3NE7A

Crystal structure of paia n-acetyltransferase from thermoplasma acidophilum in complex with coenzyme a
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
159
structure length
159
Chain Sequence
MSIEIRKLSIEDLETLIEVARESWKWTYAGIYSEEYIESWIREKYSKEKLLNEIVRSQSNLDILFLGAFADSTLIGFIELKIIANKAELLRLYLKPEYTHKKIGKTLLLEAEKIMKKKGILECRLYVHRQNSVGFSFYYKNGFKVEDTDGSDFIMEKKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLTRANSFERASE
publication title Crystal structure of the novel PaiA N-acetyltransferase from Thermoplasma acidophilum involved in the negative control of sporulation and degradative enzyme production.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Transferase
total genus 48
structure length 159
sequence length 159
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3ne7A00
3R9GA 2ZW7A 3TOAA 4MBUA 3LD2A 3ZJ0A 4L8AA 3F8KA 4R87A 3S6FA 4E8OA 2B3UA 3TO6A 2KCWA 3VWEA 5KTAA 5F49A 3FB3A 2I00A 3GKRA 5C88A 2BL1A 1Q2CA 4MY0A 4CAWA 5F47A 2B58A 3D8PA 2J8RA 4PSXA 2BUEA 2VXKA 4OADA 1Y7RA 1CM0A 2C27A 2P6EA 2B3VA 2FIWA 4AVCA 2R98A 3DR6A 1Z9UA 1RXTA 1KUYA 5F46A 4PK3A 2FXFA 4MI4A 5HMNA 4XPLA 1QSRA 4XPDB 2QMLA 4HNXB 1QSMA 4NF1A 2QIRA 4NEXA 2HV2A 4FD6A 1B6BA 3D2PA 3EXNA 3IGRA 4OLLA 4L89A 4B5PA 4JXRA 4KLVA 5DWNA 3S6KA 2R1IA 4II9A 3UY5A 3EC4A 2Q04A 1KZFA 2B4BA 4ONUA 2FT0A 2JLMA 4KOXA 3QAHA 1YX0A 4MHDA 2ATRA 4KUBA 1QSTA 2D4OA 3TTHA 4KOSA 1YK3A 2ZW5A 2K5TA 3BLNA 4PSWA 4M3SA 5ISVA 1Z4RA 1YREA 1LRZA 2Q7BA 3H4QA 4H6UA 3FRMA 3T9YA 2D4PA 1S7KA 2H5MA 2O28A 4XPKA 1M1DA 2QECA 5EC4A 2B5GB 1U6MA 3JVNA 1IIDA 4XNHC 4NSQA 5HH1A 2HQYA 2ZW4A 4KOUA 4KOVA 3W6XA 1PU9A 1QSOA 2F5IA 4JXQA 1S5KA 2ARHA 3MGDA 3F5BA 5J8FA 2OH1A 2OU2A 2J8MA 1XE4A 3WR7A 4DNCA 2P6GA 4FD5A 2G3TA 4JLYA 4UWJA 4Y49C 4QB9A 4QVTA 2FL4A 5GCNA 3D2MA 4F6AA 2PDOA 3R95A 2FIAA 4JWPA 2FS5A 2Q44A 4KVME 1L0CA 1TIQA 4AG7A 2OZGA 2VI7A 4YGOA 4CAVA 3DDDA 4KORA 3DSBA 3I3GA 1I12A 1YGHA 1Y9KA 1K4JA 1MK4A 4FD4A 4IUSA 5DWMA 3CXPA 2VEZA 2Z10A 1MJ9A 2GIVA 4AB7A 4RI1A 4I49A 4AVBA 4NCZA 4UWIA 3SXNA 3TE4A 4AVAA 2PRBA 4GS4A 2Q4VA 4KZTA 1PUAA 3TO7A 4CRYB 5FVJA 1S60A 2BEIA 4NXYA 2Z0ZA 4H6ZA 4E0AA 2B4DB 3FNCA 4IF5A 5KTDA 2VBQA 3RYOA 3B8GA 2ZW6A 1QSNA 4QBJA 2Q4YA 3E0KA 1IB1E 3TO9A 3EY5A 5I0CA 1M44A 4EVYA 3FYNA 3SXOA 1SQHA 2G0BA 3TCVA 1NSLA 5E96A 3ZZIA 3SHPA 1NE9A 4QC6A 4CRZB 4U9YA 1J4JA 2Y0MA 2PSWA 2IL4A 1GHEA 3F0AA 2ZXVA 3LODA 2R8VA 2GE3A 1Y9WA 4KOYA 4ZBGA 2DXQA 2OB0A 5EBVA 2B4DA 1NMTA 4U5YA 4R3LA 2REEA 2PR1A 2FSRA 1S3ZA 3TT2A 2RC4A 1M4IA 1VKCA 4MY3A 5F48A 4KOWA 2CY2A 5IV0A 4Y49B 2VZYA 4B5OA 3T90A 4LX9A 3W91A 1I1DA 4RS2A 1YR0A 5KTCA 2PQ8A 4R9MA 3BJ7A 1BOBA 1IYLA 2WPWA 5H84A 1S7FA 3EFAA 1N71A 2REFA 2JDCA 1B87A 2HUZA 1XEBA 3C26A 1OZPA 3QB8A 5IB0A 4F0YA 4HNWB 1XIXA 2B5GA 3D3SA 1FY7A 1KUVA 5C82A 2BSWA 3KKWA 3TOBA 1Q2DA 3FBUA 4KVXA 4B5PB 3R9EA 3G8WA 4YRHA 1MJAA 4K30A 2WPXA 3S6GA 3PGPA 2P6FA 1UFHA 3R9FA 1XF8A 1WWZA 1CJWA 2CNMA 3BJ8A 3DNSA 5IX3A 4JD6A 2VZZA 1M4DA 2GANA 2CNTA 2J8NA 3G3SA 2R7HA 1I21A 3V8IA 1V0CA 4HKFA 2JEVA 2Z11A 4J3GA 2FE7A 4CAXA 1RO5A 4R3KA 1YLEA 4KLWA 1R57A 1YVOA 4OAEA 2EVNA 4AG9A 2OZHA 3EO4A 2I79A 2PR8A 4UA3A 3P2HA 2VQYA 4XNHB 3VWDA 1P0HA 5JQ4A 3R1KA 2A4NA 1KUXA 4XPDC 3IWGA 3JUWA 4KUAA 4KVOE 3S6HA 3GY9A 4UBRA 1M4GA 5CNPA 2CNSA 2PC1A 3N7ZA 4QUSA 4MJ8A 1WK4A 3R96A 1YVKA 4R57A 3FXTA 3PP9A 4YFJA 2AE6A 2EUIA 4JJXA 1MJBA 4M85A 4ORFA 4X5KA 1IICA 4E2AA 1S7NA 4HNYB 3P2FA 5J8CA 2FCKA 1S7LA 1XMTA 2JDDA 3W6SA 3FIXA 4BMHA 2OZUA 1VHSA 1P4NA 3I9SA 4PK2A 3TFYA 3NE7A 4PV6A 3GYAA 4LUAA 1Z4EA 1Q2YA 4U9ZA 5H86A 3PZJA 4CS0B 3CXQA 2ZPAA 2G3AA 1BO4A 3CXSA 4KOTA 2P0WA 3K9UA 3OWCA 2Q0YA 2X7BA 1ON0A 3DR8A 1IYKA 2NMTA 5JPHA 2AJ6A 4H89A 4FD7A
chains in the Genus database with same CATH superfamily
4P6YA 3CT9A 3R9GA 3NH8A 3D66A 2ZW7A 4A38A 3QNVA 1Y0RA 3IC1A 3TOAA 1ARMA 5CPAA 2YGWA 4UFWA 4MBUA 5HVHA 3BXMA 3LD2A 4L8AA 2C6PA 3F8KA 4P4IA 3ZJ0A 4R87A 3KR4A 4NFRA 3S6FA 4MFQA 4C7HA 5J1QA 4E8OA 1ZLHA 1TKFA 3PB4X 4C68A 2Z3PA 1YW4A 2B3UA 3TO6A 1R43A 3D7FA 2KCWA 4ZX8A 1HDUA 3VWEA 4UEFA 5KTAA 4MMOA 5F49A 3FB3A 1EE3P 3B35A 4MHPA 5JGFA 1AUGA 3FJUA 1JWQA 3WC7A 3VARA 3B3TA 4P4FA 2PJ3A 2I00A 3GB0A 2JBKA 3GKRA 5HVFA 4RUHA 5C88A 2BL1A 1Q2CA 2RB7A 2PJ9A 4MY0A 5F47A 4CAWA 2B58A 3H8FA 3D8PA 1YQEA 2J8RA 4PSXA 4PXCA 2BUEA 2OR4A 2VXKA 5A27A 4OADA 3A9LA 3I1UA 5G21A 3RZAA 1Y7RA 1CM0A 2C27A 2CTCA 2B3VA 2FIWA 2P6EA 4AVCA 1YSJA 1TXRA 2PVVA 8CPAA 2R98A 3DR6A 1Z9UA 1CPSA 1RXTA 1KUYA 1TF8A 2CF4A 3H5ZA 4A30A 5F46A 4MCQA 1QQ9A 4PK3A 2FXFA 4MI4A 2QVPA 4KSFA 4XPLA 4GM5A 5HMNA 1QSRA 4XPDB 1Z2LA 2QMLA 4HNXB 4Q7AA 4MCSA 1QSMA 2DEAA 2RFHA 2ZEOA 1DE4C 2GU2A 1IOFA 2QIRA 4NF1A 3PB6X 2HV2A 4MHZA 4NEXA 5D29A 4FD6A 1B6BA 3LWUA 3D2PA 3EXNA 3IGRA 4OLLA 4C7IA 2F8HA 4IHMA 4A95A 2PJ7A 2Q7SA 2ZENA 1ELLP 2V77A 4L89A 1JQGA 4JXRA 4B5PA 4KLVA 1ZLIA 1BLLE 5DWNA 3S6KA 3D7HA 1ZG9A 2ZEMA 4C2YA 5AG7A 3FX6A 2R1IA 2JBJA 3TX8A 4II9A 3UY5A 3EC4A 4YWYA 2Q04A 1KZFA 2B4BA 3PFOA 2FT0A 4JYWA 4ONUA 4A32A 2HC9A 2CIJA 4FBEA 4ZI6A 2WUUA 2JLMA 2YNEA 1YX0A 3QAHA 4KOXA 3NH4A 4MHDA 1CPXA 2ATRA 4KUBA 5LYLA 3PBEA 1QSTA 2VL1A 2D4OA 3TTHA 4KOSA 1BPNA 4OC4A 1YK3A 2YNCC 4CYPA 2ZW5A 5LYFA 3NH5A 2K5TA 2ZEHA 3LACA 1LFWA 4MFJA 3CZXA 3BLNA 5CBMA 1IU8A 4PSWA 3FEEA 4O23A 4OIDA 2DPSA 5A28A 2G9DA 4M3SA 5ISVA 3WC5A 1Z4RA 1YREA 1LRZA 3NFZA 2Q7BA 3H4QA 4B12A 2ZOFA 4H6UA 3FRMA 3IU1A 3KI9A 4OC5A 5G22A 2D4PA 1S7KA 2H5MA 2O28A 2PJCA 3BI1A 1M1DA 4XPKA 4UEZA 2QECA 5EC4A 2B5GB 1DTDA 1U6MA 3JVNA 1IIDA 4XNHC 5AG6A 4G1PA 4A39A 2PIYA 4NSQA 5LRGA 4B6ZA 5HH1A 3IJ3A 2HQYA 4RN7A 3L2NA 2IQ6A 2V8VA 2ZW4A 3B7IA 4KOUA 3TC8A 4KOVA 3NA6A 3D68A 3K2KA 3W6XA 3FH4A 4MCRA 4WJBA 4EFDA 4UCNA 4P4JA 3MRUA 3S9LA 1PU9A 4F9UA 1QSOA 2F5IA 4JXQA 1XBUA 3SI1A 1S5KA 2ARHA 1A2ZA 2AFMA 2IMOA 3F5BA 3MGDA 2GREA 1Y0YA 2OH1A 2OU2A 3D67A 5J8FA 2HB6A 3FVLA 2J8MA 1XE4A 3IWEA 3WR7A 4NGPA 4MHNA 4DNCA 2P6GA 3KHXA 3PEIA 4FD5A 5IB9A 1Z8XA 2DF5A 2G3TA 4JLYA 4UWJA 4FWUA 3D4UA 4Y49C 3SJXA 4ZY1A 5G20A 1ZO0A 4QB9A 3B3VA 2AFZA 2EO8A 4KSAA 4QVTA 2XEFA 1PYTB 2C6CA 2BOAA 2FL4A 1CBXA 5GCNA 5HVGA 3D2MA 4F6AA 3KGQA 2PDOA 4W9YA 3R95A 2CXAA 2FIAA 4JWPA 2FS5A 4R7MA 5DS0A 2Q44A 4KVME 1L0CA 1TIQA 5BWAB 4UCPA 4AG7A 2OZGA 2VI7A 3GLJA 4MFZA 4YGOA 2AFOA 4CAVA 3DDDA 4KORA 3DSBA 4P10A 3GIUA 3I3GA 1LOKA 1I12A 4BD9A 1YGHA 4EMEA 4DJLA 1Y9KA 2ZEDA 1K4JA 3ISZA 4P44A 1MK4A 1F2OA 4ZGYB 3IFEA 4OP4A 4NJRA 4FD4A 4IUSA 5DWMA 3B2YA 1TF9A 4B11A 3CXPA 2VEZA 2Z10A 1MJ9A 2GIVA 4AB7A 1UWYA 4RI1A 4I49A 4AVBA 4NCZA 4OC0A 2POKA 4UWIA 3SXNA 4R76A 3TE4A 4AVAA 2PRBA 1CG2A 2Q4VA 4GS4A 4KZTA 1PUAA 2V8HA 3TO7A 3JRUA 1TKHA 4NGSA 4CRYB 4IK2A 1S60A 4OC1A 5FVJA 2BEIA 4NXYA 3PB9X 2GLJA 3BHXA 2Z0ZA 3KL9A 4PPZA 4H2KA 1Z8LA 3B3WA 4H6ZA 4WWVA 4CGNA 3NE8A 2B4DB 3FNCA 4E0AA 1BAVA 3CPXA 4P4EA 1LAMA 4IF5A 2CTBA 2XEIA 5KTDA 7CPAA 2VBQA 3RYOA 3B8GA 2ZW6A 5LRJA 1QSNA 2OOTA 4C2ZA 4QBJA 2Q4YA 3E0KA 1LANA 1IB1E 2ANPA 4CGPA 3TO9A 1Z8WA 4KSIA 3EY5A 3CPAA 2I3CA 3IIBA 1M44A 5I0CA 5HXDA 4NJQA 4EVYA 3FYNA 4OIWA 3SXOA 5JM6A 1SQHA 5ELYA 2G0BA 1OBRA 2PJ1A 3TCVA 1NSLA 4EWTA 5E96A 3ZZIA 3GUXA 3N5FA 1HDQA 3SHPA 2O4HA 1NE9A 2QYVA 3D7GA 4PXDA 4QC6A 3H8GA 2V8GA 2AFUA 5LYIA 4CRZB 4U9YA 1J4JA 1LCPA 2Y0MA 4BINA 2PSWA 5AG4A 2PJ5A 2Z3OA 2IL4A 1GHEA 2PJ0A 1ZG8A 2XEGA 2Q4ZA 2ODFA 2ZEFA 4ZX9A 3FECA 2XEJA 2ZXVA 2O53A 3F0AA 3LODA 4TWEA 2R8VA 4HPSA 2GE3A 2PVWA 1X12A 1HEEA 1Y9WA 4KOYA 4ZBGA 4ONWA 2EK9A 2DXQA 3IEHA 2OB0A 5EBVA 4UIAA 5AGEA 2C6GA 3PBBA 2B4DA 1ARLA 4CPAA 3B3SA 1NMTA 3CDXA 4U5YA 4R3LA 2REEA 1GYTA 2PR1A 2FSRA 2ZELA 4OKOA 1RTQA 1S3ZA 3K9TA 2RC4A 1M4IA 1VKCA 3HUVA 3MN8A 4PXEA 3TT2A 2V8DA 4AXVA 2YNCA 1YMEA 4CAFA 2NYQA 4MY3A 5F48A 4KOWA 3T8WA 2CY2A 1KWMA 2EWBA 4Y49B 3WC6A 5IV0A 4DYOA 2VZYA 5LYDA 2PJ8A 3VH9A 4B5OA 4K3NA 2GFQA 4OC2A 4DUKA 4ZY0A 3T90A 2ABZA 5LRKA 1IGBA 4PQAA 3PFEA 4B14A 1YW6A 4LX9A 3RBUA 5JH9A 4P4DA 3W91A 5I4MA 1I1DA 1VIXA 4RS2A 1YR0A 4X8IA 4A31A 3WT4A 5KTCA 3JTKA 2Z3KA 2Z3NA 2PQ8A 3SJGA 4R9MA 1ZG7A 3BJ7A 3S9NA 1BOBA 1IYLA 1NSAA 2Z3LA 5K8PA 2DPTA 2WPWA 5H84A 1PCAA 2NSMA 4A94A 1S7FA 2PRQA 3H8EA 1XFOA 3EFAA 1N71A 3QAYA 4UFXA 2REFA 1IY7A 2JDCA 1B87A 4NGMA 1XJOA 2HUZA 4FUUA 1XEBA 3C26A 2EBJA 3KZWA 1OZPA 2WZNA 3QB8A 5IB0A 4CGOA 3FF3A 4F0YA 3V7ZA 5THWA 1XRYA 4HNWB 1XIXA 1YLOA 3VATA 2B5GA 3D3SA 4MCPA 4Q36A 3KASA 1FY7A 4NGQA 3PRTA 4F9VA 1KUVA 4IAVA 2GLFA 2WYRA 5C82A 2BSWA 3KKWA 3TOBA 4Z65A 4MHYA 1CX8A 2YNDA 1FNOA 1Q2DA 2PJBA 2WSAA 3FBUA 2Z3MA 4F8ZA 3ISXA 4KVXA 3HLPA 2IJZA 2PJ4A 4B5PB 1CP7A 4UEEA 3R9EA 3G8WA 3PB8X 4UIBA 4YRHA 3KHZA 3RNZA 4PXBA 1MJAA 4K30A 4CGMA 2WPXA 3S6GA 2P6FA 3FEDA 3PGPA 4CAEA 1UFHA 4UF4A 3B3CA 3R9FA 1XF8A 1WWZA 1CJWA 1Z5RA 2CNMA 1XOVA 3BJ8A 4P4BA 4R8FA 3DNSA 5IX3A 2BCOA 4A37A 2F7VA 1AMPA 3FMCA 5AG5A 4M6IA 4JD6A 4MFKA 2VZZA 1M4DA 2PJ2A 2GANA 2CNTA 2J8NA 3G3SA 4R6TA 2R7HA 1I21A 3V8IA 4B13A 3RAMA 1AYEA 1LAPA 1V0CA 4HKFA 3LMSA 4KS9A 1ELMP 3DLJA 2JEVA 2Z11A 4NGTA 1VHEA 2C1CA 4J3GA 2AFXA 4B10A 4CYOA 4M6GA 2FE7A 2PJ6A 2FVGA 1M4LA 4CAXA 1RO5A 4R3KA 4YU9A 1YLEA 4KLWA 1R57A 1XMBA 1YVOA 3D7DA 4OAEA 4OC3A 4ZY2A 2EVNA 5K8MA 4AG9A 2OZHA 3IWWA 3EO4A 2I79A 4GXHA 2PR8A 4UA3A 3P2HA 2VQYA 4XNHB 3VWDA 5D8NA 1P0HA 5JQ4A 4TNUA 3R1KA 4FAIA 2A4NA 3KR5A 4C2XA 1CP6A 4MFPA 1KUXA 2AFWA 4XPDC 3IWGA 3JUWA 1F57A 4LQ6A 3DGVA 4KUAA 1F2PA 5K8OA 4KVOE 4UCMA 1FT7A 2ZEGA 3GY9A 1M4GA 4JZ0A 4UBRA 5CNPA 3S6HA 2CNSA 2PC1A 3N7ZA 4QUSA 3WABA 2Q43A 1WK4A 4MJ8A 3R96A 3RO0A 1YVKA 4R57A 5EMIA 4BBHA 3FXTA 3PP9A 2BO9A 4NGNA 3PB7X 1BPMA 4YFJA 2AE6A 2EUIA 4JJXA 1MJBA 4F0XA 1Y7EA 4M85A 4ORFA 1Q7LA 1QMUA 3SI0A 4X5KA 1IICA 2EK8A 1Z8TA 4NGRA 2PJAA 4X3RA 4E2AA 4MXUA 2Q51A 1S7NA 5F09A 4HNYB 4Q38A 4UFVA 3V38A 3P2FA 5J8CA 2PCUA 2FCKA 1S7LA 1XMTA 1H8LA 2JDDA 2QJ8A 4M6HA 4MFLA 4CYQA 4OMEA 3W6SA 3FIXA 3IU2A 4BMHA 2OZUA 1VHSA 1P4NA 4P45A 4X2TA 2ZOGA 3I9SA 3KQZA 4PK2A 4A2ZA 4CYNA 4MRIA 3NE7A 4ZYQA 3TFYA 4PV6A 3GYAA 3SI2A 4LUAA 1Z4EA 1R3NA 6CPAA 1Q2YA 4U9ZA 5H86A 3PZJA 2ZEEA 4CS0B 3KQXA 3CXQA 2JEWA 3BI0A 2AFSA 1TKJA 3IO1A 4LQGA 3SJFA 5G1ZA 4A33A 3SJEA 2ZPAA 2G3AA 2J9AA 1BO4A 4CGLA 2ZEPA 3CXSA 4KOTA 3S9MA 5K8NA 2P0WA 1VHOA 3K9UA 3OWCA 2Q0YA 2X7BA 1ON0A 1VGYA 3DR8A 3T9YA 1IYKA 2NMTA 2PIZA 1X10A 5JPHA 2AJ6A 4H89A 2PE3A 4FD7A 1IOIA
chains in the Genus database with same CATH topology
3R9GA 2ZW7A 3TOAA 2YGWA 4UFWA 4MBUA 3LD2A 3ZJ0A 4L8AA 3F8KA 4R87A 3S6FA 4C7HA 4MFQA 4E8OA 4C68A 2Z3PA 2B3UA 3TO6A 2KCWA 3VWEA 5KTAA 5F49A 3FB3A 2I00A 3GKRA 5C88A 2BL1A 1Q2CA 4MY0A 4CAWA 5F47A 2B58A 3D8PA 2J8RA 4PSXA 2BUEA 2VXKA 5A27A 4OADA 3A9LA 5G21A 1Y7RA 1CM0A 2C27A 2P6EA 2B3VA 2FIWA 4AVCA 2R98A 3DR6A 1Z9UA 1RXTA 1KUYA 3H5ZA 4A30A 5F46A 4PK3A 2FXFA 4MI4A 4KSFA 4XPLA 5HMNA 1QSRA 4XPDB 2QMLA 4HNXB 1QSMA 4NF1A 2QIRA 4NEXA 2HV2A 4FD6A 1B6BA 3D2PA 3EXNA 3IGRA 4OLLA 4C7IA 4A95A 4L89A 4B5PA 4JXRA 4KLVA 5DWNA 3S6KA 4C2YA 5AG7A 2R1IA 4II9A 3UY5A 3EC4A 2Q04A 1KZFA 2B4BA 4ONUA 2FT0A 4A32A 2WUUA 2JLMA 3QAHA 1YX0A 2YNEA 4KOXA 4MHDA 2ATRA 4KUBA 1QSTA 2D4OA 3TTHA 4KOSA 1YK3A 2YNCC 4CYPA 2ZW5A 2K5TA 4MFJA 3BLNA 4PSWA 2DPSA 5A28A 4M3SA 5ISVA 1Z4RA 1YREA 1LRZA 2Q7BA 3H4QA 4B12A 4H6UA 3FRMA 3IU1A 5G22A 2D4PA 1S7KA 2H5MA 2O28A 4XPKA 3T9YA 1M1DA 2QECA 5EC4A 2B5GB 1U6MA 3JVNA 1IIDA 4XNHC 5AG6A 4NSQA 5HH1A 2HQYA 2ZW4A 4KOUA 4KOVA 3W6XA 4UCNA 1PU9A 1QSOA 2F5IA 4JXQA 1S5KA 2ARHA 3MGDA 3F5BA 5J8FA 2OH1A 2OU2A 2J8MA 1XE4A 3IWEA 3WR7A 4DNCA 2P6GA 4FD5A 2G3TA 4JLYA 4UWJA 4Y49C 5G20A 1ZO0A 4QB9A 4KSAA 4QVTA 2FL4A 5GCNA 3D2MA 4F6AA 2PDOA 3R95A 2CXAA 2FIAA 4JWPA 2FS5A 2Q44A 4KVME 1L0CA 1TIQA 5BWAB 4UCPA 4AG7A 2OZGA 2VI7A 4MFZA 4YGOA 4CAVA 3DDDA 4KORA 3DSBA 3I3GA 1I12A 1YGHA 1Y9KA 1K4JA 1MK4A 4ZGYB 4FD4A 4IUSA 5DWMA 4B11A 3CXPA 2VEZA 2Z10A 1MJ9A 2GIVA 4AB7A 4RI1A 4I49A 4AVBA 4NCZA 4UWIA 3SXNA 3TE4A 4AVAA 2PRBA 4GS4A 2Q4VA 4KZTA 1PUAA 3TO7A 4CRYB 5FVJA 1S60A 2BEIA 4NXYA 2Z0ZA 4CGNA 4H6ZA 4E0AA 2B4DB 3FNCA 4IF5A 5KTDA 2VBQA 3RYOA 3B8GA 2ZW6A 1QSNA 4QBJA 4C2ZA 2Q4YA 3E0KA 1IB1E 4CGPA 3TO9A 3EY5A 5I0CA 1M44A 4EVYA 3FYNA 3SXOA 1SQHA 2G0BA 3TCVA 1NSLA 5E96A 3ZZIA 3SHPA 1NE9A 4QC6A 4CRZB 4U9YA 1J4JA 5AG4A 2Y0MA 2PSWA 2Z3OA 2IL4A 1GHEA 3F0AA 2ZXVA 3LODA 2R8VA 2GE3A 1Y9WA 4KOYA 4ZBGA 2DXQA 2OB0A 5EBVA 5AGEA 2B4DA 1NMTA 4U5YA 4R3LA 2REEA 2PR1A 2FSRA 1S3ZA 3TT2A 2RC4A 1M4IA 1VKCA 2YNCA 4CAFA 4MY3A 5F48A 4KOWA 2CY2A 5IV0A 4Y49B 2VZYA 4B5OA 3T90A 4B14A 4LX9A 3W91A 1I1DA 4RS2A 1YR0A 4A31A 5KTCA 3JTKA 2Z3KA 2Z3NA 2PQ8A 4R9MA 3BJ7A 1BOBA 1IYLA 2Z3LA 2DPTA 2WPWA 5H84A 1S7FA 3EFAA 1N71A 4UFXA 2REFA 2JDCA 1B87A 2HUZA 1XEBA 3C26A 1OZPA 3QB8A 5IB0A 4CGOA 4F0YA 4HNWB 1XIXA 2B5GA 3D3SA 4Q36A 1FY7A 1KUVA 5C82A 2BSWA 3KKWA 3TOBA 2YNDA 1Q2DA 3FBUA 2WSAA 2Z3MA 4KVXA 4B5PB 3R9EA 3G8WA 4YRHA 1MJAA 4K30A 4CGMA 2WPXA 3S6GA 3PGPA 2P6FA 4CAEA 1UFHA 3R9FA 1XF8A 1WWZA 1CJWA 2CNMA 3BJ8A 3DNSA 5IX3A 5AG5A 4JD6A 4MFKA 2VZZA 1M4DA 2GANA 2CNTA 2J8NA 3G3SA 2R7HA 1I21A 3V8IA 4B13A 1V0CA 4HKFA 4KS9A 2JEVA 2Z11A 4J3GA 4B10A 4CYOA 2FE7A 4CAXA 1RO5A 4R3KA 1YLEA 4KLWA 1R57A 1YVOA 4OAEA 2EVNA 4AG9A 2OZHA 3EO4A 2I79A 2PR8A 4UA3A 3P2HA 2VQYA 4XNHB 3VWDA 1P0HA 5JQ4A 3R1KA 2A4NA 4C2XA 4MFPA 1KUXA 4XPDC 3IWGA 3JUWA 4KUAA 4KVOE 4UCMA 3S6HA 3GY9A 4UBRA 1M4GA 5CNPA 2CNSA 2PC1A 3N7ZA 4QUSA 4MJ8A 1WK4A 3R96A 1YVKA 4R57A 4BBHA 3FXTA 3PP9A 4YFJA 2AE6A 2EUIA 4JJXA 1MJBA 4F0XA 4M85A 4ORFA 4X5KA 1IICA 4E2AA 1S7NA 4HNYB 4Q38A 4UFVA 3P2FA 5J8CA 2FCKA 1S7LA 1XMTA 2JDDA 4MFLA 4CYQA 3W6SA 3FIXA 3IU2A 4BMHA 2OZUA 1VHSA 1P4NA 3I9SA 4PK2A 4A2ZA 4CYNA 3TFYA 3NE7A 4PV6A 3GYAA 4LUAA 1Z4EA 1Q2YA 4U9ZA 5H86A 3PZJA 4CS0B 3CXQA 5G1ZA 4A33A 2ZPAA 2G3AA 4CGLA 1BO4A 3CXSA 4KOTA 2P0WA 3K9UA 3OWCA 2Q0YA 2X7BA 1ON0A 3DR8A 1IYKA 2NMTA 5JPHA 2AJ6A 4H89A 4FD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R9G A;  2ZW7 A;  3TOA A;  4MBU A;  3LD2 A;  3ZJ0 A;  4L8A A;  3F8K A;  4R87 A;  3S6F A;  4E8O A;  2B3U A;  3TO6 A;  2KCW A;  3VWE A;  5KTA A;  5F49 A;  3FB3 A;  2I00 A;  3GKR A;  5C88 A;  2BL1 A;  1Q2C A;  4MY0 A;  4CAW A;  5F47 A;  2B58 A;  3D8P A;  2J8R A;  4PSX A;  2BUE A;  2VXK A;  4OAD A;  1Y7R A;  1CM0 A;  2C27 A;  2P6E A;  2B3V A;  2FIW A;  4AVC A;  2R98 A;  3DR6 A;  1Z9U A;  1RXT A;  1KUY A;  5F46 A;  4PK3 A;  2FXF A;  4MI4 A;  5HMN A;  4XPL A;  1QSR A;  4XPD B;  2QML A;  4HNX B;  1QSM A;  4NF1 A;  2QIR A;  4NEX A;  2HV2 A;  4FD6 A;  1B6B A;  3D2P A;  3EXN A;  3IGR A;  4OLL A;  4L89 A;  4B5P A;  4JXR A;  4KLV A;  5DWN A;  3S6K A;  2R1I A;  4II9 A;  3UY5 A;  3EC4 A;  2Q04 A;  1KZF A;  2B4B A;  4ONU A;  2FT0 A;  2JLM A;  4KOX A;  3QAH A;  1YX0 A;  4MHD A;  2ATR A;  4KUB A;  1QST A;  2D4O A;  3TTH A;  4KOS A;  1YK3 A;  2ZW5 A;  2K5T A;  3BLN A;  4PSW A;  4M3S A;  5ISV A;  1Z4R A;  1YRE A;  1LRZ A;  2Q7B A;  3H4Q A;  4H6U A;  3FRM A;  3T9Y A;  2D4P A;  1S7K A;  2H5M A;  2O28 A;  4XPK A;  1M1D A;  2QEC A;  5EC4 A;  2B5G B;  1U6M A;  3JVN A;  1IID A;  4XNH C;  4NSQ A;  5HH1 A;  2HQY A;  2ZW4 A;  4KOU A;  4KOV A;  3W6X A;  1PU9 A;  1QSO A;  2F5I A;  4JXQ A;  1S5K A;  2ARH A;  3MGD A;  3F5B A;  5J8F A;  2OH1 A;  2OU2 A;  2J8M A;  1XE4 A;  3WR7 A;  4DNC A;  2P6G A;  4FD5 A;  2G3T A;  4JLY A;  4UWJ A;  4Y49 C;  4QB9 A;  4QVT A;  2FL4 A;  5GCN A;  3D2M A;  4F6A A;  2PDO A;  3R95 A;  2FIA A;  4JWP A;  2FS5 A;  2Q44 A;  4KVM E;  1L0C A;  1TIQ A;  4AG7 A;  2OZG A;  2VI7 A;  4YGO A;  4CAV A;  3DDD A;  4KOR A;  3DSB A;  3I3G A;  1I12 A;  1YGH A;  1Y9K A;  1K4J A;  1MK4 A;  4FD4 A;  4IUS A;  5DWM A;  3CXP A;  2VEZ A;  2Z10 A;  1MJ9 A;  2GIV A;  4AB7 A;  4RI1 A;  4I49 A;  4AVB A;  4NCZ A;  4UWI A;  3SXN A;  3TE4 A;  4AVA A;  2PRB A;  4GS4 A;  2Q4V A;  4KZT A;  1PUA A;  3TO7 A;  4CRY B;  5FVJ A;  1S60 A;  2BEI A;  4NXY A;  2Z0Z A;  4H6Z A;  4E0A A;  2B4D B;  3FNC A;  4IF5 A;  5KTD A;  2VBQ A;  3RYO A;  3B8G A;  2ZW6 A;  1QSN A;  4QBJ A;  2Q4Y A;  3E0K A;  1IB1 E;  3TO9 A;  3EY5 A;  5I0C A;  1M44 A;  4EVY A;  3FYN A;  3SXO A;  1SQH A;  2G0B A;  3TCV A;  1NSL A;  5E96 A;  3ZZI A;  3SHP A;  1NE9 A;  4QC6 A;  4CRZ B;  4U9Y A;  1J4J A;  2Y0M A;  2PSW A;  2IL4 A;  1GHE A;  3F0A A;  2ZXV A;  3LOD A;  2R8V A;  2GE3 A;  1Y9W A;  4KOY A;  4ZBG A;  2DXQ A;  2OB0 A;  5EBV A;  2B4D A;  1NMT A;  4U5Y A;  4R3L A;  2REE A;  2PR1 A;  2FSR A;  1S3Z A;  3TT2 A;  2RC4 A;  1M4I A;  1VKC A;  4MY3 A;  5F48 A;  4KOW A;  2CY2 A;  5IV0 A;  4Y49 B;  2VZY A;  4B5O A;  3T90 A;  4LX9 A;  3W91 A;  1I1D A;  4RS2 A;  1YR0 A;  5KTC A;  2PQ8 A;  4R9M A;  3BJ7 A;  1BOB A;  1IYL A;  2WPW A;  5H84 A;  1S7F A;  3EFA A;  1N71 A;  2REF A;  2JDC A;  1B87 A;  2HUZ A;  1XEB A;  3C26 A;  1OZP A;  3QB8 A;  5IB0 A;  4F0Y A;  4HNW B;  1XIX A;  2B5G A;  3D3S A;  1FY7 A;  1KUV A;  5C82 A;  2BSW A;  3KKW A;  3TOB A;  1Q2D A;  3FBU A;  4KVX A;  4B5P B;  3R9E A;  3G8W A;  4YRH A;  1MJA A;  4K30 A;  2WPX A;  3S6G A;  3PGP A;  2P6F A;  1UFH A;  3R9F A;  1XF8 A;  1WWZ A;  1CJW A;  2CNM A;  3BJ8 A;  3DNS A;  5IX3 A;  4JD6 A;  2VZZ A;  1M4D A;  2GAN A;  2CNT A;  2J8N A;  3G3S A;  2R7H A;  1I21 A;  3V8I A;  1V0C A;  4HKF A;  2JEV A;  2Z11 A;  4J3G A;  2FE7 A;  4CAX A;  1RO5 A;  4R3K A;  1YLE A;  4KLW A;  1R57 A;  1YVO A;  4OAE A;  2EVN A;  4AG9 A;  2OZH A;  3EO4 A;  2I79 A;  2PR8 A;  4UA3 A;  3P2H A;  2VQY A;  4XNH B;  3VWD A;  1P0H A;  5JQ4 A;  3R1K A;  2A4N A;  1KUX A;  4XPD C;  3IWG A;  3JUW A;  4KUA A;  4KVO E;  3S6H A;  3GY9 A;  4UBR A;  1M4G A;  5CNP A;  2CNS A;  2PC1 A;  3N7Z A;  4QUS A;  4MJ8 A;  1WK4 A;  3R96 A;  1YVK A;  4R57 A;  3FXT A;  3PP9 A;  4YFJ A;  2AE6 A;  2EUI A;  4JJX A;  1MJB A;  4M85 A;  4ORF A;  4X5K A;  1IIC A;  4E2A A;  1S7N A;  4HNY B;  3P2F A;  5J8C A;  2FCK A;  1S7L A;  1XMT A;  2JDD A;  3W6S A;  3FIX A;  4BMH A;  2OZU A;  1VHS A;  1P4N A;  3I9S A;  4PK2 A;  3TFY A;  3NE7 A;  4PV6 A;  3GYA A;  4LUA A;  1Z4E A;  1Q2Y A;  4U9Z A;  5H86 A;  3PZJ A;  4CS0 B;  3CXQ A;  2ZPA A;  2G3A A;  1BO4 A;  3CXS A;  4KOT A;  2P0W A;  3K9U A;  3OWC A;  2Q0Y A;  2X7B A;  1ON0 A;  3DR8 A;  1IYK A;  2NMT A;  5JPH A;  2AJ6 A;  4H89 A;  4FD7 A; 
#chains in the Genus database with same CATH topology
 4P6Y A;  3CT9 A;  3R9G A;  3NH8 A;  3D66 A;  2ZW7 A;  4A38 A;  3QNV A;  1Y0R A;  3IC1 A;  3TOA A;  1ARM A;  5CPA A;  2YGW A;  4UFW A;  4MBU A;  5HVH A;  3BXM A;  3LD2 A;  4L8A A;  2C6P A;  3F8K A;  4P4I A;  3ZJ0 A;  4R87 A;  3KR4 A;  4NFR A;  3S6F A;  4MFQ A;  4C7H A;  5J1Q A;  4E8O A;  1ZLH A;  1TKF A;  3PB4 X;  4C68 A;  2Z3P A;  1YW4 A;  2B3U A;  3TO6 A;  1R43 A;  3D7F A;  2KCW A;  4ZX8 A;  1HDU A;  3VWE A;  4UEF A;  5KTA A;  4MMO A;  5F49 A;  3FB3 A;  1EE3 P;  3B35 A;  4MHP A;  5JGF A;  1AUG A;  3FJU A;  1JWQ A;  3WC7 A;  3VAR A;  3B3T A;  4P4F A;  2PJ3 A;  2I00 A;  3GB0 A;  2JBK A;  3GKR A;  5HVF A;  4RUH A;  5C88 A;  2BL1 A;  1Q2C A;  2RB7 A;  2PJ9 A;  4MY0 A;  5F47 A;  4CAW A;  2B58 A;  3H8F A;  3D8P A;  1YQE A;  2J8R A;  4PSX A;  4PXC A;  2BUE A;  2OR4 A;  2VXK A;  5A27 A;  4OAD A;  3A9L A;  3I1U A;  5G21 A;  3RZA A;  1Y7R A;  1CM0 A;  2C27 A;  2CTC A;  2B3V A;  2FIW A;  2P6E A;  4AVC A;  1YSJ A;  1TXR A;  2PVV A;  8CPA A;  2R98 A;  3DR6 A;  1Z9U A;  1CPS A;  1RXT A;  1KUY A;  1TF8 A;  2CF4 A;  3H5Z A;  4A30 A;  5F46 A;  4MCQ A;  1QQ9 A;  4PK3 A;  2FXF A;  4MI4 A;  2QVP A;  4KSF A;  4XPL A;  4GM5 A;  5HMN A;  1QSR A;  4XPD B;  1Z2L A;  2QML A;  4HNX B;  4Q7A A;  4MCS A;  1QSM A;  2DEA A;  2RFH A;  2ZEO A;  1DE4 C;  2GU2 A;  1IOF A;  2QIR A;  4NF1 A;  3PB6 X;  2HV2 A;  4MHZ A;  4NEX A;  5D29 A;  4FD6 A;  1B6B A;  3LWU A;  3D2P A;  3EXN A;  3IGR A;  4OLL A;  4C7I A;  2F8H A;  4IHM A;  4A95 A;  2PJ7 A;  2Q7S A;  2ZEN A;  1ELL P;  2V77 A;  4L89 A;  1JQG A;  4JXR A;  4B5P A;  4KLV A;  1ZLI A;  1BLL E;  5DWN A;  3S6K A;  3D7H A;  1ZG9 A;  2ZEM A;  4C2Y A;  5AG7 A;  3FX6 A;  2R1I A;  2JBJ A;  3TX8 A;  4II9 A;  3UY5 A;  3EC4 A;  4YWY A;  2Q04 A;  1KZF A;  2B4B A;  3PFO A;  2FT0 A;  4JYW A;  4ONU A;  4A32 A;  2HC9 A;  2CIJ A;  4FBE A;  4ZI6 A;  2WUU A;  2JLM A;  2YNE A;  1YX0 A;  3QAH A;  4KOX A;  3NH4 A;  4MHD A;  1CPX A;  2ATR A;  4KUB A;  5LYL A;  3PBE A;  1QST A;  2VL1 A;  2D4O A;  3TTH A;  4KOS A;  1BPN A;  4OC4 A;  1YK3 A;  2YNC C;  4CYP A;  2ZW5 A;  5LYF A;  3NH5 A;  2K5T A;  2ZEH A;  3LAC A;  1LFW A;  4MFJ A;  3CZX A;  3BLN A;  5CBM A;  1IU8 A;  4PSW A;  3FEE A;  4O23 A;  4OID A;  2DPS A;  5A28 A;  2G9D A;  4M3S A;  5ISV A;  3WC5 A;  1Z4R A;  1YRE A;  1LRZ A;  3NFZ A;  2Q7B A;  3H4Q A;  4B12 A;  2ZOF A;  4H6U A;  3FRM A;  3IU1 A;  3KI9 A;  4OC5 A;  5G22 A;  2D4P A;  1S7K A;  2H5M A;  2O28 A;  2PJC A;  3BI1 A;  1M1D A;  4XPK A;  4UEZ A;  2QEC A;  5EC4 A;  2B5G B;  1DTD A;  1U6M A;  3JVN A;  1IID A;  4XNH C;  5AG6 A;  4G1P A;  4A39 A;  2PIY A;  4NSQ A;  5LRG A;  4B6Z A;  5HH1 A;  3IJ3 A;  2HQY A;  4RN7 A;  3L2N A;  2IQ6 A;  2V8V A;  2ZW4 A;  3B7I A;  4KOU A;  3TC8 A;  4KOV A;  3NA6 A;  3D68 A;  3K2K A;  3W6X A;  3FH4 A;  4MCR A;  4WJB A;  4EFD A;  4UCN A;  4P4J A;  3MRU A;  3S9L A;  1PU9 A;  4F9U A;  1QSO A;  2F5I A;  4JXQ A;  1XBU A;  3SI1 A;  1S5K A;  2ARH A;  1A2Z A;  2AFM A;  2IMO A;  3F5B A;  3MGD A;  2GRE A;  1Y0Y A;  2OH1 A;  2OU2 A;  3D67 A;  5J8F A;  2HB6 A;  3FVL A;  2J8M A;  1XE4 A;  3IWE A;  3WR7 A;  4NGP A;  4MHN A;  4DNC A;  2P6G A;  3KHX A;  3PEI A;  4FD5 A;  5IB9 A;  1Z8X A;  2DF5 A;  2G3T A;  4JLY A;  4UWJ A;  4FWU A;  3D4U A;  4Y49 C;  3SJX A;  4ZY1 A;  5G20 A;  1ZO0 A;  4QB9 A;  3B3V A;  2AFZ A;  2EO8 A;  4KSA A;  4QVT A;  2XEF A;  1PYT B;  2C6C A;  2BOA A;  2FL4 A;  1CBX A;  5GCN A;  5HVG A;  3D2M A;  4F6A A;  3KGQ A;  2PDO A;  4W9Y A;  3R95 A;  2CXA A;  2FIA A;  4JWP A;  2FS5 A;  4R7M A;  5DS0 A;  2Q44 A;  4KVM E;  1L0C A;  1TIQ A;  5BWA B;  4UCP A;  4AG7 A;  2OZG A;  2VI7 A;  3GLJ A;  4MFZ A;  4YGO A;  2AFO A;  4CAV A;  3DDD A;  4KOR A;  3DSB A;  4P10 A;  3GIU A;  3I3G A;  1LOK A;  1I12 A;  4BD9 A;  1YGH A;  4EME A;  4DJL A;  1Y9K A;  2ZED A;  1K4J A;  3ISZ A;  4P44 A;  1MK4 A;  1F2O A;  4ZGY B;  3IFE A;  4OP4 A;  4NJR A;  4FD4 A;  4IUS A;  5DWM A;  3B2Y A;  1TF9 A;  4B11 A;  3CXP A;  2VEZ A;  2Z10 A;  1MJ9 A;  2GIV A;  4AB7 A;  1UWY A;  4RI1 A;  4I49 A;  4AVB A;  4NCZ A;  4OC0 A;  2POK A;  4UWI A;  3SXN A;  4R76 A;  3TE4 A;  4AVA A;  2PRB A;  1CG2 A;  2Q4V A;  4GS4 A;  4KZT A;  1PUA A;  2V8H A;  3TO7 A;  3JRU A;  1TKH A;  4NGS A;  4CRY B;  4IK2 A;  1S60 A;  4OC1 A;  5FVJ A;  2BEI A;  4NXY A;  3PB9 X;  2GLJ A;  3BHX A;  2Z0Z A;  3KL9 A;  4PPZ A;  4H2K A;  1Z8L A;  3B3W A;  4H6Z A;  4WWV A;  4CGN A;  3NE8 A;  2B4D B;  3FNC A;  4E0A A;  1BAV A;  3CPX A;  4P4E A;  1LAM A;  4IF5 A;  2CTB A;  2XEI A;  5KTD A;  7CPA A;  2VBQ A;  3RYO A;  3B8G A;  2ZW6 A;  5LRJ A;  1QSN A;  2OOT A;  4C2Z A;  4QBJ A;  2Q4Y A;  3E0K A;  1LAN A;  1IB1 E;  2ANP A;  4CGP A;  3TO9 A;  1Z8W A;  4KSI A;  3EY5 A;  3CPA A;  2I3C A;  3IIB A;  1M44 A;  5I0C A;  5HXD A;  4NJQ A;  4EVY A;  3FYN A;  4OIW A;  3SXO A;  5JM6 A;  1SQH A;  5ELY A;  2G0B A;  1OBR A;  2PJ1 A;  3TCV A;  1NSL A;  4EWT A;  5E96 A;  3ZZI A;  3GUX A;  3N5F A;  1HDQ A;  3SHP A;  2O4H A;  1NE9 A;  2QYV A;  3D7G A;  4PXD A;  4QC6 A;  3H8G A;  2V8G A;  2AFU A;  5LYI A;  4CRZ B;  4U9Y A;  1J4J A;  1LCP A;  2Y0M A;  4BIN A;  2PSW A;  5AG4 A;  2PJ5 A;  2Z3O A;  2IL4 A;  1GHE A;  2PJ0 A;  1ZG8 A;  2XEG A;  2Q4Z A;  2ODF A;  2ZEF A;  4ZX9 A;  3FEC A;  2XEJ A;  2ZXV A;  2O53 A;  3F0A A;  3LOD A;  4TWE A;  2R8V A;  4HPS A;  2GE3 A;  2PVW A;  1X12 A;  1HEE A;  1Y9W A;  4KOY A;  4ZBG A;  4ONW A;  2EK9 A;  2DXQ A;  3IEH A;  2OB0 A;  5EBV A;  4UIA A;  5AGE A;  2C6G A;  3PBB A;  2B4D A;  1ARL A;  4CPA A;  3B3S A;  1NMT A;  3CDX A;  4U5Y A;  4R3L A;  2REE A;  1GYT A;  2PR1 A;  2FSR A;  2ZEL A;  4OKO A;  1RTQ A;  1S3Z A;  3K9T A;  2RC4 A;  1M4I A;  1VKC A;  3HUV A;  3MN8 A;  4PXE A;  3TT2 A;  2V8D A;  4AXV A;  2YNC A;  1YME A;  4CAF A;  2NYQ A;  4MY3 A;  5F48 A;  4KOW A;  3T8W A;  2CY2 A;  1KWM A;  2EWB A;  4Y49 B;  3WC6 A;  5IV0 A;  4DYO A;  2VZY A;  5LYD A;  2PJ8 A;  3VH9 A;  4B5O A;  4K3N A;  2GFQ A;  4OC2 A;  4DUK A;  4ZY0 A;  3T90 A;  2ABZ A;  5LRK A;  1IGB A;  4PQA A;  3PFE A;  4B14 A;  1YW6 A;  4LX9 A;  3RBU A;  5JH9 A;  4P4D A;  3W91 A;  5I4M A;  1I1D A;  1VIX A;  4RS2 A;  1YR0 A;  4X8I A;  4A31 A;  3WT4 A;  5KTC A;  3JTK A;  2Z3K A;  2Z3N A;  2PQ8 A;  3SJG A;  4R9M A;  1ZG7 A;  3BJ7 A;  3S9N A;  1BOB A;  1IYL A;  1NSA A;  2Z3L A;  5K8P A;  2DPT A;  2WPW A;  5H84 A;  1PCA A;  2NSM A;  4A94 A;  1S7F A;  2PRQ A;  3H8E A;  1XFO A;  3EFA A;  1N71 A;  3QAY A;  4UFX A;  2REF A;  1IY7 A;  2JDC A;  1B87 A;  4NGM A;  1XJO A;  2HUZ A;  4FUU A;  1XEB A;  3C26 A;  2EBJ A;  3KZW A;  1OZP A;  2WZN A;  3QB8 A;  5IB0 A;  4CGO A;  3FF3 A;  4F0Y A;  3V7Z A;  5THW A;  1XRY A;  4HNW B;  1XIX A;  1YLO A;  3VAT A;  2B5G A;  3D3S A;  4MCP A;  4Q36 A;  3KAS A;  1FY7 A;  4NGQ A;  3PRT A;  4F9V A;  1KUV A;  4IAV A;  2GLF A;  2WYR A;  5C82 A;  2BSW A;  3KKW A;  3TOB A;  4Z65 A;  4MHY A;  1CX8 A;  2YND A;  1FNO A;  1Q2D A;  2PJB A;  2WSA A;  3FBU A;  2Z3M A;  4F8Z A;  3ISX A;  4KVX A;  3HLP A;  2IJZ A;  2PJ4 A;  4B5P B;  1CP7 A;  4UEE A;  3R9E A;  3G8W A;  3PB8 X;  4UIB A;  4YRH A;  3KHZ A;  3RNZ A;  4PXB A;  1MJA A;  4K30 A;  4CGM A;  2WPX A;  3S6G A;  2P6F A;  3FED A;  3PGP A;  4CAE A;  1UFH A;  4UF4 A;  3B3C A;  3R9F A;  1XF8 A;  1WWZ A;  1CJW A;  1Z5R A;  2CNM A;  1XOV A;  3BJ8 A;  4P4B A;  4R8F A;  3DNS A;  5IX3 A;  2BCO A;  4A37 A;  2F7V A;  1AMP A;  3FMC A;  5AG5 A;  4M6I A;  4JD6 A;  4MFK A;  2VZZ A;  1M4D A;  2PJ2 A;  2GAN A;  2CNT A;  2J8N A;  3G3S A;  4R6T A;  2R7H A;  1I21 A;  3V8I A;  4B13 A;  3RAM A;  1AYE A;  1LAP A;  1V0C A;  4HKF A;  3LMS A;  4KS9 A;  1ELM P;  3DLJ A;  2JEV A;  2Z11 A;  4NGT A;  1VHE A;  2C1C A;  4J3G A;  2AFX A;  4B10 A;  4CYO A;  4M6G A;  2FE7 A;  2PJ6 A;  2FVG A;  1M4L A;  4CAX A;  1RO5 A;  4R3K A;  4YU9 A;  1YLE A;  4KLW A;  1R57 A;  1XMB A;  1YVO A;  3D7D A;  4OAE A;  4OC3 A;  4ZY2 A;  2EVN A;  5K8M A;  4AG9 A;  2OZH A;  3IWW A;  3EO4 A;  2I79 A;  4GXH A;  2PR8 A;  4UA3 A;  3P2H A;  2VQY A;  4XNH B;  3VWD A;  5D8N A;  1P0H A;  5JQ4 A;  4TNU A;  3R1K A;  4FAI A;  2A4N A;  3KR5 A;  4C2X A;  1CP6 A;  4MFP A;  1KUX A;  2AFW A;  4XPD C;  3IWG A;  3JUW A;  1F57 A;  4LQ6 A;  3DGV A;  4KUA A;  1F2P A;  5K8O A;  4KVO E;  4UCM A;  1FT7 A;  2ZEG A;  3GY9 A;  1M4G A;  4JZ0 A;  4UBR A;  5CNP A;  3S6H A;  2CNS A;  2PC1 A;  3N7Z A;  4QUS A;  3WAB A;  2Q43 A;  1WK4 A;  4MJ8 A;  3R96 A;  3RO0 A;  1YVK A;  4R57 A;  5EMI A;  4BBH A;  3FXT A;  3PP9 A;  2BO9 A;  4NGN A;  3PB7 X;  1BPM A;  4YFJ A;  2AE6 A;  2EUI A;  4JJX A;  1MJB A;  4F0X A;  1Y7E A;  4M85 A;  4ORF A;  1Q7L A;  1QMU A;  3SI0 A;  4X5K A;  1IIC A;  2EK8 A;  1Z8T A;  4NGR A;  2PJA A;  4X3R A;  4E2A A;  4MXU A;  2Q51 A;  1S7N A;  5F09 A;  4HNY B;  4Q38 A;  4UFV A;  3V38 A;  3P2F A;  5J8C A;  2PCU A;  2FCK A;  1S7L A;  1XMT A;  1H8L A;  2JDD A;  2QJ8 A;  4M6H A;  4MFL A;  4CYQ A;  4OME A;  3W6S A;  3FIX A;  3IU2 A;  4BMH A;  2OZU A;  1VHS A;  1P4N A;  4P45 A;  4X2T A;  2ZOG A;  3I9S A;  3KQZ A;  4PK2 A;  4A2Z A;  4CYN A;  4MRI A;  3NE7 A;  4ZYQ A;  3TFY A;  4PV6 A;  3GYA A;  3SI2 A;  4LUA A;  1Z4E A;  1R3N A;  6CPA A;  1Q2Y A;  4U9Z A;  5H86 A;  3PZJ A;  2ZEE A;  4CS0 B;  3KQX A;  3CXQ A;  2JEW A;  3BI0 A;  2AFS A;  1TKJ A;  3IO1 A;  4LQG A;  3SJF A;  5G1Z A;  4A33 A;  3SJE A;  2ZPA A;  2G3A A;  2J9A A;  1BO4 A;  4CGL A;  2ZEP A;  3CXS A;  4KOT A;  3S9M A;  5K8N A;  2P0W A;  1VHO A;  3K9U A;  3OWC A;  2Q0Y A;  2X7B A;  1ON0 A;  1VGY A;  3DR8 A;  3T9Y A;  1IYK A;  2NMT A;  2PIZ A;  1X10 A;  5JPH A;  2AJ6 A;  4H89 A;  2PE3 A;  4FD7 A;  1IOI A; 
#chains in the Genus database with same CATH homology
 3R9G A;  2ZW7 A;  3TOA A;  2YGW A;  4UFW A;  4MBU A;  3LD2 A;  3ZJ0 A;  4L8A A;  3F8K A;  4R87 A;  3S6F A;  4C7H A;  4MFQ A;  4E8O A;  4C68 A;  2Z3P A;  2B3U A;  3TO6 A;  2KCW A;  3VWE A;  5KTA A;  5F49 A;  3FB3 A;  2I00 A;  3GKR A;  5C88 A;  2BL1 A;  1Q2C A;  4MY0 A;  4CAW A;  5F47 A;  2B58 A;  3D8P A;  2J8R A;  4PSX A;  2BUE A;  2VXK A;  5A27 A;  4OAD A;  3A9L A;  5G21 A;  1Y7R A;  1CM0 A;  2C27 A;  2P6E A;  2B3V A;  2FIW A;  4AVC A;  2R98 A;  3DR6 A;  1Z9U A;  1RXT A;  1KUY A;  3H5Z A;  4A30 A;  5F46 A;  4PK3 A;  2FXF A;  4MI4 A;  4KSF A;  4XPL A;  5HMN A;  1QSR A;  4XPD B;  2QML A;  4HNX B;  1QSM A;  4NF1 A;  2QIR A;  4NEX A;  2HV2 A;  4FD6 A;  1B6B A;  3D2P A;  3EXN A;  3IGR A;  4OLL A;  4C7I A;  4A95 A;  4L89 A;  4B5P A;  4JXR A;  4KLV A;  5DWN A;  3S6K A;  4C2Y A;  5AG7 A;  2R1I A;  4II9 A;  3UY5 A;  3EC4 A;  2Q04 A;  1KZF A;  2B4B A;  4ONU A;  2FT0 A;  4A32 A;  2WUU A;  2JLM A;  3QAH A;  1YX0 A;  2YNE A;  4KOX A;  4MHD A;  2ATR A;  4KUB A;  1QST A;  2D4O A;  3TTH A;  4KOS A;  1YK3 A;  2YNC C;  4CYP A;  2ZW5 A;  2K5T A;  4MFJ A;  3BLN A;  4PSW A;  2DPS A;  5A28 A;  4M3S A;  5ISV A;  1Z4R A;  1YRE A;  1LRZ A;  2Q7B A;  3H4Q A;  4B12 A;  4H6U A;  3FRM A;  3IU1 A;  5G22 A;  2D4P A;  1S7K A;  2H5M A;  2O28 A;  4XPK A;  3T9Y A;  1M1D A;  2QEC A;  5EC4 A;  2B5G B;  1U6M A;  3JVN A;  1IID A;  4XNH C;  5AG6 A;  4NSQ A;  5HH1 A;  2HQY A;  2ZW4 A;  4KOU A;  4KOV A;  3W6X A;  4UCN A;  1PU9 A;  1QSO A;  2F5I A;  4JXQ A;  1S5K A;  2ARH A;  3MGD A;  3F5B A;  5J8F A;  2OH1 A;  2OU2 A;  2J8M A;  1XE4 A;  3IWE A;  3WR7 A;  4DNC A;  2P6G A;  4FD5 A;  2G3T A;  4JLY A;  4UWJ A;  4Y49 C;  5G20 A;  1ZO0 A;  4QB9 A;  4KSA A;  4QVT A;  2FL4 A;  5GCN A;  3D2M A;  4F6A A;  2PDO A;  3R95 A;  2CXA A;  2FIA A;  4JWP A;  2FS5 A;  2Q44 A;  4KVM E;  1L0C A;  1TIQ A;  5BWA B;  4UCP A;  4AG7 A;  2OZG A;  2VI7 A;  4MFZ A;  4YGO A;  4CAV A;  3DDD A;  4KOR A;  3DSB A;  3I3G A;  1I12 A;  1YGH A;  1Y9K A;  1K4J A;  1MK4 A;  4ZGY B;  4FD4 A;  4IUS A;  5DWM A;  4B11 A;  3CXP A;  2VEZ A;  2Z10 A;  1MJ9 A;  2GIV A;  4AB7 A;  4RI1 A;  4I49 A;  4AVB A;  4NCZ A;  4UWI A;  3SXN A;  3TE4 A;  4AVA A;  2PRB A;  4GS4 A;  2Q4V A;  4KZT A;  1PUA A;  3TO7 A;  4CRY B;  5FVJ A;  1S60 A;  2BEI A;  4NXY A;  2Z0Z A;  4CGN A;  4H6Z A;  4E0A A;  2B4D B;  3FNC A;  4IF5 A;  5KTD A;  2VBQ A;  3RYO A;  3B8G A;  2ZW6 A;  1QSN A;  4QBJ A;  4C2Z A;  2Q4Y A;  3E0K A;  1IB1 E;  4CGP A;  3TO9 A;  3EY5 A;  5I0C A;  1M44 A;  4EVY A;  3FYN A;  3SXO A;  1SQH A;  2G0B A;  3TCV A;  1NSL A;  5E96 A;  3ZZI A;  3SHP A;  1NE9 A;  4QC6 A;  4CRZ B;  4U9Y A;  1J4J A;  5AG4 A;  2Y0M A;  2PSW A;  2Z3O A;  2IL4 A;  1GHE A;  3F0A A;  2ZXV A;  3LOD A;  2R8V A;  2GE3 A;  1Y9W A;  4KOY A;  4ZBG A;  2DXQ A;  2OB0 A;  5EBV A;  5AGE A;  2B4D A;  1NMT A;  4U5Y A;  4R3L A;  2REE A;  2PR1 A;  2FSR A;  1S3Z A;  3TT2 A;  2RC4 A;  1M4I A;  1VKC A;  2YNC A;  4CAF A;  4MY3 A;  5F48 A;  4KOW A;  2CY2 A;  5IV0 A;  4Y49 B;  2VZY A;  4B5O A;  3T90 A;  4B14 A;  4LX9 A;  3W91 A;  1I1D A;  4RS2 A;  1YR0 A;  4A31 A;  5KTC A;  3JTK A;  2Z3K A;  2Z3N A;  2PQ8 A;  4R9M A;  3BJ7 A;  1BOB A;  1IYL A;  2Z3L A;  2DPT A;  2WPW A;  5H84 A;  1S7F A;  3EFA A;  1N71 A;  4UFX A;  2REF A;  2JDC A;  1B87 A;  2HUZ A;  1XEB A;  3C26 A;  1OZP A;  3QB8 A;  5IB0 A;  4CGO A;  4F0Y A;  4HNW B;  1XIX A;  2B5G A;  3D3S A;  4Q36 A;  1FY7 A;  1KUV A;  5C82 A;  2BSW A;  3KKW A;  3TOB A;  2YND A;  1Q2D A;  3FBU A;  2WSA A;  2Z3M A;  4KVX A;  4B5P B;  3R9E A;  3G8W A;  4YRH A;  1MJA A;  4K30 A;  4CGM A;  2WPX A;  3S6G A;  3PGP A;  2P6F A;  4CAE A;  1UFH A;  3R9F A;  1XF8 A;  1WWZ A;  1CJW A;  2CNM A;  3BJ8 A;  3DNS A;  5IX3 A;  5AG5 A;  4JD6 A;  4MFK A;  2VZZ A;  1M4D A;  2GAN A;  2CNT A;  2J8N A;  3G3S A;  2R7H A;  1I21 A;  3V8I A;  4B13 A;  1V0C A;  4HKF A;  4KS9 A;  2JEV A;  2Z11 A;  4J3G A;  4B10 A;  4CYO A;  2FE7 A;  4CAX A;  1RO5 A;  4R3K A;  1YLE A;  4KLW A;  1R57 A;  1YVO A;  4OAE A;  2EVN A;  4AG9 A;  2OZH A;  3EO4 A;  2I79 A;  2PR8 A;  4UA3 A;  3P2H A;  2VQY A;  4XNH B;  3VWD A;  1P0H A;  5JQ4 A;  3R1K A;  2A4N A;  4C2X A;  4MFP A;  1KUX A;  4XPD C;  3IWG A;  3JUW A;  4KUA A;  4KVO E;  4UCM A;  3S6H A;  3GY9 A;  4UBR A;  1M4G A;  5CNP A;  2CNS A;  2PC1 A;  3N7Z A;  4QUS A;  4MJ8 A;  1WK4 A;  3R96 A;  1YVK A;  4R57 A;  4BBH A;  3FXT A;  3PP9 A;  4YFJ A;  2AE6 A;  2EUI A;  4JJX A;  1MJB A;  4F0X A;  4M85 A;  4ORF A;  4X5K A;  1IIC A;  4E2A A;  1S7N A;  4HNY B;  4Q38 A;  4UFV A;  3P2F A;  5J8C A;  2FCK A;  1S7L A;  1XMT A;  2JDD A;  4MFL A;  4CYQ A;  3W6S A;  3FIX A;  3IU2 A;  4BMH A;  2OZU A;  1VHS A;  1P4N A;  3I9S A;  4PK2 A;  4A2Z A;  4CYN A;  3TFY A;  3NE7 A;  4PV6 A;  3GYA A;  4LUA A;  1Z4E A;  1Q2Y A;  4U9Z A;  5H86 A;  3PZJ A;  4CS0 B;  3CXQ A;  5G1Z A;  4A33 A;  2ZPA A;  2G3A A;  4CGL A;  1BO4 A;  3CXS A;  4KOT A;  2P0W A;  3K9U A;  3OWC A;  2Q0Y A;  2X7B A;  1ON0 A;  3DR8 A;  1IYK A;  2NMT A;  5JPH A;  2AJ6 A;  4H89 A;  4FD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...