2V8DA

Crystal structure of mutant e159a of beta-alanine synthase from saccharomyces kluyveri
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
437
structure length
437
Chain Sequence
GTLNLPAAAPLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNAEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-ALANINE SYNTHASE
publication title Crystal Structures of Yeast -Alanine Synthase Complexes Reveal the Mode of Substrate Binding and Large Scale Domain Closure Movements.
pubmed doi rcsb
source organism Saccharomyces kluyveri
total genus 148
structure length 437
sequence length 437
chains with identical sequence B
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2007-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v8dA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2v8dA01
3S9NA 1CPXA 3FH4A 2CTBA 1Z2LA 1Q7LA 4UEFA 3IJ3A 1BPMA 4LQGA 2POKA 4EFDA 3DLJA 1LOKA 2ZEOA 4P6YA 3HUVA 2QYVA 1FT7A 5K8PA 3B3WA 4EMEA 1Y7EA 3JRUA 5I4MA 2PRQA 4FWUA 4MXUA 4FBEA 3BXMA 3FEEA 4OMEA 4UIAA 3MRUA 1CG2A 3KR4A 3BHXA 3KASA 3PFEA 4ZY0A 3CPAA 2ZEHA 5LYLA 2PJBA 3D7HA 2GLFA 4NJQA 2I3CA 2V77A 2PJAA 3LWUA 3GLJA 2PVVA 5JH9A 2PE3A 5K8OA 2ZEPA 3BI1A 3PB4X 4NGQA 3KQZA 2PJ6A 1DE4C 3D68A 4TWEA 1LCPA 3NFZA 4G1PA 4GM5A 4PXDA 1ZG8A 2Q43A 3WABA 4R6TA 1XRYA 1M4LA 4WJBA 1CP7A 4X8IA 4MHZA 4ZX9A 2CIJA 5JM6A 4OKOA 3N5FA 4OC5A 4P4JA 1EE3P 1ZLIA 4Z65A 2V8GA 2PIZA 4A38A 3IEHA 2EWBA 2AFOA 3I1UA 3FF3A 4NGPA 4WWVA 4PXCA 1CPSA 2NYQA 2V8HA 4ONWA 4F9UA 1TKHA 2JBJA 2PJ7A 1F2PA 3CT9A 2F8HA 2RB7A 3B3SA 3IC1A 1LFWA 2AFXA 3B7IA 2PJ3A 4OC0A 4F9VA 1ARMA 1Y0YA 3NH8A 3ISZA 1R43A 3IFEA 3H8FA 3MN8A 1PCAA 2AFMA 4R76A 1LAPA 2ABZA 4RUHA 1Z5RA 1GYTA 1BPNA 5HXDA 2ZEEA 2OOTA 3PBEA 3S9MA 4ZY1A 6CPAA 3V7ZA 3TC8A 2ZOFA 4PXEA 7CPAA 4MHYA 4MRIA 4MCQA 8CPAA 2QVPA 2JBKA 4NGTA 4BD9A 3SJGA 4R7MA 2XEGA 1QQ9A 4UEEA 1QMUA 3RAMA 4W9YA 3CPXA 1YW4A 4OP4A 5K8NA 3T8WA 3RZAA 5K8MA 4P4IA 1TF9A 1TKJA 3QNVA 4JZ0A 2RFHA 1YMEA 4F8ZA 1ZG9A 4ZY2A 2CF4A 2O4HA 4PPZA 1XMBA 2PIYA 4ZYQA 1TF8A 2NSMA 1BAVA 3KR5A 1OBRA 3GUXA 1H8LA 3PB6X 5THWA 4R8FA 3NH4A 3S9LA 4MCPA 4PXBA 4NFRA 5LYFA 3WC5A 3BI0A 2Q51A 4JYWA 2GU2A 2PCUA 2O53A 5LRGA 3FECA 2VL1A 5CBMA 1AYEA 1VGYA 5D8NA 3IIBA 4MCSA 1ELMP 4MMOA 1AMPA 1KWMA 1YW6A 1CP6A 3K9TA 4Q7AA 4NGMA 4X2TA 3SJEA 2HB6A 1IY7A 3PFOA 2AFSA 4NGSA 4P10A 4UEZA 3KQXA 4MHNA 4FAIA 3KI9A 5LRJA 3B3TA 4IK2A 4MHPA 2OR4A 4NJRA 4ZX8A 2C6PA 2ANPA 4DUKA 3D66A 5LYDA 1LANA 4P4FA 5D29A 1VHEA 2XEIA 3FX6A 2Q4ZA 4MCRA 2J9AA 2PJ9A 1R3NA 2F7VA 1IGBA 4H2KA 2ZEGA 3SI0A 1DTDA 3PB8X 3K2KA 4OC4A 3ISXA 3KGQA 3FJUA 4A39A 5DS0A 3CDXA 2PJ8A 4P4DA 1FNOA 1NSAA 3LMSA 1VHOA 4DYOA 2C6GA 3FMCA 2PJ1A 4OC3A 4OC2A 3VATA 2ZELA 3RBUA 4FUUA 3D7GA 4CPAA 4YU9A 1UWYA 2ZENA 3HLPA 2ZEDA 3D7FA 2BO9A 3PB9X 4TNUA 1BLLE 3H8GA 1JQGA 4PQAA 2PJ5A 2IQ6A 1ELLP 4UIBA 4OC1A 5HVHA 2PVWA 3KZWA 3TX8A 3B3VA 1YLOA 1HDQA 1CX8A 2V8VA 3SI2A 2IJZA 2C6CA 3VARA 4KSIA 2GREA 2ZEMA 3B2YA 4P4EA 4P45A 4P4BA 3D4UA 3KL9A 2HC9A 2G9DA 1YSJA 2IMOA 1HDUA 2PJCA 1Z8LA 2AFWA 4P44A 1LAMA 3NH5A 3GB0A 1F2OA 2BCOA 3PB7X 1XFOA 4A37A 3WC6A 4AXVA 2C1CA 5HVGA 1HEEA 3FVLA 2XEJA 5LYIA 3NA6A 2ZOGA 3VH9A 3B35A 2WYRA 1F57A 5JGFA 3SI1A 3FEDA 3DGVA 4OIDA 3V38A 3D67A 4O23A 2DEAA 5J1QA 3IWWA 4EWTA 4NGRA 3L2NA 1TXRA 2EK8A 4IHMA 1XBUA 1TKFA 3PBBA 1ZLHA 1RTQA 2BOAA 4IAVA 2EK9A 1PYTB 2AFZA 1XJOA 2FVGA 4YWYA 1CBXA 2JEWA 3PEIA 4A94A 3SJFA 4UF4A 1ARLA 5ELYA 3KHZA 5CPAA 3WC7A 2GLJA 1VIXA 4NGNA 3WT4A 2ZEFA 5F09A 1Y0RA 5IB9A 2QJ8A 3B3CA 5HVFA 2PJ4A 2PJ2A 4DJLA 4X3RA 2PJ0A 3H8EA 2WZNA 5LRKA 2XEFA 3D7DA 4ZI6A 3PRTA 3SJXA 4B6ZA 3KHXA 1ZG7A 4K3NA 2CTCA 4OIWA 2AFUA 3IO1A 2V8DA
chains in the Genus database with same CATH superfamily
2OLWA 4ZPVR 4A4JA 2I2YA 5DDOC 2H51B 5LXYA 1TKZB 3FEZA 1YBUA 1FX4A 4QB9A 4DEZA 3Q8YA 5IC4B 4I7FA 3B3WA 4EMEA 2B8PA 1RCOB 2UP1A 1M5PC 3W2WB 2AGPA 4UIAA 2BEIA 3IS9B 3OL8A 1PYOB 1CQNA 3M2VA 3IR6B 3VGTA 3UDVA 2CPIA 5F41A 3QYYA 3TAPA 1P6TA 2V77A 2VPWB 4ZPWR 4LF6F 3I5BA 1CBKA 4LSLB 4U9RA 2YNCC 4J9UE 4NGQA 2YNHA 2N82B 4TWEA 5H9FJ 1LCPA 3I0RA 4KE5A 3QAHA 1RISA 2IRUA 1XIXA 4EBDA 1CULA 1X5OA 5GMDA 1OWXA 3HT0A 2E1AA 4H89A 4DQIA 3C8YA 4OKOA 2PC6A 3CJ3A 3GTYX 3GIIA 5SUHA 5J8CA 1K1SA 4PK2A 3BQ2A 1IR1A 3I1UA 3P49B 3M30B 4ZVPB 1N5VA 3VQSA 4ZCIA 1VIOA 2JBJA 5C25A 1IR0A 4Y65A 2JNJA 4HACB 3B3SA 3Q24A 2AFXA 1U0HB 4OQJA 1HBMA 4FN5A 1U1LA 3A9LA 4QVTA 2KT3A 4AYBD 4E2AA 2E7WA 4FPIA 1X10A 3PYGA 1IYKA 1FT8A 6CPAA 4MHYA 4CLUA 3R5DA 2BYCA 4B5PA 1ICEB 2DNLA 1SI9A 3D2WA 1KOOA 1FI4A 3CCJS 4J90A 3K8WA 5HI7A 4TVAB 3QPIA 4K2JA 2YNGA 1K73T 5IS2A 2NLWA 1M1HA 1GFWB 4I64A 5T41A 3LGHA 3MPDA 1HWLA 3G96A 3CJ5A 2OPQB 2AZ1A 3MMJA 3GUXA 5CH7B 5HQ8A 2BQRA 2QX0A 2YWEA 3T9YA 1IKWB 3OLAA 5HLFB 3NE8A 2ZM6J 3BYPA 2GU2A 2ZW5A 2LEPA 4X64F 3DM2A 3UNGC 3A12A 3KWMA 4MFKA 4C7IA 1CS4B 4USUA 2M8HA 2AGOA 3W9JA 1UJ5A 3F5BA 1PUAA 2BE9B 4RN7A 1IOFA 4MIAA 5F0WA 2SXLA 5K14A 4AXIA 5LRJA 2OPSA 5KG7A 1KUXA 1DQAA 1RADB 2ZKTA 2VONA 4CAWA 1YZ7A 3R9LA 1IKXA 4JI2J 2R7UA 1REGX 3OL7A 3R1LA 2W8LA 4JI7F 2DPSA 2RKIB 4GMKA 5LSOA 2LEAA 2DGTA 4PCQA 1P1LA 3G3SA 1RBOB 2JFKA 4AB7A 5F9LA 3CNQP 4IO1A 1VHOA 1X12A 4NYPA 2VKZG 1YJWS 4KSAA 3VATA 2PIIA 3QAYA 3PW0A 2BJ3A 4YU9A 4K4WA 2HHWA 4Q38A 2K5TA 2ZZNA 1WHWA 4TYAA 5G0RB 5KFOA 2Y0MA 2BXJA 1RT2A 1FRXA 5CYQB 3GJQB 2X3GA 8AT1B 4JI4J 1SJ3P 2GJFA 1FDDA 1APSA 4ED5A 3D6MB 3UE2A 2FHJA 3CCRS 4ED3A 4F6AA 1MMNA 1MLAA 3FMBA 4F8RA 5ETTA 1VQPS 1MJ9A 1UTAA 3A8EA 4F3QA 1KS2A 4ECRA 5DRKA 4ED6A 4TYBA 2LEBA 4B9UA 1FA0A 5B0AA 4C4WA 1GK8A 4L72B 2G4BA 1TK5A 2W2OP 5HVGA 2R9LA 2IYGA 2RNEA 2YNIA 3RRHA 3B35A 3M32B 3TZYA 5KFNA 4X4VA 1C1BA 1URNA 4LRCA 4O3SA 3B6BA 3IWWA 2DIVA 3NKYA 1BE4A 1N36J 1VLOA 1JLCB 3R5JB 2LLZA 3OFHA 4QQBA 1RTQA 5L1KA 4B02A 4PWUA 3JSMB 1GMWD 3NS5A 4MFBB 3DRPB 3HX9A 4Y49C 2VJVA 2D7SA 4ES2A 1YBAA 1UW4A 9RUBA 1VBXA 5AJ3J 4L89A 4XDDA 2OO4A 2GX8A 4C8LA 2QT7A 1N0VC 4LRAA 1IIDA 4RLEA 2RD5C 2V8PA 3H8EA 4K4ZA 5J8FA 4OZLA 2JC0A 3Q86A 4MY0A 1L3SA 3PO5A 2A6MA 3G6ES 5ETQA 1NSPA 3KMSA 1YJ9S 2O5DA 4RW9B 1S1XA 4OI0A 1CPXA 3IJ3A 2MJNA 3UD5A 3LP1B 3VCDA 5JPHA 4FYDA 4DV3J 4K5SA 2J7KA 3EXYA 3H4BA 3JS9A 5I4MA 3LWMA 1RA7A 3D6FB 4ZPBA 1J4JA 3DOLB 1S1VA 5FIIA 4CH0S 4DFPA 5B0GA 2W7OA 2VZYA 3CCZA 2K1RA 5A6WA 2I5JA 1XNRF 3OR2B 2HQFA 4Q36A 2ZEPA 3S6GA 4P71A 4USWA 1NRKA 3KQZA 3FZ2A 2VZ9A 2HQDA 4B10A 5F49A 2NYHA 4PXDA 4IG0A 4KAIA 4RW8B 2OH2A 9ATCB 3H8YA 4XIUA 1H38A 4ILMA 4XNHB 4ANEA 2OJ3A 4NA1A 3HHNB 2JEGA 2PIZA 1D8ZA 5KFJA 4CYQA 3HJVA 2ERRA 4U7UD 3K89A 3GP9A 2J7WA 3KNGA 2J8MA 5IM0A 1RLDA 1ZETA 2RQ4A 1HI8A 2E1CA 3Q22A 3BGUA 4DV0J 1ARMA 3IM9A 1ZBTA 3FCWA 3P45B 4DDFA 2XZDB 3R6GB 3AAWB 3EWGA 4L3NA 3M9NB 4QWCA 3DLEA 2QLWA 1YJTA 2J6SA 3G87A 4B3TJ 1BQNA 1LOUA 7CPAA 3HMJG 3QNWB 2WVDA 4KORA 3DI6A 3MGJA 4JI3F 4MCQA 2XHCA 1L3KA 4FNHA 2RDJA 3RYOA 1V5VA 4F2SA 3OWCA 2ZVSA 1KBRA 2CJBA 5K8NA 4Y34A 4FKYA 2HNDA 2B3VA 1U1KA 1ZG9A 2Z57B 1HW9A 4C0BA 1EJ7L 2XMJA 3KK1A 3TVKA 3CCES 4O3OA 5D8HB 2MQNA 4ZN1A 3DYAA 3J81j 2UV8G 5LXRA 3IRXB 1FK9B 4H4MB 5CBMA 4RJVA 1ELMP 5B0DA 3PYDA 3NY0A 1N5QA 3EC4A 2QYCA 1FNXH 5DGBA 2J8SA 1F2GA 5AXMA 1S6QA 2EG2A 4QPXA 2N7YA 1R57A 5C88A 4JI1J 3K17A 3J80Y 3KI9A 4HKFA 3MEKA 1OS5A 1OPIA 3EE3A 1NDCA 5A0YB 4ZJOA 4CAFA 5LYDA 4KJIA 1WC1A 4QWDA 5J2MA 1RT6B 4LUBA 3IBWA 3T3FA 3SI0A 5LSRA 4I4BA 4EBCA 3FC9A 4IOCQ 3KGQA 3GKRA 2D3UA 1IQTA 3M8PA 2HW3A 2R7WA 5KFAA 3LALA 1U45A 3IWEA 3H4DA 2FHOB 4YRHA 2CY2A 1YQHA 2BABA 1R6YA 1VQ5S 4CCHA 1JQGA 5I3QA 2P9CA 2GIVA 2JWNA 5KT4A 3RB0A 1TKZA 3ENVA 1FHTA 3BR8A 1YLOA 4ZLJA 3C26A 3MF5A 2G9OA 3DLKB 2HZVA 1VQKS 1I21A 4IR1A 3DMJA 2R2RA 1ZA2B 3W2WA 2ZEMA 2BKNA 3M9OB 1URRA 2ZZTA 1WC5A 4R25A 3ENAA 2AF6A 1OY9A 1V6HA 1RTJA 1HDUA 3I6PA 2D41A 2LQ9A 2PJCA 2ACYA 1R31A 2MLYA 3G82A 4DUYF 4J9LA 4A8OA 4RPFA 1RT4A 2BANA 2HNZB 4DR1F 2YWKA 3FVLA 1S9GA 3NNAA 1OQ6A 5F47A 1RGVA 3CO0P 4LMZA 4YB7A 3EPGA 4B5OA 4IHMA 5DG8A 1T05A 4IFVA 1ZPVA 4UFVA 1ZYQA 2KVIA 2JEWA 5F3TA 4R5PA 4ZIVA 1KHWA 2LU1A 3H90A 3I4PA 4KZTA 3BKTA 3W2VA 4M6HA 1MWYA 3T41A 3M30A 1KEKA 2UUBJ 4KOWA 2WVBA 3AODA 4FD7A 3MD3A 2B5GB 4ZI6A 1U0HA 4FF4A 4WPAA 2D1CA 2F4VJ 4OIWA 4DV7J 1R8BA 3IO1A 1BXNA 2CQ2A 2LQJA 4ZLPA 3U1MA 2KN4A 1D1UA 7FDRA 1WG1A 2BM0A 4WP9A 3W66A 3BO2A 4PG7A 4M5DB 4M5HA 4DPXA 1YGHA 3OTOF 4A95A 4R87A 4WE1B 3MUVP 3I55S 4C11A 4MFLA 3O44A 4NEZA 3D4JA 3CJ4A 2F1FA 1BY9A 3MEEA 4UWIA 4IQXA 4N47A 1QE1A 2OZGA 3FFIA 3AD9C 3LWUA 1BOBA 5HN0A 4QIGA 2HZCA 4CM0A 1FDNA 5FLXY 3QT8A 1YJNS 5G22A 4NEYA 4DI6A 1IXKA 4Q45A 3GFYA 1M0SA 2OPQA 2P6EA 1SVDA 1YIJS 1JLQB 5MAOA 3DR8A 4RNHA 1T3NA 2OTJS 4B3SJ 2Z2MA 1OQ3A 1VHFA 2NSBA 2VBYA 4DR2F 3P2FA 2V4QA 1GTHA 4USJC 3GCWP 1QSYA 3IM8A 2V8GA 1NU4A 4JXQA 1T8EA 2OZUA 2REEA 4LF1A 2ZPAA 3U7JA 5GAEI 2C42A 1FDAA 1CM0A 4UBRA 3K5PA 2PJ7A 4K4VA 1FKAF 1OJ4A 3GR0A 1Y0HA 3B7IA 2YY3A 2R7XA 3VV2B 2HQ3A 2PEHA 4BMHA 4O44A 3MMAA 1YG0A 2E66A 2AKWB 3N0VA 1C1CB 3NP5A 4ECQA 3AA8A 2OEMA 1LAPA 2XI2A 3SI8A 4LF4F 2J0SD 1VLYA 2YKQA 2XGQA 2XGPA 3IWXA 3THTA 4OYPA 3UCGA 3A1YG 3PJWA 3BJ8A 4DV6J 1S5ZA 3AT1B 3W62A 1S48A 2HAIA 2OELA 4HHHA 2HBYB 5G0RA 1RCXB 2HMIB 1YMEA 3RJMB 5CYQA 4ZY2A 4P2XA 1N54B 4UCPA 3KLHB 4ZP7A 3GIJA 2R4FA 3KR5A 1H3DA 2C2EA 1P1TA 5JMNA 3RRGA 2R7OA 1ZAXA 1WC0A 5HROB 2MSSA 2RU3A 3MAAB 5D8NA 3BGRA 1Y5LB 5H9EK 1Q2CA 2ZH4A 1DY3A 2HS3A 3SJEA 2UUAF 1LNQA 1Q4RA 4C3LA 3NGKA 3FBEA 3KHGA 3FSXA 2V94A 3KQXA 4OADA 1EP4A 3TA0A 3RB4A 2RU9A 5DDQC 3QIPB 4QZVB 1NHUA 1JLCA 4MCRA 2GHVC 2HIYA 4AD6A 1X5TA 3BO3A 4MFBA 2G13A 3TARA 3KLEB 4CO1A 4DR3F 4N5SA 1XMQF 2QIFA 4CLWA 2EKYA 1F3VA 4IOBA 3D3CJ 3K0JA 1L3TA 3VGUA 2IM2A 4R57A 5FVJA 4B17A 5KFDA 2P8IA 3OD2A 1VQ8S 2GO9A 2HNYB 5E5NA 3MMBA 4F04B 4O0NA 5HMNA 5CYMB 2NUHA 2F40A 4QJVA 1S5KA 5IC6B 3LODA 5KT7A 4FF3A 4RW9A 4TXSA 5HP1A 1UFKA 4C7QA 2JLFA 2NZCA 2B6AA 2BRKA 1LWFA 2CPYA 1VOMA 5L39A 4X4RA 2B0GA 2BE2A 1VKCA 3K59A 1B87A 2AEFA 3I32A 4KSIA 2C2KB 3R27A 5HMYA 5HATA 4RW7A 5C5JA 4QYZK 1AW0A 3UCZP 3IWNC 4CNYA 3FRZA 2IVMA 3EY5A 3C15A 2YWHA 4DF4A 4CLSA 2HSEB 3Q8UA 3NH5A 3TO6A 2U2FA 3OR2A 4K2XA 1FTRA 4I6YA 5L9NA 4DFMA 2B4OA 1YVFA 3C46A 1CJWA 4DOZA 1SH0A 2WBMA 1WOOA 1RTDB 3SI1A 3FEDA 1Y9WA 3AXKA 4ZPDA 4RI1A 4JWPA 1JJ4A 3QZ7A 3L2NA 1TXRA 4RW8A 2G1DA 2F4FA 2C2NA 1FX2A 1XN9A 2OTLS 4R3LA 2D69A 1D9DA 3PKYA 3G8SA 2AFZA 1WF0A 3HO1A 2NXEA 4F2RA 4Q8EA 3PEIA 1UEUA 1RWXB 2P0WA 1H74A 2HV2A 2V2KA 3J81Y 2X1AA 2E1MC 1SKSA 4PQUA 1JLFA 4URGA 2ZEFA 3H5YA 2FHJD 2OEKA 3BB5A 3MM6B 2D9OA 4CO3A 1CC8A 1HYSB 4LBIA 2VG6B 1YBTA 2I8EA 3W9HA 3HZGA 1K44A 3DLHA 2DXEA 4UW2A 1NKBA 2V50A 2FVCA 3CB4A 3V6DB 1KFSA 2BV3A 2GVZB 4EZ6A 4OZJA 3OPKA 3C6TB 1NB7A 4OYBA 2WSEC 1IB1E 3H40A 3PZPA 3K7RA 3FXTA 4KT0C 4LQ9A 1X4AA 2ATCB 3ADAC 3UCUP 2PJBA 2GLFA 1DHMA 5LM7E 2VZZA 3CDAA 4PPDA 4FVCA 3GLJA 3H59A 2PVVA 3S6KA 3C16B 2MQOA 3GILA 1T9XA 4ZVRB 4P52A 4I49A 2PJ6A 3NS7B 4NOHA 4FF1A 3JSRA 3BSOA 4OI2A 1NH8A 4R0JA 5I0CA 4G1PA 2KDOA 3PHEA 1F9EB 3IRXA 1FK9A 3QWPA 4X65J 4H4MA 1H98A 1VQSA 3CEDA 4C6AA 2P6SA 3B8GA 3F0AA 4V1Ak 3JTNA 1QSLA 2YQ0A 3N5FA 5AE2A 3VALA 4P4JA 3TO9A 2YX1A 4LRFA 2D3ZA 4E8UA 2OD4A 5E3RA 4RU9A 1HI0P 1IBCB 1CPSA 3V2UC 3PW5A 5CABA 3UDCA 4V19X 4ZVUB 3R5BA 2PDOA 1UAWA 3BH7B 2J8RA 1S7IA 1N33F 1UPMB 1BLUA 4EUVA 1X9MA 4L74A 4C8KA 5E3QA 1Y0YA 3ISZA 2W9BA 3H98A 3PW4A 1YJUA 3NRBA 1RT6A 4DHVA 4LQ3A 2G3AA 3PKMA 2IJNA 4DV2F 2HFUA 2MZJA 5KFPA 5AG4A 4Q8FA 2ZOFA 3H42A 3WC0A 2QVPA 4JI8F 3SJGA 1KP6A 1EARA 2OAUA 3J7YI 4DPTA 1GH8A 2DR8A 2XZTB 5DJBA 3RZAA 2HFSA 5GCNA 2WK4A 1XR5A 3I4HX 1B64A 5DS7A 1S9EB 2YKMA 1O51A 1CJVA 3LGMA 3JQKA 4Q0BA 3TZZA 3P8BB 2GMJA 4ZOSA 3DRXA 1FWPA 2CDQA 3SDEA 4ORFA 1OBRA 1VMBA 1T9UA 3NH4A 3DLKA 3EO4A 4NXMJ 2DB1A 1CJUB 3M8RA 2FLPA 1SJ4P 3RGIA 1HQUB 2VFRA 3TAMA 2Q51A 1S7KA 4OZ0A 4KH1B 2BOPA 2P6GA 2E29A 1RT5B 3LGNA 3QT5A 4KOVA 3B54A 4P2SA 4ILRA 2OSQA 4F3OA 1T02A 2NSCA 4I56A 4KB7A 1TL7B 4E0DA 2V34A 1SJRA 4UEZA 2W25A 3DHXA 3OL9A 1J27A 2M70A 3CUNA 2GVDB 1KTVA 5KT5A 4JI0F 1S0OA 1VHEA 1WD6A 1Q82T 4ANCA 2FVRA 5JVHQ 3NXZA 2PJ9A 4YR0A 2YKPA 1S79A 1KLMA 2O01C 1FNOA 1NDPA 5DDPC 4F4XA 4B11A 1IJFB 1O0PA 2C3UA 3IA0A 3N5BA 3FMCA 3VWSA 5G20A 3VAJA 1TKXA 2ZBCA 2B5GA 3D7GA 1Z1ZA 4NYOA 4GKJJ 2PGCA 2ZEDA 4LIWA 3FQLA 1F60B 3OVSA 3PB9X 1X4DA 1FRHA 2DNQA 1X9WA 1JLEA 2DT9A 4EO6A 1G1XA 1ELLP 2E7XA 2FC8A 4DUZJ 3QLHA 4RNMA 3DOKA 2DY9A 3PIPQ 2VQEJ 2Y0SD 4YP3A 3IBFB 3D4UA 1Y5NB 2BJ7A 7FD1A 4L73A 2HC9A 1VQYA 4IO9Q 5LJ5Y 4AL7A 4WFBQ 4X66F 1D8YA 1SV5A 4Y2AA 2V4JB 3KKWA 4G1QB 4TLQA 1J5EJ 5BJRA 1MN7A 2AFWA 2WPWA 4P44A 4AQYJ 2D3O1 1S7FA 4DMZA 4J9KA 2UUCF 4XPKA 4XNHC 2J0QD 5KFLA 1NK4A 2B4BA 4FKXA 1F57A 5JGFA 3U02A 3KXDA 5KFCA 3NOGA 1FKPA 5LMUJ 5KFTA 1RWUA 3S8SA 2WHOA 1HWJA 4NGRA 4IDKB 3MXHP 2E9ZA 4MYTA 3PBBA 1VQ9S 4CH7A 3TUIC 3A3OB 3MOZA 4OI3A 1GXTA 3MCOA 2KL8A 2FVGA 1IBKJ 4M5NA 4TQRA 1FFWB 1XMOJ 3HSJA 4JI6J 5B09A 2B43A 3LW5C 3MR6A 1G2EA 4Y2CA 4OV6A 5DQIA 3A13A 5I3PA 4KC5A 4UTGA 2UZAA 3B82A 1H73A 2V6AA 3PW2A 4X2BA 1Z9UA 5IWAJ 3KHXA 2F8EX 2H65B 1Q81T 4AL6A 3SEOA 4PV6A 3FH4A 2CTBA 1C1CA 3MEGB 1DARA 2N4CA 2POKA 2EBJA 1HNIB 4CLFA 1OIAA 2VPZB 3LPEA 3BDPA 2MQQA 2PD1A 1WOSA 3OQ2A 1NPRA 1X4CA 5HK4A 3MECA 3TO8A 3OV7A 2MDAA 3SYZA 2AIRB 2CG8A 4KQZA 1NSLA 2XI3A 5ETVA 1H2TZ 4K0KJ 4DR7J 3P4UB 4NSQA 1S1UB 3P96A 1FJ7A 4NJQA 2HGMA 4LQ6A 2DRAA 1VRUB 4J9RA 3IMQJ 1T03A 1B7YB 2QTWA 3NBPB 4I1TA 2VD3A 2WPXA 2HHPA 1SH3A 4CAXA 3G8TA 4FBTA 1LKZA 4F4KA 2A4NA 3MM9B 3WR7A 1OO0B 2XCAA 4UCNA 2QYGA 3DRSB 3G8QA 1U7LA 2H54B 1M5VC 3ISND 2QLFB 3MR2A 3T1YJ 4R6TA 1XRYA 3PEHA 4DCOB 2FQQB 5HROA 3TZWA 2ZBIA 4EEYA 1WUUA 3MAAA 2DNYA 4CP5A 1WTBA 3EPIA 1N71A 2ALYB 2GW8A 2R8IA 5A8RB 1LXNA 5ITHA 4P7TA 1WI6A 4J37A 1N5YB 5I3UA 3PRBA 4CZCA 3BH6B 1HQEA 3CT9A 4F7VA 4O0IA 4DN0A 2LYVA 5IOLA 3QIPA 3DLGB 3R1KA 5LL6d 2F3JA 5F8JA 2IL4A 4DBQA 3NAHA 2I79A 4IYQA 5E96A 2HS0A 4C2XA 2LQBA 1VR6A 1BPNA 2VQYA 2JEFA 3TTHA 1WC4A 2RDDA 2MY7A 2YVSA 5KG5A 4TKTA 2DNKA 2UU9F 1Z4RA 2RIJA 4X62F 1P8GA 2CPXA 2BUNA 3RAMA 4RW4B 1JLAB 1YK9A 3GCXP 5K8MA 3PM9A 2BDPA 2ALZA 1KVKA 5BYRA 2YXLA 2OZHA 1REVB 5F8GA 3LD2A 4ER8A 2BSWA 4FXDA 1ZM9A 1DJ0A 1Y3KA 3TX0A 3RAXA 4IQMA 3S9LA 4D3HA 5ETKA 1GHEA 4M5KA 2OIHA 3PTWA 4NZ7A 1SJ1A 3G6VA 4RW6B 2UUWA 2PCUA 3CJRA 3IU1A 3FUYA 3CMQA 3H20A 4TU8A 1DTQA 2FL4A 1RAIB 3PRDA 2LXUA 1ZZFA 2H5MA 2JVRA 3K9TA 5GMEA 4X2TA 2EFOA 2HB6A 4W90B 1L0CA 2IY5B 3FBFA 1WF2A 2DPTA 4IK2A 1NLKL 2EFPA 2FLLA 4LF6J 3VGVA 4ZX8A 1N34F 4DUTA 4U67Q 3MFIA 4KY3A 2ZJRQ 3CD0A 1LWCA 2IAJA 1UVJA 1R3NA 1XC9A 2Z0ZA 3MPWA 1HMVA 5KFSA 4OZNA 1UA1A 4Y0FA 4MIWA 4CGLA 1X60A 3R5CA 2HRUA 3E51A 2C6GA 2W2MP 3MFHA 4IKAA 2CQGA 5DDRC 3OTBA 1WACA 3M8YA 4TLRA 3NEKA 1JXEA 2J6TA 2BO9A 4YR3A 1GX6A 1OYEA 2V69A 4GVBA 2O67A 2MSTA 3G8WA 1QDUB 4WBFA 5FLXU 3R96A 3DR6A 2DGSA 2OEJA 1R6VA 5HVHA 5F8HA 3C14B 4NLDA 1KZFA 2WOMA 3T5LA 3V6DA 4OIXA 3PRVA 1K0TA 4HTJA 4A8QA 2HVIA 4ZVHA 1FVSA 1NHKL 3B2YA 3Q8VA 3LACA 1RXOB 2MHEA 4RNNA 4H4OB 4RO0A 4TU7A 3N6NA 3SXOA 3VAKA 1CJTB 4B3MF 3ZNJ1 2ZE2A 1JKHB 5HMXA 4UOCA 1WHXA 1XEZA 1U1QA 1JMTA 2C1CA 4TY8B 1X4BA 2IMWP 4O23A 2DEJA 3TT2A 1B3TA 4U7UK 3D54A 4AG9A 4KV8B 4OI6A 1F5AA 1B0TA 1XBUA 5DWNA 1KSPA 3CVKA 2JC1A 4WIIA 3MGDA 4DX6A 2DXDA 5IX3A 2HHQA 1PYTB 2OPPB 3CPWR 1SQGA 3T1HF 4YWYA 2XMMA 3TVZA 4XO0A 3CCUS 3UQSA 3MM8B 5CNPA 5KG1A 4XK8C 4HNYB 4M3SA 2ZKUA 4EGLA 2R7QA 1VDHA 2GZOA 1LWXA 3WT4A 2PDAA 4L6V3 4X64J 3OVAA 4Y6IA 2ASLA 2KT5A 3GR1A 1YJRA 4K5RA 2XEFA 2OD6A 4M6IA 2AMCB 1M90T 2MKHA 4IUFA 2HHHF 2HLTA 3UD4P 4I7FB 1WHVA 4JI5J 1ELOA 3CSKA 1YZ6A 2VA3A 4G6VB 5KTDA 3DLLQ 1ZM3A 2BMBA 4MK8A 3BO4A 2H3EB 1P0HA 1UW9A 4FBEA 2P9GA 4JI7J 4F4WA 1MJBA 2KYXA 3ZZYA 1H2UX 2B7BB 3RBEA 4J7CA 1ROFA 2CKWA 2I3CA 1QY7A 2FJXA 1VQ7S 1JLBA 2YNHB 2KXHA 2CQHA 1QAJA 1NK9A 3I0RB 3S7RA 1SKUB 1UJ4A 3D68A 2FHMA 5CD4H 2J9DA 2RUSA 1H7XA 3IGRA 4EFAC 3EFAA 4C8OA 4ZKAA 3PHTA 3PYFA 1U2FA 3KKFA 1W2BR 5HH1A 3KNAA 3GV8B 2AJQA 5H1SV 3FCHA 1H72C 5IV4A 4OX9J 4LX9A 3ZNUA 4OC5A 3QGIA 3RW6A 4RKUC 3N79A 3FF3A 1XR6A 1ZO0A 3P2HA 2QMWA 1GNKA 2KRBA 3CCVS 3LUYA 1HNXF 3IGNA 4LF7F 2ZD1A 5IT9Y 2QMXA 1Z8TA 2HHSA 1O8BA 1LW0A 3IC1A 5HMZA 2L41A 4YS2A 3K2YA 1RI7A 4OC0A 2HKEA 4F9VA 4KVXA 3I31A 2ZW4A 2YGWA 1NBEB 4R8UA 3H8FA 3H7HB 5AE3A 1FXRA 4R3KA 4NZ6A 3HFZB 2MMYA 1V5IB 1BC6A 2K3IA 3OR1A 2VB6A 4B5PB 1IOIA 4ZY1A 1TL3A 2EFNA 4PABA 1SQHA 1RUSA 2J0XA 2OMOA 3R7SB 2MQLA 4DL6A 2AGQA 1WG5A 1T94A 2YNGB 1A9NB 1ACMB 4KGXB 3CPXA 1HFEL 2FIUA 3FMWA 2JVOA 2A1BA 2IVFB 1VHSA 1TF9A 3I5CA 1TKJA 4DF8A 3CWJA 4F8ZA 2BKPA 3S6FA 5I42A 1VISA 4ELUA 3BQ1A 3RU0A 2PIYA 5KT2A 2EG1A 3H5UA 8ATCB 1BAVA 1RAFB 4RUBA 4JI2F 4PWWA 5THWA 5HAOA 1AUDA 2XNQA 3L7UA 2YKOA 1K8AT 2HYIB 3DM2B 3PACA 4ECZA 3AY0A 2ZH5A 4DLGA 3K5MA 1S59A 1A2ZA 4MFPA 3JTOA 3ITHA 3D8PA 2CJ9A 2KU7A 1MG7A 2NXNA 1IU8A 4G1QA 5A2QY 2HGNA 1S6PA 1OPZA 1CP6A 4F0KA 1UMJA 4Q7AA 1SQFA 2WW4A 1VBKA 2LP4A 1QTMA 1HWUA 3J81U 1SQEA 3QRRA 2OPSB 1IY7A 2EO8A 5HANA 3LQVA 2GIFA 4FAIA 3ZXWA 4OX7A 2ZW7A 2FXFA 2GFFA 2VH7A 2UXBF 4Y2KA 5A28A 4IDKA 4A31A 2R98A 4KFBB 2IRXA 2DHGA 3K2KA 1QSRA 1FTCA 3KJVA 2ZHAA 4CI0B 1K47A 5LSLA 2CQ4A 4L3KA 3CJ8A 2PJ1A 4ZPTR 3CD7A 4OC2A 5BWAB 2FC9A 1Q86T 4A32A 4K4UA 2C3OA 1WF1A 2QSWA 3NMRA 2CQ1A 2ZENA 2JX2A 1GX5A 3BF4A 3HKWA 1GT8A 2PA8D 4NZ0A 4NLVA 2PI5A 1R89A 1JB0C 2YX4A 3O3LA 2QE5A 2ZC3A 1HNIA 1Z2ZA 1YKWA 2GNKA 1CX8A 5CXTA 2V8VA 1Y3JA 4X4PA 2C6CA 4X4UA 5L1LA 4FD6A 1FXDA 1WJ9A 2EFQA 2L48A 4NCZA 4C68A 1WELA 3QGGA 3FB3A 2HGLA 3D1OA 4B3RJ 1S1UA 4MIBA 1U6MA 2CNLB 2JDJA 3R8YA 1Z8LA 1LAMA 3GB0A 2YNIB 1YWXA 4JI3J 1FFGB 2HLUA 3OHAA 2KVQE 1RK8A 1C1BB 4QPTA 1BWVA 5DQHA 3Q8SB 1HHTP 5F8NA 1HIYA 2DPJA 4FP9A 3CGIA 1FO1A 3MM9A 4X5KA 3V6JA 2PMHA 4WTOB 3S6HA 1U2RA 4DV3F 4DXLA 1VBZA 5C2CA 2XNRA 3N6MA 2GQCA 2QFJA 2AYGA 2HPUA 3SJFA 1DURA 4UF4A 5EWGA 4CO0A 3L7OA 4USMA 5A8RA 2RT3A 1HBUA 1WDDA 3CJKA 1N5YA 3NAIA 4F02A 3A3NB 3MM7A 1YX2A 2FJWA 3QRQA 2WTFA 4KLVA 2WZNA 5KFRA 2Y1LB 2DF5A 4RNFA 4FD4A 3Q2SC 1S60A 4RBUA 3DLGA 3ZZIA 4LF8F 2OHDA 2HVEA 4UEFA 3WX8A 2XWXA 2R7VA 2RRAA 3RW7A 2IDEA 2VDIA 3BBBA 4U9YA 2MEWA 3O5TB 2H9ZA 4I69A 1AFJA 4AFFA 2ZEJA 1S1VB 3OUYA 4HNWB 1SC6A 3TOAA 3MRUA 1GAOA 1DFDA 2QECA 4ZY0A 2A0FB 1X31C 4ID5A 2I5JB 1FE0A 1B4SA 4C97A 3W60A 3UVJA 3EGNA 4DL5A 4NMXA 1RJJA 2MGZB 1T0TV 4ZN3A 3ZZ0A 2I6WA 3KG0A 4NA2A 2YKNB 3PDNA 4IG0B 4U96A 1U6ZA 4NL5A 1VRQC 4G65A 2WVFA 3JQMA 2B58A 2Z3KA 3G6XA 3R9EA 2ZUGA 4RW6A 4PSXA 4N7TA 1YTYA 1ZTWA 2YBVA 3V5RA 3PJ9A 3ONQA 3DOMB 1CVJA 1RP5A 4A38A 1FRJA 2EWBA 5IM0B 3FKBA 1VQMS 4DCPB 4PXCA 2ILZA 2ILYA 4IUSA 1VK8A 2CPDA 2M5YA 2HHUA 5DLFA 2UXDF 5EHHA 5KTAA 1RLCL 1Q2DA 3IGVA 1S57A 2RS8A 4DUYJ 3DLEB 3X1LB 1U1MA 4DR1J 3VAMA 4BCAA 4RNOA 2DKOB 2BW7A 3SIPB 3MN8A 1R8CA 1Q7LB 4C8MA 4WU3A 3FDSA 2HURA 1N6QB 4RUHA 1SL2A 4RU2A 4B9VA 5HXDA 1V0CA 1IBMF 3ICLA 1VFJA 1MMLA 3S01A 4MRIA 1AT1B 1P9QC 2HQIA 4U6PA 1I1DA 4WFNQ 3GJSB 3SQGB 3WHIA 5B08A 3Q8RB 2MYFA 1OY8A 3SZ2A 2HNDB 2HVHA 2ASYA 3ZZPA 4OP4A 3MI7X 2VBXA 4NCAA 3CJ0A 3UDEA 2RFHA 1T9YA 3KK1B 1T9WA 3DYAB 2BJEA 5D6GA 5L46A 4R8FA 1SH2A 2RC4A 1V3RA 2DNHA 4CM2A 4ZPAA 4MCPA 2Q6BA 2I9SA 4NFRA 4CLLA 4EO8A 1PJ7A 2FJEB 2BJ1A 2L9DA 5D4OA 3M1VA 3M6WA 4H4OA 2V2ZA 2BR0A 3K8VA 3IIBA 4MCSA 4DV1J 2Q44A 1CJTA 4RUCA 4B08A 1JKHA 2CUYA 2GO8A 3EYZA 2A6OA 3AD8C 3V6HA 1WI8A 3H5ZA 4I67A 3TEGA 1R27B 2IJFA 2XULA 1AA1B 4Z37A 4Q44A 4A8XA 2JLMA 2AZ3A 4MI4A 2ZBRA 4CLZA 3ENQA 1RT1A 4C2MA 1UWBA 3IWLA 4FDFA 2F7VA 3M8PB 5IFMA 3ZTSA 5E3AA 1S77D 1WNEA 4ED0A 3TEHB 2HVDA 4DYOA 2Q66A 4DR2J 4WKYA 1U09A 4FUUA 4WKRA 4LVNP 4LBPA 2A2DA 1R0CB 1FERA 3TRGA 5EUHA 1Q16B 1OY6A 1AXQA 3H8GA 2B51A 1X5SA 2AU0A 5KFZA 2HQGA 4JYAF 1W2IA 2NYIA 3MR3A 4QYRA 1O5JA 2DH8A 3IBCB 1SXLA 3HP6A 3PEJA 2QLBB 3AJDA 2Z3PA 3DMJB 4M5GA 4QU6A 4I2PA 2MKYA 2KJWA 1KNZA 4HDHA 1NK0A 2PMWA 5ETRA 1RTJB 2JLGA 1WDTA 2ZNYA 2KT2A 5KFEA 3KL9A 1YVOA 2FLNA 2HHVA 2Y1JA 1KFDA 5GAHI 4LF4J 2FDNA 1YSJA 2AP6A 3G82B 4EYHB 2Q7SA 3BJ7A 1RT4B 4ZHRA 2BANB 3QIDA 5KT6A 1CJKA 1S9GB 4PKDB 2RDIA 4XPLA 1RHQB 4U7CA 1IR2A 4S0MA 1T3OA 2CIMA 1LEOA 3VH9A 2XYGB 1GXUA 4DV7F 1F0XA 1JNZB 2KTQA 4CNZA 3TW0A 5GAGU 1VC6A 1T05B 4USKA 5E2QA 4IFVB 4DV4F 4UOHA 2Q4VA 4R5PB 3N4WA 4GRSA 3AH6A 1XJOA 1DTTA 1HNVA 3W2VB 1CBXA 1S12A 2CG4A 5DZ6A 2C3MA 3H0PA 3QBCA 4BWMA 1HBNB 1DQ8A 3WC7A 4OX6A 5G21A 5F09A 3IG1B 5D0GA 3T9ZA 3BGOP 2CPJA 3V8IA 2CXEA 4B6ZA 1Y11A 2VASA 4K3NA 3CJTA 3DRRB 1K9MT 2IA6A 3CMAS 1U1RA 4DJBA 1HNWF 5F3ZA 4F67A 2K7JA 4FNIA 3GE9A 4C11B 2QYVA 1FT7A 2RRNA 2YPZA 2B9EA 2PRQA 4RWWA 3KOAA 2QRRA 4OZ3A 4OYOA 1YGYA 4YHHF 3MEEB 3KR4A 2KG0A 1QE1B 2RQKA 2LECA 4EVYA 2NCKL 3FFIB 4NE9C 5BYQA 2HUZA 2MJUA 4DR3J 4MKVA 2MZSA 5LYLA 2C22A 1PILA 4P7VA 5EBVA 1Q1KA 2B8QA 2XSFA 4Q2LA 2EFVA 5EDWA 2PR1A 3CMES 4U8VA 3TQ1A 1Y7RA 3PB4X 4CH1A 3BV8A 1PAEX 3K5OA 4UOGA 1NK7A 2GQ2A 2QL7B 3L95X 4A8WA 1PYSB 2M4MA 1IJEB 2NZ4A 2DVIA 2IHR1 4K4TA 2YWGA 4RUAA 1NHVA 1I12A 1S0VA 5AG7A 1S7LA 3KUGA 4U8YA 1I51B 3CXQA 4DV6F 1XR7A 4F50A 3POTA 4NGPA 3VAHA 1FXLA 5KG3A 1NM2A 1ZOTA 3SBMA 2B9YA 3TJ9A 3DCAA 2O66A 3WDOA 2ZWPA 4O44B 3G9CA 3MMAB 5ETLA 3OSPA 4PAAA 3T5JA 3SMZA 1TV6B 1IWGA 2DR6A 3FRYA 3E01B 2Z10A 3HI9A 4KFBA 1JJ2R 2GIRA 2KB2A 4DR4J 4LFBJ 4CGOA 2LVWA 3GFXA 2XMVA 5SZTA 3D2PA 1S0NA 2WVEA 1S1TA 2BQ3A 3S9MA 4IFYA 2CNSA 1B7FA 1HHQA 1NO8A 2CWXA 3MPVA 2EBGA 1X7VA 2OU2A 5DLGA 3W5YA 1MROA 4JBCA 1ZM4A 4DX7A 1RAHB 1MN9A 4JXRA 2GANA 2FGCA 4DSEA 2IFXA 4C3KA 4U9ZA 3W8PA 3UR3C 4YDDB 4J9OA 4UY85 1YJVA 4OHZA 1U4BA 4A47A 1H8LA 5B7WA 1EB0A 4O4GB 4N56A 1VRTA 2ZVIA 4H4KC 5LYFA 4AXJA 3BGRB 2CQPA 3BI0A 3LP2B 1XEBA 4JYWA 2XS7A 1C4CA 2VL1A 2YNDA 4NLTA 3MURP 2FJAB 4ZGYB 1TMJA 3CJQA 1RTHA 3MR7A 2V9KA 3DU6A 3CCTA 5L8RC 3J7A1 3JTPA 2ATRA 4DZDA 1EP4B 3FVYA 2GAHC 5A8WB 2JRSA 3CDUA 3IRWP 4PRFA 2MTLA 2WUUA 1J5OB 3UR0A 3NWGA 2XB2D 1KN6A 3HF5A 4CS0B 4NJRA 3H5XA 1HI1A 1NJZA 2C3YA 4BC9A 4WK3A 2LQ5A 2HBQB 4CAEA 4UOFA 2XYHB 4WIQA 4HVZA 5KFXA 4ED2A 2HWHA 3ISXA 3PY8A 2P6FA 2ZHOA 3LH2S 1RWKB 4NCGA 3PXGa 3FJUA 2ZH3A 4WFZA 1Q5YA 2KCWA 1XJWB 3MMBB 2VQFJ 2EVNA 1NKCA 4AG7A 2CRLA 4DQRA 1Y7PA 3GY9A 4CPAA 1UWYA 2KG1A 2FLOA 2JH3A 2XMWA 4KHPF 3D7FA 5HP1B 4N76A 1BLLE 2W8KA 1HNZF 3QAEA 2B6AB 1LWFB 1WTFA 1FVQA 4WP8A 4O3PA 3R6LB 1RQ0A 4BHQA 2LXIA 2WW8A 4KSEB 1F9HA 2BE2B 3O1LA 5KFUA 3CCLS 2B7CB 4PEOA 2W9AA 2ARHA 4Q43A 4RW7B 1AB8A 2GV1A 3K58A 1TKDA 4NLSA 3QJJA 4KRWA 4A46A 5K5MA 2GHWA 3C15B 4DV2J 2G9DA 5KFWA 2RILA 2AYMA 3ZZRA 1NMTA 2CQ3A 3PB7X 2VC1A 4LT6A 4EK2A 4HHUA 2MGZA 4M63A 4JI8J 5KT3A 4J3GA 2GMHA 4ES3A 3QSYB 2GFQA 2Q0YA 2AJ2A 2YKNA 1XERA 3WQPA 1RTIA 5F0UA 1F9FA 1GQEA 5IT9U 4NLRA 5EGYA 4EWTA 2WB1D 4ERDA 2DR5A 4KHRA 2EK8A 2E5HA 4ZVQB 1Z4EA 4CWBA 2BE7D 2L3MA 3WIVA 1YVKA 3W6XA 2OSRA 3TJ8A 2JEVA 4WZQA 3AJ1A 3DOMA 1JLFB 5H9EJ 4PQUB 1KQGB 5ELYA 4B9LA 2HRYA 3D0GE 3GIMA 3F0NA 1MNEA 4WTYA 2AHOB 4CYPA 2XLKA 5IXUA 3DDIA 4WZMA 2PJ4A 4MK7A 4UUXA 4X3RA 3C6UB 5ETMA 4ZVSB 3D3SA 1NXIA 3M8SA 2FCKA 3AOBA 2V2QA 1XWLA 3G6YA 3R97A 2Z0GA 2DR9A 1Q7LA 3NGUA 3TE4A 1N6QA 1RWNB 5B0CA 4X65F 4P6YA 2BVZA 4WYWA 3NNCA 4JI0J 1QAYA 2G3TA 1R7IA 2DTJA 4PG6A 2F65A 2FZCB 3FEYB 3QGHA 3SQGA 5IQ6A 1MJAA 4EBEA 2UVUA 2G0IA 2DXFA 3QGPA 2IA0A 4ETXA 3KLFB 4FVMA 3QJPA 1VQ4S 2YTCA 1FEEA 2FUG9 1G3OA 4ZVOB 5DG9A 1HR0F 1NPKA 4Y28C 1Y10A 1P9YA 1SBRA 3PW7A 2M3DA 4AT1B 2LMIA 1EQMA 2VODA 2WVCA 2VFTA 3MDFA 4E2FB 3AFGA 4KKOB 1UVNA 4YY3F 4QYZJ 3WABA 5HQMA 1NK8A 3FSYA 2XMAA 4X8IA 4OV1A 1KOHA 5JM6A 3LOUA 2VKRA 3I9V9 4HT5A 5MLCV 1KDNA 3I3GA 3RNZA 4WWVA 2IBKA 4K8RA 2VG5B 4JV2A 1ZS6A 1Q8LA 4M5JA 4RBVA 4IRKA 3BLNA 2EEYA 5GAHU 4CGPA 4X66J 1QAIA 2JDCA 2B5JA 4USTA 2W9BB 1I94F 5KFQA 3KG1A 3NCRA 2UUCJ 2CXAA 5ISVA 2ZNZA 2PC1A 3C19A 3ELHA 4CT8A 2ZBQA 1KR4A 3RRKA 2FHKA 2OOTA 2R7HA 1RACB 4M1KA 4ECTA 2XTJP 4UZCA 3FRMA 5C42A 1HD0A 3ZZOA 3TQEA 1QQ9A 2PQ8A 1QMUA 5E7OB 3ULHA 1LK5A 2H5EA 2K3KA 1JK9B 2YKMB 4EZ9A 3T8WA 1CJVB 4Q0BB 2DNOA 4O3RA 3SDEB 3M6XA 2CA9A 3J7Z5 4AVBA 3TAMB 2ASDA 4D3GA 3X3UA 1KQFB 1QSTA 3P3DA 4CLKA 3UO0A 1AYEA 5HBMA 2Y9HA 4F0HA 2RUGA 5E0OA 2YNCA 1F6TA 3BZQA 2UVVA 3SV3A 4XPEA 2GAGC 3GIUA 3PFOA 2AFSA 4H6ZA 4DNCA 3M6UA 4MHNA 5LT5A 3T9NA 5C24A 1IM4A 5KFMA 5T14A 2JEIA 2QA4G 3OTEA 4LUAA 4DSIA 3SSRA 3AOCA 2CVIA 4OI1A 1KLMB 1L3UA 2B9WA 4ED1A 5DS0A 4CYUA 3LO3A 4I0WA 1TKXB 1NPPA 3E3XA 2AD9A 1HBNA 1NDLA 1J5EF 2ZELA 4AQYF 3EZUA 3OFFA 2VXKA 3IG1A 1JLEB 2XG8A 3QWUA 4WYLA 1KQSR 3CCWA 3DRRA 3QLHB 4DL3A 4XAKA 3HJFA 5LMUF 3DOKB 3KJFB 2BA9A 3DNSA 4UIBA 5ETSA 4OC1A 1U48A 1K0VA 3TX8A 4DU8A 4EMDA 1HDQA 4MJ8A 3ZC4A 3HSZA 3CTRA 1U02A 3W65A 3CIMA 4P45A 1SV5B 1XMOF 1TAQA 1DAXA 4ELTA 1NCLA 4B3OB 2IC3B 2PRBA 1XBWA 2G2YA 4DLEA 4P2MA 5CZVA 3FNCA 2F5GA 5HSPA 2UU9J 3KLIA 2ABYA 2RE1A 2V63A 2M0GB 1DZ5A 4X62J 1FKPB 3R2CJ 1SC4B 2N3LA 4DX5A 1HPZB 2RF2A 2FJVA 2MQPA 4OIDA 3V38A 3OXLA 2DEAA 2R2TA 4N41A 1PO6A 3MM5B 3CXPA 4MHDA 2WSAA 2MXYA 3JXOA 4ECVA 4PUOA 2LA4A 5KFVA 2M8DB 3SCJE 3Q23A 1KD1T 1OSDA 4ECUA 3HCXA 2OI2A 2ACMA 4DR7F 2XMTA 4X84A 1FWKA 4O3NA 1RHKB 3T5HA 1VIXA 2OKQA 2F63A 3GPAA 1RWMB 4ZVGA 4LF9J 1EHWA 3QJLA 3PP9A 4KH0B 1JNRB 5LOQA 2MY8A 1TV6A 1U49A 3RYLA 3E01A 3K5LA 1U1NA 4EU0A 1A0OB 4OZ2A 4ZIWA 3MECB 4NLWA 4EI2A 4DZ6A 3F56A 1N34J 3BN7A 5K8PA 2A2CA 2C2DA 3US5A 1CG2A 2DCUB 3BEGB 5KFIA 2XO6A 2A3JA 4K4SA 2ZEHA 3I0SA 5AT1B 1T03B 3KK3A 4URSA 3BPDA 3D0IE 1X9SA 3GYGA 5A27A 3HHDA 3D5MA 1Z8WA 3EMTA 1V3ZA 2K06A 1YLXA 2X7IA 4O4GA 1S72S 4IG3A 4ECYA 2CNOB 2PA3A 1H6KX 4PR6A 5EMIA 2Q79A 3LP2A 4C2YA 4FZVA 2ROEA 1N5TA 3PO4A 3N6LA 1TMMA 1TVRA 4L75A 3V81A 1NUEA 5I3UB 4M94A 4ICLB 1KONA 4DR6F 2DRDA 4LFCF 3QT6A 1HQEB 1TP7A 2WSFC 5A8WA 4B9SA 3GONA 3GG0A 3ZTOA 4XPCA 3N9UC 5DO2A 1J5OA 4B3MJ 2LDIA 2MPUA 3NE7A 1LWEA 2MKSA 3IP0A 3IFEA 4C48A 4ECWA 2EUIA 2AFMA 3GJTB 3H2UB 1Z8XA 4N8NA 3R9FA 2W24A 1ZAWA 2OH1A 4WF9Q 3PBEA 3PVXA 5D4PA 2ZDOA 3TVYA 3M2RA 3LPYA 2RJZA 2AQ4A 1RE1B 1C0UA 2ADBA 1FJCA 4DL2A 1XE4A 2W4CA 1S1WA 4X4TA 4DS4A 4NGTA 5ETOA 4BD9A 1X4EA 2XY5A 4R7MA 5CD4A 3ETMA 3T1HJ 2E5LF 4LSZB 2OFGX 5LJ3Y 3TO7A 4NI2A 2DHHA 5DETA 4LF5F 1RB0A 3EZ5A 1WWHA 2R1IA 2FY1A 3QNVA 2DY1A 5B0BA 2U1AA 4LBHA 1TUWA 5J2QA 1IBLF 4ZLLA 1Y4ZB 3IR5B 3RR8A 4X4NA 2NSMA 3NG8A 1YLEA 1JXLA 3PB6X 2Z8QA 3B4DA 2IRYA 2UVRA 2AWZA 3N28A 4JD6A 3NGSA 2R8HA 3TFYA 1RT3B 2P6TA 2HHHJ 2JSXA 3EXCX 4YEAA 1DTQB 1VGYA 3W8GA 3OLBA 5D78A 4F4YA 4IF5A 2KJVA 2RAQA 1JIHA 2CJKA 2DXQA 4HHJA 1E6VA 4NLXA 2HFVA 4ED7A 4KGMA 2QLXA 5FD1A 4LRDA 4ES1A 3BS9A 4LIRA 5C82A 5GMKa 5KOXA 2DYAA 2PSWA 3ISNC 1LWCB 2IAJB 2W4PA 4F3MA 5ETPA 5KFHA 1RXTA 5D29A 3FZBA 2NUUG 1SL0A 3VWDA 1HMVB 1Y9OA 4OC4A 4WP3A 2D4PA 3FIXA 2KRRA 3HDSA 3CJ2A 4C9DA 3CDXA 2PJ8A 1IKYA 3SSQA 3LMSA 3RO0A 4YB1P 2DO0A 3CZXA 2AT1B 4NXNF 3LA0A 1BQMA 2KHCA 1B70B 1XNQF 2HBZB 2F9JA 4DSKA 1NDKA 1UFHA 3C6UA 2VOPA 4GVBB 3JB9k 1WC3A 3ZFVA 1QSMA 5GADI 1NSKL 4HTIA 4PQAA 1HNXJ 2YQ3A 1ZH5A 4LF7J 2WOMB 3FBBA 1C0TB 2PVWA 4RS2A 4HI1A 4QU7A 3QFWA 2ZZMA 4ZITA 2L08A 1FD8A 1AUSL 3WBZA 4LR9A 2XEXA 2DJWA 1UPPA 1N4LA 3GJRB 1RT7A 2WONA 4N77A 5F8MA 2ZE2B 5FDLA 3JUWA 2Q1LA 5G4DA 4XPDB 1S7NA 3DFEA 2IYIA 4FYVB 2H4WB 4CTAA 1H7WA 3OW2R 2APOA 5J2NA 2DEIA 5IB0A 4L8AA 2BX6A 2R2UA 5LMNJ 3KLFA 3IU2A 2CNNB 1ZA1B 3OBIA 2C1EB 2QG9B 2HIQA 1SB6A 2AJFE 5J1QA 4UQGA 1QSNA 4JI5F 4KKOA 4HYKA 4YN3B 5KG0A 1W26A 4DV5F 2EK9A 4C3MA 4E8OA 1FJGF 3DRYA 3HHLD 3GMGA 4M85A 2JOQA 1QD1A 4GO5X 5KFKA 3U1NA 2E7VA 4LVOP 2ZW6A 2DD8S 3VTIA 2VG5A 1HARA 3VVTA 2DH9A 2N3OA 5IB9A 3GIRA 1VCTA 4NLGA 5DG7A 1QUPA 4J9PA 3WIUA 4OLOA 3PRTA 2CTCA 2AFUA 2V8DA 1R0AA 4NLQA 3ZZTA 3P6YC 3VAIA 4LQGA 2DO4A 4B12A 2MKIA 3EVOA 1TL4A 2GMLA 3CCMS 4AUKA 3THPA 3CC4S 4AVCA 4IH7A 2UXBJ 3D1HA 4FPRA 4OX9F 3DU5A 4FWUA 3GV5B 3FEEA 4USVA 2FGOA 2GC8A 2HZAA 4JV1A 3PFEA 4KOTA 2W7AA 2MZ1A 4P2FA 5AG5A 1JLBB 2IVYA 2QL9B 4ZLNA 2OPRB 3TI0A 2PJAA 3JYTA 7AT1B 2Z3MA 1IVZA 4QIWD 2X1BA 3BYRA 2OGUA 5J2PB 3W5XA 4DS5A 4DFJA 2UVWA 2COLA 2DR7A 3U27A 4KLWA 3FEXB 2CWKA 4I2QA 3PCOB 4CGNA 1X0FA 3DDKA 2LQ8A 3QFHA 2L9NA 5IZHA 3PV8A 4QIEA 2P2CB 2O28A 3R5GA 4URQU 4OJ1A 5CAAA 5G1ZA 4HKQA 1TFWA 4CLPA 1R0BG 1FNMA 1WHYA 2ZD1B 2NYQA 2Z3OA 2KZMA 1LW0B 2FJDB 1XQIA 4DU7A 4ZMMA 3RB3A 3KK2A 2D9PA 4B9NA 1SC3B 4CYOA 3D2MA 2EC2A 2RS2A 2Q4YA 4R8UB 3SQOP 5H86A 1ZAVA 1RU1A 3M7VA 3OR1B 2FPHX 2W01A 4R76A 1TL3B 3M05A 2QFIA 2ABZA 2VHGA 4B9MA 1MK4A 5HMWA 2QMLA 1YRUA 3KUHA 2C2OB 4PWDA 3M8QA 2EKNA 2DHSA 4KGVB 1V3SA 2BW2A 5GAEU 2VC0A 3V4IA 4P4IA 5I42B 3BQ0A 2WCXA 5KTCA 2MKKA 5JUMA 1TL1A 2CPFA 1TUGB 2GE3A 3HHKA 3HLUA 2RQCA 1U8WA 4ZYQA 1N32J 5DWMA 2DHXA 3GSIA 5DM6Q 2H5JB 5KG4A 4LF8J 3RTVA 5A8KA 3ITHB 1BQXA 3UY5A 1S6PB 5K20B 4B3OA 2IC3A 4WU2A 2R7RA 4J9QA 3TUZC 3EM1A 1KWMA 1FRLA 4Z2XA 1YW6A 4EYIB 3G86A 5IQQA 5BR8F 2AEMA 4JV5F 1LV5A 4QBJA 1HPZA 4WXWA 3PG9A 4PYDA 1FD2A 1FF2A 5EC4A 1CLFA 5CHCB 1F1BB 3FJ2A 2NPIA 3K9UA 1ZTTA 1FKOB 4AL5A 2AE6A 3HFKA 3MM5A 2R42A 1RKIA 1UZHA 3MEDA 1I3OB 2UXCF 2R8GA 4NLPA 2J9AA 3KJVB 2J7UA 4RL1A 3HT3A 2ZEGA 3KLVA 2E9RX 1LXJA 4YDXA 2J76E 2W2NP 4A39A 4QUSA 3W63A 4B3RF 4DPOA 4HEA9 4P4DA 2MHNA 1RWVB 3D3BJ 3ET6A 2G1HA 2PE8A 1U1OA 1D3WA 3GYNA 2X51A 1RHJB 1UWAA 3R3TA 4DR5F 3HVAA 4OYWA 1CC7A 2XZWA 2QMUB 2VOOA 4YOEA 3O8WA 2ZDPA 2JLEA 4LF2A 2CNMA 4IRCA 4M95A 4K59A 2P9EA 1UVMA 4WCEQ 1D9FA 3UD3P 1B6BA 1L5UA 2IQ6A 2JZ5A 3Q8PB 4II9A 2UXDJ 4DN9A 3DDNA 1EZZB 3HFVA 4E0AA 5H9FK 3TOQA 1M5HA 2D74B 4K4XA 1K1QA 3KDNA 2YNEA 1WSRA 1Q7YT 1NE9A 2GGPA 4NRUA 2DGXA 1RHRB 4YFUA 1Q0NA 4A33A 2IMOA 1AROP 1E6YA 1IBMJ 2FE7A 1T11A 1M44A 1TZ0A 4AXVA 4DG1A 2XEJA 4ONUA 3J80U 1RKJA 1IUJA 3HVWA 4QW8A 2EC0A 3M2UA 1VQNS 2F9DA 2H4YB 2KO1A 4CGMA 4IAVA 1ZPWX 4LFAJ 1KLNA 3OJUA 2GA7A 1TKTA 3A8KA 1HBUB 2I00A 4A94A 4L76A 3CJKB 4E98A 1IM6A 4ICLA 3MM7B 4K4YA 4F0MA 4QR0A 5M2UA 3PX4A 3M8ZA 3BBCA 4J91A 5CCLA 1HQ2A 3NGRA 4OHYA 3W5ZA 2NR0A 2M52A 2ZOMA 4LSNA 3UI3A 3BSNA 2V9WA 1TIQA 4DQPA 1MU2A 1U25A 2XSJA 2J0WA 1PGZA 1OZPA 3D7SB 4ZJQA 4FF2A 3DLJA 2CADA 1LOKA 2RVJA 3OUYB 4DWIA 4GKKF 4M8LA 3F41A 3FYNA 4I6AA 2E1PA 3BXMA 4MKYA 4CIOA 4ID5B 3OXGA 1WKLA 3UNYA 3KASA 2AJ6A 1DBDA 5F48A 3M4XA 1TQLA 5HQLA 3UVJB 2QA1A 3GZ7A 3IS9A 3LTOA 1U1PA 2WSCC 4ENOA 2HFOA 3L7PA 4ELVA 2PE3A 1BWEA 2RMLA 2Z2YB 1NEEA 1RDRA 2LKZA 3BI1A 4JOUA 4A8YA 4ECXA 1VBYA 1PBAA 1DE4C 4LSLA 4RR5A 5T7LB 1U0SA 3CO9A 3AOAA 2DCLA 5GADU 4U5YA 4JYAJ 2GJIA 1B0PA 2Q43A 1M1GA 1RT3A 1H2VZ 4KR0B 5DM7Q 2HQYA 2HQCA 4LJMA 2H48B 1EIYB 2PMZD 4Z65A 3BKFA 5EWEA 1PJ5A 2PEBA 4HNXB 1X4FA 3UPFA 1PBUA 2UV8A 5B0FA 4OAEA 3LWLA 3HD2A 2KM8B 5AGEA 1WC6A 2DITA 1PC4A 1FFSB 3IAM9 4YR2A 4KTQA 4HACA 4NX9A 1RU2A 2BBEA 1T9VA 3G71S 3VVUA 2DISA 4ZBGA 4WFYA 1SKWA 4R0EA 4UZBA 1JJHA 2FYXA 3THVA 3L9ZA 4B9TA 1NZAA 6FD1A 4OHXA 4DV4J 4PXEA 4JJXA 4DV1F 2HEKA 4OZ5A 3FGVA 2OMLA 4JV0A 1VJWA 2DGWA 2QL5B 3SV4A 1U47A 1YW4A 2J8AA 2EW9A 3SXLA 4B13A 2JL9A 4N8OA 2ODFA 3TA2A 3N7ZA 5GVQA 1VK3A 1FESA 4PPZA 1DLOB 2KFNA 4QIVA 1B99A 1C0TA 3L3CA 2HVZA 2Z11A 2QA4S 1RAOA 3M1VB 4PXBA 3KHLA 5D4NA 4J9NA 1HNWJ 1CSJA 2WAQD 3FECA 1IKWA 3I96A 3A4TA 1A6LA 5HLFA 4P75A 2KXNB 3QSIA 3KG4A 1AMPA 4YHHJ 3J7YU 3LANA 2Z2LA 1LW2B 2JDDA 1CS4A 1TR0A 3ILOA 4YFJA 1TTHB 1U2CA 2B4DB 4BBYA 4KIAA 1NAQA 2Q7BA 4P10A 4OHWA 1RT1B 1UWBB 2C6PA 5KG6A 1S3ZA 4ZP9A 3SHPA 1IQZA 3ZO7A 3R2DJ 4OX8A 4GXHA 1HLWA 1IGBA 1LK7A 2DGQA 1UVIA 3AJ2A 1N5SA 3LAKA 1NK5A 5EX3A 1PC5A 2RKIA 1JX4A 2WB4A 4TU9A 1RWWB 1BO4A 2YX7A 4JP8A 3W7BA 2HG4A 3WX4A 3UWTA 1QTNB 4OC3A 3EICA 4NRTA 5M2PA 1IKVB 4ZCLA 2G2ZA 3OJSA 2Z4PA 1IYLA 1O6XA 1NZ8A 4JUZA 4V19J 4X4SA 5D0RA 2VFUA 1B0VA 4I2PB 4ZVTB 1OSCA 2FVQA 1Y5IB 3K5NA 1MWZA 2O3DA 2QGFB 4YB6A 2J6UA 3MTKA 1RAGB 3I82A 2B3UA 4X4QA 2C2MB 4P4BA 5IT0A 1YX0A 1XMTA 3NL0A 5HO4A 3SFUA 4ZHRB 4OLLA 4MJKA 2RRBA 2VICA 1CEZA 1CJKB 1CQMA 4RX6A 4DX8H 4IH5A 4MYUA 2OPRA 4U95A 4OLPA 3L09A 2HFNA 1PG5B 3AA9A 3RBXA 2N4DA 3JSBA 3FBCA 3MCMA 1N56A 2YNFB 2Z58B 5HJYA 2HK2A 3MWBA 2BZ2A 5LYIA 2KXFA 1NK6A 3NA6A 2C2ZB 5U47A 3R1HA 3HSGA 2WYRA 5J2PA 1D9AA 3W1YC 2LU2A 2BJ9A 2W7PA 2ZH7A 4RWXA 4CO2A 3KJNB 3OTCA 2CQCA 4HPSA 3M32A 2C2RA 3OTDA 1DTTB 1HNVB 2ZH1A 2XYPB 3JSMA 1ARLA 5M2RA 3VGSA 4MBUA 3DRPA 2GHPA 2XWYA 5B0EA 2A18A 3GFZA 2Z56B 2Z2ZA 3Q2TC 1K4JA 2XY6A 2RSQA 4DJLA 2MKCA 3KLGB 2PJ0A 4O4RA 2R3VA 5LRKA 4QR1A 3ZTQA 3D7DA 3I5AA 3GSDA 2E5IA 5D77A 3S9NA 4OYAA 1ZM2A 3K57A 1BPMA 2ZM6F 2QN6B 2W1BA 3HUVA 3KJQB 1OMSA 3S6EA 2ZHBA 3LP1A 3BKUA 1GMVA 3IR7B 4OMEA 3CDBA 3HHEA 2CZ4A 2QV6A 3T6JA 1VS3A 2KH9A 2XS2A 2HK3A 1M5KC 3DOLA 3CD5A 2VUGA 3KYLA 5L38A 1N48A 4Y2MA 3EUNA 1NJYA 2QZ8A 4UFWA 1PAUB 1S9FA 4KHPJ 3BR9A 2KFZA 1FDBA 3PR4A 4OZ1A 1HNZJ 1AUGA 4DR4F 4LFBF 1YR0A 2CJYB 1SL1A 2R8KA 3H4QA 5FJ4A 2I0XA 3PGPA 1U6BA 5CA5A 3POTB 4FYWB 3P5BP 5F8LA 3QO9B 4ZP6A 4OJHA 3QATA 3CD6S 2E5GA 1TKHA 1XNRJ 1F2PA 4AE5A 3SCLE 2F8HA 2RB7A 4JI4F 1HL6A 2VI7A 4TN2A 2AYEA 2PJ3A 1FKOA 1UETA 2V0NA 3I56S 2XQCA 3MR5A 1PCAA 4A8MP 4CYNA 1S1TB 2BJDA 4IFYB 1M1DA 1KQKA 4FXWA 4ZDNA 4A8KA 1WG4A 4MAKA 4DFKA 1TELA 1MROB 1LRZA 3QMQA 1UA0A 1P4NA 1JWWA 3OFEA 4IRDA 4WXOA 4UEEA 3UW1A 4DL4A 3TYTA 5CZXA 2K2PA 4QCLA 3W91A 1SJFA 3BSAA 2BRLA 1N36F 1MSWD 4QWBA 2ZXVA 4XPDC 3LP0B 4ZS6A 4ECSA 4NWBA 2HWIA 1VRTB 4IR9A 5E41A 5C2GA 2M9KA 3QB8A 5AJ3F 3IXQA 1RTHB 2RQMA 5DQGA 1Y9KA 2VQFF 4ZA1A 1G7CB 4MMOA 2W2PP 5A76A 2EBEA 4QWEA 1VC0A 3Q0AA 3GV7B 4MY3A 2VFSA 4NGMA 2J8NA 2ROPA 1J2VA 4LR8A 1YJ7A 3F44A 1M1KT 4Z7CA 4WFXA 3C2PA 4CT9A 4GVLA 3B3TA 1QSOA 3BN4A 1S4FA 3UDLA 3HZEA 1PSDA 4KUAA 2YWFA 2ZH6A 1EKRA 1QLNA 1EETB 1LANA 3ZZZA 5EN1A 4ETZA 2Q4ZA 5A0YA 1S76D 4NCGB 3QAUA 1HR0J 2DHAA 1DTDA 3FBUA 2MQ8A 4ZCKA 4HT7A 5D3GB 1C4AA 2Y1IA 4KS9A 4YY3J 1DRZA 2AJ0A 2VBZA 1TUVA 3VAFA 3MAQA 3RBUA 4Z7YA 1X8DA 1LQ9A 4PZVA 2I1RA 2AJ4A 1YDLA 3VF0B 4YB5A 4UY8T 1UFLA 2VG7B 1UJ6A 1AFIA 1VC5A 3VZHA 3HHLB 2PJ5A 1YRTA 3HPOA 3JTKA 2MZRA 4WFAQ 1F5CA 2QEXS 1RABB 3OHBA 1F3FA 1S99A 1VYAA 2ZH2A 1I94J 1A7GE 2PN6A 3SI2A 1BMQB 4MK9A 2KI2A 1SPBP 1RAEB 4NF1A 2VF3A 2VJUA 2Y1RI 3T6BA 2JEJA 2F5IA 4DV0F 3GYAA 3A8IA 5AXKA 2MKJA 1RTIB 3O6QA 4USIA 2HNZA 2ZJPQ 1NJWA 5T7LA 3TP2A 2VV5A 4NYZA 1RBAA 4B3TF 2CNTA 2YPYA 1U8SA 2IJRA 1RYRA 1TKFA 1QUVA 2J5AA 2HHXA 2ZH8A 1UFWA 1RZMA 3TANA 2IM3A 2FIWA 2BACA 3H2VE 5AXLA 1X0PA 3DXBA 3KHZA 1OYDA 3UN3A 1M4IA 4KPYA 2DGUA 1G4CA 3KHRA 1BD6A 1EAYC 3GIKA 3HXMA 1PJ6A 2DRBA 2E9TA 3MCNA 4P74A 2XHWA 2G2OA 3B8HA 1Y00A 1NH7A 3AB2B 2EK6A 1KVJA 1Q8BA 1KUVA 2NPFA 4R9MA 5AE1A 2CQBA 1Z2LA 2Y8WA 2NXUA 4P6QA 1WWZA 1UP1A 5EWFA 3W6SA 3N01A 2BUEA 1QSSA 3D28A 4EFDA 1TK8A 3MZIA 4UT4A 4KOUA 1JWQA 2BJ8A 1TFYA 1NB2A 2JHEA 1M5OC 3CULA 4C8NA 2I38A 2OB0A 4UUWA 4FYXB 4M5DA 1UZDA 3LAMA 2BKOA 4WE1A 4W92B 2Z30B 4JI1F 1JLGB 1MMDA 5JJBA 3DDDA 2CVEA 3CXCR 5D0EA 5JH9A 4ITSA 3H25A 4Q5VA 3G4SS 5K8OA 1SUQB 3ILJA 2FVSA 2B4VA 1DLOA 4K50A 1X4GA 1TK0A 5K9FA 4CAVA 4MH8A 3QRPA 2OUGA 2XS5A 4QC6A 3CCSS 1H0HB 2X3DA 5L9XA 3VQTA 1T95A 5CYJA 4K30A 1PIEA 4HI2A 3MUMP 1JLQA 2IPOB 1EQ0A 2LCWA 1M4LA 1L3VA 4WJBA 2C28A 5D4LA 4A30A 3EGVA 4MFJA 3OTOJ 4JLYA 2V67A 4LREA 3TWZA 4KYZA 2VU5A 3RBZA 3VWEA 3IEHA 2AFOA 3ZZUA 4TY9A 3ZJ0A 2B5JB 4TQSA 2YH1A 1NJXA 2X1GA 1LW2A 2V8HA 2B4DA 2D3OR 3E0KA 4GC6A 3Q8QB 4DQQA 4PG8A 1LFWA 1S97A 4A8SA 4Y3CA 3BJYA 4ZK7M 3CCQS 1R43A 3JQJA 3JAMY 3R5AA 4BBHA 1YITS 1GYTA 4LRBA 3TR5A 3AD7C 2H5IB 3A3PB 5C42B 1Q8KA 3V7ZA 3W3SA 2B9XA 4CDIA 1HD1A 4PG4A 2Y0BB 2JBKA 4OHVA 4OYIA 1HWKA 1IKVA 2PFDA 4Y00A 4W9YA 4YMEA 3E2EA 5E33A 2PR8A 4P72A 1PU9A 4UFXA 1HW8A 3M8WA 3W64A 4C7HA 4J9SA 3TZXA 2YQ1A 3C3LA 2HMIA 2CQIA 1TF8A 2LFVA 4NPOA 3RAQA 1RBLA 3KLHA 1GMUA 2CJXB 3EXNA 2ZBPA 4FYYB 3D9BA 3WC5A 5HBMB 3QZ8A 2UUBF 2G0CA 3W61A 4GC7A 2Y8YA 3UN5A 4M5LA 4JB8B 4IOAQ 2QJ3A 4GS4A 4J9MA 2F4VF 3AB4B 1UVLA 3TAQA 3NMAA 3VHQA 2YNFA 1NJIT 1X4HA 5C24B 1Q2YA 3NOCA 1WEYA 4PG5A 5RUBA 1GTEA 5KAKA 4UQTA 2DNGA 4HH1A 1RYSA 3EJMA 4MHPA 2M7SA 3PJXA 4DPUA 2BM1A 4DUKA 1W25A 3CXSA 4F25A 4P4FA 5A6PA 4ZVEA 5J1EB 4NLOA 2FY8A 4CYUB 1U26A 2EVZA 2MLXA 1EKSA 2C3PA 2ATLA 3KLEA 3T5KA 3HD1A 2PFFB 1NSQA 2VBQA 1SIWB 4ILLA 3MPYA 2ASJA 2LDYA 1FE4A 3KLGA 2ROGA 2UUAJ 2ZITA 2CFXA 2NQPA 2HNYA 4DL7A 3AQPA 4DR6J 4A48A 4TNUA 3J7ZT 4LFCJ 3KTQA 1Q53A 4RBTA 5CYMA 4PYAA 1XOVA 4B3SF 4ALZA 2DNZA 2Z3LA 4YUDA 3WC2A 3KFWX 3OL6A 2JJ4D 1S10A 3D1QA 2A10A 4Q2MA 3MTJA 1QVFR 3AHPA 2EXUA 1XMQJ 1R8AA 3HVTB 2DNPA 2YKAA 1N8RT 2QO3A 3FSIA 3F8KA 3KLIB 2DNMA 1XF8A 4NLUA 4PK3A 1GXLA 1F2HA 3BGLA 2CQ0A 4F0XA 2VEZA 4KOYA 1WEXA 2RF2B 3WC6A 4LF9F 2J9EA 1QAXA 2GS8A 4KO0B 4KHMA 4NA3A 2E5LJ 2KZZA 2HAFA 1RHMB 4LF5J 3D67A 1VHIA 4PUOB 1R8HA 1RTDA 3UN2A 2NMTA 2KM8C 3H5SA 3HVRA 3HSDA 3D0HE 1IBLJ 1ZLHA 3G2XA 3TA1A 3NNHA 4ED4A 3PX0A 2NS1B 1Q78A 2RH3A 2AYBA 1MWQA 2FTRA 2GJ2A 3QO9A 3RUBL 5CPAA 1ZZNA 2RHQB 2C27A 1I1GA 2EK1A 3FK4A 2QJ8A 5BXIA 5IT4A 5HVFA 3DGPB 3GU0A 2W2QP 4QW9A 2W9CB 2N7CA 2HRTA 5DZ7A 1YI2S 3ILLA 2LXFA 3T19A 1ZG7A 2B3TB 1HBOB 3MM6A 3FNNA 1SC1B 3TUPA 3LF0A 2G0JA 3MMCB 1HYSA 1WEZA 4HL9A 2VG6A 3M9MB 1Q79A 2EFGA 4BINA 2FJBB 2R2SA 1FJEB 5C7PA 3GWCA 2EPIA 4H6UA 3KDOA 3JRUA 1RA6A 2GVZA 3I0SB 3C6TA 4ED8A 3BHXA 3KK3B 2V2VA 2VA2A 1ITPA 3CPAA 3DSBA 1XIQA 3P5TL 5KG2A 3D7HA 4IH6A 2R7TA 3DKDA 1VJQA 2HWTA 4NXNJ 1XNQJ 2AJ1A 4HH0A 2FS5A 4A2ZA 3LP0A 2NXJA 3HKZD 4NMLA 3V4MA 3C16A 4IG3B 4X4OA 1S49A 1UEKA 2GIQA 5ETNA 2E1RA 3Q89A 1IWAA 3PNIA 4NEXA 2FT0A 4GM5A 2QA2A 2CDRB 3JVNA 2KHDA 1FY7A 1XTZA 1KRPA 4DSFA 1TVRB 1CP7A 1RAJA 3V81B 2GCFA 1W7WA 4ZX9A 3NGTA 2CIJA 3BDEA 4I68A 3DC2A 2WBRA 1T7PA 2DGVA 3IWGA 1AZSB 5HL7Q 2J9DE 3Q83A 2CAJA 3TJAA 1IN0A 4F9UA 1I5OB 3RR7A 1S4EA 2CYYA 5HJXA 3DN9A 4WWSA 1LWEB 5L1IA 1EETA 3NH8A 1FRMA 4OFZA 4MFQA 4UCMA 4Y49B 2FZKB 4OJGA 4F0YA 2IM1A 1YHQS 4ZVFA 3M2RB 5E3CA 3SXNA 1C0UB 2GQQA 3HK2A 3R95A 5KOWA 1S1WB 2Q6CA 5D3GA 2G0BA 3B4MA 4KOSA 4BLGA 1N52B 1ULRA 8CPAA 2AV5A 4NI2B 4DV5J 3BM7A 3EGWB 2PI4A 2XEGA 3M2VB 1FJGJ 2DK2A 4USHA 3HM9A 3NGDA 1P27B 1BHNA 3PX6A 2VG7A 5J2QB 4M5MA 4M5IA 5ADZA 3HHLA 2BQUA 3S1TA 1N33J 4J9VA 4ZP8A 1BGXT 2O4HA 4MFZA 3DLBA 3R9GA 4C8YA 5J1PA 1XMBA 2M2BA 3PYEA 2V4RA 3QQCD 3MUTP 1S9EA 3DXSX 1IICA 4CO5A 4BC7A 1YQEA 2XY7A 1NMEB 1CULB 4ANDA 3SCKE 1KKHA 4QR2A 5AXNA 1CJUA 2XCPA 2F8MA 2RHSB 3WZ0A 1HQUA 2DNRA 1E6VB 4KPCA 4DCJB 2CJQA 8RUCA 1RT5A 3CDWA 3GFHA 1JJCB 5DGAA 4B14A 5D0HA 2R8JA 4CO4A 4NGSA 4NXYA 1UVKA 5C25B 1TL7A 2DBBA 3MHYA 1QVGR 2VPYB 1HBMB 3D66A 1WKJA 4FD5A 4F4AA 4LR7A 3FX6A 1WSVA 2GVDA 2ZC4A 3NLCA 4H2KA 3PB8X 3NCPA 3CIZA 1IKYB 3O2IA 3R7NB 1UL3A 3RBDA 3MOJB 3E8OA 3R7BB 1BQMB 1N0UA 1NSAA 1RWPB 2B4PA 4KGZB 1M4DA 3RB6A 4NLYA 2MZQA 2VPXB 5EX0A 3HLPA 4FS1A 5LMNF 5CCMA 2KYZA 3VZIA 2FZGB 1GMWA 3GG1A 5GAGI 1Q95G 5F46A 3T90A 2ADCA 3B78A 2HBRB 1I6JA 3KZWA 1GEHA 3OSNA 2P5VA 4J5OA 1RT7B 2HHTA 2WONB 3VARA 3TUJC 2XBPA 4MKAA 1HHSA 5FDLB 2VDHA 3CC7S 4OL8A 1M5SA 3C66A 2QSFA 5A2QU 4KVME 4CRYB 1D09B 4BWJA 1JLGA 5F9NA 4CTAB 3T1AA 5J2NB 1WORA 1ON0A 3DNCA 2EI5A 3A8JA 4MTPA 2VFVA 1F2OA 2V4JA 2BCOA 4H54A 4A37A 1SUQA 4C98A 2DNNA 5K14B 2IDLA 4MT1A 2OP5A 2PSZA 3MD1A 4NCBA 2ZFHA 1IKXB 1YREA 3TOBA 5JQ4A 1SKRA 2HS4A 4AVAA 1VQLS 2K8GA 2JFDA 1WKKA 1EX8A 2MZTA 5CQGA 4G3IA 2CJAA 1Q8IA 2DH7A 1RHUB 5AG6A 2CNKB 4DSJA 2AEJA 4C0HA 1R8PA 2FSRA 4DQSA 3ZTPA 1KTQA 2AW0A 3ETOA 4F4ZA 1UEVA 2IBOA 1QM9A 1R0AB 4BS2A 3ILIA 3MCSA 2ZWOA 1PKUA 1U6FA 5BR8J 4NXMF 2GLJA 1WOPA 3CE8A 1RT2B 2REFA 4JV5J 3NWRA 4QIFA 1S6UA 4QOTA 2ZEOA 1FRIA 3MEGA 4KSFA 2XLIA 2K7KA 3PIOQ 1Y7EA 3M6VA 1DQ9A 1TAUA 4MXUA 2UXCJ 2CPEA 4F26A 1TU0B 4OYXA 5KTQA 2BEFA 3JYTB 2V68A 4NASA 4MKBA 4HLBA 1FCAA 3BREA 1HKAA 3JSYA 4DPYA 3KMQA 3SSSA 1N88A 4F36A 2ZJQQ 2FVPA 5JVGQ 2IM0A 1VRUA 3V6KA 1C2PA 3I9ZA 2CZVC 4OYMA 4DR5J 4I2QB 3NBPA 4P9SA 3SCIE 3KHHA 3NFZA 1Z4UA 3FCVA 3HULA 4OJ3A 4YGOA 5JXSA 1ZG8A 2CPHA 2PT0A 3DRSA 1G6BA 3MAHA 5IV3A 4MHZA 3TCVA 3D6HB 5KFYA 4DPWA 3NS6A 2UUTA 1SCJB 2CQDA 1EE3P 2OFHX 2Q3PA 3EDQB 4DL0C 1ZLIA 4GKJF 4ZCMA 3IAS9 1S6OA 1RSCA 1BUXA 3KK2B 4ONWA 2Z3NA 5J1NA 3UFCX 3EDRB 2BL1A 3OFGA 5IV0A 1V9OA 4DUZF 4ID8A 4BDPA 3PZJA 1SIZA 4C2ZA 3AQOA 5KFFA 2QC3A 1N32F 1S1XB 2VQEF 4GO7X 2DIUA 4WK1A 5J1EA 2WZ1A 1UCNA 3HHLC 2LA6A 4YQWA 1Z5RA 2W4DA 4XDCA 1X5PA 2ZEEA 1HWIA 2WRMA 3BSCA 4PWDB 3M8QB 3GQCA 3TC8A 5KFGA 4KUBA 3AXMA 3U1LA 4ZPCA 1VQOS 2B56A 4C0OC 1VI7A 3H2LA 2QLJB 3V4IB 2B4UA 4FS2A 2Q04A 4A8FA 3L4BC 1TL1B 3OT9A 2MQMA 2K1RB 4KBIA 2DPIA 4RW4A 1JLAA 2XM3A 4JZ0A 3MPUB 2CF4A 1D0EA 4TNOA 2IIHA 3EZOA 5BYSA 1IBKF 1REVA 6AT1B 1FEHA 2MLZA 5A8KB 1RO5A 4ATNA 2V5HG 1VQ6S 4QWAA 2X1FA 2HFZA 4JI6F 2X7BA 4ZJLA 2ZUAA 6FDRA 3EGZA 3HVTA 2O53A 5LRGA 4GKKJ 4Y2IA 4KOXA 3EVWA 4CRZB 2EWHA 1Q5VA 4C8ZA 1T9TA 5D15A 5IWAF 2R8VA 2E5JA 3EVMA 4HDGA 4KO0A 4W98A 2E44A 2NREA 3MEDB 2OR4A 4CLYA 1U24A 1KHVA 3F73A 1JXVA 3GYXB 2ANPA 3DHWC 4KVOE 2NXCA 3IN5A 2XEIA 1FRKA 2VBWA 2PO4A 2YH0A 4K0KF 4PSWA 1UKUA 3VR1A 4CRJA 3I9SA 4OMFG 1M4GA 3ET6B 2H1YA 3OXFA 2CZ9A 1BQNB 3QT7A 1S0MA 5KFBA 2AX0A 3W9IA 3NCQA 3DI6B 4OYZA 2KKHA 1RTZA 5E3PA 3DGPA 1RWOB 3VAGA 3ZTRA 2W9CA 1YRXA 2AX1A 4UA3A 3PR5B 2R7SA 2ZH9A 3TNVA 3D6TB 1HBOA 3T1YF 3MMCA 1KC8T 3CDEA 1NNDA 3RG6A 2J9CA 4I6WA 3B3VA 2XMUA 2M88A 2GGPB 2XMKA 2IJZA 4QBUA 4LFAF 1FWLA 5F8IA 5H84A 3C14A 2GREA 2KFYA 4P4EA 3I87A 1E6YB 4DSLA 3KUEA 3BPSP 4FXVA 4KGKA 3J7AN 4CLTA 1NKEA 2CPZA 4DG1B 5L1JA 2FIAA 1XFOA 2D4OA 1KVIA 1S6QB 2XC9A 1HEEA 2L9WA 2ZOGA 1TL5A 3BGFA 4CQ1A 3CC2S 3DGVA 4UWJA 4TY8A 3M2UB 4OI4A 4FBUA 1S7HA 2O1PA 4H4KA 2QIRA 4RZRA 2YWWA 1TKTB 2MB0B 4O3QA 3EX7B 2FD2A 4XTTA 2BOAA 5J2MB 2XLJA 4KV8A 4P73A 3BBFA 3SFGA 4K7QA 1QJHA 1HA1A 4W4MA 2Y3YA 3JAMU 1SJQA 1LFPA 1PYTA 2OPPA 1AZSA 4HR2A 2DGOA 2FB0A 2VIHA 1XK8A 3MM8A 4NGNA 1YK3A 3FQKA