 A;  4F9V A;  2HC9 A;  2XEI A;  2NSM A;  4R6T A;  4Q7A A;  3LMS A;  5LYL A;  4X8I A;  2AFW A;  3GLJ A;  1M4L A;  5J1Q A;  5K8P A;  1EE3 P;  3KGQ A;  2QVP A;  4MCR A;  4OC4 A;  1YW4 A;  2BCO A;  2AFS A;  2O4H A;  4WWV A;  1BPN A;  1Y0Y A;  5THW A;  5HVH A;  3FMC A;  3PBE A;  3L2N A;  3VAT A;  4MCQ A;  2OR4 A;  4EME A;  2V8V A;  3KQZ A;  4PXB A;  4F8Z A;  1Q7L A;  3PEI A;  2V8H A;  4ZY0 A;  3PB9 X;  1GYT A;  2GLF A;  2PJ6 A;  3RAM A;  2PRQ A;  3SI1 A;  4JZ0 A;  2XEG A;  1F2P A;  1LFW A;  3IC1 A;  3FX6 A;  2AFO A;  1Z8L A;  3TX8 A;  3KHX A;  5LYF A;  1BLL E;  1ZLH A;  1H8L A;  4PXE A;  4IAV A;  4OIW A;  4ZI6 A;  4R7M A;  3WC5 A;  7CPA A;  4PXD A;  4UEZ A;  4P4J A;  2QJ8 A;  3D7H A;  3V38 A;  3B7I A;  2PJC A;  4TWE A;  4A39 A;  3H8E A;  3B3S A;  4G1P A;  3S9N A;  4NGM A;  3PB6 X;  3QNV A;  1DTD A;  2RFH A;  5LYI A;  2Q4Z A;  2V8G A;  2C6P A;  1TF8 A;  4NGP A;  4GM5 A;  2RB7 A;  3B2Y A;  1CPS A;  3D7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...