3NE7A

Crystal structure of paia n-acetyltransferase from thermoplasma acidophilum in complex with coenzyme a
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
159
structure length
159
Chain Sequence
MSIEIRKLSIEDLETLIEVARESWKWTYAGIYSEEYIESWIREKYSKEKLLNEIVRSQSNLDILFLGAFADSTLIGFIELKIIANKAELLRLYLKPEYTHKKIGKTLLLEAEKIMKKKGILECRLYVHRQNSVGFSFYYKNGFKVEDTDGSDFIMEKKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ACETYLTRANSFERASE
publication title Crystal structure of the novel PaiA N-acetyltransferase from Thermoplasma acidophilum involved in the negative control of sporulation and degradative enzyme production.
pubmed doi rcsb
source organism Thermoplasma acidophilum
total genus 48
structure length 159
sequence length 159
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3ne7A00
4CS0B 2PC1A 2FE7A 4AB7A 4PV6A 5H84A 1RXTA 1NE9A 5F49A 1WWZA 3TOAA 3EC4A 3G3SA 1K4JA 4XNHB 3R9GA 1CJWA 1S7KA 5HH1A 2R98A 1XEBA 1S3ZA 4NSQA 1IYLA 4AVAA 2Z0ZA 4PSXA 4H89A 5C88A 2R7HA 2Q44A 3BLNA 5I0CA 4BMHA 2VZZA 4JXQA 1M1DA 2GANA 4QUSA 3TO9A 4UWIA 1J4JA 3DSBA 3EO4A 2BEIA 1Z4EA 3D2MA 4KOXA 1YVKA 3V8IA 1NSLA 3EXNA 3TO7A 3BJ8A 2OU2A 1YGHA 2JLMA 1B6BA 3QAHA 1P4NA 4M3SA 3RYOA 5IV0A 4B5PA 4R57A 3B8GA 3VWDA 2I00A 4KOWA 2B5GB 1TIQA 2B4DB 4R3KA 3PZJA 4KZTA 4HKFA 1BOBA 4B5OA 3S6GA 4U9ZA 3N7ZA 2AJ6A 4IF5A 1Q2CA 5F47A 1R57A 4CRYB 1IIDA 1ON0A 2ZW5A 2FS5A 4MY3A 4UA3A 2PQ8A 5KTAA 1N71A 3PP9A 2O28A 4XPKA 3GYAA 2I79A 4MBUA 1Z4RA 4J3GA 2FCKA 3D8PA 4JWPA 2B3VA 5CNPA 5ISVA 3FIXA 4CRZB 3D2PA 4II9A 1YR0A 4KVXA 4ONUA 2B3UA 4F0YA 4NEXA 4L89A 4HNXB 1I21A 5JPHA 4QC6A 3W6SA 4CAXA 2QMLA 4XPDB 2CNMA 2F5IA 1YX0A 2Q7BA 1Y9WA 1SQHA 3TCVA 1I12A 4PSWA 3NE7A 2JDCA 2VQYA 4PK2A 3BJ7A 2REEA 3FYNA 2PDOA 3FRMA 1XMTA 3ZZIA 1S7LA 1IB1E 3R9FA 1MJAA 4NF1A 4KOYA 1LRZA 4XPLA 4ORFA 1QSMA 4K30A 4B5PB 3DR6A 2ZW6A 2Y0MA 3FBUA 2VXKA 1MJ9A 4U5YA 1KUVA 3CXSA 4AG7A 2EVNA 2ZW4A 2OZGA 4KOTA 3S6FA 1MK4A 2P0WA 3T9YA 3EY5A 3DDDA 2CY2A 4E2AA 3OWCA 2FT0A 4F6AA 4LX9A 1GHEA 2G3AA 1KUXA 2OZHA 2OH1A 5FVJA 3WR7A 3MGDA 4JD6A 1UFHA 4MJ8A 4OLLA 3EFAA 2R8VA 1P0HA 4KOUA 1YREA 5F48A 1Q2YA 4R3LA 1IYKA 5J8FA 3LODA 2G3TA 2KCWA 2J8MA 2VBQA 2WPXA 3IGRA 5H86A 4YRHA 1M44A 1V0CA 4GS4A 3VWEA 5C82A 5HMNA 2PR8A 4AVCA 3SHPA 3GKRA 4KOVA 3F8KA 3D3SA 3KKWA 2VZYA 3R9EA 1Y9KA 1VHSA 4MI4A 4UBRA 1KZFA 1S7NA 1YVOA 4H6ZA 2Q4YA 4NCZA 4Y49C 2QIRA 3FNCA 2JDDA 3E0KA 2PR1A 3DNSA 2RC4A 1I1DA 4OADA 1VKCA 2Q0YA 3FB3A 1MJBA 4H6UA 2HUZA 3SXOA 4FD5A 2ZW7A 4KLWA 2X7BA 3R96A 4MHDA 4JJXA 5E96A 4CAWA 2C27A 3I3GA 4XNHC 3TO6A 3CXQA 2CNSA 3PGPA 1BO4A 4QVTA 2B4BA 4FD7A 4AVBA 3LD2A 2B5GA 2GE3A 2HV2A 2JEVA 3F5BA 4MY0A 3R1KA 1L0CA 2OB0A 3IWGA 1OZPA 3S6KA 2AE6A 2FXFA 1YLEA 4KORA 5IB0A 4KVME 3W91A 2J8NA 2D4OA 4LUAA 2ZPAA 3TT2A 2B58A 2A4NA 2EUIA 5EBVA 2CNTA 4R9MA 4KVOE 2FIWA 4HNWB 2BUEA 5J8CA 2Q4VA 3CXPA 1XIXA 4KUAA 4X5KA 1FY7A 3T90A 4EVYA 3G8WA 1S7FA 1NMTA 2GIVA 5IX3A 5DWNA 4DNCA 1S5KA 3TE4A 1M4DA 2BSWA 2VI7A 4M85A 2WPWA 4AG9A 1WK4A 2NMTA 3JUWA 4ZBGA 2REFA 4L8AA 1Q2DA 2Z10A 3S6HA 2J8RA 3DR8A 2P6FA 2FIAA 1Y7RA 2G0BA 1Z9UA 4E8OA 2DXQA 5EC4A 3I9SA 1M4IA 2P6EA 5DWMA 2K5TA 1YK3A 4RI1A 3JVNA 1XE4A 2Q04A 2FSRA 3P2HA 4R87A 4YGOA 3TTHA 2R1IA 1PU9A 2FL4A 4FD6A 3K9UA 1QSRA 3TOBA 3TFYA 3H4QA 4OAEA 4PK3A 3P2FA 4XPDC 1PUAA 2BL1A 4KUBA 1IICA 4NXYA 4KOSA 1S60A 2OZUA 2IL4A 5KTCA 4QBJA 4IUSA 1QSOA 1XF8A 5JQ4A 2ZXVA 4JXRA 2Z11A 4YFJA 3SXNA 3R95A 4UWJA 2PSWA 3GY9A 2ATRA 2QECA 4HNYB 3QB8A 3F0AA 1CM0A 4I49A 2D4PA 1U6MA 2PRBA 1RO5A 3C26A 2B4DA 2ARHA 5F46A 1KUYA 5KTDA 2VEZA 1QSTA 3UY5A 4RS2A 4KLVA 3W6XA 1M4GA 2HQYA 4E0AA 4QB9A 4Y49B 2P6GA 1B87A 2H5MA 3FXTA 4CAVA 4JLYA 5GCNA 4FD4A 1QSNA 3ZJ0A 4U9YA
chains in the Genus database with same CATH superfamily
4CS0B 3VARA 1CG2A 2PC1A 2FE7A 2PIZA 4AB7A 3KGQA 4PV6A 1ARMA 5D29A 5LRGA 3IIBA 5H84A 4UCNA 4FAIA 5K8OA 1UWYA 1RXTA 1TKFA 1QMUA 1NE9A 5F49A 1WWZA 2WUUA 4MXUA 1R43A 1BAVA 3NH4A 1BLLE 1CBXA 3RZAA 3TOAA 2CIJA 3EC4A 1TF9A 3G3SA 1K4JA 5G22A 2VL1A 3KHZA 4XNHB 3R9GA 4CAEA 1CJWA 1S7KA 1TF8A 2EWBA 5HH1A 3B3VA 2Z3PA 3KASA 4Q7AA 2R98A 4UEZA 2Z3OA 1XEBA 1HDQA 2ZEGA 2PJ4A 3LWUA 5K8PA 1S3ZA 4NSQA 4UCPA 2XEJA 4CYPA 3V38A 1IYLA 2CTBA 4AVAA 2Z0ZA 4A38A 4PSXA 2RB7A 4H89A 5C88A 1IU8A 2R7HA 2Q44A 3BLNA 4NGPA 3BXMA 4F0XA 4BMHA 5I0CA 2VZZA 1H8LA 3QAYA 5AG6A 4JXQA 1M1DA 5ELYA 8CPAA 2GANA 3BI0A 4H2KA 4LQGA 5AG5A 4QUSA 3TO9A 4UWIA 1LAMA 1X12A 1RTQA 3WC6A 1J4JA 2NSMA 3DSBA 3EO4A 3ISZA 2BEIA 1Z4EA 3D2MA 4KOXA 4TNUA 5K8MA 2EK9A 4IK2A 1YVKA 2PRQA 1NSLA 3EXNA 3TO7A 3TX8A 2GLFA 3BJ8A 4OC0A 3V8IA 3PFEA 2OU2A 5IB9A 5CPAA 1YGHA 1ZLIA 2JLMA 1B6BA 3GIUA 2RFHA 3QAHA 4OIDA 3L2NA 3WABA 1P4NA 2DPSA 4DUKA 3B2YA 4M3SA 3RYOA 5IV0A 2V8DA 3RO0A 4B5PA 4R57A 3D7HA 3B8GA 2BO9A 4YU9A 3SI2A 3VWDA 5BWAB 4P4BA 1HEEA 2I00A 2IJZA 2B5GB 4FWUA 4KOWA 4FBEA 3CPAA 1TIQA 3IO1A 2B4DB 3NFZA 4R3KA 3PB7X 1LAPA 2FVGA 2C6CA 3KQZA 4BD9A 2G9DA 3PZJA 4KZTA 4HKFA 4Q38A 1BOBA 1AUGA 5I4MA 1EE3P 4P4DA 2GFQA 5JGFA 2PJ6A 4B5OA 3S6GA 4U9ZA 3SI0A 3S9LA 2AFXA 2GU2A 2AJ6A 2V8VA 3N7ZA 4IF5A 1Q2CA 5F47A 1R57A 1ZG9A 4CRYB 4MHYA 1IIDA 1ON0A 4OC4A 2ZW5A 2FS5A 4MY3A 4UA3A 2PJ3A 2PQ8A 5KTAA 5JH9A 1N71A 3PP9A 2O28A 4GM5A 2DF5A 4XPKA 4NGTA 3GYAA 2I79A 3B3WA 4MBUA 1CPXA 1Z4RA 4J3GA 2FCKA 3D8PA 3CZXA 4JWPA 2B3VA 5CNPA 3IU2A 4MFQA 5ISVA 3FIXA 3FEEA 4CRZB 3D2PA 2PJ8A 5J1QA 4II9A 1YR0A 2PJ9A 3WC7A 4KVXA 4ONUA 2B3UA 3IJ3A 4PXCA 4F0YA 4NEXA 4L89A 1XFOA 4C7IA 4MFKA 5HXDA 1XBUA 4P6YA 4HNXB 1I21A 2QVPA 1ZG8A 3VATA 5JPHA 4NJQA 4QC6A 3W6SA 4CAXA 2PJAA 4AXVA 2QMLA 3PEIA 3PBBA 1ELMP 2GLJA 4XPDB 2AFMA 5G21A 2CNMA 3KQXA 2F5IA 1YX0A 2Q7BA 4F9UA 2AFOA 1Y9WA 2V77A 3B3SA 4RN7A 4CYNA 1LOKA 3H8GA 1SQHA 5HVFA 3TCVA 1I12A 3B3CA 4OKOA 3NE7A 4PSWA 4A31A 5LYLA 2JDCA 1CP7A 4LQ6A 4UFXA 4A39A 2VQYA 3N5FA 4PK2A 4WWVA 1JWQA 3BJ7A 2PJ1A 2Q7SA 2REEA 1ARLA 2V8GA 3FYNA 4UEFA 2XEIA 2PDOA 4BINA 3FRMA 1PYTB 1XMTA 3ZZIA 1LANA 1S7LA 1IB1E 3K2KA 2QYVA 5A28A 4MFJA 3R9FA 1MJAA 4NF1A 4KOYA 4P4EA 4ONWA 1LRZA 4XPLA 3PFOA 7CPAA 1R3NA 4ORFA 1Q7LA 1QSMA 4K30A 1DE4C 1HDUA 4B5PB 3DR6A 2ZW6A 2Y0MA 3FBUA 4KSFA 2VXKA 1MJ9A 4U5YA 3QNVA 4C68A 4ZGYB 2ZEOA 4U9YA 5CBMA 3A9LA 1KUVA 4NGRA 3SJGA 3CXSA 4AG7A 2EVNA 2ZW4A 1PCAA 3H8FA 2OZGA 3PRTA 3KZWA 4PXBA 1LCPA 1YQEA 4KOTA 3K9TA 4IHMA 1ELLP 4MCPA 4A30A 1LFWA 5F09A 2ZENA 3NE8A 3S6FA 1MK4A 2P0WA 3T9YA 2IMOA 3GB0A 3EY5A 1QQ9A 3DDDA 2CY2A 3PB9X 1Z5RA 4E2AA 4F8ZA 4MFLA 3OWCA 5LYFA 2FT0A 2PJ5A 2PVWA 1CX8A 2ABZA 4F6AA 3WT4A 2Z3LA 4LX9A 4OC1A 2AFSA 1GHEA 2PIYA 5HVHA 1F2PA 2G3AA 1KUXA 4UEEA 2OZHA 2OH1A 3TC8A 4WJBA 5FVJA 3MGDA 4JD6A 5LRJA 3WR7A 1UFHA 4MJ8A 3H8EA 3LACA 4NJRA 4OLLA 3EFAA 4PXEA 2R8VA 5THWA 4A2ZA 1P0HA 4KOUA 2WSAA 3WC5A 1YREA 3IWEA 5LRKA 5F48A 1Q2YA 3MRUA 4R3LA 4DYOA 1IYKA 6CPAA 3FEDA 5J8FA 3LODA 1TKJA 1IGBA 2AFZA 2G3TA 2KCWA 3B7IA 4B12A 3HLPA 2WYRA 4P4FA 2J8MA 2VBQA 2WPXA 3IGRA 3SJFA 5H86A 3S9NA 4YRHA 5AG7A 1M44A 4BBHA 1V0CA 3KL9A 2WZNA 4GS4A 2QJ8A 4C2YA 3D7DA 3VWEA 5C82A 4CAFA 2O4HA 4K3NA 1NSAA 5HMNA 4P45A 2PR8A 4AVCA 2ODFA 4KSIA 3SHPA 3GKRA 3NA6A 4KOVA 3F8KA 1Z8WA 3D3SA 3KKWA 4CYQA 2VZYA 3R9EA 1Y9KA 1VHSA 1YLOA 4MI4A 4UBRA 1KZFA 1S7NA 1Y7EA 1YVOA 2C6PA 2OR4A 4H6ZA 4A33A 3FJUA 2Q4YA 4NCZA 4B11A 2V8HA 4Y49C 2QIRA 3FNCA 4CPAA 4UIAA 2IQ6A 2JDDA 3PB4X 1A2ZA 3E0KA 4B6ZA 3LMSA 2Z3NA 4MRIA 2PR1A 3DNSA 1FT7A 4EMEA 1ZG7A 2RC4A 1I1DA 4OADA 1X10A 1VKCA 4PXDA 4R8FA 2Q0YA 1BPNA 3FMCA 2ZOGA 3D66A 3FB3A 1M4LA 4B13A 2EO8A 3DGVA 1MJBA 4MCQA 3HUVA 4H6UA 2HUZA 3SXOA 2ZEMA 3CT9A 4FD5A 2ZW7A 5G20A 1BPMA 4KLWA 4GXHA 1CP6A 2X7BA 4P10A 4MHDA 4JJXA 3R96A 5E96A 4ZX8A 2Z3MA 4CAWA 2C27A 3I3GA 4XNHC 2DPTA 3TO6A 3CXQA 4B10A 2CNSA 3PGPA 1BO4A 2PCUA 3S9MA 2Q51A 2B4BA 4FD7A 4QVTA 3RNZA 3NH8A 4AVBA 2YNEA 3LD2A 4OC3A 2Z3KA 4A95A 2B5GA 2GE3A 2HV2A 5AG4A 2JEVA 4RUHA 5JM6A 4MCRA 4YWYA 3F5BA 2JBJA 4MY0A 4NFRA 4R76A 3R1KA 1L0CA 2OB0A 3BHXA 3IWGA 1IOIA 1OZPA 4MHPA 4EWTA 3S6KA 2AE6A 2FXFA 1YLEA 2I3CA 4KORA 5IB0A 4KVME 3W91A 4NGMA 2J8NA 2BOAA 1F2OA 2D4OA 4LUAA 3VH9A 1VHEA 3CDXA 2ZPAA 3SI1A 3TT2A 3IEHA 2YNCC 4MFPA 2B58A 2A4NA 2EUIA 3D4UA 4EFDA 3T8WA 5EBVA 4UFVA 4Q36A 2PE3A 2CNTA 4MHZA 2PVVA 2NYQA 3JTKA 4UFWA 4R9MA 4UCMA 5G1ZA 4KVOE 2FIWA 4HNWB 2BUEA 3D67A 5J8CA 2Q4VA 3CXPA 4OIWA 2YGWA 1XIXA 4KUAA 2PJ0A 4X5KA 1FY7A 3T90A 3KHXA 4EVYA 4ZYQA 1Z2LA 3G8WA 1S7FA 2PJ7A 1NMTA 2GIVA 5IX3A 2ZEDA 5DWNA 4HPSA 4PPZA 4A32A 4DNCA 1S5KA 1Z8LA 3TE4A 3SJXA 2CF4A 5D8NA 1M4DA 2BSWA 2VI7A 5LYDA 2Q43A 3BI1A 4UF4A 1XMBA 3FF3A 4M85A 2WPWA 4IAVA 4NGNA 1TKHA 4AG9A 1WK4A 2NMTA 3JUWA 4UIBA 3IFEA 2ZEEA 4ZBGA 2REFA 4L8AA 2O53A 1Q2DA 2Z10A 3S6HA 2J8RA 3DR8A 5DS0A 1XRYA 2P6FA 2FIAA 3D68A 4R7MA 4OC5A 1Y7RA 2G0BA 3IC1A 2GREA 3D7FA 1Z9UA 2DEAA 4E8OA 4X2TA 2PJCA 3ISXA 4Z65A 2DXQA 1AMPA 5EC4A 3I9SA 1M4IA 2BCOA 4W9YA 2P6EA 5DWMA 2OOTA 3FVLA 2K5TA 2POKA 2PJBA 4C2XA 4NGSA 2ZEHA 1YK3A 4RI1A 4PQAA 3FH4A 3JVNA 4R6TA 1ZO0A 4TWEA 1JQGA 1OBRA 1XE4A 3KR5A 2Q04A 4MFZA 4X8IA 2FSRA 1Y0RA 3P2HA 4R87A 4YGOA 4CGNA 3TTHA 1Z8TA 4M6GA 2EK8A 2AFWA 4JYWA 2R1IA 1Z8XA 1PU9A 2FL4A 3IWWA 4FD6A 4G1PA 3K9UA 1XJOA 4A94A 4A37A 1QSRA 3TOBA 4B14A 3TFYA 4M6IA 2JEWA 3RAMA 2ZOFA 4X3RA 3H4QA 4OAEA 2CXAA 3RBUA 4PK3A 1YW6A 4MHNA 3P2FA 1F57A 3GLJA 4KSAA 4XPDC 4KS9A 3V7ZA 1PUAA 2PJ2A 2BL1A 4OC2A 4KUBA 1IICA 3IU1A 4NXYA 4KOSA 5K8NA 4P4JA 2YNDA 1S60A 2OZUA 2JBKA 2IL4A 4CGLA 5KTCA 1GYTA 4QBJA 4IUSA 1CPSA 3PBEA 2XEGA 1XOVA 2EBJA 4OMEA 3KI9A 2F8HA 1QSOA 2YNCA 5AGEA 4JZ0A 1VIXA 1XF8A 2HC9A 4FUUA 2ZEPA 2ANPA 2AFUA 2ZXVA 4JXRA 5JQ4A 1AYEA 2Z11A 4MMOA 4YFJA 4CGOA 4ZY0A 3B35A 3SXNA 1VHOA 4ZX9A 4F9VA 3R95A 4ZI6A 4O23A 4C2ZA 3NH5A 2PSWA 4UWJA 3GY9A 4P44A 2C6GA 1KWMA 3CPXA 4P4IA 2ATRA 2QECA 4HNYB 3QB8A 3F0AA 1CM0A 4ZY1A 2CTCA 4I49A 2D4PA 1U6MA 2PRBA 4ZY2A 3B3TA 2Q4ZA 1RO5A 3C26A 3FX6A 2F7VA 3GUXA 4CYOA 2B4DA 2ZELA 3JRUA 2ARHA 5EMIA 5F46A 3D7GA 2HB6A 1KUYA 1YMEA 1YSJA 2ZEFA 2VEZA 4OP4A 4M6HA 5KTDA 1QSTA 3H5ZA 3KR4A 1IOFA 5A27A 3UY5A 4RS2A 3SJEA 5HVGA 4KLVA 5LYIA 3W6XA 1M4GA 2HQYA 4E0AA 2C1CA 1TXRA 4QB9A 4Y49B 1ZLHA 4MCSA 4NGQA 2XEFA 2P6GA 1VGYA 3PB6X 1DTDA 3I1UA 4C7HA 1B87A 3MN8A 4DJLA 2H5MA 1IY7A 1YW4A 3PB8X 4CGMA 4CGPA 3DLJA 3FXTA 4CAVA 2J9AA 3FECA 4JLYA 5GCNA 1FNOA 4FD4A 1QSNA 3ZJ0A 1Y0YA
chains in the Genus database with same CATH topology
4CS0B 2PC1A 2FE7A 4AB7A 4PV6A 5H84A 4UCNA 1RXTA 1NE9A 5F49A 1WWZA 2WUUA 3TOAA 3EC4A 3G3SA 1K4JA 5G22A 4CAEA 4XNHB 3R9GA 1CJWA 1S7KA 5HH1A 2Z3PA 2R98A 2Z3OA 1XEBA 1S3ZA 4NSQA 4UCPA 4CYPA 1IYLA 4AVAA 2Z0ZA 4PSXA 4H89A 5C88A 2R7HA 2Q44A 3BLNA 4F0XA 5I0CA 4BMHA 2VZZA 5AG6A 4JXQA 1M1DA 2GANA 5AG5A 4QUSA 3TO9A 4UWIA 1J4JA 3DSBA 3EO4A 2BEIA 1Z4EA 3D2MA 4KOXA 1YVKA 3V8IA 1NSLA 3EXNA 3TO7A 3BJ8A 2OU2A 1YGHA 2JLMA 1B6BA 3QAHA 1P4NA 2DPSA 4M3SA 3RYOA 5IV0A 4B5PA 4R57A 3B8GA 3VWDA 5BWAB 2I00A 4KOWA 2B5GB 1TIQA 2B4DB 4R3KA 3PZJA 4KZTA 4HKFA 4Q38A 1BOBA 4B5OA 3S6GA 4U9ZA 3N7ZA 2AJ6A 4IF5A 1Q2CA 5F47A 1R57A 4CRYB 1IIDA 1ON0A 2ZW5A 2FS5A 4MY3A 4UA3A 2PQ8A 5KTAA 1N71A 3PP9A 2O28A 4XPKA 3GYAA 2I79A 4MBUA 1Z4RA 4J3GA 2FCKA 3D8PA 4JWPA 2B3VA 5CNPA 3IU2A 4MFQA 5ISVA 3FIXA 4CRZB 3D2PA 4II9A 1YR0A 4KVXA 4ONUA 2B3UA 4F0YA 4NEXA 4L89A 4C7IA 4MFKA 4HNXB 1I21A 5JPHA 4QC6A 3W6SA 4CAXA 2QMLA 4XPDB 5G21A 2CNMA 2F5IA 1YX0A 2Q7BA 1Y9WA 4CYNA 1SQHA 3TCVA 1I12A 4PSWA 3NE7A 4A31A 2JDCA 4UFXA 2VQYA 4PK2A 3BJ7A 2REEA 3FYNA 2PDOA 3FRMA 1XMTA 3ZZIA 1S7LA 1IB1E 5A28A 4MFJA 3R9FA 1MJAA 4NF1A 4KOYA 1LRZA 4XPLA 4ORFA 1QSMA 4K30A 4B5PB 3DR6A 2ZW6A 2Y0MA 3FBUA 4KSFA 2VXKA 1MJ9A 4U5YA 4C68A 4ZGYB 3A9LA 1KUVA 3CXSA 4AG7A 2EVNA 2ZW4A 2OZGA 4KOTA 4A30A 3S6FA 1MK4A 2P0WA 3T9YA 3EY5A 3DDDA 2CY2A 4E2AA 4MFLA 3OWCA 2FT0A 4F6AA 2Z3LA 4LX9A 1GHEA 2G3AA 1KUXA 2OZHA 2OH1A 5FVJA 3WR7A 3MGDA 4JD6A 1UFHA 4MJ8A 4OLLA 3EFAA 4A2ZA 2R8VA 1P0HA 4KOUA 2WSAA 1YREA 3IWEA 5F48A 1Q2YA 4R3LA 1IYKA 5J8FA 3LODA 2G3TA 2KCWA 4B12A 2J8MA 2VBQA 2WPXA 3IGRA 5H86A 4YRHA 5AG7A 1M44A 4BBHA 1V0CA 4GS4A 4C2YA 3VWEA 5C82A 4CAFA 5HMNA 2PR8A 4AVCA 3SHPA 3GKRA 4KOVA 3F8KA 3D3SA 3KKWA 4CYQA 2VZYA 3R9EA 1Y9KA 1VHSA 4MI4A 4UBRA 1KZFA 1S7NA 1YVOA 4A33A 4H6ZA 2Q4YA 4NCZA 4B11A 4Y49C 2QIRA 3FNCA 2JDDA 3E0KA 2Z3NA 2PR1A 3DNSA 2RC4A 1I1DA 4OADA 1VKCA 2Q0YA 3FB3A 4B13A 1MJBA 4H6UA 2HUZA 3SXOA 4FD5A 2ZW7A 5G20A 4KLWA 2X7BA 3R96A 4MHDA 4JJXA 5E96A 4CAWA 2Z3MA 2C27A 3I3GA 4XNHC 2DPTA 3TO6A 3CXQA 4B10A 2CNSA 3PGPA 1BO4A 4QVTA 2B4BA 4FD7A 4AVBA 2YNEA 3LD2A 2Z3KA 4A95A 2B5GA 2GE3A 2HV2A 5AG4A 2JEVA 3F5BA 4MY0A 3R1KA 1L0CA 2OB0A 3IWGA 1OZPA 3S6KA 2AE6A 2FXFA 1YLEA 4KORA 5IB0A 4KVME 3W91A 2J8NA 2D4OA 4LUAA 2ZPAA 3TT2A 4MFPA 2YNCC 2B58A 2A4NA 2EUIA 5EBVA 4UFVA 4Q36A 2CNTA 4UFWA 3JTKA 5G1ZA 4R9MA 4UCMA 4KVOE 2FIWA 4HNWB 2BUEA 5J8CA 2Q4VA 3CXPA 2YGWA 1XIXA 4KUAA 4X5KA 1FY7A 3T90A 4EVYA 3G8WA 1S7FA 1NMTA 2GIVA 5IX3A 5DWNA 4A32A 4DNCA 1S5KA 3TE4A 1M4DA 2BSWA 2VI7A 4M85A 2WPWA 4AG9A 1WK4A 2NMTA 3JUWA 4ZBGA 2REFA 4L8AA 1Q2DA 2Z10A 3S6HA 2J8RA 3DR8A 2P6FA 2FIAA 1Y7RA 2G0BA 1Z9UA 4E8OA 2DXQA 5EC4A 3I9SA 1M4IA 2P6EA 5DWMA 4C2XA 2K5TA 1YK3A 4RI1A 3JVNA 1ZO0A 4MFZA 1XE4A 2Q04A 2FSRA 3P2HA 4R87A 4YGOA 4CGNA 3TTHA 2R1IA 1PU9A 2FL4A 4FD6A 3K9UA 1QSRA 3TOBA 4B14A 3TFYA 3H4QA 4OAEA 2CXAA 4PK3A 3P2FA 4KSAA 4XPDC 4KS9A 1PUAA 2BL1A 4KUBA 1IICA 3IU1A 4NXYA 4KOSA 2YNDA 1S60A 2OZUA 2IL4A 4CGLA 5KTCA 4QBJA 4IUSA 1QSOA 2YNCA 5AGEA 1XF8A 5JQ4A 2ZXVA 4JXRA 2Z11A 4YFJA 4CGOA 3SXNA 3R95A 4C2ZA 4UWJA 2PSWA 3GY9A 2ATRA 2QECA 4HNYB 3QB8A 3F0AA 1CM0A 4I49A 2D4PA 1U6MA 2PRBA 1RO5A 3C26A 4CYOA 2B4DA 2ARHA 5F46A 1KUYA 5KTDA 2VEZA 1QSTA 3H5ZA 5A27A 3UY5A 4RS2A 4KLVA 3W6XA 1M4GA 2HQYA 4E0AA 4QB9A 4Y49B 2P6GA 4C7HA 1B87A 2H5MA 4CGMA 4CGPA 3FXTA 4CAVA 4JLYA 5GCNA 4FD4A 1QSNA 3ZJ0A 4U9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CS0 B;  2PC1 A;  2FE7 A;  4AB7 A;  4PV6 A;  5H84 A;  1RXT A;  1NE9 A;  5F49 A;  1WWZ A;  3TOA A;  3EC4 A;  3G3S A;  1K4J A;  4XNH B;  3R9G A;  1CJW A;  1S7K A;  5HH1 A;  2R98 A;  1XEB A;  1S3Z A;  4NSQ A;  1IYL A;  4AVA A;  2Z0Z A;  4PSX A;  4H89 A;  5C88 A;  2R7H A;  2Q44 A;  3BLN A;  5I0C A;  4BMH A;  2VZZ A;  4JXQ A;  1M1D A;  2GAN A;  4QUS A;  3TO9 A;  4UWI A;  1J4J A;  3DSB A;  3EO4 A;  2BEI A;  1Z4E A;  3D2M A;  4KOX A;  1YVK A;  3V8I A;  1NSL A;  3EXN A;  3TO7 A;  3BJ8 A;  2OU2 A;  1YGH A;  2JLM A;  1B6B A;  3QAH A;  1P4N A;  4M3S A;  3RYO A;  5IV0 A;  4B5P A;  4R57 A;  3B8G A;  3VWD A;  2I00 A;  4KOW A;  2B5G B;  1TIQ A;  2B4D B;  4R3K A;  3PZJ A;  4KZT A;  4HKF A;  1BOB A;  4B5O A;  3S6G A;  4U9Z A;  3N7Z A;  2AJ6 A;  4IF5 A;  1Q2C A;  5F47 A;  1R57 A;  4CRY B;  1IID A;  1ON0 A;  2ZW5 A;  2FS5 A;  4MY3 A;  4UA3 A;  2PQ8 A;  5KTA A;  1N71 A;  3PP9 A;  2O28 A;  4XPK A;  3GYA A;  2I79 A;  4MBU A;  1Z4R A;  4J3G A;  2FCK A;  3D8P A;  4JWP A;  2B3V A;  5CNP A;  5ISV A;  3FIX A;  4CRZ B;  3D2P A;  4II9 A;  1YR0 A;  4KVX A;  4ONU A;  2B3U A;  4F0Y A;  4NEX A;  4L89 A;  4HNX B;  1I21 A;  5JPH A;  4QC6 A;  3W6S A;  4CAX A;  2QML A;  4XPD B;  2CNM A;  2F5I A;  1YX0 A;  2Q7B A;  1Y9W A;  1SQH A;  3TCV A;  1I12 A;  4PSW A;  3NE7 A;  2JDC A;  2VQY A;  4PK2 A;  3BJ7 A;  2REE A;  3FYN A;  2PDO A;  3FRM A;  1XMT A;  3ZZI A;  1S7L A;  1IB1 E;  3R9F A;  1MJA A;  4NF1 A;  4KOY A;  1LRZ A;  4XPL A;  4ORF A;  1QSM A;  4K30 A;  4B5P B;  3DR6 A;  2ZW6 A;  2Y0M A;  3FBU A;  2VXK A;  1MJ9 A;  4U5Y A;  1KUV A;  3CXS A;  4AG7 A;  2EVN A;  2ZW4 A;  2OZG A;  4KOT A;  3S6F A;  1MK4 A;  2P0W A;  3T9Y A;  3EY5 A;  3DDD A;  2CY2 A;  4E2A A;  3OWC A;  2FT0 A;  4F6A A;  4LX9 A;  1GHE A;  2G3A A;  1KUX A;  2OZH A;  2OH1 A;  5FVJ A;  3WR7 A;  3MGD A;  4JD6 A;  1UFH A;  4MJ8 A;  4OLL A;  3EFA A;  2R8V A;  1P0H A;  4KOU A;  1YRE A;  5F48 A;  1Q2Y A;  4R3L A;  1IYK A;  5J8F A;  3LOD A;  2G3T A;  2KCW A;  2J8M A;  2VBQ A;  2WPX A;  3IGR A;  5H86 A;  4YRH A;  1M44 A;  1V0C A;  4GS4 A;  3VWE A;  5C82 A;  5HMN A;  2PR8 A;  4AVC A;  3SHP A;  3GKR A;  4KOV A;  3F8K A;  3D3S A;  3KKW A;  2VZY A;  3R9E A;  1Y9K A;  1VHS A;  4MI4 A;  4UBR A;  1KZF A;  1S7N A;  1YVO A;  4H6Z A;  2Q4Y A;  4NCZ A;  4Y49 C;  2QIR A;  3FNC A;  2JDD A;  3E0K A;  2PR1 A;  3DNS A;  2RC4 A;  1I1D A;  4OAD A;  1VKC A;  2Q0Y A;  3FB3 A;  1MJB A;  4H6U A;  2HUZ A;  3SXO A;  4FD5 A;  2ZW7 A;  4KLW A;  2X7B A;  3R96 A;  4MHD A;  4JJX A;  5E96 A;  4CAW A;  2C27 A;  3I3G A;  4XNH C;  3TO6 A;  3CXQ A;  2CNS A;  3PGP A;  1BO4 A;  4QVT A;  2B4B A;  4FD7 A;  4AVB A;  3LD2 A;  2B5G A;  2GE3 A;  2HV2 A;  2JEV A;  3F5B A;  4MY0 A;  3R1K A;  1L0C A;  2OB0 A;  3IWG A;  1OZP A;  3S6K A;  2AE6 A;  2FXF A;  1YLE A;  4KOR A;  5IB0 A;  4KVM E;  3W91 A;  2J8N A;  2D4O A;  4LUA A;  2ZPA A;  3TT2 A;  2B58 A;  2A4N A;  2EUI A;  5EBV A;  2CNT A;  4R9M A;  4KVO E;  2FIW A;  4HNW B;  2BUE A;  5J8C A;  2Q4V A;  3CXP A;  1XIX A;  4KUA A;  4X5K A;  1FY7 A;  3T90 A;  4EVY A;  3G8W A;  1S7F A;  1NMT A;  2GIV A;  5IX3 A;  5DWN A;  4DNC A;  1S5K A;  3TE4 A;  1M4D A;  2BSW A;  2VI7 A;  4M85 A;  2WPW A;  4AG9 A;  1WK4 A;  2NMT A;  3JUW A;  4ZBG A;  2REF A;  4L8A A;  1Q2D A;  2Z10 A;  3S6H A;  2J8R A;  3DR8 A;  2P6F A;  2FIA A;  1Y7R A;  2G0B A;  1Z9U A;  4E8O A;  2DXQ A;  5EC4 A;  3I9S A;  1M4I A;  2P6E A;  5DWM A;  2K5T A;  1YK3 A;  4RI1 A;  3JVN A;  1XE4 A;  2Q04 A;  2FSR A;  3P2H A;  4R87 A;  4YGO A;  3TTH A;  2R1I A;  1PU9 A;  2FL4 A;  4FD6 A;  3K9U A;  1QSR A;  3TOB A;  3TFY A;  3H4Q A;  4OAE A;  4PK3 A;  3P2F A;  4XPD C;  1PUA A;  2BL1 A;  4KUB A;  1IIC A;  4NXY A;  4KOS A;  1S60 A;  2OZU A;  2IL4 A;  5KTC A;  4QBJ A;  4IUS A;  1QSO A;  1XF8 A;  5JQ4 A;  2ZXV A;  4JXR A;  2Z11 A;  4YFJ A;  3SXN A;  3R95 A;  4UWJ A;  2PSW A;  3GY9 A;  2ATR A;  2QEC A;  4HNY B;  3QB8 A;  3F0A A;  1CM0 A;  4I49 A;  2D4P A;  1U6M A;  2PRB A;  1RO5 A;  3C26 A;  2B4D A;  2ARH A;  5F46 A;  1KUY A;  5KTD A;  2VEZ A;  1QST A;  3UY5 A;  4RS2 A;  4KLV A;  3W6X A;  1M4G A;  2HQY A;  4E0A A;  4QB9 A;  4Y49 B;  2P6G A;  1B87 A;  2H5M A;  3FXT A;  4CAV A;  4JLY A;  5GCN A;  4FD4 A;  1QSN A;  3ZJ0 A;  4U9Y A; 
#chains in the Genus database with same CATH topology
 4CS0 B;  3VAR A;  1CG2 A;  2PC1 A;  2FE7 A;  2PIZ A;  4AB7 A;  3KGQ A;  4PV6 A;  1ARM A;  5D29 A;  5LRG A;  3IIB A;  5H84 A;  4UCN A;  4FAI A;  5K8O A;  1UWY A;  1RXT A;  1TKF A;  1QMU A;  1NE9 A;  5F49 A;  1WWZ A;  2WUU A;  4MXU A;  1R43 A;  1BAV A;  3NH4 A;  1BLL E;  1CBX A;  3RZA A;  3TOA A;  2CIJ A;  3EC4 A;  1TF9 A;  3G3S A;  1K4J A;  5G22 A;  2VL1 A;  3KHZ A;  4XNH B;  3R9G A;  4CAE A;  1CJW A;  1S7K A;  1TF8 A;  2EWB A;  5HH1 A;  3B3V A;  2Z3P A;  3KAS A;  4Q7A A;  2R98 A;  4UEZ A;  2Z3O A;  1XEB A;  1HDQ A;  2ZEG A;  2PJ4 A;  3LWU A;  5K8P A;  1S3Z A;  4NSQ A;  4UCP A;  2XEJ A;  4CYP A;  3V38 A;  1IYL A;  2CTB A;  4AVA A;  2Z0Z A;  4A38 A;  4PSX A;  2RB7 A;  4H89 A;  5C88 A;  1IU8 A;  2R7H A;  2Q44 A;  3BLN A;  4NGP A;  3BXM A;  4F0X A;  4BMH A;  5I0C A;  2VZZ A;  1H8L A;  3QAY A;  5AG6 A;  4JXQ A;  1M1D A;  5ELY A;  8CPA A;  2GAN A;  3BI0 A;  4H2K A;  4LQG A;  5AG5 A;  4QUS A;  3TO9 A;  4UWI A;  1LAM A;  1X12 A;  1RTQ A;  3WC6 A;  1J4J A;  2NSM A;  3DSB A;  3EO4 A;  3ISZ A;  2BEI A;  1Z4E A;  3D2M A;  4KOX A;  4TNU A;  5K8M A;  2EK9 A;  4IK2 A;  1YVK A;  2PRQ A;  1NSL A;  3EXN A;  3TO7 A;  3TX8 A;  2GLF A;  3BJ8 A;  4OC0 A;  3V8I A;  3PFE A;  2OU2 A;  5IB9 A;  5CPA A;  1YGH A;  1ZLI A;  2JLM A;  1B6B A;  3GIU A;  2RFH A;  3QAH A;  4OID A;  3L2N A;  3WAB A;  1P4N A;  2DPS A;  4DUK A;  3B2Y A;  4M3S A;  3RYO A;  5IV0 A;  2V8D A;  3RO0 A;  4B5P A;  4R57 A;  3D7H A;  3B8G A;  2BO9 A;  4YU9 A;  3SI2 A;  3VWD A;  5BWA B;  4P4B A;  1HEE A;  2I00 A;  2IJZ A;  2B5G B;  4FWU A;  4KOW A;  4FBE A;  3CPA A;  1TIQ A;  3IO1 A;  2B4D B;  3NFZ A;  4R3K A;  3PB7 X;  1LAP A;  2FVG A;  2C6C A;  3KQZ A;  4BD9 A;  2G9D A;  3PZJ A;  4KZT A;  4HKF A;  4Q38 A;  1BOB A;  1AUG A;  5I4M A;  1EE3 P;  4P4D A;  2GFQ A;  5JGF A;  2PJ6 A;  4B5O A;  3S6G A;  4U9Z A;  3SI0 A;  3S9L A;  2AFX A;  2GU2 A;  2AJ6 A;  2V8V A;  3N7Z A;  4IF5 A;  1Q2C A;  5F47 A;  1R57 A;  1ZG9 A;  4CRY B;  4MHY A;  1IID A;  1ON0 A;  4OC4 A;  2ZW5 A;  2FS5 A;  4MY3 A;  4UA3 A;  2PJ3 A;  2PQ8 A;  5KTA A;  5JH9 A;  1N71 A;  3PP9 A;  2O28 A;  4GM5 A;  2DF5 A;  4XPK A;  4NGT A;  3GYA A;  2I79 A;  3B3W A;  4MBU A;  1CPX A;  1Z4R A;  4J3G A;  2FCK A;  3D8P A;  3CZX A;  4JWP A;  2B3V A;  5CNP A;  3IU2 A;  4MFQ A;  5ISV A;  3FIX A;  3FEE A;  4CRZ B;  3D2P A;  2PJ8 A;  5J1Q A;  4II9 A;  1YR0 A;  2PJ9 A;  3WC7 A;  4KVX A;  4ONU A;  2B3U A;  3IJ3 A;  4PXC A;  4F0Y A;  4NEX A;  4L89 A;  1XFO A;  4C7I A;  4MFK A;  5HXD A;  1XBU A;  4P6Y A;  4HNX B;  1I21 A;  2QVP A;  1ZG8 A;  3VAT A;  5JPH A;  4NJQ A;  4QC6 A;  3W6S A;  4CAX A;  2PJA A;  4AXV A;  2QML A;  3PEI A;  3PBB A;  1ELM P;  2GLJ A;  4XPD B;  2AFM A;  5G21 A;  2CNM A;  3KQX A;  2F5I A;  1YX0 A;  2Q7B A;  4F9U A;  2AFO A;  1Y9W A;  2V77 A;  3B3S A;  4RN7 A;  4CYN A;  1LOK A;  3H8G A;  1SQH A;  5HVF A;  3TCV A;  1I12 A;  3B3C A;  4OKO A;  3NE7 A;  4PSW A;  4A31 A;  5LYL A;  2JDC A;  1CP7 A;  4LQ6 A;  4UFX A;  4A39 A;  2VQY A;  3N5F A;  4PK2 A;  4WWV A;  1JWQ A;  3BJ7 A;  2PJ1 A;  2Q7S A;  2REE A;  1ARL A;  2V8G A;  3FYN A;  4UEF A;  2XEI A;  2PDO A;  4BIN A;  3FRM A;  1PYT B;  1XMT A;  3ZZI A;  1LAN A;  1S7L A;  1IB1 E;  3K2K A;  2QYV A;  5A28 A;  4MFJ A;  3R9F A;  1MJA A;  4NF1 A;  4KOY A;  4P4E A;  4ONW A;  1LRZ A;  4XPL A;  3PFO A;  7CPA A;  1R3N A;  4ORF A;  1Q7L A;  1QSM A;  4K30 A;  1DE4 C;  1HDU A;  4B5P B;  3DR6 A;  2ZW6 A;  2Y0M A;  3FBU A;  4KSF A;  2VXK A;  1MJ9 A;  4U5Y A;  3QNV A;  4C68 A;  4ZGY B;  2ZEO A;  4U9Y A;  5CBM A;  3A9L A;  1KUV A;  4NGR A;  3SJG A;  3CXS A;  4AG7 A;  2EVN A;  2ZW4 A;  1PCA A;  3H8F A;  2OZG A;  3PRT A;  3KZW A;  4PXB A;  1LCP A;  1YQE A;  4KOT A;  3K9T A;  4IHM A;  1ELL P;  4MCP A;  4A30 A;  1LFW A;  5F09 A;  2ZEN A;  3NE8 A;  3S6F A;  1MK4 A;  2P0W A;  3T9Y A;  2IMO A;  3GB0 A;  3EY5 A;  1QQ9 A;  3DDD A;  2CY2 A;  3PB9 X;  1Z5R A;  4E2A A;  4F8Z A;  4MFL A;  3OWC A;  5LYF A;  2FT0 A;  2PJ5 A;  2PVW A;  1CX8 A;  2ABZ A;  4F6A A;  3WT4 A;  2Z3L A;  4LX9 A;  4OC1 A;  2AFS A;  1GHE A;  2PIY A;  5HVH A;  1F2P A;  2G3A A;  1KUX A;  4UEE A;  2OZH A;  2OH1 A;  3TC8 A;  4WJB A;  5FVJ A;  3MGD A;  4JD6 A;  5LRJ A;  3WR7 A;  1UFH A;  4MJ8 A;  3H8E A;  3LAC A;  4NJR A;  4OLL A;  3EFA A;  4PXE A;  2R8V A;  5THW A;  4A2Z A;  1P0H A;  4KOU A;  2WSA A;  3WC5 A;  1YRE A;  3IWE A;  5LRK A;  5F48 A;  1Q2Y A;  3MRU A;  4R3L A;  4DYO A;  1IYK A;  6CPA A;  3FED A;  5J8F A;  3LOD A;  1TKJ A;  1IGB A;  2AFZ A;  2G3T A;  2KCW A;  3B7I A;  4B12 A;  3HLP A;  2WYR A;  4P4F A;  2J8M A;  2VBQ A;  2WPX A;  3IGR A;  3SJF A;  5H86 A;  3S9N A;  4YRH A;  5AG7 A;  1M44 A;  4BBH A;  1V0C A;  3KL9 A;  2WZN A;  4GS4 A;  2QJ8 A;  4C2Y A;  3D7D A;  3VWE A;  5C82 A;  4CAF A;  2O4H A;  4K3N A;  1NSA A;  5HMN A;  4P45 A;  2PR8 A;  4AVC A;  2ODF A;  4KSI A;  3SHP A;  3GKR A;  3NA6 A;  4KOV A;  3F8K A;  1Z8W A;  3D3S A;  3KKW A;  4CYQ A;  2VZY A;  3R9E A;  1Y9K A;  1VHS A;  1YLO A;  4MI4 A;  4UBR A;  1KZF A;  1S7N A;  1Y7E A;  1YVO A;  2C6P A;  2OR4 A;  4H6Z A;  4A33 A;  3FJU A;  2Q4Y A;  4NCZ A;  4B11 A;  2V8H A;  4Y49 C;  2QIR A;  3FNC A;  4CPA A;  4UIA A;  2IQ6 A;  2JDD A;  3PB4 X;  1A2Z A;  3E0K A;  4B6Z A;  3LMS A;  2Z3N A;  4MRI A;  2PR1 A;  3DNS A;  1FT7 A;  4EME A;  1ZG7 A;  2RC4 A;  1I1D A;  4OAD A;  1X10 A;  1VKC A;  4PXD A;  4R8F A;  2Q0Y A;  1BPN A;  3FMC A;  2ZOG A;  3D66 A;  3FB3 A;  1M4L A;  4B13 A;  2EO8 A;  3DGV A;  1MJB A;  4MCQ A;  3HUV A;  4H6U A;  2HUZ A;  3SXO A;  2ZEM A;  3CT9 A;  4FD5 A;  2ZW7 A;  5G20 A;  1BPM A;  4KLW A;  4GXH A;  1CP6 A;  2X7B A;  4P10 A;  4MHD A;  4JJX A;  3R96 A;  5E96 A;  4ZX8 A;  2Z3M A;  4CAW A;  2C27 A;  3I3G A;  4XNH C;  2DPT A;  3TO6 A;  3CXQ A;  4B10 A;  2CNS A;  3PGP A;  1BO4 A;  2PCU A;  3S9M A;  2Q51 A;  2B4B A;  4FD7 A;  4QVT A;  3RNZ A;  3NH8 A;  4AVB A;  2YNE A;  3LD2 A;  4OC3 A;  2Z3K A;  4A95 A;  2B5G A;  2GE3 A;  2HV2 A;  5AG4 A;  2JEV A;  4RUH A;  5JM6 A;  4MCR A;  4YWY A;  3F5B A;  2JBJ A;  4MY0 A;  4NFR A;  4R76 A;  3R1K A;  1L0C A;  2OB0 A;  3BHX A;  3IWG A;  1IOI A;  1OZP A;  4MHP A;  4EWT A;  3S6K A;  2AE6 A;  2FXF A;  1YLE A;  2I3C A;  4KOR A;  5IB0 A;  4KVM E;  3W91 A;  4NGM A;  2J8N A;  2BOA A;  1F2O A;  2D4O A;  4LUA A;  3VH9 A;  1VHE A;  3CDX A;  2ZPA A;  3SI1 A;  3TT2 A;  3IEH A;  2YNC C;  4MFP A;  2B58 A;  2A4N A;  2EUI A;  3D4U A;  4EFD A;  3T8W A;  5EBV A;  4UFV A;  4Q36 A;  2PE3 A;  2CNT A;  4MHZ A;  2PVV A;  2NYQ A;  3JTK A;  4UFW A;  4R9M A;  4UCM A;  5G1Z A;  4KVO E;  2FIW A;  4HNW B;  2BUE A;  3D67 A;  5J8C A;  2Q4V A;  3CXP A;  4OIW A;  2YGW A;  1XIX A;  4KUA A;  2PJ0 A;  4X5K A;  1FY7 A;  3T90 A;  3KHX A;  4EVY A;  4ZYQ A;  1Z2L A;  3G8W A;  1S7F A;  2PJ7 A;  1NMT A;  2GIV A;  5IX3 A;  2ZED A;  5DWN A;  4HPS A;  4PPZ A;  4A32 A;  4DNC A;  1S5K A;  1Z8L A;  3TE4 A;  3SJX A;  2CF4 A;  5D8N A;  1M4D A;  2BSW A;  2VI7 A;  5LYD A;  2Q43 A;  3BI1 A;  4UF4 A;  1XMB A;  3FF3 A;  4M85 A;  2WPW A;  4IAV A;  4NGN A;  1TKH A;  4AG9 A;  1WK4 A;  2NMT A;  3JUW A;  4UIB A;  3IFE A;  2ZEE A;  4ZBG A;  2REF A;  4L8A A;  2O53 A;  1Q2D A;  2Z10 A;  3S6H A;  2J8R A;  3DR8 A;  5DS0 A;  1XRY A;  2P6F A;  2FIA A;  3D68 A;  4R7M A;  4OC5 A;  1Y7R A;  2G0B A;  3IC1 A;  2GRE A;  3D7F A;  1Z9U A;  2DEA A;  4E8O A;  4X2T A;  2PJC A;  3ISX A;  4Z65 A;  2DXQ A;  1AMP A;  5EC4 A;  3I9S A;  1M4I A;  2BCO A;  4W9Y A;  2P6E A;  5DWM A;  2OOT A;  3FVL A;  2K5T A;  2POK A;  2PJB A;  4C2X A;  4NGS A;  2ZEH A;  1YK3 A;  4RI1 A;  4PQA A;  3FH4 A;  3JVN A;  4R6T A;  1ZO0 A;  4TWE A;  1JQG A;  1OBR A;  1XE4 A;  3KR5 A;  2Q04 A;  4MFZ A;  4X8I A;  2FSR A;  1Y0R A;  3P2H A;  4R87 A;  4YGO A;  4CGN A;  3TTH A;  1Z8T A;  4M6G A;  2EK8 A;  2AFW A;  4JYW A;  2R1I A;  1Z8X A;  1PU9 A;  2FL4 A;  3IWW A;  4FD6 A;  4G1P A;  3K9U A;  1XJO A;  4A94 A;  4A37 A;  1QSR A;  3TOB A;  4B14 A;  3TFY A;  4M6I A;  2JEW A;  3RAM A;  2ZOF A;  4X3R A;  3H4Q A;  4OAE A;  2CXA A;  3RBU A;  4PK3 A;  1YW6 A;  4MHN A;  3P2F A;  1F57 A;  3GLJ A;  4KSA A;  4XPD C;  4KS9 A;  3V7Z A;  1PUA A;  2PJ2 A;  2BL1 A;  4OC2 A;  4KUB A;  1IIC A;  3IU1 A;  4NXY A;  4KOS A;  5K8N A;  4P4J A;  2YND A;  1S60 A;  2OZU A;  2JBK A;  2IL4 A;  4CGL A;  5KTC A;  1GYT A;  4QBJ A;  4IUS A;  1CPS A;  3PBE A;  2XEG A;  1XOV A;  2EBJ A;  4OME A;  3KI9 A;  2F8H A;  1QSO A;  2YNC A;  5AGE A;  4JZ0 A;  1VIX A;  1XF8 A;  2HC9 A;  4FUU A;  2ZEP A;  2ANP A;  2AFU A;  2ZXV A;  4JXR A;  5JQ4 A;  1AYE A;  2Z11 A;  4MMO A;  4YFJ A;  4CGO A;  4ZY0 A;  3B35 A;  3SXN A;  1VHO A;  4ZX9 A;  4F9V A;  3R95 A;  4ZI6 A;  4O23 A;  4C2Z A;  3NH5 A;  2PSW A;  4UWJ A;  3GY9 A;  4P44 A;  2C6G A;  1KWM A;  3CPX A;  4P4I A;  2ATR A;  2QEC A;  4HNY B;  3QB8 A;  3F0A A;  1CM0 A;  4ZY1 A;  2CTC A;  4I49 A;  2D4P A;  1U6M A;  2PRB A;  4ZY2 A;  3B3T A;  2Q4Z A;  1RO5 A;  3C26 A;  3FX6 A;  2F7V A;  3GUX A;  4CYO A;  2B4D A;  2ZEL A;  3JRU A;  2ARH A;  5EMI A;  5F46 A;  3D7G A;  2HB6 A;  1KUY A;  1YME A;  1YSJ A;  2ZEF A;  2VEZ A;  4OP4 A;  4M6H A;  5KTD A;  1QST A;  3H5Z A;  3KR4 A;  1IOF A;  5A27 A;  3UY5 A;  4RS2 A;  3SJE A;  5HVG A;  4KLV A;  5LYI A;  3W6X A;  1M4G A;  2HQY A;  4E0A A;  2C1C A;  1TXR A;  4QB9 A;  4Y49 B;  1ZLH A;  4MCS A;  4NGQ A;  2XEF A;  2P6G A;  1VGY A;  3PB6 X;  1DTD A;  3I1U A;  4C7H A;  1B87 A;  3MN8 A;  4DJL A;  2H5M A;  1IY7 A;  1YW4 A;  3PB8 X;  4CGM A;  4CGP A;  3DLJ A;  3FXT A;  4CAV A;  2J9A A;  3FEC A;  4JLY A;  5GCN A;  1FNO A;  4FD4 A;  1QSN A;  3ZJ0 A;  1Y0Y A; 
#chains in the Genus database with same CATH homology
 4CS0 B;  2PC1 A;  2FE7 A;  4AB7 A;  4PV6 A;  5H84 A;  4UCN A;  1RXT A;  1NE9 A;  5F49 A;  1WWZ A;  2WUU A;  3TOA A;  3EC4 A;  3G3S A;  1K4J A;  5G22 A;  4CAE A;  4XNH B;  3R9G A;  1CJW A;  1S7K A;  5HH1 A;  2Z3P A;  2R98 A;  2Z3O A;  1XEB A;  1S3Z A;  4NSQ A;  4UCP A;  4CYP A;  1IYL A;  4AVA A;  2Z0Z A;  4PSX A;  4H89 A;  5C88 A;  2R7H A;  2Q44 A;  3BLN A;  4F0X A;  5I0C A;  4BMH A;  2VZZ A;  5AG6 A;  4JXQ A;  1M1D A;  2GAN A;  5AG5 A;  4QUS A;  3TO9 A;  4UWI A;  1J4J A;  3DSB A;  3EO4 A;  2BEI A;  1Z4E A;  3D2M A;  4KOX A;  1YVK A;  3V8I A;  1NSL A;  3EXN A;  3TO7 A;  3BJ8 A;  2OU2 A;  1YGH A;  2JLM A;  1B6B A;  3QAH A;  1P4N A;  2DPS A;  4M3S A;  3RYO A;  5IV0 A;  4B5P A;  4R57 A;  3B8G A;  3VWD A;  5BWA B;  2I00 A;  4KOW A;  2B5G B;  1TIQ A;  2B4D B;  4R3K A;  3PZJ A;  4KZT A;  4HKF A;  4Q38 A;  1BOB A;  4B5O A;  3S6G A;  4U9Z A;  3N7Z A;  2AJ6 A;  4IF5 A;  1Q2C A;  5F47 A;  1R57 A;  4CRY B;  1IID A;  1ON0 A;  2ZW5 A;  2FS5 A;  4MY3 A;  4UA3 A;  2PQ8 A;  5KTA A;  1N71 A;  3PP9 A;  2O28 A;  4XPK A;  3GYA A;  2I79 A;  4MBU A;  1Z4R A;  4J3G A;  2FCK A;  3D8P A;  4JWP A;  2B3V A;  5CNP A;  3IU2 A;  4MFQ A;  5ISV A;  3FIX A;  4CRZ B;  3D2P A;  4II9 A;  1YR0 A;  4KVX A;  4ONU A;  2B3U A;  4F0Y A;  4NEX A;  4L89 A;  4C7I A;  4MFK A;  4HNX B;  1I21 A;  5JPH A;  4QC6 A;  3W6S A;  4CAX A;  2QML A;  4XPD B;  5G21 A;  2CNM A;  2F5I A;  1YX0 A;  2Q7B A;  1Y9W A;  4CYN A;  1SQH A;  3TCV A;  1I12 A;  4PSW A;  3NE7 A;  4A31 A;  2JDC A;  4UFX A;  2VQY A;  4PK2 A;  3BJ7 A;  2REE A;  3FYN A;  2PDO A;  3FRM A;  1XMT A;  3ZZI A;  1S7L A;  1IB1 E;  5A28 A;  4MFJ A;  3R9F A;  1MJA A;  4NF1 A;  4KOY A;  1LRZ A;  4XPL A;  4ORF A;  1QSM A;  4K30 A;  4B5P B;  3DR6 A;  2ZW6 A;  2Y0M A;  3FBU A;  4KSF A;  2VXK A;  1MJ9 A;  4U5Y A;  4C68 A;  4ZGY B;  3A9L A;  1KUV A;  3CXS A;  4AG7 A;  2EVN A;  2ZW4 A;  2OZG A;  4KOT A;  4A30 A;  3S6F A;  1MK4 A;  2P0W A;  3T9Y A;  3EY5 A;  3DDD A;  2CY2 A;  4E2A A;  4MFL A;  3OWC A;  2FT0 A;  4F6A A;  2Z3L A;  4LX9 A;  1GHE A;  2G3A A;  1KUX A;  2OZH A;  2OH1 A;  5FVJ A;  3WR7 A;  3MGD A;  4JD6 A;  1UFH A;  4MJ8 A;  4OLL A;  3EFA A;  4A2Z A;  2R8V A;  1P0H A;  4KOU A;  2WSA A;  1YRE A;  3IWE A;  5F48 A;  1Q2Y A;  4R3L A;  1IYK A;  5J8F A;  3LOD A;  2G3T A;  2KCW A;  4B12 A;  2J8M A;  2VBQ A;  2WPX A;  3IGR A;  5H86 A;  4YRH A;  5AG7 A;  1M44 A;  4BBH A;  1V0C A;  4GS4 A;  4C2Y A;  3VWE A;  5C82 A;  4CAF A;  5HMN A;  2PR8 A;  4AVC A;  3SHP A;  3GKR A;  4KOV A;  3F8K A;  3D3S A;  3KKW A;  4CYQ A;  2VZY A;  3R9E A;  1Y9K A;  1VHS A;  4MI4 A;  4UBR A;  1KZF A;  1S7N A;  1YVO A;  4A33 A;  4H6Z A;  2Q4Y A;  4NCZ A;  4B11 A;  4Y49 C;  2QIR A;  3FNC A;  2JDD A;  3E0K A;  2Z3N A;  2PR1 A;  3DNS A;  2RC4 A;  1I1D A;  4OAD A;  1VKC A;  2Q0Y A;  3FB3 A;  4B13 A;  1MJB A;  4H6U A;  2HUZ A;  3SXO A;  4FD5 A;  2ZW7 A;  5G20 A;  4KLW A;  2X7B A;  3R96 A;  4MHD A;  4JJX A;  5E96 A;  4CAW A;  2Z3M A;  2C27 A;  3I3G A;  4XNH C;  2DPT A;  3TO6 A;  3CXQ A;  4B10 A;  2CNS A;  3PGP A;  1BO4 A;  4QVT A;  2B4B A;  4FD7 A;  4AVB A;  2YNE A;  3LD2 A;  2Z3K A;  4A95 A;  2B5G A;  2GE3 A;  2HV2 A;  5AG4 A;  2JEV A;  3F5B A;  4MY0 A;  3R1K A;  1L0C A;  2OB0 A;  3IWG A;  1OZP A;  3S6K A;  2AE6 A;  2FXF A;  1YLE A;  4KOR A;  5IB0 A;  4KVM E;  3W91 A;  2J8N A;  2D4O A;  4LUA A;  2ZPA A;  3TT2 A;  4MFP A;  2YNC C;  2B58 A;  2A4N A;  2EUI A;  5EBV A;  4UFV A;  4Q36 A;  2CNT A;  4UFW A;  3JTK A;  5G1Z A;  4R9M A;  4UCM A;  4KVO E;  2FIW A;  4HNW B;  2BUE A;  5J8C A;  2Q4V A;  3CXP A;  2YGW A;  1XIX A;  4KUA A;  4X5K A;  1FY7 A;  3T90 A;  4EVY A;  3G8W A;  1S7F A;  1NMT A;  2GIV A;  5IX3 A;  5DWN A;  4A32 A;  4DNC A;  1S5K A;  3TE4 A;  1M4D A;  2BSW A;  2VI7 A;  4M85 A;  2WPW A;  4AG9 A;  1WK4 A;  2NMT A;  3JUW A;  4ZBG A;  2REF A;  4L8A A;  1Q2D A;  2Z10 A;  3S6H A;  2J8R A;  3DR8 A;  2P6F A;  2FIA A;  1Y7R A;  2G0B A;  1Z9U A;  4E8O A;  2DXQ A;  5EC4 A;  3I9S A;  1M4I A;  2P6E A;  5DWM A;  4C2X A;  2K5T A;  1YK3 A;  4RI1 A;  3JVN A;  1ZO0 A;  4MFZ A;  1XE4 A;  2Q04 A;  2FSR A;  3P2H A;  4R87 A;  4YGO A;  4CGN A;  3TTH A;  2R1I A;  1PU9 A;  2FL4 A;  4FD6 A;  3K9U A;  1QSR A;  3TOB A;  4B14 A;  3TFY A;  3H4Q A;  4OAE A;  2CXA A;  4PK3 A;  3P2F A;  4KSA A;  4XPD C;  4KS9 A;  1PUA A;  2BL1 A;  4KUB A;  1IIC A;  3IU1 A;  4NXY A;  4KOS A;  2YND A;  1S60 A;  2OZU A;  2IL4 A;  4CGL A;  5KTC A;  4QBJ A;  4IUS A;  1QSO A;  2YNC A;  5AGE A;  1XF8 A;  5JQ4 A;  2ZXV A;  4JXR A;  2Z11 A;  4YFJ A;  4CGO A;  3SXN A;  3R95 A;  4C2Z A;  4UWJ A;  2PSW A;  3GY9 A;  2ATR A;  2QEC A;  4HNY B;  3QB8 A;  3F0A A;  1CM0 A;  4I49 A;  2D4P A;  1U6M A;  2PRB A;  1RO5 A;  3C26 A;  4CYO A;  2B4D A;  2ARH A;  5F46 A;  1KUY A;  5KTD A;  2VEZ A;  1QST A;  3H5Z A;  5A27 A;  3UY5 A;  4RS2 A;  4KLV A;  3W6X A;  1M4G A;  2HQY A;  4E0A A;  4QB9 A;  4Y49 B;  2P6G A;  4C7H A;  1B87 A;  2H5M A;  4CGM A;  4CGP A;  3FXT A;  4CAV A;  4JLY A;  5GCN A;  4FD4 A;  1QSN A;  3ZJ0 A;  4U9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...