2B5GB

Wild type ssat- 1.7a structure
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
167
structure length
159
Chain Sequence
b'FVIRPATAADCSDILRLIKELAYEYMEEQVILTEKDLLEDGFFYHCLVAEVPWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 1
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 32
structure length 159
sequence length 167
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b5gB00
2FE7A 4JJXA 5KTDA 1BO4A 4MJ8A 4PV6A 2X7BA 1KUVA 4PK2A 3TO6A 2B58A 4JD6A 1YLEA 5DWMA 2PR8A 1LRZA 3EO4A 4PK3A 2FL4A 1CM0A 4B5OA 1Y7RA 2R7HA 4AVCA 4EVYA 1K4JA 4UWJA 2PDOA 3SXNA 3CXPA 4QVTA 4M3SA 2Y0MA 2B4BA 4JXQA 2ZW6A 3WR7A 3DR8A 3R9FA 1WWZA 2B5GB 3T9YA 2HV2A 3CXSA 4K30A 1BOBA 3PZJA 5F48A 2C27A 4QUSA 3PP9A 3G8WA 3DDDA 2P6FA 1Z4EA 4CAWA 2VEZA 3R9EA 5C88A 2J8NA 2OZGA 3LD2A 5F46A 1KUYA 3VWEA 4E8OA 4YGOA 2CNTA 4MI4A 4JWPA 2JLMA 1S3ZA 1L0CA 2Q7BA 5FVJA 2ATRA 2OZHA 4B5PA 4KOTA 3H4QA 3F0AA 2R8VA 3TE4A 1YK3A 4OAEA 4GS4A 2I79A 2PRBA 1SQHA 4L89A 3D2MA 4Y49C 4IF5A 5EBVA 2P6GA 3EY5A 3TT2A 5KTAA 1OZPA 2GANA 1M1DA 4R3KA 1S60A 1NE9A 1M4GA 2PSWA 4ZBGA 3FIXA 3GKRA 2VI7A 1KZFA 1QSOA 4R87A 4CAXA 3UY5A 1MJBA 1I1DA 4R3LA 3VWDA 4KVXA 4PSXA 3TOAA 2FIAA 1VHSA 1S5KA 2HQYA 2IL4A 2I00A 4Y49B 2RC4A 4XPLA 4NCZA 4CAVA 1M4DA 2BL1A 4KLVA 2G0BA 4XPDC 3K9UA 5HMNA 2B3UA 2R98A 2WPXA 2FXFA 1GHEA 2VQYA 1MJAA 2VZZA 1Q2DA 2VZYA 5I0CA 3D8PA 4MBUA 2P6EA 4MY3A 3W6XA 5CNPA 2D4PA 2K5TA 3R96A 1NMTA 2Z10A 3I9SA 1N71A 2B5GA 2J8MA 1B6BA 2ZW7A 4NEXA 4UWIA 3DSBA 4KUAA 3SXOA 3F8KA 2Q4VA 2OB0A 2QMLA 4UA3A 2HUZA 3NE7A 4XPDB 5F49A 5J8FA 1M44A 1R57A 4F6AA 3RYOA 4IUSA 5E96A 3R9GA 4KOWA 2ARHA 3QB8A 1KUXA 4XNHC 4YFJA 2R1IA 2FSRA 4DNCA 3P2FA 4E2AA 1V0CA 1RO5A 3FXTA 2REFA 1I21A 4MY0A 2A4NA 4QB9A 2D4OA 1PU9A 4RS2A 3G3SA 3T90A 5H84A 1RXTA 3W91A 2EVNA 3R1KA 3EXNA 4NXYA 2Q04A 1YX0A 4KLWA 2JDDA 3D3SA 3V8IA 5IX3A 2G3TA 4KVME 1WK4A 1S7NA 2ZPAA 4LX9A 1Y9WA 1YGHA 4FD7A 3S6HA 1J4JA 5KTCA 2CNSA 1U6MA 3OWCA 4XNHB 2REEA 1M4IA 4L8AA 1XF8A 3FBUA 4YRHA 2CNMA 4HKFA 3F5BA 1PUAA 2BUEA 1FY7A 2B3VA 4F0YA 2OZUA 1XE4A 5F47A 3TOBA 4BMHA 3BJ7A 4KZTA 2NMTA 4AVAA 3ZZIA 4ORFA 2J8RA 1UFHA 4CRZB 4HNWB 5J8CA 2Z11A 2BSWA 1TIQA 4U9ZA 5EC4A 3GY9A 1P0HA 4KOVA 2B4DB 1QSTA 2ZW5A 4CS0B 1XEBA 3FYNA 4CRYB 2CY2A 2PR1A 4KUBA 2Z0ZA 2QIRA 4H6UA 1Q2CA 3TO7A 4AB7A 3I3GA 3GYAA 2VBQA 2H5MA 1ON0A 2Q0YA 3B8GA 5JQ4A 4U5YA 4QC6A 5DWNA 2FS5A 1I12A 3EFAA 3MGDA 3R95A 5JPHA 2AJ6A 1MK4A 2Q44A 4NF1A 1MJ9A 3FRMA 1XIXA 2OU2A 1CJWA 4HNXB 4J3GA 5ISVA 4MHDA 4AG7A 3BLNA 4I49A 3BJ8A 2BEIA 3IGRA 2P0WA 2PQ8A 1YVOA 4X5KA 3TFYA 4KOYA 2ZW4A 3W6SA 3E0KA 4II9A 3CXQA 4QBJA 5H86A 3C26A 4H89A 3S6KA 1IYKA 4FD5A 4XPKA 2FCKA 3DR6A 4JXRA 4OADA 3DNSA 1B87A 1XMTA 1QSNA 4M85A 2QECA 1Q2YA 1P4NA 1IIDA 3P2HA 1QSRA 3TTHA 4UBRA 4E0AA 2G3AA 3ZJ0A 2O28A 4R9MA 1S7KA 4AVBA 3TO9A 3PGPA 4ONUA 3S6FA 4NSQA 4H6ZA 2WPWA 3EC4A 4LUAA 1IYLA 1QSMA 4KOSA 4HNYB 3IWGA 4B5PB 3QAHA 2AE6A 4U9YA 2KCWA 2OH1A 3KKWA 4FD6A 4OLLA 4KORA 4KOXA 1IB1E 4AG9A 1S7FA 2ZXVA 2EUIA 4KOUA 1YVKA 2B4DA 2JDCA 1Z9UA 3TCVA 2DXQA 5IB0A 3FNCA 4FD4A 4KVOE 3JUWA 2FT0A 2GE3A 2JEVA 3SHPA 2FIWA 1YREA 3N7ZA 4JLYA 2F5IA 5GCNA 3LODA 5C82A 1Z4RA 2GIVA 3D2PA 2VXKA 3JVNA 4RI1A 3FB3A 4R57A 2PC1A 1S7LA 1YR0A 1VKCA 5HH1A 1Y9KA 2Q4YA 5IV0A 3S6GA 1IICA 4PSWA 1NSLA
chains in the Genus database with same CATH superfamily
2FE7A 1VIXA 4DJLA 4JJXA 3DLJA 5KTDA 1BO4A 4MJ8A 5CPAA 3SI1A 2OOTA 4PV6A 2X7BA 2Q4ZA 4UFWA 2BO9A 2G9DA 2V77A 1KUVA 3PBBA 4UIAA 3CDXA 4PK2A 4UF4A 3TO6A 2AFOA 2B58A 4MHNA 4WWVA 2AFXA 4JD6A 1YLEA 2OR4A 5DWMA 2PR8A 1LRZA 1Z5RA 2PJ4A 2FL4A 3EO4A 4PK3A 3IU1A 4A38A 1CM0A 4B5OA 4B11A 1Y7RA 2R7HA 4RN7A 4AVCA 2ZEDA 4EVYA 1K4JA 4UWJA 2PDOA 3SXNA 1Z2LA 3CXPA 4QVTA 4M3SA 3RO0A 1F2PA 4PXBA 2Y0MA 1TF9A 2PVVA 2B4BA 3B3CA 4JXQA 2PJ9A 2ZW6A 3WR7A 3DR8A 3PB6X 4MHYA 1WWZA 4OC1A 4PPZA 3R9FA 1OBRA 2B5GB 3T9YA 5JM6A 2Q43A 4A94A 1VHEA 2ZELA 2HV2A 3CXSA 4K30A 1BOBA 4NGQA 1R43A 3PZJA 5F48A 2C27A 1CX8A 4QUSA 5JH9A 3PP9A 1CP6A 5G20A 4OIDA 4TNUA 2YNCA 4YWYA 3G8WA 3DDDA 2FVGA 3A9LA 2P6FA 1Z4EA 2ANPA 4CAWA 2VEZA 3R9EA 4EFDA 3GUXA 5C88A 2J8NA 2OZGA 3LD2A 5F46A 1KUYA 2JBJA 5K8OA 4R6TA 4P4JA 3VWEA 2EK8A 5HVHA 1YSJA 4E8OA 3PRTA 4YGOA 4MCQA 2CNTA 2DEAA 4CGLA 4MI4A 4JWPA 3SI0A 3H8GA 2ABZA 3B3TA 2JLMA 1S3ZA 4B14A 1L0CA 2Q7BA 2PE3A 5FVJA 4FWUA 4CAFA 3RNZA 2ATRA 4UIBA 2OZHA 3FVLA 4KOTA 4MFQA 4B5PA 3IU2A 3H4QA 3F0AA 5THWA 1LOKA 2QJ8A 1YMEA 2R8VA 1XRYA 4OC3A 3TE4A 4OIWA 1YK3A 1EE3P 4OAEA 4GS4A 2I79A 2PRBA 4NGPA 1AUGA 1BLLE 4A2ZA 1NSAA 1SQHA 3WABA 3GB0A 2PJ2A 3D2MA 4L89A 4Y49C 4P4DA 4IF5A 5EBVA 2P6GA 2WYRA 4NGSA 4CGOA 3EY5A 3TT2A 5KTAA 1OZPA 5K8MA 1QMUA 4GXHA 2GANA 4OC0A 3RZAA 2Z3LA 1M1DA 4R3KA 3FH4A 1S60A 3FEEA 4MFKA 1R3NA 4CYOA 4CGMA 1NE9A 1IOIA 1M4GA 4MHZA 3FX6A 2PSWA 1BPMA 4ZBGA 3FIXA 3GKRA 2Q7SA 2VI7A 1KZFA 1QSOA 4R87A 4CAXA 3UY5A 1Y0YA 3B7IA 1X12A 3NH5A 3PBEA 3K9TA 1MJBA 2EK9A 1XBUA 5AG4A 1H8LA 1I1DA 3L2NA 5IB9A 3CPXA 3KQXA 3MN8A 3B3SA 4NFRA 4R3LA 5H84A 3RBUA 3VWDA 4F0XA 4KVXA 4M6IA 4PSXA 1JQGA 1VGYA 1PYTB 2FIAA 3TOAA 4GM5A 1VHSA 5K8PA 1S5KA 3D68A 2PJ6A 2VL1A 2HQYA 1CPXA 2IL4A 4P10A 4CYQA 4BD9A 2NSMA 2I00A 1TXRA 4Y49B 3TX8A 2RC4A 4XPLA 4NCZA 4ZY0A 4CAVA 1M4DA 2BL1A 4IHMA 4NGTA 5LYFA 4KLVA 1HDQA 2G0BA 4R8FA 2RFHA 4XPDC 2PJ1A 4CPAA 1LANA 3K9UA 4UCNA 5HMNA 2V8HA 3WC7A 2B3UA 2R98A 2WPXA 4A31A 1Q7LA 2FXFA 3PB9X 1GHEA 2PJBA 2VQYA 4H2KA 2O53A 1MJAA 2QYVA 2VZZA 2GFQA 2Z3PA 1Q2DA 2VZYA 2XEGA 4K3NA 4PXDA 4A37A 3GIUA 2YNEA 5I0CA 3D8PA 2CIJA 2P6EA 4MBUA 4MY3A 8CPAA 4BINA 3BHXA 4OC4A 1XMBA 3WC5A 3W6XA 2GREA 2PIZA 4BBHA 5CNPA 1IOFA 4O23A 2D4PA 2K5TA 1ZLHA 2YNDA 3R96A 1NMTA 2Z10A 2RB7A 2ODFA 4M6HA 2GU2A 3FEDA 3D7HA 2ZEGA 3I9SA 4B13A 5AG5A 1N71A 2B5GA 3D66A 2J8MA 1Z8XA 1B6BA 2CXAA 2ZW7A 1UWYA 4NEXA 4UWIA 4F9UA 3DSBA 4KUAA 4UCMA 3GLJA 4UEZA 4ZX8A 3SXOA 2O4HA 1CPSA 1DTDA 3S9NA 3F8KA 1LCPA 2Q4VA 4KSFA 2WZNA 2JEWA 3BI1A 2OB0A 2QMLA 4UA3A 4UFXA 1JWQA 1QQ9A 2CF4A 2HUZA 1VHOA 3NE7A 4XPDB 5F49A 5J8FA 1M44A 1R57A 3B35A 3KR5A 4F6AA 1HEEA 3RYOA 4IUSA 5E96A 3R9GA 1YQEA 4KOWA 2ARHA 5LRJA 3QB8A 1KUXA 2C1CA 1Y7EA 1ARMA 2CTCA 3NH4A 4JZ0A 4XNHC 4ZX9A 4YFJA 1XJOA 2R1IA 1IY7A 4RUHA 2FSRA 4DNCA 2PJ7A 4NGMA 3P2FA 2V8VA 4E2AA 1ARLA 1V0CA 3PB8X 2ZEPA 5F09A 1RO5A 1AYEA 3FXTA 3IIBA 3SJFA 2EWBA 4B6ZA 2REFA 1I21A 5G1ZA 4MY0A 4F9VA 3D7FA 2A4NA 3FMCA 4QB9A 2D4OA 1PU9A 2PJAA 5DS0A 3FECA 3QAYA 2J9AA 3G3SA 4RS2A 4M6GA 6CPAA 3T90A 1ZG8A 3CT9A 3PFOA 1RXTA 1DE4C 2XEJA 4Q38A 4P4IA 3KHZA 2PJ0A 3W91A 4CGNA 2EVNA 3B2YA 4ZI6A 1RTQA 3EXNA 3KGQA 3R1KA 4NXYA 4NGNA 2Q04A 2IJZA 1YX0A 3K2KA 4KLWA 2JDDA 4KSAA 5G21A 3D3SA 4P44A 3V8IA 1BAVA 2G3TA 4KVME 1WK4A 5A27A 2NYQA 5IX3A 4HPSA 1S7NA 5HVFA 2ZPAA 2ZEOA 4LX9A 5K8NA 1Y9WA 4A33A 5A28A 1YGHA 1YW6A 4FD7A 4R7MA 3S6HA 1J4JA 5KTCA 2CNSA 3B3WA 3FJUA 1U6MA 3BXMA 3OWCA 4Q7AA 4XNHB 4CYPA 2REEA 1M4IA 2PRQA 3WT4A 4L8AA 1XF8A 3KASA 2Z3NA 3FBUA 4YRHA 2CNMA 4HKFA 3F5BA 1PUAA 2BUEA 1FY7A 1XOVA 3PB4X 2B3VA 4Q36A 4F0YA 2OZUA 2ZEMA 4PXEA 4X2TA 1Z8WA 2BOAA 5LYIA 4EWTA 2Z3KA 3NH8A 1XE4A 4P6YA 2F8HA 3SJXA 5F47A 3TOBA 3V7ZA 2JBKA 4C7HA 4OC5A 2PVWA 3DGVA 5ELYA 4YU9A 4BMHA 3BJ7A 4KZTA 2NMTA 3NFZA 3ZZIA 4AVAA 4ORFA 2J8RA 1UFHA 3PFEA 4CRZB 4HNWB 4MFPA 5J8CA 2Z11A 2BSWA 3NE8A 4MFJA 1TIQA 4U9ZA 5EC4A 1LAPA 1P0HA 3GY9A 3NA6A 2BCOA 4KOVA 2B4DB 3H8EA 4C68A 1IU8A 1QSTA 2Q51A 4UEEA 2ZW5A 4NJRA 2DPTA 1XEBA 3FYNA 4CRYB 4CS0B 3ISXA 5HVGA 2AFZA 3ISZA 2CY2A 2PR1A 4KUBA 1TF8A 2Z0ZA 2QIRA 3D7DA 4H6UA 4C7IA 1YLOA 4OC2A 2DPSA 1Q2CA 3TO7A 4NJQA 4AB7A 4FBEA 3I3GA 3VATA 4IAVA 1XFOA 3GYAA 2VBQA 3H8FA 5EMIA 4B10A 2H5MA 4A39A 2ZEFA 1ON0A 2Q0YA 3B8GA 5JQ4A 4U5YA 4ONWA 4A30A 1AMPA 4PXCA 3H5ZA 4QC6A 3I1UA 3FF3A 5DWNA 2FS5A 5AG7A 3HLPA 1I12A 5AG6A 3EFAA 4X3RA 3SI2A 3MGDA 1LAMA 5CBMA 3R95A 4A95A 5JPHA 2PJ3A 4P45A 2I3CA 2AJ6A 1TKFA 1MK4A 2Q44A 2Z3OA 2ZEEA 4NF1A 1MJ9A 3FRMA 1XIXA 3MRUA 2OU2A 1CJWA 1F2OA 4HNXB 4J3GA 3KHXA 2AFWA 4MHDA 4MCPA 5LYLA 4AXVA 5ISVA 2F7VA 2QVPA 1ELMP 2YNCC 4AG7A 3BLNA 4I49A 3SJGA 3BJ8A 1ELLP 3KQZA 2BEIA 3KL9A 2V8DA 1F57A 3IGRA 2P0WA 2PQ8A 2ZENA 4ZY2A 4TWEA 1YVOA 4X5KA 5AGEA 3N5FA 3JTKA 3TFYA 4DUKA 2AFUA 2GLJA 4KOYA 2ZW4A 3W6SA 5JGFA 4MMOA 4MCSA 1Z8LA 3E0KA 3S9LA 2C6PA 1Y0RA 3B3VA 4II9A 4PQAA 3CXQA 4CAEA 2EBJA 4QBJA 5H86A 3C26A 3QNVA 4H89A 2PIYA 3S6KA 1IYKA 1TKHA 4ZY1A 2CTBA 3PB7X 4X8IA 3KR4A 4FD5A 2FCKA 4XPKA 3DR6A 4JXRA 7CPAA 4OADA 3DNSA 1B87A 1XMTA 2V8GA 1QSNA 4M85A 5I4MA 1TKJA 2QECA 1Q2YA 3IO1A 3HUVA 1HDUA 2C6GA 1P4NA 1IIDA 2PJ5A 3P2HA 3KI9A 4C2ZA 5BWAB 1QSRA 3TTHA 1CG2A 4UBRA 4E0AA 2G3AA 3ZJ0A 4DYOA 2WSAA 2ZOGA 3D67A 2O28A 3D7GA 1S7KA 4R9MA 4CYNA 4ZGYB 4AVBA 3TO9A 3PGPA 4ONUA 4UCPA 3S6FA 4NSQA 3BI0A 4H6ZA 4PSWA 2WPWA 3EC4A 2DF5A 4LUAA 2HB6A 1CP7A 2IMOA 1IYLA 4Z65A 1M4LA 3IEHA 4W9YA 1QSMA 4KOSA 4HNYB 1ZG9A 3IWGA 4R76A 1Z8TA 2AFSA 5G22A 4IK2A 4B5PB 4P4BA 5D29A 3CPAA 2AE6A 3QAHA 4U9YA 2PJCA 2KCWA 2OH1A 3KKWA 4FD6A 4OP4A 4KS9A 4OLLA 3IJ3A 4KORA 4KOXA 3LACA 4EMEA 1IB1E 1PCAA 4AG9A 2AFMA 4F8ZA 4MFLA 1S7FA 4G1PA 2GLFA 3D4UA 2ZXVA 2EUIA 4KOUA 3S9MA 2HC9A 4C2XA 1YVKA 2B4DA 2JDCA 1Z9UA 3IC1A 3TCVA 3LMSA 2ZOFA 2DXQA 5IB0A 1YW4A 3FNCA 4NGRA 5LRKA 1KWMA 2C6CA 4FD4A 4KVOE 1ZO0A 5HXDA 5J1QA 3JUWA 4UEFA 2FT0A 4ZYQA 2GE3A 2JEVA 3SHPA 2FIWA 1YREA 3N7ZA 4JLYA 1X10A 2F5IA 5GCNA 4MCRA 3VH9A 3LODA 2PCUA 4P4FA 5C82A 1FNOA 1Z4RA 3V38A 3SJEA 2GIVA 2POKA 3VARA 2YGWA 3WC6A 1BPNA 3D2PA 2VXKA 3JVNA 4MHPA 4RI1A 4FUUA 2XEIA 4MFZA 3FB3A 4R57A 2PC1A 4LQ6A 4WJBA 2WUUA 2Z3MA 1S7LA 2XEFA 3IFEA 1YR0A 4P4EA 1A2ZA 3JRUA 4LQGA 1VKCA 1ZLIA 4JYWA 4OKOA 1IGBA 5HH1A 4A32A 4OMEA 4MXUA 1ZG7A 3IWEA 3IWWA 1GYTA 1Y9KA 3KZWA 5D8NA 3TC8A 1LFWA 4MRIA 1CBXA 4B12A 3T8WA 2PJ8A 2Q4YA 3LWUA 4KSIA 3RAMA 4UFVA 5LYDA 5IV0A 5LRGA 3S6GA 3CZXA 1FT7A 3PEIA 2EO8A 2IQ6A 1IICA 2ZEHA 4FAIA 4CGPA 4C2YA 1NSLA
chains in the Genus database with same CATH topology
2FE7A 4JJXA 5KTDA 1BO4A 4MJ8A 4PV6A 2X7BA 4UFWA 1KUVA 4PK2A 3TO6A 2B58A 4JD6A 1YLEA 5DWMA 2PR8A 1LRZA 3EO4A 4PK3A 2FL4A 3IU1A 1CM0A 4B5OA 4B11A 1Y7RA 2R7HA 4AVCA 4EVYA 1K4JA 4UWJA 2PDOA 3SXNA 3CXPA 4QVTA 4M3SA 2Y0MA 2B4BA 4JXQA 2ZW6A 3WR7A 3DR8A 3R9FA 1WWZA 2B5GB 3T9YA 2HV2A 3CXSA 4K30A 1BOBA 3PZJA 5F48A 2C27A 4QUSA 3PP9A 5G20A 2YNCA 3G8WA 3DDDA 3A9LA 2P6FA 1Z4EA 4CAWA 2VEZA 3R9EA 5C88A 2J8NA 2OZGA 3LD2A 5F46A 1KUYA 3VWEA 4E8OA 4YGOA 2CNTA 4CGLA 4MI4A 4JWPA 2JLMA 1S3ZA 4B14A 1L0CA 2Q7BA 5FVJA 4CAFA 2ATRA 2OZHA 4B5PA 4KOTA 4MFQA 3IU2A 3H4QA 3F0AA 2R8VA 3TE4A 1YK3A 4OAEA 4GS4A 2I79A 2PRBA 4A2ZA 1SQHA 4L89A 3D2MA 4Y49C 4IF5A 5EBVA 2P6GA 4CGOA 3EY5A 3TT2A 5KTAA 1OZPA 2GANA 2Z3LA 1M1DA 4R3KA 1S60A 4MFKA 4CYOA 4CGMA 1NE9A 1M4GA 2PSWA 4ZBGA 3FIXA 3GKRA 2VI7A 1KZFA 1QSOA 4R87A 4CAXA 3UY5A 1MJBA 5AG4A 1I1DA 4R3LA 3VWDA 4F0XA 4KVXA 4PSXA 3TOAA 2FIAA 1VHSA 1S5KA 2HQYA 2IL4A 4CYQA 2I00A 4Y49B 2RC4A 4XPLA 4NCZA 4CAVA 1M4DA 2BL1A 4KLVA 2G0BA 4XPDC 3K9UA 4UCNA 5HMNA 2B3UA 2R98A 2WPXA 4A31A 2FXFA 1GHEA 2VQYA 1MJAA 2VZZA 2Z3PA 1Q2DA 2VZYA 5I0CA 2YNEA 3D8PA 4MBUA 2P6EA 4MY3A 3W6XA 4BBHA 5CNPA 2D4PA 2K5TA 2YNDA 3R96A 1NMTA 2Z10A 3I9SA 4B13A 5AG5A 1N71A 2B5GA 2J8MA 1B6BA 2CXAA 2ZW7A 4NEXA 4UWIA 3DSBA 4KUAA 4UCMA 3SXOA 3F8KA 2Q4VA 4KSFA 2OB0A 2QMLA 4UA3A 4UFXA 2HUZA 3NE7A 4XPDB 5F49A 5J8FA 1M44A 1R57A 4F6AA 3RYOA 4IUSA 5E96A 3R9GA 4KOWA 2ARHA 3QB8A 1KUXA 4XNHC 4YFJA 2R1IA 2FSRA 4DNCA 3P2FA 4E2AA 1V0CA 1RO5A 3FXTA 2REFA 1I21A 5G1ZA 4MY0A 2A4NA 4QB9A 2D4OA 1PU9A 4RS2A 3G3SA 3T90A 5H84A 1RXTA 4Q38A 4CGNA 3W91A 2EVNA 3R1KA 3EXNA 4NXYA 2Q04A 1YX0A 4KLWA 2JDDA 4KSAA 5G21A 3D3SA 3V8IA 5A27A 5IX3A 2G3TA 4KVME 1WK4A 1S7NA 2ZPAA 4LX9A 1Y9WA 4A33A 5A28A 1YGHA 4FD7A 3S6HA 1J4JA 5KTCA 2CNSA 1U6MA 3OWCA 4XNHB 4CYPA 2REEA 1M4IA 4L8AA 1XF8A 2Z3NA 3FBUA 4YRHA 2CNMA 4HKFA 3F5BA 1PUAA 2BUEA 1FY7A 2B3VA 4Q36A 4F0YA 2OZUA 2Z3KA 1XE4A 5F47A 3TOBA 4C7HA 4BMHA 3BJ7A 4KZTA 2NMTA 4AVAA 3ZZIA 4ORFA 2J8RA 1UFHA 4CRZB 4HNWB 4MFPA 5J8CA 2Z11A 2BSWA 4MFJA 1TIQA 4U9ZA 5EC4A 3GY9A 1P0HA 4KOVA 4C68A 2B4DB 1QSTA 2ZW5A 4CS0B 2DPTA 1XEBA 3FYNA 4CRYB 2CY2A 2PR1A 4KUBA 2Z0ZA 2QIRA 4H6UA 4C7IA 2DPSA 1Q2CA 3TO7A 4AB7A 3I3GA 3GYAA 2VBQA 4B10A 2H5MA 1ON0A 2Q0YA 3B8GA 5JQ4A 4U5YA 4A30A 4QC6A 3H5ZA 5DWNA 2FS5A 5AG7A 1I12A 5AG6A 3EFAA 3MGDA 3R95A 4A95A 5JPHA 2AJ6A 1MK4A 2Q44A 2Z3OA 4NF1A 1MJ9A 3FRMA 1XIXA 2OU2A 1CJWA 4HNXB 4J3GA 5ISVA 4MHDA 2YNCC 4AG7A 3BLNA 4I49A 3BJ8A 2BEIA 3IGRA 2P0WA 2PQ8A 1YVOA 4X5KA 5AGEA 3JTKA 3TFYA 4KOYA 2ZW4A 3W6SA 3E0KA 4II9A 3CXQA 4CAEA 4QBJA 5H86A 3C26A 4H89A 3S6KA 1IYKA 4FD5A 4XPKA 2FCKA 3DR6A 4JXRA 4OADA 3DNSA 1B87A 1XMTA 1QSNA 4M85A 2QECA 1Q2YA 1P4NA 1IIDA 3P2HA 5BWAB 4C2ZA 1QSRA 3TTHA 4UBRA 4E0AA 2G3AA 3ZJ0A 2WSAA 4ZGYB 2O28A 4R9MA 1S7KA 4CYNA 4AVBA 3TO9A 3PGPA 4ONUA 4UCPA 3S6FA 4NSQA 4H6ZA 2WPWA 3EC4A 4LUAA 1IYLA 1QSMA 4KOSA 4HNYB 3IWGA 5G22A 4B5PB 3QAHA 2AE6A 4U9YA 2KCWA 2OH1A 3KKWA 4FD6A 4KS9A 4OLLA 4KORA 4KOXA 1IB1E 4AG9A 4MFLA 1S7FA 4C2XA 2ZXVA 2EUIA 4KOUA 1YVKA 2B4DA 2JDCA 1Z9UA 3TCVA 2DXQA 5IB0A 3FNCA 4FD4A 4KVOE 1ZO0A 3JUWA 2FT0A 2GE3A 2JEVA 3SHPA 2FIWA 1YREA 3N7ZA 4JLYA 2F5IA 5GCNA 3LODA 5C82A 1Z4RA 2GIVA 2YGWA 3D2PA 2VXKA 3JVNA 4RI1A 4MFZA 3FB3A 4R57A 2PC1A 2WUUA 2Z3MA 1S7LA 1YR0A 4A32A 1VKCA 5HH1A 3IWEA 1Y9KA 4B12A 2Q4YA 4UFVA 5IV0A 3S6GA 1IICA 4PSWA 4CGPA 4C2YA 1NSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FE7 A;  4JJX A;  5KTD A;  1BO4 A;  4MJ8 A;  4PV6 A;  2X7B A;  1KUV A;  4PK2 A;  3TO6 A;  2B58 A;  4JD6 A;  1YLE A;  5DWM A;  2PR8 A;  1LRZ A;  3EO4 A;  4PK3 A;  2FL4 A;  1CM0 A;  4B5O A;  1Y7R A;  2R7H A;  4AVC A;  4EVY A;  1K4J A;  4UWJ A;  2PDO A;  3SXN A;  3CXP A;  4QVT A;  4M3S A;  2Y0M A;  2B4B A;  4JXQ A;  2ZW6 A;  3WR7 A;  3DR8 A;  3R9F A;  1WWZ A;  2B5G B;  3T9Y A;  2HV2 A;  3CXS A;  4K30 A;  1BOB A;  3PZJ A;  5F48 A;  2C27 A;  4QUS A;  3PP9 A;  3G8W A;  3DDD A;  2P6F A;  1Z4E A;  4CAW A;  2VEZ A;  3R9E A;  5C88 A;  2J8N A;  2OZG A;  3LD2 A;  5F46 A;  1KUY A;  3VWE A;  4E8O A;  4YGO A;  2CNT A;  4MI4 A;  4JWP A;  2JLM A;  1S3Z A;  1L0C A;  2Q7B A;  5FVJ A;  2ATR A;  2OZH A;  4B5P A;  4KOT A;  3H4Q A;  3F0A A;  2R8V A;  3TE4 A;  1YK3 A;  4OAE A;  4GS4 A;  2I79 A;  2PRB A;  1SQH A;  4L89 A;  3D2M A;  4Y49 C;  4IF5 A;  5EBV A;  2P6G A;  3EY5 A;  3TT2 A;  5KTA A;  1OZP A;  2GAN A;  1M1D A;  4R3K A;  1S60 A;  1NE9 A;  1M4G A;  2PSW A;  4ZBG A;  3FIX A;  3GKR A;  2VI7 A;  1KZF A;  1QSO A;  4R87 A;  4CAX A;  3UY5 A;  1MJB A;  1I1D A;  4R3L A;  3VWD A;  4KVX A;  4PSX A;  3TOA A;  2FIA A;  1VHS A;  1S5K A;  2HQY A;  2IL4 A;  2I00 A;  4Y49 B;  2RC4 A;  4XPL A;  4NCZ A;  4CAV A;  1M4D A;  2BL1 A;  4KLV A;  2G0B A;  4XPD C;  3K9U A;  5HMN A;  2B3U A;  2R98 A;  2WPX A;  2FXF A;  1GHE A;  2VQY A;  1MJA A;  2VZZ A;  1Q2D A;  2VZY A;  5I0C A;  3D8P A;  4MBU A;  2P6E A;  4MY3 A;  3W6X A;  5CNP A;  2D4P A;  2K5T A;  3R96 A;  1NMT A;  2Z10 A;  3I9S A;  1N71 A;  2B5G A;  2J8M A;  1B6B A;  2ZW7 A;  4NEX A;  4UWI A;  3DSB A;  4KUA A;  3SXO A;  3F8K A;  2Q4V A;  2OB0 A;  2QML A;  4UA3 A;  2HUZ A;  3NE7 A;  4XPD B;  5F49 A;  5J8F A;  1M44 A;  1R57 A;  4F6A A;  3RYO A;  4IUS A;  5E96 A;  3R9G A;  4KOW A;  2ARH A;  3QB8 A;  1KUX A;  4XNH C;  4YFJ A;  2R1I A;  2FSR A;  4DNC A;  3P2F A;  4E2A A;  1V0C A;  1RO5 A;  3FXT A;  2REF A;  1I21 A;  4MY0 A;  2A4N A;  4QB9 A;  2D4O A;  1PU9 A;  4RS2 A;  3G3S A;  3T90 A;  5H84 A;  1RXT A;  3W91 A;  2EVN A;  3R1K A;  3EXN A;  4NXY A;  2Q04 A;  1YX0 A;  4KLW A;  2JDD A;  3D3S A;  3V8I A;  5IX3 A;  2G3T A;  4KVM E;  1WK4 A;  1S7N A;  2ZPA A;  4LX9 A;  1Y9W A;  1YGH A;  4FD7 A;  3S6H A;  1J4J A;  5KTC A;  2CNS A;  1U6M A;  3OWC A;  4XNH B;  2REE A;  1M4I A;  4L8A A;  1XF8 A;  3FBU A;  4YRH A;  2CNM A;  4HKF A;  3F5B A;  1PUA A;  2BUE A;  1FY7 A;  2B3V A;  4F0Y A;  2OZU A;  1XE4 A;  5F47 A;  3TOB A;  4BMH A;  3BJ7 A;  4KZT A;  2NMT A;  4AVA A;  3ZZI A;  4ORF A;  2J8R A;  1UFH A;  4CRZ B;  4HNW B;  5J8C A;  2Z11 A;  2BSW A;  1TIQ A;  4U9Z A;  5EC4 A;  3GY9 A;  1P0H A;  4KOV A;  2B4D B;  1QST A;  2ZW5 A;  4CS0 B;  1XEB A;  3FYN A;  4CRY B;  2CY2 A;  2PR1 A;  4KUB A;  2Z0Z A;  2QIR A;  4H6U A;  1Q2C A;  3TO7 A;  4AB7 A;  3I3G A;  3GYA A;  2VBQ A;  2H5M A;  1ON0 A;  2Q0Y A;  3B8G A;  5JQ4 A;  4U5Y A;  4QC6 A;  5DWN A;  2FS5 A;  1I12 A;  3EFA A;  3MGD A;  3R95 A;  5JPH A;  2AJ6 A;  1MK4 A;  2Q44 A;  4NF1 A;  1MJ9 A;  3FRM A;  1XIX A;  2OU2 A;  1CJW A;  4HNX B;  4J3G A;  5ISV A;  4MHD A;  4AG7 A;  3BLN A;  4I49 A;  3BJ8 A;  2BEI A;  3IGR A;  2P0W A;  2PQ8 A;  1YVO A;  4X5K A;  3TFY A;  4KOY A;  2ZW4 A;  3W6S A;  3E0K A;  4II9 A;  3CXQ A;  4QBJ A;  5H86 A;  3C26 A;  4H89 A;  3S6K A;  1IYK A;  4FD5 A;  4XPK A;  2FCK A;  3DR6 A;  4JXR A;  4OAD A;  3DNS A;  1B87 A;  1XMT A;  1QSN A;  4M85 A;  2QEC A;  1Q2Y A;  1P4N A;  1IID A;  3P2H A;  1QSR A;  3TTH A;  4UBR A;  4E0A A;  2G3A A;  3ZJ0 A;  2O28 A;  4R9M A;  1S7K A;  4AVB A;  3TO9 A;  3PGP A;  4ONU A;  3S6F A;  4NSQ A;  4H6Z A;  2WPW A;  3EC4 A;  4LUA A;  1IYL A;  1QSM A;  4KOS A;  4HNY B;  3IWG A;  4B5P B;  3QAH A;  2AE6 A;  4U9Y A;  2KCW A;  2OH1 A;  3KKW A;  4FD6 A;  4OLL A;  4KOR A;  4KOX A;  1IB1 E;  4AG9 A;  1S7F A;  2ZXV A;  2EUI A;  4KOU A;  1YVK A;  2B4D A;  2JDC A;  1Z9U A;  3TCV A;  2DXQ A;  5IB0 A;  3FNC A;  4FD4 A;  4KVO E;  3JUW A;  2FT0 A;  2GE3 A;  2JEV A;  3SHP A;  2FIW A;  1YRE A;  3N7Z A;  4JLY A;  2F5I A;  5GCN A;  3LOD A;  5C82 A;  1Z4R A;  2GIV A;  3D2P A;  2VXK A;  3JVN A;  4RI1 A;  3FB3 A;  4R57 A;  2PC1 A;  1S7L A;  1YR0 A;  1VKC A;  5HH1 A;  1Y9K A;  2Q4Y A;  5IV0 A;  3S6G A;  1IIC A;  4PSW A;  1NSL A; 
#chains in the Genus database with same CATH topology
 2FE7 A;  1VIX A;  4DJL A;  4JJX A;  3DLJ A;  5KTD A;  1BO4 A;  4MJ8 A;  5CPA A;  3SI1 A;  2OOT A;  4PV6 A;  2X7B A;  2Q4Z A;  4UFW A;  2BO9 A;  2G9D A;  2V77 A;  1KUV A;  3PBB A;  4UIA A;  3CDX A;  4PK2 A;  4UF4 A;  3TO6 A;  2AFO A;  2B58 A;  4MHN A;  4WWV A;  2AFX A;  4JD6 A;  1YLE A;  2OR4 A;  5DWM A;  2PR8 A;  1LRZ A;  1Z5R A;  2PJ4 A;  2FL4 A;  3EO4 A;  4PK3 A;  3IU1 A;  4A38 A;  1CM0 A;  4B5O A;  4B11 A;  1Y7R A;  2R7H A;  4RN7 A;  4AVC A;  2ZED A;  4EVY A;  1K4J A;  4UWJ A;  2PDO A;  3SXN A;  1Z2L A;  3CXP A;  4QVT A;  4M3S A;  3RO0 A;  1F2P A;  4PXB A;  2Y0M A;  1TF9 A;  2PVV A;  2B4B A;  3B3C A;  4JXQ A;  2PJ9 A;  2ZW6 A;  3WR7 A;  3DR8 A;  3PB6 X;  4MHY A;  1WWZ A;  4OC1 A;  4PPZ A;  3R9F A;  1OBR A;  2B5G B;  3T9Y A;  5JM6 A;  2Q43 A;  4A94 A;  1VHE A;  2ZEL A;  2HV2 A;  3CXS A;  4K30 A;  1BOB A;  4NGQ A;  1R43 A;  3PZJ A;  5F48 A;  2C27 A;  1CX8 A;  4QUS A;  5JH9 A;  3PP9 A;  1CP6 A;  5G20 A;  4OID A;  4TNU A;  2YNC A;  4YWY A;  3G8W A;  3DDD A;  2FVG A;  3A9L A;  2P6F A;  1Z4E A;  2ANP A;  4CAW A;  2VEZ A;  3R9E A;  4EFD A;  3GUX A;  5C88 A;  2J8N A;  2OZG A;  3LD2 A;  5F46 A;  1KUY A;  2JBJ A;  5K8O A;  4R6T A;  4P4J A;  3VWE A;  2EK8 A;  5HVH A;  1YSJ A;  4E8O A;  3PRT A;  4YGO A;  4MCQ A;  2CNT A;  2DEA A;  4CGL A;  4MI4 A;  4JWP A;  3SI0 A;  3H8G A;  2ABZ A;  3B3T A;  2JLM A;  1S3Z A;  4B14 A;  1L0C A;  2Q7B A;  2PE3 A;  5FVJ A;  4FWU A;  4CAF A;  3RNZ A;  2ATR A;  4UIB A;  2OZH A;  3FVL A;  4KOT A;  4MFQ A;  4B5P A;  3IU2 A;  3H4Q A;  3F0A A;  5THW A;  1LOK A;  2QJ8 A;  1YME A;  2R8V A;  1XRY A;  4OC3 A;  3TE4 A;  4OIW A;  1YK3 A;  1EE3 P;  4OAE A;  4GS4 A;  2I79 A;  2PRB A;  4NGP A;  1AUG A;  1BLL E;  4A2Z A;  1NSA A;  1SQH A;  3WAB A;  3GB0 A;  2PJ2 A;  3D2M A;  4L89 A;  4Y49 C;  4P4D A;  4IF5 A;  5EBV A;  2P6G A;  2WYR A;  4NGS A;  4CGO A;  3EY5 A;  3TT2 A;  5KTA A;  1OZP A;  5K8M A;  1QMU A;  4GXH A;  2GAN A;  4OC0 A;  3RZA A;  2Z3L A;  1M1D A;  4R3K A;  3FH4 A;  1S60 A;  3FEE A;  4MFK A;  1R3N A;  4CYO A;  4CGM A;  1NE9 A;  1IOI A;  1M4G A;  4MHZ A;  3FX6 A;  2PSW A;  1BPM A;  4ZBG A;  3FIX A;  3GKR A;  2Q7S A;  2VI7 A;  1KZF A;  1QSO A;  4R87 A;  4CAX A;  3UY5 A;  1Y0Y A;  3B7I A;  1X12 A;  3NH5 A;  3PBE A;  3K9T A;  1MJB A;  2EK9 A;  1XBU A;  5AG4 A;  1H8L A;  1I1D A;  3L2N A;  5IB9 A;  3CPX A;  3KQX A;  3MN8 A;  3B3S A;  4NFR A;  4R3L A;  5H84 A;  3RBU A;  3VWD A;  4F0X A;  4KVX A;  4M6I A;  4PSX A;  1JQG A;  1VGY A;  1PYT B;  2FIA A;  3TOA A;  4GM5 A;  1VHS A;  5K8P A;  1S5K A;  3D68 A;  2PJ6 A;  2VL1 A;  2HQY A;  1CPX A;  2IL4 A;  4P10 A;  4CYQ A;  4BD9 A;  2NSM A;  2I00 A;  1TXR A;  4Y49 B;  3TX8 A;  2RC4 A;  4XPL A;  4NCZ A;  4ZY0 A;  4CAV A;  1M4D A;  2BL1 A;  4IHM A;  4NGT A;  5LYF A;  4KLV A;  1HDQ A;  2G0B A;  4R8F A;  2RFH A;  4XPD C;  2PJ1 A;  4CPA A;  1LAN A;  3K9U A;  4UCN A;  5HMN A;  2V8H A;  3WC7 A;  2B3U A;  2R98 A;  2WPX A;  4A31 A;  1Q7L A;  2FXF A;  3PB9 X;  1GHE A;  2PJB A;  2VQY A;  4H2K A;  2O53 A;  1MJA A;  2QYV A;  2VZZ A;  2GFQ A;  2Z3P A;  1Q2D A;  2VZY A;  2XEG A;  4K3N A;  4PXD A;  4A37 A;  3GIU A;  2YNE A;  5I0C A;  3D8P A;  2CIJ A;  2P6E A;  4MBU A;  4MY3 A;  8CPA A;  4BIN A;  3BHX A;  4OC4 A;  1XMB A;  3WC5 A;  3W6X A;  2GRE A;  2PIZ A;  4BBH A;  5CNP A;  1IOF A;  4O23 A;  2D4P A;  2K5T A;  1ZLH A;  2YND A;  3R96 A;  1NMT A;  2Z10 A;  2RB7 A;  2ODF A;  4M6H A;  2GU2 A;  3FED A;  3D7H A;  2ZEG A;  3I9S A;  4B13 A;  5AG5 A;  1N71 A;  2B5G A;  3D66 A;  2J8M A;  1Z8X A;  1B6B A;  2CXA A;  2ZW7 A;  1UWY A;  4NEX A;  4UWI A;  4F9U A;  3DSB A;  4KUA A;  4UCM A;  3GLJ A;  4UEZ A;  4ZX8 A;  3SXO A;  2O4H A;  1CPS A;  1DTD A;  3S9N A;  3F8K A;  1LCP A;  2Q4V A;  4KSF A;  2WZN A;  2JEW A;  3BI1 A;  2OB0 A;  2QML A;  4UA3 A;  4UFX A;  1JWQ A;  1QQ9 A;  2CF4 A;  2HUZ A;  1VHO A;  3NE7 A;  4XPD B;  5F49 A;  5J8F A;  1M44 A;  1R57 A;  3B35 A;  3KR5 A;  4F6A A;  1HEE A;  3RYO A;  4IUS A;  5E96 A;  3R9G A;  1YQE A;  4KOW A;  2ARH A;  5LRJ A;  3QB8 A;  1KUX A;  2C1C A;  1Y7E A;  1ARM A;  2CTC A;  3NH4 A;  4JZ0 A;  4XNH C;  4ZX9 A;  4YFJ A;  1XJO A;  2R1I A;  1IY7 A;  4RUH A;  2FSR A;  4DNC A;  2PJ7 A;  4NGM A;  3P2F A;  2V8V A;  4E2A A;  1ARL A;  1V0C A;  3PB8 X;  2ZEP A;  5F09 A;  1RO5 A;  1AYE A;  3FXT A;  3IIB A;  3SJF A;  2EWB A;  4B6Z A;  2REF A;  1I21 A;  5G1Z A;  4MY0 A;  4F9V A;  3D7F A;  2A4N A;  3FMC A;  4QB9 A;  2D4O A;  1PU9 A;  2PJA A;  5DS0 A;  3FEC A;  3QAY A;  2J9A A;  3G3S A;  4RS2 A;  4M6G A;  6CPA A;  3T90 A;  1ZG8 A;  3CT9 A;  3PFO A;  1RXT A;  1DE4 C;  2XEJ A;  4Q38 A;  4P4I A;  3KHZ A;  2PJ0 A;  3W91 A;  4CGN A;  2EVN A;  3B2Y A;  4ZI6 A;  1RTQ A;  3EXN A;  3KGQ A;  3R1K A;  4NXY A;  4NGN A;  2Q04 A;  2IJZ A;  1YX0 A;  3K2K A;  4KLW A;  2JDD A;  4KSA A;  5G21 A;  3D3S A;  4P44 A;  3V8I A;  1BAV A;  2G3T A;  4KVM E;  1WK4 A;  5A27 A;  2NYQ A;  5IX3 A;  4HPS A;  1S7N A;  5HVF A;  2ZPA A;  2ZEO A;  4LX9 A;  5K8N A;  1Y9W A;  4A33 A;  5A28 A;  1YGH A;  1YW6 A;  4FD7 A;  4R7M A;  3S6H A;  1J4J A;  5KTC A;  2CNS A;  3B3W A;  3FJU A;  1U6M A;  3BXM A;  3OWC A;  4Q7A A;  4XNH B;  4CYP A;  2REE A;  1M4I A;  2PRQ A;  3WT4 A;  4L8A A;  1XF8 A;  3KAS A;  2Z3N A;  3FBU A;  4YRH A;  2CNM A;  4HKF A;  3F5B A;  1PUA A;  2BUE A;  1FY7 A;  1XOV A;  3PB4 X;  2B3V A;  4Q36 A;  4F0Y A;  2OZU A;  2ZEM A;  4PXE A;  4X2T A;  1Z8W A;  2BOA A;  5LYI A;  4EWT A;  2Z3K A;  3NH8 A;  1XE4 A;  4P6Y A;  2F8H A;  3SJX A;  5F47 A;  3TOB A;  3V7Z A;  2JBK A;  4C7H A;  4OC5 A;  2PVW A;  3DGV A;  5ELY A;  4YU9 A;  4BMH A;  3BJ7 A;  4KZT A;  2NMT A;  3NFZ A;  3ZZI A;  4AVA A;  4ORF A;  2J8R A;  1UFH A;  3PFE A;  4CRZ B;  4HNW B;  4MFP A;  5J8C A;  2Z11 A;  2BSW A;  3NE8 A;  4MFJ A;  1TIQ A;  4U9Z A;  5EC4 A;  1LAP A;  1P0H A;  3GY9 A;  3NA6 A;  2BCO A;  4KOV A;  2B4D B;  3H8E A;  4C68 A;  1IU8 A;  1QST A;  2Q51 A;  4UEE A;  2ZW5 A;  4NJR A;  2DPT A;  1XEB A;  3FYN A;  4CRY B;  4CS0 B;  3ISX A;  5HVG A;  2AFZ A;  3ISZ A;  2CY2 A;  2PR1 A;  4KUB A;  1TF8 A;  2Z0Z A;  2QIR A;  3D7D A;  4H6U A;  4C7I A;  1YLO A;  4OC2 A;  2DPS A;  1Q2C A;  3TO7 A;  4NJQ A;  4AB7 A;  4FBE A;  3I3G A;  3VAT A;  4IAV A;  1XFO A;  3GYA A;  2VBQ A;  3H8F A;  5EMI A;  4B10 A;  2H5M A;  4A39 A;  2ZEF A;  1ON0 A;  2Q0Y A;  3B8G A;  5JQ4 A;  4U5Y A;  4ONW A;  4A30 A;  1AMP A;  4PXC A;  3H5Z A;  4QC6 A;  3I1U A;  3FF3 A;  5DWN A;  2FS5 A;  5AG7 A;  3HLP A;  1I12 A;  5AG6 A;  3EFA A;  4X3R A;  3SI2 A;  3MGD A;  1LAM A;  5CBM A;  3R95 A;  4A95 A;  5JPH A;  2PJ3 A;  4P45 A;  2I3C A;  2AJ6 A;  1TKF A;  1MK4 A;  2Q44 A;  2Z3O A;  2ZEE A;  4NF1 A;  1MJ9 A;  3FRM A;  1XIX A;  3MRU A;  2OU2 A;  1CJW A;  1F2O A;  4HNX B;  4J3G A;  3KHX A;  2AFW A;  4MHD A;  4MCP A;  5LYL A;  4AXV A;  5ISV A;  2F7V A;  2QVP A;  1ELM P;  2YNC C;  4AG7 A;  3BLN A;  4I49 A;  3SJG A;  3BJ8 A;  1ELL P;  3KQZ A;  2BEI A;  3KL9 A;  2V8D A;  1F57 A;  3IGR A;  2P0W A;  2PQ8 A;  2ZEN A;  4ZY2 A;  4TWE A;  1YVO A;  4X5K A;  5AGE A;  3N5F A;  3JTK A;  3TFY A;  4DUK A;  2AFU A;  2GLJ A;  4KOY A;  2ZW4 A;  3W6S A;  5JGF A;  4MMO A;  4MCS A;  1Z8L A;  3E0K A;  3S9L A;  2C6P A;  1Y0R A;  3B3V A;  4II9 A;  4PQA A;  3CXQ A;  4CAE A;  2EBJ A;  4QBJ A;  5H86 A;  3C26 A;  3QNV A;  4H89 A;  2PIY A;  3S6K A;  1IYK A;  1TKH A;  4ZY1 A;  2CTB A;  3PB7 X;  4X8I A;  3KR4 A;  4FD5 A;  2FCK A;  4XPK A;  3DR6 A;  4JXR A;  7CPA A;  4OAD A;  3DNS A;  1B87 A;  1XMT A;  2V8G A;  1QSN A;  4M85 A;  5I4M A;  1TKJ A;  2QEC A;  1Q2Y A;  3IO1 A;  3HUV A;  1HDU A;  2C6G A;  1P4N A;  1IID A;  2PJ5 A;  3P2H A;  3KI9 A;  4C2Z A;  5BWA B;  1QSR A;  3TTH A;  1CG2 A;  4UBR A;  4E0A A;  2G3A A;  3ZJ0 A;  4DYO A;  2WSA A;  2ZOG A;  3D67 A;  2O28 A;  3D7G A;  1S7K A;  4R9M A;  4CYN A;  4ZGY B;  4AVB A;  3TO9 A;  3PGP A;  4ONU A;  4UCP A;  3S6F A;  4NSQ A;  3BI0 A;  4H6Z A;  4PSW A;  2WPW A;  3EC4 A;  2DF5 A;  4LUA A;  2HB6 A;  1CP7 A;  2IMO A;  1IYL A;  4Z65 A;  1M4L A;  3IEH A;  4W9Y A;  1QSM A;  4KOS A;  4HNY B;  1ZG9 A;  3IWG A;  4R76 A;  1Z8T A;  2AFS A;  5G22 A;  4IK2 A;  4B5P B;  4P4B A;  5D29 A;  3CPA A;  2AE6 A;  3QAH A;  4U9Y A;  2PJC A;  2KCW A;  2OH1 A;  3KKW A;  4FD6 A;  4OP4 A;  4KS9 A;  4OLL A;  3IJ3 A;  4KOR A;  4KOX A;  3LAC A;  4EME A;  1IB1 E;  1PCA A;  4AG9 A;  2AFM A;  4F8Z A;  4MFL A;  1S7F A;  4G1P A;  2GLF A;  3D4U A;  2ZXV A;  2EUI A;  4KOU A;  3S9M A;  2HC9 A;  4C2X A;  1YVK A;  2B4D A;  2JDC A;  1Z9U A;  3IC1 A;  3TCV A;  3LMS A;  2ZOF A;  2DXQ A;  5IB0 A;  1YW4 A;  3FNC A;  4NGR A;  5LRK A;  1KWM A;  2C6C A;  4FD4 A;  4KVO E;  1ZO0 A;  5HXD A;  5J1Q A;  3JUW A;  4UEF A;  2FT0 A;  4ZYQ A;  2GE3 A;  2JEV A;  3SHP A;  2FIW A;  1YRE A;  3N7Z A;  4JLY A;  1X10 A;  2F5I A;  5GCN A;  4MCR A;  3VH9 A;  3LOD A;  2PCU A;  4P4F A;  5C82 A;  1FNO A;  1Z4R A;  3V38 A;  3SJE A;  2GIV A;  2POK A;  3VAR A;  2YGW A;  3WC6 A;  1BPN A;  3D2P A;  2VXK A;  3JVN A;  4MHP A;  4RI1 A;  4FUU A;  2XEI A;  4MFZ A;  3FB3 A;  4R57 A;  2PC1 A;  4LQ6 A;  4WJB A;  2WUU A;  2Z3M A;  1S7L A;  2XEF A;  3IFE A;  1YR0 A;  4P4E A;  1A2Z A;  3JRU A;  4LQG A;  1VKC A;  1ZLI A;  4JYW A;  4OKO A;  1IGB A;  5HH1 A;  4A32 A;  4OME A;  4MXU A;  1ZG7 A;  3IWE A;  3IWW A;  1GYT A;  1Y9K A;  3KZW A;  5D8N A;  3TC8 A;  1LFW A;  4MRI A;  1CBX A;  4B12 A;  3T8W A;  2PJ8 A;  2Q4Y A;  3LWU A;  4KSI A;  3RAM A;  4UFV A;  5LYD A;  5IV0 A;  5LRG A;  3S6G A;  3CZX A;  1FT7 A;  3PEI A;  2EO8 A;  2IQ6 A;  1IIC A;  2ZEH A;  4FAI A;  4CGP A;  4C2Y A;  1NSL A; 
#chains in the Genus database with same CATH homology
 2FE7 A;  4JJX A;  5KTD A;  1BO4 A;  4MJ8 A;  4PV6 A;  2X7B A;  4UFW A;  1KUV A;  4PK2 A;  3TO6 A;  2B58 A;  4JD6 A;  1YLE A;  5DWM A;  2PR8 A;  1LRZ A;  3EO4 A;  4PK3 A;  2FL4 A;  3IU1 A;  1CM0 A;  4B5O A;  4B11 A;  1Y7R A;  2R7H A;  4AVC A;  4EVY A;  1K4J A;  4UWJ A;  2PDO A;  3SXN A;  3CXP A;  4QVT A;  4M3S A;  2Y0M A;  2B4B A;  4JXQ A;  2ZW6 A;  3WR7 A;  3DR8 A;  3R9F A;  1WWZ A;  2B5G B;  3T9Y A;  2HV2 A;  3CXS A;  4K30 A;  1BOB A;  3PZJ A;  5F48 A;  2C27 A;  4QUS A;  3PP9 A;  5G20 A;  2YNC A;  3G8W A;  3DDD A;  3A9L A;  2P6F A;  1Z4E A;  4CAW A;  2VEZ A;  3R9E A;  5C88 A;  2J8N A;  2OZG A;  3LD2 A;  5F46 A;  1KUY A;  3VWE A;  4E8O A;  4YGO A;  2CNT A;  4CGL A;  4MI4 A;  4JWP A;  2JLM A;  1S3Z A;  4B14 A;  1L0C A;  2Q7B A;  5FVJ A;  4CAF A;  2ATR A;  2OZH A;  4B5P A;  4KOT A;  4MFQ A;  3IU2 A;  3H4Q A;  3F0A A;  2R8V A;  3TE4 A;  1YK3 A;  4OAE A;  4GS4 A;  2I79 A;  2PRB A;  4A2Z A;  1SQH A;  4L89 A;  3D2M A;  4Y49 C;  4IF5 A;  5EBV A;  2P6G A;  4CGO A;  3EY5 A;  3TT2 A;  5KTA A;  1OZP A;  2GAN A;  2Z3L A;  1M1D A;  4R3K A;  1S60 A;  4MFK A;  4CYO A;  4CGM A;  1NE9 A;  1M4G A;  2PSW A;  4ZBG A;  3FIX A;  3GKR A;  2VI7 A;  1KZF A;  1QSO A;  4R87 A;  4CAX A;  3UY5 A;  1MJB A;  5AG4 A;  1I1D A;  4R3L A;  3VWD A;  4F0X A;  4KVX A;  4PSX A;  3TOA A;  2FIA A;  1VHS A;  1S5K A;  2HQY A;  2IL4 A;  4CYQ A;  2I00 A;  4Y49 B;  2RC4 A;  4XPL A;  4NCZ A;  4CAV A;  1M4D A;  2BL1 A;  4KLV A;  2G0B A;  4XPD C;  3K9U A;  4UCN A;  5HMN A;  2B3U A;  2R98 A;  2WPX A;  4A31 A;  2FXF A;  1GHE A;  2VQY A;  1MJA A;  2VZZ A;  2Z3P A;  1Q2D A;  2VZY A;  5I0C A;  2YNE A;  3D8P A;  4MBU A;  2P6E A;  4MY3 A;  3W6X A;  4BBH A;  5CNP A;  2D4P A;  2K5T A;  2YND A;  3R96 A;  1NMT A;  2Z10 A;  3I9S A;  4B13 A;  5AG5 A;  1N71 A;  2B5G A;  2J8M A;  1B6B A;  2CXA A;  2ZW7 A;  4NEX A;  4UWI A;  3DSB A;  4KUA A;  4UCM A;  3SXO A;  3F8K A;  2Q4V A;  4KSF A;  2OB0 A;  2QML A;  4UA3 A;  4UFX A;  2HUZ A;  3NE7 A;  4XPD B;  5F49 A;  5J8F A;  1M44 A;  1R57 A;  4F6A A;  3RYO A;  4IUS A;  5E96 A;  3R9G A;  4KOW A;  2ARH A;  3QB8 A;  1KUX A;  4XNH C;  4YFJ A;  2R1I A;  2FSR A;  4DNC A;  3P2F A;  4E2A A;  1V0C A;  1RO5 A;  3FXT A;  2REF A;  1I21 A;  5G1Z A;  4MY0 A;  2A4N A;  4QB9 A;  2D4O A;  1PU9 A;  4RS2 A;  3G3S A;  3T90 A;  5H84 A;  1RXT A;  4Q38 A;  4CGN A;  3W91 A;  2EVN A;  3R1K A;  3EXN A;  4NXY A;  2Q04 A;  1YX0 A;  4KLW A;  2JDD A;  4KSA A;  5G21 A;  3D3S A;  3V8I A;  5A27 A;  5IX3 A;  2G3T A;  4KVM E;  1WK4 A;  1S7N A;  2ZPA A;  4LX9 A;  1Y9W A;  4A33 A;  5A28 A;  1YGH A;  4FD7 A;  3S6H A;  1J4J A;  5KTC A;  2CNS A;  1U6M A;  3OWC A;  4XNH B;  4CYP A;  2REE A;  1M4I A;  4L8A A;  1XF8 A;  2Z3N A;  3FBU A;  4YRH A;  2CNM A;  4HKF A;  3F5B A;  1PUA A;  2BUE A;  1FY7 A;  2B3V A;  4Q36 A;  4F0Y A;  2OZU A;  2Z3K A;  1XE4 A;  5F47 A;  3TOB A;  4C7H A;  4BMH A;  3BJ7 A;  4KZT A;  2NMT A;  4AVA A;  3ZZI A;  4ORF A;  2J8R A;  1UFH A;  4CRZ B;  4HNW B;  4MFP A;  5J8C A;  2Z11 A;  2BSW A;  4MFJ A;  1TIQ A;  4U9Z A;  5EC4 A;  3GY9 A;  1P0H A;  4KOV A;  4C68 A;  2B4D B;  1QST A;  2ZW5 A;  4CS0 B;  2DPT A;  1XEB A;  3FYN A;  4CRY B;  2CY2 A;  2PR1 A;  4KUB A;  2Z0Z A;  2QIR A;  4H6U A;  4C7I A;  2DPS A;  1Q2C A;  3TO7 A;  4AB7 A;  3I3G A;  3GYA A;  2VBQ A;  4B10 A;  2H5M A;  1ON0 A;  2Q0Y A;  3B8G A;  5JQ4 A;  4U5Y A;  4A30 A;  4QC6 A;  3H5Z A;  5DWN A;  2FS5 A;  5AG7 A;  1I12 A;  5AG6 A;  3EFA A;  3MGD A;  3R95 A;  4A95 A;  5JPH A;  2AJ6 A;  1MK4 A;  2Q44 A;  2Z3O A;  4NF1 A;  1MJ9 A;  3FRM A;  1XIX A;  2OU2 A;  1CJW A;  4HNX B;  4J3G A;  5ISV A;  4MHD A;  2YNC C;  4AG7 A;  3BLN A;  4I49 A;  3BJ8 A;  2BEI A;  3IGR A;  2P0W A;  2PQ8 A;  1YVO A;  4X5K A;  5AGE A;  3JTK A;  3TFY A;  4KOY A;  2ZW4 A;  3W6S A;  3E0K A;  4II9 A;  3CXQ A;  4CAE A;  4QBJ A;  5H86 A;  3C26 A;  4H89 A;  3S6K A;  1IYK A;  4FD5 A;  4XPK A;  2FCK A;  3DR6 A;  4JXR A;  4OAD A;  3DNS A;  1B87 A;  1XMT A;  1QSN A;  4M85 A;  2QEC A;  1Q2Y A;  1P4N A;  1IID A;  3P2H A;  5BWA B;  4C2Z A;  1QSR A;  3TTH A;  4UBR A;  4E0A A;  2G3A A;  3ZJ0 A;  2WSA A;  4ZGY B;  2O28 A;  4R9M A;  1S7K A;  4CYN A;  4AVB A;  3TO9 A;  3PGP A;  4ONU A;  4UCP A;  3S6F A;  4NSQ A;  4H6Z A;  2WPW A;  3EC4 A;  4LUA A;  1IYL A;  1QSM A;  4KOS A;  4HNY B;  3IWG A;  5G22 A;  4B5P B;  3QAH A;  2AE6 A;  4U9Y A;  2KCW A;  2OH1 A;  3KKW A;  4FD6 A;  4KS9 A;  4OLL A;  4KOR A;  4KOX A;  1IB1 E;  4AG9 A;  4MFL A;  1S7F A;  4C2X A;  2ZXV A;  2EUI A;  4KOU A;  1YVK A;  2B4D A;  2JDC A;  1Z9U A;  3TCV A;  2DXQ A;  5IB0 A;  3FNC A;  4FD4 A;  4KVO E;  1ZO0 A;  3JUW A;  2FT0 A;  2GE3 A;  2JEV A;  3SHP A;  2FIW A;  1YRE A;  3N7Z A;  4JLY A;  2F5I A;  5GCN A;  3LOD A;  5C82 A;  1Z4R A;  2GIV A;  2YGW A;  3D2P A;  2VXK A;  3JVN A;  4RI1 A;  4MFZ A;  3FB3 A;  4R57 A;  2PC1 A;  2WUU A;  2Z3M A;  1S7L A;  1YR0 A;  4A32 A;  1VKC A;  5HH1 A;  3IWE A;  1Y9K A;  4B12 A;  2Q4Y A;  4UFV A;  5IV0 A;  3S6G A;  1IIC A;  4PSW A;  4CGP A;  4C2Y A;  1NSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...