4R3KA

Crystal structure of ard1 n-terminal acetyltransferase from sulfolobus solfataricus bound to coa
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
157
structure length
157
Chain Sequence
DFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAIVDNSVVGYIMPRIEWGFSNIKQLPSLVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYYADGEDAYLMARPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized N-acetyltransferase SSO0209
publication title Structural Basis for Substrate-specific Acetylation of N alpha-acetyltransferase Ard1 from Sulfolobus solfataricus
pubmed doi rcsb
source organism Sulfolobus solfataricus p2
molecule tags Transferase
total genus 49
structure length 157
sequence length 157
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2014-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4r3kA00
2PRBA 4ORFA 4AVBA 1CJWA 3GY9A 4K30A 2Z0ZA 1I1DA 4MI4A 1XIXA 1PU9A 4QC6A 2D4PA 1S3ZA 4KUBA 1S60A 3G3SA 4MHDA 1WK4A 3VWEA 5KTCA 2C27A 2B58A 1P4NA 2WPXA 4R87A 3CXPA 1GHEA 4AG7A 2FCKA 3PZJA 3IWGA 5DWNA 1YREA 4AB7A 4XNHB 2NMTA 5KTAA 2R7HA 1QSNA 3B8GA 4E8OA 5IV0A 1VHSA 1YR0A 1NMTA 1YVKA 4NCZA 2FE7A 5DWMA 2D4OA 2REFA 1Z4RA 3PP9A 2GANA 2VZZA 3PGPA 2FXFA 1SQHA 1XE4A 3BJ8A 3S6GA 4R3LA 2P0WA 2FT0A 3C26A 2K5TA 2PC1A 4HNWB 3FB3A 2Q4VA 4XPDB 4FD7A 2R98A 3W6XA 3F5BA 2IL4A 4J3GA 4BMHA 4FD6A 5F46A 3IGRA 5H84A 4JD6A 5IX3A 4YRHA 4HNXB 4QBJA 4NEXA 4Y49B 1S7KA 2OZHA 4IUSA 1M4GA 2PSWA 3W91A 1MJ9A 3DDDA 2BSWA 2G3TA 2GIVA 4KOSA 1LRZA 5C88A 4M85A 1BOBA 5HH1A 3E0KA 2JDDA 1KZFA 2P6GA 2QMLA 1IICA 4E2AA 3FRMA 1TIQA 2ZW6A 4AVAA 2PQ8A 2B4DA 2Q04A 2ZPAA 5I0CA 1YGHA 1Q2CA 4UA3A 3FIXA 2Q7BA 4AG9A 3OWCA 2OB0A 4KOVA 4IF5A 2CNTA 3EXNA 3T9YA 4KLVA 4NF1A 4KVME 1I12A 3DR8A 4MY0A 2VQYA 2EUIA 3SXOA 4LUAA 2B3UA 1IB1E 2B4DB 1NSLA 2Q44A 2I79A 1QSRA 4PK3A 3TTHA 2B5GA 2BL1A 2H5MA 1S7FA 4R9MA 5H86A 4GS4A 3TO6A 1PUAA 4KORA 1YVOA 4OADA 3EO4A 3P2HA 3W6SA 4UWIA 3CXQA 2FL4A 4XPKA 3D8PA 3S6FA 1L0CA 2WPWA 2OZGA 3F8KA 2B5GB 2FS5A 3P2FA 1MJBA 3TO9A 2B4BA 4NSQA 3R9EA 2F5IA 3TO7A 3EY5A 3I3GA 4XNHC 1YX0A 4ZBGA 2DXQA 4U5YA 4AVCA 2ZW5A 1M4IA 3G8WA 4NXYA 4YFJA 5E96A 5HMNA 2VZYA 2ZXVA 5EBVA 2O28A 4B5PA 4U9ZA 4B5OA 3F0AA 3D3SA 3S6HA 3CXSA 1QSTA 2B3VA 2FSRA 1QSMA 1Y9KA 2CNMA 2J8NA 5F48A 4FD5A 3FXTA 2JDCA 1KUXA 1Q2YA 4XPDC 4KVXA 2OH1A 3EC4A 3ZJ0A 1M4DA 4KOTA 5CNPA 3DNSA 4QVTA 2OZUA 4CRZB 3TT2A 2RC4A 4KOWA 1OZPA 4F6AA 3RYOA 4U9YA 3GKRA 4PSWA 4UBRA 4Y49C 3R9GA 2HQYA 2JLMA 4KVOE 2R8VA 4H89A 1V0CA 1MJAA 1CM0A 4KUAA 2JEVA 2QECA 3LODA 1VKCA 3I9SA 1ON0A 4QUSA 5J8CA 1IIDA 1NE9A 3T90A 2ZW4A 2Z11A 1P0HA 1RXTA 4JXRA 4LX9A 3SHPA 5J8FA 4R3KA 2Z10A 4EVYA 4CAWA 2X7BA 4H6UA 4X5KA 2AJ6A 1J4JA 4HKFA 2I00A 2HUZA 3R9FA 1K4JA 3TCVA 4L8AA 2KCWA 4KLWA 1Z9UA 4UWJA 2J8MA 5GCNA 3QB8A 4XPLA 3EFAA 4JJXA 3R95A 2REEA 2EVNA 3MGDA 1KUVA 5EC4A 1KUYA 1Y7RA 4CRYB 3D2MA 2BUEA 3N7ZA 3VWDA 2VI7A 4FD4A 4OLLA 3TOBA 3GYAA 4MJ8A 2Q4YA 4MBUA 1UFHA 3JUWA 4CAXA 3UY5A 2P6EA 4II9A 1BO4A 3FNCA 4HNYB 4E0AA 4QB9A 3FBUA 2HV2A 2OU2A 1N71A 2FIAA 1YK3A 3JVNA 2PR8A 5F49A 3H4QA 4MY3A 2BEIA 5JPHA 4PSXA 5ISVA 4M3SA 1RO5A 1IYLA 3TOAA 2A4NA 1M44A 4JWPA 3TE4A 2AE6A 1Q2DA 4KOYA 2CY2A 2Q0YA 5C82A 4OAEA 4B5PB 4PK2A 2FIWA 3NE7A 3DSBA 2VXKA 1Y9WA 2G0BA 2PR1A 3DR6A 1U6MA 1MK4A 2QIRA 3R96A 2R1IA 4L89A 1I21A 3FYNA 1IYKA 1S5KA 2CNSA 4KOUA 4RI1A 4DNCA 1XF8A 1YLEA 4F0YA 4JLYA 1B87A 1XEBA 4CAVA 3S6KA 3D2PA 2ZW7A 2GE3A 4ONUA 1S7NA 4R57A 4I49A 2VBQA 3LD2A 4YGOA 3ZZIA 2Y0MA 3TFYA 2J8RA 4JXQA 2VEZA 1M1DA 5F47A 3SXNA 3WR7A 5IB0A 4PV6A 2ARHA 2G3AA 4H6ZA 1B6BA 3BJ7A 3V8IA 1FY7A 2ATRA 1WWZA 3BLNA 1S7LA 3K9UA 1XMTA 5FVJA 4KOXA 4RS2A 5JQ4A 3KKWA 4KZTA 4CS0B 2PDOA 1Z4EA 1R57A 5KTDA 3R1KA 3QAHA 2P6FA 1QSOA
chains in the Genus database with same CATH superfamily
1HEEA 2CTCA 5AG5A 1H8LA 1IOFA 2PRBA 2Z3NA 4ORFA 2GREA 4AVBA 1CJWA 4ZX8A 2QVPA 3GY9A 3B3WA 4K30A 4TNUA 2Z0ZA 1I1DA 1XRYA 4MI4A 1VGYA 1XIXA 2XEFA 4FBEA 2Q4ZA 1PU9A 4CGMA 4QC6A 1XMBA 2D4PA 3IU2A 1S3ZA 4KUBA 4MCQA 1S60A 3G3SA 4MHDA 1WK4A 4EFDA 3PFEA 3VWEA 5A27A 5KTCA 2C27A 3WC6A 3DGVA 1ELMP 4P4BA 1BPMA 5J1QA 4UCMA 4M6HA 2B58A 3SI0A 2PJ4A 3IWEA 1Y0YA 1FT7A 2PJ1A 3MN8A 1P4NA 1JQGA 3PB6X 2WPXA 2O4HA 3NA6A 4R87A 5K8MA 3CXPA 2Z3LA 2ZEPA 1CBXA 4ONWA 1GHEA 4AG7A 2FCKA 3PZJA 3IWGA 3QAYA 1VIXA 4MCSA 3SJGA 3V38A 4CGPA 5DWNA 1YREA 2RFHA 4AB7A 4XNHB 3IWWA 2NMTA 2YNCC 4IK2A 4B11A 2R7HA 5KTAA 4NJRA 4M6GA 1QSNA 4BBHA 3B8GA 3BXMA 4E8OA 2PJ9A 5CPAA 5IV0A 2V8HA 2PJ3A 1LANA 1VHSA 2XEJA 1YR0A 2C1CA 1NMTA 4UCPA 1YVKA 3TC8A 2QJ8A 4NCZA 4B6ZA 2FE7A 5DWMA 2D4OA 2REFA 1Z4RA 4CPAA 3PP9A 5LRKA 4OC4A 1R43A 2GANA 1Z8TA 2VZZA 3PGPA 1CX8A 2XEGA 2FXFA 5G22A 1Z8LA 3FVLA 1CP6A 1SQHA 1HDQA 1XE4A 2PIZA 3BJ8A 3S6GA 1X10A 4R3LA 4PPZA 2P0WA 2FT0A 1YMEA 4Q38A 1NSAA 4K3NA 3KGQA 3C26A 3H8EA 2K5TA 2PC1A 2PJ0A 4HNWB 2PJ5A 3FB3A 3FF3A 2Q4VA 4P6YA 4XPDB 4FD7A 2PIYA 3V7ZA 2R98A 4LQ6A 1M4LA 2EK9A 3W6XA 4C2YA 1IU8A 3F5BA 2IL4A 5LYDA 4J3GA 4BMHA 2WSAA 4FD6A 3B3CA 3B7IA 1JWQA 3IGRA 5H84A 5F46A 4JD6A 5IX3A 2PJBA 4YRHA 3CT9A 3HLPA 4HNXB 4QBJA 4NEXA 4Y49B 1ZLIA 1S7KA 4ZY1A 2OZHA 1CG2A 4IUSA 4YU9A 1M4GA 5BWAB 2J9AA 4F0XA 3MRUA 2PSWA 2YGWA 4PQAA 1CP7A 3W91A 4MCPA 2C6CA 1MJ9A 4B10A 4B14A 4MHYA 4R8FA 1Y7EA 2ZOFA 3DDDA 2BSWA 2G3TA 4IAVA 3FEEA 2GIVA 4KOSA 4UFXA 1LRZA 3SI2A 4CGNA 5C88A 1F2OA 2EBJA 4M85A 1BOBA 4PXDA 2JEWA 2JDDA 3E0KA 5HH1A 1KZFA 2P6GA 2QMLA 1IICA 3PBEA 1YLOA 3FRMA 1TIQA 3IIBA 4E2AA 2ZW6A 4MHZA 2PQ8A 4AVAA 5AG4A 3T8WA 2B4DA 2PJ6A 3CPAA 4MHNA 2Q04A 7CPAA 2ZPAA 5I0CA 1YGHA 4NGRA 1Q2CA 4UA3A 3VARA 4GM5A 4A33A 3B35A 3FIXA 1X12A 1TXRA 2Q7BA 3RBUA 3S9LA 3KQXA 4AG9A 3OWCA 2OB0A 5JGFA 4KOVA 4IF5A 2CNTA 3EXNA 3KASA 3KI9A 3NH8A 4KLVA 3FH4A 4NF1A 3T9YA 4KVME 1I12A 3DR8A 2CF4A 2VQYA 4MY0A 4DJLA 2EUIA 1IOIA 3SXOA 4LUAA 2B3UA 2V8GA 1IB1E 2B4DB 4DYOA 2WZNA 2JBJA 4ZGYB 1NSLA 3JTKA 4UFVA 5D29A 2Q44A 4A32A 1QSOA 1QQ9A 2I79A 1QSRA 4PK3A 3TTHA 2B5GA 4P10A 2BL1A 1BAVA 2H5MA 4YWYA 1S7FA 1TKFA 4R9MA 5H86A 4UEEA 4CYPA 4EMEA 4GS4A 3TO6A 1PUAA 4KORA 4W9YA 4IHMA 1YSJA 1YVOA 4OADA 3VH9A 3EO4A 3FECA 4OC5A 2ODFA 3P2HA 4NFRA 2IQ6A 3W6SA 4CYOA 2ZENA 3N5FA 4UWIA 3IO1A 2ZEDA 4CGOA 3CXQA 4OIWA 1RTQA 1PYTB 2FL4A 4XPKA 1Q7LA 3D8PA 3S6FA 1L0CA 4UIAA 1TKJA 2WPWA 2OZGA 3F8KA 2AFXA 2B5GB 4F8ZA 2FS5A 3P2FA 3ISZA 1MJBA 4R76A 3RAMA 4A31A 2AFOA 3TO9A 4A2ZA 2OR4A 2B4BA 2ZELA 3I1UA 4NSQA 3R9EA 1VHOA 3IFEA 3H5ZA 3FEDA 4NGMA 1LCPA 2F5IA 4AXVA 3TO7A 2ZEGA 3EY5A 3BI0A 4MFLA 3I3GA 3L2NA 4XNHC 1YX0A 4ZBGA 2DXQA 3SJFA 3GIUA 2YNEA 4U5YA 4UEFA 5G20A 4Z65A 5I4MA 4A39A 3B3VA 3IEHA 4AVCA 2ZW5A 5AG6A 1M4IA 3G8WA 4UIBA 5HXDA 3KHZA 4OKOA 4NXYA 4YFJA 5E96A 1ARMA 2Q7SA 1YQEA 5HMNA 2VZYA 2ZXVA 4MHPA 2XEIA 2O28A 3D4UA 5EBVA 3TX8A 4P4EA 3SI1A 4UF4A 4U9ZA 4B5OA 4B5PA 1LAMA 3F0AA 3B3TA 3D3SA 4A94A 3S6HA 3CXSA 1IGBA 2Q43A 4BINA 1QSTA 1XJOA 2B3VA 4MFQA 2FSRA 2GU2A 1PCAA 3CDXA 2ZEFA 1ZG8A 3IJ3A 1QSMA 4B12A 1IY7A 2ZEEA 1Y9KA 5LYFA 4NJQA 2DPTA 2Z3OA 2CNMA 5HVFA 2J8NA 3K2KA 4G1PA 3BI1A 5F48A 3NFZA 4FD5A 2Q51A 3FXTA 2FVGA 4JZ0A 2JDCA 1KUXA 5LRJA 1Q2YA 3D7DA 4XPDC 4KVXA 2OH1A 3FX6A 5AGEA 4NGPA 3EC4A 3ZJ0A 1M4DA 2EK8A 2GLJA 3DNSA 4KOTA 4QVTA 5CNPA 2OZUA 4CRZB 3TT2A 2RC4A 4KOWA 2ZOGA 3WABA 4BD9A 2F7VA 1OZPA 1BLLE 4F6AA 2ZEMA 5ELYA 2PRQA 4TWEA 4MFJA 3IC1A 3LWUA 3RYOA 4U9YA 3D7FA 3GKRA 4PSWA 4UBRA 4Y49C 4F9UA 3KHXA 4H2KA 4DUKA 3D67A 3B3SA 2CTBA 1Z5RA 4MFPA 3R9GA 2PJCA 2PVVA 3RO0A 2DF5A 4F9VA 2HQYA 2I3CA 3H8GA 1GYTA 3S9MA 2V8VA 2JLMA 4KSIA 4KVOE 2R8VA 4R6TA 4H89A 4A95A 3D68A 1V0CA 1MJAA 1CM0A 4KUAA 5K8NA 3RNZA 5EMIA 4OIDA 2JEVA 2QECA 2RB7A 2HB6A 1AMPA 2EO8A 2EWBA 3KR4A 3LODA 1VKCA 3I9SA 1DTDA 2AFSA 1CPXA 1ON0A 3D7GA 4QUSA 4KS9A 5J8CA 3S9NA 1IIDA 3CZXA 3PB8X 2ZEHA 2PCUA 4A38A 4A37A 4HPSA 4P4DA 3PB9X 3PRTA 2DEAA 1EE3P 1OBRA 1NE9A 3T90A 2ZW4A 1F57A 3NH4A 3VATA 4RN7A 5LYIA 4Q7AA 3NH5A 3K9TA 2Z11A 1AYEA 1LOKA 1P0HA 1RXTA 3RZAA 1DE4C 1XBUA 2VL1A 3D7HA 5JH9A 1R3NA 4C68A 1ARLA 4JXRA 4ZY2A 2PE3A 4NGSA 1QMUA 4LX9A 2C6PA 4MXUA 3SHPA 4OP4A 5J8FA 4R3KA 2Z10A 3SJEA 4ZY0A 4CAEA 5LYLA 1BPNA 3KR5A 4MRIA 2X7BA 4CAFA 4CAWA 4H6UA 4X5KA 4EVYA 2AJ6A 1J4JA 4OC2A 2GLFA 4HKFA 1Z8XA 2I00A 2HUZA 3R9FA 1K4JA 3TCVA 4PXCA 4KSAA 4L8AA 2KCWA 4KLWA 1Z9UA 2YNCA 4UWJA 1TF9A 1LFWA 2J8MA 5HVHA 4WJBA 4X8IA 2V77A 1KWMA 5GCNA 3QB8A 1YW4A 4XPLA 3EFAA 4ZX9A 4JJXA 5D8NA 1UWYA 4KSFA 5CBMA 2CIJA 4P45A 6CPAA 2AFWA 5DS0A 4WWVA 3R95A 2REEA 4FAIA 2O53A 4LQGA 3KQZA 4NGQA 2AFZA 2EVNA 2HC9A 3PFOA 3MGDA 1KUVA 3FMCA 1ZO0A 5EC4A 1KUYA 1Y7RA 1ZG9A 4CRYB 5HVGA 3D2MA 2BUEA 2PVWA 3N7ZA 3WC7A 3VWDA 2VI7A 4FD4A 3LMSA 1AUGA 2DPSA 4OC0A 4OLLA 3TOBA 3GYAA 1ZG7A 2PJ7A 4CYNA 2Z3MA 4ZI6A 4C2XA 4MJ8A 4EWTA 2Q4YA 4MBUA 1UFHA 3JUWA 4CAXA 3UY5A 2P6EA 4II9A 5K8PA 1BO4A 3FNCA 4HNYB 4E0AA 2ABZA 3CPXA 8CPAA 2C6GA 4QB9A 3FBUA 2HV2A 2OU2A 1N71A 1FNOA 2FIAA 1YK3A 3JVNA 4PXBA 2PR8A 5THWA 4C7HA 5F49A 2GFQA 3H4QA 3NE8A 1ZLHA 1TF8A 4MY3A 4MCRA 4UCNA 2BEIA 5JPHA 4PSXA 5ISVA 3KZWA 4M3SA 4GXHA 1RO5A 1IYLA 3TOAA 2Z3KA 5A28A 4CGLA 2A4NA 1M44A 4FWUA 4JWPA 4X2TA 3TE4A 4JYWA 1HDUA 3FJUA 2AE6A 4A30A 1Q2DA 4KOYA 4C2ZA 1LAPA 2CY2A 5LRGA 4CYQA 4RUHA 3D66A 2Q0YA 4MMOA 3PB4X 3GB0A 5C82A 4X3RA 2F8HA 2POKA 3IU1A 4OAEA 4B5PB 4PK2A 2FIWA 1Z2LA 3NE7A 3DSBA 2VXKA 4OMEA 1Y9WA 2G0BA 2PR1A 2V8DA 3HUVA 4R7MA 5JM6A 3DR6A 1U6MA 1A2ZA 2NSMA 2PJAA 1MK4A 3JRUA 2QIRA 3QNVA 2BCOA 1Y0RA 3R96A 2R1IA 3H8FA 4L89A 1I21A 3FYNA 2OOTA 3PB7X 5IB9A 1IYKA 1XOVA 1S5KA 1XFOA 2Z3PA 2CNSA 2QYVA 2CXAA 4KOUA 4RI1A 4DNCA 4ZYQA 4P4FA 1XF8A 1YLEA 4F0YA 2AFUA 4JLYA 1B87A 4MFZA 1XEBA 2NYQA 2JBKA 5AG7A 3PEIA 3D2PA 4NGTA 3S6KA 4CAVA 2ZW7A 2GE3A 4ONUA 4OC1A 4R57A 4UFWA 4I49A 2VBQA 3LD2A 4YGOA 2BO9A 3ZZIA 2Y0MA 5K8OA 2J8RA 3TFYA 4JXQA 4O23A 4P4JA 2VEZA 1M1DA 5F47A 3SXNA 2BOAA 3WR7A 5IB0A 4B13A 2YNDA 1CPSA 3B2YA 2ARHA 4PV6A 2WUUA 2G3AA 2G9DA 2IJZA 3ISXA 1F2PA 2PJ8A 3PBBA 2PJ2A 4MFKA 4H6ZA 5G1ZA 4PXEA 1TKHA 4FUUA 1B6BA 3BJ7A 3V8IA 2AFMA 1FY7A 2ATRA 1WWZA 1Z8WA 2WYRA 3DLJA 2ZEOA 3GLJA 4NGNA 3BLNA 3LACA 1ELLP 2ANPA 4OC3A 1S7LA 4P4IA 2IMOA 3WC5A 3K9UA 1XMTA 5FVJA 4M6IA 5G21A 4KOXA 4RS2A 1VHEA 3A9LA 3WT4A 4Q36A 5JQ4A 3BHXA 5F09A 3KKWA 4KZTA 4CS0B 2PDOA 4C7IA 3SJXA 3GUXA 1Z4EA 3KL9A 4P44A 1R57A 5KTDA 1YW6A 3R1KA 4UEZA 3QAHA 2P6FA 1S7NA
chains in the Genus database with same CATH topology
5AG5A 2PRBA 2Z3NA 4ORFA 4AVBA 1CJWA 3GY9A 4K30A 2Z0ZA 1I1DA 4MI4A 1XIXA 1PU9A 4CGMA 4QC6A 2D4PA 3IU2A 1S3ZA 4KUBA 1S60A 3G3SA 4MHDA 1WK4A 3VWEA 5A27A 5KTCA 2C27A 4UCMA 2B58A 3IWEA 1P4NA 2WPXA 4R87A 3CXPA 2Z3LA 1GHEA 4AG7A 2FCKA 3PZJA 3IWGA 4CGPA 5DWNA 1YREA 4AB7A 4XNHB 2NMTA 2YNCC 4B11A 5KTAA 2R7HA 4BBHA 1QSNA 3B8GA 4E8OA 5IV0A 1VHSA 1YR0A 4UCPA 1NMTA 1YVKA 4NCZA 2FE7A 5DWMA 2D4OA 2REFA 1Z4RA 3PP9A 2GANA 2VZZA 3PGPA 2FXFA 5G22A 1SQHA 1XE4A 3BJ8A 3S6GA 4R3LA 2P0WA 2FT0A 4Q38A 3C26A 2K5TA 2PC1A 4HNWB 3FB3A 2Q4VA 4XPDB 4FD7A 2R98A 3W6XA 4C2YA 3F5BA 2IL4A 4J3GA 4BMHA 2WSAA 4FD6A 3IGRA 5F46A 5H84A 4JD6A 5IX3A 4YRHA 4HNXB 4QBJA 4NEXA 4Y49B 1S7KA 2OZHA 4IUSA 1M4GA 5BWAB 4F0XA 2PSWA 2YGWA 3W91A 1MJ9A 4B10A 4B14A 3DDDA 2BSWA 2G3TA 2GIVA 4KOSA 4UFXA 1LRZA 4CGNA 5C88A 4M85A 1BOBA 5HH1A 3E0KA 2JDDA 1KZFA 2P6GA 2QMLA 1IICA 4E2AA 3FRMA 1TIQA 2ZW6A 4AVAA 2PQ8A 5AG4A 2B4DA 2Q04A 2ZPAA 5I0CA 1YGHA 1Q2CA 4UA3A 4A33A 3FIXA 2Q7BA 4AG9A 3OWCA 2OB0A 4KOVA 4IF5A 2CNTA 3EXNA 3T9YA 4KLVA 4NF1A 4KVME 1I12A 3DR8A 4MY0A 2VQYA 2EUIA 3SXOA 4LUAA 2B3UA 1IB1E 2B4DB 4ZGYB 1NSLA 3JTKA 4UFVA 4A32A 2Q44A 2I79A 1QSRA 4PK3A 3TTHA 2B5GA 2BL1A 2H5MA 1S7FA 4R9MA 4CYPA 5H86A 4GS4A 3TO6A 1PUAA 4KORA 1YVOA 4OADA 3EO4A 3P2HA 3W6SA 4CYOA 4UWIA 4CGOA 3CXQA 2FL4A 4XPKA 3D8PA 3S6FA 1L0CA 2WPWA 2OZGA 3F8KA 2B5GB 2FS5A 3P2FA 1MJBA 4A31A 3TO9A 4A2ZA 2B4BA 4NSQA 3R9EA 3H5ZA 2F5IA 3TO7A 3EY5A 4MFLA 3I3GA 4XNHC 1YX0A 4ZBGA 2DXQA 2YNEA 4U5YA 5G20A 4AVCA 2ZW5A 5AG6A 1M4IA 3G8WA 4NXYA 4YFJA 5E96A 5HMNA 2VZYA 2ZXVA 5EBVA 2O28A 4B5PA 4U9ZA 4B5OA 3F0AA 3D3SA 3S6HA 3CXSA 1QSTA 2B3VA 4MFQA 2FSRA 4B12A 1QSMA 1Y9KA 2DPTA 2Z3OA 2CNMA 2J8NA 5F48A 4FD5A 3FXTA 2JDCA 1KUXA 1Q2YA 4XPDC 4KVXA 2OH1A 5AGEA 3EC4A 3ZJ0A 1M4DA 4KOTA 5CNPA 3DNSA 4QVTA 2OZUA 4CRZB 3TT2A 2RC4A 4KOWA 1OZPA 4F6AA 3RYOA 4MFJA 4U9YA 3GKRA 4PSWA 4UBRA 4Y49C 4MFPA 3R9GA 2HQYA 2JLMA 4KVOE 2R8VA 4H89A 4A95A 1V0CA 1MJAA 1CM0A 4KUAA 2JEVA 2QECA 3LODA 1VKCA 3I9SA 1ON0A 4QUSA 4KS9A 5J8CA 1IIDA 1NE9A 3T90A 2ZW4A 2Z11A 1P0HA 1RXTA 4C68A 4JXRA 4LX9A 3SHPA 5J8FA 4R3KA 2Z10A 4CAEA 4CAFA 4CAWA 2X7BA 4EVYA 4H6UA 4X5KA 2AJ6A 1J4JA 4HKFA 2I00A 2HUZA 3R9FA 1K4JA 3TCVA 4KSAA 4L8AA 2KCWA 4KLWA 1Z9UA 2YNCA 4UWJA 2J8MA 5GCNA 3QB8A 4XPLA 3EFAA 4JJXA 4KSFA 3R95A 2REEA 2EVNA 3MGDA 1KUVA 1ZO0A 5EC4A 1KUYA 1Y7RA 4CRYB 3D2MA 2BUEA 3N7ZA 3VWDA 2VI7A 4FD4A 2DPSA 4OLLA 3TOBA 3GYAA 4CYNA 2Z3MA 4C2XA 4MJ8A 2Q4YA 4MBUA 1UFHA 3JUWA 4CAXA 3UY5A 2P6EA 4II9A 1BO4A 3FNCA 4HNYB 4E0AA 4QB9A 3FBUA 2HV2A 2OU2A 1N71A 2FIAA 1YK3A 3JVNA 2PR8A 4C7HA 5F49A 3H4QA 4MY3A 4UCNA 2BEIA 5JPHA 4PSXA 5ISVA 4M3SA 1RO5A 1IYLA 3TOAA 2Z3KA 5A28A 4CGLA 2A4NA 1M44A 4JWPA 3TE4A 2AE6A 4A30A 1Q2DA 4KOYA 4C2ZA 2CY2A 4CYQA 2Q0YA 5C82A 3IU1A 4OAEA 4B5PB 4PK2A 2FIWA 3NE7A 3DSBA 2VXKA 1Y9WA 2G0BA 2PR1A 3DR6A 1U6MA 1MK4A 2QIRA 3R96A 2R1IA 4L89A 1I21A 3FYNA 1IYKA 1S5KA 2Z3PA 2CNSA 2CXAA 4KOUA 4RI1A 4DNCA 1XF8A 1YLEA 4F0YA 4JLYA 1B87A 4MFZA 1XEBA 4CAVA 5AG7A 3S6KA 3D2PA 2ZW7A 2GE3A 4ONUA 1S7NA 4R57A 4UFWA 4I49A 2VBQA 3LD2A 4YGOA 3ZZIA 2Y0MA 3TFYA 2J8RA 4JXQA 2VEZA 1M1DA 5F47A 3SXNA 3WR7A 5IB0A 4B13A 2YNDA 4PV6A 2ARHA 2WUUA 2G3AA 4MFKA 4H6ZA 5G1ZA 1B6BA 3BJ7A 3V8IA 1FY7A 2ATRA 1WWZA 3BLNA 1S7LA 3K9UA 1XMTA 5FVJA 5G21A 4KOXA 4RS2A 3A9LA 5JQ4A 4Q36A 3KKWA 4KZTA 4CS0B 2PDOA 4C7IA 1Z4EA 1R57A 5KTDA 3R1KA 3QAHA 2P6FA 1QSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PRB A;  4ORF A;  4AVB A;  1CJW A;  3GY9 A;  4K30 A;  2Z0Z A;  1I1D A;  4MI4 A;  1XIX A;  1PU9 A;  4QC6 A;  2D4P A;  1S3Z A;  4KUB A;  1S60 A;  3G3S A;  4MHD A;  1WK4 A;  3VWE A;  5KTC A;  2C27 A;  2B58 A;  1P4N A;  2WPX A;  4R87 A;  3CXP A;  1GHE A;  4AG7 A;  2FCK A;  3PZJ A;  3IWG A;  5DWN A;  1YRE A;  4AB7 A;  4XNH B;  2NMT A;  5KTA A;  2R7H A;  1QSN A;  3B8G A;  4E8O A;  5IV0 A;  1VHS A;  1YR0 A;  1NMT A;  1YVK A;  4NCZ A;  2FE7 A;  5DWM A;  2D4O A;  2REF A;  1Z4R A;  3PP9 A;  2GAN A;  2VZZ A;  3PGP A;  2FXF A;  1SQH A;  1XE4 A;  3BJ8 A;  3S6G A;  4R3L A;  2P0W A;  2FT0 A;  3C26 A;  2K5T A;  2PC1 A;  4HNW B;  3FB3 A;  2Q4V A;  4XPD B;  4FD7 A;  2R98 A;  3W6X A;  3F5B A;  2IL4 A;  4J3G A;  4BMH A;  4FD6 A;  5F46 A;  3IGR A;  5H84 A;  4JD6 A;  5IX3 A;  4YRH A;  4HNX B;  4QBJ A;  4NEX A;  4Y49 B;  1S7K A;  2OZH A;  4IUS A;  1M4G A;  2PSW A;  3W91 A;  1MJ9 A;  3DDD A;  2BSW A;  2G3T A;  2GIV A;  4KOS A;  1LRZ A;  5C88 A;  4M85 A;  1BOB A;  5HH1 A;  3E0K A;  2JDD A;  1KZF A;  2P6G A;  2QML A;  1IIC A;  4E2A A;  3FRM A;  1TIQ A;  2ZW6 A;  4AVA A;  2PQ8 A;  2B4D A;  2Q04 A;  2ZPA A;  5I0C A;  1YGH A;  1Q2C A;  4UA3 A;  3FIX A;  2Q7B A;  4AG9 A;  3OWC A;  2OB0 A;  4KOV A;  4IF5 A;  2CNT A;  3EXN A;  3T9Y A;  4KLV A;  4NF1 A;  4KVM E;  1I12 A;  3DR8 A;  4MY0 A;  2VQY A;  2EUI A;  3SXO A;  4LUA A;  2B3U A;  1IB1 E;  2B4D B;  1NSL A;  2Q44 A;  2I79 A;  1QSR A;  4PK3 A;  3TTH A;  2B5G A;  2BL1 A;  2H5M A;  1S7F A;  4R9M A;  5H86 A;  4GS4 A;  3TO6 A;  1PUA A;  4KOR A;  1YVO A;  4OAD A;  3EO4 A;  3P2H A;  3W6S A;  4UWI A;  3CXQ A;  2FL4 A;  4XPK A;  3D8P A;  3S6F A;  1L0C A;  2WPW A;  2OZG A;  3F8K A;  2B5G B;  2FS5 A;  3P2F A;  1MJB A;  3TO9 A;  2B4B A;  4NSQ A;  3R9E A;  2F5I A;  3TO7 A;  3EY5 A;  3I3G A;  4XNH C;  1YX0 A;  4ZBG A;  2DXQ A;  4U5Y A;  4AVC A;  2ZW5 A;  1M4I A;  3G8W A;  4NXY A;  4YFJ A;  5E96 A;  5HMN A;  2VZY A;  2ZXV A;  5EBV A;  2O28 A;  4B5P A;  4U9Z A;  4B5O A;  3F0A A;  3D3S A;  3S6H A;  3CXS A;  1QST A;  2B3V A;  2FSR A;  1QSM A;  1Y9K A;  2CNM A;  2J8N A;  5F48 A;  4FD5 A;  3FXT A;  2JDC A;  1KUX A;  1Q2Y A;  4XPD C;  4KVX A;  2OH1 A;  3EC4 A;  3ZJ0 A;  1M4D A;  4KOT A;  5CNP A;  3DNS A;  4QVT A;  2OZU A;  4CRZ B;  3TT2 A;  2RC4 A;  4KOW A;  1OZP A;  4F6A A;  3RYO A;  4U9Y A;  3GKR A;  4PSW A;  4UBR A;  4Y49 C;  3R9G A;  2HQY A;  2JLM A;  4KVO E;  2R8V A;  4H89 A;  1V0C A;  1MJA A;  1CM0 A;  4KUA A;  2JEV A;  2QEC A;  3LOD A;  1VKC A;  3I9S A;  1ON0 A;  4QUS A;  5J8C A;  1IID A;  1NE9 A;  3T90 A;  2ZW4 A;  2Z11 A;  1P0H A;  1RXT A;  4JXR A;  4LX9 A;  3SHP A;  5J8F A;  4R3K A;  2Z10 A;  4EVY A;  4CAW A;  2X7B A;  4H6U A;  4X5K A;  2AJ6 A;  1J4J A;  4HKF A;  2I00 A;  2HUZ A;  3R9F A;  1K4J A;  3TCV A;  4L8A A;  2KCW A;  4KLW A;  1Z9U A;  4UWJ A;  2J8M A;  5GCN A;  3QB8 A;  4XPL A;  3EFA A;  4JJX A;  3R95 A;  2REE A;  2EVN A;  3MGD A;  1KUV A;  5EC4 A;  1KUY A;  1Y7R A;  4CRY B;  3D2M A;  2BUE A;  3N7Z A;  3VWD A;  2VI7 A;  4FD4 A;  4OLL A;  3TOB A;  3GYA A;  4MJ8 A;  2Q4Y A;  4MBU A;  1UFH A;  3JUW A;  4CAX A;  3UY5 A;  2P6E A;  4II9 A;  1BO4 A;  3FNC A;  4HNY B;  4E0A A;  4QB9 A;  3FBU A;  2HV2 A;  2OU2 A;  1N71 A;  2FIA A;  1YK3 A;  3JVN A;  2PR8 A;  5F49 A;  3H4Q A;  4MY3 A;  2BEI A;  5JPH A;  4PSX A;  5ISV A;  4M3S A;  1RO5 A;  1IYL A;  3TOA A;  2A4N A;  1M44 A;  4JWP A;  3TE4 A;  2AE6 A;  1Q2D A;  4KOY A;  2CY2 A;  2Q0Y A;  5C82 A;  4OAE A;  4B5P B;  4PK2 A;  2FIW A;  3NE7 A;  3DSB A;  2VXK A;  1Y9W A;  2G0B A;  2PR1 A;  3DR6 A;  1U6M A;  1MK4 A;  2QIR A;  3R96 A;  2R1I A;  4L89 A;  1I21 A;  3FYN A;  1IYK A;  1S5K A;  2CNS A;  4KOU A;  4RI1 A;  4DNC A;  1XF8 A;  1YLE A;  4F0Y A;  4JLY A;  1B87 A;  1XEB A;  4CAV A;  3S6K A;  3D2P A;  2ZW7 A;  2GE3 A;  4ONU A;  1S7N A;  4R57 A;  4I49 A;  2VBQ A;  3LD2 A;  4YGO A;  3ZZI A;  2Y0M A;  3TFY A;  2J8R A;  4JXQ A;  2VEZ A;  1M1D A;  5F47 A;  3SXN A;  3WR7 A;  5IB0 A;  4PV6 A;  2ARH A;  2G3A A;  4H6Z A;  1B6B A;  3BJ7 A;  3V8I A;  1FY7 A;  2ATR A;  1WWZ A;  3BLN A;  1S7L A;  3K9U A;  1XMT A;  5FVJ A;  4KOX A;  4RS2 A;  5JQ4 A;  3KKW A;  4KZT A;  4CS0 B;  2PDO A;  1Z4E A;  1R57 A;  5KTD A;  3R1K A;  3QAH A;  2P6F A;  1QSO A; 
#chains in the Genus database with same CATH topology
 1HEE A;  2CTC A;  5AG5 A;  1H8L A;  1IOF A;  2PRB A;  2Z3N A;  4ORF A;  2GRE A;  4AVB A;  1CJW A;  4ZX8 A;  2QVP A;  3GY9 A;  3B3W A;  4K30 A;  4TNU A;  2Z0Z A;  1I1D A;  1XRY A;  4MI4 A;  1VGY A;  1XIX A;  2XEF A;  4FBE A;  2Q4Z A;  1PU9 A;  4CGM A;  4QC6 A;  1XMB A;  2D4P A;  3IU2 A;  1S3Z A;  4KUB A;  4MCQ A;  1S60 A;  3G3S A;  4MHD A;  1WK4 A;  4EFD A;  3PFE A;  3VWE A;  5A27 A;  5KTC A;  2C27 A;  3WC6 A;  3DGV A;  1ELM P;  4P4B A;  1BPM A;  5J1Q A;  4UCM A;  4M6H A;  2B58 A;  3SI0 A;  2PJ4 A;  3IWE A;  1Y0Y A;  1FT7 A;  2PJ1 A;  3MN8 A;  1P4N A;  1JQG A;  3PB6 X;  2WPX A;  2O4H A;  3NA6 A;  4R87 A;  5K8M A;  3CXP A;  2Z3L A;  2ZEP A;  1CBX A;  4ONW A;  1GHE A;  4AG7 A;  2FCK A;  3PZJ A;  3IWG A;  3QAY A;  1VIX A;  4MCS A;  3SJG A;  3V38 A;  4CGP A;  5DWN A;  1YRE A;  2RFH A;  4AB7 A;  4XNH B;  3IWW A;  2NMT A;  2YNC C;  4IK2 A;  4B11 A;  2R7H A;  5KTA A;  4NJR A;  4M6G A;  1QSN A;  4BBH A;  3B8G A;  3BXM A;  4E8O A;  2PJ9 A;  5CPA A;  5IV0 A;  2V8H A;  2PJ3 A;  1LAN A;  1VHS A;  2XEJ A;  1YR0 A;  2C1C A;  1NMT A;  4UCP A;  1YVK A;  3TC8 A;  2QJ8 A;  4NCZ A;  4B6Z A;  2FE7 A;  5DWM A;  2D4O A;  2REF A;  1Z4R A;  4CPA A;  3PP9 A;  5LRK A;  4OC4 A;  1R43 A;  2GAN A;  1Z8T A;  2VZZ A;  3PGP A;  1CX8 A;  2XEG A;  2FXF A;  5G22 A;  1Z8L A;  3FVL A;  1CP6 A;  1SQH A;  1HDQ A;  1XE4 A;  2PIZ A;  3BJ8 A;  3S6G A;  1X10 A;  4R3L A;  4PPZ A;  2P0W A;  2FT0 A;  1YME A;  4Q38 A;  1NSA A;  4K3N A;  3KGQ A;  3C26 A;  3H8E A;  2K5T A;  2PC1 A;  2PJ0 A;  4HNW B;  2PJ5 A;  3FB3 A;  3FF3 A;  2Q4V A;  4P6Y A;  4XPD B;  4FD7 A;  2PIY A;  3V7Z A;  2R98 A;  4LQ6 A;  1M4L A;  2EK9 A;  3W6X A;  4C2Y A;  1IU8 A;  3F5B A;  2IL4 A;  5LYD A;  4J3G A;  4BMH A;  2WSA A;  4FD6 A;  3B3C A;  3B7I A;  1JWQ A;  3IGR A;  5H84 A;  5F46 A;  4JD6 A;  5IX3 A;  2PJB A;  4YRH A;  3CT9 A;  3HLP A;  4HNX B;  4QBJ A;  4NEX A;  4Y49 B;  1ZLI A;  1S7K A;  4ZY1 A;  2OZH A;  1CG2 A;  4IUS A;  4YU9 A;  1M4G A;  5BWA B;  2J9A A;  4F0X A;  3MRU A;  2PSW A;  2YGW A;  4PQA A;  1CP7 A;  3W91 A;  4MCP A;  2C6C A;  1MJ9 A;  4B10 A;  4B14 A;  4MHY A;  4R8F A;  1Y7E A;  2ZOF A;  3DDD A;  2BSW A;  2G3T A;  4IAV A;  3FEE A;  2GIV A;  4KOS A;  4UFX A;  1LRZ A;  3SI2 A;  4CGN A;  5C88 A;  1F2O A;  2EBJ A;  4M85 A;  1BOB A;  4PXD A;  2JEW A;  2JDD A;  3E0K A;  5HH1 A;  1KZF A;  2P6G A;  2QML A;  1IIC A;  3PBE A;  1YLO A;  3FRM A;  1TIQ A;  3IIB A;  4E2A A;  2ZW6 A;  4MHZ A;  2PQ8 A;  4AVA A;  5AG4 A;  3T8W A;  2B4D A;  2PJ6 A;  3CPA A;  4MHN A;  2Q04 A;  7CPA A;  2ZPA A;  5I0C A;  1YGH A;  4NGR A;  1Q2C A;  4UA3 A;  3VAR A;  4GM5 A;  4A33 A;  3B35 A;  3FIX A;  1X12 A;  1TXR A;  2Q7B A;  3RBU A;  3S9L A;  3KQX A;  4AG9 A;  3OWC A;  2OB0 A;  5JGF A;  4KOV A;  4IF5 A;  2CNT A;  3EXN A;  3KAS A;  3KI9 A;  3NH8 A;  4KLV A;  3FH4 A;  4NF1 A;  3T9Y A;  4KVM E;  1I12 A;  3DR8 A;  2CF4 A;  2VQY A;  4MY0 A;  4DJL A;  2EUI A;  1IOI A;  3SXO A;  4LUA A;  2B3U A;  2V8G A;  1IB1 E;  2B4D B;  4DYO A;  2WZN A;  2JBJ A;  4ZGY B;  1NSL A;  3JTK A;  4UFV A;  5D29 A;  2Q44 A;  4A32 A;  1QSO A;  1QQ9 A;  2I79 A;  1QSR A;  4PK3 A;  3TTH A;  2B5G A;  4P10 A;  2BL1 A;  1BAV A;  2H5M A;  4YWY A;  1S7F A;  1TKF A;  4R9M A;  5H86 A;  4UEE A;  4CYP A;  4EME A;  4GS4 A;  3TO6 A;  1PUA A;  4KOR A;  4W9Y A;  4IHM A;  1YSJ A;  1YVO A;  4OAD A;  3VH9 A;  3EO4 A;  3FEC A;  4OC5 A;  2ODF A;  3P2H A;  4NFR A;  2IQ6 A;  3W6S A;  4CYO A;  2ZEN A;  3N5F A;  4UWI A;  3IO1 A;  2ZED A;  4CGO A;  3CXQ A;  4OIW A;  1RTQ A;  1PYT B;  2FL4 A;  4XPK A;  1Q7L A;  3D8P A;  3S6F A;  1L0C A;  4UIA A;  1TKJ A;  2WPW A;  2OZG A;  3F8K A;  2AFX A;  2B5G B;  4F8Z A;  2FS5 A;  3P2F A;  3ISZ A;  1MJB A;  4R76 A;  3RAM A;  4A31 A;  2AFO A;  3TO9 A;  4A2Z A;  2OR4 A;  2B4B A;  2ZEL A;  3I1U A;  4NSQ A;  3R9E A;  1VHO A;  3IFE A;  3H5Z A;  3FED A;  4NGM A;  1LCP A;  2F5I A;  4AXV A;  3TO7 A;  2ZEG A;  3EY5 A;  3BI0 A;  4MFL A;  3I3G A;  3L2N A;  4XNH C;  1YX0 A;  4ZBG A;  2DXQ A;  3SJF A;  3GIU A;  2YNE A;  4U5Y A;  4UEF A;  5G20 A;  4Z65 A;  5I4M A;  4A39 A;  3B3V A;  3IEH A;  4AVC A;  2ZW5 A;  5AG6 A;  1M4I A;  3G8W A;  4UIB A;  5HXD A;  3KHZ A;  4OKO A;  4NXY A;  4YFJ A;  5E96 A;  1ARM A;  2Q7S A;  1YQE A;  5HMN A;  2VZY A;  2ZXV A;  4MHP A;  2XEI A;  2O28 A;  3D4U A;  5EBV A;  3TX8 A;  4P4E A;  3SI1 A;  4UF4 A;  4U9Z A;  4B5O A;  4B5P A;  1LAM A;  3F0A A;  3B3T A;  3D3S A;  4A94 A;  3S6H A;  3CXS A;  1IGB A;  2Q43 A;  4BIN A;  1QST A;  1XJO A;  2B3V A;  4MFQ A;  2FSR A;  2GU2 A;  1PCA A;  3CDX A;  2ZEF A;  1ZG8 A;  3IJ3 A;  1QSM A;  4B12 A;  1IY7 A;  2ZEE A;  1Y9K A;  5LYF A;  4NJQ A;  2DPT A;  2Z3O A;  2CNM A;  5HVF A;  2J8N A;  3K2K A;  4G1P A;  3BI1 A;  5F48 A;  3NFZ A;  4FD5 A;  2Q51 A;  3FXT A;  2FVG A;  4JZ0 A;  2JDC A;  1KUX A;  5LRJ A;  1Q2Y A;  3D7D A;  4XPD C;  4KVX A;  2OH1 A;  3FX6 A;  5AGE A;  4NGP A;  3EC4 A;  3ZJ0 A;  1M4D A;  2EK8 A;  2GLJ A;  3DNS A;  4KOT A;  4QVT A;  5CNP A;  2OZU A;  4CRZ B;  3TT2 A;  2RC4 A;  4KOW A;  2ZOG A;  3WAB A;  4BD9 A;  2F7V A;  1OZP A;  1BLL E;  4F6A A;  2ZEM A;  5ELY A;  2PRQ A;  4TWE A;  4MFJ A;  3IC1 A;  3LWU A;  3RYO A;  4U9Y A;  3D7F A;  3GKR A;  4PSW A;  4UBR A;  4Y49 C;  4F9U A;  3KHX A;  4H2K A;  4DUK A;  3D67 A;  3B3S A;  2CTB A;  1Z5R A;  4MFP A;  3R9G A;  2PJC A;  2PVV A;  3RO0 A;  2DF5 A;  4F9V A;  2HQY A;  2I3C A;  3H8G A;  1GYT A;  3S9M A;  2V8V A;  2JLM A;  4KSI A;  4KVO E;  2R8V A;  4R6T A;  4H89 A;  4A95 A;  3D68 A;  1V0C A;  1MJA A;  1CM0 A;  4KUA A;  5K8N A;  3RNZ A;  5EMI A;  4OID A;  2JEV A;  2QEC A;  2RB7 A;  2HB6 A;  1AMP A;  2EO8 A;  2EWB A;  3KR4 A;  3LOD A;  1VKC A;  3I9S A;  1DTD A;  2AFS A;  1CPX A;  1ON0 A;  3D7G A;  4QUS A;  4KS9 A;  5J8C A;  3S9N A;  1IID A;  3CZX A;  3PB8 X;  2ZEH A;  2PCU A;  4A38 A;  4A37 A;  4HPS A;  4P4D A;  3PB9 X;  3PRT A;  2DEA A;  1EE3 P;  1OBR A;  1NE9 A;  3T90 A;  2ZW4 A;  1F57 A;  3NH4 A;  3VAT A;  4RN7 A;  5LYI A;  4Q7A A;  3NH5 A;  3K9T A;  2Z11 A;  1AYE A;  1LOK A;  1P0H A;  1RXT A;  3RZA A;  1DE4 C;  1XBU A;  2VL1 A;  3D7H A;  5JH9 A;  1R3N A;  4C68 A;  1ARL A;  4JXR A;  4ZY2 A;  2PE3 A;  4NGS A;  1QMU A;  4LX9 A;  2C6P A;  4MXU A;  3SHP A;  4OP4 A;  5J8F A;  4R3K A;  2Z10 A;  3SJE A;  4ZY0 A;  4CAE A;  5LYL A;  1BPN A;  3KR5 A;  4MRI A;  2X7B A;  4CAF A;  4CAW A;  4H6U A;  4X5K A;  4EVY A;  2AJ6 A;  1J4J A;  4OC2 A;  2GLF A;  4HKF A;  1Z8X A;  2I00 A;  2HUZ A;  3R9F A;  1K4J A;  3TCV A;  4PXC A;  4KSA A;  4L8A A;  2KCW A;  4KLW A;  1Z9U A;  2YNC A;  4UWJ A;  1TF9 A;  1LFW A;  2J8M A;  5HVH A;  4WJB A;  4X8I A;  2V77 A;  1KWM A;  5GCN A;  3QB8 A;  1YW4 A;  4XPL A;  3EFA A;  4ZX9 A;  4JJX A;  5D8N A;  1UWY A;  4KSF A;  5CBM A;  2CIJ A;  4P45 A;  6CPA A;  2AFW A;  5DS0 A;  4WWV A;  3R95 A;  2REE A;  4FAI A;  2O53 A;  4LQG A;  3KQZ A;  4NGQ A;  2AFZ A;  2EVN A;  2HC9 A;  3PFO A;  3MGD A;  1KUV A;  3FMC A;  1ZO0 A;  5EC4 A;  1KUY A;  1Y7R A;  1ZG9 A;  4CRY B;  5HVG A;  3D2M A;  2BUE A;  2PVW A;  3N7Z A;  3WC7 A;  3VWD A;  2VI7 A;  4FD4 A;  3LMS A;  1AUG A;  2DPS A;  4OC0 A;  4OLL A;  3TOB A;  3GYA A;  1ZG7 A;  2PJ7 A;  4CYN A;  2Z3M A;  4ZI6 A;  4C2X A;  4MJ8 A;  4EWT A;  2Q4Y A;  4MBU A;  1UFH A;  3JUW A;  4CAX A;  3UY5 A;  2P6E A;  4II9 A;  5K8P A;  1BO4 A;  3FNC A;  4HNY B;  4E0A A;  2ABZ A;  3CPX A;  8CPA A;  2C6G A;  4QB9 A;  3FBU A;  2HV2 A;  2OU2 A;  1N71 A;  1FNO A;  2FIA A;  1YK3 A;  3JVN A;  4PXB A;  2PR8 A;  5THW A;  4C7H A;  5F49 A;  2GFQ A;  3H4Q A;  3NE8 A;  1ZLH A;  1TF8 A;  4MY3 A;  4MCR A;  4UCN A;  2BEI A;  5JPH A;  4PSX A;  5ISV A;  3KZW A;  4M3S A;  4GXH A;  1RO5 A;  1IYL A;  3TOA A;  2Z3K A;  5A28 A;  4CGL A;  2A4N A;  1M44 A;  4FWU A;  4JWP A;  4X2T A;  3TE4 A;  4JYW A;  1HDU A;  3FJU A;  2AE6 A;  4A30 A;  1Q2D A;  4KOY A;  4C2Z A;  1LAP A;  2CY2 A;  5LRG A;  4CYQ A;  4RUH A;  3D66 A;  2Q0Y A;  4MMO A;  3PB4 X;  3GB0 A;  5C82 A;  4X3R A;  2F8H A;  2POK A;  3IU1 A;  4OAE A;  4B5P B;  4PK2 A;  2FIW A;  1Z2L A;  3NE7 A;  3DSB A;  2VXK A;  4OME A;  1Y9W A;  2G0B A;  2PR1 A;  2V8D A;  3HUV A;  4R7M A;  5JM6 A;  3DR6 A;  1U6M A;  1A2Z A;  2NSM A;  2PJA A;  1MK4 A;  3JRU A;  2QIR A;  3QNV A;  2BCO A;  1Y0R A;  3R96 A;  2R1I A;  3H8F A;  4L89 A;  1I21 A;  3FYN A;  2OOT A;  3PB7 X;  5IB9 A;  1IYK A;  1XOV A;  1S5K A;  1XFO A;  2Z3P A;  2CNS A;  2QYV A;  2CXA A;  4KOU A;  4RI1 A;  4DNC A;  4ZYQ A;  4P4F A;  1XF8 A;  1YLE A;  4F0Y A;  2AFU A;  4JLY A;  1B87 A;  4MFZ A;  1XEB A;  2NYQ A;  2JBK A;  5AG7 A;  3PEI A;  3D2P A;  4NGT A;  3S6K A;  4CAV A;  2ZW7 A;  2GE3 A;  4ONU A;  4OC1 A;  4R57 A;  4UFW A;  4I49 A;  2VBQ A;  3LD2 A;  4YGO A;  2BO9 A;  3ZZI A;  2Y0M A;  5K8O A;  2J8R A;  3TFY A;  4JXQ A;  4O23 A;  4P4J A;  2VEZ A;  1M1D A;  5F47 A;  3SXN A;  2BOA A;  3WR7 A;  5IB0 A;  4B13 A;  2YND A;  1CPS A;  3B2Y A;  2ARH A;  4PV6 A;  2WUU A;  2G3A A;  2G9D A;  2IJZ A;  3ISX A;  1F2P A;  2PJ8 A;  3PBB A;  2PJ2 A;  4MFK A;  4H6Z A;  5G1Z A;  4PXE A;  1TKH A;  4FUU A;  1B6B A;  3BJ7 A;  3V8I A;  2AFM A;  1FY7 A;  2ATR A;  1WWZ A;  1Z8W A;  2WYR A;  3DLJ A;  2ZEO A;  3GLJ A;  4NGN A;  3BLN A;  3LAC A;  1ELL P;  2ANP A;  4OC3 A;  1S7L A;  4P4I A;  2IMO A;  3WC5 A;  3K9U A;  1XMT A;  5FVJ A;  4M6I A;  5G21 A;  4KOX A;  4RS2 A;  1VHE A;  3A9L A;  3WT4 A;  4Q36 A;  5JQ4 A;  3BHX A;  5F09 A;  3KKW A;  4KZT A;  4CS0 B;  2PDO A;  4C7I A;  3SJX A;  3GUX A;  1Z4E A;  3KL9 A;  4P44 A;  1R57 A;  5KTD A;  1YW6 A;  3R1K A;  4UEZ A;  3QAH A;  2P6F A;  1S7N A; 
#chains in the Genus database with same CATH homology
 5AG5 A;  2PRB A;  2Z3N A;  4ORF A;  4AVB A;  1CJW A;  3GY9 A;  4K30 A;  2Z0Z A;  1I1D A;  4MI4 A;  1XIX A;  1PU9 A;  4CGM A;  4QC6 A;  2D4P A;  3IU2 A;  1S3Z A;  4KUB A;  1S60 A;  3G3S A;  4MHD A;  1WK4 A;  3VWE A;  5A27 A;  5KTC A;  2C27 A;  4UCM A;  2B58 A;  3IWE A;  1P4N A;  2WPX A;  4R87 A;  3CXP A;  2Z3L A;  1GHE A;  4AG7 A;  2FCK A;  3PZJ A;  3IWG A;  4CGP A;  5DWN A;  1YRE A;  4AB7 A;  4XNH B;  2NMT A;  2YNC C;  4B11 A;  5KTA A;  2R7H A;  4BBH A;  1QSN A;  3B8G A;  4E8O A;  5IV0 A;  1VHS A;  1YR0 A;  4UCP A;  1NMT A;  1YVK A;  4NCZ A;  2FE7 A;  5DWM A;  2D4O A;  2REF A;  1Z4R A;  3PP9 A;  2GAN A;  2VZZ A;  3PGP A;  2FXF A;  5G22 A;  1SQH A;  1XE4 A;  3BJ8 A;  3S6G A;  4R3L A;  2P0W A;  2FT0 A;  4Q38 A;  3C26 A;  2K5T A;  2PC1 A;  4HNW B;  3FB3 A;  2Q4V A;  4XPD B;  4FD7 A;  2R98 A;  3W6X A;  4C2Y A;  3F5B A;  2IL4 A;  4J3G A;  4BMH A;  2WSA A;  4FD6 A;  3IGR A;  5F46 A;  5H84 A;  4JD6 A;  5IX3 A;  4YRH A;  4HNX B;  4QBJ A;  4NEX A;  4Y49 B;  1S7K A;  2OZH A;  4IUS A;  1M4G A;  5BWA B;  4F0X A;  2PSW A;  2YGW A;  3W91 A;  1MJ9 A;  4B10 A;  4B14 A;  3DDD A;  2BSW A;  2G3T A;  2GIV A;  4KOS A;  4UFX A;  1LRZ A;  4CGN A;  5C88 A;  4M85 A;  1BOB A;  5HH1 A;  3E0K A;  2JDD A;  1KZF A;  2P6G A;  2QML A;  1IIC A;  4E2A A;  3FRM A;  1TIQ A;  2ZW6 A;  4AVA A;  2PQ8 A;  5AG4 A;  2B4D A;  2Q04 A;  2ZPA A;  5I0C A;  1YGH A;  1Q2C A;  4UA3 A;  4A33 A;  3FIX A;  2Q7B A;  4AG9 A;  3OWC A;  2OB0 A;  4KOV A;  4IF5 A;  2CNT A;  3EXN A;  3T9Y A;  4KLV A;  4NF1 A;  4KVM E;  1I12 A;  3DR8 A;  4MY0 A;  2VQY A;  2EUI A;  3SXO A;  4LUA A;  2B3U A;  1IB1 E;  2B4D B;  4ZGY B;  1NSL A;  3JTK A;  4UFV A;  4A32 A;  2Q44 A;  2I79 A;  1QSR A;  4PK3 A;  3TTH A;  2B5G A;  2BL1 A;  2H5M A;  1S7F A;  4R9M A;  4CYP A;  5H86 A;  4GS4 A;  3TO6 A;  1PUA A;  4KOR A;  1YVO A;  4OAD A;  3EO4 A;  3P2H A;  3W6S A;  4CYO A;  4UWI A;  4CGO A;  3CXQ A;  2FL4 A;  4XPK A;  3D8P A;  3S6F A;  1L0C A;  2WPW A;  2OZG A;  3F8K A;  2B5G B;  2FS5 A;  3P2F A;  1MJB A;  4A31 A;  3TO9 A;  4A2Z A;  2B4B A;  4NSQ A;  3R9E A;  3H5Z A;  2F5I A;  3TO7 A;  3EY5 A;  4MFL A;  3I3G A;  4XNH C;  1YX0 A;  4ZBG A;  2DXQ A;  2YNE A;  4U5Y A;  5G20 A;  4AVC A;  2ZW5 A;  5AG6 A;  1M4I A;  3G8W A;  4NXY A;  4YFJ A;  5E96 A;  5HMN A;  2VZY A;  2ZXV A;  5EBV A;  2O28 A;  4B5P A;  4U9Z A;  4B5O A;  3F0A A;  3D3S A;  3S6H A;  3CXS A;  1QST A;  2B3V A;  4MFQ A;  2FSR A;  4B12 A;  1QSM A;  1Y9K A;  2DPT A;  2Z3O A;  2CNM A;  2J8N A;  5F48 A;  4FD5 A;  3FXT A;  2JDC A;  1KUX A;  1Q2Y A;  4XPD C;  4KVX A;  2OH1 A;  5AGE A;  3EC4 A;  3ZJ0 A;  1M4D A;  4KOT A;  5CNP A;  3DNS A;  4QVT A;  2OZU A;  4CRZ B;  3TT2 A;  2RC4 A;  4KOW A;  1OZP A;  4F6A A;  3RYO A;  4MFJ A;  4U9Y A;  3GKR A;  4PSW A;  4UBR A;  4Y49 C;  4MFP A;  3R9G A;  2HQY A;  2JLM A;  4KVO E;  2R8V A;  4H89 A;  4A95 A;  1V0C A;  1MJA A;  1CM0 A;  4KUA A;  2JEV A;  2QEC A;  3LOD A;  1VKC A;  3I9S A;  1ON0 A;  4QUS A;  4KS9 A;  5J8C A;  1IID A;  1NE9 A;  3T90 A;  2ZW4 A;  2Z11 A;  1P0H A;  1RXT A;  4C68 A;  4JXR A;  4LX9 A;  3SHP A;  5J8F A;  4R3K A;  2Z10 A;  4CAE A;  4CAF A;  4CAW A;  2X7B A;  4EVY A;  4H6U A;  4X5K A;  2AJ6 A;  1J4J A;  4HKF A;  2I00 A;  2HUZ A;  3R9F A;  1K4J A;  3TCV A;  4KSA A;  4L8A A;  2KCW A;  4KLW A;  1Z9U A;  2YNC A;  4UWJ A;  2J8M A;  5GCN A;  3QB8 A;  4XPL A;  3EFA A;  4JJX A;  4KSF A;  3R95 A;  2REE A;  2EVN A;  3MGD A;  1KUV A;  1ZO0 A;  5EC4 A;  1KUY A;  1Y7R A;  4CRY B;  3D2M A;  2BUE A;  3N7Z A;  3VWD A;  2VI7 A;  4FD4 A;  2DPS A;  4OLL A;  3TOB A;  3GYA A;  4CYN A;  2Z3M A;  4C2X A;  4MJ8 A;  2Q4Y A;  4MBU A;  1UFH A;  3JUW A;  4CAX A;  3UY5 A;  2P6E A;  4II9 A;  1BO4 A;  3FNC A;  4HNY B;  4E0A A;  4QB9 A;  3FBU A;  2HV2 A;  2OU2 A;  1N71 A;  2FIA A;  1YK3 A;  3JVN A;  2PR8 A;  4C7H A;  5F49 A;  3H4Q A;  4MY3 A;  4UCN A;  2BEI A;  5JPH A;  4PSX A;  5ISV A;  4M3S A;  1RO5 A;  1IYL A;  3TOA A;  2Z3K A;  5A28 A;  4CGL A;  2A4N A;  1M44 A;  4JWP A;  3TE4 A;  2AE6 A;  4A30 A;  1Q2D A;  4KOY A;  4C2Z A;  2CY2 A;  4CYQ A;  2Q0Y A;  5C82 A;  3IU1 A;  4OAE A;  4B5P B;  4PK2 A;  2FIW A;  3NE7 A;  3DSB A;  2VXK A;  1Y9W A;  2G0B A;  2PR1 A;  3DR6 A;  1U6M A;  1MK4 A;  2QIR A;  3R96 A;  2R1I A;  4L89 A;  1I21 A;  3FYN A;  1IYK A;  1S5K A;  2Z3P A;  2CNS A;  2CXA A;  4KOU A;  4RI1 A;  4DNC A;  1XF8 A;  1YLE A;  4F0Y A;  4JLY A;  1B87 A;  4MFZ A;  1XEB A;  4CAV A;  5AG7 A;  3S6K A;  3D2P A;  2ZW7 A;  2GE3 A;  4ONU A;  1S7N A;  4R57 A;  4UFW A;  4I49 A;  2VBQ A;  3LD2 A;  4YGO A;  3ZZI A;  2Y0M A;  3TFY A;  2J8R A;  4JXQ A;  2VEZ A;  1M1D A;  5F47 A;  3SXN A;  3WR7 A;  5IB0 A;  4B13 A;  2YND A;  4PV6 A;  2ARH A;  2WUU A;  2G3A A;  4MFK A;  4H6Z A;  5G1Z A;  1B6B A;  3BJ7 A;  3V8I A;  1FY7 A;  2ATR A;  1WWZ A;  3BLN A;  1S7L A;  3K9U A;  1XMT A;  5FVJ A;  5G21 A;  4KOX A;  4RS2 A;  3A9L A;  5JQ4 A;  4Q36 A;  3KKW A;  4KZT A;  4CS0 B;  2PDO A;  4C7I A;  1Z4E A;  1R57 A;  5KTD A;  3R1K A;  3QAH A;  2P6F A;  1QSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...