4R3KA

Crystal structure of ard1 n-terminal acetyltransferase from sulfolobus solfataricus bound to coa
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
157
structure length
157
Chain Sequence
DFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAIVDNSVVGYIMPRIEWGFSNIKQLPSLVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYYADGEDAYLMARPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized N-acetyltransferase SSO0209
publication title Structural Basis for Substrate-specific Acetylation of N alpha-acetyltransferase Ard1 from Sulfolobus solfataricus
pubmed doi rcsb
source organism Sulfolobus solfataricus p2
molecule tags Transferase
total genus 49
structure length 157
sequence length 157
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2014-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4r3kA00
1NE9A 1YX0A 4RI1A 2PDOA 1XF8A 3T90A 4E2AA 1M1DA 1S60A 5KTCA 3VWEA 3R95A 4JXQA 4B5PA 5JPHA 4NF1A 2KCWA 2B58A 4YFJA 4DNCA 4IF5A 4B5OA 3D3SA 4M85A 1IYKA 4XNHB 3BJ7A 2QECA 2Q4VA 4AVAA 2FXFA 3TE4A 2HQYA 5CNPA 2C27A 4B5PB 2ARHA 4MHDA 2JEVA 3R9FA 1KZFA 2NMTA 5J8FA 3S6HA 4HNXB 3SXNA 1QSTA 3I9SA 4M3SA 3IWGA 4AG7A 1IICA 4KVOE 3GY9A 4U9YA 2REFA 4ZBGA 4YRHA 1FY7A 1LRZA 2VI7A 3TO6A 5F47A 4E8OA 2PR1A 1P4NA 5IX3A 5IB0A 2A4NA 4CAWA 2R8VA 4HNWB 3RYOA 2B3UA 4CAXA 2AE6A 2ZW5A 4JXRA 1L0CA 2BEIA 4KVXA 2BUEA 2ZXVA 4I49A 1YK3A 1Z9UA 1YR0A 3R9GA 2EUIA 3VWDA 1UFHA 1S7NA 1YLEA 3JVNA 3MGDA 3QAHA 1B6BA 1Q2CA 2OZHA 1IIDA 4XPDC 3FIXA 4R9MA 4LUAA 4KOVA 3TOAA 1M4DA 2EVNA 4BMHA 1MJ9A 4KZTA 4KOWA 3CXSA 4F6AA 4J3GA 1BO4A 2K5TA 1NSLA 3R96A 4HNYB 2JDDA 4QB9A 4UWIA 3ZJ0A 2VBQA 1XMTA 4KOSA 3ZZIA 3W6XA 4U5YA 4H6UA 4L8AA 2Y0MA 2PR8A 1R57A 3GKRA 2FT0A 4F0YA 3S6KA 1YVOA 3DNSA 2Z11A 2J8MA 2Z10A 4XNHC 2OU2A 2FE7A 3EY5A 4MY0A 2REEA 4E0AA 5C88A 2Q44A 1MJAA 4NEXA 2RC4A 4FD5A 1I12A 2BL1A 1MJBA 2WPXA 4ONUA 3FB3A 1BOBA 4QC6A 4AVBA 5C82A 3DSBA 2F5IA 1OZPA 2P6GA 4QVTA 4JLYA 1MK4A 5EC4A 3PZJA 2Q0YA 3FRMA 2B4BA 1J4JA 2G0BA 2HV2A 2VZZA 1IYLA 1PU9A 1Q2DA 3PP9A 1RXTA 4XPLA 4PK3A 4OLLA 5HMNA 2HUZA 2G3AA 3EXNA 2FL4A 4CAVA 2FIAA 4GS4A 3D8PA 1U6MA 2ZPAA 3GYAA 1S3ZA 3K9UA 3FXTA 5I0CA 2CNTA 2OZGA 4R3KA 2P6EA 4K30A 5F48A 3F8KA 2AJ6A 1WK4A 1Q2YA 2OH1A 4FD6A 4FD4A 1RO5A 4MBUA 1M44A 3P2FA 4Y49B 1CM0A 2CY2A 1QSOA 4MY3A 1KUXA 1Y9KA 4JJXA 1ON0A 4YGOA 1KUYA 1XEBA 4OAEA 1GHEA 1XIXA 2IL4A 2OB0A 3FBUA 4CRZB 3TT2A 2GIVA 5DWNA 2X7BA 2P6FA 4XPKA 4KOXA 4CRYB 4H89A 4QUSA 5DWMA 1V0CA 1QSRA 1M4IA 4QBJA 1S7LA 1VHSA 3IGRA 3V8IA 4H6ZA 4AVCA 5E96A 5ISVA 1I1DA 1K4JA 2PC1A 1YGHA 2B5GA 4JD6A 1TIQA 1M4GA 2FIWA 1YVKA 4PSXA 5FVJA 4HKFA 3EC4A 3TCVA 2Q04A 3F5BA 4X5KA 3SHPA 4KLWA 3JUWA 2JLMA 5GCNA 2GE3A 1SQHA 1QSMA 1IB1E 3W6SA 2PRBA 2H5MA 4NCZA 4NSQA 4AB7A 2O28A 2B5GB 2VXKA 4OADA 3R9EA 4MI4A 2PQ8A 2OZUA 4U9ZA 2FS5A 1B87A 2B3VA 3T9YA 2R7HA 4KLVA 3H4QA 4PK2A 3TO9A 5J8CA 2Z0ZA 1CJWA 4II9A 3EFAA 2I79A 2CNMA 4KVME 2B4DA 1Y9WA 3QB8A 4Y49C 3D2MA 2VZYA 4KORA 4JWPA 3LD2A 3S6FA 3CXQA 5JQ4A 5KTDA 3R1KA 5IV0A 2I00A 2Q4YA 1Y7RA 3DR8A 4UWJA 2R98A 4AG9A 2PSWA 3SXOA 3G8WA 2B4DB 3EO4A 3OWCA 4IUSA 4FD7A 4LX9A 1PUAA 1VKCA 2R1IA 1NMTA 3DDDA 2P0WA 3S6GA 4R87A 4L89A 3LODA 4RS2A 4PSWA 3NE7A 1QSNA 2DXQA 2ATRA 4KOUA 4KOYA 3UY5A 2J8RA 1P0HA 2QIRA 2FSRA 3P2HA 1Z4RA 2ZW6A 3DR6A 3CXPA 3F0AA 3FNCA 2FCKA 1Z4EA 2Q7BA 2D4OA 4KUBA 3BLNA 5H86A 5EBVA 5HH1A 3TOBA 1XE4A 4CS0B 5H84A 3I3GA 3N7ZA 4MJ8A 4NXYA 2J8NA 3C26A 3KKWA 2G3TA 2WPWA 2GANA 1S7FA 3BJ8A 4KUAA 4R57A 4PV6A 2JDCA 3FYNA 3D2PA 3B8GA 1WWZA 2VQYA 2QMLA 1YREA 3WR7A 1S5KA 1I21A 2ZW7A 4ORFA 1S7KA 4EVYA 1KUVA 1N71A 4KOTA 3PGPA 2VEZA 3TFYA 4XPDB 3TTHA 2BSWA 2ZW4A 3W91A 4UA3A 2CNSA 2D4PA 3TO7A 3E0KA 5F46A 3G3SA 5F49A 4R3LA 4UBRA 5KTAA
chains in the Genus database with same CATH superfamily
2PJAA 1NE9A 4B10A 3H8GA 1YX0A 4RI1A 3ISZA 4ZX8A 2PDOA 1XF8A 3T90A 2GLJA 2EK9A 3IO1A 1X10A 4E2AA 1TF9A 5HXDA 1M1DA 1S60A 4EMEA 3IJ3A 4A39A 5KTCA 1GYTA 3LMSA 3VWEA 1RTQA 4A33A 3R95A 3PB4X 3BHXA 4JXQA 5D29A 4B5PA 5JPHA 4KSAA 1JWQA 3CPAA 3D7DA 4NF1A 5K8MA 1R3NA 2KCWA 2Q7SA 3IFEA 2B58A 4YFJA 5G1ZA 3CZXA 4DNCA 4IK2A 1DE4C 2PJ3A 4IF5A 4UF4A 4B5OA 3D3SA 2I3CA 3WT4A 4M85A 5F09A 1IYKA 4XNHB 4C2YA 4R7MA 3BJ7A 4A37A 2QECA 3VARA 5HVHA 2Q4VA 1Z8WA 4AVAA 4C2ZA 1AUGA 3B3SA 2FXFA 2JEWA 3TE4A 2V77A 4MXUA 4OKOA 2HQYA 5CNPA 3FECA 2C27A 3PRTA 1Y7EA 4B5PB 1HDUA 2ARHA 4MHDA 2JEVA 4KSIA 3R9FA 4OC0A 1KZFA 2NMTA 3S9NA 2WZNA 5J8FA 3KL9A 3S6HA 4CGPA 3DLJA 3PB6X 3TX8A 4A2ZA 3IEHA 2HB6A 4HNXB 3SXNA 4MFKA 4A38A 4CYQA 3FMCA 1QSTA 3I9SA 1IU8A 4M3SA 3IWGA 2G9DA 5AG6A 1X12A 2ZENA 4AG7A 1IICA 4KVOE 3GY9A 2EWBA 4U9YA 2GU2A 2REFA 4DJLA 5IB9A 4P4JA 4ZBGA 4M6IA 4YRHA 4C2XA 4MMOA 4CYPA 1FY7A 1LRZA 2VI7A 6CPAA 1TKFA 3TO6A 4UCMA 5F47A 4P44A 2ZEGA 4CAEA 3FEEA 4E8OA 4MHZA 2PR1A 1P4NA 3RBUA 5IB0A 5IX3A 2A4NA 2CTBA 4A95A 4PXBA 1IGBA 3PFEA 4CAWA 2R8VA 3D67A 4C68A 4WJBA 4MFQA 4HNWB 3RYOA 2B3UA 2Z3KA 4CAXA 5HVGA 2AE6A 2ZW5A 4JXRA 4UFVA 5AG4A 1L0CA 5A28A 2BEIA 4KVXA 1KWMA 2BUEA 2PJBA 2ZXVA 1YK3A 4I49A 7CPAA 1Z9UA 1YR0A 3R9GA 2EUIA 3LACA 3VWDA 2PE3A 1UFHA 1S7NA 1BPNA 1YLEA 3GUXA 3JVNA 4NGPA 3MGDA 3QAHA 4P4IA 1B6BA 1Q2CA 1CP6A 4IHMA 2OZHA 1IIDA 1CX8A 4XPDC 2PVWA 3FIXA 4R9MA 3LWUA 4LUAA 1YSJA 4KOVA 3TOAA 1M4DA 2EVNA 3QNVA 4BMHA 3PB7X 5AG7A 1MJ9A 4KZTA 4P6YA 4KOWA 1ARMA 3CXSA 2XEFA 4OMEA 4PQAA 4J3GA 4BINA 4F6AA 1BO4A 3KQXA 2K5TA 1NSLA 3SI2A 4CGNA 4OIWA 2QYVA 3R96A 3KHZA 2PJ2A 4HNYB 4GXHA 3NH8A 3PB9X 4X3RA 3GB0A 2JDDA 1BLLE 1IY7A 5LYLA 4QB9A 4UWIA 2Q43A 3QAYA 2VBQA 1XMTA 1UWYA 4KOSA 5ELYA 3L2NA 5THWA 3ZJ0A 1VHOA 3ZZIA 1FT7A 2OR4A 4DUKA 3SJXA 1HDQA 3W6XA 4U5YA 3PEIA 1TXRA 4H6UA 1Z8XA 2DPSA 2PIZA 2Y0MA 3KQZA 4L8AA 4MCRA 4UFXA 2PR8A 3V38A 1R57A 3GKRA 4MFZA 2FT0A 2POKA 3S6KA 3RAMA 1YVOA 3DNSA 4F0YA 4ZY1A 4LQ6A 2ZEPA 2Z11A 2J8MA 2Z10A 3N5FA 4XNHC 1Q7LA 5DS0A 4MHNA 2OU2A 2WSAA 2FE7A 3EY5A 4P4EA 4MY0A 2REEA 1XMBA 2C6PA 4CPAA 4IAVA 4E0AA 3IC1A 2EO8A 5C88A 2Q44A 1MJAA 4NEXA 2JBJA 2YNCA 4M6GA 4O23A 2GREA 1PCAA 5AGEA 2PJ0A 2RC4A 4FD5A 2ZEMA 3D7FA 4F9VA 1I12A 2BL1A 1MJBA 2WPXA 4ONUA 4RUHA 3FB3A 3DGVA 1BOBA 4QC6A 3KI9A 2RFHA 4AVBA 5C82A 3V7ZA 2ANPA 3DSBA 1QQ9A 2F5IA 1Z5RA 1OZPA 1LAPA 2P6GA 3TC8A 3D66A 4QVTA 2Z3MA 4A30A 4JLYA 1MK4A 4UIAA 5EC4A 1ZLIA 4NGTA 4UCNA 3PZJA 5JGFA 4NJRA 2Q0YA 3IIBA 2BOAA 4MFLA 4NFRA 3FRMA 3FVLA 2B4BA 3HLPA 1J4JA 1XFOA 2G0BA 2HV2A 2VZZA 4NGMA 5JM6A 4EFDA 1IOFA 1IYLA 1PU9A 1Q2DA 3PP9A 3VATA 1RXTA 4XPLA 2V8GA 4JZ0A 4PK3A 4P45A 3WC5A 3D68A 3H8EA 4OLLA 5HMNA 3T8WA 2HUZA 3PB8X 2G3AA 3EXNA 4OC4A 5LYDA 5LYIA 2FL4A 5HVFA 4C7HA 1LFWA 2ABZA 4CAVA 2FIAA 4P4FA 4GS4A 3D8PA 4AXVA 2C6CA 2Z3PA 1U6MA 2ZPAA 3FF3A 4P4BA 4MRIA 2CIJA 3GYAA 3FEDA 1S3ZA 4R8FA 5CPAA 3K9UA 3FXTA 1LOKA 2ODFA 5I0CA 2CNTA 2OZGA 2ZEHA 4R3KA 5J1QA 2P6EA 4K30A 4OC3A 1LANA 5LRGA 5F48A 3RZAA 3F8KA 2AJ6A 1WK4A 2ZOGA 3B7IA 4ZY0A 1EE3P 1Q2YA 2OH1A 3KASA 4FD4A 4FD6A 3SJGA 4HPSA 1RO5A 4PPZA 2Q51A 2CXAA 1HEEA 1VGYA 4MBUA 1VHEA 3WABA 1ZG7A 1M44A 3P2FA 4Y49B 1CM0A 2CY2A 4B6ZA 2AFMA 1QSOA 4MY3A 1A2ZA 2ZEFA 1KUXA 1Y0RA 1Y9KA 2XEIA 3KR5A 1ON0A 4JJXA 4YGOA 5G21A 4CAFA 2AFZA 4Z65A 2PJ6A 1KUYA 1XEBA 4OAEA 1GHEA 4Q7AA 1YLOA 1XIXA 2IL4A 1FNOA 2OB0A 3FBUA 4G1PA 4UCPA 2AFOA 1CPSA 4CRZB 3WC7A 3HUVA 2XEGA 1LCPA 2BCOA 3BXMA 4P4DA 4B11A 3TT2A 2GIVA 3D4UA 2O4HA 5DWNA 2X7BA 2P6FA 4R76A 1TKJA 4W9YA 3NH5A 4XPKA 2XEJA 3S9MA 4KOXA 4CRYB 4H89A 4QUSA 5DWMA 3H5ZA 1ELMP 1V0CA 1ZG9A 4WWVA 5G20A 1QSRA 1M4IA 4QBJA 1S7LA 1VHSA 1YW4A 3IGRA 3PBEA 3V8IA 4H6ZA 4OP4A 1CBXA 3RNZA 4UEFA 4OIDA 4NJQA 3SJEA 4AVCA 5E96A 4OC2A 5ISVA 3CPXA 2JBKA 2Z3OA 2ZELA 4MHPA 3MN8A 1ELLP 1I1DA 1K4JA 2PC1A 1YGHA 2B5GA 2V8VA 4JD6A 3D7GA 1TIQA 1M4GA 4F8ZA 1TKHA 4A94A 2HC9A 2FIWA 2ZOFA 1YVKA 3KGQA 4PSXA 5FVJA 4HKFA 3VH9A 4C7IA 4ZY2A 4NGSA 3EC4A 4B12A 3H8FA 3TCVA 4MFPA 1BAVA 2OOTA 2IQ6A 5LRJA 2Q04A 3F5BA 4M6HA 1ZG8A 4X5KA 1F2PA 4KLWA 3SHPA 3JUWA 2JLMA 5GCNA 2GE3A 1SQHA 1QSMA 4A32A 3PBBA 4A31A 1IB1E 3W6SA 2GLFA 2YNEA 4OC1A 2AFWA 2PJ8A 2PRBA 5EMIA 4X8IA 1CG2A 2H5MA 4NCZA 1F57A 1ARLA 1CPXA 1PYTB 3IU1A 4NSQA 4AB7A 2O28A 2B5GB 2VXKA 1YW6A 4OADA 3R9EA 5A27A 4MI4A 2PQ8A 1XOVA 2OZUA 3KZWA 4U9ZA 4UFWA 2FS5A 1B87A 2B3VA 3T9YA 4MCSA 4TNUA 3PFOA 5LYFA 2PJ7A 2R7HA 3FX6A 2AFUA 4KLVA 2QJ8A 3H4QA 4ZX9A 4PK2A 2PJ5A 5AG5A 3B3WA 2IMOA 2RB7A 1Z8LA 3NA6A 2V8DA 2DPTA 2PRQA 3CDXA 3TO9A 2PJCA 5J8CA 5D8NA 2Z0ZA 1CJWA 3I1UA 2PCUA 4FWUA 1LAMA 3WC6A 5K8NA 3FJUA 4II9A 2NYQA 2PIYA 2Q4ZA 3EFAA 2I79A 5LRKA 2EBJA 3A9LA 2CNMA 4KVME 2B4DA 3BI1A 2WYRA 4NGQA 1Y9WA 3QB8A 3JTKA 4Y49C 4F0XA 1H8LA 2GFQA 3D2MA 2VZYA 4K3NA 4KORA 4JWPA 4FUUA 4UEEA 1XBUA 1TF8A 3LD2A 3S6FA 4CGMA 3CXQA 5JQ4A 5KTDA 2BO9A 3R1KA 4PXDA 5K8OA 2O53A 5IV0A 2I00A 2Q4YA 2YGWA 1Y7RA 2PJ9A 4GM5A 3DR8A 4UWJA 8CPAA 2R98A 4AG9A 2PSWA 4ZI6A 3SXOA 3G8WA 1XRYA 3KHXA 3B3CA 2Z3NA 3B2YA 2B4DB 3SI0A 3EO4A 2FVGA 3OWCA 3NE8A 4IUSA 4FD7A 3D7HA 4LX9A 4MHYA 2PJ1A 4CYOA 1PUAA 3SJFA 1VKCA 5BWAB 2R1IA 4BD9A 2F8HA 1NMTA 4CGOA 2ZEDA 3DDDA 2P0WA 2C6GA 4RN7A 3IWEA 4MFJA 1JQGA 4UEZA 3FH4A 3S6GA 2PVVA 3SI1A 4DYOA 4TWEA 4R87A 1Z2LA 4L89A 3LODA 3NH4A 4B13A 4RS2A 1Y0YA 3B35A 3K2KA 3NE7A 4PSWA 1QSNA 2DXQA 2ATRA 2DEAA 2V8HA 4NGRA 4FBEA 4CGLA 1ZLHA 1M4LA 1NSAA 2J9AA 4KOUA 4KOYA 3UY5A 4B14A 1YMEA 2WUUA 2J8RA 4JYWA 3S9LA 3IU2A 4KSFA 5CBMA 1P0HA 1OBRA 2QIRA 2FSRA 3NFZA 4LQGA 3P2HA 3K9TA 1Z4RA 5K8PA 2ZW6A 3DR6A 2VL1A 3CXPA 3F0AA 3FNCA 2FCKA 1AMPA 4Q36A 1IOIA 5I4MA 1Z4EA 4YWYA 1YQEA 2C1CA 2CF4A 4ONWA 1XJOA 2Q7BA 3B3TA 2D4OA 4KUBA 3B3VA 2ZEOA 3BLNA 4CYNA 5H86A 5EBVA 2Z3LA 2ZEEA 5HH1A 3CT9A 3ISXA 3TOBA 1DTDA 1XE4A 4YU9A 2QVPA 4ZGYB 4CS0B 5H84A 3I3GA 3N7ZA 4MJ8A 2CTCA 1ZO0A 2J8NA 4NXYA 4PXCA 4ZYQA 1BPMA 4Q38A 3C26A 3KKWA 3JRUA 3RO0A 2G3TA 2WPWA 2F7VA 2GANA 1S7FA 3BJ8A 4KUAA 4R57A 5G22A 3GIUA 4PV6A 3KR4A 2JDCA 3FYNA 2AFXA 3D2PA 2YNCC 2NSMA 4UIBA 5JH9A 3B8GA 4OC5A 1CP7A 4H2KA 2DF5A 4NGNA 4R6TA 3BI0A 2YNDA 4KS9A 1WWZA 2VQYA 2QMLA 1R43A 1YREA 3GLJA 3WR7A 3MRUA 4X2TA 1S5KA 2EK8A 1I21A 1Z8TA 2ZW7A 4MCQA 1S7KA 4ORFA 1KUVA 4BBHA 4EVYA 1N71A 4KOTA 1VIXA 2VEZA 3PGPA 3TFYA 1AYEA 4XPDB 1QMUA 3TTHA 2BSWA 2ZW4A 3W91A 4PXEA 4UA3A 4F9UA 2CNSA 2D4PA 3IWWA 2IJZA 3TO7A 4MCPA 2PJ4A 3E0KA 5F46A 3G3SA 4EWTA 5F49A 4R3LA 4FAIA 2AFSA 4P10A 4UBRA 1F2OA 5KTAA
chains in the Genus database with same CATH topology
1NE9A 4B10A 1YX0A 4RI1A 2PDOA 1XF8A 3T90A 4E2AA 1M1DA 1S60A 5KTCA 4A33A 3VWEA 3R95A 4JXQA 4B5PA 5JPHA 4KSAA 4NF1A 2KCWA 2B58A 4YFJA 5G1ZA 4DNCA 4IF5A 4B5OA 3D3SA 4M85A 1IYKA 4XNHB 4C2YA 3BJ7A 2QECA 2Q4VA 4AVAA 4C2ZA 2FXFA 3TE4A 2HQYA 5CNPA 2C27A 4B5PB 2ARHA 4MHDA 2JEVA 3R9FA 1KZFA 2NMTA 5J8FA 3S6HA 4CGPA 4A2ZA 4HNXB 3SXNA 4MFKA 4CYQA 1QSTA 3I9SA 4M3SA 3IWGA 5AG6A 4AG7A 1IICA 4KVOE 3GY9A 4U9YA 2REFA 4ZBGA 4YRHA 4C2XA 4CYPA 1FY7A 1LRZA 2VI7A 3TO6A 4UCMA 5F47A 4CAEA 4E8OA 2PR1A 1P4NA 5IX3A 5IB0A 2A4NA 4CAWA 4A95A 2R8VA 4C68A 4MFQA 4HNWB 3RYOA 2B3UA 2Z3KA 4CAXA 2AE6A 2ZW5A 4JXRA 4UFVA 5AG4A 1L0CA 5A28A 2BEIA 4KVXA 2BUEA 2ZXVA 4I49A 1YK3A 1Z9UA 1YR0A 3R9GA 2EUIA 3VWDA 1UFHA 1S7NA 1YLEA 3JVNA 3MGDA 3QAHA 1B6BA 1Q2CA 2OZHA 1IIDA 4XPDC 3FIXA 4R9MA 4LUAA 4KOVA 3TOAA 1M4DA 2EVNA 4BMHA 5AG7A 1MJ9A 4KZTA 4KOWA 3CXSA 4F6AA 4J3GA 1BO4A 2K5TA 1NSLA 4CGNA 3R96A 4HNYB 2JDDA 4QB9A 4UWIA 3ZJ0A 2VBQA 1XMTA 4KOSA 3ZZIA 3W6XA 4U5YA 4H6UA 2DPSA 2Y0MA 4L8AA 4UFXA 2PR8A 1R57A 3GKRA 4MFZA 2FT0A 4F0YA 3S6KA 1YVOA 3DNSA 2Z11A 2J8MA 2Z10A 4XNHC 2OU2A 2WSAA 2FE7A 3EY5A 4MY0A 2REEA 4E0AA 5C88A 2Q44A 1MJAA 4NEXA 2YNCA 5AGEA 2RC4A 4FD5A 1I12A 2BL1A 1MJBA 2WPXA 4ONUA 3FB3A 1BOBA 4QC6A 4AVBA 5C82A 3DSBA 2F5IA 1OZPA 2P6GA 4QVTA 2Z3MA 4A30A 4JLYA 1MK4A 5EC4A 4UCNA 3PZJA 2Q0YA 4MFLA 3FRMA 2B4BA 1J4JA 2G0BA 2HV2A 2VZZA 1IYLA 1PU9A 1Q2DA 3PP9A 1RXTA 4XPLA 4PK3A 4OLLA 5HMNA 2HUZA 2G3AA 3EXNA 2FL4A 4C7HA 4CAVA 2FIAA 4GS4A 3D8PA 2Z3PA 1U6MA 2ZPAA 3GYAA 1S3ZA 3K9UA 3FXTA 5I0CA 2CNTA 2OZGA 4R3KA 2P6EA 4K30A 5F48A 3F8KA 2AJ6A 1WK4A 1Q2YA 2OH1A 4FD6A 4FD4A 1RO5A 2CXAA 4MBUA 1M44A 3P2FA 4Y49B 1CM0A 2CY2A 1QSOA 4MY3A 1KUXA 1Y9KA 4JJXA 5G21A 1ON0A 4YGOA 4CAFA 1KUYA 1XEBA 4OAEA 1GHEA 1XIXA 2IL4A 2OB0A 3FBUA 4UCPA 4CRZB 4B11A 3TT2A 2GIVA 5DWNA 2X7BA 2P6FA 4XPKA 4KOXA 4CRYB 4H89A 4QUSA 5DWMA 3H5ZA 1V0CA 5G20A 1QSRA 1M4IA 4QBJA 1S7LA 1VHSA 3IGRA 3V8IA 4H6ZA 4AVCA 5E96A 5ISVA 2Z3OA 1I1DA 1K4JA 2PC1A 1YGHA 2B5GA 4JD6A 1TIQA 1M4GA 2FIWA 1YVKA 4C7IA 4PSXA 5FVJA 4HKFA 3EC4A 4B12A 3TCVA 4MFPA 2Q04A 3F5BA 4X5KA 3SHPA 4KLWA 3JUWA 2JLMA 5GCNA 2GE3A 1SQHA 1QSMA 4A32A 4A31A 1IB1E 3W6SA 2YNEA 2PRBA 2H5MA 4NCZA 4NSQA 3IU1A 4AB7A 2O28A 2B5GB 2VXKA 4OADA 3R9EA 5A27A 4MI4A 2PQ8A 2OZUA 4UFWA 4U9ZA 2FS5A 1B87A 2B3VA 3T9YA 2R7HA 4KLVA 3H4QA 4PK2A 5AG5A 2DPTA 3TO9A 5J8CA 2Z0ZA 1CJWA 4II9A 3EFAA 2I79A 3A9LA 2CNMA 4KVME 2B4DA 1Y9WA 3QB8A 3JTKA 4Y49C 4F0XA 3D2MA 2VZYA 4KORA 4JWPA 3LD2A 3S6FA 4CGMA 3CXQA 5JQ4A 5KTDA 3R1KA 5IV0A 2I00A 2Q4YA 2YGWA 1Y7RA 3DR8A 4UWJA 2R98A 4AG9A 2PSWA 3SXOA 3G8WA 2Z3NA 2B4DB 3EO4A 3OWCA 4IUSA 4FD7A 4LX9A 4CYOA 1PUAA 1VKCA 5BWAB 2R1IA 1NMTA 4CGOA 3DDDA 2P0WA 3IWEA 4MFJA 3S6GA 4R87A 4L89A 3LODA 4B13A 4RS2A 4PSWA 3NE7A 1QSNA 2DXQA 2ATRA 4CGLA 4KOUA 4KOYA 3UY5A 4B14A 2WUUA 2J8RA 3IU2A 4KSFA 1P0HA 2QIRA 2FSRA 3P2HA 1Z4RA 2ZW6A 3DR6A 3CXPA 3F0AA 3FNCA 2FCKA 4Q36A 1Z4EA 2Q7BA 2D4OA 4KUBA 3BLNA 4CYNA 5H86A 5EBVA 2Z3LA 5HH1A 3TOBA 1XE4A 4ZGYB 4CS0B 5H84A 3I3GA 3N7ZA 4MJ8A 4NXYA 1ZO0A 2J8NA 4Q38A 3C26A 3KKWA 2G3TA 2WPWA 2GANA 1S7FA 3BJ8A 4KUAA 4R57A 5G22A 4PV6A 2JDCA 3FYNA 3D2PA 2YNCC 3B8GA 2YNDA 4KS9A 1WWZA 2VQYA 2QMLA 1YREA 3WR7A 1S5KA 1I21A 2ZW7A 4ORFA 1S7KA 4BBHA 1KUVA 4EVYA 1N71A 4KOTA 3PGPA 2VEZA 3TFYA 4XPDB 3TTHA 2BSWA 2ZW4A 3W91A 4UA3A 2CNSA 2D4PA 3TO7A 3E0KA 5F46A 3G3SA 5F49A 4R3LA 4UBRA 5KTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NE9 A;  1YX0 A;  4RI1 A;  2PDO A;  1XF8 A;  3T90 A;  4E2A A;  1M1D A;  1S60 A;  5KTC A;  3VWE A;  3R95 A;  4JXQ A;  4B5P A;  5JPH A;  4NF1 A;  2KCW A;  2B58 A;  4YFJ A;  4DNC A;  4IF5 A;  4B5O A;  3D3S A;  4M85 A;  1IYK A;  4XNH B;  3BJ7 A;  2QEC A;  2Q4V A;  4AVA A;  2FXF A;  3TE4 A;  2HQY A;  5CNP A;  2C27 A;  4B5P B;  2ARH A;  4MHD A;  2JEV A;  3R9F A;  1KZF A;  2NMT A;  5J8F A;  3S6H A;  4HNX B;  3SXN A;  1QST A;  3I9S A;  4M3S A;  3IWG A;  4AG7 A;  1IIC A;  4KVO E;  3GY9 A;  4U9Y A;  2REF A;  4ZBG A;  4YRH A;  1FY7 A;  1LRZ A;  2VI7 A;  3TO6 A;  5F47 A;  4E8O A;  2PR1 A;  1P4N A;  5IX3 A;  5IB0 A;  2A4N A;  4CAW A;  2R8V A;  4HNW B;  3RYO A;  2B3U A;  4CAX A;  2AE6 A;  2ZW5 A;  4JXR A;  1L0C A;  2BEI A;  4KVX A;  2BUE A;  2ZXV A;  4I49 A;  1YK3 A;  1Z9U A;  1YR0 A;  3R9G A;  2EUI A;  3VWD A;  1UFH A;  1S7N A;  1YLE A;  3JVN A;  3MGD A;  3QAH A;  1B6B A;  1Q2C A;  2OZH A;  1IID A;  4XPD C;  3FIX A;  4R9M A;  4LUA A;  4KOV A;  3TOA A;  1M4D A;  2EVN A;  4BMH A;  1MJ9 A;  4KZT A;  4KOW A;  3CXS A;  4F6A A;  4J3G A;  1BO4 A;  2K5T A;  1NSL A;  3R96 A;  4HNY B;  2JDD A;  4QB9 A;  4UWI A;  3ZJ0 A;  2VBQ A;  1XMT A;  4KOS A;  3ZZI A;  3W6X A;  4U5Y A;  4H6U A;  4L8A A;  2Y0M A;  2PR8 A;  1R57 A;  3GKR A;  2FT0 A;  4F0Y A;  3S6K A;  1YVO A;  3DNS A;  2Z11 A;  2J8M A;  2Z10 A;  4XNH C;  2OU2 A;  2FE7 A;  3EY5 A;  4MY0 A;  2REE A;  4E0A A;  5C88 A;  2Q44 A;  1MJA A;  4NEX A;  2RC4 A;  4FD5 A;  1I12 A;  2BL1 A;  1MJB A;  2WPX A;  4ONU A;  3FB3 A;  1BOB A;  4QC6 A;  4AVB A;  5C82 A;  3DSB A;  2F5I A;  1OZP A;  2P6G A;  4QVT A;  4JLY A;  1MK4 A;  5EC4 A;  3PZJ A;  2Q0Y A;  3FRM A;  2B4B A;  1J4J A;  2G0B A;  2HV2 A;  2VZZ A;  1IYL A;  1PU9 A;  1Q2D A;  3PP9 A;  1RXT A;  4XPL A;  4PK3 A;  4OLL A;  5HMN A;  2HUZ A;  2G3A A;  3EXN A;  2FL4 A;  4CAV A;  2FIA A;  4GS4 A;  3D8P A;  1U6M A;  2ZPA A;  3GYA A;  1S3Z A;  3K9U A;  3FXT A;  5I0C A;  2CNT A;  2OZG A;  4R3K A;  2P6E A;  4K30 A;  5F48 A;  3F8K A;  2AJ6 A;  1WK4 A;  1Q2Y A;  2OH1 A;  4FD6 A;  4FD4 A;  1RO5 A;  4MBU A;  1M44 A;  3P2F A;  4Y49 B;  1CM0 A;  2CY2 A;  1QSO A;  4MY3 A;  1KUX A;  1Y9K A;  4JJX A;  1ON0 A;  4YGO A;  1KUY A;  1XEB A;  4OAE A;  1GHE A;  1XIX A;  2IL4 A;  2OB0 A;  3FBU A;  4CRZ B;  3TT2 A;  2GIV A;  5DWN A;  2X7B A;  2P6F A;  4XPK A;  4KOX A;  4CRY B;  4H89 A;  4QUS A;  5DWM A;  1V0C A;  1QSR A;  1M4I A;  4QBJ A;  1S7L A;  1VHS A;  3IGR A;  3V8I A;  4H6Z A;  4AVC A;  5E96 A;  5ISV A;  1I1D A;  1K4J A;  2PC1 A;  1YGH A;  2B5G A;  4JD6 A;  1TIQ A;  1M4G A;  2FIW A;  1YVK A;  4PSX A;  5FVJ A;  4HKF A;  3EC4 A;  3TCV A;  2Q04 A;  3F5B A;  4X5K A;  3SHP A;  4KLW A;  3JUW A;  2JLM A;  5GCN A;  2GE3 A;  1SQH A;  1QSM A;  1IB1 E;  3W6S A;  2PRB A;  2H5M A;  4NCZ A;  4NSQ A;  4AB7 A;  2O28 A;  2B5G B;  2VXK A;  4OAD A;  3R9E A;  4MI4 A;  2PQ8 A;  2OZU A;  4U9Z A;  2FS5 A;  1B87 A;  2B3V A;  3T9Y A;  2R7H A;  4KLV A;  3H4Q A;  4PK2 A;  3TO9 A;  5J8C A;  2Z0Z A;  1CJW A;  4II9 A;  3EFA A;  2I79 A;  2CNM A;  4KVM E;  2B4D A;  1Y9W A;  3QB8 A;  4Y49 C;  3D2M A;  2VZY A;  4KOR A;  4JWP A;  3LD2 A;  3S6F A;  3CXQ A;  5JQ4 A;  5KTD A;  3R1K A;  5IV0 A;  2I00 A;  2Q4Y A;  1Y7R A;  3DR8 A;  4UWJ A;  2R98 A;  4AG9 A;  2PSW A;  3SXO A;  3G8W A;  2B4D B;  3EO4 A;  3OWC A;  4IUS A;  4FD7 A;  4LX9 A;  1PUA A;  1VKC A;  2R1I A;  1NMT A;  3DDD A;  2P0W A;  3S6G A;  4R87 A;  4L89 A;  3LOD A;  4RS2 A;  4PSW A;  3NE7 A;  1QSN A;  2DXQ A;  2ATR A;  4KOU A;  4KOY A;  3UY5 A;  2J8R A;  1P0H A;  2QIR A;  2FSR A;  3P2H A;  1Z4R A;  2ZW6 A;  3DR6 A;  3CXP A;  3F0A A;  3FNC A;  2FCK A;  1Z4E A;  2Q7B A;  2D4O A;  4KUB A;  3BLN A;  5H86 A;  5EBV A;  5HH1 A;  3TOB A;  1XE4 A;  4CS0 B;  5H84 A;  3I3G A;  3N7Z A;  4MJ8 A;  4NXY A;  2J8N A;  3C26 A;  3KKW A;  2G3T A;  2WPW A;  2GAN A;  1S7F A;  3BJ8 A;  4KUA A;  4R57 A;  4PV6 A;  2JDC A;  3FYN A;  3D2P A;  3B8G A;  1WWZ A;  2VQY A;  2QML A;  1YRE A;  3WR7 A;  1S5K A;  1I21 A;  2ZW7 A;  4ORF A;  1S7K A;  4EVY A;  1KUV A;  1N71 A;  4KOT A;  3PGP A;  2VEZ A;  3TFY A;  4XPD B;  3TTH A;  2BSW A;  2ZW4 A;  3W91 A;  4UA3 A;  2CNS A;  2D4P A;  3TO7 A;  3E0K A;  5F46 A;  3G3S A;  5F49 A;  4R3L A;  4UBR A;  5KTA A; 
#chains in the Genus database with same CATH topology
 2PJA A;  1NE9 A;  4B10 A;  3H8G A;  1YX0 A;  4RI1 A;  3ISZ A;  4ZX8 A;  2PDO A;  1XF8 A;  3T90 A;  2GLJ A;  2EK9 A;  3IO1 A;  1X10 A;  4E2A A;  1TF9 A;  5HXD A;  1M1D A;  1S60 A;  4EME A;  3IJ3 A;  4A39 A;  5KTC A;  1GYT A;  3LMS A;  3VWE A;  1RTQ A;  4A33 A;  3R95 A;  3PB4 X;  3BHX A;  4JXQ A;  5D29 A;  4B5P A;  5JPH A;  4KSA A;  1JWQ A;  3CPA A;  3D7D A;  4NF1 A;  5K8M A;  1R3N A;  2KCW A;  2Q7S A;  3IFE A;  2B58 A;  4YFJ A;  5G1Z A;  3CZX A;  4DNC A;  4IK2 A;  1DE4 C;  2PJ3 A;  4IF5 A;  4UF4 A;  4B5O A;  3D3S A;  2I3C A;  3WT4 A;  4M85 A;  5F09 A;  1IYK A;  4XNH B;  4C2Y A;  4R7M A;  3BJ7 A;  4A37 A;  2QEC A;  3VAR A;  5HVH A;  2Q4V A;  1Z8W A;  4AVA A;  4C2Z A;  1AUG A;  3B3S A;  2FXF A;  2JEW A;  3TE4 A;  2V77 A;  4MXU A;  4OKO A;  2HQY A;  5CNP A;  3FEC A;  2C27 A;  3PRT A;  1Y7E A;  4B5P B;  1HDU A;  2ARH A;  4MHD A;  2JEV A;  4KSI A;  3R9F A;  4OC0 A;  1KZF A;  2NMT A;  3S9N A;  2WZN A;  5J8F A;  3KL9 A;  3S6H A;  4CGP A;  3DLJ A;  3PB6 X;  3TX8 A;  4A2Z A;  3IEH A;  2HB6 A;  4HNX B;  3SXN A;  4MFK A;  4A38 A;  4CYQ A;  3FMC A;  1QST A;  3I9S A;  1IU8 A;  4M3S A;  3IWG A;  2G9D A;  5AG6 A;  1X12 A;  2ZEN A;  4AG7 A;  1IIC A;  4KVO E;  3GY9 A;  2EWB A;  4U9Y A;  2GU2 A;  2REF A;  4DJL A;  5IB9 A;  4P4J A;  4ZBG A;  4M6I A;  4YRH A;  4C2X A;  4MMO A;  4CYP A;  1FY7 A;  1LRZ A;  2VI7 A;  6CPA A;  1TKF A;  3TO6 A;  4UCM A;  5F47 A;  4P44 A;  2ZEG A;  4CAE A;  3FEE A;  4E8O A;  4MHZ A;  2PR1 A;  1P4N A;  3RBU A;  5IB0 A;  5IX3 A;  2A4N A;  2CTB A;  4A95 A;  4PXB A;  1IGB A;  3PFE A;  4CAW A;  2R8V A;  3D67 A;  4C68 A;  4WJB A;  4MFQ A;  4HNW B;  3RYO A;  2B3U A;  2Z3K A;  4CAX A;  5HVG A;  2AE6 A;  2ZW5 A;  4JXR A;  4UFV A;  5AG4 A;  1L0C A;  5A28 A;  2BEI A;  4KVX A;  1KWM A;  2BUE A;  2PJB A;  2ZXV A;  1YK3 A;  4I49 A;  7CPA A;  1Z9U A;  1YR0 A;  3R9G A;  2EUI A;  3LAC A;  3VWD A;  2PE3 A;  1UFH A;  1S7N A;  1BPN A;  1YLE A;  3GUX A;  3JVN A;  4NGP A;  3MGD A;  3QAH A;  4P4I A;  1B6B A;  1Q2C A;  1CP6 A;  4IHM A;  2OZH A;  1IID A;  1CX8 A;  4XPD C;  2PVW A;  3FIX A;  4R9M A;  3LWU A;  4LUA A;  1YSJ A;  4KOV A;  3TOA A;  1M4D A;  2EVN A;  3QNV A;  4BMH A;  3PB7 X;  5AG7 A;  1MJ9 A;  4KZT A;  4P6Y A;  4KOW A;  1ARM A;  3CXS A;  2XEF A;  4OME A;  4PQA A;  4J3G A;  4BIN A;  4F6A A;  1BO4 A;  3KQX A;  2K5T A;  1NSL A;  3SI2 A;  4CGN A;  4OIW A;  2QYV A;  3R96 A;  3KHZ A;  2PJ2 A;  4HNY B;  4GXH A;  3NH8 A;  3PB9 X;  4X3R A;  3GB0 A;  2JDD A;  1BLL E;  1IY7 A;  5LYL A;  4QB9 A;  4UWI A;  2Q43 A;  3QAY A;  2VBQ A;  1XMT A;  1UWY A;  4KOS A;  5ELY A;  3L2N A;  5THW A;  3ZJ0 A;  1VHO A;  3ZZI A;  1FT7 A;  2OR4 A;  4DUK A;  3SJX A;  1HDQ A;  3W6X A;  4U5Y A;  3PEI A;  1TXR A;  4H6U A;  1Z8X A;  2DPS A;  2PIZ A;  2Y0M A;  3KQZ A;  4L8A A;  4MCR A;  4UFX A;  2PR8 A;  3V38 A;  1R57 A;  3GKR A;  4MFZ A;  2FT0 A;  2POK A;  3S6K A;  3RAM A;  1YVO A;  3DNS A;  4F0Y A;  4ZY1 A;  4LQ6 A;  2ZEP A;  2Z11 A;  2J8M A;  2Z10 A;  3N5F A;  4XNH C;  1Q7L A;  5DS0 A;  4MHN A;  2OU2 A;  2WSA A;  2FE7 A;  3EY5 A;  4P4E A;  4MY0 A;  2REE A;  1XMB A;  2C6P A;  4CPA A;  4IAV A;  4E0A A;  3IC1 A;  2EO8 A;  5C88 A;  2Q44 A;  1MJA A;  4NEX A;  2JBJ A;  2YNC A;  4M6G A;  4O23 A;  2GRE A;  1PCA A;  5AGE A;  2PJ0 A;  2RC4 A;  4FD5 A;  2ZEM A;  3D7F A;  4F9V A;  1I12 A;  2BL1 A;  1MJB A;  2WPX A;  4ONU A;  4RUH A;  3FB3 A;  3DGV A;  1BOB A;  4QC6 A;  3KI9 A;  2RFH A;  4AVB A;  5C82 A;  3V7Z A;  2ANP A;  3DSB A;  1QQ9 A;  2F5I A;  1Z5R A;  1OZP A;  1LAP A;  2P6G A;  3TC8 A;  3D66 A;  4QVT A;  2Z3M A;  4A30 A;  4JLY A;  1MK4 A;  4UIA A;  5EC4 A;  1ZLI A;  4NGT A;  4UCN A;  3PZJ A;  5JGF A;  4NJR A;  2Q0Y A;  3IIB A;  2BOA A;  4MFL A;  4NFR A;  3FRM A;  3FVL A;  2B4B A;  3HLP A;  1J4J A;  1XFO A;  2G0B A;  2HV2 A;  2VZZ A;  4NGM A;  5JM6 A;  4EFD A;  1IOF A;  1IYL A;  1PU9 A;  1Q2D A;  3PP9 A;  3VAT A;  1RXT A;  4XPL A;  2V8G A;  4JZ0 A;  4PK3 A;  4P45 A;  3WC5 A;  3D68 A;  3H8E A;  4OLL A;  5HMN A;  3T8W A;  2HUZ A;  3PB8 X;  2G3A A;  3EXN A;  4OC4 A;  5LYD A;  5LYI A;  2FL4 A;  5HVF A;  4C7H A;  1LFW A;  2ABZ A;  4CAV A;  2FIA A;  4P4F A;  4GS4 A;  3D8P A;  4AXV A;  2C6C A;  2Z3P A;  1U6M A;  2ZPA A;  3FF3 A;  4P4B A;  4MRI A;  2CIJ A;  3GYA A;  3FED A;  1S3Z A;  4R8F A;  5CPA A;  3K9U A;  3FXT A;  1LOK A;  2ODF A;  5I0C A;  2CNT A;  2OZG A;  2ZEH A;  4R3K A;  5J1Q A;  2P6E A;  4K30 A;  4OC3 A;  1LAN A;  5LRG A;  5F48 A;  3RZA A;  3F8K A;  2AJ6 A;  1WK4 A;  2ZOG A;  3B7I A;  4ZY0 A;  1EE3 P;  1Q2Y A;  2OH1 A;  3KAS A;  4FD4 A;  4FD6 A;  3SJG A;  4HPS A;  1RO5 A;  4PPZ A;  2Q51 A;  2CXA A;  1HEE A;  1VGY A;  4MBU A;  1VHE A;  3WAB A;  1ZG7 A;  1M44 A;  3P2F A;  4Y49 B;  1CM0 A;  2CY2 A;  4B6Z A;  2AFM A;  1QSO A;  4MY3 A;  1A2Z A;  2ZEF A;  1KUX A;  1Y0R A;  1Y9K A;  2XEI A;  3KR5 A;  1ON0 A;  4JJX A;  4YGO A;  5G21 A;  4CAF A;  2AFZ A;  4Z65 A;  2PJ6 A;  1KUY A;  1XEB A;  4OAE A;  1GHE A;  4Q7A A;  1YLO A;  1XIX A;  2IL4 A;  1FNO A;  2OB0 A;  3FBU A;  4G1P A;  4UCP A;  2AFO A;  1CPS A;  4CRZ B;  3WC7 A;  3HUV A;  2XEG A;  1LCP A;  2BCO A;  3BXM A;  4P4D A;  4B11 A;  3TT2 A;  2GIV A;  3D4U A;  2O4H A;  5DWN A;  2X7B A;  2P6F A;  4R76 A;  1TKJ A;  4W9Y A;  3NH5 A;  4XPK A;  2XEJ A;  3S9M A;  4KOX A;  4CRY B;  4H89 A;  4QUS A;  5DWM A;  3H5Z A;  1ELM P;  1V0C A;  1ZG9 A;  4WWV A;  5G20 A;  1QSR A;  1M4I A;  4QBJ A;  1S7L A;  1VHS A;  1YW4 A;  3IGR A;  3PBE A;  3V8I A;  4H6Z A;  4OP4 A;  1CBX A;  3RNZ A;  4UEF A;  4OID A;  4NJQ A;  3SJE A;  4AVC A;  5E96 A;  4OC2 A;  5ISV A;  3CPX A;  2JBK A;  2Z3O A;  2ZEL A;  4MHP A;  3MN8 A;  1ELL P;  1I1D A;  1K4J A;  2PC1 A;  1YGH A;  2B5G A;  2V8V A;  4JD6 A;  3D7G A;  1TIQ A;  1M4G A;  4F8Z A;  1TKH A;  4A94 A;  2HC9 A;  2FIW A;  2ZOF A;  1YVK A;  3KGQ A;  4PSX A;  5FVJ A;  4HKF A;  3VH9 A;  4C7I A;  4ZY2 A;  4NGS A;  3EC4 A;  4B12 A;  3H8F A;  3TCV A;  4MFP A;  1BAV A;  2OOT A;  2IQ6 A;  5LRJ A;  2Q04 A;  3F5B A;  4M6H A;  1ZG8 A;  4X5K A;  1F2P A;  4KLW A;  3SHP A;  3JUW A;  2JLM A;  5GCN A;  2GE3 A;  1SQH A;  1QSM A;  4A32 A;  3PBB A;  4A31 A;  1IB1 E;  3W6S A;  2GLF A;  2YNE A;  4OC1 A;  2AFW A;  2PJ8 A;  2PRB A;  5EMI A;  4X8I A;  1CG2 A;  2H5M A;  4NCZ A;  1F57 A;  1ARL A;  1CPX A;  1PYT B;  3IU1 A;  4NSQ A;  4AB7 A;  2O28 A;  2B5G B;  2VXK A;  1YW6 A;  4OAD A;  3R9E A;  5A27 A;  4MI4 A;  2PQ8 A;  1XOV A;  2OZU A;  3KZW A;  4U9Z A;  4UFW A;  2FS5 A;  1B87 A;  2B3V A;  3T9Y A;  4MCS A;  4TNU A;  3PFO A;  5LYF A;  2PJ7 A;  2R7H A;  3FX6 A;  2AFU A;  4KLV A;  2QJ8 A;  3H4Q A;  4ZX9 A;  4PK2 A;  2PJ5 A;  5AG5 A;  3B3W A;  2IMO A;  2RB7 A;  1Z8L A;  3NA6 A;  2V8D A;  2DPT A;  2PRQ A;  3CDX A;  3TO9 A;  2PJC A;  5J8C A;  5D8N A;  2Z0Z A;  1CJW A;  3I1U A;  2PCU A;  4FWU A;  1LAM A;  3WC6 A;  5K8N A;  3FJU A;  4II9 A;  2NYQ A;  2PIY A;  2Q4Z A;  3EFA A;  2I79 A;  5LRK A;  2EBJ A;  3A9L A;  2CNM A;  4KVM E;  2B4D A;  3BI1 A;  2WYR A;  4NGQ A;  1Y9W A;  3QB8 A;  3JTK A;  4Y49 C;  4F0X A;  1H8L A;  2GFQ A;  3D2M A;  2VZY A;  4K3N A;  4KOR A;  4JWP A;  4FUU A;  4UEE A;  1XBU A;  1TF8 A;  3LD2 A;  3S6F A;  4CGM A;  3CXQ A;  5JQ4 A;  5KTD A;  2BO9 A;  3R1K A;  4PXD A;  5K8O A;  2O53 A;  5IV0 A;  2I00 A;  2Q4Y A;  2YGW A;  1Y7R A;  2PJ9 A;  4GM5 A;  3DR8 A;  4UWJ A;  8CPA A;  2R98 A;  4AG9 A;  2PSW A;  4ZI6 A;  3SXO A;  3G8W A;  1XRY A;  3KHX A;  3B3C A;  2Z3N A;  3B2Y A;  2B4D B;  3SI0 A;  3EO4 A;  2FVG A;  3OWC A;  3NE8 A;  4IUS A;  4FD7 A;  3D7H A;  4LX9 A;  4MHY A;  2PJ1 A;  4CYO A;  1PUA A;  3SJF A;  1VKC A;  5BWA B;  2R1I A;  4BD9 A;  2F8H A;  1NMT A;  4CGO A;  2ZED A;  3DDD A;  2P0W A;  2C6G A;  4RN7 A;  3IWE A;  4MFJ A;  1JQG A;  4UEZ A;  3FH4 A;  3S6G A;  2PVV A;  3SI1 A;  4DYO A;  4TWE A;  4R87 A;  1Z2L A;  4L89 A;  3LOD A;  3NH4 A;  4B13 A;  4RS2 A;  1Y0Y A;  3B35 A;  3K2K A;  3NE7 A;  4PSW A;  1QSN A;  2DXQ A;  2ATR A;  2DEA A;  2V8H A;  4NGR A;  4FBE A;  4CGL A;  1ZLH A;  1M4L A;  1NSA A;  2J9A A;  4KOU A;  4KOY A;  3UY5 A;  4B14 A;  1YME A;  2WUU A;  2J8R A;  4JYW A;  3S9L A;  3IU2 A;  4KSF A;  5CBM A;  1P0H A;  1OBR A;  2QIR A;  2FSR A;  3NFZ A;  4LQG A;  3P2H A;  3K9T A;  1Z4R A;  5K8P A;  2ZW6 A;  3DR6 A;  2VL1 A;  3CXP A;  3F0A A;  3FNC A;  2FCK A;  1AMP A;  4Q36 A;  1IOI A;  5I4M A;  1Z4E A;  4YWY A;  1YQE A;  2C1C A;  2CF4 A;  4ONW A;  1XJO A;  2Q7B A;  3B3T A;  2D4O A;  4KUB A;  3B3V A;  2ZEO A;  3BLN A;  4CYN A;  5H86 A;  5EBV A;  2Z3L A;  2ZEE A;  5HH1 A;  3CT9 A;  3ISX A;  3TOB A;  1DTD A;  1XE4 A;  4YU9 A;  2QVP A;  4ZGY B;  4CS0 B;  5H84 A;  3I3G A;  3N7Z A;  4MJ8 A;  2CTC A;  1ZO0 A;  2J8N A;  4NXY A;  4PXC A;  4ZYQ A;  1BPM A;  4Q38 A;  3C26 A;  3KKW A;  3JRU A;  3RO0 A;  2G3T A;  2WPW A;  2F7V A;  2GAN A;  1S7F A;  3BJ8 A;  4KUA A;  4R57 A;  5G22 A;  3GIU A;  4PV6 A;  3KR4 A;  2JDC A;  3FYN A;  2AFX A;  3D2P A;  2YNC C;  2NSM A;  4UIB A;  5JH9 A;  3B8G A;  4OC5 A;  1CP7 A;  4H2K A;  2DF5 A;  4NGN A;  4R6T A;  3BI0 A;  2YND A;  4KS9 A;  1WWZ A;  2VQY A;  2QML A;  1R43 A;  1YRE A;  3GLJ A;  3WR7 A;  3MRU A;  4X2T A;  1S5K A;  2EK8 A;  1I21 A;  1Z8T A;  2ZW7 A;  4MCQ A;  1S7K A;  4ORF A;  1KUV A;  4BBH A;  4EVY A;  1N71 A;  4KOT A;  1VIX A;  2VEZ A;  3PGP A;  3TFY A;  1AYE A;  4XPD B;  1QMU A;  3TTH A;  2BSW A;  2ZW4 A;  3W91 A;  4PXE A;  4UA3 A;  4F9U A;  2CNS A;  2D4P A;  3IWW A;  2IJZ A;  3TO7 A;  4MCP A;  2PJ4 A;  3E0K A;  5F46 A;  3G3S A;  4EWT A;  5F49 A;  4R3L A;  4FAI A;  2AFS A;  4P10 A;  4UBR A;  1F2O A;  5KTA A; 
#chains in the Genus database with same CATH homology
 1NE9 A;  4B10 A;  1YX0 A;  4RI1 A;  2PDO A;  1XF8 A;  3T90 A;  4E2A A;  1M1D A;  1S60 A;  5KTC A;  4A33 A;  3VWE A;  3R95 A;  4JXQ A;  4B5P A;  5JPH A;  4KSA A;  4NF1 A;  2KCW A;  2B58 A;  4YFJ A;  5G1Z A;  4DNC A;  4IF5 A;  4B5O A;  3D3S A;  4M85 A;  1IYK A;  4XNH B;  4C2Y A;  3BJ7 A;  2QEC A;  2Q4V A;  4AVA A;  4C2Z A;  2FXF A;  3TE4 A;  2HQY A;  5CNP A;  2C27 A;  4B5P B;  2ARH A;  4MHD A;  2JEV A;  3R9F A;  1KZF A;  2NMT A;  5J8F A;  3S6H A;  4CGP A;  4A2Z A;  4HNX B;  3SXN A;  4MFK A;  4CYQ A;  1QST A;  3I9S A;  4M3S A;  3IWG A;  5AG6 A;  4AG7 A;  1IIC A;  4KVO E;  3GY9 A;  4U9Y A;  2REF A;  4ZBG A;  4YRH A;  4C2X A;  4CYP A;  1FY7 A;  1LRZ A;  2VI7 A;  3TO6 A;  4UCM A;  5F47 A;  4CAE A;  4E8O A;  2PR1 A;  1P4N A;  5IX3 A;  5IB0 A;  2A4N A;  4CAW A;  4A95 A;  2R8V A;  4C68 A;  4MFQ A;  4HNW B;  3RYO A;  2B3U A;  2Z3K A;  4CAX A;  2AE6 A;  2ZW5 A;  4JXR A;  4UFV A;  5AG4 A;  1L0C A;  5A28 A;  2BEI A;  4KVX A;  2BUE A;  2ZXV A;  4I49 A;  1YK3 A;  1Z9U A;  1YR0 A;  3R9G A;  2EUI A;  3VWD A;  1UFH A;  1S7N A;  1YLE A;  3JVN A;  3MGD A;  3QAH A;  1B6B A;  1Q2C A;  2OZH A;  1IID A;  4XPD C;  3FIX A;  4R9M A;  4LUA A;  4KOV A;  3TOA A;  1M4D A;  2EVN A;  4BMH A;  5AG7 A;  1MJ9 A;  4KZT A;  4KOW A;  3CXS A;  4F6A A;  4J3G A;  1BO4 A;  2K5T A;  1NSL A;  4CGN A;  3R96 A;  4HNY B;  2JDD A;  4QB9 A;  4UWI A;  3ZJ0 A;  2VBQ A;  1XMT A;  4KOS A;  3ZZI A;  3W6X A;  4U5Y A;  4H6U A;  2DPS A;  2Y0M A;  4L8A A;  4UFX A;  2PR8 A;  1R57 A;  3GKR A;  4MFZ A;  2FT0 A;  4F0Y A;  3S6K A;  1YVO A;  3DNS A;  2Z11 A;  2J8M A;  2Z10 A;  4XNH C;  2OU2 A;  2WSA A;  2FE7 A;  3EY5 A;  4MY0 A;  2REE A;  4E0A A;  5C88 A;  2Q44 A;  1MJA A;  4NEX A;  2YNC A;  5AGE A;  2RC4 A;  4FD5 A;  1I12 A;  2BL1 A;  1MJB A;  2WPX A;  4ONU A;  3FB3 A;  1BOB A;  4QC6 A;  4AVB A;  5C82 A;  3DSB A;  2F5I A;  1OZP A;  2P6G A;  4QVT A;  2Z3M A;  4A30 A;  4JLY A;  1MK4 A;  5EC4 A;  4UCN A;  3PZJ A;  2Q0Y A;  4MFL A;  3FRM A;  2B4B A;  1J4J A;  2G0B A;  2HV2 A;  2VZZ A;  1IYL A;  1PU9 A;  1Q2D A;  3PP9 A;  1RXT A;  4XPL A;  4PK3 A;  4OLL A;  5HMN A;  2HUZ A;  2G3A A;  3EXN A;  2FL4 A;  4C7H A;  4CAV A;  2FIA A;  4GS4 A;  3D8P A;  2Z3P A;  1U6M A;  2ZPA A;  3GYA A;  1S3Z A;  3K9U A;  3FXT A;  5I0C A;  2CNT A;  2OZG A;  4R3K A;  2P6E A;  4K30 A;  5F48 A;  3F8K A;  2AJ6 A;  1WK4 A;  1Q2Y A;  2OH1 A;  4FD6 A;  4FD4 A;  1RO5 A;  2CXA A;  4MBU A;  1M44 A;  3P2F A;  4Y49 B;  1CM0 A;  2CY2 A;  1QSO A;  4MY3 A;  1KUX A;  1Y9K A;  4JJX A;  5G21 A;  1ON0 A;  4YGO A;  4CAF A;  1KUY A;  1XEB A;  4OAE A;  1GHE A;  1XIX A;  2IL4 A;  2OB0 A;  3FBU A;  4UCP A;  4CRZ B;  4B11 A;  3TT2 A;  2GIV A;  5DWN A;  2X7B A;  2P6F A;  4XPK A;  4KOX A;  4CRY B;  4H89 A;  4QUS A;  5DWM A;  3H5Z A;  1V0C A;  5G20 A;  1QSR A;  1M4I A;  4QBJ A;  1S7L A;  1VHS A;  3IGR A;  3V8I A;  4H6Z A;  4AVC A;  5E96 A;  5ISV A;  2Z3O A;  1I1D A;  1K4J A;  2PC1 A;  1YGH A;  2B5G A;  4JD6 A;  1TIQ A;  1M4G A;  2FIW A;  1YVK A;  4C7I A;  4PSX A;  5FVJ A;  4HKF A;  3EC4 A;  4B12 A;  3TCV A;  4MFP A;  2Q04 A;  3F5B A;  4X5K A;  3SHP A;  4KLW A;  3JUW A;  2JLM A;  5GCN A;  2GE3 A;  1SQH A;  1QSM A;  4A32 A;  4A31 A;  1IB1 E;  3W6S A;  2YNE A;  2PRB A;  2H5M A;  4NCZ A;  4NSQ A;  3IU1 A;  4AB7 A;  2O28 A;  2B5G B;  2VXK A;  4OAD A;  3R9E A;  5A27 A;  4MI4 A;  2PQ8 A;  2OZU A;  4UFW A;  4U9Z A;  2FS5 A;  1B87 A;  2B3V A;  3T9Y A;  2R7H A;  4KLV A;  3H4Q A;  4PK2 A;  5AG5 A;  2DPT A;  3TO9 A;  5J8C A;  2Z0Z A;  1CJW A;  4II9 A;  3EFA A;  2I79 A;  3A9L A;  2CNM A;  4KVM E;  2B4D A;  1Y9W A;  3QB8 A;  3JTK A;  4Y49 C;  4F0X A;  3D2M A;  2VZY A;  4KOR A;  4JWP A;  3LD2 A;  3S6F A;  4CGM A;  3CXQ A;  5JQ4 A;  5KTD A;  3R1K A;  5IV0 A;  2I00 A;  2Q4Y A;  2YGW A;  1Y7R A;  3DR8 A;  4UWJ A;  2R98 A;  4AG9 A;  2PSW A;  3SXO A;  3G8W A;  2Z3N A;  2B4D B;  3EO4 A;  3OWC A;  4IUS A;  4FD7 A;  4LX9 A;  4CYO A;  1PUA A;  1VKC A;  5BWA B;  2R1I A;  1NMT A;  4CGO A;  3DDD A;  2P0W A;  3IWE A;  4MFJ A;  3S6G A;  4R87 A;  4L89 A;  3LOD A;  4B13 A;  4RS2 A;  4PSW A;  3NE7 A;  1QSN A;  2DXQ A;  2ATR A;  4CGL A;  4KOU A;  4KOY A;  3UY5 A;  4B14 A;  2WUU A;  2J8R A;  3IU2 A;  4KSF A;  1P0H A;  2QIR A;  2FSR A;  3P2H A;  1Z4R A;  2ZW6 A;  3DR6 A;  3CXP A;  3F0A A;  3FNC A;  2FCK A;  4Q36 A;  1Z4E A;  2Q7B A;  2D4O A;  4KUB A;  3BLN A;  4CYN A;  5H86 A;  5EBV A;  2Z3L A;  5HH1 A;  3TOB A;  1XE4 A;  4ZGY B;  4CS0 B;  5H84 A;  3I3G A;  3N7Z A;  4MJ8 A;  4NXY A;  1ZO0 A;  2J8N A;  4Q38 A;  3C26 A;  3KKW A;  2G3T A;  2WPW A;  2GAN A;  1S7F A;  3BJ8 A;  4KUA A;  4R57 A;  5G22 A;  4PV6 A;  2JDC A;  3FYN A;  3D2P A;  2YNC C;  3B8G A;  2YND A;  4KS9 A;  1WWZ A;  2VQY A;  2QML A;  1YRE A;  3WR7 A;  1S5K A;  1I21 A;  2ZW7 A;  4ORF A;  1S7K A;  4BBH A;  1KUV A;  4EVY A;  1N71 A;  4KOT A;  3PGP A;  2VEZ A;  3TFY A;  4XPD B;  3TTH A;  2BSW A;  2ZW4 A;  3W91 A;  4UA3 A;  2CNS A;  2D4P A;  3TO7 A;  3E0K A;  5F46 A;  3G3S A;  5F49 A;  4R3L A;  4UBR A;  5KTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...