2V8DA

Crystal structure of mutant e159a of beta-alanine synthase from saccharomyces kluyveri
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
437
structure length
437
Chain Sequence
b'GTLNLPAAAPLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNAEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-ALANINE SYNTHASE
molecule tags Hydrolase
source organism Saccharomyces kluyveri
publication title Crystal Structures of Yeast -Alanine Synthase Complexes Reveal the Mode of Substrate Binding and Large Scale Domain Closure Movements.
pubmed doi rcsb
total genus 148
structure length 437
sequence length 437
chains with identical sequence B
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2007-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v8dA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2v8dA01
4PXCA 1ARLA 4UF4A 2IQ6A 4O23A 2G9DA 4OMEA 2CIJA 2AFXA 3SI1A 4OIWA 3CPXA 3SJFA 5IB9A 2Q43A 3MRUA 4OC0A 3PB6X 2PE3A 4X8IA 4WWVA 3D7HA 2PJCA 2ZEHA 5DS0A 2FVGA 1XRYA 3SI2A 4MCPA 2PRQA 4R7MA 3LMSA 1H8LA 2XEJA 2XEIA 3PFEA 2ZELA 3FJUA 5LRKA 1QMUA 4IK2A 2GREA 2AFUA 5J1QA 4FBEA 3D4UA 3WC5A 1AMPA 3GLJA 1ELMP 2V8HA 4ZY2A 1TF9A 2PJ2A 3NH5A 4OC1A 3TX8A 3FX6A 2Q51A 4UEEA 4OC5A 5LRGA 3IEHA 5LRJA 2NSMA 4ZX8A 1OBRA 2C6PA 3KHZA 2Q4ZA 3BI1A 1F2PA 1Y0RA 2VL1A 3V7ZA 2PJ3A 2PVVA 1ZLHA 4OKOA 1Q7LA 3KQXA 2ZEMA 3B3WA 3FEDA 3IWWA 3FVLA 5K8NA 4YU9A 5JH9A 3QNVA 4P4BA 4TNUA 3NFZA 5THWA 3FH4A 3KQZA 2XEGA 3SJXA 5JM6A 4OC3A 2BCOA 3FMCA 4NGNA 1VHOA 4PXEA 1BLLE 2HC9A 3NH8A 4P4EA 1VIXA 3PEIA 1XMBA 3I1UA 5D29A 3B3SA 3MN8A 2AFZA 4GM5A 2PIYA 4P4DA 3FEEA 4P44A 3CPAA 3K2KA 3KL9A 3SJGA 2RFHA 4MCQA 1NSAA 4Z65A 4ZI6A 2F7VA 4A37A 3BI0A 1DE4C 2PJ9A 4NGTA 1YW4A 3RBUA 2ZEOA 3DLJA 4P10A 1IY7A 1CPSA 1Z8LA 3PB8X 5LYIA 3CDXA 2ABZA 3T8WA 4P4IA 5JGFA 1PYTB 4A39A 5LYDA 1XBUA 4OIDA 4R76A 2I3CA 4UEFA 1CX8A 4LQGA 4EFDA 4DUKA 2ZOGA 2V8DA 4ZX9A 3BXMA 4ZY1A 2PVWA 4W9YA 4MMOA 2ZEDA 1VHEA 4EMEA 5LYFA 2PJ1A 3B35A 4Q7AA 1M4LA 3H8EA 1PCAA 4WJBA 3TC8A 3WT4A 3RAMA 4NFRA 3JRUA 1CP6A 4MHPA 2PCUA 3N5FA 1XFOA 2EK8A 1TXRA 2OOTA 4UEZA 4CPAA 2WYRA 4PQAA 3NA6A 2IMOA 2ZEPA 2PJ4A 4PPZA 4F8ZA 4NJQA 2HB6A 2PJAA 4R8FA 2AFOA 3D7FA 2C6GA 4P4FA 1ARMA 2OR4A 4H2KA 1HDQA 4NJRA 1Y0YA 2DEAA 2O4HA 2PJ5A 1HEEA 2IJZA 4BD9A 3B3TA 3KR4A 4MHZA 3HLPA 3KI9A 1ZG9A 3PB7X 1UWYA 3D7GA 3KZWA 3B3CA 4AXVA 2ZEFA 5K8MA 1GYTA 3KHXA 1DTDA 2JBJA 1LCPA 2NYQA 4TWEA 2AFWA 3D66A 3PB4X 1QQ9A 4MHNA 2WZNA 2BO9A 4ONWA 1KWMA 3B2YA 3S9NA 1LANA 4P45A 3DGVA 1AYEA 2ZOFA 2GLJA 3IFEA 4DJLA 4G1PA 2ZEGA 4FUUA 1BPNA 2PJ0A 4IAVA 2PIZA 4P6YA 5LYLA 2ANPA 4FWUA 3SJEA 2PJ7A 3IJ3A 4X3RA 2POKA 4P4JA 3PBBA 1XJOA 3PBEA 2CTBA 1IGBA 4MCRA 4OC4A 3H8GA 3WABA 2O53A 2PJ8A 8CPAA 3HUVA 1YMEA 2EWBA 1FNOA 1VGYA 4OC2A 1TKJA 1BPMA 2V8GA 1ELLP 3K9TA 3ISXA 4MXUA 1ZG7A 3S9LA 2GLFA 3VH9A 3RZAA 3PFOA 3FECA 5F09A 2ZEEA 7CPAA 1BAVA 3ISZA 2RB7A 3D7DA 1YLOA 4PXBA 4ZY0A 2PJBA 1YSJA 3B7IA 3SI0A 1CP7A 3VATA 4OP4A 3PRTA 1CBXA 2QYVA 3BHXA 4F9UA 4NGPA 2F8HA 3IC1A 4B6ZA 4NGRA 4PXDA 3WC7A 1EE3P 2C6CA 1Z2LA 4UIBA 1TKFA 1ZG8A 2PJ6A 5K8OA 1F57A 5ELYA 4YWYA 3GUXA 5CBMA 5CPAA 3KGQA 1R3NA 2AFMA 4NGQA 4NGMA 4FAIA 1ZLIA 2C1CA 5HVHA 1LFWA 2QJ8A 4UIAA 1TKHA 4EWTA 5I4MA 2V8VA 1LAMA 1F2OA 3IIBA 1CG2A 1Z5RA 4IHMA 3S9MA 3B3VA 2ZENA 4NGSA 3H8FA 3KASA 1LAPA 1YW6A 2BOAA 1R43A 1JQGA 4X2TA 1Y7EA 2GU2A 1LOKA 3D68A 4R6TA 2J9AA 2JBKA 3PB9X 4MCSA 1TF8A 1FT7A 4K3NA 3LWUA 4KSIA 2V77A 4MRIA 1CPXA 3CT9A 2AFSA 2CF4A 2JEWA 2QVPA 4F9VA 2CTCA 4A38A 4MHYA 4RUHA 5D8NA 5HXDA 3L2NA 3IO1A 2EK9A 3KR5A 3NH4A 4ZYQA 1HDUA 6CPAA 3D67A 4JYWA 5HVFA 5HVGA 5K8PA 4DYOA 4JZ0A 3FF3A 2XEFA 3VARA 1RTQA 3V38A 3WC6A 4A94A 3GB0A
chains in the Genus database with same CATH superfamily
3WIVA 1P1TA 1PG5B 1LNQA 2EXUA 2FY1A 3IBCB 4UF4A 3DFEA 3BEGB 3R5DA 3V4IA 4RW8A 3DOKB 1XMOF 1ZYQA 2Z0ZA 2GW8A 4DV5J 2ZEHA 1JLEB 2PEBA 1MU2B 2P6GA 3RU0A 1Q5YA 4RU9A 2IM0A 2V4JA 3MDFA 4DU7A 2Z3PA 2DGUA 4EBDA 1WOSA 4F0HA 2NMTA 3GV8B 4CNYA 3T1YJ 2IM3A 4O3OA 4ONUA 1VQYA 3JSMA 3DLHA 3W63A 2GIFA 1CJTA 2QJ3A 4G1QA 2CNMA 5MAOA 4Z7CA 3TX8A 4LF7F 2RILA 5KG4A 3TCVA 2QN6B 3ICLA 1OZPA 4HKFA 3LUYA 4CLPA 1W26A 2C22A 2P6SA 3M2RB 3SXNA 1X4CA 2G4BA 2C2DA 4FD7A 5HQ8A 1EETB 2JL9A 4A4JA 3FBBA 2BEIA 3JS9A 4EEYA 4ZPCA 1S4EA 2P5VA 4HYKA 2FT0A 2PJ3A 1HI8A 1ZLHA 4NLPA 1S12A 2DIUA 2P0WA 4PYAA 1GMVA 2KU7A 3MWBA 2Z3NA 3FNCA 3W3SA 5E33A 3IG1A 4KQZA 1QLNA 1QSSA 1RT3A 3ENAA 5IWAF 1FKOA 1NK5A 2OH2A 1PYOB 1VBZA 1UVNA 4P2FA 3EJMA 3HXMA 1XMBA 3I1UA 4NI2A 1WACA 5D6GA 5D0RA 2HWHA 4DQPA 5J1NA 1U26A 2DGSA 2A0FB 1L3SA 1RAEB 1FD8A 2KI2A 3ISND 1WF1A 4YB6A 4DR4F 4QWDA 4J9QA 3ELHA 1NSKL 1HLWA 4AYBD 4L3NA 2YNCC 2RE1A 4P2XA 3DOLA 4DFMA 3TE4A 4YEAA 4XPDB 1RTZA 4MJ8A 2VG5B 2ATLA 3S6EA 1K1QA 1RTIB 5H9FK 3MURP 3R1LA 4A32A 1S7HA 4JBCA 1T7PA 1KQFB 3B8GA 2V68A 4Q7AA 4H89A 3LP1A 2XNRA 4AXIA 1W7WA 5FJ4A 2BW2A 2HYIB 3MFHA 2B5GA 1NSLA 2GGPB 5LOQA 1RCXB 4NCAA 4F4YA 1MWQA 4N77A 4ZVTB 3CXCR 4JI1F 3AD7C 4CYOA 1HPZA 2KZMA 1B0PA 2PJ4A 2Z56B 4FZVA 2ACYA 3S8SA 2A10A 2HB6A 4LREA 2L3MA 4BS2A 3D7FA 1F0XA 2HNYB 4JI3F 1YRTA 2DCLA 1GAOA 3NGKA 1RAJA 3X3UA 3V4MA 2CZ4A 4F26A 2KT2A 1ZM3A 4FXWA 2RRBA 1XERA 4KB7A 4GC6A 2UUCF 3LGMA 2YKOA 5DRKA 2CYYA 2ZEFA 5EWEA 5EC4A 5D4PA 5KG2A 2V67A 3A8IA 1U1NA 2E7XA 2XWXA 2IRUA 3PO5A 1ACMB 2C2KB 2VG7A 3FXTA 5J2NB 3M30B 2Z57B 5ETMA 3DHXA 3H90A 1FA0A 2LLZA 5KG1A 3TQEA 3NOCA 1HQEA 4DL6A 1BPNA 3PJXA 1VQ5S 1QE1B 4DR2F 1HPZB 2MGZB 2XBPA 1YJNS 4LQ3A 3ENVA 4USVA 5EMIA 3MM8A 2L9DA 2GIVA 3DDNA 2EFPA 3OVAA 8CPAA 2JZ5A 3SDEA 2EWBA 2DHAA 3HHNB 1FNXH 3FDSA 1UJ4A 4M1KA 3GIMA 5BYSA 2QIFA 1QTNB 4KOVA 1LQ9A 3H4DA 5HSPA 1S1WB 2Q1LA 2C3PA 3K17A 3K0JA 4JWPA 1UJ5A 1YJ7A 4HR2A 2OU2A 4FF2A 4F4XA 5E3CA 1P0HA 4ILLA 2HVIA 1HARA 3AJDA 3KHRA 4LRFA 3EDRB 4V1Ak 5U47A 4DSEA 1TKFA 4NX9A 3N9UC 1HBNB 3GUXA 3N79A 4QUSA 2IVMA 4QWEA 2GFFA 2OMLA 2DGQA 3G8WA 2I79A 3TUZC 5KFDA 1SKUB 5KFAA 3CDAA 1LFWA 2QJ8A 5FD1A 1N54B 4EWTA 1LWCA 3POTB 3L4BC 1SJQA 3ZTOA 3GZ7A 3TWZA 2D4OA 1LK7A 4IFVB 3I5BA 2KFNA 1RE1B 4PKDB 2ZM6J 1JQGA 3HULA 4C48A 4Y2IA 4D3GA 4RNMA 1JLFB 1RI7A 1M5PC 1RHMB 5GMKa 1B3TA 3ETOA 3A3OB 2IY5B 3Q89A 3CT9A 5D15A 4HH0A 2AFSA 2RQKA 4I68A 3QWUA 5ETVA 3L2NA 4FS1A 2EK9A 3NP5A 2Q6CA 6CPAA 3ZZRA 3LGNA 3OTBA 4X4OA 3BV8A 2JLGA 2DH9A 3VARA 2X3GA 1HW8A 4PXCA 5C82A 5C42B 4GXHA 1JLGA 1SIWB 1UPMB 1CJTB 1IN0A 1F9HA 2WOMB 4CAWA 5GAHU 3ZXWA 2OPSB 3PB6X 4R8UA 3PW4A 4YDDB 3BBBA 1NMEB 4P7TA 2AYMA 2QRRA 1ON0A 4G1IA 2WB4A 4NLTA 1JWWA 2CKWA 4HACB 1SUQA 4UFWA 3EYZA 2XMMA 2QFJA 4DZ6A 1S3ZA 5J1QA 4FBEA 1C4CA 3RYLA 3MR2A 4JV5J 1Y5LB 1RTJB 5LJ3Y 4CLYA 3G82B 5E41A 4QIFA 3SCJE 1JKHA 2XZDB 1G3OA 4UFVA 1HBMB 2UXBJ 3I9ZA 1PJ6A 2XMUA 4JLYA 3KK3B 2FZGB 4R0EA 3DDIA 1LOUA 3R97A 4FD6A 2ZH5A 4HNXB 4JI5J 2C2EA 3MOZA 2RQMA 2B3UA 5GMDA 3BN7A 2FIWA 3FK4A 4DL2A 3W2VA 2RKIB 5JH9A 2X7IA 4FF4A 3DXBA 4AFFA 2JEVA 2HBZB 1DAXA 3BSAA 3FH4A 3PXGa 3SJXA 1RXOB 3FMCA 2YKPA 1DJ0A 2DHXA 1EQMA 1Y11A 1H3DA 2AX1A 2RH3A 4CI0B 2ADCA 2Y0BB 2AJFE 3MM5A 3TEHB 1V5VA 1S5KA 1NSAA 3DRRB 4Z65A 2DNOA 2PJ9A 5B0GA 2MJNA 1Z2ZA 3QWPA 5KFLA 1JWQA 5C2CA 4DL4A 1NKBA 3WHIA 4O4GB 4ZPBA 4KLVA 3T8WA 1TFWA 2AW0A 2J8MA 3SHPA 2XGPA 3R9FA 4LF5J 2NYHA 1Y4ZB 3HHDA 3NEKA 1KS2A 2FLOA 4UCMA 3BXMA 3SSSA 4DG1B 1T3NA 1IR2A 5HJXA 5D77A 3M05A 3CXSA 3NE7A 4EMEA 3NNAA 2RQCA 1HQUA 4P52A 1JMTA 1DLOB 1NRKA 4ITSA 1YBUA 4C0OC 3KHHA 1VQ4S 1KKHA 2AT1B 2Z10A 5D3GA 3OSPA 2HQ3A 1TXRA 1FRHA 2LQJA 1N34F 5IWAJ 1SC1B 5LJ5Y 5BYRA 3FFIA 2R7WA 5B0FA 5KTQA 1AFIA 5G0RB 4F8ZA 3P3DA 4LFBJ 5G21A 4I2QB 2D3UA 1KHWA 5DM7Q 1S1VA 3W62A 2VFSA 3PG9A 2O4HA 4JXRA 1OWXA 4N8OA 2CJYB 3LP2B 4Y2MA 1SJFA 1VR6A 2HQFA 4NLXA 1FK9A 2HFVA 2HPUA 4XTTA 2A6MA 5DG7A 1TP7A 4ES1A 2UZAA 4LRBA 3SSRA 2FVQA 2HW3A 1B4SA 3N4WA 4ONWA 4CAFA 4KVOE 3ILLA 3S9NA 4OZ1A 1KVIA 1U09A 1B99A 4RW6A 1HWUA 2D1CA 2FGOA 1X5PA 1H98A 2BANB 5CYQB 3VAKA 4H6UA 4O3PA 5F8GA 3MOJB 2QC3A 3NOGA 3H2UB 4NEXA 3FQKA 2ANPA 3GYAA 5G4DA 2ALYB 1DQ8A 2OELA 2X1FA 4A8WA 5DG9A 1I1DA 1MWZA 1WHVA 3CMES 4ES2A 5HL7Q 5HLFB 4CS0B 3S6HA 2CJ9A 2U2FA 2CJAA 1TL7A 2BJ7A 3ISXA 4NZ0A 3A12A 1YZ6A 3Q8YA 3MR7A 1HYSA 2HS3A 1N32J 4FF1A 3ISZA 3UD4P 1FDNA 1RTDA 5ETPA 2DVIA 2XNQA 4PABA 4ECTA 1FKPA 4GKJJ 1HMVA 1U2CA 1NUEA 2DO0A 1RTHB 3AT1B 4YB5A 4R3KA 3IAM9 1FESA 5CA5A 2QG9B 4K0KF 1X5OA 4PG8A 4C8KA 4DL7A 1Q2YA 1LAMA 4CZCA 4DV0J 1NB7A 3D6FB 4TU7A 2FJEB 4HNYB 4IFYB 3MF5A 3MFIA 3QAUA 4KO0B 1P6TA 4LF4J 4F67A 1Y7EA 2RKIA 4R6TA 2CNOB 5IT0A 5C88A 1IBMJ 4MCSA 3BREA 1V6HA 4PUOA 1R6YA 4AE5A 3HMJG 2KZZA 3ILJA 2XYPB 4ZLNA 3G6XA 2CF4A 2JEWA 2UXDJ 4ECRA 3PRVA 3LPYA 3LTOA 4HKQA 3CWJA 3H0PA 4JI2J 3C2PA 2D4PA 3BR9A 3LGHA 1SKWA 1F60B 1OYDA 5CQGA 2L9NA 3DDKA 4DV6F 1SXLA 3HHLB 1WEXA 1RAHB 1S9GB 2DIVA 5AG6A 1FVSA 3G2XA 4KKOB 1IJFB 1ZM2A 3KLGA 3M8QA 3C16B 4PQUA 4OIWA 5IB9A 4EYIB 3Q0AA 1LWFB 2MZJA 2Q79A 1HQUB 3MMAB 3D7HA 1MWYA 3W5ZA 3UNYA 5HK4A 4GVBB 2C3UA 3QGPA 4ED4A 3R95A 3D7SB 3WC5A 5HQLA 3BF4A 4PSXA 2ZW7A 1RT6B 2DRDA 2E1AA 1S99A 4NLUA 2VZYA 4DV2F 1CVJA 4MH8A 3I55S 2ZUAA 1NXIA 1MK4A 4Y34A 1X5SA 2C2MB 2QTWA 1BE4A 1F2PA 1Y0RA 1BQMB 3D6MB 2Y1RI 1WHWA 4J37A 2W4PA 4OKOA 1R8HA 5IB0A 2VG5A 2FTRA 2QL5B 2Z2MA 1OSCA 2MQQA 4DL0C 5C7PA 2WONA 4CYPA 5LL6d 1Q7LB 5AXNA 2PDAA 3POTA 4NGNA 4BBHA 1MMNA 3OTEA 2V0NA 4F3OA 3A1YG 2LMIA 3DRSA 3IP0A 4DV7F 2ZZMA 2W7PA 4B9NA 3V6KA 3QJPA 3SQGA 3R6GB 4WFYA 2EBGA 1D9DA 4B3TJ 1ZA2B 2V34A 2OPRB 4RJVA 3T1HF 2NXJA 3A3PB 3T9NA 2EO8A 4IRKA 1FXRA 2MZSA 2UUBJ 3CDXA 1R0CB 3UWTA 4LF1A 2FD2A 1YLEA 1RTJA 1NZAA 2DNLA 3VZIA 1RWUA 1ICEB 5KTAA 1R6VA 2YQ0A 2G0BA 1G1XA 2WCXA 3SQGB 5F8HA 3AFGA 3H8YA 4CO0A 4KBIA 3EM1A 4KLWA 1NPPA 4CAXA 1GTEA 4UTGA 3CPWR 1SV5B 2WSFC 1NHKL 4DQRA 3K9UA 3WT4A 3NGSA 5F3ZA 1YBAA 4YFUA 3D28A 1OO0B 4W92B 5F8MA 3BBFA 2MKJA 3BLNA 5EHHA 3KLIA 2NLWA 1HQEB 3NA6A 1WSVA 4DV4F 3VGTA 5KT7A 3DU5A 4IOCQ 4E0DA 2B0GA 4RKUC 4XNHB 2GCFA 2QIRA 4NASA 4P4FA 4NLVA 3BDEA 1SJRA 3DR6A 1WDTA 4NRTA 1NSPA 1XBWA 4TXSA 2ZDPA 2CDQA 1M90T 3RW6A 2LU2A 2DNZA 1IBLF 4K4SA 1ZAXA 2Z30B 2MKKA 2IJRA 2JBJA 3VV2B 2KG1A 2K3KA 3DI6A 3D66A 2OKQA 3FYNA 4C6AA 1R8PA 2Y9HA 5CZXA 4BC7A 2OUGA 5J2MA 1YITS 4F7VA 5B0BA 2BRKA 3HHKA 4CLWA 4USMA 4V19J 5D0HA 3PJWA 1OIAA 4IG0A 3IFEA 5H1SV 3W5XA 1N5QA 3MD1A 5DQIA 4FBUA 4FUUA 4OJ1A 3Q8UA 4TY8B 4M5NA 2PD1A 1P27B 1I1GA 1WKKA 3QZ7A 4NCGB 2R8JA 1UETA 4LF8J 2Y1JA 2PJ7A 3KLHA 2J0QD 4OI0A 2BYCA 3H8GA 3TO9A 5KG7A 1HNIB 2MTLA 2QLXA 3BJ7A 2BZ2A 4KJIA 2CQHA 3IN5A 3G6ES 4R57A 1S1UA 1IWAA 2MSSA 2XULA 2N7CA 2YNGA 4PZVA 2B6AB 3LWLA 4HTIA 1YSJA 2MPUA 3E01B 5B0CA 3D0GE 2W4DA 4FKYA 1CJKA 3VAHA 2QYVA 3HJFA 4USWA 3T90A 1BWEA 1KQSR 2D7SA 4UIBA 4KGZB 3UCZP 1T95A 2Q04A 2OLWA 2WW8A 3D54A 4PG5A 3W91A 4CRZB 4NEYA 3H2LA 2DGTA 2MQMA 3EUNA 2NR0A 2DCUB 2QE5A 1HL6A 1YJRA 3A13A 3PYFA 4H4OA 1IVZA 2PR1A 3FBFA 3S1TA 1AT1B 3M8YA 3G71S 4JI4F 4ZA1A 1T03A 5L39A 2RHQB 1ZPVA 1ZOTA 2KVQE 5M2UA 4DWIA 3GTYX 3IGNA 2B4BA 4Q36A 1TF8A 5J2PA 4EZ6A 1FT7A 3LQVA 4K4YA 1P9QC 2UUWA 2HUZA 1YRXA 1OMSA 4MIAA 2VASA 3KLFA 4NZ6A 3HPOA 2W2NP 2HVDA 1H73A 3EPIA 2V2VA 2RC4A 2CQGA 1YDLA 2B9XA 5HVGA 1YJ9S 3M2RA 2FLPA 3M7VA 2GVZA 1PGZA 1IUJA 2FS5A 2XMWA 2CIJA 4ZGYB 2K1RB 5AG4A 4UUWA 4MBUA 4X8IA 4DR2J 4MFBB 9RUBA 4ECWA 2W2PP 1WC6A 5KFQA 3RAQA 3GG1A 3KJNB 2GREA 5ETSA 4AXJA 1DTTA 4MJKA 2R8HA 3V4IB 1OY9A 4IOBA 4HDHA 4LQ6A 1C0UA 4DFPA 1RJJA 4H4OB 3TI0A 4LSLA 5L1KA 4DL5A 2LXUA 1BC6A 2PMZD 3MPWA 3P4UB 1NDLA 1SPBP 3GSDA 3F56A 5LRGA 1CSJA 2AYGA 2HQYA 1UWBB 2RJZA 4I2PB 4R25A 3MD3A 1EP4A 4EVYA 2BACA 2QA4S 3PIPQ 3LP2A 1RK8A 3FIXA 3BI1A 3CJ8A 3RR7A 3W60A 2VHGA 4KTQA 3ZZTA 5LSRA 2PVVA 1RSCA 2M3DA 4HT7A 6FDRA 4DQQA 1TKZB 3FFIB 4XPEA 1EIYB 1KNZA 2Z4PA 3MEGA 2B43A 4DUYJ 2RU3A 3F0AA 3I96A 4A30A 3IWEA 2DISA 5KFFA 2ZBPA 3SXOA 2C2OB 2YKNA 5EX0A 3A8JA 4OQJA 7FDRA 3MN8A 4R9MA 2WBRA 3UDLA 2PIYA 4XAKA 2FXFA 2ZKTA 2DYAA 2JC0A 4NA3A 4UBRA 4BMHA 3L9ZA 2J6TA 1QM9A 1FRMA 5KFZA 3T5LA 1T05A 2KM8C 4OZLA 4DR5F 1LFPA 3MCOA 1CPSA 4OADA 2KXNB 3T9YA 2HGMA 3RO0A 2RHSB 2IHR1 3M2UA 2VDIA 3L09A 5G22A 2OZGA 4FPRA 4QW8A 2HAFA 4TYBA 2GV1A 4OZ0A 4OI4A 2Q4YA 3J7Z5 3H8EA 4RW9A 3TTHA 2UUTA 4C2XA 2ZOMA 1UFHA 5C25B 1WK4A 2KT5A 5CABA 1S4FA 2MKYA 2LVWA 3I3GA 1X4EA 1KP6A 1ZTWA 4PQAA 1S1UB 4DR7F 5FDLB 1IB1E 3CJ3A 4CLFA 4RW7A 3R2CJ 1LW2B 3SQOP 1AUGA 5KG3A 5C24A 4PPDA 4J5OA 2J0SD 5JXSA 2IJZA 2REFA 2CDRB 4TN2A 1NPRA 4HACA 1LV5A 4B3TF 2BM0A 4GMKA 5I42B 3MGDA 1HBOA 1YX0A 1S9EA 2ASJA 4ZVOB 3DRSB 2EC2A 1XNRF 4CTAB 2ZH6A 1D9AA 2QMXA 3OFEA 3OLBA 4I49A 4O3SA 2N4DA 3Q24A 4KYZA 1JJ4A 2FHKA 1IU8A 3IWLA 3E0KA 4EMDA 3W2WB 1Y9WA 1SUQB 3FZ2A 3P6YC 1NK0A 5JVGQ 4RZRA 4OYOA 3PV8A 1UEVA 3P5BP 2KRRA 1JLBB 4YR2A 3DLGA 2RUGA 4P4JA 3ULHA 3PBBA 2JFDA 3GJQB 4MCRA 2JEFA 5HJYA 3U1MA 1I5OB 4HI1A 4J90A 5T7LA 4M95A 4BDPA 1G4CA 3G8TA 1FJGJ 1SH2A 4EO8A 3CD6S 4HVZA 5FLXY 3H2VE 5A8KB 3QT6A 5KFIA 3RNZA 2YX7A 1FE0A 4QU7A 3ZZIA 1JXVA 5DG8A 4ELVA 2EBJA 3AH6A 3M1VA 3R9EA 1BD6A 2F1FA 4B6ZA 1EZZB 5DDQC 1EE3P 4ZVUB 3PW5A 3CCES 2ZHBA 1ZG8A 3KMQA 1TTHB 2VA2A 4CGMA 2F5IA 4RWWA 2DY1A 3CO9A 3KDOA 1ZLIA 4ED1A 3UI3A 1AUDA 1RAIB 3BGRA 1UEUA 2KRBA 5C24B 2LEBA 2EWHA 3MCNA 3S9MA 3DU6A 2ZENA 1ELOA 1MLAA 3H8FA 3MPYA 1FWLA 2UXBF 2Y1IA 3EXNA 2BOAA 5KFBA 2GJFA 2EC0A 8AT1B 2JX2A 5ITHA 4K4XA 1FO1A 4OLPA 2I8EA 2DPTA 3QAEA 2H5MA 2Q66A 4MRIA 2EKYA 4AQYF 3KNAA 2YY3A 1T9WA 2WSCC 1B0TA 3OQ2A 1HIYA 3KLGB 2IC3B 4JYWA 1QAYA 3NS6A 1NJIT 4C68A 2HFUA 4RWXA 3OPKA 4DSJA 2CPYA 3BGLA 4N56A 2HNDB 4ECQA 3BQ0A 5KG5A 3AXKA 3UQSA 3RB3A 4WFAQ 2GAHC 3AXMA 4FKXA 4WWVA 5DS0A 2GJ2A 1YVFA 2HBYB 3SXLA 1FX4A 3MAQA 3HX9A 4MAKA 5AE3A 2K5TA 1YRUA 2FHOB 1URRA 2XEIA 1HMVB 2GHVC 1R8BA 4KV8A 4ANCA 4DPWA 4Y28C 3MPVA 4EO6A 3UCUP 1AMPA 5JUMA 2G1DA 5J2NA 4JI4J 4QU6A 1Y3KA 3MECB 3OBIA 3H5UA 2P6TA 2KH9A 1ROFA 2XSFA 1T05B 1V3ZA 1VC5A 2ABYA 4PWUA 4E8OA 1KOOA 2WPXA 3MM9A 1T9VA 2CZ9A 2Q4ZA 4JI0F 2DTJA 4O3RA 4Q43A 4C98A 2DR7A 1C2PA 1T9YA 2YWEA 2LECA 2ZEMA 3HHLA 2EG1A 1RTDB 3R27A 3CW2C 4I6WA 3S6GA 2HZAA 1IQZA 2H65B 3NFZA 3ISNC 4YFJA 3D0HE 4DUZJ 2B9WA 2DNNA 4URQU 4HI2A 4RN7A 4PXEA 3DOLB 4P4EA 2W2MP 1X4AA 3GE9A 3B78A 2E7VA 1GXUA 5A8WA 4P4DA 3FQLA 2J76E 1KSPA 2MDAA 5K20B 4AL5A 1ZBTA 4NEZA 1TL4A 1IBKJ 4UZBA 2WVDA 1F3VA 4TLQA 3BN4A 3BS9A 4IUSA 1GNKA 4RI1A 3QNWB 4DF8A 5HQMA 1X10A 2EEYA 4DSFA 2MEWA 3MEDB 2J0WA 2KL8A 2I3CA 4JI8J 1TL1A 3HJVA 4AT1B 5L38A 2W7OA 1VK8A 4MMOA 1XC9A 1Z8XA 3CJKB 1RT1A 2M4MA 4PK2A 2V4QA 3LACA 4M6IA 3B35A 1JLAB 4L3KA 4E0AA 1JB0C 3SIPB 1FCAA 3KLFB 2OEKA 3P5TL 4MY3A 1NCLA 1V3RA 3C6TA 3KK2A 3KG1A 1RWOB 1EETA 2PCUA 5J2PB 5MLCV 3NGRA 1CQMA 4L75A 3HSJA 3LOUA 2GFQA 3C15A 2WYRA 1Z1ZA 4ZLPA 3AJ2A 3IG1B 1A6LA 3AD9C 3VVTA 4B02A 4LUBA 5AXKA 1Z9UA 4PAAA 3BGUA 3ZNUA 2PJ5A 1NK7A 4DCJB 4IO9Q 4B10A 3NMRA 3OFHA 1X4FA 1PC4A 5CD4A 4AXVA 4KGKA 5KFXA 2XO7A 1GTHA 3PB4X 3BSCA 2ZBIA 5HAOA 4DV0F 4CGPA 1SQFA 1RDRA 1CJKB 3KNGA 3CDWA 4QBJA 2CFXA 1CS4B 1QSOA 3B82A 3M2VB 2VQEJ 2JVOA 2KHCA 3CDUA 5CYMB 4XDDA 1BUXA 4KSEB 5GAGU 4RW4A 2KN4A 4ZMMA 1DQAA 3FSIA 1M1GA 2GO9A 3DNCA 1QSTA 5IM0B 5AE2A 1YREA 2O53A 4OI1A 3HUVA 3KLEA 4J9UE 4ANEA 3AD8C 2P2CB 4Q8EA 4U7UD 1TV6B 4RL1A 4IG3A 2XC9A 4DV6J 4O0NA 2V2KA 3IMQJ 3BGFA 4NE9C 3CCVS 4LSZB 4N5SA 4J9RA 2A1BA 4PXBA 1HR0J 1CP7A 2O3DA 2QL9B 3ZZYA 3M8SA 2G3TA 4PWWA 5J2MB 4NGPA 2R7VA 3WC7A 1S0VA 2CAJA 3DI6B 4HTJA 4CH0S 1J27A 3VAJA 1IM6A 4WFXA 4J9KA 2CNTA 4BLGA 3UR0A 1XNRJ 1EX8A 4QR0A 4FAIA 3TVZA 2VBWA 4QWBA 2G2OA 2MLZA 2VONA 3P8BB 1F2OA 2YGWA 5GAEU 4RBVA 1FT8A 4UOGA 3HVAA 2UUAJ 4M5GA 3PACA 4OIXA 3CJSA 4HT5A 2JLFA 1IXKA 2VBYA 4X2TA 2QSFA 2BOPA 5DZ7A 1AW0A 5T7LB 5C2GA 3OJUA 1W25A 4K3NA 4KSIA 1TQLA 2OPPA 1FE4A 1CPXA 3R5GA 3BH7B 1HD0A 2CRLA 4DSKA 4ECUA 3R7SB 4HNWB 4ZYQA 4WE1B 3TA1A 5IS2A 4ZHRA 3NG8A 2JHEA 4LX9A 4NLOA 3KUGA 1OY6A 3OV7A 1S6PA 4LF7J 3V38A 2X3DA 3C14A 3BKFA 3E3XA 2ZW4A 2W25A 2KXHA 4KSFA 3UD5A 2PRBA 3H20A 3NWRA 2Q43A 3CB4A 4FS2A 4NA2A 2DH8A 2DNRA 5H9EK 2PJCA 3MGJA 3FNNA 3BM7A 1UTAA 2KHDA 1U1MA 3R9LA 1H8LA 2XEJA 5A2QU 2ZWOA 1VQSA 3O3LA 4OYXA 4A8XA 2PC1A 2AFUA 1CBKA 1RBAA 4K8RA 4C3KA 2DPIA 3UVJB 2XLIA 4QIVA 1S9GA 2Q7SA 2Q3PA 4Q0BA 4K59A 4Y2KA 3OW2R 3QYYA 2CJKA 2OFHX 2O67A 2K2PA 3T19A 1BQMA 4AQYJ 1NK8A 3KHZA 3M9MB 4USUA 1WF0A 2V6AA 2B8QA 4X5KA 1S1XA 3G8SA 5HANA 3DM2B 5DS7A 1SKRA 3Q8RB 1FDDA 1J5OA 2EUIA 4TU8A 4KRWA 4EYHB 4KY3A 3ZZPA 2RS2A 1KHVA 4H4MB 4MFLA 4II9A 3FEXB 2DD8S 1RBOB 1L3VA 2KXFA 1JLQB 5K9FA 3M6WA 1M5OC 4RUAA 4Z2XA 3THPA 3NCPA 2C2NA 1TL3B 4M6HA 4DV3F 3D6TB 2JLEA 2FJXA 2YWFA 2LYVA 3KL9A 2R7SA 3AOAA 4ATNA 4QCLA 3ZNJ1 4WU3A 2I38A 3FGVA 1LWFA 2D9OA 2M9KA 5F48A 2OI2A 2W24A 4FYVB 2YKNB 4QQBA 3CCRS 2HVEA 2LQBA 1NPKA 4BWJA 1XBUA 1RAFB 4UEFA 4NLYA 3MEGB 2VG7B 1E6VB 2R7OA 2YNFA 2PC6A 4OAEA 4ZPVR 3MPDA 1GMWD 4OX6A 1T11A 4F36A 1ZM9A 2ZD1A 2XZTB 1RT7A 2W7AA 3PX0A 5ETNA 2MY7A 3GILA 3TC8A 1HNXJ 4C9DA 3OUYB 1B70B 2HNYA 4WIQA 2RD5C 3MEEA 2H4WB 2ASDA 2R8KA 2W4CA 1V3SA 2YTCA 1Q78A 3M8WA 1A2ZA 4DUZF 1KD1T 5CYQA 4JI7F 4WBFA 5IXUA 2HIYA 5CAAA 4PPZA 2HRUA 1WC0A 3AQOA 3P96A 2H48B 3TARA 4HLBA 4EI2A 5GCNA 2OR4A 2ZPAA 4AL6A 1HDQA 4F4WA 2GANA 2VOPA 1SH3A 4CH1A 2FVCA 1NH8A 1XQIA 5GMEA 3B3TA 3WIUA 2D3OR 2JOQA 2MZ1A 3VAGA 1IJEB 2R7HA 2BABA 2DHGA 4TWEA 4GC7A 4PV6A 1QQ9A 3K58A 4MHNA 3DRYA 1F6TA 2BO9A 4FN5A 3MTKA 2K1RA 3JQJA 2NUHA 4AG9A 1WTBA 4OLOA 4OX7A 2ZEGA 1LW0B 2X1BA 3BO3A 1JXLA 2CXAA 4IAVA 4F0XA 1K8AT 2VG6B 3B54A 3R6LB 4X4UA 2OEJA 2LXIA 2BJ3A 1HWLA 4A8YA 2HHWA 4DS4A 2FJBB 2ROEA 2E9RX 1HNZF 2LQ9A 2XM3A 3D8PA 2BE7D 4MXUA 1VDHA 1RT3B 4M5KA 1KOHA 2BKPA 1W2IA 2APOA 2H3EB 2WSEC 4OHVA 3KUHA 4OZ2A 3KK1A 1YI2S 3B7IA 1D1UA 3AODA 4WFZA 5HO4A 1WKJA 1H74A 4RU2A 5HLFA 2X1AA 1Y5NB 4KV8B 2CPJA 5CCLA 5E3QA 1Y5IB 1BHNA 2UXCF 3LP1B 3VTIA 2C6CA 4HH1A 4KOYA 3Q83A 4CYQA 3U7JA 3CJKA 2JJ4D 3Q86A 5CBMA 4MK7A 1SIZA 1S9FA 2AFMA 3JSRA 2FLLA 1TL1B 5HVHA 1GMWA 3VGUA 1VQNS 4JI2F 1KVJA 2JEIA 2LQ5A 4X64F 3R5BA 3L3CA 3DRPA 3PEJA 4KVME 2CNKB 3EY5A 2DNYA 2Q7BA 5H86A 2GU2A 2R2UA 1M0SA 1F2GA 3V5RA 3KLVA 1R7IA 1BGXT 1VQ8S 3CE8A 4ICLB 2G2YA 2ROPA 4NI2B 2FLNA 2AJ1A 2AQ4A 2R42A 2AJ4A 3E01A 1FTRA 2ZH2A 5K8PA 1YHQS 4NF1A 3FCHA 3SI8A 1KQGB 1EKRA 1N36J 1CEZA 1E6VA 1KTVA 2E29A 3FJ2A 4J7CA 1U47A 3JQKA 3MMBA 3CD7A 1ZAVA 3HP6A 2E5GA 1AZSA 3HSZA 3ZTQA 4B12A 3IU2A 4KGVB 3QGIA 3LMSA 3HFVA 2LP4A 1T9UA 1S6UA 1FVQA 2IRXA 3MM5B 4EZ9A 4IK2A 1Q8LA 3ENQA 2O28A 2WOMA 4WXOA 3F41A 5IT4A 3Q23A 1CS4A 3R1HA 2ZKUA 3GIRA 5F3TA 5ISVA 4DV1J 1YQEA 3TW0A 1VHSA 3FX6A 2Y8YA 4MTPA 3W61A 4M5HA 5D8HB 3I4HX 3W2VB 2FHJA 3DRRA 1KLMB 1JJ2R 4QJVA 3LWMA 3NCQA 2OO4A 1WWZA 3ZTPA 1APSA 1U1OA 4A8QA 5HROA 3W8PA 2WB1D 2VL1A 3VCDA 3GV5B 1X7VA 4M5LA 3BJYA 2W8KA 2RF2B 1A7GE 1TIQA 1XNQJ 2VQFF 5JM6A 4OC3A 1AROP 4CO3A 3QMQA 1BLLE 1IYLA 4NLSA 3PEIA 4O4RA 1RKIA 1X31C 2COLA 5EGYA 4ELTA 1Q2DA 2H5JB 2AWZA 3G8QA 2F65A 4WCEQ 2AZ3A 2HBRB 1XF8A 3I6PA 2GIRA 1WHYA 5KG0A 1X4GA 2GHWA 3QLHA 2VBQA 1J2VA 4BBYA 1WC1A 4H4KA 1TKTB 1VQMS 4QIWD 5HBMB 2DHSA 2F5GA 2ABZA 4XPLA 5KFJA 3QRQA 2AD9A 4OIDA 4R76A 3UDCA 3BGRB 4MT1A 4LQGA 2DNPA 1MG7A 1IKVB 2EK1A 4K7QA 5KFCA 4PWDA 4M3SA 4LR7A 3GFYA 2BKNA 3P2FA 4HPSA 1U1RA 1Q86T 4J9NA 2V9WA 1I12A 4F3MA 3OXGA 1Q82T 2XY6A 3D4JA 1NZ8A 3CJTA 3TAMA 1CP6A 3I9SA 1H38A 4WU2A 3BSOA 1RT4A 1IKWB 3CVKA 2DITA 2GZOA 5ETOA 4KUAA 2RDIA 5BR8J 5B0DA 1D9FA 4NJQA 2UU9J 3OXLA 2YNEA 1NO8A 3R96A 2BQRA 4E2AA 3W65A 2DNGA 1LWEA 2K06A 4I0WA 4KOUA 4B3SJ 2CZVC 1SH0A 2XHWA 3SCLE 4DR3J 4Z7YA 1HNVB 1WUUA 1WNEA 1UA0A 1Q95G 1P9YA 4CLZA 3PB7X 4LF2A 4K4ZA 1D09B 2CPHA 1GYTA 2ZHAA 4ZCKA 3MM7A 2XS5A 5CYJA 2EI5A 2XLJA 3C16A 1HBUB 3DGVA 1AYEA 3DR8A 3BPSP 2JDJA 2IM1A 1U6BA 1Q8KA 3VR1A 2F9JA 2HHHF 4P6YA 2IL4A 4K2XA 2F4VJ 1M4GA 2GC8A 1T0TV 2VODA 4OZ3A 5L46A 3IRXB 1FNOA 1HW9A 3K7RA 4OC2A 5E0OA 3M8QB 1YG0A 2DKOB 1X4DA 4AL7A 1I94J 2QLJB 1OPZA 3KWMA 4D3HA 3P45B 2GLFA 4ZIWA 3FECA 3L95X 5E5NA 2IM2A 4ZY0A 2DEIA 2FJDB 3RYOA 2F4FA 2EFQA 3MEEB 3NE8A 4U95A 1IYKA 3JVNA 3MM6A 2K8GA 4F9UA 3N01A 1FY7A 4NGRA 1XMTA 2DXEA 1PILA 1QSMA 5ETKA 1H72C 1WHXA 1X12A 3TT2A 3X1LB 1FD2A 1S6QB 2CXEA 1U8WA 5K8OA 1D8YA 4UY85 3OVSA 3TVKA 2H4YB 2YX4A 2CG8A 2LA4A 2YNFB 1QUPA 4NGMA 5DETA 3SCKE 5E3RA 3KKFA 1KC8T 3UPFA 4MYUA 4FD4A 4UIAA 3LAMA 3IIBA 5M2RA 1WD6A 5KFEA 3UE2A 1S5ZA 4OHXA 1IWGA 4R87A 3VWDA 1XEZA 2DBBA 1GFWB 1L3UA 1XOVA 2SXLA 3M8PA 4Y2AA 4YDXA 1YVOA 1OS5A 4WE1A 3TAMB 4ORFA 2ZH8A 5D0EA 3SCIE 3TJ9A 2HQIA 1JLCB 4B17A 3D5MA 3GR1A 4NXMJ 1AXQA 4ZKAA 2PFDA 4DYOA 5A0YA 2AF6A 3MMJA 4CH7A 3OR1A 3DM2A 3UW1A 2HRYA 2FC9A 2BJ9A 4DV2J 3OL7A 4QIGA 2G9DA 3MXHP 1RGVA 2WVEA 4YHHJ 2JDCA 1QVGR 2ALZA 1YGHA 3PZPA 1OSDA 4ZVGA 3K5OA 4WWSA 2PRQA 2IJNA 2B9YA 3SEOA 2ADBA 2BA9A 3BSNA 2JWNA 3FJUA 4WK1A 3GMGA 2PT0A 2RAQA 2KM8B 1H0HB 1C0UB 1S7NA 2FIAA 3T41A 1NE9A 2AZ1A 2ROGA 3M9NB 2Q51A 4ZS6A 1FRXA 4OC5A 1S9EB 5M2PA 3Q8PB 2MJUA 5KG6A 1FK9B 4A8OA 2AX0A 1KUYA 2VPZB 3KLEB 2VJVA 1N5YA 2AJ6A 4NMLA 1Q4RA 4B9LA 2J9EA 1HI1A 2LQ8A 3Q8VA 2VEZA 2FIUA 2FB0A 4WZQA 2N3OA 4BWMA 4NXNJ 5A6PA 4YU9A 4TNUA 3GKRA 1V5IB 1Z8TA 3WX8A 3LALA 2ILYA 3MR6A 2CADA 3KJFB 4EGLA 5D0GA 4IDKB 4IR9A 2ZH4A 1SL1A 2HGNA 3HCXA 3J7YU 1WELA 3DYAB 1WG4A 4P44A 3CPAA 3KOAA 2PSZA 2VKZG 2BRLA 4NMXA 4MCQA 4XO0A 1FFSB 1RLDA 4ZI6A 3PVXA 1SB6A 2JDDA 2X1GA 3QAYA 4MFJA 5SUHA 1ZZFA 1YJUA 3CIMA 2Z0GA 1S72S 2CPZA 3VGVA 1OPIA 4MK9A 4C7QA 4LRAA 1T9TA 1TAQA 4LUAA 1V0CA 4FVCA 4K4UA 3CTRA 3D2MA 5D4NA 4LMZA 4DUKA 3TYTA 3MAAA 4WP9A 3CZXA 1SVDA 2XQCA 3DCAA 1T3OA 2CVIA 4DF4A 1VHEA 2ZNZA 2LFVA 3GIJA 4PR6A 2RNEA 4ZP7A 1REGX 4ZVFA 4ED5A 3PO4A 2XMVA 2FVSA 4JV5F 1ZTTA 1N56A 1N88A 2FDNA 2Z3LA 3R5CA 1AFJA 3N5BA 4IG3B 2X51A 3DKDA 3DGPB 3TUPA 2PJAA 2PEHA 3G82A 1YQHA 3VQSA 2C6GA 4CLLA 4QW9A 1YTYA 2HGLA 5ETLA 3GCXP 1VS3A 1JLAA 3RB0A 2QGFB 1ZG9A 5HP1A 3EO4A 4NOHA 4I2PA 2XYGB 2GJIA 5CYMA 2VFRA 2REEA 2Z11A 3BZQA 2L48A 1Y9KA 5KOXA 1RADB 5A8WB 4OYPA 3SV3A 4R8UB 5I3UB 3TR5A 1F5AA 2ZVIA 3H42A 4OX8A 2HURA 3PW2A 5SZTA 4HHJA 3ZZUA 4L89A 4UA3A 2XS2A 2C2RA 3CO0P 4RNHA 1TELA 5JPHA 3HD2A 2WAQD 3FMBA 2ZH9A 4DV3J 2CPIA 4X4NA 4W98A 9ATCB 5AJ3F 1M4IA 2PJ8A 2W9CB 2MB0B 4MFZA 4B5OA 1TKJA 1BPMA 5L1JA 4F2RA 1C1BB 1CJVB 3K9TA 5EBVA 4ZOSA 4C2YA 2MZRA 4YY3J 3EX7B 4LF5F 3NGTA 5KFMA 3HKWA 1E6YA 1BXNA 1K9MT 3ITHB 3NBPB 1RHRB 4FYWB 2QA1A 4LFCF 1TFYA 2J6SA 1WF2A 4B3SF 1CC7A 1J5EF 4F2SA 4ZN3A 3FRMA 4Y0FA 4G65A 2IYGA 3EE3A 2XHCA 1C1CA 3RB6A 2VQYA 3HK2A 4J9PA 4M85A 4W90B 3DRXA 4LT6A 4Y00A 2O66A 3DXSX 2YQ1A 4MY0A 3F8KA 4YOEA 5LMNF 3B4MA 3DDDA 4P74A 2ATCB 1HNXF 3TUJC 3FMWA 3H5SA 4TNOA 4JD6A 2W2QP 3MPUB 3HT3A 3PNIA 4AUKA 1PSDA 4PEOA 2CPEA 2XYHB 1NJXA 1TK5A 3VZHA 2ILZA 2A3JA 1S1WA 3DLEB 2V2QA 2W9BA 4QVTA 4EBEA 1HKAA 2AJ2A 3WBZA 1GEHA 3M8RA 4U67Q 3TJ8A 2R8IA 3NXZA 3LWUA 1GX6A 4C7HA 4DJBA 1N48A 1DURA 1RQ0A 5I0CA 4F9VA 5ETRA 1ZPWX 5D8NA 4OJGA 2O01C 2QX0A 4B9SA 1UA1A 2J7KA 3DMJA 3IWNC 4N8NA 4B3OA 1EARA 4JI1J 5J8CA 2XEFA 4KO0A 2R9LA 4Q2MA 1UVMA 2GX8A 3N0VA 4UQTA 1ARLA 4LBPA 2WVBA 2YNIB 3GIUA 1F3FA 2PSWA 3SI1A 1TK8A 1CULB 1L3KA 2PE3A 3O2IA 5IOLA 1DQ9A 3I9V9 1SKSA 3DOMA 3G87A 2MZTA 3SI2A 4C8ZA 4A8FA 4ERDA 2MQPA 1FWKA 2Z3MA 4QBUA 4NYZA 3PM9A 2B5JB 2G13A 3H25A 3GLJA 4DUYF 4ZY2A 1I3OB 4F8RA 5B7WA 1Z4EA 1MROA 3TA2A 2BX6A 4UEEA 1S97A 4UOCA 4RBTA 2E7WA 3OJSA 1B87A 1FJCA 2PR8A 1RT4B 4ZX8A 4GO7X 2DGXA 3CJQA 3TANA 2C6PA 1KEKA 1VJWA 3FBCA 1XIXA 4DPYA 1KUXA 3OSNA 2HFNA 5H84A 1MJ9A 2RUSA 3DLGB 4FXVA 3JXOA 4GRSA 4KPCA 1RYSA 1X5TA 3DHWC 3QNVA 3HVTB 2Z8QA 2MYFA 5F46A 5DQHA 2ZE2B 2BM1A 4IKAA 3KUEA 3HVRA 5D29A 2DNHA 2IBOA 1F5BA 1TKTA 3CMQA 3SZ2A 3RAXA 4B9MA 4CRJA 4ZVQB 3TQ1A 3QLHB 5H9FJ 5DDOC 8ATCB 1U6ZA 4MIWA 1CC8A 3GU0A 3RBUA 3DLBA 2OIHA 1KQKA 3DLEA 5EWGA 4KSAA 3T1HJ 4KOWA 4DR7J 4RW7B 2ASLA 1HD1A 1PAEX 4I2QA 1TUWA 4NLRA 4ECYA 2ZZTA 2AGPA 3ONQA 2IRYA 1CX8A 2NPFA 4EFDA 4UOHA 4DI6A 1YBTA 3J80U 3MUTP 1HBOB 1T9XA 3HHLD 1M5HA 4W9YA 1R0AA 3RB4A 1RTHA 3KMSA 1NJZA 4MFPA 5IC6B 4CM2A 1LEOA 2HAIA 4OYIA 2L41A 2P9GA 3CJ0A 2CQBA 1HNZJ 2IBKA 1LW2A 4DPUA 1RBLA 3BO4A 4P7VA 1CPZA 1C0TB 3DGPA 2EKNA 2XMTA 1N6QB 3T6JA 3M2VA 4V19X 4L72B 2B4PA 1XEBA 5DDPC 1BWVA 1B0VA 4NLWA 2BXJA 2AFOA 3PR5B 3UDVA 1ARMA 3GWCA 5C25A 2H51B 1JNRB 3NY0A 1AUSL 4KAIA 3J81U 2E9ZA 4ELUA 2NXNA 4KGXB 5KT2A 1PJ7A 2FC8A 2AGOA 3KZWA 1RP5A 2YKAA 1IBLJ 1MU2A 4J9OA 5KFYA 3DLKB 4FBTA 4RW8B 1R31A 2M8DB 3LW5C 2KFYA 1FFGB 3CD5A 3QATA 3B2YA 3W8GA 4P45A 4M5DB 3R8YA 4B11A 4G1PA 3W9HA 1VQ6S 4RUBA 2DR8A 2QLFB 3L7PA 1UVIA 5F9LA 4OYWA 1XMQJ 4OZJA 3HFKA 3E2EA 1CLFA 4FYYB 4FNIA 4FWUA 3SJEA 1XIQA 2PI5A 3IR6B 3KDNA 3QGHA 1QDUB 3M4XA 2QT7A 2DY9A 1GQEA 3IR7B 1S1VB 8RUCA 5B09A 4ZP9A 4NCGA 2MQLA 1H2UX 2IVYA 4IF5A 4QYRA 1X4BA 1ZG7A 3RZAA 4P72A 1BAVA 2B8PA 4CAEA 4DR1F 2V94A 1YLOA 2DF5A 2B56A 4LSLB 5HH1A 2E9TA 4CRYB 4C8LA 3CDEA 4TYAA 4ZVEA 1PC5A 3PRTA 3IWGA 5C5JA 1OQ3A 3TO8A 2HIQA 3EPGA 2HSEB 1DY3A 3TA0A 4NLQA 4KH0B 3F0NA 4PXDA 3EZOA 3OWCA 2F40A 3J7YI 3IXQA 4ZVHA 2PJ6A 5AT1B 1U45A 4RW4B 1RA6A 1UAWA 2CNNB 3UO0A 1UWBA 4L6V3 3CCSS 3KGQA 3TOBA 1KLNA 3D1HA 2K3IA 2CQDA 7AT1B 2AYBA 2I1RA 3CUNA 1WORA 2ODFA 5IX3A 3V6DA 2M70A 1SQEA 4AD6A 2DGVA 2AJQA 4B9VA 1N33J 3JQMA 2DT9A 2HNZA 3T1AA 2VH7A 3N6LA 4K50A 4B08A 1SC4B 1Q7YT 2HZCA 3TEGA 3N6MA 4P9SA 3CXQA 5AJ3J 4X66F 4ETXA 1JX4A 2MHNA 2VC0A 4MHYA 1B64A 4HHHA 3MZIA 4ZPWR 3KHLA 1NAQA 2HVHA 1HDUA 1R0AB 2J9CA 2WZ1A 3QT5A 2F63A 5IQQA 2MQ8A 1Q0NA 3CNQP 3WC6A 3KKWA 1BOBA 3ZTSA 4JI3J 5KFTA 5L9XA 4Q5VA 4EU0A 1K1SA 1ULRA 2J5AA 4OMEA 3SJFA 2HKEA 1WC5A 3C6TB 1N8RT 2UVUA 4ECZA 2I9SA 3UR3C 4ZVSB 1UCNA 3PHTA 4E8UA 3EXCX 2LU1A 3DSBA 4U7CA 4UZCA 4NCZA 3WC0A 2ATRA 4MCPA 4C0BA 4I6AA 1T94A 1NLKL 4F4ZA 2UVRA 3D4UA 4CO2A 5EX3A 3J80Y 2E5JA 4OC1A 2YH0A 1IICA 1RXTA 3IEHA 5LRJA 3IM8A 2KCWA 4OI6A 5G1ZA 2VPYB 1NDCA 1KONA 3GCWP 2WVCA 2XMJA 2AE6A 4U8VA 1J4JA 3CGIA 4C8MA 2K7KA 1W2BR 1VBXA 4GS4A 3C66A 2RDDA 1TMJA 5I3QA 2HFOA 3ADAC 3V7ZA 1FFWB 1IOFA 3HSDA 4A8SA 3W7BA 5C42A 3KQXA 4J3GA 3Q2SC 1N5TA 5KT4A 2HHPA 1FJEB 4L74A 4CAVA 2ASYA 3HSGA 1MROB 4JI8F 1F9EB 2GHPA 3W6SA 2BCOA 1RCOB 2KJVA 1D3WA 4OV6A 4X65J 4IQXA 1VHOA 4J9MA 2W8LA 2BQ3A 4GM5A 3KTQA 4WTYA 2FY8A 4GKJF 1RB0A 2OSRA 2YNHB 4C3LA 4DR6F 2JNJA 2RFHA 4Q2LA 4YN3B 1B7YB 3AB2B 4DX7A 3JTPA 5GAHI 4DG1A 4IR1A 4U5YA 4K4VA 3B6BA 3PYDA 4KOTA 4KFBB 3WC2A 2JVRA 3DLJA 4P10A 4QYZK 2FQQB 3MECA 4LQ9A 4NA1A 4B3RF 1G6BA 2CPXA 1P8GA 4Y49B 3EVOA 1F1BB 4ENOA 1YVKA 2ARHA 2MKSA 2RQ4A 1SL0A 2DGWA 2V8DA 4H6ZA 1U6FA 1G7CB 3G4SS 4JV0A 3D2WA 2JEGA 1HHQA 4DPOA 2J8AA 1S0OA 1PO6A 2GGPA 2DXFA 1YWXA 1DARA 1X0FA 4ZCLA 3KFWX 2DEJA 2G0JA 4J9SA 1KFSA 3MM6B 4C4WA 5EWFA 4YUDA 2BJEA 3NS5A 1VYAA 4B3MJ 1XFOA 2M2BA 4XPCA 3CMAS 4H4MA 2VOOA 1N6QA 3TRGA 3MUVP 4DL3A 2A2DA 2IDEA 5CNPA 2B4UA 2NSBA 2IMWP 3IRXA 2PN6A 1TUVA 2DEAA 1SV5A 3W1YC 3NRBA 4DZDA 1SCJB 3PKMA 3JB9k 2C1EB 1RWVB 1Q79A 1K73T 3BYPA 5DGAA 4MKBA 1H7WA 3M32A 3OR2B 3W9JA 2NYQA 2LA6A 4CO4A 2QLBB 3IWXA 3CIZA 4CQ1A 1YX2A 3QRRA 2NREA 2RS8A 2R7UA 3A8EA 4CNZA 2ZOFA 6AT1B 3BQ1A 3H59A 1NU4A 1FNMA 3IS9B 4UT4A 1MNEA 1UVKA 1S6PB 3V6JA 5H9EJ 2PJ0A 2GVDA 2DPSA 1U1KA 2CQIA 4KR0B 4OYBA 4MKYA 5FIIA 1EKSA 2KO1A 1NK9A 4LFAF 4FPIA 5D4LA 4FXDA 2PDOA 1RUSA 4P73A 4KZTA 4M6GA 1E6YB 7CPAA 2UUAF 2G9OA 2HNZB 2C3MA 4UQGA 1RWWB 4ZHRB 1C1BA 1CJVA 3O5TB 3M2UB 3VATA 4FNHA 3V6DB 3NCRA 2ZBCA 5J2QB 3VF0B 3LA0A 3QAHA 1IR1A 3BHXA 1BQNA 4IRDA 3TOQA 4DCPB 4DSLA 4WIIA 1Z2LA 3FSXA 3GG0A 2IVFB 2V4JB 4U6PA 3K8WA 4YWYA 2CJBA 2HBQB 2R8GA 4WZMA 2D69A 1I6JA 4YGOA 1BO4A 5IC4B 3EZ5A 1MJBA 1CG2A 5HMXA 4AVAA 2CPFA 1NJWA 4WF9Q 4AVBA 1LK5A 2B4DB 1P1LA 2B5JA 2Y1LB 1XMQF 4MI4A 2ZH1A 2YWWA 1HWIA 1UW4A 3NAIA 3BGOP 4LBHA 1Z4RA 5J1EB 5HP1B 2R7QA 2B4OA 2DO4A 2V77A 2YNDA 4U9YA 3WR7A 3LD2A 4X62F 4KS9A 1NDKA 5HXDA 3IO1A 1Z8WA 4ZLJA 4NXNF 1VHFA 3QQCD 5D4OA 4DR1J 5ADZA 2IFXA 4PYDA 1UFKA 4LFBF 2H5EA 2HQDA 4IOAQ 4A94A 2RDJA 3AAWB 4MFKA 4FYDA 3NLCA 2IQ6A 4DX8H 4ANDA 4N76A 1RHQB 3CPXA 2VXKA 5ETTA 5GADI 5KFVA 3PKYA 3CJ2A 2AU0A 2R8VA 3FCWA 4RNFA 1KLMA 2WVFA 3BKUA 3EFAA 3AB4B 3G86A 5CCMA 3I0RA 2XY5A 4CLSA 4OLLA 2V9KA 1RU1A 1O51A 4YR0A 2FPHX 1RO5A 4C8YA 3PY8A 2UP1A 3NH5A 2DNMA 5D78A 4CLUA 3OFGA 3ZZZA 1KFDA 3AOBA 2VZ9A 2OZHA 1Q53A 3C6UA 4DPXA 4I6YA 1Y00A 1C0TA 3QPIA 3GV7B 1JLCA 1SC3B 2N82B 1VI7A 2F3JA 2NPIA 4ZP6A 1FKPB 4P2MA 1FRJA 3GYGA 2WK4A 2HWTA 1C4AA 2BUNA 5LMNJ 2R2SA 1VLYA 1WOPA 3M8PB 3FEDA 1VCTA 4FVMA 3IWWA 4A33A 4KHPF 1L5UA 1QD1A 1SC6A 3MCMA 3C15B 4F4KA 1I21A 3TFYA 2ZDOA 3F44A 2QA4G 1Y9OA 5E3AA 4OHYA 3NH8A 2MMYA 3TO6A 3PTWA 3S6KA 1T8EA 1Q8IA 3CCLS 4ALZA 3HF5A 4RO0A 1U4BA 2PA3A 4CYUB 3B4DA 3QRPA 3UN2A 3OHAA 1RYRA 2KTQA 2F7VA 5EUHA 1WSRA 1G2EA 2HS0A 2HMIA 2YX1A 4MFBA 1IY7A 1ZH5A 3C26A 5LMUF 2BE9B 2HFZA 2U1AA 3SMZA 1NHVA 4M5MA 5I3UA 3PDNA 3AA9A 3BDPA 5KFGA 2E5LJ 3QIDA 4GO5X 1SQHA 3CCQS 4XDCA 2VA3A 1K47A 2AGQA 3NGDA 1QSNA 3PYGA 4CM0A 5HATA 4R0JA 1UW9A 1F5CA 1CJUB 2XSJA 2OZUA 2LEPA 1FEHA 3G6YA 4N41A 4X4VA 3U1LA 3GPAA 4HDGA 1NEEA 5A0YB 4LR9A 1HYSB 2IIHA 5K14B 1Y3JA 4X65F 1GX5A 1ZS6A 1J5EJ 1S48A 3E51A 2M52A 2XCAA 4TKTA 4O3QA 4K5SA 3K5LA 2D3O1 1ITPA 4O4GA 1HHSA 1V9OA 3SFUA 1DFDA 4NJRA 2DNQA 4LSNA 3IBWA 1N0VC 3ZJ0A 4BD9A 3TOAA 4MHZA 4F50A 4WPAA 4F4AA 4DCOB 3ZTRA 2ZJQQ 4CP5A 1S0MA 4YP3A 2ZJRQ 2F4VF 1S6QA 1FEEA 3GR0A 1I51B 3T5KA 1QY7A 3PW7A 4B3RJ 3AHPA 1RHKB 3EICA 3M8ZA 1LANA 1URNA 2XLKA 4LF6J 4ZCMA 4DUTA 2GLJA 1PAUB 1UVLA 1RT2B 4DJLA 2OTLS 2IYIA 4J91A 1S49A 2AIRB 2QV6A 4LVOP 1K0TA 3DMJB 2Z58B 2DHHA 4UCPA 2PIZA 4LBIA 4DXLA 4X4PA 5G20A 1Q2CA 3D0IE 4DHVA 5F0WA 3RG6A 4C7IA 4ECVA 4IRCA 1XJOA 2PGCA 2D9PA 2GIQA 2C3OA 4DFKA 3AY0A 4X4QA 1VGYA 3KLHB 4DPTA 1ELLP 4ZDNA 2B6AA 2FGCA 2I6WA 2RRAA 2AEFA 4X64J 4H4KC 5F09A 3JTNA 3PHEA 1RA7A 2CWXA 1XTZA 1WG1A 3I4PA 3K5MA 4DN0A 1OYEA 1RT5A 4OP4A 3QZ8A 1M5VC 1HR0F 4UFXA 3OUYA 3CJ5A 3MMCA 2PI4A 3ZFVA 1KR4A 2DXDA 1N5YB 4ZPTR 4I67A 2ZD1B 2LEAA 1Q5VA 2X7BA 1M1HA 3U1NA 5CPAA 5KTDA 2KDOA 3TP2A 4M5JA 2C1CA 3U02A 4NSQA 1QVFR 2HHTA 4IG0B 2V8VA 2QYCA 1Z5RA 2E1RA 4ED2A 3FRYA 1R57A 2J0XA 4Y6IA 1LAPA 1R43A 2HHQA 2HHXA 3CCJS 1GT8A 4TVAB 2RIJA 1U02A 1VQ9S 1BQNB 2E5IA 1S79A 2OPPB 3R5AA 4KH1B 3I56S 4Q38A 5KT3A 1RWXB 3ETMA 5AGEA 3TJAA 1RTIA 3LP0A 4YR3A 3W2WA 2KVIA 4PRFA 5IT9Y 2HLUA 2BKOA 3M6XA 1J5OB 2BE2A 5KFRA 4JJXA 4IFVA 4Y65A 3SSQA 3OTOJ 1X9WA 4TQSA 2XS7A 2QZ8A 2XGQA 5DQGA 2GNKA 2FE7A 4PG6A 4USIA 4OC0A 2QECA 3K57A 1TU0B 4GKKJ 1AB8A 3M32B 2BEFA 3CCUS 3R1KA 3DOMB 2ZBQA 1H6KX 2CVEA 5T41A 3VWEA 4TQRA 5LRKA 1QMUA 1IQTA 4U96A 4NRUA 4X4TA 1F9FA 4LIRA 1PYTA 2PJ2A 4QPXA 1FRLA 2NXUA 2DNKA 2IJFA 4L76A 5JQ4A 2YKMA 1IKXB 2ACMA 1TV6A 3FZBA 2BQUA 1NNDA 3V81A 4QZVB 2OGUA 4DQSA 2AKWB 5JVHQ 2BDPA 4X2BA 3TNVA 3EVMA 4ILRA 2MKHA 2GQCA 1RWPB 1Q7LA 2YBVA 3B3WA 2UV8G 5F47A 1VIOA 5FDLA 4UOFA 3TZWA 2B3VA 6FD1A 3DRPB 5LXYA 2XEGA 2VPXB 1U24A 4URGA 2WHOA 2BMBA 3HM9A 2NZCA 2DJWA 2HC9A 4Z37A 4KVXA 4U8YA 1T02A 5KT5A 4MHDA 3W6XA 4XPDC 1TUGB 3FEEA 1M1KT 5L8RC 2Y0SD 1S0NA 3MM8B 3T9ZA 5F9NA 2W1BA 3HT0A 3NAHA 4ZCIA 2MGZA 3I0SA 5E3PA 1QE1A 2O1PA 4A37A 1UPPA 2I0XA 4ED3A 4LSNB 2GS8A 4WYWA 3I32A 4F6AA 3R7NB 1EQ0A 2R1IA 5DLGA 3KK1B 3PX6A 3SV4A 4DR3F 3HI9A 2Q4VA 3KJVB 4MKAA 3R7BB 3W5YA 2DB1A 1X4HA 1KN6A 2G0IA 1XE4A 2OPQB 2Q0YA 4NFRA 3RBDA 3JRUA 1LWEB 1PBUA 4RX6A 3RRKA 4JXQA 2J6UA 5B0EA 4W4MA 3GFZA 3AJ1A 2OTJS 2FZCB 3PCOB 3QO9B 2EVZA 2IMOA 1TKZA 2ZEPA 4CT9A 1LW0A 4F04B 5LXRA 2M5YA 2WPWA 3GFHA 2DR9A 2HK3A 2Q44A 2CQPA 4GVLA 1MJAA 2G0CA 3SDEB 4O0IA 1QJHA 1UMJA 1HEEA 5IV4A 3IAS9 5IM0A 3KR4A 1KTQA 2EK6A 4EBCA 2C2ZB 4PUOB 5GADU 1UWYA 5DDRC 4OX9F 3K2YA 1YKWA 2AFWA 2B4VA 3THVA 3NL0A 3RUBL 3BBCA 3LPEA 4J9VA 4G6VB 4YMEA 1UL3A 3OFFA 1KWMA 4B5PA 1TKDA 4A95A 1OY8A 2ZW6A 4YY3F 3ENWA 4OJHA 4NXYA 3GSIA 4QWCA 2V50A 3CC2S 5D3GB 2GMHA 2XMAA 3NNHA 2OB0A 2POKA 2LXFA 2ZUGA 4DU8A 3A4TA 2CTBA 4YQWA 3EWGA 1YMEA 2I5JA 3QT8A 1MSWD 4B9UA 2W01A 3OTDA 1Y7PA 2GVZB 3MTJA 3GQCA 5IQ6A 1N32F 2F9DA 2J7WA 1HQ2A 1LXJA 2PFFB 5A2QY 2FVPA 5KOWA 4NYPA 4S0MA 2ZC3A 3OHBA 3H5ZA 3LH2S 1TL7B 3JUWA 4NCBA 2QLWA 5LT5A 1XK8A 1S7FA 3KK2B 4WFBQ 2GAGC 2B51A 2MSTA 3RGIA 1L3TA 1U7LA 4XK8C 3UFCX 4C3MA 2A6OA 5ELYA 3GIIA 1P4NA 1TR0A 1YZ7A 3TO7A 2LDIA 5KFWA 4JI7J 5I4MA 4A47A 2FZKB 2B3TB 2CIMA 4NGSA 5F8IA 4C8OA 4LIWA 1M44A 2XCPA 1GMUA 1LOKA 1EJ7L 4A46A 4UWIA 3FEYB 3FC9A 3PYEA 4Q45A 2RMLA 3FVYA 2UXDF 4KORA 1KDNA 2CTCA 4JI6F 1R89A 4KPYA 3K89A 1XJWB 3QGGA 3WX4A 4ID5A 5HVFA 2EVNA 3FUYA 2FJWA 2LDYA 1ZM4A 2OH1A 3H5YA 4JYAF 3WDOA 1UWAA 1Y7RA 2HQCA 2PE8A 2XTJP 2QYGA 4YB7A 1H2VZ 4R5PB 2J8NA 5J1EA 3ILIA 2QEXS 4IYQA 3PEHA 2ZJPQ 4HHUA 4I69A 1BMQB 2YKQA 1WWHA 3J7ZT 4TY8A 4J9LA 3VAMA 2WBMA 3OL6A 5J2QA 4PCQA 2Y8WA 3Q8QB 1YR0A 3CEDA 3PZJA 1FXLA 1SJ4P 2V2ZA 1QSYA 2YNCA 5KFNA 1XMOJ 2IDLA 4KGMA 4Y2CA 3BH6B 3FCVA 2HQGA 4K4TA 1OBRA 3TUIC 2GO8A 4B14A 3DOKA 2PMWA 1DZ5A 2OEMA 3M1VB 2ZW5A 3GIKA 3KHGA 4M94A 3IBFB 3EGNA 1JLFA 2HG4A 2GVDB 2R7TA 2P6FA 1FF2A 2ERRA 4FYXB 2YVSA 3OTOF 3IS9A 1XNQF 2IPOB 3LO3A 5L1LA 4IO1A 1BQXA 2BV3A 1OQ6A 5AXMA 4JUZA 2G2ZA 4GKKF 1IR0A 3R9GA 5IFMA 3QIPA 3OT9A 1VQKS 1ZAWA 3EDQB 2N4CA 3SFGA 1R27B 2YKMB 4MYTA 1TZ0A 2G1HA 1FKAF 3BI0A 1DE4C 4NGTA 4WP3A 2JC1A 2FHMA 5F8LA 2ZH7A 2R3VA 2VKRA 3V6HA 5F0UA 1N36F 3PB8X 3G9CA 3UVJA 2VFTA 2JH3A 4P4IA 4CYNA 1PYTB 5A8RA 1S77D 1JLGB 1PBAA 1A0OB 2WONB 2QO3A 3I5CA 2ZH3A 2XMKA 5KFUA 4KOXA 4N47A 2OHDA 2XO6A 3CF5Q 1M5KC 2K7JA 1UFLA 2A4NA 2KKHA 4ES3A 4QC6A 4UWJA 2HK2A 1M4LA 3JTOA 4UW2A 2D41A 4WJBA 1VISA 1GXTA 3H7HB 1LXNA 3RAMA 1FI4A 1X9SA 1K4JA 4MHPA 3OR1B 1U49A 2OOTA 4UEZA 5BYQA 3QFHA 2V5HG 2VI7A 4LF9J 4DDFA 5HMZA 1RT6A 1UFWA 1F2HA 2GMJA 2ZZNA 4FD5A 3M30A 2W2OP 1Q81T 3O44A 2RVJA 1Y0YA 4C11B 3FKBA 3CC4S 3ZO7A 3FBUA 2GQ2A 5GVQA 3MM7B 5CHCB 3PP9A 4ZPAA 3QJJA 4P75A 3VAFA 2VPWB 3BQ2A 1HBNA 1DTDA 4E2FB 2YNHA 3MMAA 2GQQA 1VRTA 2V4RA 1SQGA 1FJ7A 4FP9A 2R7XA 2KYZA 1N34J 3K5NA 2MLYA 4KHPJ 4DLEA 1PU9A 2AJ0A 1NHUA 4KFBA 4WFNQ 4GVBA 1KUVA 3HDSA 5LSLA 2QMLA 1RKJA 3PR4A 1IM4A 2E1CA 2OP5A 1HWJA 1PUAA 4DEZA 2HHHJ 3IJ3A 2JSXA 3M6UA 4X62J 5ETQA 1JNZB 4WTOB 3JAMY 4ICLA 1VK3A 5F8JA 2GE3A 2VB6A 3CXPA 4I64A 3PW0A 1MW7A 4LVNP 5FLXU 4JP8A 3WQPA 2VUGA 3HFZB 4UCNA 1VKCA 3FSYA 2V69A 4RPFA 1NKCA 3NGUA 2XWYA 1I94F 2Y3YA 3R2DJ 2R7RA 4LRCA 2CQ2A 3AA8A 1U25A 4RNOA 3C8YA 1ZETA 1GK8A 3BO2A 3C3LA 2MHEA 1YK9A 3PIOQ 1LWXA 2HHUA 2NZ4A 4X66J 1R3NA 1NB2A 3QT7A 3GP9A 5F41A 1RT2A 1REVA 4LJMA 1EB0A 1HBUA 1TKXA 2Z2LA 1DTTB 2R4FA 4WKYA 2EFVA 2JRSA 1U0HB 3H98A 3QSIA 2J9AA 2DK2A 1DTQA 2JBKA 3PB9X 5AG5A 3HHEA 4CT8A 4ZJQA 5A27A 3JYTB 2B7BB 2EW9A 2XZWA 1XR6A 5DM6Q 4KC5A 5HN0A 1WG5A 1HNWF 2QMUB 3TZYA 3JSYA 4CGNA 4A38A 2P9CA 4WP8A 3JYTA 4XPKA 2VG6A 1SBRA 4H54A 2VJUA 2MQNA 3OL9A 1N4LA 2HHSA 1NJYA 3G3SA 4CIOA 3IR5B 5BJRA 2HLTA 2BANA 3VALA 2GA7A 2A18A 2JFKA 1VFJA 1Q8BA 3MEDA 1CJUA 2AFXA 3T3FA 2HVZA 3BB5A 2FSRA 1XR5A 4A8KA 1Y10A 1N0UA 1U2FA 2WTFA 3N28A 3L7UA 1EP4B 5DGBA 2R98A 3CCWA 4U9RA 1VRUA 2P6EA 2HEKA 4PG4A 1FHTA 2WW4A 5B0AA 2DRAA 3O8WA 2ZELA 1IKVA 2J7UA 2OFGX 2C28A 1S1TA 2PMHA 3AQPA 2YXLA 2CNLB 3IA0A 1ELMP 1TF9A 5CD4H 1S1TB 2YNGB 4X4SA 3IGVA 1WI6A 1RAAB 2VU5A 2C42A 4MFQA 5GAEI 4ZBGA 5KFHA 1M4DA 3W66A 1RWMB 2CQ1A 5JJBA 2MQOA 2R2TA 5A6WA 5AE1A 2WUUA 4TU9A 1VBYA 3RR8A 2CJXB 3C6UB 1FKOB 1WEZA 2P9EA 3UCGA 3EVWA 2HWIA 3S01A 3KQZA 3OL8A 4G1QB 3ZC4A 1NK4A 1RLCL 1HI0P 1S7IA 4C97A 2RU9A 1VIXA 3D6HB 2XEXA 4MIBA 1HNIA 4TY9A 4C2ZA 2AFZA 4BINA 4JI5F 5DO2A 3KXDA 3MCSA 3RW7A 5F8NA 3K2KA 3I0SB 3SJGA 2AV5A 4NLGA 4WKRA 4CO1A 3RRGA 2ZEOA 4O44A 1UKUA 4C11A 1Z8LA 4M5DA 3RRHA 5JGFA 3GYNA 1REVB 1RISA 1JLQA 4KHMA 1NM2A 2QA2A 1AA1B 3EXYA 2NYIA 3I0RB 3LAKA 1WC4A 3KLIB 3MEKA 3NMAA 5A76A 1O6XA 3CJ4A 1R8AA 1X8DA 5LYFA 4A2ZA 1JLEA 2WSAA 5T14A 2FUG9 4I7FB 2V63A 2XY7A 3F73A 2FL4A 1IKYA 5KT6A 4USHA 5AXLA 5KFPA 4NLDA 2H1YA 3H4BA 2EK8A 2DXQA 2VFUA 2NUUG 4ECXA 5LM7E 1NDPA 5A28A 4ZVPB 4BC9A 4C2MA 2IC3A 2J9DA 4OYAA 5L1IA 1R0BG 3EZUA 2ZWPA 3HLPA 3V81B 2HFSA 5I42A 1RT1B 1VOMA 4OFZA 5K8MA 3B8HA 4DQIA 1LCPA 4BCAA 1K0VA 3DLLQ 2QL7B 1Z4UA 4Q8FA 7FD1A 2VBXA 4Y49C 4OI2A 4L8AA 3NS7B 4DN9A 3V2UC 5BWAB 4DOZA 4DX6A 2BE2B 2ZVSA 4DV1F 3RTVA 2YH1A 2C27A 4ZPDA 2CJQA 1VQPS 2CQ4A 2OPRA 3T5HA 1QSRA 5F49A 2EPIA 3QB8A 3KJQB 1EAYC 2MKCA 2OSQA 3GJTB 1TVRB 5KTCA 1M5SA 2AHOB 4QR1A 3RBZA 1N52B 1WOOA 4F25A 4CLTA 3ZZ0A 1IGBA 4OC4A 1QTMA 3WABA 1U1QA 1RT7B 1SL2A 2B9EA 5K5MA 4NWBA 1O0PA 5DWNA 1QAJA 1FJGF 3VWSA 2BR0A 3HLUA 3IU1A 2RSQA 3O1LA 2KB2A 3S9LA 3VH9A 4CLKA 4KIAA 4F02A 3LP0B 1RABB 2G3AA 2YWHA 1QSLA 2PJBA 2DH7A 2DGOA 1U8SA 1S7LA 1S60A 3SI0A 1SJ3P 3I31A 1CBXA 4USTA 1RU2A 4ED8A 1IIDA 1PYSB 1HHTP 1FDBA 3OLAA 3MR5A 4ZJOA 1JLBA 3FB3A 4LF8F 2M0GB 4DMZA 4ETZA 1U6MA 1IOIA 1DTQB 2M7SA 1YK3A 2IAJA 2BSWA 2UVWA 1FWPA 4M5IA 3OTCA 5DLFA 4FDFA 3P2HA 3MMCB 2XG8A 3H40A 3RBEA 5A8RB 4IHMA 2VZZA 3B3VA 4KKOA 4JV1A 1JIHA 1HWKA 1Q1KA 5B08A 3KASA 4B3OB 1QAXA 4DS5A 3PJ9A 3M9OB 1O5JA 4KOSA 2E1MC 3DC2A 5E96A 4I4BA 2CQCA 3ET6B 4RW9B 1IBKF 2NSCA 3ET6A 3L7OA 3DN9A 1VQLS 1LRZA 3K5PA 1WJ9A 3P49B 2KFZA 2OAUA 2OMOA 3IRWP 4JZ0A 3R5JB 1WC3A 1CJWA 1RTQA 2VD3A 2HS4A 1N71A 3GB0A 4EK2A 4MK8A 5BR8F 2B7CB 1DRZA 2N3LA 2NXEA 2AP6A 4HL9A 1N5VA 3AOCA 2P8IA 1FX2A 4R7MA 1XN9A 1VC6A 2Z2YB 3UY5A 2BVZA 3LF0A 2PQ8A 4QOTA 4OI3A 3BKTA 4DBQA 3UN5A 3HZGA 2I00A 1QAIA 2Z3OA 1UP1A 4LR8A 1S76D 1PKUA 4LFCJ 4RLEA 3GONA 3I5AA 1VRTB 4NPOA 2CUYA 2IA0A 4EUVA 4CGLA 4G3IA 2IAJB 4NL5A 2ZM6F 2NSMA 3S6FA 1FXDA 4X84A 4WK3A 2CY2A 3KG0A 2QFIA 4DR6J 2UUCJ 1KVKA 2B5GB 1UJ6A 1HNWJ 2EBEA 4CCHA 1RACB 4B13A 1VJQA 1C1CB 1TL3A 1CULA 3OVBA 3CCTA 4WXWA 2YWKA 3C19A 4PK3A 3DNSA 3UDEA 1WI8A 4QR2A 1EHWA 2BW7A 3CULA 5A8KA 3FVLA 5KAKA 5K8NA 4QPTA 1NK6A 4P4BA 1X9MA 4LRDA 5LMUJ 4K2JA 1IKWA 2BJ1A 2LCWA 3UN3A 3EGVA 2VQEF 5EN1A 4ECSA 3B3SA 4ZITA 4M63A 2VICA 1FRKA 1CQNA 1U1LA 3RJMB 4I1TA 4OZ5A 4CYUA 2BBEA 2ZNYA 5LSOA 4ZK7M 4PWDB 3TVYA 3FEZA 2RRNA 3TZXA 4JI6J 1GXLA 4L73A 1H7XA 1YW4A 2W9BB 3QSYB 4DFJA 5L9NA 3HZEA 5LYIA 2YQ3A 4U9ZA 2KG0A 3NNCA 3PX4A 1RWKB 4UUXA 3TX0A 4AVCA 3T6BA 4CTAA 5HBMA 5G0RA 2ZFHA 2HMIB 4ZX9A 4ZY1A 2ZXVA 3C46A 1OJ4A 4OHZA 2ZEDA 2QSWA 2JEJA 2PJ1A 1UZDA 1PCAA 2DR5A 1X0PA 4URSA 1HA1A 5EDWA 2E5HA 1D0EA 4CDIA 3TAQA 3A3NB 3N5FA 4F3QA 4IUFA 3U27A 3KJVA 4AB7A 5BXIA 2XI2A 4C0HA 2MXYA 3ZZOA 1WDDA 1SJ1A 3VAIA 4R8FA 5HMNA 1QUVA 3A8KA 5KFKA 1RAOA 4H2KA 3HO1A 2EFOA 1BY9A 4WYLA 1MMLA 4YHHF 3CCZA 1TK0A 4USKA 2L08A 3D7GA 3B3CA 3KHXA 2J9DE 3MAAB 1GH8A 3DYAA 4ZJLA 2EFNA 1T03B 1AZSB 2H9ZA 4IDKA 4RW6B 5KFOA 4ZIVA 3D1QA 3NWGA 4B5PB 2ZEJA 2CQ3A 3HHLC 2HNDA 2OJ3A 4E98A 2WRMA 2E1PA 2J8RA 4OYMA 4ED7A 5FVJA 5LYLA 2NCKL 3J7A1 1CM0A 5AG7A 1X60A 2BJ8A 4BHQA 2NS1B 4ZLLA 4R5PA 4X3RA 2VBZA 4YS2A 5CH7B 1XWLA 2VFVA 4JOUA 3PBEA 1MMDA 4KUBA 4KT0C 2V8GA 3HKZD 3SYZA 1IKXA 1UZHA 2IA6A 1TL5A 2EFGA 3GJSB 3UNGC 2FVRA 5J1PA 2ZEEA 4JYAJ 2XI3A 2H5IB 2C3YA 4K5RA 4QWAA 2ZBRA 1HFEL 2RB7A 4YRHA 3BYRA 3QJLA 2KJWA 3GYXB 4Y3CA 2E44A 1K44A 2CPDA 4ZVRB 4I7FA 2HV2A 2UVVA 4K4WA 3DLKA 4IH5A 1FERA 1B7FA 3GJRB 1YLXA 3NKYA 1VRUB 2HRTA 3D3SA 4DV5F 1F57A 5CZVA 5I3PA 3KK3A 4U7UK 5J8FA 1YGYA 4XNHC 3LANA 2KT3A 2DRBA 4C8NA 1JKHB 3T1YF 2B4DA 1TKHA 1VLOA 1U0SA 3V8IA 1PJ5A 2ZE2A 3HD1A 2CG4A 1D8ZA 1FRIA 2Z2ZA 5KFSA 4O44B 3D1OA 1YW6A 3HVTA 2M88A 3IM9A 1S6OA 2R2RA 3D68A 3QBCA 2OD4A 2PO4A 4OV1A 2BJDA 4DSIA 3MI7X 2QVPA 4RUHA 3FBEA 4CGOA 3MM9B 3NH4A 2VDHA 3S7RA 1U0HA 3BR8A 2UU9F 2EG2A 1YJVA 2B58A 3R3TA 4O3NA 1R8CA 4O23A 3H5XA 2I5JB 3MRUA 4R3LA 3PGPA 1U48A 3A9LA 1NKEA 3OR2A 2FVGA 1XRYA 3I87A 1Y0HA 3SBMA 3QIPB 3PFEA 4I56A 2ZC4A 3Q8SB 4TLRA 1S7KA 3Q2TC 2FHJD 1BLUA 4A8MP 3N6NA 4DR4J 3M6VA 3TZZA 2F8EX 2DPJA 1TKXB 2V8HA 3GFXA 2YNIA 5IV3A 1UEKA 3G6VA 3OXFA 3D9BA 2M8HA 1S57A 1VQ7S 2NXCA 1YIJS 4OHWA 2YPYA 1XR7A 3CJRA 4AG7A 5CXTA 2YPZA 2V8PA 4JV2A 2BUEA 4IH6A 4P2SA 3J81j 2FJAB 2OPSA 2D3ZA 3J81Y 1RHUB 2Q6BA 2AEMA 2W9AA 4LF9F 1IBCB 1N33F 3CDBA 2QMWA 4KE5A 4DX5A 4P71A 5THWA 4YB1P 4ILMA 1FDAA 2A2CA 3KG4A 3G96A 4RR5A 3MUMP 3IGRA 2E5LF 2XB2D 2LKZA 2PA8D 3HVWA 1MN7A 3VVUA 1RAGB 4ZP8A 2MKIA 2OPQA 4USJC 3CSKA 4N7TA 3Q22A 4P6QA 3W64A 3THTA 3JSBA 2VV5A 4B9TA 4RUCA 3EMTA 4JI0J 1DBDA 3VGSA 2CQ0A 3PRBA 3VHQA 3O6QA 2J8SA 2BL1A 4PQUB 1B6BA 1VC0A 5DWMA 4A31A 4A39A 1LWCB 5LYDA 1LKZA 3W9IA 4A48A 1TAUA 1VMBA 4ER8A 2YWGA 1UVJA 3EC4A 2ZOGA 2PVWA 3K59A 4ID5B 4M8LA 4F0MA 2VF3A 4OZNA 4Q44A 1ZZNA 1VBKA 4F0KA 3E8OA 4ZN1A 4OJ3A 4K0KJ 5JMNA 4DR5J 4NXMF 4OMFG 1YJTA 1RZMA 4OX9J 1N5SA 1RT5B 5HI7A 2PIIA 2AYEA 4PSWA 4LF6F 4B3MF 4CPAA 2FYXA 4FF3A 4ED6A 1VQOS 1KZFA 1H2TZ 1NBEB 2CWKA 2N7YA 4Q0BB 1JXEA 4IFYA 4LF4F 3TAPA 1VHIA 5E2QA 1IBMF 1S1XB 4IQMA 2L9WA 5DJBA 3KI9A 1JK9B 2ZHOA 2RT3A 4OL8A 1NSQA 2MY8A 1PIEA 2AEJA 3BPDA 3K8VA 2WZNA 2UV8A 3H4QA 1KRPA 4QIEA 2JLMA 2KYXA 5HMYA 2NQPA 2MLXA 2UUBF 1A9NB 4JB8B 4CWBA 1VRQC 3ITHA 4F0YA 2HHVA 4OYZA 4RS2A 5IV0A 2RF2A 2CNSA 2GMLA 3I82A 4IH7A 3BJ8A 4MKVA 1YJWS 4QYZJ 1L0CA 2I2YA 5DZ6A 1WEYA 1HNVA 5RUBA 1DLOA 4ED0A 3WZ0A 1O8BA 5E7OB 3JTKA 3MR3A 1SI9A 2CA9A 3KYLA 3PRDA 1GHEA 1JJCB 4PG7A 4LFAJ 2FCKA 3UD3P 3JAMU 3C14B 5IT9U 3NBPA 3CCMS 5K14A 2D74B 1ZO0A 3PFOA 3D7DA 2H54B 2ZITA 4DV4J 4EFAC 1FTCA 4NZ7A 2FJVA 1KBRA 3D3BJ 2XSJB 1WKLA 2W9CA 5HMWA 3JSMB 3CC7S 4HEA9 2UXCJ 2F8HA 3IC1A 5HROB 3LODA 4ID8A 4RBUA 1TVRA 2O5DA 3MAHA 4XIUA 4K30A 4CO5A 5IZHA 2E66A 2F8MA 4NGQA 1ZA1B 3FRZA 3F5BA 4KHRA 1S10A 2VC1A 1M1DA 3RBXA 3MMBB 1RHJB 1NMTA 3US5A 2DR6A 3EGWB 2VIHA 4NYOA 3GY9A 4DLGA 2VQFJ 1WTFA 3QO9A 1TMMA 3J7AN 3N7ZA 1Q16B 3ILOA 4DV7J 2AMCB 1JJHA 3VQTA 1DHMA 3OD2A 2Z3KA 2OD6A 1IKYB 1MN9A 4UY8T 3QFWA 4DNCA 4RNNA </