2V8DA

Crystal structure of mutant e159a of beta-alanine synthase from saccharomyces kluyveri
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
437
structure length
437
Chain Sequence
GTLNLPAAAPLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNAEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-ALANINE SYNTHASE
publication title Crystal Structures of Yeast -Alanine Synthase Complexes Reveal the Mode of Substrate Binding and Large Scale Domain Closure Movements.
pubmed doi rcsb
source organism Saccharomyces kluyveri
molecule tags Hydrolase
total genus 148
structure length 437
sequence length 437
chains with identical sequence B
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2007-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v8dA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2v8dA01
1AMPA 2PJBA 4MHZA 2BOAA 3D67A 4OC0A 3FECA 2QJ8A 3SJGA 3FEEA 2V8DA 2PJ4A 3WC5A 1Z5RA 3JRUA 3KHZA 4IAVA 3RBUA 3DLJA 1ARLA 3D7HA 5HXDA 2AFUA 3WT4A 4R7MA 1VHEA 3MN8A 3B3WA 5HVFA 3WC7A 4ZY0A 4PQAA 2DEAA 4P4IA 4R6TA 4MHPA 5F09A 4F8ZA 1M4LA 4P4FA 4A37A 2PJ1A 1IGBA 2ZELA 2PJ9A 3B3VA 4ZY2A 2Q43A 4NGNA 3PBBA 2AFXA 2POKA 3DGVA 5LYDA 2VL1A 4P45A 3D7FA 3FJUA 2V8VA 5J1QA 4UF4A 4ZI6A 1TXRA 3SI1A 3QNVA 2PIZA 4MHNA 4ZX8A 2C6PA 2G9DA 4MCPA 5ELYA 4MCRA 3N5FA 3SJFA 4MRIA 4OIDA 1JQGA 3B3CA 4OIWA 3IIBA 4ZYQA 3IO1A 1FNOA 2ZOFA 4K3NA 3B35A 1LOKA 2ZEPA 3FVLA 3KL9A 1UWYA 1XFOA 1CPSA 2PJ6A 2BCOA 4MCSA 2JEWA 2V8HA 1DTDA 1CP7A 1CX8A 4YWYA 1HEEA 3K2KA 2NYQA 3SI2A 6CPAA 1CBXA 4W9YA 4X8IA 4F9VA 1KWMA 1ARMA 3TX8A 2CF4A 4YU9A 2AFMA 2PIYA 5K8NA 2PCUA 2ABZA 3K9TA 4OP4A 3KGQA 3BI1A 2EK9A 2Q51A 5CBMA 2ZEGA 2HB6A 1XBUA 2ZOGA 3T8WA 5LRKA 4EFDA 3H8EA 4OC1A 2C6CA 2ZEOA 1LAMA 3D7DA 4NJRA 3B2YA 3IC1A 3H8FA 4OC4A 5HVGA 4GM5A 4P4EA 5JGFA 3LMSA 2PJ2A 4DUKA 4PPZA 3SJEA 1Y0YA 2O53A 4UEEA 1FT7A 3B3TA 3D7GA 3CPAA 1YW6A 2EWBA 4F9UA 4IK2A 5K8OA 3KZWA 1LCPA 5JH9A 3IEHA 5I4MA 2WYRA 2F8HA 1CPXA 4P6YA 3IWWA 2NSMA 3PB7X 2ZEEA 3ISXA 2PE3A 2V8GA 3B3SA 4UIBA 3BXMA 4X3RA 2OOTA 4P44A 3PB8X 3H8GA 3VARA 4OC2A 1R43A 4UEZA 3NH8A 4NGPA 2XEIA 3D68A 3TC8A 2RB7A 4OC5A 4P4BA 1LANA 2CIJA 2XEJA 4PXEA 1Y0RA 1YSJA 4NGQA 3GB0A 2BO9A 2PJ7A 5DS0A 3NH4A 3GLJA 4Z65A 1H8LA 4NJQA 1ZG7A 4X2TA 4NFRA 3MRUA 3NH5A 3VATA 2PJAA 2JBJA 4FAIA 4P10A 4MCQA 1TF9A 1PYTB 1Y7EA 5K8MA 2IMOA 1HDUA 1PCAA 1F57A 5THWA 3PFEA 4WWVA 2ZEFA 2V77A 1ZG8A 1F2PA 4KSIA 2ZEDA 5CPAA 1BPMA 4Q7AA 3ISZA 4FWUA 4EMEA 1YW4A 2PJ0A 4OC3A 3BI0A 7CPAA 1CP6A 2EK8A 3BHXA 4NGTA 2OR4A 1YMEA 4JZ0A 2HC9A 3CPXA 1AYEA 1Z2LA 1Z8LA 4H2KA 2PVVA 3S9MA 4PXDA 1F2OA 4LQGA 2C1CA 5K8PA 2PJ3A 3KR5A 4R8FA 3FF3A 3PFOA 1DE4C 2XEGA 3FX6A 1EE3P 1LAPA 2QYVA 1BAVA 3NFZA 3HLPA 2ZEHA 4P4JA 4NGMA 2GU2A 2PVWA 2GLFA 2XEFA 4MXUA 3LWUA 2IQ6A 1QQ9A 4DYOA 3KQXA 2CTCA 1RTQA 4B6ZA 4EWTA 3D66A 5D29A 3FMCA 4FBEA 1IY7A 2FVGA 4P4DA 3I1UA 3V38A 2WZNA 4OKOA 4UEFA 2AFWA 4CPAA 2ANPA 4R76A 4G1PA 1BPNA 5LYFA 4A38A 1ZLIA 5LYIA 5LYLA 3S9LA 3RAMA 3CDXA 3IJ3A 3WABA 1CG2A 5JM6A 4FUUA 2IJZA 3CT9A 1OBRA 4BD9A 3PRTA 4AXVA 3PB4X 1NSAA 3PB9X 2F7VA 1GYTA 1Q7LA 1TKHA 2J9AA 4A39A 4ZY1A 2O4HA 3SJXA 3SI0A 2GREA 2Q4ZA 3KHXA 4UIAA 3D4UA 4MHYA 1VGYA 4PXCA 4NGRA 4RUHA 1R3NA 1TKJA 8CPAA 2PRQA 3VH9A 2PJ8A 2ZEMA 1ELMP 3RZAA 3B7IA 2RFHA 1BLLE 3V7ZA 2CTBA 3FEDA 1QMUA 2PJ5A 3HUVA 4TNUA 2C6GA 3PEIA 3S9NA 3GUXA 2AFSA 1TF8A 1XMBA 1HDQA 2I3CA 3KI9A 4OMEA 1ZLHA 2GLJA 4MMOA 5LRGA 4PXBA 4A94A 3KASA 4NGSA 3NA6A 4TWEA 4ONWA 2JBKA 5IB9A 5LRJA 2AFOA 3PB6X 1YLOA 1XRYA 1ELLP 1TKFA 1VIXA 4DJLA 5HVHA 3KR4A 3KQZA 4JYWA 5D8NA 4WJBA 3IFEA 2PJCA 1VHOA 1XJOA 3WC6A 1ZG9A 2AFZA 2QVPA 3FH4A 1LFWA 4O23A 4ZX9A 2ZENA 3L2NA 3PBEA 4IHMA
chains in the Genus database with same CATH superfamily
3UNYA 2H4YB 3ICLA 3IM9A 4B08A 2GVDA 4F67A 2YY3A 4RW6B 2JVOA 3SI8A 2J8MA 3EPIA 4B14A 1JJ4A 3K8WA 2KHCA 2J0WA 2O28A 3DDNA 1Q95G 1FJCA 4WIIA 1RHJB 2NREA 4RNMA 2KZZA 4I2PA 1RTHB 3R8YA 2PJ1A 1S79A 3NCRA 3QPIA 2M2BA 2GW8A 4UQGA 5A8KB 3MEEA 1RWWB 3FBFA 2MDAA 5L1JA 4PG8A 4EK2A 4HYKA 2QZ8A 4L3NA 2R8HA 4AT1B 1QVFR 2OPSB 2E9TA 1OS5A 2RUGA 2KCWA 1NK9A 1CEZA 2OU2A 4A8MP 4EO6A 1ZZNA 1KOOA 4GXHA 2VUGA 2IC3B 2QSFA 2HBZB 1CPSA 3FCVA 5J1EA 4MK9A 4RLEA 1N5YB 1X5PA 1T3NA 2E5GA 1A2ZA 3LTOA 2KM8B 4BCAA 1KTVA 3F0NA 2DNGA 1RXTA 4F9VA 3D4JA 1MMNA 3RAQA 3VR1A 1H2UX 3ZTRA 5AXNA 1QSSA 1T03B 4F04B 4LBHA 1SIZA 5LRKA 3EX7B 4OC1A 2RKIB 5HMZA 4OHYA 3NNAA 1LAMA 3M2VB 2OELA 2ZH3A 3TANA 2JL9A 4LSNB 4OC4A 4IKAA 1UVKA 1SXLA 4P4EA 3QT5A 3DRYA 1L3UA 2ASJA 4DR7J 2O53A 4MJKA 4KS9A 1F0XA 3PJWA 3RBXA 4DZDA 4CZCA 4WZQA 2Y0MA 3CJ8A 5IC6B 2Q0YA 4B3SF 1BY9A 4PUOB 4DG1B 4ZVTB 3CWJA 3PG9A 1SCJB 2W2QP 2ZE2A 2IJNA 3TFYA 4FZVA 2DB1A 2G1DA 4H4KA 4RNOA 5HLFB 3JTOA 1BQNB 3BDPA 2V4RA 1SKWA 4PXEA 4RW8B 4H54A 3CDEA 1RAEB 2E1CA 3DN9A 1IKWB 3MM7A 3H4DA 3D2PA 3GKRA 3R7SB 1FRHA 1N48A 4E2AA 1QAXA 1N0VC 2L9DA 5A2QY 2FS5A 3HMJG 4AFFA 3TARA 5JMNA 2C1EB 4KSIA 1HIYA 1LFPA 1ZOTA 1BPMA 4Q7AA 5IB0A 4JP8A 3KHLA 4LQ3A 3OVSA 2EK8A 2CVIA 3M7VA 2AP6A 1RGVA 2CNLB 5KFGA 4MK7A 3PR4A 3J81j 3MAAB 3PKYA 2B4BA 2M0GB 4A46A 3QIPA 4EYHB 5F0UA 1F2OA 4YY3J 3H42A 4UWJA 1RU2A 2Z3LA 5KG2A 3FSIA 2OH1A 3PRVA 3CCUS 3MEGA 1MJAA 3LWUA 4I2QB 2P8IA 3NS5A 2YNIA 2W9BB 4EWTA 4M6GA 2JLEA 3AXMA 1RT1A 5IX3A 3G96A 5B0BA 3QAEA 2CQCA 3JSBA 4B12A 3GMGA 2G2OA 4NYPA 2OJ3A 2VDIA 4K4XA 3AQPA 4ELUA 1P8GA 1S1WA 4AVAA 2AZ3A 2QFJA 2N3LA 3BQ2A 2CQIA 2R42A 3G8QA 4ILLA 1RTIA 3DOKB 3FYNA 2NLWA 3MMCA 1RXOB 5EX3A 1YKWA 3CXPA 5F0WA 2XS5A 3H25A 1K8AT 5K5MA 2G2YA 3UPFA 2HQGA 3DLGB 4FDFA 4PXCA 1S7NA 4NASA 3WC0A 4C8ZA 4NXNF 1CJKA 4KHMA 1MG7A 5AT1B 2HGMA 4CNYA 5DLFA 3MM9B 1HD1A 1FWPA 2Y1RI 3BGOP 3CZXA 3RZAA 1KUVA 4OLPA 2GHWA 2XM3A 2A2DA 3EM1A 2DNHA 3QNWB 2YWWA 4ZMMA 2XMUA 2D9PA 4MIAA 3SCLE 1B70B 2DIVA 1FNMA 3PEIA 2Q3PA 2AFSA 2IL4A 1NBEB 2HHQA 1RLCL 3TAMB 2JJ4D 2BEIA 4J9QA 2XSFA 4QU7A 1TL1B 1SJ3P 3ZZPA 5KFWA 2PI4A 4Z7CA 4JI7J 1EARA 3HFKA 4MMOA 4B11A 1U49A 5CAAA 3S6FA 2YH1A 4ZJOA 3WX4A 3DRPB 3SYZA 1DURA 2J9DE 1D1UA 2ERRA 1WI8A 3RBZA 2GX8A 3QRPA 3UFCX 4DPWA 3CDAA 1HA1A 3VWEA 3IRWP 1ZG9A 2IFXA 4EBCA 3PBEA 2C3UA 4IHMA 4XPKA 2YKAA 5EDWA 3R5JB 4RW7B 4HHUA 1XMQF 4WK3A 3F5BA 2JRSA 3M30A 3KK1A 1RHMB 2JFKA 1EP4A 1YBAA 1JLCA 4CM0A 2KH9A 1VQNS 1NJYA 2QMUB 2HGNA 3C16A 1X4EA 4LRFA 3JQKA 4ZVOB 1F9EB 1XJWB 1NMTA 2D7SA 1Y9WA 2O66A 4R0EA 5T7LB 5KOWA 3ELHA 3QWUA 3PXGa 1S9GA 4ZVFA 4K4WA 3FJ2A 1KFSA 2PJ9A 4PABA 4ZK7M 5CXTA 1S1VA 3JUWA 3V4MA 4NEZA 1NDCA 4JJXA 4JBCA 4CLYA 1FCAA 3IO1A 3OL6A 1Q8IA 4PV6A 2RQCA 2IVYA 2G0BA 4CT9A 3KL9A 2VASA 3RAXA 4YN3B 1VRUB 4GKKF 1FX4A 3SQOP 4ZLPA 4QW9A 3EWGA 3MCSA 1CP7A 4YDDB 3DU6A 1NSPA 2CDQA 2UUAF 3FBCA 4B17A 2G4BA 2QGFB 3G8SA 2GMHA 4UOHA 3KK3A 3ZC4A 2MGZB 2CJBA 1ARMA 1X0PA 2ZH4A 2PA3A 5GVQA 2VJVA 5LSLA 7FD1A 3D28A 4C2ZA 1M5PC 2GVDB 3CF5Q 3RW7A 2Y0SD 4OZ0A 2WW4A 1X7VA 4DMZA 3C6UB 1M5VC 3H8FA 5HVGA 3BBCA 3M2RA 5E5NA 1UVIA 4NLQA 4P2XA 3SJEA 4I2PB 4X66J 1SH0A 4P72A 1Q79A 4DR4J 4U9ZA 5HP1B 5M2RA 3QAHA 2FCKA 2ZC3A 3T90A 3BKUA 3OL8A 2LVWA 4UBRA 4ZLLA 1T8EA 2BM1A 2Z2ZA 1S1TA 3LP2A 3E3XA 3TZWA 4ZCMA 1I21A 1F2GA 1AUDA 1HBNB 4AG7A 3UO0A 1GQEA 4M3SA 1RT4A 1UVMA 1E6YA 4M5MA 3GJRB 5DG7A 2ZWPA 2V94A 3LODA 4KRWA 5J1EB 3T1HF 3NGSA 5A6WA 5HROB 4N7TA 3VVUA 4JXQA 2ZWOA 3WIUA 2Z3OA 4M5IA 2PJAA 1IBLF 4X84A 3NGTA 3R5AA 4K5RA 2UXDF 4O44B 4NZ6A 4ZCIA 2OPQA 3KLEA 2PC6A 1GX6A 2KDOA 4FS2A 2HV2A 5IOLA 3PX0A 1SJQA 1FD8A 4X2BA 5H9EJ 3GE9A 1TP7A 2UXBF 4ICLB 4UY85 3OLBA 4NA2A 1DTTB 1RSCA 2OD6A 2PR1A 1G4CA 1AROP 4J9MA 3UE2A 2XEXA 2PJ3A 3KR5A 1S57A 4USWA 2BQUA 1HLWA 2DR7A 2XEGA 4CTAA 3P96A 1YHQS 2C3OA 3CCVS 4F2RA 1ZA2B 5CZVA 1TK0A 4P7VA 3DLLQ 2ZHAA 3ZNUA 2QL5B 5D29A 2VONA 5HL7Q 1UJ4A 2P0WA 3IGVA 3I1UA 2QO3A 4LRDA 2CQDA 4N47A 1UFKA 2ZE2B 2IAJA 3VAJA 1CM0A 3B8HA 4OL8A 2Q4VA 3L9ZA 2VQFJ 3R27A 5KFAA 4CYQA 4X4VA 1BXNA 1HPZA 4LSLA 1R27B 3BDEA 2CG8A 2FZKB 3MM7B 3I5BA 3GIIA 4Q2MA 1TL3B 5AXLA 1NSQA 4ZVRB 1NH8A 2O4HA 1Z8XA 4IF5A 2RIJA 3UN5A 2KT2A 1FJGF 2A18A 3NRBA 4DCOB 2HNDB 2Q44A 2AJ2A 1OWXA 4O3QA 4ZJQA 5IWAJ 3UR0A 4JI1F 4UCMA 3VH9A 1FVSA 4GVBA 4BHQA 3LF0A 2M8HA 1WELA 2R7TA 2DGSA 3D1HA 3QIPB 2YNCC 1B7FA 4NCAA 4TNUA 4TQSA 4PG7A 5FLXU 2DISA 1Q7YT 4JD6A 1E6VA 2V68A 2VFRA 2C27A 4KSFA 3GJTB 4OI1A 1SC3B 2BJ1A 3RB4A 3TJAA 4C8KA 1B7YB 4IFVA 2EG2A 3G87A 2YNIB 1WEZA 1T94A 3CUNA 3V81B 1WC5A 4ZCLA 1RT1B 2XG8A 4ANEA 3GFYA 2W4DA 3T3FA 3AFGA 2G2ZA 4U6PA 4JYWA 2WPXA 4USUA 2HS3A 2HIQA 2VOPA 1HYSA 2Y8YA 4RW9A 4ZLNA 1U1PA 4O0NA 4ZX9A 1VQOS 3T5KA 2KZMA 4C0OC 1S1WB 4A4JA 2PDOA 5JVGQ 2FUG9 3BPDA 2HURA 1YI2S 5KFVA 1DFDA 3D67A 3FECA 1RTIB 5EUHA 2A1BA 3MMCB 2FIUA 2M7SA 3WC5A 4W4MA 3RBUA 1ARLA 3OFHA 4OYIA 2LQJA 4DR3J 4ED7A 3MN8A 4LQ6A 3BR9A 2MKHA 3ZNJ1 3HK2A 2RVJA 1RACB 1CJKB 3K5PA 1D9DA 3B3VA 2Z3MA 2AFXA 1RQ0A 3R9EA 3S6EA 1NUEA 3QNVA 2A6MA 1Y5LB 1S9EA 1VK3A 2GE3A 2GQQA 3MFIA 2G9DA 2VBQA 1NKBA 5C25B 2QSWA 2AJ4A 4YGOA 3HKWA 2HAIA 5J1PA 4LFAJ 4DHVA 2XS7A 5H1SV 3D6HB 1RKIA 4DL0C 4NLPA 4E0DA 2PJ6A 3BM7A 2BCOA 4GC6A 2K2PA 2H48B 2OH2A 1CX8A 1FRKA 2YBVA 5A8WB 4MFQA 2WVBA 2MTLA 4UZCA 2NYQA 1BC6A 1NJIT 3KLGA 4PRFA 3O6QA 1ZTWA 2IDLA 2VDHA 4XPDB 1YZ6A 2W01A 2EFGA 4BMHA 3LD2A 4R5PA 4UFWA 4XIUA 3TVYA 3H8EA 3M30B 2C6CA 3KK1B 4LF4F 2MKJA 2VFSA 4D3GA 4FF1A 3W3SA 2HVIA 3C16B 1N5SA 1HBMA 2BANB 4EO8A 3OTOJ 3NP5A 3K89A 2QYCA 1S6OA 3OT9A 3HJVA 1S9GB 1T9YA 4CO2A 3EZ5A 4MTPA 2ZBCA 3R5DA 3CJ5A 2ZJRQ 2DPIA 5HJYA 1S1VB 4NOHA 1FKOA 1TMJA 4P73A 2FVCA 2VKZG 1URRA 4F7VA 3Q23A 1F3VA 4LBIA 4K4UA 5EWGA 4F0MA 4X4UA 4DOZA 4LF1A 3BJYA 2YNDA 3GV8B 3D68A 2CJXB 2NXCA 3S1TA 4KGMA 3UY5A 3GV5B 3KDNA 1U2FA 2AIRB 4LF2A 3TWZA 5AXMA 3C2PA 4NJQA 1ZG7A 2R9LA 4M5DA 1XEBA 1Y10A 1GTHA 2B58A 2RRAA 1U26A 5B0FA 4RZRA 2UP1A 3DU5A 4JI2F 2EFOA 2QLFB 4NXMF 4ED8A 2CZVC 1SV5A 4FF4A 4WWVA 4QBJA 4IO9Q 1U47A 4IR9A 1KVJA 2HVHA 4RUAA 4KUBA 2JSXA 2BV3A 3DLEA 3Q22A 5HMXA 1SL2A 3PZJA 1FKAF 2HQ3A 1CLFA 4TY8A 4PR6A 4PXDA 1NPPA 2JOQA 3M2RB 1EETA 2MXYA 4ED4A 2CNKB 4QZVB 2JEJA 1HHSA 1QUPA 4FD7A 4A8SA 2JEFA 1H0HB 2UUWA 1H72C 2YKOA 3IAS9 2AYBA 3TX0A 4OI0A 1T9TA 3L09A 3TRGA 2CTCA 1KBRA 1S1TB 3LP2B 4HLBA 4FVMA 4Z2XA 3IN5A 5EWFA 1ON0A 3R2DJ 3MEKA 4RI1A 3NEKA 3H20A 1RT4B 3QO9A 1YJWS 2JDCA 2G3AA 1FFGB 3CTRA 5F9LA 1E6YB 3QZ7A 1Y7PA 5F47A 4JI6J 4HACA 1R31A 4CGOA 2E66A 3BBFA 4EZ6A 1U0SA 2VG7A 4DV3J 4WBFA 1YLXA 3H5XA 2JX2A 3CJ3A 5C7PA 3NCPA 3NKYA 3FMWA 4C3LA 1PSDA 2R7VA 3KHXA 2VA3A 1VGYA 4NMXA 3ZTQA 3KLEB 4TVAB 2VKRA 2K7JA 4G65A 2M4MA 3MECA 4FKXA 4FPIA 3PYEA 3ENVA 2X1AA 3FEDA 1AFJA 3R5BA 3GUXA 1GXUA 2EFPA 1FK9A 2R2RA 4CTAB 1HDQA 4Y3CA 2PT0A 2Z30B 2XMKA 1RTZA 5KT5A 1FO1A 2XS2A 2EI5A 2B9XA 1FXLA 4A94A 3VGUA 3KUHA 2HYIB 4ONWA 4DL4A 5IB9A 4IFYB 2LU1A 2XMWA 2BJ3A 4MKAA 4M5HA 3MGDA 3R96A 4ZVQB 3GSIA 3HZEA 5J2MA 1SJ1A 3OR2B 2Q04A 3D3CJ 2YNEA 1TELA 3BQ1A 2J6TA 2XMVA 1X31C 1VI7A 3UQSA 2CVEA 3EXNA 4RO0A 2DNRA 4WXOA 3RJMB 1HPZB 1YJTA 4LSLB 5J8FA 1CJUA 1MMLA 4IH5A 4ECVA 2KRRA 4DV7J 4GS4A 4Y65A 1GNKA 2XZTB 3WC7A 5G4DA 2LA6A 2XMAA 2JWNA 3JTNA 5DJBA 5D78A 1VQ4S 1EHWA 3U1NA 1B64A 3DLBA 4IH7A 2I2YA 4CLWA 1IGBA 2DXEA 2YH0A 4ZY2A 3X3UA 3GCXP 1XC9A 2VL1A 2OSQA 4DCJB 4LR9A 5AG7A 4V19X 5CCLA 1WSVA 2RQKA 4B3MF 3VAGA 1LQ9A 2AZ1A 1XTZA 4MCRA 2F4FA 4OIDA 5KFKA 3OTBA 2UV8A 2MY7A 4NLGA 1E6VB 2DNYA 2ZVSA 3FVLA 2K3IA 4DEZA 1FJEB 4H4OB 1DJ0A 2BJEA 1RTJA 1FDBA 2QMLA 4PZVA 3GG1A 4YB7A 1S10A 2PMZD 2EBGA 4MYUA 4QQBA 1Q53A 4LF8F 3HCXA 3K5MA 3K2KA 2V67A 2ZKTA 3QGIA 1SUQA 2LDIA 3K57A 3VZIA 4ZHRA 1I5OB 1SPBP 2HQFA 4M85A 2H65B 4LSZB 5KT6A 3F73A 1HNWJ 3NWGA 3QQCD 4Y34A 1TQLA 1AXQA 2FLLA 4B5OA 1VRQC 1VHFA 4ZPDA 4EVYA 5G20A 1IKXB 2N82B 3BREA 4NYZA 1QAYA 3KLIB 2ZEOA 4MFLA 2H54B 4HHHA 3DC2A 2FGOA 4WE1A 4ZVEA 1BMQB 3FDSA 3CDWA 2QL9B 4JYAJ 5C42B 1D3WA 2ARHA 1Y0YA 3DSBA 3VF0B 5B0CA 4C0HA 3EYZA 4M5GA 1YK3A 4FD6A 3WR7A 2VPYB 4DQQA 1Q81T 2J9DA 4O3RA 4R0JA 4YS2A 5JH9A 2X7IA 4QYZK 2WB1D 4CIOA 4F0KA 4B13A 4P6YA 1NLKL 5EHHA 4CH7A 1VQ5S 1PBUA 3OUYA 2DGTA 1RHQB 4ZCKA 2HBYB 4EFAC 3PB8X 3UCGA 1WC0A 4Y6IA 3EE3A 3M4XA 3GQCA 5KFHA 2XEJA 4ILMA 2O01C 3QSIA 2Y1LB 3MD3A 1IU8A 1HWIA 3NH5A 8ATCB 4M6HA 2Q1LA 1U1MA 4F3OA 2XNRA 2FIAA 1N33J 4DV6J 3PACA 4L8AA 3BSOA 3UDVA 3H7HB 4DX8H 3W2VA 2ODFA 1SJ4P 4YY3F 2OSRA 4JV1A 4X4SA 3AA9A 3BHXA 3SCIE 2G0CA 3RR8A 2BVZA 2EKYA 3GU0A 4DSJA 3S9MA 1HBMB 5ETVA 3PFOA 3Q8QB 3HSGA 2QYVA 4DSFA 2GO8A 5DM7Q 3J7A1 2OPRB 4Z7YA 4NEXA 2MKYA 1UETA 1IKYA 2XB2D 4NLXA 4MXUA 4Y0FA 5CD4H 2XGPA 4ID5A 1U8WA 5J2QB 1FKOB 5HQ8A 3H0PA 4EUVA 3W91A 1X4FA 2FVGA 1TK5A 4YR0A 4C8OA 4RBUA 2AMCB 3EVMA 3VQSA 2B8PA 4E8OA 3NOGA 1NPKA 2EEYA 2QIFA 4KGVB 5LYIA 3M05A 2OAUA 3AOAA 3P4UB 4V19J 1T05A 1CG2A 4Q38A 1UL3A 2RDJA 4FUUA 2I79A 3CW2C 2F8MA 2X51A 4M5DB 1R8HA 1JLFB 2VQEJ 1HFEL 1NCLA 1HHQA 3PCOB 1U6ZA 4Y49B 1N4LA 1QSRA 2V5HG 2E5LJ 1ELMP 4TU9A 4X5KA 1QTNB 4EU0A 1JXLA 4TY8B 2AJ6A 2MZRA 2OPPA 2H5EA 1YVFA 4DR2F 2RDIA 2DR8A 2IDEA 3GILA 1EETB 2HIYA 2XMJA 2H5MA 1XMBA 4FD4A 5K9FA 2AEMA 6AT1B 3IS9A 1RWKB 4IDKA 5HSPA 1XBWA 1URNA 5EMIA 2B3UA 2AYEA 3KHHA 2CFXA 4FP9A 3BGLA 4ZVUB 1J4JA 3KQZA 2CJKA 1WG5A 2P2CB 4A8OA 1LWEA 2JLGA 2GHPA 3CDUA 2QA1A 1LFWA 4HHJA 3EICA 1QSYA 2NCKL 4OJHA 4HACB 2BJ7A 3NCQA 2ZW7A 3AXKA 3Q2SC 4OC0A 1NEEA 4AL5A 2VG7B 1B0TA 1RWMB 4QJVA 3D5MA 2NYIA 4KH1B 3TJ9A 3M8WA 5HVFA 3CEDA 4X4NA 2ZW6A 4MHPA 1F9FA 1LXNA 5CQGA 5I42A 3R9GA 1PAEX 4Q2LA 2IM2A 2P9CA 3LALA 5L46A 3EZUA 4PKDB 3DGVA 4O4GA 3GJQB 1RHUB 3ZZOA 1KD1T 2QLJB 3MECB 4P45A 2AYGA 1DQ8A 1FDDA 2E7XA 3AD8C 3QLHA 4DL5A 4KSAA 4OIWA 3BS9A 5E3QA 1FK9B 1HQUB 5DDPC 4NSQA 2AJ1A 4Z37A 1EJ7L 4DU8A 4A31A 2E44A 4F3QA 1XE4A 2CQ3A 1VBXA 4F4YA 3M2UB 3H8YA 2W2PP 4MCSA 4G1QA 2DXQA 2D4PA 2GIFA 4LQ9A 4WFXA 3OJSA 1H74A 1KLMB 4IYQA 5D6GA 3DI6A 5J2MB 3N9UC 1KWMA 2W4CA 2PIYA 4HDHA 2PCUA 1PILA 4A48A 1KDNA 1RT2A 1VKCA 4OI4A 3PJ9A 3PYDA 4LVNP 2XI3A 1CJUB 1I94F 1SB6A 1ZBTA 3W8GA 1UJ6A 1HWKA 5HMYA 4LIRA 3PNIA 2Y0BB 5E33A 4RW4A 4K30A 2IY5B 3OFEA 3LMSA 3TA2A 2UVRA 1DRZA 4UEEA 2CJQA 1G1XA 4EYIB 3D7GA 1S49A 1S6PA 1DQ9A 1FESA 2HLTA 2QEXS 1HI0P 4M5JA 2ZEEA 1L3VA 2FSRA 1U1LA 5KT4A 1Q86T 3ISNC 8RUCA 4X3RA 2HFOA 1TUGB 2MQLA 1WC3A 1LANA 2NPIA 3TZYA 4LF6F 2PJ7A 2ASLA 1RTJB 3FB3A 2R7OA 1L0CA 3MRUA 2ZZNA 2FL4A 4DBQA 1S5ZA 2YWFA 1NDLA 2ZC4A 5L38A 4Q0BB 2J9CA 3MM8A 3I3GA 3MR2A 1SUQB 4X4RA 2RC4A 2PSWA 1GXTA 4DFKA 4ZHRB 2XO6A 1DLOB 3OJUA 4DR6J 2ZH8A 3A8EA 1Y3JA 3CD7A 2ADCA 5CPAA 2CNTA 2OZHA 5F8JA 2BW2A 3HHLA 3WDOA 3W60A 2PFFB 2ALZA 3P5TL 2XZWA 1AYEA 3ILIA 2V6AA 2CWXA 5H9FJ 1VHSA 1LW2A 1YLEA 1Q2CA 2PFDA 4PG6A 1TV6A 1LAPA 1R6YA 3O5TB 5KFSA 1PJ5A 3TQ1A 4FXWA 4UUXA 1IR2A 4B3TF 4O0IA 3LO3A 4HT7A 1FY7A 1QQ9A 2IQ6A 3KJNB 3N6NA 1RBLA 2N4CA 1PO6A 2VQFF 4LREA 2MJNA 2W7PA 3D66A 4YB1P 4KJIA 3FMCA 5KFPA 3OUYB 4IO1A 4OKOA 1IBMF 2DHXA 1RE1B 1HR0J 4CPAA 2ANPA 1NM2A 1RJJA 2VEZA 4J7CA 3CJTA 1SBRA 4H6ZA 5ADZA 3B4MA 3MTJA 4KPYA 2QFIA 4RUBA 1VK8A 1RAIB 5IQ6A 5E0OA 4P75A 4MKBA 5A76A 2DNMA 3PW4A 2NUUG 4I7FA 5IWAF 4M94A 4P2SA 4W92B 4ZY1A 1YK9A 4F4WA 1JXEA 4BBHA 1IBCB 3NS6A 1OYEA 1RI7A 2CADA 1TKJA 1UEVA 3A3PB 1MN7A 4K8RA 2FHOB 2GJIA 4CH1A 2DNLA 1FE0A 5DS7A 2RFHA 3QGGA 6FDRA 2H9ZA 3RRGA 2XTJP 3EY5A 2GMLA 4U8VA 4KB7A 3HUVA 1H3DA 3S9NA 5F3TA 2DRAA 3DDKA 1QJHA 1RT7B 3E01A 5ETPA 4KOXA 4KVME 1MWZA 3KLHA 1P1LA 5DDQC 5MLCV 3PRBA 1XMOJ 4ID5B 3AD9C 3M6UA 1WOPA 4HTIA 2VICA 3PIOQ 2B4DA 5FLXY 4HH1A 2V4JA 3SCKE 1LRZA 2X3GA 1RT5A 1UEUA 3E8OA 1WEXA 1NPRA 1Z9UA 2VQYA 5IM0A 2QA4S 1B99A 2BW7A 4M5KA 4QYRA 1K44A 1K47A 5KT3A 1WHYA 3CVKA 2L08A 3TVZA 1T05B 1TU0B 3W5ZA 5K20B 2HFSA 3BGUA 1FDNA 1VFJA 4CAEA 4OX9J 3C6TB 4TQRA 3D2MA 2LKZA 1KRPA 4IAVA 3ETMA 3KLVA 2BRLA 4DV5J 4P4IA 4R6TA 1G7CB 3CJRA 3IAM9 4P4FA 2WHOA 4A37A 3GSDA 3UWTA 4N56A 2R8IA 4DL3A 1C4AA 5J2NA 1O6XA 4URGA 4HEA9 2X7BA 4OAEA 1HWJA 4LFAF 3RB0A 2CNMA 2QECA 3PDNA 1UA1A 2DKOB 4CP5A 2MQQA 3DLKA 2XC9A 5JJBA 3B3CA 3QJPA 3IIBA 1FNOA 4KE5A 4K3NA 1LKZA 3NNHA 3IS9B 4D3HA 4OV6A 4IDKB 2XGQA 4IRKA 2DR6A 5DDRC 1HEEA 3IRXA 2VZYA 3R3TA 1LWEB 2FHJA 2HZCA 3TX8A 3HT3A 5A8RA 1RWUA 3ISND 4DUZF 3FBBA 4B3OA 3K9TA 3UR3C 4YR2A 3OTOF 1FEHA 1JLBA 1A6LA 1FXRA 2HFNA 4K4TA 3AJ2A 1UW4A 1BWVA 1WD6A 2QLWA 5B0AA 4GM5A 2VPXB 2WONA 4QR0A 4ZPBA 4CS0B 5DG9A 1FT7A 1Q7LB 1GMWA 4C8MA 2R2TA 2MKSA 1YW6A 1YX0A 2GJFA 1KN6A 4JOUA 4DV4J 4QR2A 3DMJB 2P6FA 1LCPA 5HO4A 5H84A 3HKZD 3PW0A 2BJ8A 2V8GA 3QT7A 2UUBF 3HXMA 1F3FA 5ETMA 2CXAA 2I00A 4MH8A 3QLHB 2OOTA 2DJWA 4RW6A 4WFAQ 3I31A 2J0QD 4WCEQ 3L4BC 2BE9B 3PR5B 4NGPA 3TT2A 2Q7SA 2RB7A 4K4SA 2Q66A 1H2VZ 3G82B 2LA4A 3VALA 2VD3A 2F4VF 3BKTA 2X3DA 1KKHA 2RJZA 2EKNA 3C66A 2AQ4A 5E3RA 1RTHA 4UOCA 2X1GA 1OPZA 4IG0A 4FAIA 1V3RA 1YG0A 5L9XA 2QL7B 3DI6B 5ETRA 2V77A 1HWLA 1TKZA 1WG1A 3IBWA 2UXCJ 2OPSA 4UOGA 4WYLA 4YHHF 2NQPA 5IV3A 3D6TB 4WWSA 1WG4A 1R6VA 2PDAA 3IU2A 3M1VA 2MQMA 2UU9J 3OXLA 4CM2A 2HC9A 4NCGB 2KJVA 5G1ZA 2PIIA 2XWXA 3T9ZA 1WHXA 2L48A 5K8PA 4PYAA 1AW0A 5D0HA 1WTFA 2WK4A 5GMDA 1N5YA 4ZVHA 5BXIA 2AGPA 1FEEA 1Q2YA 2HFVA 4RWXA 4K4VA 1HQEB 3OSNA 4M5LA 3P8BB 1S59A 1TKTB 1AA1B 1MROA 4DYOA 3HD2A 4U7UD 2AWZA 2RE1A 3KQXA 4ED1A 2CNNB 3I9V9 1F9HA 2Y9HA 5LJ5Y 4ZP6A 1T03A 5DLGA 1CJVA 4ZBGA 1HNXJ 2OI2A 3HHLD 4J9KA 1ZLIA 4B3RJ 3I55S 3M2VA 2XMMA 2WPWA 2Z0ZA 2GZOA 4FF3A 3GIJA 5F41A 1ZM2A 4CDIA 2HZAA 4YMEA 2NZCA 2YWEA 3WHIA 4I0WA 3QFHA 4FYXB 4ELVA 1QSLA 4MHYA 2ZPAA 3BV8A 4DF4A 3IWGA 4NGRA 3KFWX 5LSRA 3W9JA 3ITHB 2QG9B 3W7BA 2E9RX 4FXVA 1NJXA 3KG0A 2YX7A 3HHLB 2GIVA 3R1HA 2F1FA 2FDNA 4L76A 5KG0A 1Q8LA 5KFRA 4MIWA 3OD2A 2KHDA 4JI5J 3N5BA 2OD4A 2EVZA 3F8KA 2O3DA 1U7LA 2H1YA 1IKWA 3RYOA 1TV6B 3FVYA 4U9RA 4KOWA 2ASYA 2ZM6F 4BDPA 2IYIA 2W24A 4RX6A 1WKJA 3FZ2A 3FFIA 1J2VA 4Q43A 1LV5A 1Y9OA 2H5JB 4KSEB 1HQ2A 3DOMB 1N32J 3W65A 4LFBJ 1ZS6A 4JI4J 3ET6B 3X1LB 1IR0A 4FYDA 1YZ7A 2VU5A 1IQZA 2J6SA 2I38A 3FC9A 4LF5J 3EZOA 3T1YJ 4F3MA 4M8LA 5IT4A 1VCTA 2A0FB 4BWJA 2R7SA 4PEOA 4MHZA 1DY3A 3G6XA 3TUZC 2YKMB 1JIHA 4RR5A 4I7FB 1T11A 2ZW4A 1VC5A 2FJAB 4CCHA 4X65J 2RQMA 1QVGR 3M9MB 1UZDA 1EIYB 3MCOA 1BQMA 2I5JA 1UFWA 1S4EA 2W9BA 2BXJA 5KFNA 4WF9Q 2E7VA 5C24A 3CNQP 1PU9A 2CPFA 1TL4A 3D7SB 2ZITA 4IH6A 5L1IA 1KNZA 2Q43A 3JTKA 2G0JA 4II9A 4UTGA 3TZZA 2HVZA 2AD9A 1FKPA 3P6YC 4QWBA 4URSA 2F63A 5DO2A 3VQTA 3FBEA 3B35A 3DOKA 3MI7X 2OZUA 3NOCA 4JI8F 1I6JA 4CYUB 2FVSA 5LT5A 5BYRA 1DTQB 2XYHB 3A3OB 3MM5A 2B5JA 4K0KF 2REEA 4QWAA 1CS4B 2B4DB 1T9VA 1J5EJ 3SEOA 1RT5B 2K3KA 4F50A 4X8IA 2Y3YA 5IM0B 3KNAA 3PVXA 1F6TA 2CF4A 1W2IA 2JDJA 3JYTB 1IBKF 1EKRA 3CSKA 2Q51A 1N5QA 1F60B 1AB8A 3AOBA 2DT9A 4Q45A 2VIHA 1NK7A 4CLZA 3C8YA 3M6WA 4C3MA 3ZJ0A 5KFLA 2ZUAA 3HO1A 4U95A 4ZIWA 2HRTA 3CCRS 2X1FA 2HWTA 4RKUC 3TTHA 2XLIA 2HEKA 5LMNJ 3IGNA 1UFHA 3HFZB 1C1BA 4GKJJ 2H4WB 1G2EA 3CPAA 5E7OB 2JC1A 5IQQA 3CCJS 3EJMA 2WVCA 2XY7A 1IQTA 1JJHA 4TKTA 3LQVA 3CCQS 3R6GB 4UIBA 4LR7A 4P2MA 3UCUP 3Q8SB 4X62F 3NNCA 1KP6A 3DLKB 4YB5A 2VFUA 2VH7A 1XNRF 1SJRA 1UWAA 4XPLA 3BPSP 1HL6A 3GONA 4OC2A 2HGLA 2U1AA 3KJFB 4QWEA 2OIHA 4OC5A 4ECQA 4X4OA 4MAKA 1OYDA 1N33F 3TO8A 2KKHA 1MMDA 4CGLA 1H8LA 2CPZA 4OX6A 4X2TA 4K4YA 4TU7A 3OTCA 3VATA 1MK4A 5G21A 1YJVA 2EXUA 1N36F 1U25A 5F9NA 5CA5A 5AG6A 5A8RB 4MK8A 1F2PA 4WU2A 3M9OB 4USVA 5KG6A 2VZ9A 3GYGA 4NZ7A 2R1IA 4F0YA 4DN0A 1JLBB 3TZXA 4RPFA 1XMTA 2LXFA 1HWUA 3G8WA 1FRJA 4CO1A 2OR4A 2LEAA 1JLGB 2DPJA 1XIXA 4CO0A 4KFBB 4I68A 2QJ3A 2B4UA 3GWCA 2WVEA 1YRXA 3MCNA 2ZBQA 1HNIB 5CH7B 1VRUA 2Z58B 1OJ4A 2WONB 4WP3A 2R7RA 2BABA 2JZ5A 1EE3P 3ENQA 4AQYF 3HLPA 4N41A 1IOFA 4C6AA 3PW2A 4A8FA 3GYXB 3K5LA 1I3OB 2FJEB 2C3PA 4J37A 4KR0B 1ULRA 2AT1B 3TE4A 3O3LA 4YP3A 4MY3A 2KN4A 1B6BA 4Y28C 2GVZA 4DJBA 1CSJA 4RUCA 3DCAA 4HI2A 3OW2R 4UEFA 3HPOA 3VTIA 4TYBA 4U8YA 2AEJA 1X0FA 3NAIA 4LX9A 4KPCA 3L3CA 3PHTA 2V63A 2CPDA 3C6UA 1BHNA 4P2FA 4B3SJ 4Y2AA 2NXEA 3JXOA 3PB4X 4EBEA 4DUYJ 3H98A 3JAMU 1TKHA 2PQ8A 4IG0B 4ENOA 5HP1A 2DBBA 2E5LF 2BOPA 5DWNA 2OKQA 3PEJA 3H40A 5ISVA 2RHQB 3Q8UA 4K50A 5GCNA 3D1OA 4U7UK 3PY8A 1TKZB 1PAUB 9ATCB 1MU2A 2X1BA 2WAQD 2A2CA 2CPHA 2C2EA 1HBNA 4H4MA 3A12A 3M1VB 4ONUA 1XR7A 3DHWC 5BYSA 2XO7A 1R8BA 4CLLA 4LF9F 4YB6A 4B5PA 3PX6A 4KGKA 5KG4A 1WHWA 3R97A 2QV6A 2V34A 2MZSA 5HROA 5HANA 2W2OP 1QSOA 1UEKA 5EN1A 4PXBA 1MROB 2DYAA 1DBDA 1I1GA 2FLOA 4TWEA 2E1PA 4KHPJ 2RD5C 4ECRA 2MKIA 3PB6X 4O44A 3FQLA 3BH7B 4PSWA 3RB6A 1SH2A 1SVDA 1MJBA 1HKAA 1WC6A 1HD0A 1YJRA 5AE1A 4NE9C 1CJVB 3TJ8A 2IVFB 4ICLA 3FH4A 4WU3A 3TP2A 2KXNB 4OYZA 3K7RA 3U27A 4B9NA 1DTTA 4NI2B 3CC7S 3JQMA 2H5IB 4MKYA 5B7WA 2QJ8A 2OUGA 3QT8A 1NK5A 1Z5RA 3DLJA 1PYOB 5I0CA 2AYMA 2K5TA 5F09A 2HW3A 4WFYA 1KLNA 2AX1A 1TFYA 5LL6d 2GAHC 1IN0A 1SIWB 2DNQA 3H5UA 2DNZA 2NXNA 2YNFA 2YPZA 4ZP8A 3CE8A 2NYHA 2MJUA 4C4WA 4KOVA 1UTAA 1RB0A 2FHMA 3D6FB 1M5KC 1Q2DA 2EW9A 3C15B 4DV1F 1UVNA 2KXHA 3NAHA 2GFFA 1QDUB 1XOVA 4HDGA 4MFJA 1XWLA 2QMXA 3I5AA 3MZIA 3JSYA 5KFJA 4GC7A 3OBIA 2GMJA 3HHNB 4NXNJ 1HBUA 1TL3A 2QTWA 1J5OA 4DV0F 2Z0GA 1K4JA 1ZTTA 2JLMA 1JJCB 3N01A 3FFIB 2U2FA 4DPTA 2HNDA 3VAFA 4QWDA 2HQDA 3LAKA 3SI2A 1CBXA 2IM0A 2FY1A 3HJFA 4WK1A 3HF5A 2ROPA 3GR0A 4KOUA 5K8NA 2CDRB 4B9TA 2ZEGA 1XBUA 1A7GE 4P9SA 1O5JA 4XTTA 5C88A 3NGDA 3FQKA 2R7QA 1QAJA 4JLYA 4W98A 5B0DA 1S0NA 1D9AA 1YGYA 1C1CB 1N34F 4PG5A 4L72B 4PQUB 5KT2A 1NU4A 4CQ1A 1BQMB 2GIRA 2I5JB 3RBDA 2KU7A 2YNHA 3N6MA 1S7FA 5KFUA 5C24B 4AL6A 1Z8WA 3V81A 3HDSA 4DFPA 3BKFA 4KOYA 5GAHI 3IEHA 4OYPA 2MY8A 4YQWA 1RBAA 5DM6Q 1KVKA 1TVRA 4ILRA 2EK1A 4R9MA 2CA9A 3DR6A 4KV8A 1FKPB 1YGHA 4LUAA 4OZ1A 2C3MA 4X64F 1R43A 3SXLA 2YKNA 3T5JA 1W2BR 3J7AN 4CRYB 1YSJA 3OR1B 4C98A 3THTA 4DV2F 3MM5B 2B5JB 1JJ2R 3M8QA 2KG0A 2EG1A 1B3TA 2YKQA 1CQNA 3A4TA 2JBJA 2PC1A 4MCQA 4L74A 3MXHP 3M32A 5K8MA 5AJ3F 2R2SA 2QIRA 5ETSA 4TNOA 5CZXA 3OWCA 4LT6A 3OL7A 2BRKA 3WBZA 1X4BA 4FS1A 3TUPA 2J8NA 5KOXA 4EMEA 2PJ0A 5C25A 3FEXB 3W6SA 1UVLA 1EB0A 3KKFA 4JB8B 1N5TA 2XZDB 2J7UA 1K1QA 5KTAA 3JB9k 3UDEA 3KHGA 1C1BB 4P4JA 3LUYA 2PN6A 5A8WA 4PK3A 2DGWA 1HR0F 2R2UA 3G9CA 2DEJA 2PRBA 2DGOA 2ZJPQ 2VBWA 1IY7A 2LYVA 2OFGX 1U0HA 3CJQA 4TU8A 3HT0A 2NUHA 1UZHA 3I96A 4DPXA 3UDCA 2VPZB 2WBRA 5FD1A 1EQMA 4ORFA 3NBPB 3PV8A 3JSRA 4QBUA 1BGXT 4CI0B 2HNZA 2FZCB 2BANA 3CT9A 1WSRA 1C0UB 2C2OB 4AL7A 3MHYA 2W9AA 2H51B 3CCLS 2PSZA 3R1LA 3CD6S 5B08A 4A39A 1VC0A 2DHSA 3BQ0A 3LGMA 1RA6A 4M5NA 4K4ZA 1NK8A 1NDKA 4DPUA 2AJ0A 1BO4A 2GV1A 2NXJA 4B9LA 4ERDA 2YKPA 3T1HJ 1PYSB 2CYYA 1D0EA 1S77D 5EC4A 3D2WA 3QYYA 3B7IA 5D4LA 1I12A 3CXSA 4H6UA 3PYGA 1A9NB 3A13A 3KUGA 1TF8A 3M8PB 2UXDJ 4OMEA 3G4SS 4MBUA 2GIQA 2GS8A 3D0HE 2DCLA 3M6VA 2I0XA 2UXBJ 5LRJA 3CIZA 2HHPA 4QWCA 5EBVA 2GVZB 1TKDA 2E5JA 2QT7A 3OVAA 1V5VA 2KYZA 5SUHA 2DIUA 2XCPA 5GMEA 4L75A 3HD1A 1XJOA 3WC6A 3QRQA 2GC8A 4ZVSB 4PAAA 3ZZ0A 4NLUA 2ZNZA 3B8GA 3TO7A 1S6QA 1TR0A 4C2XA 1JNZB 4UW2A 4USIA 2I1RA 2ZH1A 3GP9A 1N5VA 3CGIA 4CO4A 3SJGA 4GO7X 2DGVA 4AG9A 4C68A 3D7HA 4OI3A 2M9KA 4UY8T 5HQLA 1NZAA 5G0RA 1S7LA 2HQYA 3CJSA 4F6AA 5F46A 3RRKA 1APSA 3Q24A 2GGPA 4LVOP 3IM8A 2RH3A 4NPOA 5LM7E 2D3O1 1MU2B 1RISA 2KYXA 2FE7A 1HW8A 2DRBA 4MY0A 4H4MB 4HI1A 5J1QA 4UF4A 4YEAA 1ZETA 1TXRA 2C2ZB 3O1LA 4OYMA 1OMSA 4MHNA 1ACMB 2C6PA 1GK8A 4B5PB 3N6LA 2VG6B 3VGVA 2ZD1A 1JQGA 2EWHA 2ZUGA 4NX9A 2C28A 3KTQA 5F8IA 4OYXA 1HMVB 2BDPA 1FJGJ 1PC5A 4W90B 4JI1J 2WVFA 4ES2A 2HHUA 2ZH2A 4RU2A 4ECUA 1NK6A 4JV5J 4CLPA 1N6QB 4I4BA 2LU2A 3R1KA 3P2HA 1QTMA 2P5VA 2LXUA 5H86A 1YJUA 2R7UA 4TLRA 3DRSA 2Z10A 3MPYA 2ACMA 2C42A 3PRDA 5D0RA 2YNCA 4KZTA 4YU9A 3U7JA 2DHAA 2OTJS 1Y5IB 4OP4A 4ZIVA 5GAEI 1RT3B 4MFKA 2DGQA 2HB6A 5F49A 4DXLA 3DFEA 4DCPB 2CQBA 5IT0A 3V8IA 1VOMA 2DNKA 2CXEA 4DUKA 4ECYA 4C8LA 4WPAA 1M1GA 1TZ0A 4IFYA 5CD4A 2NSCA 4P71A 4NXYA 4AE5A 3UD4P 4IQXA 4BINA 2WOMA 2XYGB 1D8YA 2IIHA 4C11B 5I4MA 2YNFB 3F56A 2BSWA 2L9NA 1DZ5A 3OR2A 4KORA 1WK4A 2PE3A 3EGZA 1VQ7S 4J5OA 2E9ZA 2CZ9A 3DRRB 1C0TA 4P44A 2OEKA 5BR8F 2HBRB 3EGVA 1IOIA 2A4NA 2FXFA 3J7Z5 3RTVA 1HBUB 3VAHA 1J5OB 3GR1A 1Y0HA 1QE1B 2JVRA 3U02A 4JUZA 2UVUA 2GANA 1M0SA 4DX5A 3ADAC 2KXFA 3MPUB 2V2QA 2UU9F 3EGWB 3HI9A 2HK2A 3W5XA 3MAHA 1VLYA 3BJ8A 1C4CA 3M8SA 3GIMA 1NNDA 4NA1A 1JB0C 1YW4A 4OC3A 7CPAA 2KM8C 2Y8WA 4I6WA 4OFZA 1YX2A 3Q83A 3MOZA 4FYYB 1B87A 5ETOA 1FRXA 2J6UA 3GYNA 4H4OA 4CLSA 3FF3A 2CPJA 3DYAB 1WHVA 2YNHB 3FX6A 3SZ2A 3GCWP 3C46A 5HJXA 2Z3PA 4NLTA 4F0HA 2XULA 3MR3A 3D8PA 3MEDA 4B3RF 1TVRB 4OYAA 3H4QA 2XLKA 4KLVA 1PJ6A 2ATCB 4KV8B 5LSOA 3V4IA 1V5IB 3VV2B 3QT6A 4KQZA 1IKXA 4L3KA 1DHMA 2O67A 3KLIA 2YKNB 1VRTB 2OHDA 3B6BA 3OPKA 1ZAWA 3D3SA 4WYWA 3MR6A 2DPTA 1ZH5A 4HH0A 5C42A 3M8QB 5C2GA 3W9IA 2NR0A 5D0EA 1NSAA 3PB9X 4QR1A 1GTEA 2ZDPA 4CWBA 3M32B 2HHHF 2GREA 2KVIA 4LFCF 4OLOA 1TFWA 2DRDA 1KOHA 5IC4B 4F4ZA 2EPIA 3FNCA 4IUSA 3G3SA 4QYZJ 3ZZRA 2UUCF 4CO3A 5JQ4A 5HK4A 4KO0A 1NB2A 1Q8BA 2J7WA 2V50A 1UWBB 5I3PA 1TAUA 3LA0A 4NXMJ 2D3ZA 3R6LB 5DDOC 1N32F 1U09A 1ZLHA 4JI4F 4CAXA 4C7HA 3W2WA 4A8WA 3T1YF 1XR5A 1S76D 1R89A 3GYAA 1U0HB 1VIXA 5HVHA 4FN5A 3MMJA 4F0XA 5F8GA 3N7ZA 4ZP9A 3LW5C 3T5LA 3BJ7A 1OY8A 4KVXA 2HNZB 1R8CA 2DCUB 2QN6B 1FF2A 1CBKA 5EX0A 2QLXA 4IUFA 3DM2B 3WT4A 2OPRA 1VHEA 5AG5A 1EQ0A 4ZY0A 1S7IA 2Z3NA 2R8KA 3PZPA 4M1KA 2K06A 5A28A 5J2QA 1FRMA 3MPVA 2J9EA 2ZELA 2N3OA 4DR5F 4NGNA 4OHVA 4IG3A 1N0UA 4KLWA 2FY8A 1RUSA 2B9YA 2BZ2A 2MZJA 3FJUA 4ZI6A 1S72S 4LR8A 1NAQA 3T1AA 3PM9A 3HP6A 2HQCA 1VIOA 4DL7A 5ELYA 2V2KA 5KFYA 4M6IA 5E3CA 3H5SA 2JEIA 5IT9U 1JXVA 2B43A 2I6WA 2O1PA 4BBYA 1CC7A 1FRLA 3N79A 3GV7B 1JLFA 5SZTA 5M2PA 3MM6B 2FIWA 4NLVA 4ZGYB 4M95A 4G6VB 3TR5A 3TEGA 1U6MA 4C8NA 5DETA 3NMAA 4NLRA 4DDFA 3HHKA 2CPEA 3ILOA 2L9WA 2C2RA 4IR1A 3QWPA 2R8GA 5KFDA 1S1UA 3T9YA 3MUVP 4B9UA 4OI6A 2VOOA 3QATA 3PO4A 1S6QB 2A3JA 3KLFA 1JLAB 4TN2A 3T8WA 2Z57B 4I69A 5GAGI 2MSSA 2E7WA 2BUNA 1GXLA 3B2YA 4UWIA 5G0RB 4I64A 1FERA 4DSLA 3KYLA 3QB8A 1LW0A 2HS0A 5G22A 1NZ8A 3TA1A 3VHQA 2GGPB 3UCZP 3RW6A 4QIWD 4DSEA 5BJRA 3MDFA 3FXTA 1HNZF 5IFMA 3QJLA 4NWBA 3BXMA 3DGPB 1XERA 2ABYA 4HL9A 5DQIA 2ZD1B 2DO4A 3OHBA 4G3IA 4NLSA 1NMEB 2VC1A 3SFGA 2CNOB 5LMUF 3FNNA 1SKRA 2GHVC 4NCBA 1UMJA 3OXGA 4O3PA 3ONQA 1SKSA 3DDIA 1TIQA 1R0AB 1IM6A 2ZVIA 2WSAA 4B3MJ 3TI0A 3LANA 2JEGA 4C7QA 1PYTB 2HAFA 3AB4B 4ZDNA 1Y7EA 2LQ9A 3DRSB 3B4DA 8AT1B 1CJTA 2V9WA 2RILA 4G1IA 2CIMA 2RS2A 3MR5A 2HG4A 1GFWB 5L1LA 3UVJA 4N8OA 1X9WA 5IXUA 3BSNA 1LWFA 3JVNA 3Q0AA 4XPCA 1HQUA 5RUBA 2EO8A 4KUAA 1RZMA 4DU7A 1K9MT 2HLUA 2LQ8A 4LF8J 4LF7F 3EFAA 2ZBRA 3M2UA 4XDDA 3IMQJ 1JMTA 2IRYA 3KNGA 1U8SA 1CQMA 1N88A 2D3UA 1FWKA 1KQGB 2WOMB 2YWKA 5CYQA 3I0RA 3NE8A 3KUEA 1KLMA 1U02A 5CCMA 4EGLA 1Q5VA 4FBEA 2R8VA 3PW5A 1EZZB 3I5CA 1WI6A 1SJFA 1C0TB 4USMA 3KDOA 5CNPA 3HX9A 2AFWA 2DH8A 4DUYF 5LYFA 3RYLA 4XPEA 2NXUA 5KTCA 3RG6A 3IJ3A 4YFUA 1EKSA 3LPEA 2YPYA 3MMBA 2IJZA 1LEOA 3IG1A 3PRTA 1P27B 3H59A 5IV0A 2F7VA 5I3UB 2IA0A 5GADI 1KVIA 1YITS 3CIMA 2J9AA 3H2LA 1X4CA 4QC6A 5J8CA 5L9NA 3QAYA 4F26A 3SXNA 3HVAA 4XDCA 1T95A 8CPAA 3JAMY 5LOQA 2MSTA 2Z2LA 2R3VA 1I1DA 1UFLA 2IYGA 1UAWA 2ZH7A 4DQSA 2DNPA 4A8QA 3H4BA 2HWIA 4JI3J 2CTBA 4CAVA 4LUBA 3PTWA 2Z8QA 4WFZA 3MF5A 4KHPF 1HARA 1IYKA 1KC8T 5MAOA 2ILYA 1BWEA 2EFVA 1S9FA 2GLJA 1DARA 4Q0BA 4WKYA 1FFSB 3ZTOA 3MEDB 1JLQA 4I6YA 4O3NA 3IXQA 4DFJA 3FUYA 2YQ3A 1DLOA 4ZPTR 4RNFA 3V4IB 3TYTA 5FJ4A 2AX0A 2JHEA 4DR7F 1VHOA 4QIFA 1QY7A 1QSMA 3GIUA 2DNOA 3Q86A 2XY6A 1SL1A 1X5SA 1AMPA 3H2UB 1CULA 2DGUA 2PJBA 3EVOA 1MWYA 3LH2S 3IBCB 4ANCA 3US5A 2BOAA 1RA7A 2B6AA 3FEEA 2JDDA 2V8DA 3IBFB 3KHZA 3OSPA 4CLUA 3K2YA 4ZLJA 5LXYA 1NXIA 2WW8A 3P45B 3B3WA 4WP9A 1OQ3A 2R7HA 3C14A 4H4KC 2ZFHA 4CGMA 3MAQA 2E1RA 1GMVA 3K17A 3W61A 1RCXB 2O5DA 1AZSA 2YQ1A 5ETQA 1TL7B 2HZVA 1PUAA 3N4WA 2M8DB 2F5GA 3OV7A 4DLGA 4F4XA 4KO0B 1W7WA 1YJNS 2OMOA 3K9UA 1NHVA 1U1NA 1PGZA 2BL1A 3SFUA 2DK2A 5C82A 3C26A 1VISA 2BE2A 4ZP7A 5D77A 4O3OA 2VC0A 1FRIA 4EEYA 3ENAA 1OZPA 3CD0A 3W2WB 2V9KA 2C2KB 4AVCA 1SC6A 4HPSA 3HVTA 1VQ8S 4DF8A 3NWRA 4XNHC 3DKDA 4DR2J 4W9YA 4C97A 2D74B 3SSRA 2QMWA 2WSEC 2J8SA 1QD1A 4NMLA 1VQ9S 3KGQA 5B09A 3LP0A 2B8QA 2B3VA 1SH3A 5KFTA 3FZBA 1Z1ZA 1RT7A 1M1KT 1K1SA 2CJ9A 1JKHA 5EWEA 2BJ9A 4CLTA 4F4AA 4AB7A 1ZPWX 3I4HX 4ATNA 1I51B 3BO2A 1RO5A 3R9LA 1VJQA 3AQOA 1RLDA 3TVKA 1D9FA 1ZAVA 5C5JA 2EWBA 4U67Q 3MOJB 2M88A 2AW0A 4J3GA 1CPXA 3GG0A 4IG3B 2DD8S 1Y7RA 4ETZA 3PB7X 2PD1A 3NGKA 1FD2A 1OSCA 4GMKA 4UQTA 5HBMA 4RU9A 3W9HA 4C8YA 3VARA 1S6UA 1M90T 2D4OA 2D1CA 3C6TA 3KG1A 1VQ6S 4QB9A 1V3ZA 2UVVA 1IWGA 2MPUA 1CC8A 3GB0A 3SQGA 1NK0A 1S97A 3D0IE 1YVOA 3I56S 2Z3KA 4YDXA 1Y3KA 2MQOA 2PR8A 3MPDA 2IMOA 3UI3A 1S1UB 4Y00A 2YNGA 2BMBA 2DR9A 1MLAA 1ZM3A 2F8EX 4A95A 4JI7F 1RWNB 5T14A 1GAOA 3KLFB 2EBJA 4PWDA 3F44A 1J27A 3KOAA 3IR5B 3W6XA 1OY9A 1XIQA 1L3TA 1H98A 4A2ZA 1YBTA 2PVVA 1NKCA 4XPDC 4CAWA 1LW0B 4A33A 2Q6CA 1WNEA 4DR1J 4R8FA 2OO4A 2ALYB 3KJVA 2ZEHA 1HBOA 4CGPA 1RAAB 5D8HB 2AKWB 2HHTA 3EDRB 1I94J 4CYPA 3CDBA 2ROGA 1ZO0A 3QJJA 4DSIA 3HHDA 4OZLA 3RGIA 2WZNA 2Z11A 3K59A 3MEEB 2R98A 4KIAA 2WCXA 2A6OA 3O8WA 1BPNA 1UA0A 2B3TB 2HMIA 2FVPA 4OV1A 1YBUA 1YJ7A 2D69A 4ZN3A 2MB0B 2F40A 1R0BG 5J2PA 4DNCA 3CD5A 3OQ2A 1Q7LA 4AVBA 4R3LA 2ADBA 2K1RA 5CHCB 2CQ0A 2AE6A 4NA3A 3DMJA 3SI0A 4LRBA 2K8GA 4K5SA 3S01A 2LQBA 1CJTB 2MZ1A 3FRMA 2HBQB 3AD7C 4B10A 2HWHA 3UVJB 4DZ6A 5BWAB 2JEVA 1LWFB 1M1DA 4LF6J 3QGHA 2CQ1A 5ETTA 1YVKA 4IOBA 2BKOA 4ES3A 3G82A 1QMUA 4USJC 3OFFA 3THPA 2CRLA 3EVWA 1RWOB 3MCMA 5CYQB 3I0RB 2QA4G 2DO0A 3KASA 3BSCA 2BQ3A 3POTA 3HVRA 1ELLP 1PKUA 4ZVGA 3QGPA 1RADB 3G2XA 4NRUA 2J8RA 2OMLA 4DL6A 4QVTA 5B0EA 4X66F 2AFZA 4BC9A 4DR4F 1P9YA 4NCGA 4FNIA 4HNXB 3NGRA 1RWVB 2VXKA 3MMBB 4F2SA 3IG1B 3SBMA 3J7YI 4B3TJ 2GJ2A 2MQPA 4F36A 3BLNA 2XBPA 4WIQA 4RS2A 1NKEA 4N77A 1IKVA 4R7MA 5HH1A 1HQEA 1RAOA 5KFOA 2W9CA 4MFZA 4IRDA 1Z8TA 1IBMJ 1TKTA 4R87A 2NMTA 4FKYA 1CJWA 3U1LA 2PE8A 5I3QA 1Q82T 5GAHU 2W2MP 3AH6A 2RF2A 1WKKA 4ZX8A 3VVTA 4DX7A 3HSJA 4MRIA 4M63A 4N8NA 4JV5F 2E29A 4AXIA 4ZYQA 2ZOFA 4A30A 5GMKa 1X9MA 4OI2A 4CO5A 5KFFA 2IBKA 5KFQA 3A8IA 3A9LA 1WF2A 1JLQB 2Q4YA 2CUYA 4XNHB 2B7CB 2V8HA 2MQNA 1Q4RA 4PSXA 1Y5NB 3ITHA 5F3ZA 1L5UA 4ZPCA 3MEGB 2QX0A 2UUTA 4FD5A 5F8NA 3BR8A 1ZYQA 1FDAA 4B9SA 2HVDA 4ED2A 3S6HA 2XNQA 4KKOA 2W4PA 2ABZA 4K2JA 1DAXA 2M70A 2RSQA 1CULB 4ANDA 1S0OA 1GEHA 1ZM9A 3M8RA 2B6AB 4ZVPB 2RMLA 3AOCA 5M2UA 3D7DA 3PEHA 1ZAXA 2D9OA 1M1HA 3QBCA 1TAQA 3C14B 2MKKA 3KWMA 5JGFA 3NMRA 1K73T 1V6HA 2BEFA 2MMYA 3EO4A 1RP5A 3M9NB 1UP1A 4A32A 1VDHA 4YOEA 1AZSB 3DXBA 2P9EA 1VQMS 3DOMA 4B9VA 2WYRA 3ET6A 2CQ4A 5KFBA 2LFVA 4J9NA 3SV3A 2JFDA 4C0BA 3ISXA 2OEJA 3W5YA 3B3SA 2L41A 3FEYB 3TQEA 1YWXA 1P9QC 4ZN1A 4DN9A 4FYVB 1YRTA 4UCPA 3BSAA 1P1TA 2BE2B 2YKMA 3O2IA 3RRHA 2EVNA 3TC8A 1WWZA 3CXCR 5DGAA 2CIJA 2OB0A 1Y0RA 4NGQA 2WZ1A 3NH4A 3V6JA 4PWUA 3BF4A 2PO4A 3ZTSA 2KT3A 3KKWA 2HS4A 3EMTA 2F65A 4BLGA 4RBTA 2VFVA 3HVTB 3P5BP 1S0VA 1OPIA 3L7PA 5F8HA 2J0SD 4MI4A 4JI0J 1T7PA 1RKJA 3QSYB 4CT8A 4AXJA 2XCAA 1YTYA 4A8YA 4FWUA 3V6KA 2WTFA 1VBZA 3LP0B 4HR2A 2RDDA 1S1XA 5JXSA 2QA2A 4WTOB 2FZGB 3GFHA 2XSJA 2BJDA 1JKHB 4H2KA 2FT0A 2QYGA 3EXCX 4CYNA 4CYUA 1Z4RA 3B82A 3Q89A 3TAQA 1DTQA 3TEHB 1S3ZA 4N5SA 1EP4B 1JLCB 1CS4A 3E2EA 1FX2A 4DUZJ 1Q1KA 4RNNA 1X8DA 2GU2A 4R57A 2IJFA 3GFZA 2YWGA 4FVCA 1KEKA 1RTQA 5KAKA 3D3BJ 4RJVA 5LJ3Y 4I1TA 3JYTA 5D4NA 1OIAA 4DR3F 4P4DA 3FK4A 4ZA1A 5HBMB 4WFNQ 2FVQA 3CCTA 3I6PA 4KTQA 2BM0A 2ACYA 4G1PA 4Y2IA 4A38A 5HMNA 4Q36A 4GRSA 4J9OA 4JXRA 3CCWA 5JM6A 1NJZA 1FTCA 3SQGB 5F48A 4BD9A 2IA6A 1R0CB 1ICEB 1GYTA 2IRXA 1ZA1B 4NL5A 2UUBJ 1WDTA 2GQ2A 4K7QA 2Q4ZA 1ELOA 3ILJA 1WOSA 2YNGB 1R3NA 2UVWA 1LWXA 2I8EA 1OQ6A 5C2CA 2WVDA 4PWDB 2OEMA 3KK3B 1EX8A 2F4VJ 1VQYA 2WRMA 4JWPA 4NLDA 2IBOA 3IWNC 1H38A 1Z4EA 3LGHA 4N76A 3Q8PB 3H90A 4TXSA 3DDDA 2W8KA 2LP4A 1VQLS 2DXFA 4ZPVR 3KJVB 3HSDA 1KQFB 3PKMA 2I3CA 3GIRA 1HBOB 4DQIA 1VHIA 4OYOA 4ZOSA 4U7CA 3MFHA 4YHHJ 3NA6A 1N54B 2JBKA 3I87A 2AFOA 1YLOA 3NE7A 3EPGA 4AUKA 3TCVA 2IM3A 1REVA 4RWWA 2B7BB 1RAJA 2K7KA 1JLGA 3IR6B 3TAPA 2H3EB 1Q78A 4KFBA 2HMIB 1X4HA 2BACA 3HFVA 3PGPA 1HNIA 1W25A 2FVRA 3M8ZA 5GAEU 5J2PB 2PJ4A 3R9FA 2K1RB 3H2VE 4QPXA 3LOUA 2L3MA 2MHEA 4PG4A 2YGWA 4F8ZA 2SXLA 4L6V3 5BYQA 4AYBD 2BKPA 1QSNA 4TY9A 4HKQA 2HUZA 3H5YA 1IYLA 4QPTA 5H9EK 4K2XA 4KOSA 4CAFA 2G3TA 3D7FA 4WXWA 3SSSA 2BQRA 3SI1A 2HHSA 2BR0A 4MT1A 1UPMB 2OPQB 1KSPA 3OFGA 2ZJQQ 4S0MA 4Y49C 1VLOA 3N5FA 5AGEA 2VBXA 3MUTP 3EUNA 1TL5A 3Q8RB 1UWYA 2YXLA 2V2ZA 1XFOA 4HVZA 1JK9B 2FD2A 5DZ7A 5IT9Y 1HHTP 2MLXA 1P4NA 3HLUA 4ES1A 4HNWB 3K8VA 1DTDA 4B9MA 3POTB 1IJFB 4I56A 3SDEA 4DX6A 2J8AA 5ITHA 1VMBA 3DRXA 4C48A 4WZMA 3N28A 5KG7A 4OJ3A 1F1BB 2AFMA 1RAHB 2VJUA 1S99A 1X5TA 4ZKAA 2ZM6J 1QSTA 4E2FB 1U2RA 2CPXA 3TW0A 2IAJB 2G13A 2VG5A 4R8UA 1Q0NA 4U96A 3ZXWA 2B4OA 3PYFA 3KG4A 1IKVB 2MYFA 2W9CB 2J5AA 3T5HA 1RYSA 1X4DA 3B3TA 2RUSA 4JI6F 4F9UA 2ROEA 4ZITA 2ATRA 4L73A 3DR8A 2WB4A 4WTYA 2C3YA 1FHTA 2KL8A 4ED3A 2UV8G 4DV3F 3IWWA 4EZ9A 2LQ5A 2RF2B 1YREA 4OX7A 4NI2A 1T9UA 4MKVA 4GVBB 3VAIA 1D8ZA 2V4QA 2FLNA 2W1BA 4JV0A 2XEIA 3CO9A 3E51A 3IWEA 2GO9A 4P4BA 1KUXA 4PWWA 2HPUA 2DH7A 1IXKA 1IR1A 1C2PA 1IVZA 3R95A 1RWPB 4PK2A 1JNRB 1PG5B 2LEPA 4WKRA 1M4DA 4IFVB 2DVIA 3R7NB 4JV2A 2OZGA 5D3GA 1H2TZ 1P6TA 4KKOB 2DHHA 3ILLA 4HKFA 4C2MA 4JI8J 2YTCA 1ZZFA 3ISZA 3S6KA 3CPWR 3C15A 1TK8A 3BI0A 2F3JA 1CP6A 1HYSB 2J76E 3AY0A 4K0KJ 2FB0A 4NGTA 4RW9B 3OVBA 1U6FA 1RABB 1L3SA 4J9LA 1Z8LA 1BUXA 1A0OB 3K0JA 1Y4ZB 3W1YC 5B0GA 4K59A 2P6EA 3NFZA 1VQKS 1IBKJ 1Q5YA 4TYAA 2DF5A 2EBEA 4WP8A 3TO6A 1XK8A 2ZBIA 1F5BA 2XEFA 1LNQA 3C3LA 2R4FA 4J9UE 4ZPWR 3FKBA 4DV7F 3WC2A 2P9GA 2VBYA 1RHRB 1B0VA 2GA7A 4URQU 2KFZA 3VWSA 3S9LA 1ZM4A 1S9EB 3J80U 1C1CA 4UA3A 4CGNA 4PQUA 1K0VA 1YQHA 3KK2A 3L7OA 3KJQB 2CJYB 2VODA 1WOOA 3N0VA 4DPOA 2EC0A 3W66A 4ER8A 2D3OR 2DR5A 4NLYA 4X62J 3PW7A 5FIIA 3PIPQ 4KGXB 4Y2MA 1XNRJ 2NS1B 3ULHA 3ZFVA 4JI3F 1RT6A 2OGUA 2ZBPA 2KVQE 3MTKA 2PRQA 1M44A 2PJ8A 3KLGB 1S1XB 4YRHA 2BA9A 2XQCA 5A27A 2FJBB 1LXJA 1BLLE 3V7ZA 2XSJB 1B0PA 5JPHA 1YQEA 5U47A 2LEBA 2MLZA 2RQ4A 2YQ0A 4R5PB 3AHPA 3FRZA 3OR1A 2ZZTA 1N36J 3SCJE 1HNWF 3KI9A 2WSFC 3TO9A 4OJGA 5HN0A 2M3DA 3J81U 5JVHQ 3KXDA 1XNQJ 4NGSA 1FT8A 4KC5A 2IHR1 4IQMA 5KG3A 3RR7A 1U2CA 2BYCA 2IVMA 5HI7A 3FCWA 4JYAF 5K14A 2CQGA 4WJBA 2PJCA 3T6BA 3FIXA 2PEBA 1F2HA 4O23A 4AQYJ 3CCSS 5DG8A 1LOUA 3S6GA 1WF0A 5DGBA 1XF8A 4BS2A 2W7OA 3V6HA 3SHPA 3WIVA 5HXDA 1SQEA 2PI5A 5GAGU 4PQAA 1S5KA 2HSEB 3GPAA 4NZ0A 3W8PA 4L89A 2KTQA 3MWBA 4C3KA 1FNXH 4MIBA 2B5GA 1PJ7A 3VCDA 4QW8A 1V3SA 2KB2A 5E3AA 2ZEJA 1S0MA 3HULA 3PBBA 2MKCA 2Z56B 2XMTA 3EC4A 1Y11A 4KHRA 3CJKA 1SV5B 3LWLA 1PBAA 2EFNA 2XWYA 3NBPA 2W8LA 1WORA 5KFXA 3BEGB 2B9WA 3A8KA 4ECXA 4MCPA 2W7AA 2CY2A 1TUVA 3DLEB 2KRBA 4DV6F 2B56A 4UCNA 3JTPA 1C0UA 5DRKA 2LCWA 3B54A 4DPYA 3I9ZA 1TKXA 2ZEPA 3IGRA 4UOFA 3LWMA 2ZNYA 3I82A 4QU6A 4ETXA 5DWMA 4FF2A 3K58A 1NB7A 2AV5A 4ZPAA 2RRBA 4LF9J 2CZ4A 1REVB 3CJ2A 1L3KA 2P6GA 3UD3P 1ROFA 4DI6A 2PA8D 3VWDA 4MHDA 1S48A 3D6MB 1LWCA 1V0CA 3UD5A 1U48A 2EK9A 3Q8YA 3QMQA 4XK8C 3MD1A 3PJXA 3QO9B 2FGCA 4XAKA 1WC1A 5KFMA 3M8PA 3MUMP 4NJRA 2IMWP 3PO5A 1RAFB 3TUIC 4F25A 2P6TA 2R8JA 4X4TA 2PJ2A 4OZ5A 4PPZA 1AT1B 1OY6A 2VA2A 2CQ2A 1KTQA 2F9DA 5DZ6A 5EGYA 1JLEA 2GNKA 4DLEA 4USHA 1AUSL 1RHKB 4C2YA 2REFA 1G6BA 2FJXA 5KG5A 2DY1A 4J91A 4P52A 2VQEF 3FMBA 4ZJLA 3G6YA 5KFCA 2JLFA 4R3KA 3NH8A 2JH3A 1UCNA 4C9DA 2LDYA 5A2QU 4NLWA 3OLAA 2C2NA 3IR7B 2VB6A 5FDLA 4Z65A 3G8TA 2RAQA 1U6BA 1N52B 1HI8A 3BGFA 1X4GA 3SDEB 2J0XA 1GT8A 2EFQA 1KHVA 5L8RC 1CPZA 2B0GA 4DV1J 2FJDB 5GADU 1F57A 3BGRA 2BBEA 1VR6A 1OSDA 4BC7A 4HTJA 4ED0A 2IM1A 2ILZA 1M4GA 3FCHA 3BN7A 5JUMA 4DR1F 2VG6A 2VG5B 4DV0J 1RBOB 4P7TA 4R8UB 1AFIA 1HMVA 2D41A 3TOQA 3CPXA 2YX4A 3DXSX 1Z4UA 1Z2LA 1W26A 4QIGA 3DHXA 2APOA 1VQSA 3FBUA 1H7WA 2AGOA 1BOBA 4OX8A 2VI7A 1RAGB 1N6QA 1BAVA 3NS7B 2KT5A 4BWMA 3BO4A 4NGMA 2DY9A 2VHGA 5IS2A 3WZ0A 2OP5A 1TUWA 3QFWA 4DS4A 1JWQA 4ECSA 4LIWA 3BYRA 4QCLA 2E5IA 1G3OA 1FJ7A 2BUEA 1N34J 1RT3A 1KUYA 1M4IA 2NPFA 2PEHA 4OHXA 1NSKL 1NHUA 5CABA 2M52A 2ZHOA 3CDXA 2HFUA 5KT7A 5D0GA 4CLFA 2HNYA 1FFWB 4YUDA 3FGVA 1OBRA 4V1Ak 1FI4A 2HK3A 2RHSB 4KVOE 3MMAA 4DUTA 2CPIA 3VAKA 1IWAA 3Q2TC 4FYWB 2M5YA 4C11A 1NDPA 5D3GB 4P6QA 4X64J 2FYXA 3AJDA 4NYOA 1FTRA 1NH7A 4MFBA 3DRRA 2FJVA 3CCZA 1KHWA 4DV2J 1REGX 5ETLA 2R7XA 3V2UC 2ZZMA 4KAIA 2ASDA 2AGQA 5HMWA 2YX1A 1X4AA 2V69A 1YRUA 1QE1A 2GAGC 3FRYA 5AJ3J 2HVEA 4EBDA 1WTBA 1YDLA 3FSXA 3U1MA 1PC4A 3BZQA 4WE1B 2E5HA 1UW9A 1O51A 3BYPA 2Q7BA 2XY5A 2VZZA 1S7HA 4C7IA 1R8AA 1RTDA 3FSYA 1IB1E 3AA8A 1TKFA 3GFXA 4LMZA 1T3OA 4ID8A 4OHZA 4E8UA 2KFYA 2ZENA 3UN3A 3L2NA 2CJAA 1VBYA 4H89A 3CMES 1S60A 1BE4A 3O44A 1RU1A 2AJFE 3DYAA 3KK2B 1X10A 1SC1B 3JRUA 1MSWD 2VBZA 2AFUA 3EXYA 1SQHA 5E96A 2YVSA 3NLCA 5KG1A 2BKNA 2DEAA 4ELTA 1XMQJ 1M4LA 1WACA 1KR4A 2F5IA 2FTRA 2RRNA 2AU0A 3GTYX 1RT6B 5FVJA 1FVQA 3SIPB 3BO3A 1AUGA 2HHWA 1U1KA 5LYDA 4Y2CA 3W2VB 4NCZA 1VRTA 2PIZA 3VAMA 4NF1A 3JS9A 4UZBA 3CC4S 1N56A 2V0NA 3Q8VA 3R2CJ 2G0IA 3OHAA 4DR6F 3GZ7A 1LOKA 3HHLC 1IUJA 2MLYA 4A47A 3JSMA 1UVJA 2EC2A 3NXZA 1Y9KA 2JEWA 3WX8A 5T41A 4DS5A 3RB3A 4AD6A 3HHEA 3MURP 1MJ9A 2CQHA 3NY0A 1IKYB 7FDRA 2DXDA 5K14B 2NZ4A 4GKKJ 2XHCA 2LMIA 3G6ES 2FC8A 1Z2ZA 2OTLS 2B4PA 3P3DA 3BI1A 2UUAJ 5CBMA 1U45A 4DSKA 2DNNA 3AT1B 1UWBA 3QIDA 1NO8A 4EMDA 1X5OA 4EFDA 3EDQB 4A8KA 1O8BA 2C22A 3IC1A 4Q5VA 2XHWA 5KFEA 2HFZA 4KY3A 2LLZA 4ED6A 2DH9A 1T02A 4UFVA 2B5GB 2J7KA 1XR6A 1WDDA 5K8OA 3KZWA 1HNVA 2IRUA 2F8HA 1VBKA 4Q44A 3DOLA 1HI1A 3CJKB 2NSMA 3V6DA 1BQXA 2VF3A 9RUBA 3T41A 3ZTPA 4MJ8A 3LPYA 3R5CA 3H8GA 1FA0A 2Q79A 3EGNA 2W2NP 2OLWA 4NRTA 4UEZA 2JNJA 2OPPB 1TKXB 3IU1A 2HQIA 2MQ8A 3DM2A 3ZZUA 4LRAA 4F02A 1U4BA 5A0YA 2BO9A 5DS0A 1JX4A 4JI0F 3LAMA 3IP0A 1PIEA 4NFRA 1BD6A 3RO0A 4FBUA 4QUSA 1RK8A 4P10A 4HNYB 1WF1A 1TF9A 2VFTA 3AB2B 4DL2A 3LP1A 1PCAA 3TNVA 3G6VA 3PFEA 2ZH6A 4FNHA 4ECTA 1LWCB 2DHGA 1VJWA 3D0GE 5CYMA 1S7KA 2RT3A 1XQIA 1IBLJ 1X9SA 2AHOB 1QM9A 1XMOF 1S4FA 1NJWA 3DNCA 1YMEA 1T9WA 4JZ0A 4EI2A 3OL9A 1YJ9S 2CG4A 2WUUA 2WBMA 3IWXA 3MM6A 3B78A 4ECWA 1WKLA 4ALZA 1SI9A 2B9EA 4KYZA 3OTDA 3I9SA 2F9JA 3I0SA 4OMFG 2V2VA 3TUJC 4OYWA 3W63A 1JLEB 3DLHA 4OX9F 5I42B 4DFMA 4KH0B 4B6ZA 3UNGC 2IJRA 4U9YA 1N71A 5IZHA 1TTHB 4OZNA 2FJWA 3RBEA 4DV5F 1JLAA 3HVWA 1KZFA 4O4GB 4R76A 2IPOB 4X4QA 4DQPA 2I9SA 1Q8KA 1VC6A 3PP9A 1F5CA 5D4PA 2AJQA 5IV4A 1IIDA 4OLLA 3C19A 3CJ4A 2W25A 5LYLA 2LXIA 1ZPVA 3RAMA 4J9SA 1VYAA 4P74A 4OQJA 4XO0A 4QIEA 5FDLB 3G86A 2AEFA 2MEWA 1MN9A 1R7IA 2UZAA 3MGJA 5HATA 5CYJA 1U24A 4KBIA 2P6SA 4KGZB 3J7YU 3T6JA 4F8RA 2RU3A 4G1QB 5BR8J 1MNEA 1ITPA 3BGRB 3D4UA 3CCES 4UFXA 5KFZA 4RUHA 1Y00A 2Z2YB 3A8JA 1N8RT 1GHEA 1KFDA 1QLNA 4ED5A 5AE2A 2BX6A 1H7XA 3VZHA 5ETKA 3DGPA 6FD1A 5A8KA 2XI2A 2HHXA 2ZEMA 3SV4A 1H6KX 3SSQA 5HQMA 4I67A 1O0PA 1RT2B 2CWKA 1RDRA 2OFHX 1Q16B 1R0AA 3LGNA 4GVLA 4USTA 4USKA 1KONA 3MR7A 1VS3A 2AF6A 2IC3A 1R57A 4RW4B 1NE9A 4LBPA 1DQAA 1MW7A 1PYTA 1WC4A 4O3SA 3J7ZT 1TMMA 4RN7A 5J1NA 3VGSA 3I4PA 3W62A 3BH6B 1S6PB 1T0TV 4KT0C 1XRYA 4QOTA 4A8XA 4DJLA 1X60A 3BB5A 3SXOA 4F4KA 3A3NB 3UDLA 3M6XA 2QVPA 4OIXA 4DV4F 3ZZYA 3TOBA 1XEZA 2HNYB 2QE5A 4Y2KA 2MHNA 2RKIA 3PHEA 4U5YA 2C2DA 3CMQA 3MMAB 2Z4PA 4LSNA 1SQFA 2VV5A 1RCOB 3RU0A 3WQPA 2FHKA 3BBBA 4TLQA 4OZJA 1FWLA 4Q8EA 3GY9A 2BE7D 1U1QA 3HSZA 2CKWA 3JQJA 3MM8B 3R7BB 4MFBB 2ZH5A 2DPSA 3F0AA 1VQPS 2FPHX 2POKA 4PUOA 4CRZB 4DG1A 1KQSR 1JWWA 1B4SA 2V8VA 1UPPA 3CO0P 4PCQA 3S7RA 2PMHA 1T9XA 5H9FK 3SJFA 1FE4A 4NLOA 4OHWA 2HHHJ 3KHRA 5F8LA 1KS2A 3GIKA 4LFCJ 1GMUA 3F41A 1MWQA 5HLFA 4ECZA 1M5HA 2B51A 5I3UA 2UXCF 1BQNA 4OYBA 4RW8A 1LW2B 1OO0B 3MPWA 2UUCJ 2KJWA 2ZDOA 2PGCA 2WSCC 1RTDB 2CPYA 2KG1A 4I49A 4YWYA 1NSLA 4GO5X 3HZGA 3AAWB 6CPAA 1X12A 4RNHA 3GJSB 2FQQB 4J9RA 2DTJA 2Z2MA 2ZOGA 1R8PA 4CRJA 1U1RA 3P49B 3L7UA 4KOTA 4E0AA 2G1HA 2VPWB 2MZTA 4OZ2A 4CLKA 2FLPA 3MAAA 4NEYA 2EUIA 3ZZIA 1IJEB 3OTEA 2E1AA 2MZQA 3CB4A 4FBTA 2DITA 1HNXF 5DQHA 2ZW5A 4MYTA 3ZZZA 4LF4J 3HM9A 4O4RA 3FEZA 3UN2A 3THVA 1NHKL 4DQRA 4IK2A 3S8SA 5L1KA 1SKUB 4RBVA 4HT5A 4I6AA 4I2QA 4IRCA 2JC0A 3BN4A 3ETOA 2YWHA 3L95X 4J9PA 1GH8A 2C2MB 3P2FA 3NGUA 4WFBQ 2ZHBA 3KMQA 3CJ0A 3E0KA 3H5ZA 3A1YG 3QZ8A 3JSMB 4DR5J 3PX4A 4J9VA 1F5AA 4FXDA 5A6PA 2ZXVA 2COLA 3GLJA 2KFNA 2DEIA 3ZO7A 3E01B 4PYDA 1QUVA 1M5OC 3KLHB 4JI5F 4MFPA 4E98A 1RWXB 2R7WA 1TL7A 3QRRA 4LRCA 1QAIA 1YIJS 1FXDA 4B02A 1HDUA 1CVJA 2N7YA 5THWA 3DLGA 3VGTA 2ZEFA 4ITSA 1ZG8A 4DWIA 2ZEDA 5D15A 3CXQA 2V4JB 1V9OA 4R25A 1UJ5A 1K0TA 5D4OA 2EK6A 2RU9A 5E2QA 4ZS6A 3MM9A 3ZZTA 4UT4A 2Y1JA 4JI2J 2CQPA 3ENWA 4LFBF 3K5OA 2RS8A 1D09B 2B4VA 5ETNA 4LQGA 2C1CA 1YR0A 2E1MC 3TA0A 1DE4C 4LF5F 3QAUA 2N7CA 4PPDA 3TAMA 3R5GA 1WUUA 3AODA 2A10A 2ZH9A 1TL1A 3V5RA 2HKEA 4FPRA 1HNVB 2PVWA 2GLFA 1WWHA 3D1QA 1HW9A 1SC4B 2G9OA 2HRYA 3AJ1A 3DOLB 2Q6BA 2Y1IA 3DRPA 3V6DB 5J2NB 2NSBA 4OZ3A 3V38A 4X65F 1BLUA 5KFIA 4OJ1A 2QRRA 3LACA 4YFJA 2FHJD 3NL0A 3CULA 1P0HA 3SMZA 1WJ9A 4Q8FA 4UUWA 3W64A 3WABA 1UKUA 3CCMS 4RW7A 5AG4A 5A0YB 3KMSA 5KTQA 1IICA 1HNZJ 5F8MA 4AXVA 3M8YA 2CAJA 4X4PA 1NRKA 1SQGA 3TOAA 5E41A 4LJMA 3J80Y 4RL1A 3T19A 3SJXA 5E3PA 5L39A 3LP1B 4UIAA 1H73A 1M5SA 2CNSA 3OXFA 5T7LA 1GMWD 2N4DA 3NG8A 2FC9A 3CC2S 4QIVA 5KTDA 5LMUJ 5CYMB 3IRXB 2QLBB 5HAOA 1NK4A 3RNZA 3RUBL 2XLJA 4B3OB 1LK5A 4J90A 1J5EF 1WEYA 2GQCA 1EAYC 2GFQA 4CH0S 3G71S 2HHVA 1XN9A 1XNQF 2PJ5A 2C6GA 4IOAQ 3DNSA 1S12A 3I32A 5AE3A 3I0SB 3IA0A 2ATLA 1IM4A 4YR3A 3D54A 2ZOMA 2V8PA 3K5NA 2ZKUA 5LRGA 3IWLA 2RNEA 2KO1A 4CYOA 3D9BA 3UW1A 2XYPB 5DQGA 5AXKA 5LXRA 2PMWA 2QC3A 2LECA 1LK7A 3T9NA 4LF7J