2B5GB

Wild type ssat- 1.7a structure
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
167
structure length
159
Chain Sequence
FVIRPATAADCSDILRLIKELAYEYMEEQVILTEKDLLEDGFFYHCLVAEVPWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Diamine acetyltransferase 1
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 159
sequence length 167
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b5gB00
2D4PA 2B3VA 1BO4A 4KOVA 2ZW7A 5JQ4A 4FD7A 3E0KA 1VKCA 2EUIA 3EXNA 5I0CA 4IUSA 3DSBA 2B4BA 3QB8A 3MGDA 1IYLA 1XE4A 2R1IA 3RYOA 3S6FA 4QVTA 4H6ZA 2CY2A 4FD4A 1K4JA 4YFJA 4KVOE 2AE6A 5IX3A 3DNSA 2CNTA 2J8MA 4J3GA 3I9SA 3T9YA 3P2FA 2Z11A 4U5YA 2WPWA 3R96A 2F5IA 4GS4A 1B87A 4PK3A 3DDDA 3G3SA 1CJWA 5KTAA 4HKFA 3DR6A 1XMTA 4X5KA 2I00A 1Y7RA 1YX0A 4ZBGA 2JDCA 4KUAA 3R9GA 1S7LA 1Z4EA 3GYAA 4RS2A 5F46A 4JJXA 3R9FA 1PUAA 2OZUA 4ONUA 3TOAA 4HNWB 3S6HA 3TE4A 1KUXA 2CNMA 2X7BA 3TO6A 1S7FA 4QB9A 2P0WA 4MY0A 1M1DA 1NE9A 4PSWA 4F6AA 2GIVA 4E2AA 4XNHB 2VZZA 2FS5A 3D2PA 2B58A 2ZW6A 3PGPA 1S5KA 1I12A 1IIDA 2RC4A 4NF1A 2PC1A 3FBUA 4B5PB 4AG9A 4KOTA 4KOXA 4KOWA 4CS0B 4KOUA 1Y9WA 1YGHA 4L89A 3WR7A 5H84A 4JWPA 2BUEA 2WPXA 2OU2A 1QSRA 4UWJA 3FYNA 1KUYA 2AJ6A 1WK4A 1M4GA 2ZW4A 4I49A 2PRBA 3B8GA 1OZPA 3FXTA 4R3KA 4RI1A 4NSQA 5HH1A 3TO7A 1Z4RA 4KVXA 1RXTA 4R87A 3W6SA 1M4IA 3TFYA 4FD6A 1M4DA 4IF5A 3IGRA 2QMLA 5FVJA 2VXKA 3PZJA 5ISVA 1VHSA 2ARHA 4JLYA 2G0BA 2PQ8A 3SHPA 3TOBA 1UFHA 2HQYA 3R1KA 4KOYA 4YRHA 1YREA 2R8VA 1I1DA 1SQHA 2P6GA 2OZHA 3ZZIA 5J8CA 3BJ7A 3R95A 3TT2A 3JUWA 3CXQA 1S7KA 3FIXA 4ORFA 2Y0MA 3EC4A 3D8PA 5JPHA 1L0CA 2ZPAA 3K9UA 5DWMA 2VEZA 4KORA 2Q4VA 2BEIA 1P0HA 2D4OA 5H86A 5HMNA 1FY7A 2OB0A 4OLLA 5F47A 3D3SA 1XF8A 4U9ZA 4II9A 2PDOA 3W6XA 2FCKA 2QECA 1YK3A 2HUZA 3PP9A 3FB3A 4R57A 1BOBA 3SXNA 3QAHA 5E96A 2DXQA 2FIWA 3FRMA 2B5GB 2CNSA 1Q2DA 1CM0A 1QSMA 4NXYA 4DNCA 1I21A 4JXRA 3ZJ0A 5J8FA 3EFAA 3TO9A 3FNCA 4HNYB 2OZGA 2P6EA 1MK4A 2VQYA 1MJ9A 1Z9UA 2R7HA 4K30A 3V8IA 2PSWA 4AB7A 2J8RA 2KCWA 4KLWA 4PSXA 3UY5A 3S6GA 4XNHC 1MJAA 3LD2A 2B4DA 4KUBA 2JLMA 2FE7A 1Q2YA 4B5PA 4CRZB 1XIXA 4Y49C 2VI7A 1MJBA 4LUAA 5C82A 4UWIA 2O28A 2ZW5A 4JD6A 2G3TA 3BLNA 5IB0A 2GANA 2EVNA 4XPKA 4UBRA 1QSNA 1XEBA 2C27A 1NSLA 4QC6A 1R57A 2JDDA 4FD5A 3C26A 4M85A 4E0AA 1S7NA 3CXPA 4L8AA 4BMHA 4YGOA 4CAVA 3NE7A 3G8WA 2Z10A 4F0YA 2FIAA 4XPDC 1PU9A 3VWEA 1IICA 4QUSA 2Q7BA 3BJ8A 4MJ8A 5KTCA 3EO4A 4B5OA 1GHEA 4AVAA 5C88A 3F5BA 4KLVA 1KUVA 1LRZA 4HNXB 2VZYA 4MI4A 2K5TA 1KZFA 4PV6A 2IL4A 1YVOA 1QSOA 3W91A 3TCVA 4MBUA 5DWNA 4JXQA 5KTDA 1V0CA 1Q2CA 4KVME 2PR8A 4H6UA 2Z0ZA 4QBJA 3F0AA 2H5MA 2FL4A 1S60A 1U6MA 5CNPA 2PR1A 1RO5A 5EC4A 2REFA 2P6FA 4LX9A 2JEVA 3GKRA 2Q04A 4UA3A 4E8OA 3DR8A 4KZTA 2OH1A 4NCZA 4EVYA 2NMTA 3SXOA 3I3GA 2FSRA 1QSTA 2BSWA 1NMTA 3TTHA 2J8NA 4AVBA 4CRYB 1M44A 4U9YA 5F49A 2Q4YA 2A4NA 4NEXA 1IB1E 2Q0YA 1YLEA 1IYKA 2FT0A 3GY9A 1B6BA 2VBQA 1WWZA 2FXFA 2GE3A 3T90A 2B5GA 3LODA 4AVCA 1TIQA 4PK2A 4AG7A 4CAWA 3S6KA 4XPLA 1N71A 2G3AA 5IV0A 2QIRA 2R98A 5F48A 2HV2A 1YR0A 2B3UA 2BL1A 2B4DB 4R9MA 4Y49B 3CXSA 3D2MA 1P4NA 4H89A 4KOSA 2ZXVA 3P2HA 3EY5A 4MHDA 4OADA 5GCNA 4OAEA 3R9EA 1Y9KA 2Q44A 1ON0A 4CAXA 3N7ZA 1S3ZA 2REEA 4M3SA 2I79A 3JVNA 1J4JA 2ATRA 3IWGA 3VWDA 4XPDB 3F8KA 4R3LA 3OWCA 5EBVA 1YVKA 3KKWA 3H4QA 4MY3A
chains in the Genus database with same CATH superfamily
2D4PA 1R3NA 2HC9A 2B3VA 1BO4A 4KOVA 2ZW7A 4NGTA 4P4FA 5JQ4A 4ZI6A 4FD7A 3E0KA 1VKCA 1XFOA 1F2OA 3A9LA 3D7DA 4UCNA 1IY7A 2NYQA 1AMPA 1BAVA 3FEEA 3B2YA 4HPSA 1LAMA 2EUIA 4OIDA 4FBEA 3EXNA 5I0CA 3D68A 1XBUA 2Z3LA 4IUSA 2DF5A 3DSBA 2B4BA 3QB8A 3MGDA 1IYLA 2YNDA 1XE4A 2R1IA 3PB4X 3RYOA 3S6FA 4QVTA 1ARMA 3FH4A 2QVPA 3GIUA 4DJLA 4H6ZA 2CY2A 2O4HA 4FD4A 1K4JA 2PE3A 4YFJA 5LYLA 2ZEOA 4KVOE 5DS0A 2AE6A 3H8EA 5IX3A 3DNSA 2CNTA 3S9NA 2AFXA 2J8MA 3PB9X 4A37A 4J3GA 2XEFA 3I9SA 4MFPA 3T9YA 2AFMA 3P2FA 2Z11A 4U5YA 2EK9A 2WPWA 2HB6A 3D66A 2F5IA 4WWVA 3R96A 2Q51A 4GS4A 4MHZA 4MHYA 5A28A 1B87A 4UIAA 2PIYA 4PK3A 3DDDA 5D8NA 3G3SA 1CJWA 2EBJA 4F8ZA 3ISXA 2ZEEA 5KTAA 4HKFA 3DR6A 4CAEA 1XMTA 1YSJA 4X5KA 3PEIA 1LAPA 3V38A 4C7IA 2I00A 1Y7RA 8CPAA 1YX0A 1Z5RA 5LYFA 4ZBGA 2JDCA 1XOVA 1ZO0A 3WT4A 3BHXA 4KUAA 3KI9A 3R9GA 3NH8A 1S7LA 1Z4EA 3GYAA 4RS2A 5F46A 4JJXA 4MFZA 1BPMA 4UEFA 2BCOA 3R9FA 1PUAA 4DUKA 2OZUA 5HVHA 2BOAA 3IFEA 2GU2A 1FT7A 4ONUA 3TOAA 4HNWB 2PCUA 3S6HA 4BD9A 3TE4A 3CZXA 1EE3P 1KUXA 2CNMA 2X7BA 3SI0A 4ZGYB 3SJEA 2CTCA 3TO6A 1Y7EA 3IIBA 1IGBA 1S7FA 4QB9A 2P0WA 2WSAA 4P45A 4MY0A 3FEDA 4PXBA 1M1DA 1NE9A 3D7GA 3D4UA 4PSWA 5G20A 2GIVA 3KHZA 4E2AA 2EWBA 4CGLA 4F6AA 4XNHB 3PRTA 2VZZA 2FS5A 3D2PA 2B58A 2V8DA 2ZW6A 4NGSA 3PGPA 1VHEA 1A2ZA 2EO8A 1S5KA 1I12A 1IIDA 2RC4A 1CG2A 4NF1A 4OIWA 3PBEA 2PC1A 3FBUA 4B5PB 3B3TA 4AG9A 4KOTA 1HDQA 2GLFA 2YGWA 4A32A 3NA6A 3PB6X 4KOXA 4KOWA 4CS0B 4KOUA 1Y9WA 3H5ZA 1YGHA 4L89A 3WR7A 5JM6A 5H84A 1PCAA 4JWPA 2BUEA 2WPXA 1VHOA 2OU2A 5HVFA 1VGYA 4P10A 1QSRA 4UWJA 4CGMA 4CGPA 3FYNA 1KUYA 2AJ6A 3GB0A 1WK4A 4PXEA 1M4GA 2ZW4A 3KQXA 2WZNA 3K2KA 4NFRA 2VL1A 1M4LA 2G9DA 3B35A 4I49A 2PRBA 4LQGA 2IJZA 3B8GA 4CYQA 1OZPA 2F8HA 2DPTA 1Z8LA 3FXTA 4R3KA 4RI1A 3IC1A 4NSQA 5HH1A 3TO7A 1Z4RA 2QYVA 4P6YA 4KVXA 1RXTA 4R87A 1CPXA 4MCSA 3W6SA 1M4IA 1BLLE 4X2TA 2PJ9A 3TFYA 2Z3OA 5F09A 4FD6A 7CPAA 1FNOA 1NSAA 1M4DA 4C2YA 2PJ8A 4F0XA 4C2XA 1TF8A 4R76A 1Z8WA 4YWYA 2Z3NA 4IF5A 4RN7A 3H8FA 3IGRA 2QMLA 2ZEHA 3BXMA 5FVJA 4LQ6A 2VXKA 3PZJA 5ISVA 4CYPA 1VHSA 1CX8A 2ARHA 4JLYA 2G0BA 2PQ8A 2PVVA 4MCRA 3SHPA 3TOBA 3WC5A 3SJFA 1QQ9A 1UFHA 3NFZA 3NH4A 2HQYA 4OC1A 3QNVA 3R1KA 4KOYA 4MCQA 5BWAB 4W9YA 2GFQA 1Y0YA 4M6HA 2OOTA 1TKJA 4YRHA 1YREA 1YW6A 2R8VA 2ZEMA 1I1DA 1SQHA 4IK2A 3KR4A 1H8LA 2AFWA 4MFLA 2P6GA 2OZHA 4OC0A 5A27A 2V8HA 1YW4A 4K3NA 3ZZIA 5J8CA 3FX6A 4NGQA 3S9LA 3BJ7A 2V8VA 4P4IA 4PPZA 3R95A 3CXQA 3JUWA 1S7KA 3TT2A 3FIXA 4ORFA 4ZY2A 5G21A 2Y0MA 3H8GA 3EC4A 1LOKA 2PJ0A 3D8PA 2AFOA 5JPHA 1L0CA 4C2ZA 2ZPAA 3K9UA 5DWMA 2CIJA 3DGVA 2VEZA 4KORA 2Q4VA 3KASA 2BEIA 3FJUA 1XRYA 1TXRA 2CXAA 1P0HA 2D4OA 2ZOGA 4MRIA 3QAYA 2IQ6A 5H86A 1DE4C 3IO1A 1TKHA 5HMNA 1IOIA 1FY7A 2OB0A 3DLJA 4P4JA 4OLLA 3BI1A 5F47A 3D3SA 3VARA 1YMEA 1XF8A 3GLJA 1GYTA 4M6IA 2PDOA 4U9ZA 5ELYA 4X8IA 5EMIA 3TC8A 3W6XA 4II9A 2FCKA 2QECA 2WUUA 1YK3A 2BO9A 2HUZA 1JWQA 3NE8A 2IMOA 3RZAA 1TF9A 3PP9A 2ZOFA 3FB3A 4R57A 2DEAA 1BOBA 2ZENA 3LACA 3PBBA 4NJRA 2PJBA 4OC2A 3SXNA 1QMUA 2XEIA 3QAHA 1LCPA 4MHNA 4FAIA 2GLJA 4B12A 2WYRA 3LMSA 3PB7X 2CTBA 3GUXA 5E96A 4A2ZA 2DXQA 2FIWA 3FRMA 3T8WA 3B3SA 2B5GB 2CNSA 4YU9A 2RB7A 1Q2DA 4FWUA 2PJ2A 1CM0A 1QSMA 4NXYA 2PJ6A 4ZX9A 4MCPA 1CP6A 1YLOA 4DNCA 1I21A 4JXRA 3ZJ0A 5J8FA 3EFAA 3TO9A 4ZY1A 4KSAA 2YNCA 3SJXA 4UFXA 3SI1A 3K9TA 4UFVA 2PIZA 3FNCA 4HNYB 1AUGA 2OZGA 2Z3PA 2P6EA 4ONWA 1MK4A 3L2NA 2VQYA 3RBUA 2YNCC 4A38A 1ARLA 1MJ9A 1Z9UA 2O53A 2R7HA 3VATA 4K30A 4CAFA 5AG5A 4F9UA 3V8IA 5K8NA 2PSWA 5K8PA 4UEEA 4AB7A 1ZLIA 2J8RA 4R8FA 4UFWA 2KCWA 4KLWA 4PSXA 3UY5A 4B11A 3S6GA 2ABZA 4B14A 3LWUA 1MJAA 4XNHC 2XEGA 2B4DA 2YNEA 3LD2A 4KUBA 2C1CA 4OMEA 2JLMA 2FE7A 1Q2YA 2PJ4A 3FECA 4B5PA 2PVWA 1Y0RA 4CRZB 2JEWA 1XIXA 2PJ7A 4Y49C 4AXVA 2VI7A 3IWEA 5JH9A 1MJBA 4LUAA 4RUHA 4Q7AA 4NGMA 5C82A 4MFQA 3D67A 1ZLHA 4UWIA 2O28A 5K8OA 2ZW5A 4JD6A 2Q43A 1ELMP 2G3TA 3BLNA 4M6GA 5AG4A 5IB0A 2GANA 2EVNA 4XPKA 4UBRA 1QSNA 5LRJA 1XEBA 4ZY0A 1IU8A 2J9AA 2C27A 2PJAA 4NGNA 4NGRA 4QC6A 1NSLA 1R57A 2JDDA 5JGFA 1Z2LA 2FVGA 3C26A 4FD5A 4M85A 1S7NA 4E0AA 1ZG7A 2C6GA 3CXPA 3V7ZA 4KSFA 4PQAA 4L8AA 4JYWA 1XMBA 4YGOA 4BMHA 4CAVA 3NE7A 5J1QA 3G8WA 2Z10A 1LFWA 1X10A 4F0YA 2JBKA 2PRQA 3SJGA 2FIAA 3KHXA 4UIBA 4XPDC 1PU9A 3VWEA 1IICA 4Q36A 4QUSA 2Q7BA 3VH9A 2ZELA 4MFKA 3MRUA 4B10A 4BINA 5IB9A 4A94A 4UCMA 3BJ8A 3I1UA 4MJ8A 5AG6A 5G1ZA 5KTCA 3EO4A 5CPAA 3KL9A 4B5OA 4P4DA 1GHEA 4AVAA 5C88A 3F5BA 3IU1A 4KLVA 4CYNA 1KUVA 1UWYA 4PXDA 1LRZA 4KS9A 2GREA 4ZX8A 1IOFA 4HNXB 2PJ1A 5LRGA 2VZYA 3IU2A 4MI4A 4WJBA 1CP7A 3CDXA 5LYDA 2K5TA 3JRUA 4F9VA 4ZYQA 1KZFA 4PV6A 3N5FA 4KSIA 4FUUA 2IL4A 1YVOA 1QSOA 3HUVA 3TCVA 3W91A 4MBUA 1YQEA 5DWNA 2F7VA 4P4EA 4JXQA 4UEZA 5KTDA 1Z8TA 2QJ8A 3ISZA 4X3RA 1BPNA 1V0CA 1Q2CA 3CT9A 1ELLP 4CGOA 4KVME 4G1PA 1ZG9A 2PR8A 4H6UA 1AYEA 2Z0ZA 4QBJA 3JTKA 2C6PA 3F0AA 2H5MA 2FL4A 1S60A 1U6MA 2DPSA 5CNPA 3S9MA 4A95A 2Q7SA 2PR1A 3KQZA 1HEEA 1RO5A 2POKA 2V77A 2EK8A 5EC4A 2REFA 2P6FA 4LX9A 3WC7A 2JEVA 2RFHA 4C68A 3B3CA 1TKFA 3HLPA 3GKRA 2Q04A 3WC6A 4A30A 2JBJA 4UA3A 4JZ0A 3IWWA 4E8OA 3BI0A 3SI2A 3B7IA 3DR8A 4KZTA 5THWA 2OH1A 3RO0A 4OKOA 4OC3A 4IAVA 4P44A 4CGNA 3FF3A 2I3CA 4NCZA 4OP4A 3RNZA 4EVYA 2NMTA 3KR5A 3I3GA 3SXOA 2FSRA 4EWTA 1QSTA 1Z8XA 4EFDA 2BSWA 5CBMA 1F57A 1NMTA 4MFJA 3TTHA 2J8NA 4AVBA 4CRYB 4TNUA 1M44A 4U9YA 1X12A 3RAMA 5AG7A 4H2KA 5F49A 2Q4YA 4B13A 2Z3MA 2ZEFA 3FMCA 4P4BA 2A4NA 2PJ5A 2ZEGA 4NEXA 1CPSA 1OBRA 1KWMA 1IB1E 2Q0YA 3PFEA 1YLEA 1IYKA 2CF4A 2FT0A 3GY9A 3IJ3A 1B6BA 3KGQA 3PFOA 4NGPA 4Q38A 4GM5A 6CPAA 4TWEA 1F2PA 1PYTB 3CPAA 2VBQA 1WWZA 2OR4A 2GE3A 2FXFA 1R43A 3T90A 4CPAA 2B5GA 2ZEPA 4UF4A 3LODA 2AFUA 4AVCA 1TIQA 4PK2A 3D7HA 5AGEA 2Q4ZA 4AG7A 4CAWA 2Z3KA 3S6KA 5D29A 4MHPA 1N71A 4XPLA 5G22A 4CYOA 4A31A 1Q7LA 1XJOA 5LRKA 5I4MA 2G3AA 4DYOA 5IV0A 2QIRA 2R98A 5F48A 5HXDA 2HV2A 1DTDA 2PJCA 1YR0A 2B3UA 2BL1A 3NH5A 5HVGA 4EMEA 2B4DB 2XEJA 4R9MA 4MXUA 4Y49B 3CXSA 5LYIA 3D2MA 4Z65A 4C7HA 5K8MA 1P4NA 3B3VA 4H89A 4KOSA 2C6CA 2ZXVA 3P2HA 3PB8X 4PXCA 2ODFA 3EY5A 4MHDA 4B6ZA 4OADA 5GCNA 2ZEDA 4OAEA 1HDUA 1ZG8A 4R7MA 3R9EA 1Y9KA 2ANPA 4OC4A 3KZWA 4GXHA 2Q44A 3B3WA 4A33A 1ON0A 4CAXA 4A39A 2PJ3A 3N7ZA 1S3ZA 4R6TA 2REEA 1CBXA 1RTQA 4M3SA 1JQGA 4UCPA 4NJQA 2I79A 2AFZA 3JVNA 3MN8A 3TX8A 1J4JA 1VIXA 2ATRA 3WABA 3IWGA 4OC5A 3VWDA 2NSMA 3D7FA 4IHMA 2V8GA 3IEHA 4MMOA 2AFSA 3CPXA 3F8KA 4O23A 1LANA 4XPDB 4BBHA 4R3LA 3OWCA 5EBVA 3FVLA 1YVKA 3KKWA 3H4QA 4MY3A
chains in the Genus database with same CATH topology
2D4PA 2B3VA 1BO4A 4KOVA 2ZW7A 5JQ4A 4FD7A 3E0KA 1VKCA 3A9LA 4UCNA 2EUIA 3EXNA 5I0CA 2Z3LA 4IUSA 3DSBA 2B4BA 3QB8A 3MGDA 1IYLA 2YNDA 1XE4A 2R1IA 3RYOA 3S6FA 4QVTA 4H6ZA 2CY2A 4FD4A 1K4JA 4YFJA 4KVOE 2AE6A 5IX3A 3DNSA 2CNTA 2J8MA 4J3GA 3I9SA 4MFPA 3T9YA 3P2FA 2Z11A 4U5YA 2WPWA 3R96A 2F5IA 4GS4A 5A28A 1B87A 4PK3A 3DDDA 3G3SA 1CJWA 5KTAA 4HKFA 3DR6A 4CAEA 1XMTA 4X5KA 4C7IA 2I00A 1Y7RA 1YX0A 4ZBGA 2JDCA 1ZO0A 4KUAA 3R9GA 1S7LA 1Z4EA 3GYAA 4RS2A 5F46A 4JJXA 4MFZA 3R9FA 1PUAA 2OZUA 4ONUA 3TOAA 4HNWB 3S6HA 3TE4A 1KUXA 2CNMA 2X7BA 4ZGYB 3TO6A 1S7FA 4QB9A 2P0WA 2WSAA 4MY0A 1M1DA 1NE9A 4PSWA 4F6AA 5G20A 2GIVA 4E2AA 4CGLA 4XNHB 2VZZA 2FS5A 3D2PA 2B58A 2ZW6A 3PGPA 1S5KA 1I12A 1IIDA 2RC4A 4NF1A 2PC1A 3FBUA 4B5PB 4AG9A 4KOTA 2YGWA 4A32A 4KOXA 4KOWA 4CS0B 4KOUA 1Y9WA 3H5ZA 1YGHA 4L89A 3WR7A 5H84A 4JWPA 2BUEA 2WPXA 2OU2A 4CGPA 1QSRA 4UWJA 4CGMA 3FYNA 1KUYA 2AJ6A 1WK4A 1M4GA 2ZW4A 4CYQA 4I49A 2PRBA 3B8GA 1OZPA 2DPTA 3FXTA 4R3KA 4RI1A 4NSQA 5HH1A 3TO7A 1Z4RA 4KVXA 1RXTA 4R87A 3W6SA 1M4IA 3TFYA 2Z3OA 4FD6A 1M4DA 4C2YA 4F0XA 4C2XA 2Z3NA 4IF5A 3IGRA 2QMLA 5FVJA 2VXKA 3PZJA 5ISVA 4CYPA 1VHSA 2ARHA 4JLYA 2G0BA 2PQ8A 3SHPA 3TOBA 1UFHA 2HQYA 3R1KA 4KOYA 5BWAB 4YRHA 1YREA 2R8VA 1I1DA 1SQHA 4MFLA 2P6GA 2OZHA 5A27A 3ZZIA 5J8CA 3BJ7A 3R95A 3TT2A 3JUWA 3CXQA 1S7KA 3FIXA 4ORFA 5G21A 2Y0MA 3EC4A 3D8PA 5JPHA 1L0CA 4C2ZA 2ZPAA 3K9UA 5DWMA 2VEZA 4KORA 2Q4VA 2BEIA 2CXAA 1P0HA 2D4OA 5H86A 5HMNA 1FY7A 2OB0A 4OLLA 5F47A 3D3SA 1XF8A 4U9ZA 4II9A 2PDOA 3W6XA 2FCKA 2QECA 2WUUA 1YK3A 2HUZA 3PP9A 3FB3A 4R57A 1BOBA 3SXNA 3QAHA 4B12A 5E96A 4A2ZA 2DXQA 2FIWA 3FRMA 2B5GB 2CNSA 1Q2DA 1CM0A 1QSMA 4NXYA 4DNCA 1I21A 4JXRA 3ZJ0A 5J8FA 3EFAA 3TO9A 4KSAA 2YNCA 4UFXA 4UFVA 3FNCA 4HNYB 2OZGA 2Z3PA 2P6EA 1MK4A 2VQYA 2YNCC 1MJ9A 1Z9UA 4CAFA 2R7HA 4K30A 5AG5A 3V8IA 2PSWA 4AB7A 2J8RA 4UFWA 2KCWA 4KLWA 4PSXA 3UY5A 4B11A 3S6GA 4B14A 4XNHC 1MJAA 3LD2A 2B4DA 2YNEA 4KUBA 2JLMA 2FE7A 1Q2YA 4B5PA 4CRZB 1XIXA 4Y49C 2VI7A 3IWEA 1MJBA 4LUAA 5C82A 4MFQA 4UWIA 2O28A 2ZW5A 4JD6A 2G3TA 3BLNA 5AG4A 5IB0A 2GANA 2EVNA 4XPKA 4UBRA 1QSNA 1XEBA 2C27A 1NSLA 4QC6A 1R57A 2JDDA 4FD5A 3C26A 4M85A 4E0AA 1S7NA 3CXPA 4KSFA 4L8AA 4BMHA 4YGOA 4CAVA 3NE7A 3G8WA 2Z10A 4F0YA 2FIAA 4XPDC 1PU9A 3VWEA 1IICA 4Q36A 4QUSA 2Q7BA 4MFKA 4B10A 4UCMA 3BJ8A 4MJ8A 5AG6A 5KTCA 5G1ZA 3EO4A 4B5OA 1GHEA 4AVAA 5C88A 3F5BA 3IU1A 4KLVA 4CYNA 1KUVA 1LRZA 4KS9A 4HNXB 2VZYA 3IU2A 4MI4A 2K5TA 1KZFA 4PV6A 2IL4A 1YVOA 1QSOA 3W91A 3TCVA 4MBUA 5DWNA 4JXQA 5KTDA 1V0CA 1Q2CA 4CGOA 4KVME 2PR8A 4H6UA 2Z0ZA 4QBJA 3JTKA 3F0AA 2H5MA 2FL4A 1S60A 1U6MA 2DPSA 5CNPA 4A95A 2PR1A 1RO5A 5EC4A 2REFA 2P6FA 4LX9A 2JEVA 4C68A 3GKRA 2Q04A 4A30A 4UA3A 4E8OA 3DR8A 4KZTA 4CGNA 2OH1A 4NCZA 4EVYA 2NMTA 3SXOA 3I3GA 2FSRA 1QSTA 2BSWA 1NMTA 3TTHA 4MFJA 2J8NA 4AVBA 4CRYB 1M44A 4U9YA 5AG7A 5F49A 2Q4YA 4B13A 2Z3MA 2A4NA 4NEXA 1IB1E 2Q0YA 1YLEA 1IYKA 2FT0A 3GY9A 1B6BA 4Q38A 2VBQA 1WWZA 2FXFA 2GE3A 3T90A 2B5GA 3LODA 4AVCA 1TIQA 4PK2A 5AGEA 4AG7A 4CAWA 2Z3KA 3S6KA 4XPLA 1N71A 5G22A 4CYOA 4A31A 2G3AA 5IV0A 2QIRA 2R98A 5F48A 2HV2A 1YR0A 2B3UA 2BL1A 2B4DB 4R9MA 4Y49B 3CXSA 3D2MA 4C7HA 1P4NA 4H89A 4KOSA 2ZXVA 3P2HA 3EY5A 4MHDA 4OADA 5GCNA 4OAEA 3R9EA 1Y9KA 2Q44A 4A33A 1ON0A 4CAXA 3N7ZA 1S3ZA 2REEA 4M3SA 4UCPA 2I79A 3JVNA 1J4JA 2ATRA 3IWGA 3VWDA 4XPDB 3F8KA 4BBHA 4R3LA 3OWCA 5EBVA 1YVKA 3KKWA 3H4QA 4MY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D4P A;  2B3V A;  1BO4 A;  4KOV A;  2ZW7 A;  5JQ4 A;  4FD7 A;  3E0K A;  1VKC A;  2EUI A;  3EXN A;  5I0C A;  4IUS A;  3DSB A;  2B4B A;  3QB8 A;  3MGD A;  1IYL A;  1XE4 A;  2R1I A;  3RYO A;  3S6F A;  4QVT A;  4H6Z A;  2CY2 A;  4FD4 A;  1K4J A;  4YFJ A;  4KVO E;  2AE6 A;  5IX3 A;  3DNS A;  2CNT A;  2J8M A;  4J3G A;  3I9S A;  3T9Y A;  3P2F A;  2Z11 A;  4U5Y A;  2WPW A;  3R96 A;  2F5I A;  4GS4 A;  1B87 A;  4PK3 A;  3DDD A;  3G3S A;  1CJW A;  5KTA A;  4HKF A;  3DR6 A;  1XMT A;  4X5K A;  2I00 A;  1Y7R A;  1YX0 A;  4ZBG A;  2JDC A;  4KUA A;  3R9G A;  1S7L A;  1Z4E A;  3GYA A;  4RS2 A;  5F46 A;  4JJX A;  3R9F A;  1PUA A;  2OZU A;  4ONU A;  3TOA A;  4HNW B;  3S6H A;  3TE4 A;  1KUX A;  2CNM A;  2X7B A;  3TO6 A;  1S7F A;  4QB9 A;  2P0W A;  4MY0 A;  1M1D A;  1NE9 A;  4PSW A;  4F6A A;  2GIV A;  4E2A A;  4XNH B;  2VZZ A;  2FS5 A;  3D2P A;  2B58 A;  2ZW6 A;  3PGP A;  1S5K A;  1I12 A;  1IID A;  2RC4 A;  4NF1 A;  2PC1 A;  3FBU A;  4B5P B;  4AG9 A;  4KOT A;  4KOX A;  4KOW A;  4CS0 B;  4KOU A;  1Y9W A;  1YGH A;  4L89 A;  3WR7 A;  5H84 A;  4JWP A;  2BUE A;  2WPX A;  2OU2 A;  1QSR A;  4UWJ A;  3FYN A;  1KUY A;  2AJ6 A;  1WK4 A;  1M4G A;  2ZW4 A;  4I49 A;  2PRB A;  3B8G A;  1OZP A;  3FXT A;  4R3K A;  4RI1 A;  4NSQ A;  5HH1 A;  3TO7 A;  1Z4R A;  4KVX A;  1RXT A;  4R87 A;  3W6S A;  1M4I A;  3TFY A;  4FD6 A;  1M4D A;  4IF5 A;  3IGR A;  2QML A;  5FVJ A;  2VXK A;  3PZJ A;  5ISV A;  1VHS A;  2ARH A;  4JLY A;  2G0B A;  2PQ8 A;  3SHP A;  3TOB A;  1UFH A;  2HQY A;  3R1K A;  4KOY A;  4YRH A;  1YRE A;  2R8V A;  1I1D A;  1SQH A;  2P6G A;  2OZH A;  3ZZI A;  5J8C A;  3BJ7 A;  3R95 A;  3TT2 A;  3JUW A;  3CXQ A;  1S7K A;  3FIX A;  4ORF A;  2Y0M A;  3EC4 A;  3D8P A;  5JPH A;  1L0C A;  2ZPA A;  3K9U A;  5DWM A;  2VEZ A;  4KOR A;  2Q4V A;  2BEI A;  1P0H A;  2D4O A;  5H86 A;  5HMN A;  1FY7 A;  2OB0 A;  4OLL A;  5F47 A;  3D3S A;  1XF8 A;  4U9Z A;  4II9 A;  2PDO A;  3W6X A;  2FCK A;  2QEC A;  1YK3 A;  2HUZ A;  3PP9 A;  3FB3 A;  4R57 A;  1BOB A;  3SXN A;  3QAH A;  5E96 A;  2DXQ A;  2FIW A;  3FRM A;  2B5G B;  2CNS A;  1Q2D A;  1CM0 A;  1QSM A;  4NXY A;  4DNC A;  1I21 A;  4JXR A;  3ZJ0 A;  5J8F A;  3EFA A;  3TO9 A;  3FNC A;  4HNY B;  2OZG A;  2P6E A;  1MK4 A;  2VQY A;  1MJ9 A;  1Z9U A;  2R7H A;  4K30 A;  3V8I A;  2PSW A;  4AB7 A;  2J8R A;  2KCW A;  4KLW A;  4PSX A;  3UY5 A;  3S6G A;  4XNH C;  1MJA A;  3LD2 A;  2B4D A;  4KUB A;  2JLM A;  2FE7 A;  1Q2Y A;  4B5P A;  4CRZ B;  1XIX A;  4Y49 C;  2VI7 A;  1MJB A;  4LUA A;  5C82 A;  4UWI A;  2O28 A;  2ZW5 A;  4JD6 A;  2G3T A;  3BLN A;  5IB0 A;  2GAN A;  2EVN A;  4XPK A;  4UBR A;  1QSN A;  1XEB A;  2C27 A;  1NSL A;  4QC6 A;  1R57 A;  2JDD A;  4FD5 A;  3C26 A;  4M85 A;  4E0A A;  1S7N A;  3CXP A;  4L8A A;  4BMH A;  4YGO A;  4CAV A;  3NE7 A;  3G8W A;  2Z10 A;  4F0Y A;  2FIA A;  4XPD C;  1PU9 A;  3VWE A;  1IIC A;  4QUS A;  2Q7B A;  3BJ8 A;  4MJ8 A;  5KTC A;  3EO4 A;  4B5O A;  1GHE A;  4AVA A;  5C88 A;  3F5B A;  4KLV A;  1KUV A;  1LRZ A;  4HNX B;  2VZY A;  4MI4 A;  2K5T A;  1KZF A;  4PV6 A;  2IL4 A;  1YVO A;  1QSO A;  3W91 A;  3TCV A;  4MBU A;  5DWN A;  4JXQ A;  5KTD A;  1V0C A;  1Q2C A;  4KVM E;  2PR8 A;  4H6U A;  2Z0Z A;  4QBJ A;  3F0A A;  2H5M A;  2FL4 A;  1S60 A;  1U6M A;  5CNP A;  2PR1 A;  1RO5 A;  5EC4 A;  2REF A;  2P6F A;  4LX9 A;  2JEV A;  3GKR A;  2Q04 A;  4UA3 A;  4E8O A;  3DR8 A;  4KZT A;  2OH1 A;  4NCZ A;  4EVY A;  2NMT A;  3SXO A;  3I3G A;  2FSR A;  1QST A;  2BSW A;  1NMT A;  3TTH A;  2J8N A;  4AVB A;  4CRY B;  1M44 A;  4U9Y A;  5F49 A;  2Q4Y A;  2A4N A;  4NEX A;  1IB1 E;  2Q0Y A;  1YLE A;  1IYK A;  2FT0 A;  3GY9 A;  1B6B A;  2VBQ A;  1WWZ A;  2FXF A;  2GE3 A;  3T90 A;  2B5G A;  3LOD A;  4AVC A;  1TIQ A;  4PK2 A;  4AG7 A;  4CAW A;  3S6K A;  4XPL A;  1N71 A;  2G3A A;  5IV0 A;  2QIR A;  2R98 A;  5F48 A;  2HV2 A;  1YR0 A;  2B3U A;  2BL1 A;  2B4D B;  4R9M A;  4Y49 B;  3CXS A;  3D2M A;  1P4N A;  4H89 A;  4KOS A;  2ZXV A;  3P2H A;  3EY5 A;  4MHD A;  4OAD A;  5GCN A;  4OAE A;  3R9E A;  1Y9K A;  2Q44 A;  1ON0 A;  4CAX A;  3N7Z A;  1S3Z A;  2REE A;  4M3S A;  2I79 A;  3JVN A;  1J4J A;  2ATR A;  3IWG A;  3VWD A;  4XPD B;  3F8K A;  4R3L A;  3OWC A;  5EBV A;  1YVK A;  3KKW A;  3H4Q A;  4MY3 A; 
#chains in the Genus database with same CATH topology
 2D4P A;  1R3N A;  2HC9 A;  2B3V A;  1BO4 A;  4KOV A;  2ZW7 A;  4NGT A;  4P4F A;  5JQ4 A;  4ZI6 A;  4FD7 A;  3E0K A;  1VKC A;  1XFO A;  1F2O A;  3A9L A;  3D7D A;  4UCN A;  1IY7 A;  2NYQ A;  1AMP A;  1BAV A;  3FEE A;  3B2Y A;  4HPS A;  1LAM A;  2EUI A;  4OID A;  4FBE A;  3EXN A;  5I0C A;  3D68 A;  1XBU A;  2Z3L A;  4IUS A;  2DF5 A;  3DSB A;  2B4B A;  3QB8 A;  3MGD A;  1IYL A;  2YND A;  1XE4 A;  2R1I A;  3PB4 X;  3RYO A;  3S6F A;  4QVT A;  1ARM A;  3FH4 A;  2QVP A;  3GIU A;  4DJL A;  4H6Z A;  2CY2 A;  2O4H A;  4FD4 A;  1K4J A;  2PE3 A;  4YFJ A;  5LYL A;  2ZEO A;  4KVO E;  5DS0 A;  2AE6 A;  3H8E A;  5IX3 A;  3DNS A;  2CNT A;  3S9N A;  2AFX A;  2J8M A;  3PB9 X;  4A37 A;  4J3G A;  2XEF A;  3I9S A;  4MFP A;  3T9Y A;  2AFM A;  3P2F A;  2Z11 A;  4U5Y A;  2EK9 A;  2WPW A;  2HB6 A;  3D66 A;  2F5I A;  4WWV A;  3R96 A;  2Q51 A;  4GS4 A;  4MHZ A;  4MHY A;  5A28 A;  1B87 A;  4UIA A;  2PIY A;  4PK3 A;  3DDD A;  5D8N A;  3G3S A;  1CJW A;  2EBJ A;  4F8Z A;  3ISX A;  2ZEE A;  5KTA A;  4HKF A;  3DR6 A;  4CAE A;  1XMT A;  1YSJ A;  4X5K A;  3PEI A;  1LAP A;  3V38 A;  4C7I A;  2I00 A;  1Y7R A;  8CPA A;  1YX0 A;  1Z5R A;  5LYF A;  4ZBG A;  2JDC A;  1XOV A;  1ZO0 A;  3WT4 A;  3BHX A;  4KUA A;  3KI9 A;  3R9G A;  3NH8 A;  1S7L A;  1Z4E A;  3GYA A;  4RS2 A;  5F46 A;  4JJX A;  4MFZ A;  1BPM A;  4UEF A;  2BCO A;  3R9F A;  1PUA A;  4DUK A;  2OZU A;  5HVH A;  2BOA A;  3IFE A;  2GU2 A;  1FT7 A;  4ONU A;  3TOA A;  4HNW B;  2PCU A;  3S6H A;  4BD9 A;  3TE4 A;  3CZX A;  1EE3 P;  1KUX A;  2CNM A;  2X7B A;  3SI0 A;  4ZGY B;  3SJE A;  2CTC A;  3TO6 A;  1Y7E A;  3IIB A;  1IGB A;  1S7F A;  4QB9 A;  2P0W A;  2WSA A;  4P45 A;  4MY0 A;  3FED A;  4PXB A;  1M1D A;  1NE9 A;  3D7G A;  3D4U A;  4PSW A;  5G20 A;  2GIV A;  3KHZ A;  4E2A A;  2EWB A;  4CGL A;  4F6A A;  4XNH B;  3PRT A;  2VZZ A;  2FS5 A;  3D2P A;  2B58 A;  2V8D A;  2ZW6 A;  4NGS A;  3PGP A;  1VHE A;  1A2Z A;  2EO8 A;  1S5K A;  1I12 A;  1IID A;  2RC4 A;  1CG2 A;  4NF1 A;  4OIW A;  3PBE A;  2PC1 A;  3FBU A;  4B5P B;  3B3T A;  4AG9 A;  4KOT A;  1HDQ A;  2GLF A;  2YGW A;  4A32 A;  3NA6 A;  3PB6 X;  4KOX A;  4KOW A;  4CS0 B;  4KOU A;  1Y9W A;  3H5Z A;  1YGH A;  4L89 A;  3WR7 A;  5JM6 A;  5H84 A;  1PCA A;  4JWP A;  2BUE A;  2WPX A;  1VHO A;  2OU2 A;  5HVF A;  1VGY A;  4P10 A;  1QSR A;  4UWJ A;  4CGM A;  4CGP A;  3FYN A;  1KUY A;  2AJ6 A;  3GB0 A;  1WK4 A;  4PXE A;  1M4G A;  2ZW4 A;  3KQX A;  2WZN A;  3K2K A;  4NFR A;  2VL1 A;  1M4L A;  2G9D A;  3B35 A;  4I49 A;  2PRB A;  4LQG A;  2IJZ A;  3B8G A;  4CYQ A;  1OZP A;  2F8H A;  2DPT A;  1Z8L A;  3FXT A;  4R3K A;  4RI1 A;  3IC1 A;  4NSQ A;  5HH1 A;  3TO7 A;  1Z4R A;  2QYV A;  4P6Y A;  4KVX A;  1RXT A;  4R87 A;  1CPX A;  4MCS A;  3W6S A;  1M4I A;  1BLL E;  4X2T A;  2PJ9 A;  3TFY A;  2Z3O A;  5F09 A;  4FD6 A;  7CPA A;  1FNO A;  1NSA A;  1M4D A;  4C2Y A;  2PJ8 A;  4F0X A;  4C2X A;  1TF8 A;  4R76 A;  1Z8W A;  4YWY A;  2Z3N A;  4IF5 A;  4RN7 A;  3H8F A;  3IGR A;  2QML A;  2ZEH A;  3BXM A;  5FVJ A;  4LQ6 A;  2VXK A;  3PZJ A;  5ISV A;  4CYP A;  1VHS A;  1CX8 A;  2ARH A;  4JLY A;  2G0B A;  2PQ8 A;  2PVV A;  4MCR A;  3SHP A;  3TOB A;  3WC5 A;  3SJF A;  1QQ9 A;  1UFH A;  3NFZ A;  3NH4 A;  2HQY A;  4OC1 A;  3QNV A;  3R1K A;  4KOY A;  4MCQ A;  5BWA B;  4W9Y A;  2GFQ A;  1Y0Y A;  4M6H A;  2OOT A;  1TKJ A;  4YRH A;  1YRE A;  1YW6 A;  2R8V A;  2ZEM A;  1I1D A;  1SQH A;  4IK2 A;  3KR4 A;  1H8L A;  2AFW A;  4MFL A;  2P6G A;  2OZH A;  4OC0 A;  5A27 A;  2V8H A;  1YW4 A;  4K3N A;  3ZZI A;  5J8C A;  3FX6 A;  4NGQ A;  3S9L A;  3BJ7 A;  2V8V A;  4P4I A;  4PPZ A;  3R95 A;  3CXQ A;  3JUW A;  1S7K A;  3TT2 A;  3FIX A;  4ORF A;  4ZY2 A;  5G21 A;  2Y0M A;  3H8G A;  3EC4 A;  1LOK A;  2PJ0 A;  3D8P A;  2AFO A;  5JPH A;  1L0C A;  4C2Z A;  2ZPA A;  3K9U A;  5DWM A;  2CIJ A;  3DGV A;  2VEZ A;  4KOR A;  2Q4V A;  3KAS A;  2BEI A;  3FJU A;  1XRY A;  1TXR A;  2CXA A;  1P0H A;  2D4O A;  2ZOG A;  4MRI A;  3QAY A;  2IQ6 A;  5H86 A;  1DE4 C;  3IO1 A;  1TKH A;  5HMN A;  1IOI A;  1FY7 A;  2OB0 A;  3DLJ A;  4P4J A;  4OLL A;  3BI1 A;  5F47 A;  3D3S A;  3VAR A;  1YME A;  1XF8 A;  3GLJ A;  1GYT A;  4M6I A;  2PDO A;  4U9Z A;  5ELY A;  4X8I A;  5EMI A;  3TC8 A;  3W6X A;  4II9 A;  2FCK A;  2QEC A;  2WUU A;  1YK3 A;  2BO9 A;  2HUZ A;  1JWQ A;  3NE8 A;  2IMO A;  3RZA A;  1TF9 A;  3PP9 A;  2ZOF A;  3FB3 A;  4R57 A;  2DEA A;  1BOB A;  2ZEN A;  3LAC A;  3PBB A;  4NJR A;  2PJB A;  4OC2 A;  3SXN A;  1QMU A;  2XEI A;  3QAH A;  1LCP A;  4MHN A;  4FAI A;  2GLJ A;  4B12 A;  2WYR A;  3LMS A;  3PB7 X;  2CTB A;  3GUX A;  5E96 A;  4A2Z A;  2DXQ A;  2FIW A;  3FRM A;  3T8W A;  3B3S A;  2B5G B;  2CNS A;  4YU9 A;  2RB7 A;  1Q2D A;  4FWU A;  2PJ2 A;  1CM0 A;  1QSM A;  4NXY A;  2PJ6 A;  4ZX9 A;  4MCP A;  1CP6 A;  1YLO A;  4DNC A;  1I21 A;  4JXR A;  3ZJ0 A;  5J8F A;  3EFA A;  3TO9 A;  4ZY1 A;  4KSA A;  2YNC A;  3SJX A;  4UFX A;  3SI1 A;  3K9T A;  4UFV A;  2PIZ A;  3FNC A;  4HNY B;  1AUG A;  2OZG A;  2Z3P A;  2P6E A;  4ONW A;  1MK4 A;  3L2N A;  2VQY A;  3RBU A;  2YNC C;  4A38 A;  1ARL A;  1MJ9 A;  1Z9U A;  2O53 A;  2R7H A;  3VAT A;  4K30 A;  4CAF A;  5AG5 A;  4F9U A;  3V8I A;  5K8N A;  2PSW A;  5K8P A;  4UEE A;  4AB7 A;  1ZLI A;  2J8R A;  4R8F A;  4UFW A;  2KCW A;  4KLW A;  4PSX A;  3UY5 A;  4B11 A;  3S6G A;  2ABZ A;  4B14 A;  3LWU A;  1MJA A;  4XNH C;  2XEG A;  2B4D A;  2YNE A;  3LD2 A;  4KUB A;  2C1C A;  4OME A;  2JLM A;  2FE7 A;  1Q2Y A;  2PJ4 A;  3FEC A;  4B5P A;  2PVW A;  1Y0R A;  4CRZ B;  2JEW A;  1XIX A;  2PJ7 A;  4Y49 C;  4AXV A;  2VI7 A;  3IWE A;  5JH9 A;  1MJB A;  4LUA A;  4RUH A;  4Q7A A;  4NGM A;  5C82 A;  4MFQ A;  3D67 A;  1ZLH A;  4UWI A;  2O28 A;  5K8O A;  2ZW5 A;  4JD6 A;  2Q43 A;  1ELM P;  2G3T A;  3BLN A;  4M6G A;  5AG4 A;  5IB0 A;  2GAN A;  2EVN A;  4XPK A;  4UBR A;  1QSN A;  5LRJ A;  1XEB A;  4ZY0 A;  1IU8 A;  2J9A A;  2C27 A;  2PJA A;  4NGN A;  4NGR A;  4QC6 A;  1NSL A;  1R57 A;  2JDD A;  5JGF A;  1Z2L A;  2FVG A;  3C26 A;  4FD5 A;  4M85 A;  1S7N A;  4E0A A;  1ZG7 A;  2C6G A;  3CXP A;  3V7Z A;  4KSF A;  4PQA A;  4L8A A;  4JYW A;  1XMB A;  4YGO A;  4BMH A;  4CAV A;  3NE7 A;  5J1Q A;  3G8W A;  2Z10 A;  1LFW A;  1X10 A;  4F0Y A;  2JBK A;  2PRQ A;  3SJG A;  2FIA A;  3KHX A;  4UIB A;  4XPD C;  1PU9 A;  3VWE A;  1IIC A;  4Q36 A;  4QUS A;  2Q7B A;  3VH9 A;  2ZEL A;  4MFK A;  3MRU A;  4B10 A;  4BIN A;  5IB9 A;  4A94 A;  4UCM A;  3BJ8 A;  3I1U A;  4MJ8 A;  5AG6 A;  5G1Z A;  5KTC A;  3EO4 A;  5CPA A;  3KL9 A;  4B5O A;  4P4D A;  1GHE A;  4AVA A;  5C88 A;  3F5B A;  3IU1 A;  4KLV A;  4CYN A;  1KUV A;  1UWY A;  4PXD A;  1LRZ A;  4KS9 A;  2GRE A;  4ZX8 A;  1IOF A;  4HNX B;  2PJ1 A;  5LRG A;  2VZY A;  3IU2 A;  4MI4 A;  4WJB A;  1CP7 A;  3CDX A;  5LYD A;  2K5T A;  3JRU A;  4F9V A;  4ZYQ A;  1KZF A;  4PV6 A;  3N5F A;  4KSI A;  4FUU A;  2IL4 A;  1YVO A;  1QSO A;  3HUV A;  3TCV A;  3W91 A;  4MBU A;  1YQE A;  5DWN A;  2F7V A;  4P4E A;  4JXQ A;  4UEZ A;  5KTD A;  1Z8T A;  2QJ8 A;  3ISZ A;  4X3R A;  1BPN A;  1V0C A;  1Q2C A;  3CT9 A;  1ELL P;  4CGO A;  4KVM E;  4G1P A;  1ZG9 A;  2PR8 A;  4H6U A;  1AYE A;  2Z0Z A;  4QBJ A;  3JTK A;  2C6P A;  3F0A A;  2H5M A;  2FL4 A;  1S60 A;  1U6M A;  2DPS A;  5CNP A;  3S9M A;  4A95 A;  2Q7S A;  2PR1 A;  3KQZ A;  1HEE A;  1RO5 A;  2POK A;  2V77 A;  2EK8 A;  5EC4 A;  2REF A;  2P6F A;  4LX9 A;  3WC7 A;  2JEV A;  2RFH A;  4C68 A;  3B3C A;  1TKF A;  3HLP A;  3GKR A;  2Q04 A;  3WC6 A;  4A30 A;  2JBJ A;  4UA3 A;  4JZ0 A;  3IWW A;  4E8O A;  3BI0 A;  3SI2 A;  3B7I A;  3DR8 A;  4KZT A;  5THW A;  2OH1 A;  3RO0 A;  4OKO A;  4OC3 A;  4IAV A;  4P44 A;  4CGN A;  3FF3 A;  2I3C A;  4NCZ A;  4OP4 A;  3RNZ A;  4EVY A;  2NMT A;  3KR5 A;  3I3G A;  3SXO A;  2FSR A;  4EWT A;  1QST A;  1Z8X A;  4EFD A;  2BSW A;  5CBM A;  1F57 A;  1NMT A;  4MFJ A;  3TTH A;  2J8N A;  4AVB A;  4CRY B;  4TNU A;  1M44 A;  4U9Y A;  1X12 A;  3RAM A;  5AG7 A;  4H2K A;  5F49 A;  2Q4Y A;  4B13 A;  2Z3M A;  2ZEF A;  3FMC A;  4P4B A;  2A4N A;  2PJ5 A;  2ZEG A;  4NEX A;  1CPS A;  1OBR A;  1KWM A;  1IB1 E;  2Q0Y A;  3PFE A;  1YLE A;  1IYK A;  2CF4 A;  2FT0 A;  3GY9 A;  3IJ3 A;  1B6B A;  3KGQ A;  3PFO A;  4NGP A;  4Q38 A;  4GM5 A;  6CPA A;  4TWE A;  1F2P A;  1PYT B;  3CPA A;  2VBQ A;  1WWZ A;  2OR4 A;  2GE3 A;  2FXF A;  1R43 A;  3T90 A;  4CPA A;  2B5G A;  2ZEP A;  4UF4 A;  3LOD A;  2AFU A;  4AVC A;  1TIQ A;  4PK2 A;  3D7H A;  5AGE A;  2Q4Z A;  4AG7 A;  4CAW A;  2Z3K A;  3S6K A;  5D29 A;  4MHP A;  1N71 A;  4XPL A;  5G22 A;  4CYO A;  4A31 A;  1Q7L A;  1XJO A;  5LRK A;  5I4M A;  2G3A A;  4DYO A;  5IV0 A;  2QIR A;  2R98 A;  5F48 A;  5HXD A;  2HV2 A;  1DTD A;  2PJC A;  1YR0 A;  2B3U A;  2BL1 A;  3NH5 A;  5HVG A;  4EME A;  2B4D B;  2XEJ A;  4R9M A;  4MXU A;  4Y49 B;  3CXS A;  5LYI A;  3D2M A;  4Z65 A;  4C7H A;  5K8M A;  1P4N A;  3B3V A;  4H89 A;  4KOS A;  2C6C A;  2ZXV A;  3P2H A;  3PB8 X;  4PXC A;  2ODF A;  3EY5 A;  4MHD A;  4B6Z A;  4OAD A;  5GCN A;  2ZED A;  4OAE A;  1HDU A;  1ZG8 A;  4R7M A;  3R9E A;  1Y9K A;  2ANP A;  4OC4 A;  3KZW A;  4GXH A;  2Q44 A;  3B3W A;  4A33 A;  1ON0 A;  4CAX A;  4A39 A;  2PJ3 A;  3N7Z A;  1S3Z A;  4R6T A;  2REE A;  1CBX A;  1RTQ A;  4M3S A;  1JQG A;  4UCP A;  4NJQ A;  2I79 A;  2AFZ A;  3JVN A;  3MN8 A;  3TX8 A;  1J4J A;  1VIX A;  2ATR A;  3WAB A;  3IWG A;  4OC5 A;  3VWD A;  2NSM A;  3D7F A;  4IHM A;  2V8G A;  3IEH A;  4MMO A;  2AFS A;  3CPX A;  3F8K A;  4O23 A;  1LAN A;  4XPD B;  4BBH A;  4R3L A;  3OWC A;  5EBV A;  3FVL A;  1YVK A;  3KKW A;  3H4Q A;  4MY3 A; 
#chains in the Genus database with same CATH homology
 2D4P A;  2B3V A;  1BO4 A;  4KOV A;  2ZW7 A;  5JQ4 A;  4FD7 A;  3E0K A;  1VKC A;  3A9L A;  4UCN A;  2EUI A;  3EXN A;  5I0C A;  2Z3L A;  4IUS A;  3DSB A;  2B4B A;  3QB8 A;  3MGD A;  1IYL A;  2YND A;  1XE4 A;  2R1I A;  3RYO A;  3S6F A;  4QVT A;  4H6Z A;  2CY2 A;  4FD4 A;  1K4J A;  4YFJ A;  4KVO E;  2AE6 A;  5IX3 A;  3DNS A;  2CNT A;  2J8M A;  4J3G A;  3I9S A;  4MFP A;  3T9Y A;  3P2F A;  2Z11 A;  4U5Y A;  2WPW A;  3R96 A;  2F5I A;  4GS4 A;  5A28 A;  1B87 A;  4PK3 A;  3DDD A;  3G3S A;  1CJW A;  5KTA A;  4HKF A;  3DR6 A;  4CAE A;  1XMT A;  4X5K A;  4C7I A;  2I00 A;  1Y7R A;  1YX0 A;  4ZBG A;  2JDC A;  1ZO0 A;  4KUA A;  3R9G A;  1S7L A;  1Z4E A;  3GYA A;  4RS2 A;  5F46 A;  4JJX A;  4MFZ A;  3R9F A;  1PUA A;  2OZU A;  4ONU A;  3TOA A;  4HNW B;  3S6H A;  3TE4 A;  1KUX A;  2CNM A;  2X7B A;  4ZGY B;  3TO6 A;  1S7F A;  4QB9 A;  2P0W A;  2WSA A;  4MY0 A;  1M1D A;  1NE9 A;  4PSW A;  4F6A A;  5G20 A;  2GIV A;  4E2A A;  4CGL A;  4XNH B;  2VZZ A;  2FS5 A;  3D2P A;  2B58 A;  2ZW6 A;  3PGP A;  1S5K A;  1I12 A;  1IID A;  2RC4 A;  4NF1 A;  2PC1 A;  3FBU A;  4B5P B;  4AG9 A;  4KOT A;  2YGW A;  4A32 A;  4KOX A;  4KOW A;  4CS0 B;  4KOU A;  1Y9W A;  3H5Z A;  1YGH A;  4L89 A;  3WR7 A;  5H84 A;  4JWP A;  2BUE A;  2WPX A;  2OU2 A;  4CGP A;  1QSR A;  4UWJ A;  4CGM A;  3FYN A;  1KUY A;  2AJ6 A;  1WK4 A;  1M4G A;  2ZW4 A;  4CYQ A;  4I49 A;  2PRB A;  3B8G A;  1OZP A;  2DPT A;  3FXT A;  4R3K A;  4RI1 A;  4NSQ A;  5HH1 A;  3TO7 A;  1Z4R A;  4KVX A;  1RXT A;  4R87 A;  3W6S A;  1M4I A;  3TFY A;  2Z3O A;  4FD6 A;  1M4D A;  4C2Y A;  4F0X A;  4C2X A;  2Z3N A;  4IF5 A;  3IGR A;  2QML A;  5FVJ A;  2VXK A;  3PZJ A;  5ISV A;  4CYP A;  1VHS A;  2ARH A;  4JLY A;  2G0B A;  2PQ8 A;  3SHP A;  3TOB A;  1UFH A;  2HQY A;  3R1K A;  4KOY A;  5BWA B;  4YRH A;  1YRE A;  2R8V A;  1I1D A;  1SQH A;  4MFL A;  2P6G A;  2OZH A;  5A27 A;  3ZZI A;  5J8C A;  3BJ7 A;  3R95 A;  3TT2 A;  3JUW A;  3CXQ A;  1S7K A;  3FIX A;  4ORF A;  5G21 A;  2Y0M A;  3EC4 A;  3D8P A;  5JPH A;  1L0C A;  4C2Z A;  2ZPA A;  3K9U A;  5DWM A;  2VEZ A;  4KOR A;  2Q4V A;  2BEI A;  2CXA A;  1P0H A;  2D4O A;  5H86 A;  5HMN A;  1FY7 A;  2OB0 A;  4OLL A;  5F47 A;  3D3S A;  1XF8 A;  4U9Z A;  4II9 A;  2PDO A;  3W6X A;  2FCK A;  2QEC A;  2WUU A;  1YK3 A;  2HUZ A;  3PP9 A;  3FB3 A;  4R57 A;  1BOB A;  3SXN A;  3QAH A;  4B12 A;  5E96 A;  4A2Z A;  2DXQ A;  2FIW A;  3FRM A;  2B5G B;  2CNS A;  1Q2D A;  1CM0 A;  1QSM A;  4NXY A;  4DNC A;  1I21 A;  4JXR A;  3ZJ0 A;  5J8F A;  3EFA A;  3TO9 A;  4KSA A;  2YNC A;  4UFX A;  4UFV A;  3FNC A;  4HNY B;  2OZG A;  2Z3P A;  2P6E A;  1MK4 A;  2VQY A;  2YNC C;  1MJ9 A;  1Z9U A;  4CAF A;  2R7H A;  4K30 A;  5AG5 A;  3V8I A;  2PSW A;  4AB7 A;  2J8R A;  4UFW A;  2KCW A;  4KLW A;  4PSX A;  3UY5 A;  4B11 A;  3S6G A;  4B14 A;  4XNH C;  1MJA A;  3LD2 A;  2B4D A;  2YNE A;  4KUB A;  2JLM A;  2FE7 A;  1Q2Y A;  4B5P A;  4CRZ B;  1XIX A;  4Y49 C;  2VI7 A;  3IWE A;  1MJB A;  4LUA A;  5C82 A;  4MFQ A;  4UWI A;  2O28 A;  2ZW5 A;  4JD6 A;  2G3T A;  3BLN A;  5AG4 A;  5IB0 A;  2GAN A;  2EVN A;  4XPK A;  4UBR A;  1QSN A;  1XEB A;  2C27 A;  1NSL A;  4QC6 A;  1R57 A;  2JDD A;  4FD5 A;  3C26 A;  4M85 A;  4E0A A;  1S7N A;  3CXP A;  4KSF A;  4L8A A;  4BMH A;  4YGO A;  4CAV A;  3NE7 A;  3G8W A;  2Z10 A;  4F0Y A;  2FIA A;  4XPD C;  1PU9 A;  3VWE A;  1IIC A;  4Q36 A;  4QUS A;  2Q7B A;  4MFK A;  4B10 A;  4UCM A;  3BJ8 A;  4MJ8 A;  5AG6 A;  5KTC A;  5G1Z A;  3EO4 A;  4B5O A;  1GHE A;  4AVA A;  5C88 A;  3F5B A;  3IU1 A;  4KLV A;  4CYN A;  1KUV A;  1LRZ A;  4KS9 A;  4HNX B;  2VZY A;  3IU2 A;  4MI4 A;  2K5T A;  1KZF A;  4PV6 A;  2IL4 A;  1YVO A;  1QSO A;  3W91 A;  3TCV A;  4MBU A;  5DWN A;  4JXQ A;  5KTD A;  1V0C A;  1Q2C A;  4CGO A;  4KVM E;  2PR8 A;  4H6U A;  2Z0Z A;  4QBJ A;  3JTK A;  3F0A A;  2H5M A;  2FL4 A;  1S60 A;  1U6M A;  2DPS A;  5CNP A;  4A95 A;  2PR1 A;  1RO5 A;  5EC4 A;  2REF A;  2P6F A;  4LX9 A;  2JEV A;  4C68 A;  3GKR A;  2Q04 A;  4A30 A;  4UA3 A;  4E8O A;  3DR8 A;  4KZT A;  4CGN A;  2OH1 A;  4NCZ A;  4EVY A;  2NMT A;  3SXO A;  3I3G A;  2FSR A;  1QST A;  2BSW A;  1NMT A;  3TTH A;  4MFJ A;  2J8N A;  4AVB A;  4CRY B;  1M44 A;  4U9Y A;  5AG7 A;  5F49 A;  2Q4Y A;  4B13 A;  2Z3M A;  2A4N A;  4NEX A;  1IB1 E;  2Q0Y A;  1YLE A;  1IYK A;  2FT0 A;  3GY9 A;  1B6B A;  4Q38 A;  2VBQ A;  1WWZ A;  2FXF A;  2GE3 A;  3T90 A;  2B5G A;  3LOD A;  4AVC A;  1TIQ A;  4PK2 A;  5AGE A;  4AG7 A;  4CAW A;  2Z3K A;  3S6K A;  4XPL A;  1N71 A;  5G22 A;  4CYO A;  4A31 A;  2G3A A;  5IV0 A;  2QIR A;  2R98 A;  5F48 A;  2HV2 A;  1YR0 A;  2B3U A;  2BL1 A;  2B4D B;  4R9M A;  4Y49 B;  3CXS A;  3D2M A;  4C7H A;  1P4N A;  4H89 A;  4KOS A;  2ZXV A;  3P2H A;  3EY5 A;  4MHD A;  4OAD A;  5GCN A;  4OAE A;  3R9E A;  1Y9K A;  2Q44 A;  4A33 A;  1ON0 A;  4CAX A;  3N7Z A;  1S3Z A;  2REE A;  4M3S A;  4UCP A;  2I79 A;  3JVN A;  1J4J A;  2ATR A;  3IWG A;  3VWD A;  4XPD B;  3F8K A;  4BBH A;  4R3L A;  3OWC A;  5EBV A;  1YVK A;  3KKW A;  3H4Q A;  4MY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...