2V8DA

Crystal structure of mutant e159a of beta-alanine synthase from saccharomyces kluyveri
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
437
structure length
437
Chain Sequence
GTLNLPAAAPLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNAEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Yeast -Alanine Synthase Complexes Reveal the Mode of Substrate Binding and Large Scale Domain Closure Movements.
pubmed doi rcsb
source organism Saccharomyces kluyveri
molecule tags Hydrolase
molecule keywords BETA-ALANINE SYNTHASE
total genus 148
structure length 437
sequence length 437
chains with identical sequence B
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2007-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v8dA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2v8dA01
1ZLIA 4NGRA 3NFZA 2ZEMA 4OC2A 3D7GA 2PJ9A 4NGNA 2IMOA 3D7DA 2AFXA 4ZYQA 2CIJA 4ZY1A 2Q43A 3KHZA 3LMSA 2CTBA 3KR4A 4NGSA 3PBEA 2ZEEA 4UF4A 2PIYA 4P45A 4OC4A 3V7ZA 2F8HA 1TF8A 3FF3A 1IY7A 3S9NA 2OR4A 1BAVA 4JZ0A 4NGTA 3NH8A 3D7FA 4X3RA 1KWMA 1XFOA 2PJ3A 4MCPA 2POKA 5IB9A 3NH5A 5LRGA 2PVVA 2I3CA 3QNVA 7CPAA 3B35A 2O4HA 4MRIA 1LOKA 5JM6A 5I4MA 2PRQA 5CBMA 4OKOA 4DJLA 4MHZA 2CF4A 3KQXA 2AFSA 4UIBA 4NJQA 1ELMP 1FT7A 1YLOA 3DLJA 4P4EA 5DS0A 1VIXA 3IC1A 2ZOFA 3PBBA 1ZG7A 2NYQA 5CPAA 3KZWA 2ZEHA 2V8HA 2RB7A 3V38A 4R7MA 2PJ4A 2GLFA 2PJ0A 4MCQA 3VARA 3PEIA 4R76A 4UIAA 3S9LA 5THWA 3B3TA 2PJ7A 2C6CA 1BLLE 1XJOA 2EK8A 4WWVA 1AMPA 1IGBA 1UWYA 4TNUA 1CPSA 3WABA 5K8PA 4PXEA 3KASA 1ZG9A 1QQ9A 3D68A 1EE3P 1TKHA 2XEFA 5K8NA 4P4JA 4CPAA 1CP6A 3IEHA 2CTCA 4F9UA 2OOTA 3B3VA 2XEJA 2PCUA 2XEIA 1XBUA 3HLPA 3NA6A 4MCSA 4OC0A 4ZY0A 3CDXA 4NGMA 2J9AA 5LYLA 4F9VA 1Y0RA 4A39A 4MHNA 2ANPA 1YW6A 1HDUA 4A94A 5K8MA 4K3NA 4ZX9A 2WZNA 1M4LA 2C6GA 3IFEA 2ZEGA 3PFEA 3B3SA 4W9YA 2PJAA 2AFUA 3SJGA 4YWYA 4P4FA 1Z2LA 1ZG8A 4NJRA 3FJUA 4OMEA 1TF9A 3FEDA 1BPMA 4Z65A 1PCAA 3TC8A 1OBRA 4PXBA 1VHEA 2QJ8A 4MHYA 4OIDA 1YW4A 5LYDA 4DYOA 2IQ6A 1CX8A 4MHPA 2JEWA 3K2KA 3B2YA 4P44A 1R43A 4EWTA 4EMEA 4AXVA 1NSAA 2WYRA 3KI9A 1GYTA 4UEZA 5LYIA 2PJ5A 4F8ZA 2ABZA 2PJ2A 4PQAA 3BI0A 2PJBA 2JBKA 1BPNA 3B3WA 5F09A 4X8IA 3HUVA 4X2TA 3GLJA 4O23A 3PB4X 1LAPA 3IO1A 1YMEA 2DEAA 2BOAA 5J1QA 1XMBA 5LYFA 2V8GA 3IJ3A 1RTQA 2V77A 4KSIA 3KGQA 4PXDA 5D29A 3PB6X 3BHXA 3PRTA 4FAIA 1F57A 2V8DA 1H8LA 2AFMA 3FECA 2V8VA 4P10A 4P4IA 5JH9A 5HXDA 2PVWA 3FH4A 3TX8A 3JRUA 3RBUA 1DTDA 4ZY2A 3CT9A 2PJ1A 3CPAA 3PB9X 3T8WA 3GB0A 3B3CA 1YSJA 2VL1A 3WC7A 3PFOA 3KQZA 3FMCA 1LFWA 1JQGA 3H8FA 1CPXA 5HVGA 4GM5A 1HEEA 1VHOA 1F2OA 6CPAA 3SJFA 1XRYA 3VATA 4A38A 3SI2A 4YU9A 1QMUA 4BD9A 2PIZA 1Y7EA 4MXUA 3FX6A 3D7HA 4IK2A 2ZELA 3KL9A 2QYVA 2GLJA 3MN8A 3PB7X 4PPZA 3H8GA 1ELLP 3FVLA 3WT4A 4PXCA 3BXMA 3H8EA 1CBXA 2XEGA 1AYEA 5LRJA 4P4DA 2AFOA 2EWBA 2G9DA 4B6ZA 2ZENA 3N5FA 4EFDA 4OC3A 2C1CA 5JGFA 3DGVA 4R6TA 3WC5A 2GREA 1Y0YA 4IAVA 2PE3A 3SJXA 2BO9A 3FEEA 1ZLHA 5HVFA 2PJ8A 3D66A 3RAMA 4FWUA 3PB8X 4NFRA 3ISXA 3IWWA 3SI1A 4MMOA 5D8NA 3NH4A 2QVPA 2HB6A 2JBJA 2BCOA 2PJCA 2IJZA 4ONWA 4TWEA 3B7IA 1LCPA 3IIBA 3SI0A 2ZEPA 2Q51A 3L2NA 4LQGA 4DUKA 4UEFA 1LANA 3D4UA 1Z5RA 5LRKA 4H2KA 4ZX8A 1TKFA 1FNOA 1TKJA 2C6PA 2HC9A 4RUHA 2ZEFA 1TXRA 3VH9A 2ZEOA 3S9MA 1Q7LA 5ELYA 5K8OA 1HDQA 1CP7A 3SJEA 3BI1A 2O53A 4R8FA 4Q7AA 4IHMA 2GU2A 2FVGA 2RFHA 1CG2A 1Z8LA 4OIWA 4G1PA 4P6YA 4FUUA 4WJBA 4NGQA 2AFWA 1ARLA 2Q4ZA 4P4BA 3RZAA 4MCRA 2AFZA 2EK9A 3K9TA 4FBEA 2PJ6A 8CPAA 4OC5A 3LWUA 3I1UA 2NSMA 4UEEA 2ZEDA 1R3NA 4JYWA 1LAMA 4ZI6A 3MRUA 3D67A 3WC6A 5HVHA 4A37A 4OC1A 3ISZA 2ZOGA 1ARMA 3CPXA 1PYTB 4OP4A 1DE4C 4NGPA 2F7VA 1F2PA 3GUXA 1VGYA 3KHXA 3KR5A
chains in the Genus database with same CATH superfamily
4ITSA 4Y2IA 1AXQA 2VG5B 4RW8B 2DNQA 2M2BA 1ZM4A 3D7DA 4OYZA 1S7LA 4ZY1A 4ELTA 4LFBF 3R5CA 5IT9Y 4GO5X 3FZBA 4Y2KA 2WUUA 3M2RB 5SZTA 4LBHA 4P45A 1HWKA 2FC8A 2R4FA 4NGTA 4JV5J 1AFJA 3TW0A 3NH8A 3MM7A 3T9NA 4CLLA 4EU0A 3NH5A 4DF4A 5BYRA 4D3HA 3NMRA 3OSPA 1GX5A 5JM6A 4CO2A 3RBEA 3W64A 3OR2B 4OKOA 4EUVA 2HS0A 3PJWA 5AXNA 3FIXA 3KQXA 4AVCA 2AU0A 3PR5B 1FWLA 3OTDA 1D1UA 4KOYA 3TOAA 4QW9A 2UUBJ 5CD4A 2H48B 5G1ZA 1ON0A 2GLFA 1X4HA 2R8HA 1O6XA 2VH7A 4PYDA 2WVDA 1NK5A 2PC1A 2VJVA 3VAFA 3NBPA 5IFMA 2Q66A 2BE7D 3UVJA 2R7SA 2B43A 2D69A 2FIAA 2YGWA 5CXTA 1ZYQA 4IH7A 5HJXA 4DFJA 5C42B 2XEIA 1BOBA 4ZITA 5KFOA 3CJSA 3MCNA 2QA4G 2DTJA 4F9VA 1RWOB 3CE8A 2W9CA 4YEAA 4JUZA 1VDHA 1TKZA 5C2CA 2Z3LA 4XO0A 4OZ0A 3R2CJ 5IV0A 1X5TA 4OX9J 2Q4VA 4KYZA 2YNEA 5GADU 3I5CA 4D3GA 1ZPVA 4DQSA 4WFNQ 2RUSA 4NJRA 2V5HG 1KEKA 4C7HA 1FDAA 3A1YG 4WBFA 1M5OC 4MHYA 1N0VC 2P9EA 4YHHF 3GYGA 2WW4A 2VONA 1HBMB 4ZJOA 4ES2A 1RP5A 4U5YA 2YNGB 3K59A 3T9YA 1NSAA 5KAKA 1R6VA 4AVBA 2R7QA 2WW8A 2ABZA 2VUGA 3BI0A 5CCMA 3R1LA 1HD1A 4USJC 1Y10A 1BPNA 3B3WA 2JX2A 5EUHA 1LAPA 5IQQA 3QJLA 3H59A 3FXTA 2LEBA 4HDGA 3TI0A 9ATCB 1R57A 4MFJA 1HBMA 3VGSA 2V8GA 4UCNA 4J9VA 2ARHA 3I55S 3PCOB 4X65J 2OO4A 3D3BJ 3J81Y 1ZAWA 5HATA 4ELUA 2RHQB 4LF8F 2FJXA 4NYZA 4X64J 2GX8A 4P10A 3H42A 5GAEI 1BD6A 4RNHA 3KDNA 2WB1D 1JXVA 4DQPA 3KUGA 2KN4A 1N32J 3NRBA 3PB9X 1RBLA 2FZCB 3UN3A 1Z4EA 3HJFA 1ICEB 4P2XA 3MHYA 3O44A 5DQHA 2ASLA 3T6JA 2DXFA 3M30A 4QWBA 1XMTA 4YU9A 4NE9C 3P5TL 2DEIA 1BXNA 3IRXB 4OZ1A 3CJ8A 2F63A 2MPUA 2C3OA 3W8GA 1IKYB 2BM1A 2Z2LA 4AL5A 1KKHA 3W2WA 3D6FB 4DQRA 3ZTQA 1NHKL 4LRDA 1S4EA 2HQGA 4PWDA 5GCNA 2GREA 2QMUB 5A8RA 5KFMA 2CJXB 4ICLA 4B5OA 4OYIA 1FO1A 5L1IA 4GKJJ 3QWPA 4DSEA 4FD4A 1H7WA 1N48A 2QA1A 3DHXA 4ZPVR 3ISXA 3R96A 2C42A 5IOLA 4PG8A 1SC3B 1KP6A 2J5AA 1WACA 4KOVA 1XBWA 3NGRA 8RUCA 1Z2ZA 3VWEA 5KTCA 4ECXA 1Q79A 2UU9J 3EZ5A 2ZM6F 1LANA 2DH7A 3CC2S 3GIKA 3BGLA 4PG5A 4OJ1A 1HMVB 2RQ4A 4BMHA 1L0CA 2HHWA 2W7OA 1WKJA 2EBEA 5E33A 4O3RA 3R5JB 2R9LA 2IC3B 4DSFA 4IR9A 4J9QA 3KYLA 1F2GA 3BYPA 2X1GA 2D4OA 3GKRA 3GFZA 1JLCB 2ZJQQ 2VF3A 2DRAA 3TA1A 3OL6A 3PIOQ 2A6OA 1U49A 1WNEA 4G1PA 4J9MA 3RRKA 1ARLA 4FBEA 2UVUA 1WG4A 2ZZNA 3FNCA 2K5TA 1LAMA 1WOPA 2ZW4A 3ISZA 3KLGB 1IQTA 1SVDA 1VQ6S 1VBYA 3IBFB 5RUBA 2BACA 3BS9A 3BBFA 3WIVA 2X1BA 4F50A 1I5OB 3JUWA 4A8KA 5GVQA 4H4OB 4NGRA 4ZDNA 2ZEMA 1SC1B 2PJ9A 3C66A 4YS2A 2AYBA 3AJDA 2JFKA 2OIHA 4LF5J 2E1RA 3KR4A 3RBXA 3FRYA 4UF4A 4YN3B 2FCKA 4YDXA 2L48A 1FRIA 2AKWB 3MR2A 4W4MA 4M6GA 2G0JA 1YRTA 4RW7B 2I3CA 5KTAA 3AODA 1WKLA 2R3VA 4JI6F 5I3QA 1NZ8A 2QMXA 5HMNA 5HLFA 3T1YF 1RAJA 4CO1A 4CZCA 3CMES 1MW7A 2B0GA 1RAHB 3KLVA 4NEZA 1XMOF 4V19X 3MMAB 2QJ3A 1CS4A 1B0TA 2RUGA 4RUCA 3C46A 3CNQP 4BC9A 1D3WA 3AOBA 3DXBA 3CWJA 2M88A 3VARA 2OD6A 3KWMA 3OR1B 1RBOB 3D4JA 3IAS9 4MK7A 5F8HA 2RU3A 4HT7A 2B4VA 4QOTA 2H51B 2I5JB 4I2PB 2GZOA 1LW0B 2YX1A 1RWVB 2PA3A 3V81A 4K2XA 4DR6F 2UXCJ 1HBNB 2YWFA 1G2EA 4ES1A 5BR8F 3Q8QB 2GMLA 4K50A 3MMCB 4DN9A 1YRXA 1IKWA 1WC1A 2D9PA 5F41A 4H89A 4FXVA 4OX6A 1GTEA 2XY5A 2GHWA 1T9VA 1KQSR 2MHNA 4ZK7M 3C6TB 1B0VA 2R7RA 2QEXS 1QVGR 4NF1A 1GNKA 4MIBA 3CC7S 3K57A 3PHTA 3GYXB 5ETQA 2VPZB 2G1HA 2ROEA 1FDNA 5DZ6A 4QU6A 3SQGB 3EC4A 1M5HA 1WC0A 4DR3F 2X1AA 1TP7A 3H90A 4EMEA 4EWTA 2YWKA 2XBPA 2H9ZA 1GXTA 5ETVA 2PJBA 3KMSA 2Q1LA 4AE5A 1FVQA 4LVNP 1K8AT 3VWDA 4ED0A 3CCRS 4EVYA 1F5BA 2W9CB 4K59A 4GVLA 1QSSA 2QC3A 2BOAA 1HKAA 3MPDA 1M0SA 5FDLB 4I69A 4F6AA 4B3TF 5G0RB 1G3OA 4EYHB 1T0TV 3QT5A 1KVIA 2ATCB 5A28A 4PUOA 3BGOP 4IG3A 5DDOC 5LSOA 2DR8A 1KS2A 4OYOA 4LFAJ 1Q8LA 4P4IA 3FBBA 2AP6A 1YR0A 4DLEA 2O66A 4CQ1A 1N88A 1U02A 4ECTA 3CJRA 1OZPA 1L3SA 2QLBB 3R5GA 3QRPA 1HNXJ 1PJ7A 2PEBA 4DV3F 1S4FA 2GCFA 4KZTA 3W63A 2BM0A 1HEEA 1PUAA 1QAIA 3CMAS 1W2IA 3MPUB 1HYSA 2ACMA 2ZELA 3KL9A 1RTJB 2H54B 2BE2B 1KFDA 3I56S 4F0HA 1UFKA 2IM3A 1REVA 1RWMB 3H8EA 1F2HA 4LFCJ 1H7XA 2JDJA 2P9GA 1HQUA 3DU5A 3DGVA 3WC5A 1FX4A 2DGTA 2OSRA 2R7TA 2C2MB 2FGOA 2OH2A 1U2CA 1TKZB 5F3TA 2PDAA 4F25A 4X66F 3NH4A 3Q2SC 4MIAA 4IQXA 5DWNA 3OUYA 3MMCA 3MM8A 1R89A 3IR6B 3EXNA 4LF4F 1GT8A 4LX9A 3AOAA 2F3JA 3CGIA 1MROB 2XI3A 3M05A 2R2RA 4H2KA 4M5MA 3CJ3A 5J1EB 1YIJS 4XPKA 4NOHA 1TKJA 4X4TA 4CT8A 1EIYB 1DQ9A 4I2PA 2ZEFA 4IG0A 4WE1B 1JWWA 4LRCA 4KC5A 4U8VA 2HMIB 2N3OA 3LGNA 3UN5A 2MQQA 3E51A 3M8WA 3GV5B 3C6UA 2JOQA 4M5GA 3ISND 3TJAA 1VRTB 4DR7J 3IWNC 3NL0A 3EGVA 3MM6A 1Q2DA 3NE7A 3DDKA 1FFSB 2HBZB 3J7ZT 1N6QA 4MCRA 5CQGA 4C2ZA 3HHLA 1BWEA 4B3SF 1IJFB 3KJNB 1H2VZ 1RT1A 4YY3J 1I51B 3KLIB 1RWUA 3AD7C 4A8FA 2EBJA 2REFA 4WFAQ 3HSZA 4RW6A 5HSPA 1YBAA 4LF9F 2M4MA 2X7BA 3MMJA 4EGLA 4NGNA 4J91A 3DLLQ 2CIJA 2UUCF 2MSSA 3H7HB 3B78A 3I9SA 1MMNA 4AUKA 4ZLNA 3QIDA 4KOSA 2YKNB 3BYRA 4HNYB 1HNIA 3S6FA 1FI4A 3K5PA 5IWAJ 2CJYB 3BQ0A 1GH8A 2GAHC 5CZXA 1A2ZA 4R5PB 4CH1A 3Q24A 1AUDA 2O3DA 1FVSA 4Q5VA 2AFSA 2B51A 3AFGA 2BEFA 4I2QB 1VC6A 1QSMA 1WDDA 5C25B 3V4MA 3D3CJ 1WORA 4EK2A 3FVYA 1OYEA 4EBDA 1RT4B 2BMBA 3DLEA 1F9HA 2EKNA 4LQ6A 2V4JA 3BPSP 5F8JA 3S9LA 1FTRA 3LODA 4A8MP 2C6CA 4F04B 4WWVA 4UUWA 3FQLA 5A6WA 2NPFA 1B64A 1VRQC 2H5IB 4PXEA 1CSJA 3NP5A 3M9MB 4N8OA 4WP8A 2R7HA 1IM6A 3HHLB 3OL7A 1RT5B 2P2CB 2DIUA 3HHEA 2VG7A 2NXCA 4DWIA 4G6VB 1PBAA 3EGNA 4BINA 1UFLA 4U8YA 3R9EA 2IFXA 2V0NA 3LWMA 2B4DB 3TRGA 3B3SA 1JLQA 2Q6CA 2AGPA 1SPBP 2V4RA 3KNAA 4PWWA 4BCAA 4CYUA 1PIEA 1YK9A 4X4VA 3QLHB 1NJIT 2FVQA 4PXBA 1LFPA 2FS5A 1XIXA 2OP5A 1KRPA 5DQIA 2K1RB 1Q2YA 4JI3F 3KHRA 3O6QA 4LF6F 1HPZB 1S9FA 4ORFA 4ONUA 4JI0J 1RT7A 1QM9A 5A8KB 2NR0A 2OEKA 3P8BB 4NA3A 2EPIA 4FXDA 3OHBA 2Q0YA 3HUVA 2QTWA 4O23A 1EETA 2RS2A 3HVAA 4FYWB 2KM8C 2ACYA 4PK2A 1J2VA 4B14A 2DR6A 1S6QA 3N7ZA 3BH6B 2YNIB 5IS2A 2VPWB 5D77A 3VR1A 3NWGA 4QW8A 4DFKA 4KOTA 2NQPA 4LF7F 5IV4A 4RKUC 5LM7E 2PI4A 1H8LA 5LMUJ 2X3DA 1HWIA 2Z57B 5HBMA 1J27A 1LWEB 3VF0B 3FH4A 3PEHA 1RI7A 4KSEB 5ITHA 2I2YA 1S12A 2NZ4A 1TQLA 2XMKA 1YSJA 3FUYA 3PW0A 2RE1A 3UD5A 2BX6A 1LXJA 4K4ZA 4CGMA 2V8PA 2UXCF 4A8WA 3NEKA 1JXEA 2QRRA 2CPYA 4ECSA 4KTQA 1RT2A 1Y7EA 3ZZYA 4NCZA 2CDRB 1BC6A 1I12A 4KE5A 1RTHB 3DR8A 2CUYA 3OR2A 4G1IA 2GQ2A 1VQSA 4CT9A 1MSWD 4B08A 2R7OA 4O4RA 2Z3NA 1RB0A 3A8JA 4F3QA 4YDDB 1U0HB 1EZZB 2OMOA 4DDFA 2FD2A 5KT5A 2REEA 3ZZIA 2Y9HA 2Z56B 3BKTA 4NFRA 2GA7A 2Y0SD 3FKBA 4DX7A 3UR0A 1IBMF 1NK0A 5BWAB 5AG5A 2AQ4A 4MFLA 2DGXA 3EYZA 4NXMF 1U0HA 3HKZD 1RWWB 2D7SA 2GVZA 4QWDA 3MPYA 3X1LB 1XERA 1FNOA 4EYIB 1S76D 3L4BC 1FWKA 3QIPA 1RHKB 1FRKA 2YVSA 1X0PA 2BABA 1ZM2A 3HVTB 3VH9A 3S9MA 1S0VA 5A0YA 2YKAA 2ZH8A 5HO4A 1X12A 5B0EA 2AJ1A 4CNZA 4NLXA 5IT9U 1J5OB 3BI1A 5LL6d 2GU2A 1XEZA 4RUBA 2Q6BA 2NUUG 1SIZA 1FEEA 2PN6A 3EDQB 3E3XA 5H84A 5D6GA 4WJBA 4RW8A 4NEYA 4WIIA 1S6UA 1WF0A 4K0KJ 2DR7A 1QSYA 1VMBA 3EXCX 2R2UA 2UXDF 2L08A 3V81B 4ATNA 4JI4F 4B12A 2ILZA 1PYTB 4OP4A 1C4AA 2LEPA 5B0FA 1IKXA 1P6TA 2HUZA 3ETOA 3UD3P 1TK0A 2K8GA 2GVZB 3D28A 1SB6A 3LALA 3LQVA 2HNDB 3R9FA 3S7RA 1NB2A 2VODA 4JV2A 3MMAA 3A8IA 4CO4A 4EI2A 4LFCF 2LMIA 3K8WA 1B7YB 4ED5A 1Q7LB 4Q44A 4C3KA 3DM2B 5HAOA 2P6FA 2DNOA 5EMIA 4FF4A 2DGOA 3CJ0A 3SI8A 1XN9A 2HNYB 4AL6A 2XEXA 3IXQA 4LSNA 3P4UB 4ECWA 2UXDJ 5L1JA 3DYAB 4MKBA 2H1YA 4KLVA 4M8LA 1IR2A 2EFQA 5D0HA 4EMDA 2O4HA 4MRIA 4ER8A 2F5IA 1ZH5A 2EFOA 2ZHBA 3HFZB 2CF4A 3DFEA 3RGIA 3DHWC 1FT7A 2XULA 2DY1A 3M8SA 1QSTA 2RIJA 2ZHOA 2ZOFA 4J7CA 4DZDA 4AG9A 2NYQA 2V8HA 4RUAA 2OZGA 3EUNA 4PZVA 1TL3A 1XE4A 2UUTA 1BE4A 4XK8C 2DISA 1RU2A 1FJ7A 5F49A 4YGOA 2IA0A 4DV4J 1TKHA 3OBIA 2HQ3A 2AEMA 1SJRA 2D74B 4J9UE 1YG0A 4DPXA 1FRMA 1E6VB 2J9AA 4NI2A 2ZNZA 3G86A 3SSRA 3UY5A 4IR1A 2HHTA 3OR1A 4ZN3A 1WWZA 3U1NA 4QIFA 2FUG9 3K5OA 2HZAA 4GKKJ 3EXYA 1ZG8A 4CYPA 1BQXA 3G96A 4O44A 2Z3PA 1X9SA 3FEDA 1S7FA 2ZKTA 1S9GB 1NJWA 2A1BA 4TY8A 1YBUA 1HBUA 2C2DA 3G87A 1PJ6A 2RJZA 1LRZA 5KOWA 4MY3A 1WK4A 1R43A 4X4PA 2FHOB 3DSBA 4KBIA 2WVCA 4F36A 4DUYJ 1Z4RA 2ODFA 4BHQA 2C3UA 4A8OA 4I7FB 5F09A 3V2UC 3IO1A 4AL7A 3S6GA 4YR0A 3I4HX 1CC7A 4J9NA 3IGVA 4DU8A 4Y00A 5HANA 2ZE2A 1RWNB 2ASYA 5B09A 3C26A 3BHXA 3TO8A 2FGCA 1JX4A 2VU5A 2BEIA 4K4WA 2DH8A 4FKXA 1F3VA 2LDIA 2BE2A 4BWJA 2BKPA 3TYTA 1IM4A 3C15B 4KS9A 3RBUA 1N33F 3OVSA 2PJ1A 1IU8A 1IKVA 4HYKA 1IYKA 2JHEA 4PK3A 2YXLA 3BGRA 4J9LA 5ADZA 4Q2MA 4KKOA 1Q4RA 3HDSA 1WSRA 1XRYA 4OAEA 4A38A 3SI2A 3EM1A 4USWA 3HT3A 4B17A 4FD7A 1Q0NA 3GWCA 5H86A 5G20A 2FZKB 3M6VA 3TVKA 3P49B 5E3QA 1XC9A 3GFHA 2WVFA 3AB4B 2B9EA 1UETA 4O3NA 3CCWA 1KD1T 4IG0B 4FD5A 3N6LA 1NK9A 1CBXA 1DJ0A 4PUOB 3RYLA 4KY3A 1FK9B 1KTVA 3Q8SB 3LP1A 3M8PB 5KG0A 3S6KA 1GEHA 1JLFB 2ZENA 3N5FA 3NGSA 2UUAJ 4R6TA 1UP1A 3R27A 2Y0MA 2PI5A 1BQMA 2C3PA 5T7LB 2BR0A 3DCAA 4CGNA 3JS9A 4KFBA 4EFAC 2BUNA 3CJKB 2J9DA 1JKHB 2D3UA 1C2PA 1RE1B 4DMZA 1YITS 2V67A 1NHUA 3QO9A 2KT2A 2XO7A 4QR1A 3SQGA 2QG9B 3OVAA 4FP9A 1HW8A 5G0RA 3VV2B 2RMLA 2JLMA 4K4XA 4PPDA 1Z1ZA 2VBZA 3X3UA 1KUYA 1LV5A 2G0CA 2HGMA 5JVHQ 1UA1A 3EE3A 4ETXA 1JJ4A 2AJ6A 1ITPA 1B70B 2JWNA 4WK1A 4KVME 1TUVA 2LEAA 3MM5B 1U4BA 3S8SA 3AB2B 3AXKA 2YKMB 2R2SA 4ZCKA 1NH7A 2ZD1A 2OPQB 3EICA 3L3CA 5KG2A 2L9DA 4FUUA 4B3RF 3JSRA 3KKWA 1MJAA 5KFYA 2PJ6A 4AXIA 4V19J 3CULA 1S5ZA 1T7PA 4PG7A 3DR6A 5C7PA 3JAMU 4I6AA 2OAUA 1UPMB 3MM7B 1XNRJ 2CQCA 4MI4A 3B6BA 1WG1A 2NXNA 5IC4B 4B13A 1CJKB 3OTOF 3DNSA 1K1SA 3SMZA 1IBKJ 1CJUB 3CXQA 1TAUA 2IVFB 1HD0A 5F8MA 4L72B 4JD6A 1FEHA 1KBRA 1EJ7L 1SJQA 4C8OA 4UFXA 2EI5A 2Q44A 3GILA 5A2QU 3IG1A 3BSCA 1F5CA 2W4PA 2YNCA 1J5EJ 4CYOA 2YQ1A 2XQCA 4J9PA 3JQJA 4KQZA 2KYXA 2POKA 2IM0A 4OHZA 3G6XA 1YDLA 5KFKA 2G3TA 2GC8A 3QIPB 1CM0A 5LOQA 2KJWA 4NXMJ 2VG7B 4NRUA 4P71A 4MHZA 2J9CA 2GS8A 4HHUA 2MGZB 2AF6A 3Q8VA 1DARA 2IM2A 4QPTA 5HMXA 5J2PA 4DR5J 5HH1A 4TKTA 4JI7F 3J7AN 3FMBA 3D1QA 1RJJA 2PIIA 2E5LF 1BLLE 3EFAA 1UWYA 4DSKA 2OTLS 1TMMA 1UA0A 2DNGA 4ID8A 3S6EA 2XY7A 4OI0A 2XEFA 5K8NA 4CPAA 2MQ8A 3IEHA 3AXMA 2E1CA 4ENOA 2OOTA 4GMKA 5C24A 4OC0A 2WHOA 1EAYC 1M4IA 1IBLJ 2VFTA 5DS7A 4C8MA 1HDUA 2OGUA 1C1BB 3ET6B 3G82A 3MAAB 1G7CB 2QV6A 4M5HA 2L9WA 5F46A 4OLLA 2XNQA 5F48A 4CLPA 3R1KA 3VGUA 1XMQF 3SHPA 3PIPQ 4CWBA 2CQ3A 3BSAA 1TF9A 3MM9B 4ZVTB 5AT1B 5ETRA 4B9LA 1JB0C 2QJ8A 1Q5VA 3RB0A 3ENAA 1RT5A 1S7NA 1JXLA 4MHPA 2OB0A 4J9RA 4ED1A 2Z0ZA 3M32B 4FZVA 3EVOA 1YJNS 2WYRA 1Z9UA 2HFZA 4LT6A 2NXUA 2PJ2A 3ZZPA 1DLOB 4PG6A 3GLJA 1SQEA 1H98A 3KK1B 1Q53A 2GVDB 2YQ3A 1U6ZA 3IR5B 1FKPA 4Y49B 4XDDA 1Q86T 3ILOA 2FJDB 4KHRA 4I67A 2PDOA 3RNZA 4LFBJ 1CBKA 4QC6A 4LSLB 4PSWA 3ITHA 3O8WA 3IWXA 4FAIA 1BGXT 3HK2A 1P9QC 1RT3B 1JLAB 5KFLA 5HXDA 2OJ3A 5F0WA 4CO5A 2KH9A 4R87A 5AGEA 3KLFA 1UPPA 3GIJA 5IT4A 5A8RB 2QL7B 1RT6B 1IVZA 3ILJA 3AA9A 4GKJF 3P45B 1S1TA 3H8FA 4JI5J 3CDEA 2AV5A 3QSIA 5HL7Q 1QMUA 2PIZA 3BBCA 3UCGA 2VKZG 2HAFA 1FJEB 3W5ZA 4RW6B 3BJ7A 2JRSA 4NWBA 5HROA 4DR2F 1CPZA 1HWUA 2XEGA 2AFOA 3JTOA 3S6HA 3MR5A 3EPIA 2DHGA 4TU9A 2G4BA 3MTJA 1VI7A 2IYGA 2VBYA 2RRNA 4UUXA 4DHVA 1C1CB 4M94A 4AXJA 4OHVA 3I9V9 3JQMA 1U09A 4ZPCA 3Q22A 2IBOA 1FESA 4OJGA 4R5PA 3SI0A 3Q2TC 4F2SA 2J7KA 1YLEA 2JEJA 4B3MJ 2PGCA 1TL4A 2B5GB 2CPJA 1D8YA 3OFFA 2QO3A 2OSQA 4C11A 1MU2B 1KDNA 3DN9A 2A18A 5HMWA 3CCQS 4IH6A 1XIQA 2AEJA 4XTTA 3WIUA 5ETPA 2A10A 2BJDA 1R8AA 4CTAA 3TFYA 1WC5A 4ZVQB 1X10A 1ZBTA 2D41A 2UVRA 1Q8IA 3O5TB 3W66A 4CIOA 2AFWA 1Q78A 3KLIA 1FFWB 3PYEA 1GTHA 5DETA 5B7WA 4OC5A 3ZTRA 5M2PA 2HVIA 1JLCA 1MMDA 1L3TA 4FS1A 3J80Y 4CNYA 4B3OA 3MM5A 4NX9A 3VAJA 1H74A 3MAAA 4JI6J 3OLAA 4O4GA 3J7Z5 4J9KA 1XNQF 1I94F 1UEUA 5BJRA 4X4NA 2IIHA 3DDNA 3JTKA 2HV2A 1VK8A 3DOKB 3NS5A 2AFXA 3THPA 4FVCA 1SH3A 1AB8A 2OEMA 2Q43A 4LJMA 3TR5A 4P2FA 2WVBA 1TVRB 4RR5A 1R8CA 3FSYA 2MKKA 3CJKA 4LF1A 1ZPWX 5KFNA 5KFJA 3V7ZA 1PYTA 3W5YA 3K5LA 1NK7A 2FQQB 4X3RA 2CPDA 2PJ3A 3CJQA 1U8WA 3VAMA 1VIOA 2MQNA 2PMHA 4P7VA 5K14A 4J37A 1E6YA 5LRGA 1HBNA 1A9NB 5BR8J 1XEBA 5HP1B 2ZZTA 1CJUA 3MAQA 1TK5A 2YNDA 2VFRA 1HBOA 1NE9A 4OZ5A 4QIEA 2H65B 4MFBA 3CMQA 3SCJE 4Q0BA 2CJAA 1RACB 2CQBA 2M9KA 2N4CA 4QIVA 3TT2A 3THTA 3GP9A 1QSOA 4LR7A 2A2CA 3UDCA 3CZXA 2B5JB 1RAGB 2DEJA 5J2QB 1SUQB 4NL5A 4TNUA 1S7IA 2Z10A 5K8PA 4CM2A 3F41A 2XYGB 4B3RJ 1X4AA 3NGUA 4OYXA 4PCQA 2XYPB 2HLUA 3HHLD 1HI1A 1Y0RA 4A39A 4USUA 2B5JA 1VHIA 3NY0A 1MNEA 4NLOA 2M8DB 1UJ4A 3D9BA 4BDPA 1Y5NB 4A94A 1YREA 4QIWD 4K3NA 3LGHA 3GSIA 2FHKA 3MEDA 2IAJB 3L95X 4LBIA 1ZAXA 5E3PA 3FJUA 1S49A 2U2FA 3VGTA 1QD1A 4CGLA 3WHIA 2HPUA 2OD4A 3LP2B 3E01A 3BO2A 5LYDA 1DY3A 4K4YA 2IQ6A 2NPIA 4DV5J 2O67A 1T9YA 2G13A 2QLFB 3H8YA 5FDLA 1J5EF 1M44A 1AA1B 1HI8A 4JP8A 5KFHA 1S0OA 1DHMA 2JLFA 1GYTA 2KJVA 1HNIB 2CZ9A 4M6HA 1U1NA 2FHJD 1P9YA 1RQ0A 4K8RA 4L75A 4C11B 1FJGJ 5SUHA 4CAXA 3W2VB 1Q8KA 4X5KA 4FYYB 3W9JA 5DWMA 3DLHA 1IUJA 4P2MA 1F1BB 2V77A 2DO4A 1TFWA 3RU0A 1AFIA 1XK8A 4E2FB 1WHXA 3PRTA 2YY3A 4EZ6A 1F57A 1VLYA 2Q7SA 5B0CA 2V68A 2C2ZB 2PO4A 3FB3A 3SBMA 3NE8A 4DV5F 3TX8A 3WDOA 4X4SA 3T1HJ 2OPPA 2HQCA 3AH6A 4NLPA 4E2AA 3D3SA 1BQMB 1CULB 3NBPB 4DL4A 4KGVB 2N4DA 2ROPA 3T90A 3K9UA 1GMVA 2M52A 4MAKA 2CWXA 2M70A 5D0GA 4OI6A 2GQQA 3I6PA 3OPKA 5H9EK 2ZH4A 3T1YJ 2OHDA 1O5JA 4LF4J 3CF5Q 2LQJA 2W9BB 2MLYA 4IK2A 2PR8A 1RTZA 3IM8A 2XGPA 3FVLA 4DNCA 1UCNA 3P2FA 3PTWA 4GVBB 4A46A 3T5JA 3KK3A 5JUMA 5F8GA 1OY6A 4IKAA 5L8RC 4C98A 4MKVA 2K3KA 5AXMA 2FHJA 3T1HF 4IAVA 3R5BA 5J8CA 4ID5A 2RKIB 2BO9A 1DFDA 4NA1A 4WKRA 3CC4S 1BO4A 3JAMY 1T94A 5EX3A 5D8NA 1UJ5A 3LD2A 1MROA 4CI0B 2HB6A 2E9ZA 3HHNB 2BCOA 1NUEA 3QPIA 3IAM9 1NSLA 2BRKA 1XWLA 2RF2B 5HQLA 3TO9A 1FDBA 2LFVA 2GO8A 2LLZA 4CCHA 1U1LA 2RD5C 3F0AA 4QWEA 4ELVA 5MAOA 1TXRA 2RC4A 3GCWP 1TL7B 4DX5A 3E0KA 1X4EA 1REVB 1PG5B 2PEHA 2HHSA 2DNNA 2KFZA 1Z8LA 4TNOA 4HNXB 3GSDA 4KOXA 2Y3YA 2G0BA 2DBBA 1RKIA 3MCOA 1T05A 3M2UB 2EK9A 2LU1A 3H2LA 1YGYA 5D8HB 3TWZA 4MJKA 4UEEA 1YJVA 2ZVSA 1ZAVA 2R8IA 3DXSX 1ARMA 5CYJA 1MN7A 1HHSA 3CCES 1SQHA 1PAUB 4TLRA 3BB5A 3MMBA 2FLNA 1YQHA 3W2WB 3L7UA 4W90B 4Y2MA 4DPOA 5DM7Q 1VQ9S 3NFZA 3PO4A 3ZTSA 2KRRA 2ZWPA 2KO1A 5IT0A 1TV6A 4DR2J 3N5BA 2FLLA 1KLMB 2FVRA 3EO4A 4DV3J 1D9DA 4EEYA 5AG6A 1PILA 1NKCA 4Q36A 3PDNA 5J2QA 3NCQA 1IXKA 4DV0J 5IM0B 3S9NA 1BAVA 3D7FA 1V3RA 4DL6A 4DXLA 3GG0A 1NPRA 4DR1J 2RRBA 2LDYA 1ULRA 2GHPA 3MAHA 4N76A 4HH1A 1U25A 3HSJA 3GV7B 2AJQA 3HPOA 2ZNYA 5I4MA 5CBMA 1IOIA 2ZM6J 2ILYA 3H25A 2HVHA 5L1LA 4PAAA 1SV5A 1YLOA 3TJ8A 2D3O1 2KFYA 4DL5A 2WOMA 3SFGA 3CD7A 3TARA 3AQPA 2DNPA 2DJWA 2AW0A 5AE3A 2RB7A 1AZSB 3GG1A 1JJHA 4BWMA 2PJ0A 3NMAA 3HMJG 3MM9A 1RTIA 1K44A 2F4VJ 2GIFA 2IAJA 3R9LA 4KT0C 3DU6A 1HNWJ 2HGLA 1CJVA 4WFXA 2KRBA 2MTLA 2YNGA 1XF8A 1QQ9A 2F9JA 4RW9B 2VOPA 2QN6B 1CP6A 4F9UA 1QAXA 2XWXA 1R31A 2YWWA 2HW3A 2DHXA 2YNHB 1XBUA 3HLPA 5CABA 2J9EA 4DSJA 4NGMA 5LYLA 2IM1A 1F60B 4KV8A 1T9XA 2I8EA 3VAKA 3WX4A 4WFBQ 2FIWA 3CCMS 4CLUA 5D4OA 2BJEA 1IWAA 1FY7A 4HACB 3E8OA 3EPGA 3SJGA 4OJ3A 1PKUA 3R7NB 3BZQA 2E29A 5F47A 3RBZA 4IDKA 1KHWA 3TC8A 4ILLA 4X2BA 4Q0BB 2JNJA 3LO3A 4DYOA 1NMTA 1YJRA 4B3SJ 2DXQA 4R0EA 2IHR1 3K2KA 4CO0A 1SC4B 4I1TA 3E2EA 2CQ0A 5LYIA 3FC9A 1V3ZA 5DGAA 3OLBA 3NNCA 2E7VA 4Y2CA 3HD1A 4N47A 3M1VA 1KNZA 3IG1B 2QFIA 2KKHA 5LYFA 1TR0A 3IJ3A 3BF4A 3M1VB 2DXDA 5M2RA 4UOGA 2DGQA 4ED2A 3TOBA 4UBRA 4U7CA 2EBGA 2DO0A 1XMOJ 2FJWA 2CAJA 3EMTA 4CS0B 2VD3A 2PFDA 5DO2A 3B8GA 3T8WA 3KXDA 4X64F 3HSDA 2F9DA 1XQIA 2GJFA 3LANA 3CCVS 2ZKUA 4OHWA 4WFYA 2Z3MA 3WC7A 2VPXB 2EWHA 4Y3CA 2FHMA 1NEEA 4RNMA 2GIVA 4RN7A 2X3GA 2HBQB 3SJFA 4ZCIA 2R7UA 3T6BA 3QFHA 2E9RX 3QO9B 4DJBA 5J2NA 3TQEA 4A33A 2ZPAA 4M5DA 3N6MA 4OLOA 2MKCA 3R7BB 3D54A 3UVJB 4P7TA 3KKFA 2WK4A 4PXCA 3BXMA 1MU2A 4RL1A 3H2UB 1WI8A 8ATCB 2XO6A 5HQ8A 5K14B 3UDVA 3C6TA 3BR8A 1S59A 4ALZA 1VOMA 2WZ1A 2CQ1A 3QQCD 5JGFA 2W24A 4QQBA 1S9EA 2XSJA 2BJ7A 9RUBA 1ZM9A 2B9YA 2HIYA 6FDRA 2MY7A 2HK2A 2DRDA 1TVRA 2OZHA 2QVPA 3CDAA 2UU9F 3I96A 2DR5A 3BSNA 1RWXB 3OXLA 1RDRA 5HMZA 3CEDA 4RX6A 2MZSA 3FSIA 4NRTA 3P6YC 4UWIA 3VWSA 2VA2A 4USMA 2GGPA 1TU0B 1MLAA 1MJ9A 2VZZA 1LWFA 2XI2A 1LXNA 1NO8A 5KFFA 5KOXA 4I7FA 1FRXA 4LREA 4TXSA 4ED6A 3H5ZA 4UQGA 4JXQA 3JTPA 4F3MA 4DL3A 3JSBA 1LWEA 4FBTA 2HEKA 4F8RA 2W2OP 3I87A 2DIVA 2C3MA 2P9CA 3IBCB 1PC4A 3QMQA 2HZCA 2VFSA 4J3GA 4OADA 2YH0A 1SJ1A 4C0OC 3PRDA 8AT1B 3I1UA 1N36J 4O3PA 3KLFB 2BRLA 3WC0A 4NCAA 2B5GA 1U2RA 4G1QA 1S1TB 4ZPTR 4U96A 5HLFB 1UW4A 3J7YI 1PO6A 3T5KA 4ANCA 2EW9A 3JYTB 2DKOB 4NCGB 3RW7A 4I64A 1VC0A 4YB7A 1C1CA 1R8BA 5D0RA 1FRLA 2XHCA 1NSKL 3JVNA 4KJIA 2HHPA 2LKZA 2CJQA 1OQ6A 2B3VA 3H40A 3FF3A 3LPYA 4ZPBA 2DR9A 2RS8A 3LAMA 2ZE2B 4AVAA 3RJMB 1S7KA 3UDEA 2HURA 3BKFA 1RLCL 2VQEF 2W7PA 1UVLA 2PVVA 2V2QA 3CO9A 2ZFHA 2F5GA 1LOKA 4J9SA 3MD1A 4U95A 1N34F 4UA3A 2CPEA 3IWGA 3J7YU 2YKPA 4LSLA 3CD0A 4KVXA 3DOLA 4KH1B 2OELA 4G1QB 5DS0A 4NLRA 5ETMA 1F5AA 1C0TB 2J7UA 1CULA 2ZEHA 1WSVA 1TL7A 4MCQA 2DGSA 5E3AA 1UWBB 4DPTA 2HFSA 3HZEA 3B3TA 1N6QB 2D9OA 4ZIVA 4H6ZA 3FJ2A 4F26A 3TNVA 4DUTA 2Y0BB 3R7SB 5D4LA 1GHEA 2FVCA 1EE3P 3GCXP 2UXBF 3M32A 4QUSA 5F8LA 2XEJA 3G8QA 2WONB 2CQ2A 4NASA 4K5SA 2UVVA 3ICLA 2KXNB 3I0RA 2GVDA 4DCJB 2NXJA 1X4FA 3EGWB 1Q8BA 1FKPB 1KQGB 5FJ4A 2HHHF 4CM0A 4MTPA 2MQLA 3U02A 4UCMA 2OPRA 1A6LA 3GMGA 2AFUA 5HN0A 3PYDA 2VB6A 3KHLA 1TUGB 1NSPA 4IFYB 5DGBA 1OY8A 4ZPDA 4MFQA 4ANDA 4ZCLA 3QBCA 2ZOMA 3AOCA 5CZVA 3QT8A 1CX8A 2YQ0A 1VQKS 2ZH1A 5CYQA 4AXVA 3HJVA 3HULA 3KI9A 4IOCQ 3W62A 3IWEA 4B3TJ 3PJXA 4V1Ak 2B8PA 1Q7YT 5LMNJ 4A8XA 3N6NA 2ZXVA 4FN5A 1VISA 3O1LA 1UMJA 4LF2A 1RTJA 1RU1A 2UV8G 1M1KT 5HMYA 3KMQA 1Q2CA 4IRKA 5L1KA 3DRSA 5KFCA 1I21A 4TU8A 2DVIA 2ZC3A 2B4UA 2VQFF 4F0MA 3W9IA 3HX9A 2AJ2A 2HSEB 4M85A 4URQU 1S6PA 4IDKB 5G22A 4XNHB 2XM3A 3BO3A 3LW5C 2KXHA 3G6YA 2NCKL 2YX7A 2I00A 2E5GA 4NMLA 1X4GA 1X8DA 3HCXA 1U24A 1NK8A 1HNWF 3ZTOA 1YI2S 1LFWA 2VZYA 2HHUA 2I5JA 3UQSA 1M1GA 3ADAC 3FBUA 1FT8A 3FMWA 1LOUA 4QZVB 2VC0A 1BWVA 4CAVA 1W25A 4XNHC 4RWWA 2AD9A 5DLGA 4J9OA 4HPSA 3OFHA 5GMEA 3PB7X 4L3KA 2C2NA 1ELLP 1UVKA 2MKHA 3HVWA 3W6SA 1HIYA 1CLFA 1Y5IB 1OYDA 1UAWA 3TVZA 1HHTP 5LRJA 2V9KA 4PV6A 3BN7A 3PM9A 2CZVC 2DHHA 5A8WA 4RPFA 2YKMA 4IOAQ 4R9MA 2AGQA 4X66J 1C0UA 4MYUA 2W25A 5HVFA 2UZAA 5BYSA 5CA5A 1GMUA 3R9GA 2DGUA 2ZEJA 3KFWX 3R5DA 3IWWA 1HI0P 2GV1A 2C27A 4ONWA 2ZBPA 3V5RA 2H4YB 2QL9B 4QBUA 1KR4A 5CAAA 1HQEA 2E5JA 5AE2A 2B3TB 4M5KA 1HR0F 3C16B 4OYBA 1M4DA 1NJZA 3VZIA 3OTOJ 5GADI 2YKOA 1PGZA 2VZ9A 4Q38A 2XCAA 3AJ1A 5C82A 1KOOA 2CA9A 3GJRB 2RU9A 1N5QA 1X5OA 2WOMB 2M8HA 2O53A 2GFFA 1UVIA 4Y34A 5CYQB 3CDWA 2DPTA 1QVFR 5CH7B 4C48A 4DUYF 3U27A 4TYAA 2B7BB 2FJBB 3AHPA 4Z2XA 3NG8A 4I4BA 2J8SA 1X5PA 3FGVA 4C0BA 1HR0J 2NSMA 4RW9A 2KZZA 3EVMA 2GE3A 2PA8D 5KT6A 3VALA 4LQ9A 3DLKA 1RHUB 4ECZA 5A27A 1SCJB 2HRTA 1FE4A 2E1PA 4ED3A 1M5SA 3KG0A 5E7OB 1ZTWA 2RNEA 1NDLA 4I6WA 1X31C 1ZLIA 1UFHA 5ETNA 1HW9A 2OMLA 2LP4A 3FDSA 2BKOA 3CIMA 3C2PA 5KFDA 2PQ8A 3D6TB 4JI7J 1RAIB 4XPDC 3SYZA 1EARA 4C8KA 3CB4A 1X4BA 4E8UA 2ZUAA 2VQYA 3MECA 1TL3B 1RT4A 1S6QB 1KWMA 1UVNA 4OJHA 1YZ7A 3RO0A 2OEJA 4J90A 1NK4A 4ECQA 1S1WB 2DPIA 4OYPA 3CD6S 5CYMB 4S0MA 2B6AA 2C2OB 4TN2A 2N3LA 1WF1A 3NOGA 5I0CA 2XB2D 2SXLA 2DK2A 5C24B 3ONQA 1WUUA 1VIXA 1JLQB 5LT5A 3DLBA 2P6SA 2FY8A 1RT6A 2W2NP 2EFVA 4ZBGA 4HKFA 3MECB 4R76A 2GJIA 3BGRB 4RNFA 1WTFA 4RNNA 2WBRA 4UOCA 5IZHA 4E8OA 1IKVB 4CGPA 3R3TA 1D8ZA 3M9NB 4K4VA 1CPSA 4MY0A 2FY1A 4JI8J 2W2PP 5D3GB 4O3SA 1S10A 3H4DA 2PE8A 4XPDB 4ZY0A 1C4CA 4MBUA 2DYAA 4IO9Q 1LW2A 3PW5A 3ZZ0A 4JI4J 2MHEA 7FD1A 1RXOB 1R0AA 5IC6B 2XMVA 3AQOA 4Y0FA 3KJVA 1VQNS 3SCIE 3IFEA 3HHDA 2YBVA 3MPWA 4HKQA 2M0GB 2R8KA 3U7JA 4Y65A 4C68A 3MEKA 2KHCA 5GAHU 4DEZA 5KG4A 3SSSA 4LF6J 3OTEA 2CQHA 1OIAA 2R7VA 1JLAA 3FCVA 3NXZA 1ZS6A 3HP6A 2JEWA 5T41A 2AJ0A 1N5VA 1S72S 1D0EA 4WIQA 4UOHA 4AQYJ 4HR2A 2IPOB 4MFPA 3CCJS 2Y1LB 3A9LA 5DJBA 4PQAA 4USVA 1ZA2B 3DLKB 4ZVHA 4JI3J 3HHKA 4KORA 3G8WA 4X8IA 3FYNA 4F4ZA 1NHVA 4C9DA 3DYAA 3CJ4A 4BLGA 1Y0HA 3FQKA 4C0HA 1T95A 4B5PA 2DEAA 4OI1A 1OWXA 4NI2B 4U7UK 2O1PA 2H4WB 2FVPA 2KI2A 5IX3A 3KLHA 3AA8A 4GXHA 2V8DA 3MR6A 4I49A 5JH9A 2MLZA 2NS1B 2H5EA 2WSEC 1WJ9A 1TKXB 3TUJC 4JV5F 5FLXY 3I31A 1U1MA 1AROP 4OMFG 4N8NA 4ICLB 3M6WA 2GNKA 4LBPA 4PWDB 2QA2A 1WEXA 1Y11A 4DV4F 5HVGA 1R0CB 3OXFA 4DS4A 3FRZA 3A8KA 2CNMA 2KG0A 3C16A 3HKWA 4JI2F 3FBCA 4MXUA 5DG9A 4OIXA 1S6OA 2GLJA 5DM6Q 3MR7A 4PPZA 1S97A 5ETTA 2JDDA 2G2ZA 2JJ4D 2DNRA 2CQPA 4ED4A 4EO6A 1R27B 1YHQS 2Q79A 2XHWA 5J1EA 1N5YA 4CRZB 3LP0B 3MOZA 1VQ8S 3VAGA 2ASJA 1S1UB 4M1KA 1JNZB 2QT7A 3SI1A 3MEEA 4OYWA 2ADCA 2B6AB 2JBJA 1BUXA 2RH3A 2IJZA 3IIBA 3H4BA 2W8KA 2JLEA 4JI2J 4YFUA 3MURP 1NKEA 3U1MA 4DV1J 3GE9A 2G2YA 1VC5A 2O01C 2Z3KA 3NGTA 5EBVA 3VHQA 1K47A 2IYIA 3LP0A 2ZW7A 1G6BA 4USKA 2MDAA 3RB4A 3SFUA 3CCUS 5EC4A 4F7VA 3VGVA 4TQRA 4KOWA 4AB7A 2JH3A 2ADBA 1ZA1B 3SJEA 4FNHA 2Z11A 3A4TA 4IHMA 2RFHA 1CG2A 2V4QA 3EWGA 2QSFA 5H9EJ 3W65A 3PX6A 4NGQA 3ZXWA 1S1XB 3T19A 2AFZA 3B82A 1UWAA 4ZJLA 2YNCC 1VRUB 4NZ7A 1YJ9S 2BQRA 1GQEA 5EN1A 3BKUA 1H3DA 1K9MT 1F6TA 2CFXA 4K2JA 3W9HA 3ZJ0A 3CPXA 4OZ2A 3D0HE 1RISA 4PRFA 4RS2A 4HLBA 1TFYA 2PD1A 1TL1A 5F9LA 1VGYA 2ROGA 1CJKA 4MK8A 1BHNA 1VQ4S 3ILIA 1FJCA 4ERDA 3BN4A 1KZFA 4KO0A 2E5HA 2ZBRA 2OPRB 4P75A 5ETKA 4KVOE 1T8EA 3MFHA 1D09B 5C88A 2JEIA 3H98A 3N0VA 3H2VE 4O0NA 3OWCA 1RTDB 3UO0A 4LFAF 2FTRA 2PIYA 2F8HA 2OPQA 5JVGQ 3GPAA 1VHFA 2J6UA 3JTNA 5FVJA 2OR4A 3DLEB 3LH2S 3PKMA 2XZWA 3D1HA 4UZBA 2Z2YB 3CXPA 1SI9A 3EVWA 3CJ2A 1EHWA 2LXUA 4K5RA 2BJ8A 3IM9A 2HVZA 3L7OA 3PXGa 4ZVGA 1ROFA 4C2YA 1IB1E 5MLCV 3OW2R 1ELMP 4G3IA 1BY9A 4P4EA 1WEYA 2B4BA 3GIMA 1NMEB 2NZCA 1F9EB 4H4KC 2I0XA 3PEIA 2KB2A 4KH0B 1FA0A 4DL0C 5KG6A 3EZOA 2EK8A 4MJ8A 1AMPA 3G4SS 3EX7B 4WYLA 1HQ2A 1UVMA 1GXUA 2ABYA 3B3VA 4KUBA 2B9WA 2GHVC 1L3UA 2CIMA 2KVQE 3P96A 3W6XA 3CDXA 3ENQA 3IWLA 4ED7A 3DRYA 4WP3A 1XNRF 4MHNA 4B9MA 2J9DE 5JMNA 2GQCA 3W7BA 4JV0A 2V69A 1R0AB 2JC1A 1HNZJ 4F4YA 4P4FA 3GIIA 4JWPA 2CNTA 4OX7A 5FLXU 1BPMA 3G6ES 1S3ZA 2F40A 2V50A 3DM2A 1NH8A 5A76A 1R7IA 1FKOB 3SXLA 4UFVA 3JSYA 4AYBD 4Q43A 1APSA 2QECA 2JL9A 4BS2A 4PKDB 4IF5A 3HHLC 2W2MP 4ZLJA 1RWPB 1F0XA 4KKOB 4O3QA 3RG6A 1KUXA 3MF5A 2LQ5A 5JPHA 4FXWA 5KFBA 2QX0A 5L39A 2KTQA 3M2VB 4DN0A 2HNZA 5GAGU 2GIRA 4LRBA 1VQPS 2MY8A 2N7CA 2FJAB 1RUSA 3DOLB 4X4QA 1B6BA 4OL8A 2EK1A 2IVYA 1N33J 3PYGA 4RZRA 1V5VA 1L3KA 2XSFA 3VVUA 2VBWA 4DPWA 3KLHB 3OFGA 2PVWA 4R8UB 2BJ1A 3OXGA 5AG7A 4K30A 3CPAA 1U26A 1VFJA 3M2VA 3GB0A 3GIUA 2E5LJ 2RKIA 3ZZTA 3T5LA 3D0IE 4B5PB 2BVZA 4OV1A 3K8VA 3UN2A 2B3UA 2L41A 1WG5A 3VQTA 4RU2A 3D6MB 2MXYA 1N8RT 1U6FA 1DTQB 5DDRC 3V4IA 1U1PA 3SQOP 2Z8QA 4DR4J 2OPPB 4FNIA 2RF2A 1UKUA 2V63A 4KGZB 2XWYA 3D7HA 5IWAF 2CADA 5H9FK 1K73T 2HNDA 3IRXA 1NPPA 3MUVP 4C3LA 4EO8A 4WZMA 4NLVA 2OFHX 3MWBA 4R25A 1RA7A 3IGNA 1QUVA 4EFDA 2C1CA 3GR1A 1T3NA 3F56A 2ZH3A 1TK8A 2AE6A 4ZVSB 4WE1A 3PRBA 3CCZA 3CDUA 1Y00A 3OV7A 3TAMB 5J2NB 1B0PA 3MGDA 3B7IA 1SKWA 2XMAA 1RTHA 2Q51A 1IKXB 4C4WA 2AIRB 5CHCB 4B9TA 1LEOA 3WQPA 3G2XA 2HZVA 5LRKA 2XYHB 2HS3A 4Z7YA 3M30B 4LRFA 1FHTA 3Q8UA 3F5BA 2YNFB 1S1VA 3U1LA 4GRSA 4B9UA 4RUHA 3LTOA 5EWGA 2XMTA 2HK3A 4HTIA 2LQ9A 2YWEA 1JK9B 2CNOB 4OZLA 1KVKA 3GYNA 3VZHA 2PFFB 5IV3A 3DRXA 2FVGA 2AWZA 3QWUA 1C1BA 2OFGX 3G82B 2MZ1A 1BQNB 4CLKA 3C6UB 2MLXA 3QAHA 1LWCB 4CGOA 5CD4H 3K9TA 4PG4A 4HI1A 4DV0F 1LKZA 1R3NA 1CC8A 1IBKF 3DRPB 4WU3A 1VHSA 5B0AA 4FF2A 2MQPA 4A37A 1FF2A 4F4WA 1UJ6A 3Q8YA 3KJFB 3CXSA 2K06A 2XTJP 2F7VA 1X60A 4IFVB 2QIRA 4ZHRA 4MKAA 4HVZA 1YGHA 1EETB 3GUXA 2OTJS 2BOPA 2I38A 1EB0A 2EUIA 3TE4A 3HF5A 3SSQA 1ZETA 3CJTA 3POTA 2ZBIA 4JLYA 3IU1A 2IRUA 3VVTA 2ALZA 3KHZA 4M63A 2Y1JA 4PQUA 1N5YB 2A6MA 4USHA 2FYXA 2ZEEA 2AZ3A 3N4WA 5DDQC 1M1HA 2R2TA 1U1KA 1RAAB 3C14B 3RRGA 4NLWA 4MCPA 1C0UB 4KV8B 2ERRA 2YKQA 4USTA 1WWHA 2J7WA 2N82B 3FNNA 3S1TA 3O2IA 3T9ZA 4B02A 2PRQA 1NBEB 2D1CA 4O4GB 4QYZJ 1U48A 1JNRB 4DR5F 4MYTA 2AYMA 4KFBB 3PBBA 2JZ5A 3KZWA 3DLGA 2MZTA 3V38A 3S01A 5L9NA 2FDNA 2VOOA 4ECRA 3GYAA 1FXRA 1W26A 2J0WA 1SJ4P 1TZ0A 2DCUB 1RT7B 2V4JB 4KSFA 1ZG9A 2Z4PA 2WONA 1B99A 3BPDA 2CTCA 1TKDA 3QZ7A 2PCUA 3NA6A 4MCSA 1RKJA 2MKIA 1RHQB 2ZJRQ 4AD6A 4OX9F 2B8QA 3BEGB 2D4PA 4CRJA 3M6UA 4C2MA 1YW6A 3QT7A 3NGDA 2HIQA 5K8MA 4IH5A 3RAXA 2ALYB 1M4LA 2C6GA 3DLGB 3RYOA 4KOUA 4UTGA 1PU9A 3AD8C 2ZVIA 1Z2LA 3BR9A 3AJ2A 3BBBA 4DX8H 2PMZD 2HWIA 4W92B 2FLPA 2OLWA 4URGA 2P6GA 1KLMA 3V8IA 2R7XA 5I3UB 4KSAA 2BZ2A 1FERA 4YR3A 1WF2A 4P44A 1FD2A 5FD1A 3HZGA 3G8SA 3NGKA 2YNIA 4DX6A 1HWJA 3KJVB 4H4KA 2F8MA 1DBDA 2FPHX 5EWEA 3CD5A 4ZP8A 2WBMA 3RB6A 4ZCMA 4LF9J 3R97A 5B08A 4LF8J 1FWPA 6AT1B 1CS4B 2JEVA 4RJVA 4CLTA 5F8IA 2RAQA 2HVEA 1NKBA 3R6GB 4PABA 1Z8WA 3K89A 1LW0A 1SKSA 1GMWD 4P9SA 3JRUA 3CCLS 2IDLA 1WC3A 2X1FA 1WC4A 1A7GE 3QZ8A 5L38A 3NKYA 1PC5A 5KFGA 5I42B 3KQZA 1RSCA 3MGJA 2J8AA 3RR8A 3CCSS 4A30A 1RHJB 3N9UC 1NAQA 1IQZA 1U45A 2PR1A 4KUAA 4BD9A 4ZVRB 3F73A 3TZYA 4NCGA 4YB1P 2F8EX 2AJFE 2J76E 4M95A 1Y9WA 4HEA9 4UOFA 4R8UA 1DTTB 3ULHA 3I9ZA 5D78A 2COLA 4P4DA 2FL4A 1B4SA 3PJ9A 2EWBA 3MFIA 3KJQB 4Y49C 2KL8A 2X7IA 2H5MA 3AT1B 4NA2A 4LRAA 3FEZA 2HFNA 4QYZK 4NLYA 4DOZA 2IA6A 1X4CA 2JSXA 4AFFA 4IRCA 1U1QA 3KK3B 1NCLA 4YQWA 5IQ6A 1TMJA 1U2FA 5KFXA 4TY9A 1T03A 1NLKL 4TQSA 1FTCA 2MSTA 2WSFC 2PJCA 3TTHA 4IQMA 2KT5A 1LCPA 3G71S 1SJ3P 3VAHA 1Q5YA 2W9BA 5C25A 3K17A 1JIHA 3KNGA 4ZIWA 3D4UA 1IWGA 2DNYA 2F65A 4IYQA 5L46A 1PYSB 2YTCA 1Z8TA 2FB0A 2WPWA 4EBEA 2FE7A 2OPSB 4FD6A 5ELYA 3QFWA 3MUMP 5K8OA 4UZCA 3OTBA 3TOQA 2AMCB 3SDEA 2ZC4A 4R8FA 3SXOA 3CDBA 2EFPA 3P2HA 3UCZP 1G1XA 5GAHI 4OHXA 4DSLA 3GJSB 4IUFA 2VBQA 2E44A 1DTQA 1AW0A 3KHHA 4LR8A 5E96A 2R8GA 3SEOA 4Z7CA 4LIRA 5B0GA 3W2VA 5IXUA 2QLXA 3MRUA 4UWJA 4FF3A 3G6VA 4B9VA 4XPEA 4OC1A 4HL9A 2VQEJ 1QJHA 3I82A 2CQIA 2IDEA 3GQCA 4DR4F 4F4XA 3CIZA 4KGXB 5H9FJ 1WOSA 3KHXA 5ETOA 2B4PA 2B7CB 4Y6IA 1NJXA 1I94J 4DPUA 4WK3A 2P6EA 2DPSA 2ZW5A 3F0NA 4ANEA 2I9SA 5CNPA 2IY5B 1CVJA 1MN9A 1KC8T 2AYGA 4A4JA 1S9EB 2XSJB 3KHGA 4K4UA 2CPIA 5KG3A 1QE1B 4XDCA 2DPJA 4M5NA 2CXEA 1TF8A 3PRVA 3NNAA 2E5IA 3I3GA 1RT1B 3A8EA 4DUZF 3ZZZA 3CW2C 2OKQA 4QYRA 2RQKA 2FIUA 2YWHA 5IB9A 4M5LA 2EC0A 3F44A 1W2BR 3WZ0A 5HQMA 4M5JA 2ZJPQ 2CZ4A 3NCPA 4OQJA 3TANA 2E66A 2QMWA 1JJ2R 1T02A 1VJWA 1S99A 1SKUB 1SXLA 3POTB 2MZRA 4DL2A 1NB7A 1RA6A 4BBHA 2PJ4A 1N0UA 1QLNA 2KU7A 3TA0A 1KN6A 2PT0A 4ZVOB 2NLWA 2HS4A 1IGBA 2HQDA 3DDDA 5KFUA 2XG8A 3D68A 2HRYA 2BW7A 4FYVB 2HYIB 2ZD1B 1E6YB 3D6HB 2FLOA 1S0MA 1Y3KA 4PYAA 4H54A 2VC1A 3PEJA 4RW4A 3N28A 2VIHA 4LIWA 1TIQA 3RB3A 2QIFA 2J0XA 1HL6A 4ECYA 2PJAA 1CQNA 2JC0A 5KFZA 3D1OA 4YWYA 2Z2MA 2EVNA 1R0BG 3RRHA 3GONA 4DF8A 3D2WA 4TYBA 4DR3J 3W60A 4Z65A 1UTAA 5E2QA 5L9XA 3DKDA 4CDIA 1VBXA 4ZA1A 3LOUA 3GV8B 4K0KF 3QAYA 1N36F 5AE1A 1SJFA 2C22A 3UW1A 1T9TA 4C7IA 3DDIA 2BA9A 4HACA 4QCLA 1YWXA 2GAGC 2VXKA 3Q89A 3OVBA 3M2RA 3K0JA 4OI2A 1RTDA 3TO6A 3H5UA 1R6YA 2HBYB 2DHSA 1XMBA 2Q3PA 1JLBB 2EG2A 2DNMA 1FJGF 4F2RA 2ATLA 1RLDA 5LXYA 4KSIA 3TUIC 1SV5B 5JQ4A 5D29A 2Z2ZA 5JJBA 2KVIA 2CRLA 3SDEB 1WHVA 2AFMA 3HVRA 2ZZMA 4L89A 4GO7X 3HFVA 3IGRA 4NXYA 2CPXA 1DTDA 4ZY2A 1RTIB 4GC7A 3DRPA 2ZW6A 4PR6A 2VPYB 4X84A 1P8GA 1C0TA 1OS5A 3H0PA 3US5A 3QJPA 4KHMA 1PAEX 1UZDA 2DCLA 3AD9C 4B9SA 4FBUA 4F3OA 1DAXA 1S1XA 1N34J 2V6AA 1FK9A 4QB9A 3UNGC 2JVOA 1HMVA 3MCSA 4PQUB 4WKYA 1VLOA 4U7UD 1F9FA 1EQ0A 1Y7RA 3LGMA 4KB7A 3PKYA 2CXAA 1Q16B 1TV6B 4OX8A 4HT5A 5D3GA 3MN8A 3PVXA 3Q0AA 2JEFA 1OQ3A 4WWSA 2AJ4A 1P4NA 3JXOA 5KTDA 1S5KA 2QZ8A 3RBDA 2V9WA 1DRZA 4AG7A 3QYYA 3OT9A 3IN5A 2IJNA 4NYOA 5T14A 1J4JA 2P5VA 3BV8A 4ZLPA 5JXSA 2PJ8A 4E98A 1TELA 1GAOA 3QB8A 1S9GA 3IR7B 2VHGA 2BYCA 2RDIA 5LJ3Y 1EKSA 1VQ7S 1YJ7A 3IS9B 4RLEA 4H6UA 3PNIA 4B9NA 4P2SA 1SH0A 4OZJA 2KG1A 2QA4S 3W1YC 2B4DA 1DQ8A 1CJVB 3ZZOA 4IFVA 5C2GA 4ECVA 1NRKA 3VAIA 1IBLF 4RBTA 1HA1A 4R0JA 2HRUA 4NZ0A 1PBUA 3EY5A 3OTCA 1CP7A 3DOKA 4RBUA 5E41A 5J1PA 3QGGA 4OIWA 1HHQA 4DG1B 2XCPA 1LW2B 4DR6J 4RI1A 4U6PA 3RZAA 4WTYA 4U9ZA 1I1DA 2RVJA 2CNSA 4XPCA 1S1WA 1F3FA 2H5JB 1U47A 2PSZA 2CPHA 5LMNF 1O8BA 3JSMA 4HTJA 4YY3F 5B0DA 2M7SA 1KQFB 3OL8A 2UVWA 2NSCA 4LR9A 2HG4A 2GGPB 3MEGA 3HM9A 2ZOGA 3Q23A 1HNVA 7AT1B 2U1AA 2BUEA 1DLOA 5K20B 3WR7A 1RZMA 3TZWA 5KT4A 5HROB 1SKRA 2VG6B 4DZ6A 2BL1A 2VA3A 2HNZB 3TUPA 4N5SA 3K5NA 1GX6A 4ZYQA 5K9FA 1Y4ZB 4XIUA 2VASA 1VRTA 4DPYA 4X65F 4ZVUB 3LMSA 2BDPA 4MFZA 3TAMA 4GS4A 1GK8A 3PV8A 2CTBA 2M3DA 3NS6A 3PBEA 4R57A 4DR1F 3TZZA 4A8QA 5EHHA 2B56A 2UP1A 4MT1A 1HNVB 2HWHA 3FFIA 3TQ1A 5J2MA 2VKRA 2I6WA 1N52B 3GJQB 1VQMS 3KLEA 4JI5F 4KHPJ 3ZNJ1 1ACMB 3ITHB 1ZZNA 4F0KA 2VBXA 1JWQA 3A3NB 4NSQA 2HMIA 5AG4A 1YVKA 2ZWOA 1S0NA 4QPXA 3KK2B 5THWA 4EBCA 1HNXF 2HHQA 3A13A 3SXNA 2K7JA 1SIWB 4MK9A 1UVJA 3GIRA 2C3YA 3QAUA 2W1BA 2GFQA 3B8HA 2HQIA 4AQYF 3E01B 2FVSA 3CCTA 1CQMA 4JBCA 2DH9A 2IJFA 3T5HA 1U6MA 4KHPF 2ANPA 3FEYB 3M7VA 3N01A 3D2PA 4DQQA 4U67Q 2HBRB 2WZNA 4LVOP 3OL9A 3K7RA 2ZEGA 4W9YA 3L9ZA 1MWZA 4KRWA 2CNKB 4QU7A 2Q4YA 4I56A 5KFPA 2ZBQA 4OMEA 5EDWA 4RU9A 2LVWA 1YBTA 1WHWA 4MIWA 3J81U 3MUTP 1VBZA 2X51A 2B58A 4C8ZA 1GMWA 3B2YA 1HFEL 4ZVEA 3MI7X 4ETZA 4OHYA 3C3LA 4MFKA 1EKRA 2MKJA 2PJ5A 4QWCA 4PSXA 3M6XA 4L3NA 3C8YA 1FNXH 3QGHA 2R1IA 5LXRA 3RR7A 4FPIA 4G65A 5J1QA 1T11A 5LMUF 1RTQA 2CNNB 1HBOB 4ZS6A 2R8VA 2MGZA 3R95A 1TL1B 4NLQA 2MYFA 2WSAA 2G2OA 5HP1A 3FECA 2R8JA 1OPIA 3I4PA 5G21A 3RUBL 4P73A 1URNA 1FKAF 2J6TA 1YVFA 4YHHJ 1TKTB 1RHMB 5E0OA 3TO7A 4TVAB 4LF7J 3CT9A 1RCOB 1VRUA 4YFJA 1TKTA 4ILMA 2DNLA 2VICA 4NMXA 2DB1A 2YX4A 1XR5A 2BJ3A 4OYMA 2JVRA 4GM5A 2EFGA 2KCWA 2UV8A 1BLUA 4UQTA 2UXBJ 3VATA 4B3OB 2HLTA 1S1VB 3H5XA 4F4KA 3I0SB 1JKHA 3UCUP 3H8GA 2EG1A 3DOMA 1PYOB 2DITA 1NDPA 2HHHJ 1AYEA 4ZHRB 1AUSL 4ZLLA 2V2VA 2R7WA 1WD6A 1KHVA 4DV2J 2CG8A 3PX4A 2CKWA 2GW8A 1K1QA 3LP1B 4KLWA 1HARA 4LMZA 5J1NA 5F3ZA 2HHVA 3BM7A 1TKXA 2QYGA 4CH0S 1ZO0A 1LWCA 3D8PA 1QE1A 2E7WA 1KFSA 1IOFA 3NWRA 4OI3A 4N56A 2PSWA 2XMJA 4P74A 4BC7A 1RT2B 1VR6A 3GTYX 1TKFA 4L74A 5KFRA 3GJTB 4BBYA 5KFEA 2GANA 3KOAA 4UCPA 2BANB 3WX8A 3NNHA 5DQGA 4A8YA 4WF9Q 1MWQA 4Q7AA 4X4RA 2W9AA 3PACA 1BMQB 2BW2A 2A4NA 5EX0A 4CTAB 2MQOA 5AJ3J 4P4BA 4DV6J 2HHXA 4W98A 1CJWA 3GFXA 2ZEDA 1X9WA 3M8ZA 4F02A 2ZDPA 2W7AA 1XR7A 1TAQA 3D2MA 2R98A 4OI4A 1NXIA 1XTZA 3QGIA 4TLQA 2QLJB 2H3EB 3KR5A 1DTTA 4UY85 5KFVA 4CLYA 4CRYB 3RW6A 2KYZA 4A8SA 2HKEA 4ZP6A 3D7GA 2IMOA 1RO5A 4KR0B 1UW9A 4WP9A 4XPLA 2CQGA 2VG5A 1VYAA 4DCOB 5EWFA 4ES3A 1FDDA 1AT1B 1ELOA 1UL3A 4IUSA 2BE9B 1DQAA 4KPCA 1S1UA 2HFUA 3DI6A 3OJSA 1IY7A 1JJCB 2NYIA 4RO0A 3KK2A 3K5MA 3PY8A 2KZMA 1M5VC 3HT0A 3BGFA 1PJ5A 3TAPA 1IN0A 4KIAA 3V6JA 2I1RA 4B11A 4DU7A 5U47A 5DG8A 3BDEA 2GJ2A 5E5NA 4UW2A 5KT3A 4NLTA 4UT4A 5KT7A 5F9NA 2E1AA 5KFAA 1VKCA 3M9OB 3MPVA 1VBKA 2P6TA 3R8YA 1ZG7A 5CPAA 4F4AA 3JYTA 3DRRB 3M8QA 2ZH7A 4LF5F 4LSNB 2LQ8A 3J80U 3VCDA 1YJWS 1P1LA 2BJ9A 1P1TA 4J5OA 1QTNB 3BREA 2PJ7A 4QIGA 5KFSA 2KXFA 3ZFVA 4JYAJ 2C2EA 5I42A 4DG1A 4O3OA 1M4GA 2GMHA 2W8LA 3MOJB 2EO8A 3IRWP 3M8RA 4YMEA 4QWAA 4UY8T 4NYPA 1SBRA 2AGOA 1H0HB 4A95A 3GR0A 2Y8YA 5H1SV 4HI2A 1OO0B 1YTYA 3P5BP 3TAQA 4IO1A 2IRYA 4F67A 2BXJA 1FRJA 4FVMA 2Z3OA 4CP5A 2BBEA 5KFQA 1JLBA 1YVOA 3HI9A 1W7WA 1AUGA 1YJUA 2DGWA 2ZDOA 2ZH2A 2C2KB 3NAHA 1N5TA 3TZXA 3PW4A 3PP9A 3IP0A 2NUHA 4A31A 4O0IA 2YH1A 1OSCA 3BQ1A 3M8QB 1YW4A 1EP4A 4PEOA 3W8PA 3UNYA 1IBCB 5DZ7A 4HH0A 1IBMJ 4CLSA 4DR7F 1FXDA 3IMQJ 1L3VA 1WELA 4F8ZA 2L9NA 2FXFA 4K4SA 3R1HA 1JLGA 1YJTA 4ZGYB 2IL4A 1NPKA 3PB4X 2F4FA 3PYFA 1WEZA 3TUZC 5B0BA 4GC6A 5D4NA 2RQCA 3WBZA 3NCRA 2AT1B 3FBEA 5F8NA 1URRA 3EZUA 4ZMMA 2RHSB 1QAYA 2MZQA 3G9CA 3KGQA 1NM2A 2QE5A 2J8MA 3IU2A 3RTVA 1OSDA 4JI1F 2J0QD 3R2DJ 1RGVA 3V6HA 2DGVA 5FIIA 1K0TA 3LP2A 2V94A 1IKYA 5CYMA 3P3DA 2VJUA 5K5MA 2CJ9A 1R8HA 3TA2A 2AYEA 2ZH6A 2LU2A 4M6IA 1H72C 3PG9A 3BQ2A 2HQYA 4CLZA 3LUYA 1VK3A 2VL1A 1SUQA 4ZPWR 5A8WB 3PW7A 4Q8FA 1Z8XA 4II9A 2EKYA 4L76A 5E3CA 1CPXA 4FYDA 3W61A 4DFPA 3D5MA 1F2OA 1QSNA 4CAFA 6CPAA 2BV3A 2FJEB 3A3PB 4YB5A 2W2QP 3MEEB 1D9FA 5M2UA 1Z4UA 2KDOA 3FX6A 2MZJA 4UFWA 2IRXA 3SZ2A 2A2DA 3EJMA 4NLDA 1IR0A 5A6PA 4YB6A 3WT4A 2CWKA 4JI1J 2OH1A 1NSQA 1MG7A 3PHEA 1TL5A 1H6KX 4OZNA 4YOEA 1LWFB 1SC6A 2MKSA 2LCWA 2NSBA 3DNCA 4DQIA 1CEZA 2PE3A 3MEDB 1B87A 3ISNC 2BANA 1VJQA 3UE2A 3C14A 3PB8X 3MCMA 4MMOA 2F4VF 3M4XA 4OV6A 2HFVA 2XS7A 4U9YA 4ILRA 2OU2A 3MR3A 2OZUA 3CO0P 5F0UA 2CQDA 3Q83A 4P52A 3OHAA 3UPFA 3L2NA 5KTQA 1ZZFA 3I0SA 5GMDA 1KQKA 4LQGA 3NAIA 1Q82T 4WPAA 1G4CA 1RCXB 3LAKA 4ZP7A 1HNZF 4LSZB 4ZVFA 2ZH9A 2R42A 1O51A 2MEWA 2C6PA 1JLGB 2CJBA 3H4QA 3PW2A 2ZUGA 2ZEOA 1AZSA 1Q7LA 1FD8A 3CTRA 1HDQA 5DLFA 2G1DA 3DMJA 4NLGA 5HBMB 3HO1A 1I1GA 4E0DA 1V3SA 1V0CA 1KSPA 2WCXA 2W4DA 3T41A 2EVZA 1SH2A 1ZOTA 4P6YA 2N7YA 2CVEA 1RYSA 4ZJQA 2GMJA 1X0FA 1WHYA 5DG7A 1PSDA 1XOVA 5D4PA 3HLUA 1TTHB 8CPAA 2YNHA 3L7PA 4X4UA 4JYWA 3WC6A 5HVHA 1CJTA 2MQMA 3A3OB 3QJJA 5GMKa 4JI0F 3NLCA 1DE4C 2XMMA 3PZPA 2QFJA 4F0YA 1F2PA 4FF1A 3IA0A 2XMWA 3M2UA 4N77A 2DT9A 1I6JA 5J8FA 4KPYA 2MJUA 4OYAA 2F1FA 2YNFA 3SV3A 4CYUB 4OC2A 2W4CA 1N5SA 3ETMA 4X4OA 3QLHA 3UWTA 1N54B 4NZ6A 2XNRA 3SIPB 2JEGA 1QY7A 2RSQA 1HWLA 4FPRA 3KUEA 6FD1A 3SCKE 3MMBB 4NGSA 4DV2F 4ED8A 4YP3A 3M8PA 1Y9KA 1RADB 3NOCA 2V2ZA 1KUVA 2Z0GA 3K2YA 1YRUA 4QVTA 3MXHP 2CDQA 2CQ4A 1RK8A 1IKWB 2CPFA 3TX0A 1NU4A 4LUBA 4A32A 2HAIA 4DJLA 1OY9A 3B4MA 1VCTA 4NJQA 3DLJA 5D15A 1NDKA 2HFOA 1S79A 1WI6A 1KONA 4RW7A 2UUCJ 3CPWR 1L5UA 2YKNA 3KDOA 1DURA 1SL2A 4UIAA 2YPZA 1VQ5S 3OJUA 1FRHA 1EX8A 7FDRA 1XJOA 2W01A 1RT3A 1WOOA 5AXLA 5A8KA 1RBAA 3WABA 1BQNA 3KASA 1H38A 5AJ3F 4JV1A 1QDUB 3FCWA 3H5SA 4OLPA 3CSKA 4DV6F 2XLJA 3M8YA 3AY0A 3IBWA 2DNKA 3LPEA 2OI2A 2XS5A 2HGNA 5ETSA 4RWXA 1FE0A 3KK1A 2V34A 4A47A 1XMQJ 1Q95G 2MKYA 1WKKA 3DC2A 3QAEA 1P27B 4IOBA 1D9AA 4ZX9A 2EXUA 2FT0A 2WB4A 5D0EA 3C19A 1JLFA 2JDCA 3VTIA 2E1MC 3Q86A 2IJRA 4YR2A 4IRDA 3W5XA 4H4MA 4Y2AA 3LWLA 5HJYA 4ZPAA 1JLEA 1M5KC 1VQLS 3DRRA 3TP2A 1VHEA 1YQEA 4OIDA 1T03B 1U0SA 4ZKAA 1YX2A 4YRHA 1U6BA 4Z37A 4L73A 1MMLA 1S77D 3F8KA 2P8IA 4NLUA 4NPOA 2XLKA 4UEZA 2LYVA 1M5PC 1VQYA 2LA6A 5E3RA 1YLXA 4QJVA 4C6AA 3HXMA 4X2TA 2DXEA 2J0SD 1IJEB 3MD3A 3NS7B 2FZGB 3TEHB 1NDCA 4I68A 2RQMA 2BQUA 3CXCR 1YZ6A 2MJNA 3PX0A 4NXNJ 1NZAA 4Q2LA 4FKYA 3QT6A 1RAFB 4E0AA 1Y7PA 4KO0B 4WZQA 4CYNA 3PB6X 4C3MA 4I2QA 1YK3A 4XAKA 3W91A 2DF5A 2C1EB 2GIQA 3KG1A 2V8VA 4HHJA 4KGKA 1KOHA 4N41A 3V6DB 3TVYA 2P0WA 4Q8EA 3OD2A 3BGUA 3EGZA 4NLSA 4A48A 1YKWA 1MK4A 1KLNA 5J2PB 2XC9A 4P72A 3BO4A 4JYAF 2DY9A 1S48A 1UEVA 2ATRA 1JQGA 4DV7F 3I32A 2G3AA 2CYYA 4DBQA 3MZIA 5KFWA 4URSA 3SCLE 3MDFA 2EK6A 1IR1A 5GAEU 1KVJA 4QR2A 5IB0A 3FBFA 1REGX 4C8NA 3JSMB 1H2UX 3BJ8A 3BDPA 2QYVA 5KG7A 1IYLA 1YX0A 3ENWA 2A3JA 4HDHA 4P6QA 1S57A 1M90T 3UI3A 1RAOA 3PGPA 5HK4A 1RYRA 3V6KA 4QBJA 3PR4A 2K2PA 4CYQA 4NEXA 2NREA 2HNYA 2G9DA 3DI6B 3HVTA 1K0VA 5HI7A 1H73A 2FC9A 1MWYA 4I0WA 4MHDA 5EGYA 2Y8WA 4JXRA 2FJVA 2NMTA 3GZ7A 5CCLA 2RDDA 1ZTTA 3FEXB 1U7LA 3D66A 3ET6A 3RAMA 4FWUA 2DD8S 5I3UA 3IS9A 2VFUA 1FKOA 3BH7B 4DFMA 2EEYA 1S7HA 3LACA 4TWEA 4C7QA 3OQ2A 2PRBA 2ZEPA 3MM6B 1HYSB 1V6HA 2J8NA 1RWKB 1Y5LB 3ZNUA 1Z5RA 1LQ9A 2NYHA 2CNLB 4ZX8A 4M5IA 4C97A 5A0YB 2D3OR 1RABB 4DSIA 2DHAA 2IVMA 3FK4A 2VDHA 2UUBF 3KUHA 3JQKA 4DV1F 4B3MF 4NCBA 1FNMA 4M3SA 2G9OA 2QYCA 4WTOB 4FDFA 4K7QA 5ETLA 1SL1A 2ZH5A 2LXFA 4DS5A 3QRQA 4IG3B 2KHDA 1T9UA 2PMWA 2XZDB 2DNHA 3DRSB 4ECUA 3ZO7A 4OZ3A 2AHOB 2KT3A 1J5OA 2LECA 2HWTA 4X62F 2WPXA 2Q4ZA 3MM8B 3OUYB 1XJWB 5C42A 1RAEB 3ZZRA 1VS3A 5KG5A 2B4OA 3UD4P 4DUZJ 2E9TA 4I6YA 4ZI6A 1S60A 3D67A 3QNWB 2CVIA 1XNQJ 1NK6A 4CH7A 1LNQA 3FCHA 2ASDA 4PWUA 3FZ2A 4NGPA 2ZBCA 2QSWA 2QL5B 4WCEQ 1Y9OA 2A0FB 1GFWB 1MJBA 5KG1A 3HD2A 3QRRA 2Z58B 1SL0A 2IBKA 5BYQA 2BKNA 3HFKA 2O28A 4WU2A 5DDPC 4M5DB 2CJKA 2XS2A 2RRAA 3TCVA 4X62J 1DZ5A 1UZHA 5AXKA 3HSGA 5I3PA 4QR0A 2Y1RI 4OC4A 5T7LA 1N71A 3N79A 5C5JA 2XY6A 1QAJA 2J8RA 4JZ0A 3ELHA 3KG4A 1CJTB 1XFOA 3K58A 1Q81T 3WC2A 5LJ5Y 4RW4B 5IM0A 4B10A 2FSRA 3QNVA 7CPAA 3B35A 2YPYA 1WC6A 2L3MA 3D0GE 1S6PB 5ISVA 3CJ5A 2XLIA 4UIBA 2KM8B 1XR6A 3IC1A 4C2XA 1UWBA 3DMJB 2J6SA 3I5BA 3PO5A 4Y28C 4R7MA 1OMSA 4FS2A 3V4IB 2RT3A 3H20A 3C15A 2O5DA 1N32F 2AZ1A 2LA4A 2EFNA 1X9MA 2MB0B 2OUGA 3PZJA 3ILLA 2UUAF 2RILA 1HPZA 2CG4A 3Q8PB 4P4JA 2MMYA 2C2RA 4HHHA 1M1DA 3AAWB 2AX0A 3H5YA 1QUPA 4U9RA 4MH8A 4ZN1A 1IICA 4IFYA 1O0PA 4DL7A 2Q7BA 3BLNA 3J7A1 3CUNA 4CO3A 1OPZA 4MKYA 1FX2A 1N56A 5BXIA 3TJ9A 1WTBA 3ZC4A 5LSRA 2G0IA 3TEGA 4MFBB 3PFEA 2Q04A 3B4DA 2V2KA 1LWXA 4RBVA 3THVA 3ENVA 3V6DA 3ZZUA 2XMUA 2QMLA 1PCAA 1T05B 1OBRA 2C28A 2NXEA 1SQFA 2JLGA 3QGPA 1T9WA 4O44B 4ZOSA 3J81j 5G4DA 2YWGA 3QSYB 4JOUA 2E7XA 3DGPB 1TUWA 4TY8B 2XZTB 3Q8RB 3W3SA 2K1RA 2LXIA 2AEFA 1QSLA 3O3LA 1K4JA 2JBKA 3G8TA 1UFWA 1X4DA 3JB9k 1YMEA 3B54A 4C8YA 3BJYA 1E6VA 3FFIB 4AT1B 5DRKA 3KTQA 2K3IA 2B9XA 1WDTA 1RHRB 3R6LB 1X5SA 2XGQA 4PXDA 2QGFB 4GKKF 2JFDA 1FXLA 1UEKA 4JJXA 1HBUB 1SQGA 4JB8B 1JLEB 2DRBA 3QATA 1QTMA 1Q1KA 1U1RA 1R8PA 1EP4B 4RNOA 4ID5B 3B3CA 2RDJA 2VDIA 3UDLA 4WYWA 3MTKA 2VFVA 1I3OB 2K7KA 1GXLA 3PFOA 4CAEA 2WTFA 3FMCA 2WAQD 1VHOA 2UUWA 2BQ3A 4Q45A 4TU7A 1QSRA 3KLGA 3ZTPA 1V9OA 4WFZA 5GAGI 2WSCC 1ZM3A 3L09A 4WXWA 3I0RB 2DNZA 4L8AA 1FCAA 5KFTA 1FFGB 1U8SA 2VG6A 2ZHAA 3KLEB 2IMWP 2M5YA 4H4OA 4H4MB 3GU0A 3VQSA 2EC2A 2OPSA 5KFIA 1JMTA 3CVKA 2VEZA 2AX1A 5KT2A 4B6ZA 4DCPB 4OC3A 4HNWB 4CLWA 5J2MB 2Y1IA 4KAIA 1Y0YA 2CY2A 4DLGA 1B7FA 3SJXA 3FRMA 3FEEA 4WXOA 1ZLHA 1P0HA 2IC3A 3R5AA 4LQ3A 4R3LA 1LK7A 2CPZA 1HLWA 2ZITA 2I79A 1OJ4A 4C8LA 1VQOS 2KFNA 4USIA 3DGPA 2BSWA 3LA0A 1EQMA 3EDRB 2QLWA 1N4LA 4JI8F 4DUKA 3T1AA 4UEFA 2GO9A 4CLFA 1T3OA 3D7SB 4FYXB 3OFEA 3GFYA 5LSLA 3RAQA 2HC9A 3GY9A 2LQBA 4GVBA 1Y3JA 4NXNF 1B3TA 2PC6A 3MEGB 2APOA 3FSXA 4DI6A 4ZVPB 3I5AA 2WRMA 1V5IB 1HQUB 1RXTA 4R3KA 4LUAA 2VV5A 4YUDA 3BSOA 3A12A 4F0XA 1NNDA 1HQEB 2WVEA 4KGMA 3T3FA 3UR3C 1KTQA 3UFCX 1X7VA 2VI7A 1LK5A 1U1OA 1NJYA 5A2QY 1IIDA 3LWUA