4F9VA

Structure of c113a/c136a mutant variant of glycosylated glutaminyl cyclase from drosophila melanogaster
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
307
structure length
307
Chain Sequence
IGSQWRDDEVHFNRTLDSILVPRVVGSRGHQQVREYLVQSLNGLGFQTEVDEFKQRVPVFGELTFANVVGTINPQAQNFLALAAHYDSKYFPNDPGFVGATDSAVPAAILLNTAKTLGAYLQKEFRNRSDVGLMLIFFDGEEAFKEWTDADSVYGSKHLAAKLASKRSGSQAQLAPRNIDRIEVLVLLDLIGARNPKFSSFYENTDGLHSSLVQIEKSLRTAGQLEGNNNMFLSRVSGGLVDDDHRPFLDENVPVLHLVATPFPDVWHTPRDNAANLHWPSIRNFNRVFRNFVYQYLKRHTSPVNLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG32412
publication title Crystal Structures of Glutaminyl Cyclases (QCs) from Drosophila melanogaster Reveal Active Site Conservation between Insect and Mammalian QCs.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase, hydrolase
total genus 107
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4f9vA00
2QYVA 4P4JA 5LYIA 4O23A 2CTBA 2AFZA 3BI0A 8CPAA 4ZI6A 4FBEA 2JEWA 4Z65A 4NGQA 5D29A 3CPAA 4EMEA 2PJ5A 3FVLA 1ZG9A 4UEFA 3B3VA 4OC5A 1LFWA 4MMOA 4R6TA 4FAIA 2ZELA 5HVFA 4MHPA 2C1CA 1GYTA 3SJGA 1NSAA 3PB8X 1DTDA 2ZENA 3HLPA 5F09A 4X3RA 4EFDA 1ZG7A 1ZG8A 1BPMA 3B35A 4RUHA 2G9DA 2HB6A 4OP4A 2O4HA 3KHZA 4OC3A 1JQGA 3KR5A 5K8MA 4PXEA 4GM5A 4P10A 3FX6A 3KGQA 3NH5A 3FJUA 2PJ7A 4AXVA 4OC2A 3NA6A 3PBBA 3WC6A 2EWBA 4NGPA 5LRJA 3FMCA 3WC7A 2IMOA 4ZY1A 1YMEA 2PJAA 3VH9A 3DGVA 4LQGA 1XRYA 3PBEA 4IAVA 3LWUA 5LYLA 1AYEA 4X2TA 7CPAA 4ONWA 1OBRA 1CX8A 4P45A 4JYWA 2ZEEA 3K2KA 2EK8A 4FWUA 4MCQA 2PVWA 2C6PA 3B3CA 1R3NA 4P4FA 1PYTB 5K8PA 1FNOA 5LYDA 2QJ8A 3N5FA 5JM6A 5THWA 2GLJA 4X8IA 3D7GA 3D67A 1R43A 3FECA 3K9TA 3KZWA 4NFRA 1DE4C 1LANA 1EE3P 2I3CA 1YW6A 2V8HA 3SI0A 4MHYA 1QMUA 4KSIA 5CPAA 3WT4A 2V8GA 5DS0A 4PXDA 1TF8A 3CT9A 3B3TA 3KQZA 3PFOA 3MRUA 2J9AA 1IY7A 1XBUA 2OOTA 5HVHA 1CPXA 4A37A 1ELLP 2O53A 1PCAA 3KQXA 4TNUA 4MRIA 3QNVA 1Y0YA 3I1UA 5HXDA 2AFOA 3KI9A 3PB6X 2ZOFA 4OIDA 2IJZA 3HUVA 4P4EA 3FH4A 3FEDA 3RBUA 4DYOA 2PJ6A 3RAMA 2BCOA 4FUUA 3FEEA 3H8EA 3SI1A 1IGBA 2ZEPA 3S9MA 5ELYA 1XFOA 1LCPA 2RFHA 4F9VA 2ANPA 2IQ6A 3IFEA 3S9NA 1XJOA 3B3WA 2WZNA 4BD9A 4UIBA 4ZX9A 2QVPA 3KR4A 3LMSA 4NJQA 4MHNA 3GUXA 2ZEFA 1RTQA 1Q7LA 3SJEA 1YW4A 3B7IA 3ISZA 2AFMA 4UF4A 2VL1A 4CPAA 2AFUA 3KHXA 3SJXA 2GLFA 3D4UA 2NYQA 2PVVA 3IO1A 4OC4A 1F2PA 1M4LA 2GU2A 3IIBA 4OMEA 5JGFA 2OR4A 3H8FA 3KL9A 1ARMA 2Q4ZA 2F8HA 4IK2A 4WJBA 1CP7A 2V77A 3S9LA 4F8ZA 3D7FA 3DLJA 3WC5A 2XEFA 4P4DA 2PIZA 2PJ3A 3NH4A 3L2NA 2HC9A 1Y7EA 5D8NA 5HVGA 4OKOA 2C6GA 1ZLHA 4OC0A 1H8LA 2PCUA 5LRGA 2AFSA 1TKFA 3PEIA 2ZEOA 2Q43A 2PJ8A 4P6YA 4PXCA 2AFWA 4YWYA 3IEHA 2XEGA 5J1QA 3B2YA 3BHXA 5K8NA 4B6ZA 1VGYA 1VHOA 4A94A 3KASA 1TF9A 4R7MA 4NJRA 1CP6A 1FT7A 4UEZA 4ZYQA 3VATA 4DUKA 1TKHA 2BO9A 3TX8A 5LRKA 2GREA 3BI1A 4PQAA 4UEEA 1CPSA 1CBXA 3VARA 1VHEA 4TWEA 2EK9A 1BPNA 3NH8A 5IB9A 1UWYA 4IHMA 1ARLA 2Q51A 3D66A 3IJ3A 4ZX8A 2ZEHA 4MCPA 2NSMA 3ISXA 2C6CA 4MXUA 1XMBA 3TC8A 2V8DA 1BAVA 1ZLIA 2PJ2A 4WWVA 3V7ZA 1TXRA 4NGTA 4NGSA 2XEJA 3CDXA 4ZY2A 4OC1A 1BLLE 3BXMA 3B3SA 2PIYA 2PRQA 4G1PA 4P4BA 3FF3A 3D7DA 5I4MA 1VIXA 1YLOA 4P44A 4W9YA 2CIJA 3CPXA 3SI2A 4NGNA 3GLJA 2XEIA 2CF4A 2FVGA 2V8VA 4YU9A 2F7VA 1TKJA 1YSJA 5LYFA 1Z5RA 4MHZA 4PXBA 3SJFA 4K3NA 3PRTA 3PFEA 2BOAA 3NFZA 3T8WA 2ZEMA 3JRUA 3PB7X 2PJ9A 2WYRA 4H2KA 1HDQA 3IWWA 4NGMA 4A39A 5K8OA 1Z8LA 2ABZA 3D68A 3PB4X 3H8GA 2PE3A 2DEAA 2PJ4A 4ZY0A 4UIAA 1AMPA 3GB0A 3MN8A 1Y0RA 1F57A 3RZAA 3PB9X 2AFXA 2RB7A 2CTCA 4PPZA 1LAMA 4Q7AA 1ELMP 2ZEGA 1CG2A 4MCSA 4JZ0A 2PJCA 2PJBA 4R76A 3IC1A 3WABA 2ZEDA 1HDUA 4MCRA 1HEEA 2ZOGA 4EWTA 4P4IA 1LOKA 4DJLA 5JH9A 3V38A 2PJ1A 4R8FA 2JBKA 5CBMA 2PJ0A 6CPAA 2POKA 1LAPA 1Z2LA 2JBJA 4F9UA 4NGRA 1KWMA 4A38A 4OIWA 1F2OA 1QQ9A 3D7HA
chains in the Genus database with same CATH superfamily
4UWJA 4CAXA 2QYVA 4P4JA 5LYIA 4O23A 4C2XA 2JDDA 3G3SA 4LQ6A 2CTBA 4C7HA 3R95A 3IU1A 2AFZA 3BI0A 8CPAA 4QVTA 5AG6A 4AG7A 4ZI6A 5BWAB 4M3SA 4FBEA 3NE7A 3F0AA 4M85A 2JEWA 2Z3MA 4KOYA 2IL4A 4NGQA 3CPAA 4GS4A 5D29A 4Z65A 2HQYA 2Z11A 2WSAA 4AB7A 4EMEA 2PJ5A 3FVLA 1ZG9A 4B14A 4UEFA 2I00A 2B5GB 2Z3OA 3B3VA 4OC5A 4C7IA 1IYLA 1LFWA 2I79A 3KKWA 4MMOA 4R6TA 4B12A 4FAIA 2CY2A 3DDDA 4AVBA 2ZELA 3CXSA 4JD6A 4MY3A 2D4OA 4NEXA 2NMTA 5HVFA 1YREA 1YX0A 3DSBA 4QBJA 4MHPA 2J8NA 1RXTA 4UFVA 2YNCC 2C1CA 4Q38A 4C2YA 1IIDA 1GYTA 1YGHA 2BL1A 5G21A 2Z10A 3SJGA 4OAEA 1NSAA 2BUEA 3QB8A 3PB8X 1MJ9A 2OZUA 1OZPA 1DTDA 2ZW4A 2REEA 1FY7A 2G0BA 2OZHA 2P6GA 2ZENA 2G3AA 2PDOA 3C26A 3EXNA 3HLPA 4JLYA 4XPLA 2Z3NA 1ZG7A 1ZG8A 1BPMA 2B4DA 3G8WA 4X3RA 4EFDA 3FYNA 3DNSA 3B35A 1PU9A 4RUHA 2G9DA 2HB6A 4OP4A 4AVAA 5JPHA 2O4HA 3KHZA 4OC3A 4ORFA 3OWCA 3QAHA 1JQGA 3KR5A 5K8MA 5H84A 4PXEA 5KTDA 4NSQA 2G3TA 4GM5A 4P10A 3LACA 3FX6A 3KGQA 2EBJA 4CAEA 2WUUA 3NH5A 5F48A 3FJUA 4KOXA 2PJ7A 2JDCA 3DR6A 4OC2A 3S6KA 1IICA 1WWZA 3NA6A 4AXVA 1Z4EA 4EVYA 3PBBA 1X10A 3WC6A 4KLWA 2EWBA 3SXOA 3ZJ0A 4B5PB 3W91A 2Q04A 2FIWA 4NGPA 5LRJA 3FMCA 4U9ZA 5EMIA 1XOVA 3E0KA 4UWIA 3WC7A 2AJ6A 2Q7SA 4NCZA 2IMOA 1Y9KA 4ZY1A 3GIUA 1YMEA 2PJAA 3VH9A 3DGVA 4LQGA 1XRYA 3PBEA 5DWNA 3UY5A 5J8CA 4IAVA 4R3LA 3FB3A 3LWUA 5LYLA 1AYEA 5J8FA 4PSWA 5A28A 4CS0B 2ATRA 4X2TA 7CPAA 4ONWA 3FXTA 1OBRA 3A9LA 1CX8A 4P45A 4JYWA 2ZEEA 3K2KA 4UCNA 2EK8A 1I21A 3PP9A 2PVWA 2C6PA 3B3CA 4FWUA 4MCQA 5F49A 4F0YA 1JWQA 2GIVA 1R3NA 4P4FA 1PYTB 5E96A 5K8PA 3TE4A 1FNOA 1S60A 4KORA 1S7NA 4OLLA 2AE6A 3D2PA 3TT2A 5LYDA 3TFYA 2QJ8A 4KVOE 3N5FA 4F6AA 5JM6A 2ZPAA 4UFWA 4L89A 5THWA 1YR0A 2GLJA 4A33A 3P2HA 3V8IA 4X8IA 5F09A 4ZGYB 3D7GA 3D67A 1IB1E 2FXFA 1QSTA 1R43A 3FECA 3K9TA 3KZWA 2VEZA 1Y7RA 4LUAA 4KOVA 4NFRA 1QSRA 1V0CA 2FT0A 1DE4C 3GKRA 4CGPA 1LANA 1EE3P 2I3CA 3FBUA 1QSOA 3TO9A 1YW6A 2YNDA 2V8HA 3SI0A 3SXNA 5C82A 4MHYA 1QMUA 4KSIA 3PGPA 5CPAA 3WT4A 2V8GA 4MFKA 3ZZIA 2VQYA 2VI7A 5DS0A 3K9UA 4PXDA 5C88A 1TF8A 3CT9A 5G20A 1GHEA 4KSAA 3B3TA 3KQZA 3PFOA 3R1KA 5F46A 3MRUA 2J9AA 2OZGA 5A27A 1TIQA 3TOAA 1IY7A 1XBUA 1YLEA 3QAYA 4MJ8A 2OOTA 4E0AA 5HVHA 4J3GA 4KOWA 4CYPA 1CPXA 4KVXA 4RN7A 4A37A 2R98A 1ELLP 2ZW7A 3I9SA 2O53A 1PCAA 3KQXA 4TNUA 4HNXB 1I1DA 1Z8XA 1CJWA 4B10A 1XE4A 4MRIA 1IYKA 5G1ZA 2EUIA 3TCVA 1LRZA 2ZXVA 1IOIA 3QNVA 2VBQA 1Y0YA 1B87A 3I1UA 3VWEA 5HXDA 2AFOA 4MFJA 3IWGA 3KI9A 3EY5A 3PB6X 4M6GA 1S7FA 2ZOFA 2QIRA 1S3ZA 3T9YA 4CRYB 4JXQA 4OIDA 3IU2A 2IJZA 2R8VA 3HUVA 2QECA 4P4EA 3FH4A 1M44A 1N71A 3FEDA 4B5OA 4II9A 3R9FA 3S6FA 2H5MA 4CAVA 3RBUA 4DYOA 1M4IA 2PJ6A 3RAMA 2BCOA 4FUUA 2DPSA 3FEEA 3H8EA 4K30A 3SI1A 1IGBA 1YQEA 4UA3A 2ZEPA 3S9MA 5ELYA 3FRMA 1XFOA 2QMLA 1LCPA 3LD2A 4MHDA 2Q0YA 2FS5A 2RFHA 4F9VA 2ANPA 2IQ6A 1KZFA 3IFEA 3S9NA 1XJOA 4A2ZA 1P0HA 2HUZA 3RO0A 3B3WA 2CXAA 2WZNA 4ZBGA 4BD9A 4UIBA 3GYAA 3TO7A 3IGRA 4ZX9A 4X5KA 2QVPA 3NE8A 2VXKA 3KR4A 3LMSA 1Z8WA 4NJQA 4QC6A 3BJ7A 4MHNA 3GUXA 4DNCA 2ZEFA 4CAFA 4B13A 1RTQA 1Q7LA 3N7ZA 3SJEA 1YW4A 2CNSA 3B7IA 4CGMA 3ISZA 4QB9A 2AFMA 4YFJA 2O28A 4UF4A 2VL1A 4CPAA 4KOTA 2AFUA 3KHXA 4FD6A 4HNYB 2GLFA 3SJXA 3BLNA 3TO6A 3D4UA 1X12A 4H89A 4GXHA 1P4NA 1I12A 2NYQA 1QSNA 2PVVA 4KZTA 3RNZA 3IO1A 4OC4A 1AUGA 4UBRA 1XMTA 1SQHA 3JVNA 2R7HA 1F2PA 1M4LA 4MY0A 2J8MA 2GU2A 5I0CA 2Z3KA 5DWMA 3IIBA 4OMEA 4UCPA 4CGNA 5JGFA 4RS2A 2Z3LA 2OR4A 3IWEA 3H8FA 3KL9A 1ARMA 2Q4ZA 2F8HA 2B3UA 2Z3PA 4M6IA 4ONUA 4IK2A 1YK3A 4WJBA 4A95A 2KCWA 1CP7A 2V77A 1Z4RA 4OADA 3S9LA 5JQ4A 4F8ZA 4AG9A 5EC4A 3D7FA 3DLJA 5H86A 4CGLA 3WC5A 4E8OA 3GY9A 5AG4A 1ZO0A 2XEFA 2PC1A 4P4DA 2PIZA 2B5GA 2PJ3A 4A32A 3NH4A 3L2NA 3D8PA 2HC9A 4U9YA 1Y7EA 3PZJA 4R3KA 5D8NA 4A30A 2Q44A 4MFZA 3T90A 5HVGA 2YGWA 5F47A 4OKOA 2C6GA 3MGDA 1ZLHA 2FCKA 4OC0A 4KOUA 1H8LA 3FNCA 2B4DB 2PCUA 5LRGA 1BO4A 1S5KA 5GCNA 2AFSA 1TKFA 3PEIA 2FSRA 2ZEOA 2Q43A 1A2ZA 1KUVA 2PJ8A 4KLVA 5CNPA 2OB0A 4P6YA 4PXCA 5IX3A 2AFWA 4YWYA 2FL4A 3H4QA 2DXQA 3IEHA 3W6XA 2XEGA 1KUYA 5EBVA 2X7BA 4XPKA 5J1QA 1XF8A 3B2YA 3BHXA 3EFAA 5K8NA 2EO8A 4PV6A 3SHPA 2VZZA 4B6ZA 1VGYA 1VHOA 4A94A 2GFQA 4KUBA 4UCMA 5IV0A 2C27A 2FE7A 2REFA 3KASA 4MFQA 3H5ZA 1TF9A 2K5TA 2ZW6A 4KUAA 4R7MA 4NJRA 5KTAA 1CP6A 2GE3A 4B5PA 1MK4A 1FT7A 2PSWA 4R87A 1Q2DA 3D3SA 1M4GA 4UEZA 4PK2A 2FIAA 4ZYQA 3VATA 4DUKA 1TKHA 2BO9A 3TX8A 5LRKA 1YVOA 2GREA 4CRZB 3F5BA 4NF1A 3R9EA 3BI1A 5ISVA 4PQAA 4UEEA 1CPSA 4Q36A 1CBXA 1K4JA 3VARA 1VHEA 4HKFA 2Q4VA 4TWEA 4FD7A 4H6ZA 1J4JA 4PSXA 4CYOA 3R9GA 2YNCA 2EK9A 4H6UA 3WR7A 1BPNA 3NH8A 1S7LA 2DPTA 4Y49C 4LX9A 2YNEA 2JEVA 4CAWA 5IB9A 4C68A 3I3GA 4HNWB 1UWYA 4IHMA 5AG5A 1ARLA 2Q51A 3D66A 2VZYA 3IJ3A 4CYNA 4ZX8A 1Z9UA 4C2ZA 1XIXA 2ODFA 2GANA 2Q4YA 1Y9WA 2ZEHA 3EC4A 4MCPA 4PK3A 4RI1A 2NSMA 3ISXA 2C6CA 4MXUA 1MJBA 4R57A 2CNTA 1XEBA 1L0CA 5FVJA 3S6GA 1XMBA 2Q7BA 3TC8A 3RYOA 3TTHA 4HPSA 4KS9A 4UFXA 2V8DA 1NSLA 1IU8A 4BMHA 2RC4A 2WPXA 4XPDC 1BAVA 1ZLIA 2PJ2A 4U5YA 4WWVA 4CGOA 2DF5A 3V7ZA 4YRHA 3EO4A 1TXRA 4NGTA 4NGSA 2XEJA 4XNHC 3CDXA 4ZY2A 4FD5A 5IB0A 4OC1A 4R9MA 4IUSA 1BLLE 1M4DA 4F0XA 2PR8A 4JXRA 5HMNA 2A4NA 2D4PA 2PIYA 2BEIA 2PRQA 3B3SA 1CM0A 3BXMA 4G1PA 1S7KA 4P4BA 5AGEA 3FF3A 2B4BA 3D7DA 1WK4A 5I4MA 1VIXA 1YLOA 2EVNA 4P44A 2JLMA 4W9YA 3TOBA 2OU2A 3DR8A 2BSWA 2CIJA 3CPXA 3F8KA 3SI2A 2ARHA 4NGNA 3GLJA 2XEIA 4M6HA 2CF4A 4Y49B 2FVGA 2V8VA 4YU9A 4NXYA 2F7VA 4KSFA 2B58A 3FIXA 1TKJA 1YSJA 2CNMA 1RO5A 5LYFA 1Z5RA 4MHZA 4PXBA 3SJFA 2F5IA 1U6MA 3B8GA 4K3NA 3CXPA 3PRTA 1VKCA 3LODA 3PFEA 2BOAA 3NFZA 3T8WA 2ZEMA 3JRUA 3PB7X 2PJ9A 2WYRA 4H2KA 1HDQA 3IWWA 4E2AA 1Z8TA 4NGMA 4A39A 5K8OA 2PR1A 4L8AA 4BINA 1Z8LA 2ABZA 3D68A 3PB4X 3H8GA 3JTKA 2PE3A 4MBUA 2DEAA 2PJ4A 1IOFA 4ZY0A 4JJXA 4XPDB 3BJ8A 4UIAA 3VWDA 2J8RA 4A31A 1AMPA 3GB0A 4BBHA 2WPWA 1UFHA 3MN8A 4MI4A 3JUWA 1Y0RA 4YGOA 1F57A 3RZAA 2OH1A 1MJAA 4XNHB 3PB9X 2Z0ZA 3D2MA 1R57A 1KUXA 5HH1A 2P6EA 3W6SA 4B11A 1NE9A 4QUSA 2AFXA 2RB7A 1BOBA 1NMTA 2CTCA 1LAMA 4PPZA 4Q7AA 1VHSA 4I49A 1ELMP 2ZEGA 1B6BA 1CG2A 4MCSA 1PUAA 4IF5A 2R1IA 2PJCA 4JZ0A 4AVCA 4FD4A 4CYQA 2B3VA 2PJBA 5G22A 4R76A 3IC1A 1M1DA 3CXQA 2ZEDA 3WABA 2Y0MA 2PRBA 1HDUA 2PQ8A 4MCRA 1Q2YA 3R96A 1HEEA 3P2FA 2ZOGA 4MFLA 4EWTA 4KVME 4MFPA 4KOSA 5KTCA 1Q2CA 4P4IA 5AG7A 1LOKA 4DJLA 2ZW5A 5JH9A 3V38A 2PJ1A 3CZXA 2JBKA 4R8FA 5CBMA 2PJ0A 6CPAA 2POKA 1LAPA 1Z2LA 2JBJA 4F9UA 4NGRA 4JWPA 1KWMA 1ON0A 4A38A 4OIWA 3S6HA 2P0WA 1F2OA 2HV2A 1QSMA 2P6FA 1YVKA 1QQ9A 3D7HA
chains in the Genus database with same CATH topology
2QYVA 4P4JA 5LYIA 4O23A 2CTBA 2AFZA 3BI0A 8CPAA 4ZI6A 4FBEA 2JEWA 4Z65A 4NGQA 5D29A 3CPAA 4EMEA 2PJ5A 3FVLA 1ZG9A 4UEFA 3B3VA 4OC5A 1LFWA 4MMOA 4R6TA 4FAIA 2ZELA 5HVFA 4MHPA 2C1CA 1GYTA 3SJGA 1NSAA 3PB8X 1DTDA 2ZENA 3HLPA 5F09A 4X3RA 4EFDA 1ZG7A 1ZG8A 1BPMA 3B35A 4RUHA 2G9DA 2HB6A 4OP4A 2O4HA 3KHZA 4OC3A 1JQGA 3KR5A 5K8MA 4PXEA 4GM5A 4P10A 3FX6A 3KGQA 3NH5A 3FJUA 2PJ7A 4AXVA 4OC2A 3NA6A 3PBBA 3WC6A 2EWBA 4NGPA 5LRJA 3FMCA 3WC7A 2IMOA 4ZY1A 1YMEA 2PJAA 3VH9A 3DGVA 4LQGA 1XRYA 3PBEA 4IAVA 3LWUA 5LYLA 1AYEA 4X2TA 7CPAA 4ONWA 1OBRA 1CX8A 4P45A 4JYWA 2ZEEA 3K2KA 2EK8A 4FWUA 4MCQA 2PVWA 2C6PA 3B3CA 1R3NA 4P4FA 1PYTB 5K8PA 1FNOA 5LYDA 2QJ8A 3N5FA 5JM6A 5THWA 2GLJA 4X8IA 3D7GA 3D67A 1R43A 3FECA 3K9TA 3KZWA 4NFRA 1DE4C 1LANA 1EE3P 2I3CA 1YW6A 2V8HA 3SI0A 4MHYA 1QMUA 4KSIA 5CPAA 3WT4A 2V8GA 5DS0A 4PXDA 1TF8A 3CT9A 3B3TA 3KQZA 3PFOA 3MRUA 2J9AA 1IY7A 1XBUA 2OOTA 5HVHA 1CPXA 4A37A 1ELLP 2O53A 1PCAA 3KQXA 4TNUA 4MRIA 3QNVA 1Y0YA 3I1UA 5HXDA 2AFOA 3KI9A 3PB6X 2ZOFA 4OIDA 2IJZA 3HUVA 4P4EA 3FH4A 3FEDA 3RBUA 4DYOA 2PJ6A 3RAMA 2BCOA 4FUUA 3FEEA 3H8EA 3SI1A 1IGBA 2ZEPA 3S9MA 5ELYA 1XFOA 1LCPA 2RFHA 4F9VA 2ANPA 2IQ6A 3IFEA 3S9NA 1XJOA 3B3WA 2WZNA 4BD9A 4UIBA 4ZX9A 2QVPA 3KR4A 3LMSA 4NJQA 4MHNA 3GUXA 2ZEFA 1RTQA 1Q7LA 3SJEA 1YW4A 3B7IA 3ISZA 2AFMA 4UF4A 2VL1A 4CPAA 2AFUA 3KHXA 3SJXA 2GLFA 3D4UA 2NYQA 2PVVA 3IO1A 4OC4A 1F2PA 1M4LA 2GU2A 3IIBA 4OMEA 5JGFA 2OR4A 3H8FA 3KL9A 1ARMA 2Q4ZA 2F8HA 4IK2A 4WJBA 1CP7A 2V77A 3S9LA 4F8ZA 3D7FA 3DLJA 3WC5A 2XEFA 4P4DA 2PIZA 2PJ3A 3NH4A 3L2NA 2HC9A 1Y7EA 5D8NA 5HVGA 4OKOA 2C6GA 1ZLHA 4OC0A 1H8LA 2PCUA 5LRGA 2AFSA 1TKFA 3PEIA 2ZEOA 2Q43A 2PJ8A 4P6YA 4PXCA 2AFWA 4YWYA 3IEHA 2XEGA 5J1QA 3B2YA 3BHXA 5K8NA 4B6ZA 1VGYA 1VHOA 4A94A 3KASA 1TF9A 4R7MA 4NJRA 1CP6A 1FT7A 4UEZA 4ZYQA 3VATA 4DUKA 1TKHA 2BO9A 3TX8A 5LRKA 2GREA 3BI1A 4PQAA 4UEEA 1CPSA 1CBXA 3VARA 1VHEA 4TWEA 2EK9A 1BPNA 3NH8A 5IB9A 1UWYA 4IHMA 1ARLA 2Q51A 3D66A 3IJ3A 4ZX8A 2ZEHA 4MCPA 2NSMA 3ISXA 2C6CA 4MXUA 1XMBA 3TC8A 2V8DA 1BAVA 1ZLIA 2PJ2A 4WWVA 3V7ZA 1TXRA 4NGTA 4NGSA 2XEJA 3CDXA 4ZY2A 4OC1A 1BLLE 3BXMA 3B3SA 2PIYA 2PRQA 4G1PA 4P4BA 3FF3A 3D7DA 5I4MA 1VIXA 1YLOA 4P44A 4W9YA 2CIJA 3CPXA 3SI2A 4NGNA 3GLJA 2XEIA 2CF4A 2FVGA 2V8VA 4YU9A 2F7VA 1TKJA 1YSJA 5LYFA 1Z5RA 4MHZA 4PXBA 3SJFA 4K3NA 3PRTA 3PFEA 2BOAA 3NFZA 3T8WA 2ZEMA 3JRUA 3PB7X 2PJ9A 2WYRA 4H2KA 1HDQA 3IWWA 4NGMA 4A39A 5K8OA 1Z8LA 2ABZA 3D68A 3PB4X 3H8GA 2PE3A 2DEAA 2PJ4A 4ZY0A 4UIAA 1AMPA 3GB0A 3MN8A 1Y0RA 1F57A 3RZAA 3PB9X 2AFXA 2RB7A 2CTCA 4PPZA 1LAMA 4Q7AA 1ELMP 2ZEGA 1CG2A 4MCSA 4JZ0A 2PJCA 2PJBA 4R76A 3IC1A 3WABA 2ZEDA 1HDUA 4MCRA 1HEEA 2ZOGA 4EWTA 4P4IA 1LOKA 4DJLA 5JH9A 3V38A 2PJ1A 4R8FA 2JBKA 5CBMA 2PJ0A 6CPAA 2POKA 1LAPA 1Z2LA 2JBJA 4F9UA 4NGRA 1KWMA 4A38A 4OIWA 1F2OA 1QQ9A 3D7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QYV A;  4P4J A;  5LYI A;  4O23 A;  2CTB A;  2AFZ A;  3BI0 A;  8CPA A;  4ZI6 A;  4FBE A;  2JEW A;  4Z65 A;  4NGQ A;  5D29 A;  3CPA A;  4EME A;  2PJ5 A;  3FVL A;  1ZG9 A;  4UEF A;  3B3V A;  4OC5 A;  1LFW A;  4MMO A;  4R6T A;  4FAI A;  2ZEL A;  5HVF A;  4MHP A;  2C1C A;  1GYT A;  3SJG A;  1NSA A;  3PB8 X;  1DTD A;  2ZEN A;  3HLP A;  5F09 A;  4X3R A;  4EFD A;  1ZG7 A;  1ZG8 A;  1BPM A;  3B35 A;  4RUH A;  2G9D A;  2HB6 A;  4OP4 A;  2O4H A;  3KHZ A;  4OC3 A;  1JQG A;  3KR5 A;  5K8M A;  4PXE A;  4GM5 A;  4P10 A;  3FX6 A;  3KGQ A;  3NH5 A;  3FJU A;  2PJ7 A;  4AXV A;  4OC2 A;  3NA6 A;  3PBB A;  3WC6 A;  2EWB A;  4NGP A;  5LRJ A;  3FMC A;  3WC7 A;  2IMO A;  4ZY1 A;  1YME A;  2PJA A;  3VH9 A;  3DGV A;  4LQG A;  1XRY A;  3PBE A;  4IAV A;  3LWU A;  5LYL A;  1AYE A;  4X2T A;  7CPA A;  4ONW A;  1OBR A;  1CX8 A;  4P45 A;  4JYW A;  2ZEE A;  3K2K A;  2EK8 A;  4FWU A;  4MCQ A;  2PVW A;  2C6P A;  3B3C A;  1R3N A;  4P4F A;  1PYT B;  5K8P A;  1FNO A;  5LYD A;  2QJ8 A;  3N5F A;  5JM6 A;  5THW A;  2GLJ A;  4X8I A;  3D7G A;  3D67 A;  1R43 A;  3FEC A;  3K9T A;  3KZW A;  4NFR A;  1DE4 C;  1LAN A;  1EE3 P;  2I3C A;  1YW6 A;  2V8H A;  3SI0 A;  4MHY A;  1QMU A;  4KSI A;  5CPA A;  3WT4 A;  2V8G A;  5DS0 A;  4PXD A;  1TF8 A;  3CT9 A;  3B3T A;  3KQZ A;  3PFO A;  3MRU A;  2J9A A;  1IY7 A;  1XBU A;  2OOT A;  5HVH A;  1CPX A;  4A37 A;  1ELL P;  2O53 A;  1PCA A;  3KQX A;  4TNU A;  4MRI A;  3QNV A;  1Y0Y A;  3I1U A;  5HXD A;  2AFO A;  3KI9 A;  3PB6 X;  2ZOF A;  4OID A;  2IJZ A;  3HUV A;  4P4E A;  3FH4 A;  3FED A;  3RBU A;  4DYO A;  2PJ6 A;  3RAM A;  2BCO A;  4FUU A;  3FEE A;  3H8E A;  3SI1 A;  1IGB A;  2ZEP A;  3S9M A;  5ELY A;  1XFO A;  1LCP A;  2RFH A;  4F9V A;  2ANP A;  2IQ6 A;  3IFE A;  3S9N A;  1XJO A;  3B3W A;  2WZN A;  4BD9 A;  4UIB A;  4ZX9 A;  2QVP A;  3KR4 A;  3LMS A;  4NJQ A;  4MHN A;  3GUX A;  2ZEF A;  1RTQ A;  1Q7L A;  3SJE A;  1YW4 A;  3B7I A;  3ISZ A;  2AFM A;  4UF4 A;  2VL1 A;  4CPA A;  2AFU A;  3KHX A;  3SJX A;  2GLF A;  3D4U A;  2NYQ A;  2PVV A;  3IO1 A;  4OC4 A;  1F2P A;  1M4L A;  2GU2 A;  3IIB A;  4OME A;  5JGF A;  2OR4 A;  3H8F A;  3KL9 A;  1ARM A;  2Q4Z A;  2F8H A;  4IK2 A;  4WJB A;  1CP7 A;  2V77 A;  3S9L A;  4F8Z A;  3D7F A;  3DLJ A;  3WC5 A;  2XEF A;  4P4D A;  2PIZ A;  2PJ3 A;  3NH4 A;  3L2N A;  2HC9 A;  1Y7E A;  5D8N A;  5HVG A;  4OKO A;  2C6G A;  1ZLH A;  4OC0 A;  1H8L A;  2PCU A;  5LRG A;  2AFS A;  1TKF A;  3PEI A;  2ZEO A;  2Q43 A;  2PJ8 A;  4P6Y A;  4PXC A;  2AFW A;  4YWY A;  3IEH A;  2XEG A;  5J1Q A;  3B2Y A;  3BHX A;  5K8N A;  4B6Z A;  1VGY A;  1VHO A;  4A94 A;  3KAS A;  1TF9 A;  4R7M A;  4NJR A;  1CP6 A;  1FT7 A;  4UEZ A;  4ZYQ A;  3VAT A;  4DUK A;  1TKH A;  2BO9 A;  3TX8 A;  5LRK A;  2GRE A;  3BI1 A;  4PQA A;  4UEE A;  1CPS A;  1CBX A;  3VAR A;  1VHE A;  4TWE A;  2EK9 A;  1BPN A;  3NH8 A;  5IB9 A;  1UWY A;  4IHM A;  1ARL A;  2Q51 A;  3D66 A;  3IJ3 A;  4ZX8 A;  2ZEH A;  4MCP A;  2NSM A;  3ISX A;  2C6C A;  4MXU A;  1XMB A;  3TC8 A;  2V8D A;  1BAV A;  1ZLI A;  2PJ2 A;  4WWV A;  3V7Z A;  1TXR A;  4NGT A;  4NGS A;  2XEJ A;  3CDX A;  4ZY2 A;  4OC1 A;  1BLL E;  3BXM A;  3B3S A;  2PIY A;  2PRQ A;  4G1P A;  4P4B A;  3FF3 A;  3D7D A;  5I4M A;  1VIX A;  1YLO A;  4P44 A;  4W9Y A;  2CIJ A;  3CPX A;  3SI2 A;  4NGN A;  3GLJ A;  2XEI A;  2CF4 A;  2FVG A;  2V8V A;  4YU9 A;  2F7V A;  1TKJ A;  1YSJ A;  5LYF A;  1Z5R A;  4MHZ A;  4PXB A;  3SJF A;  4K3N A;  3PRT A;  3PFE A;  2BOA A;  3NFZ A;  3T8W A;  2ZEM A;  3JRU A;  3PB7 X;  2PJ9 A;  2WYR A;  4H2K A;  1HDQ A;  3IWW A;  4NGM A;  4A39 A;  5K8O A;  1Z8L A;  2ABZ A;  3D68 A;  3PB4 X;  3H8G A;  2PE3 A;  2DEA A;  2PJ4 A;  4ZY0 A;  4UIA A;  1AMP A;  3GB0 A;  3MN8 A;  1Y0R A;  1F57 A;  3RZA A;  3PB9 X;  2AFX A;  2RB7 A;  2CTC A;  4PPZ A;  1LAM A;  4Q7A A;  1ELM P;  2ZEG A;  1CG2 A;  4MCS A;  4JZ0 A;  2PJC A;  2PJB A;  4R76 A;  3IC1 A;  3WAB A;  2ZED A;  1HDU A;  4MCR A;  1HEE A;  2ZOG A;  4EWT A;  4P4I A;  1LOK A;  4DJL A;  5JH9 A;  3V38 A;  2PJ1 A;  4R8F A;  2JBK A;  5CBM A;  2PJ0 A;  6CPA A;  2POK A;  1LAP A;  1Z2L A;  2JBJ A;  4F9U A;  4NGR A;  1KWM A;  4A38 A;  4OIW A;  1F2O A;  1QQ9 A;  3D7H A; 
#chains in the Genus database with same CATH topology
 4UWJ A;  4CAX A;  2QYV A;  4P4J A;  5LYI A;  4O23 A;  4C2X A;  2JDD A;  3G3S A;  4LQ6 A;  2CTB A;  4C7H A;  3R95 A;  3IU1 A;  2AFZ A;  3BI0 A;  8CPA A;  4QVT A;  5AG6 A;  4AG7 A;  4ZI6 A;  5BWA B;  4M3S A;  4FBE A;  3NE7 A;  3F0A A;  4M85 A;  2JEW A;  2Z3M A;  4KOY A;  2IL4 A;  4NGQ A;  3CPA A;  4GS4 A;  5D29 A;  4Z65 A;  2HQY A;  2Z11 A;  2WSA A;  4AB7 A;  4EME A;  2PJ5 A;  3FVL A;  1ZG9 A;  4B14 A;  4UEF A;  2I00 A;  2B5G B;  2Z3O A;  3B3V A;  4OC5 A;  4C7I A;  1IYL A;  1LFW A;  2I79 A;  3KKW A;  4MMO A;  4R6T A;  4B12 A;  4FAI A;  2CY2 A;  3DDD A;  4AVB A;  2ZEL A;  3CXS A;  4JD6 A;  4MY3 A;  2D4O A;  4NEX A;  2NMT A;  5HVF A;  1YRE A;  1YX0 A;  3DSB A;  4QBJ A;  4MHP A;  2J8N A;  1RXT A;  4UFV A;  2YNC C;  2C1C A;  4Q38 A;  4C2Y A;  1IID A;  1GYT A;  1YGH A;  2BL1 A;  5G21 A;  2Z10 A;  3SJG A;  4OAE A;  1NSA A;  2BUE A;  3QB8 A;  3PB8 X;  1MJ9 A;  2OZU A;  1OZP A;  1DTD A;  2ZW4 A;  2REE A;  1FY7 A;  2G0B A;  2OZH A;  2P6G A;  2ZEN A;  2G3A A;  2PDO A;  3C26 A;  3EXN A;  3HLP A;  4JLY A;  4XPL A;  2Z3N A;  1ZG7 A;  1ZG8 A;  1BPM A;  2B4D A;  3G8W A;  4X3R A;  4EFD A;  3FYN A;  3DNS A;  3B35 A;  1PU9 A;  4RUH A;  2G9D A;  2HB6 A;  4OP4 A;  4AVA A;  5JPH A;  2O4H A;  3KHZ A;  4OC3 A;  4ORF A;  3OWC A;  3QAH A;  1JQG A;  3KR5 A;  5K8M A;  5H84 A;  4PXE A;  5KTD A;  4NSQ A;  2G3T A;  4GM5 A;  4P10 A;  3LAC A;  3FX6 A;  3KGQ A;  2EBJ A;  4CAE A;  2WUU A;  3NH5 A;  5F48 A;  3FJU A;  4KOX A;  2PJ7 A;  2JDC A;  3DR6 A;  4OC2 A;  3S6K A;  1IIC A;  1WWZ A;  3NA6 A;  4AXV A;  1Z4E A;  4EVY A;  3PBB A;  1X10 A;  3WC6 A;  4KLW A;  2EWB A;  3SXO A;  3ZJ0 A;  4B5P B;  3W91 A;  2Q04 A;  2FIW A;  4NGP A;  5LRJ A;  3FMC A;  4U9Z A;  5EMI A;  1XOV A;  3E0K A;  4UWI A;  3WC7 A;  2AJ6 A;  2Q7S A;  4NCZ A;  2IMO A;  1Y9K A;  4ZY1 A;  3GIU A;  1YME A;  2PJA A;  3VH9 A;  3DGV A;  4LQG A;  1XRY A;  3PBE A;  5DWN A;  3UY5 A;  5J8C A;  4IAV A;  4R3L A;  3FB3 A;  3LWU A;  5LYL A;  1AYE A;  5J8F A;  4PSW A;  5A28 A;  4CS0 B;  2ATR A;  4X2T A;  7CPA A;  4ONW A;  3FXT A;  1OBR A;  3A9L A;  1CX8 A;  4P45 A;  4JYW A;  2ZEE A;  3K2K A;  4UCN A;  2EK8 A;  1I21 A;  3PP9 A;  2PVW A;  2C6P A;  3B3C A;  4FWU A;  4MCQ A;  5F49 A;  4F0Y A;  1JWQ A;  2GIV A;  1R3N A;  4P4F A;  1PYT B;  5E96 A;  5K8P A;  3TE4 A;  1FNO A;  1S60 A;  4KOR A;  1S7N A;  4OLL A;  2AE6 A;  3D2P A;  3TT2 A;  5LYD A;  3TFY A;  2QJ8 A;  4KVO E;  3N5F A;  4F6A A;  5JM6 A;  2ZPA A;  4UFW A;  4L89 A;  5THW A;  1YR0 A;  2GLJ A;  4A33 A;  3P2H A;  3V8I A;  4X8I A;  5F09 A;  4ZGY B;  3D7G A;  3D67 A;  1IB1 E;  2FXF A;  1QST A;  1R43 A;  3FEC A;  3K9T A;  3KZW A;  2VEZ A;  1Y7R A;  4LUA A;  4KOV A;  4NFR A;  1QSR A;  1V0C A;  2FT0 A;  1DE4 C;  3GKR A;  4CGP A;  1LAN A;  1EE3 P;  2I3C A;  3FBU A;  1QSO A;  3TO9 A;  1YW6 A;  2YND A;  2V8H A;  3SI0 A;  3SXN A;  5C82 A;  4MHY A;  1QMU A;  4KSI A;  3PGP A;  5CPA A;  3WT4 A;  2V8G A;  4MFK A;  3ZZI A;  2VQY A;  2VI7 A;  5DS0 A;  3K9U A;  4PXD A;  5C88 A;  1TF8 A;  3CT9 A;  5G20 A;  1GHE A;  4KSA A;  3B3T A;  3KQZ A;  3PFO A;  3R1K A;  5F46 A;  3MRU A;  2J9A A;  2OZG A;  5A27 A;  1TIQ A;  3TOA A;  1IY7 A;  1XBU A;  1YLE A;  3QAY A;  4MJ8 A;  2OOT A;  4E0A A;  5HVH A;  4J3G A;  4KOW A;  4CYP A;  1CPX A;  4KVX A;  4RN7 A;  4A37 A;  2R98 A;  1ELL P;  2ZW7 A;  3I9S A;  2O53 A;  1PCA A;  3KQX A;  4TNU A;  4HNX B;  1I1D A;  1Z8X A;  1CJW A;  4B10 A;  1XE4 A;  4MRI A;  1IYK A;  5G1Z A;  2EUI A;  3TCV A;  1LRZ A;  2ZXV A;  1IOI A;  3QNV A;  2VBQ A;  1Y0Y A;  1B87 A;  3I1U A;  3VWE A;  5HXD A;  2AFO A;  4MFJ A;  3IWG A;  3KI9 A;  3EY5 A;  3PB6 X;  4M6G A;  1S7F A;  2ZOF A;  2QIR A;  1S3Z A;  3T9Y A;  4CRY B;  4JXQ A;  4OID A;  3IU2 A;  2IJZ A;  2R8V A;  3HUV A;  2QEC A;  4P4E A;  3FH4 A;  1M44 A;  1N71 A;  3FED A;  4B5O A;  4II9 A;  3R9F A;  3S6F A;  2H5M A;  4CAV A;  3RBU A;  4DYO A;  1M4I A;  2PJ6 A;  3RAM A;  2BCO A;  4FUU A;  2DPS A;  3FEE A;  3H8E A;  4K30 A;  3SI1 A;  1IGB A;  1YQE A;  4UA3 A;  2ZEP A;  3S9M A;  5ELY A;  3FRM A;  1XFO A;  2QML A;  1LCP A;  3LD2 A;  4MHD A;  2Q0Y A;  2FS5 A;  2RFH A;  4F9V A;  2ANP A;  2IQ6 A;  1KZF A;  3IFE A;  3S9N A;  1XJO A;  4A2Z A;  1P0H A;  2HUZ A;  3RO0 A;  3B3W A;  2CXA A;  2WZN A;  4ZBG A;  4BD9 A;  4UIB A;  3GYA A;  3TO7 A;  3IGR A;  4ZX9 A;  4X5K A;  2QVP A;  3NE8 A;  2VXK A;  3KR4 A;  3LMS A;  1Z8W A;  4NJQ A;  4QC6 A;  3BJ7 A;  4MHN A;  3GUX A;  4DNC A;  2ZEF A;  4CAF A;  4B13 A;  1RTQ A;  1Q7L A;  3N7Z A;  3SJE A;  1YW4 A;  2CNS A;  3B7I A;  4CGM A;  3ISZ A;  4QB9 A;  2AFM A;  4YFJ A;  2O28 A;  4UF4 A;  2VL1 A;  4CPA A;  4KOT A;  2AFU A;  3KHX A;  4FD6 A;  4HNY B;  2GLF A;  3SJX A;  3BLN A;  3TO6 A;  3D4U A;  1X12 A;  4H89 A;  4GXH A;  1P4N A;  1I12 A;  2NYQ A;  1QSN A;  2PVV A;  4KZT A;  3RNZ A;  3IO1 A;  4OC4 A;  1AUG A;  4UBR A;  1XMT A;  1SQH A;  3JVN A;  2R7H A;  1F2P A;  1M4L A;  4MY0 A;  2J8M A;  2GU2 A;  5I0C A;  2Z3K A;  5DWM A;  3IIB A;  4OME A;  4UCP A;  4CGN A;  5JGF A;  4RS2 A;  2Z3L A;  2OR4 A;  3IWE A;  3H8F A;  3KL9 A;  1ARM A;  2Q4Z A;  2F8H A;  2B3U A;  2Z3P A;  4M6I A;  4ONU A;  4IK2 A;  1YK3 A;  4WJB A;  4A95 A;  2KCW A;  1CP7 A;  2V77 A;  1Z4R A;  4OAD A;  3S9L A;  5JQ4 A;  4F8Z A;  4AG9 A;  5EC4 A;  3D7F A;  3DLJ A;  5H86 A;  4CGL A;  3WC5 A;  4E8O A;  3GY9 A;  5AG4 A;  1ZO0 A;  2XEF A;  2PC1 A;  4P4D A;  2PIZ A;  2B5G A;  2PJ3 A;  4A32 A;  3NH4 A;  3L2N A;  3D8P A;  2HC9 A;  4U9Y A;  1Y7E A;  3PZJ A;  4R3K A;  5D8N A;  4A30 A;  2Q44 A;  4MFZ A;  3T90 A;  5HVG A;  2YGW A;  5F47 A;  4OKO A;  2C6G A;  3MGD A;  1ZLH A;  2FCK A;  4OC0 A;  4KOU A;  1H8L A;  3FNC A;  2B4D B;  2PCU A;  5LRG A;  1BO4 A;  1S5K A;  5GCN A;  2AFS A;  1TKF A;  3PEI A;  2FSR A;  2ZEO A;  2Q43 A;  1A2Z A;  1KUV A;  2PJ8 A;  4KLV A;  5CNP A;  2OB0 A;  4P6Y A;  4PXC A;  5IX3 A;  2AFW A;  4YWY A;  2FL4 A;  3H4Q A;  2DXQ A;  3IEH A;  3W6X A;  2XEG A;  1KUY A;  5EBV A;  2X7B A;  4XPK A;  5J1Q A;  1XF8 A;  3B2Y A;  3BHX A;  3EFA A;  5K8N A;  2EO8 A;  4PV6 A;  3SHP A;  2VZZ A;  4B6Z A;  1VGY A;  1VHO A;  4A94 A;  2GFQ A;  4KUB A;  4UCM A;  5IV0 A;  2C27 A;  2FE7 A;  2REF A;  3KAS A;  4MFQ A;  3H5Z A;  1TF9 A;  2K5T A;  2ZW6 A;  4KUA A;  4R7M A;  4NJR A;  5KTA A;  1CP6 A;  2GE3 A;  4B5P A;  1MK4 A;  1FT7 A;  2PSW A;  4R87 A;  1Q2D A;  3D3S A;  1M4G A;  4UEZ A;  4PK2 A;  2FIA A;  4ZYQ A;  3VAT A;  4DUK A;  1TKH A;  2BO9 A;  3TX8 A;  5LRK A;  1YVO A;  2GRE A;  4CRZ B;  3F5B A;  4NF1 A;  3R9E A;  3BI1 A;  5ISV A;  4PQA A;  4UEE A;  1CPS A;  4Q36 A;  1CBX A;  1K4J A;  3VAR A;  1VHE A;  4HKF A;  2Q4V A;  4TWE A;  4FD7 A;  4H6Z A;  1J4J A;  4PSX A;  4CYO A;  3R9G A;  2YNC A;  2EK9 A;  4H6U A;  3WR7 A;  1BPN A;  3NH8 A;  1S7L A;  2DPT A;  4Y49 C;  4LX9 A;  2YNE A;  2JEV A;  4CAW A;  5IB9 A;  4C68 A;  3I3G A;  4HNW B;  1UWY A;  4IHM A;  5AG5 A;  1ARL A;  2Q51 A;  3D66 A;  2VZY A;  3IJ3 A;  4CYN A;  4ZX8 A;  1Z9U A;  4C2Z A;  1XIX A;  2ODF A;  2GAN A;  2Q4Y A;  1Y9W A;  2ZEH A;  3EC4 A;  4MCP A;  4PK3 A;  4RI1 A;  2NSM A;  3ISX A;  2C6C A;  4MXU A;  1MJB A;  4R57 A;  2CNT A;  1XEB A;  1L0C A;  5FVJ A;  3S6G A;  1XMB A;  2Q7B A;  3TC8 A;  3RYO A;  3TTH A;  4HPS A;  4KS9 A;  4UFX A;  2V8D A;  1NSL A;  1IU8 A;  4BMH A;  2RC4 A;  2WPX A;  4XPD C;  1BAV A;  1ZLI A;  2PJ2 A;  4U5Y A;  4WWV A;  4CGO A;  2DF5 A;  3V7Z A;  4YRH A;  3EO4 A;  1TXR A;  4NGT A;  4NGS A;  2XEJ A;  4XNH C;  3CDX A;  4ZY2 A;  4FD5 A;  5IB0 A;  4OC1 A;  4R9M A;  4IUS A;  1BLL E;  1M4D A;  4F0X A;  2PR8 A;  4JXR A;  5HMN A;  2A4N A;  2D4P A;  2PIY A;  2BEI A;  2PRQ A;  3B3S A;  1CM0 A;  3BXM A;  4G1P A;  1S7K A;  4P4B A;  5AGE A;  3FF3 A;  2B4B A;  3D7D A;  1WK4 A;  5I4M A;  1VIX A;  1YLO A;  2EVN A;  4P44 A;  2JLM A;  4W9Y A;  3TOB A;  2OU2 A;  3DR8 A;  2BSW A;  2CIJ A;  3CPX A;  3F8K A;  3SI2 A;  2ARH A;  4NGN A;  3GLJ A;  2XEI A;  4M6H A;  2CF4 A;  4Y49 B;  2FVG A;  2V8V A;  4YU9 A;  4NXY A;  2F7V A;  4KSF A;  2B58 A;  3FIX A;  1TKJ A;  1YSJ A;  2CNM A;  1RO5 A;  5LYF A;  1Z5R A;  4MHZ A;  4PXB A;  3SJF A;  2F5I A;  1U6M A;  3B8G A;  4K3N A;  3CXP A;  3PRT A;  1VKC A;  3LOD A;  3PFE A;  2BOA A;  3NFZ A;  3T8W A;  2ZEM A;  3JRU A;  3PB7 X;  2PJ9 A;  2WYR A;  4H2K A;  1HDQ A;  3IWW A;  4E2A A;  1Z8T A;  4NGM A;  4A39 A;  5K8O A;  2PR1 A;  4L8A A;  4BIN A;  1Z8L A;  2ABZ A;  3D68 A;  3PB4 X;  3H8G A;  3JTK A;  2PE3 A;  4MBU A;  2DEA A;  2PJ4 A;  1IOF A;  4ZY0 A;  4JJX A;  4XPD B;  3BJ8 A;  4UIA A;  3VWD A;  2J8R A;  4A31 A;  1AMP A;  3GB0 A;  4BBH A;  2WPW A;  1UFH A;  3MN8 A;  4MI4 A;  3JUW A;  1Y0R A;  4YGO A;  1F57 A;  3RZA A;  2OH1 A;  1MJA A;  4XNH B;  3PB9 X;  2Z0Z A;  3D2M A;  1R57 A;  1KUX A;  5HH1 A;  2P6E A;  3W6S A;  4B11 A;  1NE9 A;  4QUS A;  2AFX A;  2RB7 A;  1BOB A;  1NMT A;  2CTC A;  1LAM A;  4PPZ A;  4Q7A A;  1VHS A;  4I49 A;  1ELM P;  2ZEG A;  1B6B A;  1CG2 A;  4MCS A;  1PUA A;  4IF5 A;  2R1I A;  2PJC A;  4JZ0 A;  4AVC A;  4FD4 A;  4CYQ A;  2B3V A;  2PJB A;  5G22 A;  4R76 A;  3IC1 A;  1M1D A;  3CXQ A;  2ZED A;  3WAB A;  2Y0M A;  2PRB A;  1HDU A;  2PQ8 A;  4MCR A;  1Q2Y A;  3R96 A;  1HEE A;  3P2F A;  2ZOG A;  4MFL A;  4EWT A;  4KVM E;  4MFP A;  4KOS A;  5KTC A;  1Q2C A;  4P4I A;  5AG7 A;  1LOK A;  4DJL A;  2ZW5 A;  5JH9 A;  3V38 A;  2PJ1 A;  3CZX A;  2JBK A;  4R8F A;  5CBM A;  2PJ0 A;  6CPA A;  2POK A;  1LAP A;  1Z2L A;  2JBJ A;  4F9U A;  4NGR A;  4JWP A;  1KWM A;  1ON0 A;  4A38 A;  4OIW A;  3S6H A;  2P0W A;  1F2O A;  2HV2 A;  1QSM A;  2P6F A;  1YVK A;  1QQ9 A;  3D7H A; 
#chains in the Genus database with same CATH homology
 2QYV A;  4P4J A;  5LYI A;  4O23 A;  2CTB A;  2AFZ A;  3BI0 A;  8CPA A;  4ZI6 A;  4FBE A;  2JEW A;  4Z65 A;  4NGQ A;  5D29 A;  3CPA A;  4EME A;  2PJ5 A;  3FVL A;  1ZG9 A;  4UEF A;  3B3V A;  4OC5 A;  1LFW A;  4MMO A;  4R6T A;  4FAI A;  2ZEL A;  5HVF A;  4MHP A;  2C1C A;  1GYT A;  3SJG A;  1NSA A;  3PB8 X;  1DTD A;  2ZEN A;  3HLP A;  5F09 A;  4X3R A;  4EFD A;  1ZG7 A;  1ZG8 A;  1BPM A;  3B35 A;  4RUH A;  2G9D A;  2HB6 A;  4OP4 A;  2O4H A;  3KHZ A;  4OC3 A;  1JQG A;  3KR5 A;  5K8M A;  4PXE A;  4GM5 A;  4P10 A;  3FX6 A;  3KGQ A;  3NH5 A;  3FJU A;  2PJ7 A;  4AXV A;  4OC2 A;  3NA6 A;  3PBB A;  3WC6 A;  2EWB A;  4NGP A;  5LRJ A;  3FMC A;  3WC7 A;  2IMO A;  4ZY1 A;  1YME A;  2PJA A;  3VH9 A;  3DGV A;  4LQG A;  1XRY A;  3PBE A;  4IAV A;  3LWU A;  5LYL A;  1AYE A;  4X2T A;  7CPA A;  4ONW A;  1OBR A;  1CX8 A;  4P45 A;  4JYW A;  2ZEE A;  3K2K A;  2EK8 A;  4FWU A;  4MCQ A;  2PVW A;  2C6P A;  3B3C A;  1R3N A;  4P4F A;  1PYT B;  5K8P A;  1FNO A;  5LYD A;  2QJ8 A;  3N5F A;  5JM6 A;  5THW A;  2GLJ A;  4X8I A;  3D7G A;  3D67 A;  1R43 A;  3FEC A;  3K9T A;  3KZW A;  4NFR A;  1DE4 C;  1LAN A;  1EE3 P;  2I3C A;  1YW6 A;  2V8H A;  3SI0 A;  4MHY A;  1QMU A;  4KSI A;  5CPA A;  3WT4 A;  2V8G A;  5DS0 A;  4PXD A;  1TF8 A;  3CT9 A;  3B3T A;  3KQZ A;  3PFO A;  3MRU A;  2J9A A;  1IY7 A;  1XBU A;  2OOT A;  5HVH A;  1CPX A;  4A37 A;  1ELL P;  2O53 A;  1PCA A;  3KQX A;  4TNU A;  4MRI A;  3QNV A;  1Y0Y A;  3I1U A;  5HXD A;  2AFO A;  3KI9 A;  3PB6 X;  2ZOF A;  4OID A;  2IJZ A;  3HUV A;  4P4E A;  3FH4 A;  3FED A;  3RBU A;  4DYO A;  2PJ6 A;  3RAM A;  2BCO A;  4FUU A;  3FEE A;  3H8E A;  3SI1 A;  1IGB A;  2ZEP A;  3S9M A;  5ELY A;  1XFO A;  1LCP A;  2RFH A;  4F9V A;  2ANP A;  2IQ6 A;  3IFE A;  3S9N A;  1XJO A;  3B3W A;  2WZN A;  4BD9 A;  4UIB A;  4ZX9 A;  2QVP A;  3KR4 A;  3LMS A;  4NJQ A;  4MHN A;  3GUX A;  2ZEF A;  1RTQ A;  1Q7L A;  3SJE A;  1YW4 A;  3B7I A;  3ISZ A;  2AFM A;  4UF4 A;  2VL1 A;  4CPA A;  2AFU A;  3KHX A;  3SJX A;  2GLF A;  3D4U A;  2NYQ A;  2PVV A;  3IO1 A;  4OC4 A;  1F2P A;  1M4L A;  2GU2 A;  3IIB A;  4OME A;  5JGF A;  2OR4 A;  3H8F A;  3KL9 A;  1ARM A;  2Q4Z A;  2F8H A;  4IK2 A;  4WJB A;  1CP7 A;  2V77 A;  3S9L A;  4F8Z A;  3D7F A;  3DLJ A;  3WC5 A;  2XEF A;  4P4D A;  2PIZ A;  2PJ3 A;  3NH4 A;  3L2N A;  2HC9 A;  1Y7E A;  5D8N A;  5HVG A;  4OKO A;  2C6G A;  1ZLH A;  4OC0 A;  1H8L A;  2PCU A;  5LRG A;  2AFS A;  1TKF A;  3PEI A;  2ZEO A;  2Q43 A;  2PJ8 A;  4P6Y A;  4PXC A;  2AFW A;  4YWY A;  3IEH A;  2XEG A;  5J1Q A;  3B2Y A;  3BHX A;  5K8N A;  4B6Z A;  1VGY A;  1VHO A;  4A94 A;  3KAS A;  1TF9 A;  4R7M A;  4NJR A;  1CP6 A;  1FT7 A;  4UEZ A;  4ZYQ A;  3VAT A;  4DUK A;  1TKH A;  2BO9 A;  3TX8 A;  5LRK A;  2GRE A;  3BI1 A;  4PQA A;  4UEE A;  1CPS A;  1CBX A;  3VAR A;  1VHE A;  4TWE A;  2EK9 A;  1BPN A;  3NH8 A;  5IB9 A;  1UWY A;  4IHM A;  1ARL A;  2Q51 A;  3D66 A;  3IJ3 A;  4ZX8 A;  2ZEH A;  4MCP A;  2NSM A;  3ISX A;  2C6C A;  4MXU A;  1XMB A;  3TC8 A;  2V8D A;  1BAV A;  1ZLI A;  2PJ2 A;  4WWV A;  3V7Z A;  1TXR A;  4NGT A;  4NGS A;  2XEJ A;  3CDX A;  4ZY2 A;  4OC1 A;  1BLL E;  3BXM A;  3B3S A;  2PIY A;  2PRQ A;  4G1P A;  4P4B A;  3FF3 A;  3D7D A;  5I4M A;  1VIX A;  1YLO A;  4P44 A;  4W9Y A;  2CIJ A;  3CPX A;  3SI2 A;  4NGN A;  3GLJ A;  2XEI A;  2CF4 A;  2FVG A;  2V8V A;  4YU9 A;  2F7V A;  1TKJ A;  1YSJ A;  5LYF A;  1Z5R A;  4MHZ A;  4PXB A;  3SJF A;  4K3N A;  3PRT A;  3PFE A;  2BOA A;  3NFZ A;  3T8W A;  2ZEM A;  3JRU A;  3PB7 X;  2PJ9 A;  2WYR A;  4H2K A;  1HDQ A;  3IWW A;  4NGM A;  4A39 A;  5K8O A;  1Z8L A;  2ABZ A;  3D68 A;  3PB4 X;  3H8G A;  2PE3 A;  2DEA A;  2PJ4 A;  4ZY0 A;  4UIA A;  1AMP A;  3GB0 A;  3MN8 A;  1Y0R A;  1F57 A;  3RZA A;  3PB9 X;  2AFX A;  2RB7 A;  2CTC A;  4PPZ A;  1LAM A;  4Q7A A;  1ELM P;  2ZEG A;  1CG2 A;  4MCS A;  4JZ0 A;  2PJC A;  2PJB A;  4R76 A;  3IC1 A;  3WAB A;  2ZED A;  1HDU A;  4MCR A;  1HEE A;  2ZOG A;  4EWT A;  4P4I A;  1LOK A;  4DJL A;  5JH9 A;  3V38 A;  2PJ1 A;  4R8F A;  2JBK A;  5CBM A;  2PJ0 A;  6CPA A;  2POK A;  1LAP A;  1Z2L A;  2JBJ A;  4F9U A;  4NGR A;  1KWM A;  4A38 A;  4OIW A;  1F2O A;  1QQ9 A;  3D7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...