2B5GB

Wild type ssat- 1.7a structure
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
167
structure length
159
Chain Sequence
FVIRPATAADCSDILRLIKELAYEYMEEQVILTEKDLLEDGFFYHCLVAEVPWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 1
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 32
structure length 159
sequence length 167
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b5gB00
3EFAA 4MBUA 1Q2DA 5DWMA 4NSQA 2ATRA 2BEIA 4HNYB 1LRZA 2Q4YA 1XIXA 3DR6A 2ZXVA 3R96A 1R57A 1K4JA 1S5KA 1MK4A 3FYNA 4FD5A 2ZW6A 3TO7A 3EO4A 4AVCA 5HH1A 1IYKA 3GY9A 1L0CA 4U9ZA 1XF8A 3GKRA 4J3GA 4UBRA 5H86A 3D2PA 4UWIA 4B5OA 2B3UA 1MJAA 2REFA 2FCKA 5FVJA 2JDCA 4H6ZA 3P2FA 3TOBA 2ARHA 1N71A 3I3GA 3TCVA 1TIQA 4CAWA 4CRYB 1YVOA 2G3AA 2VZYA 4LX9A 4I49A 4ZBGA 4KVXA 4U9YA 3H4QA 4NEXA 3KKWA 4PK3A 2WPXA 4R57A 5ISVA 5JPHA 1YK3A 2Q4VA 2Z11A 4B5PB 2R7HA 3N7ZA 3RYOA 2JDDA 4XNHB 2BSWA 2P6GA 1Y9WA 1S7KA 1QSMA 2WPWA 5E96A 4AVBA 1Y9KA 4Y49C 3MGDA 5C82A 3FB3A 1YGHA 2HUZA 2OZUA 2VXKA 1VHSA 2I00A 3G3SA 1XEBA 3T90A 4QC6A 2CNMA 1M4IA 4ONUA 4JD6A 3CXSA 2B3VA 4EVYA 1NMTA 2Z10A 4II9A 1WWZA 2VBQA 3S6KA 2JLMA 5DWNA 2CNTA 3DDDA 2VEZA 2EVNA 2CNSA 3TFYA 3WR7A 4CAXA 2A4NA 2PR8A 1M4GA 2P6EA 3FXTA 4IF5A 4QVTA 2EUIA 2OH1A 2OZHA 2VZZA 4KOXA 4RS2A 2GE3A 3FIXA 2AE6A 4JXRA 3B8GA 3TT2A 1PU9A 2Q0YA 3EY5A 4L8AA 2D4OA 2IL4A 1S60A 4PSWA 4KOVA 2ZW7A 2HV2A 1Z4RA 1I1DA 1Y7RA 3TO6A 1CM0A 2FL4A 3SHPA 1UFHA 3OWCA 1M44A 4ORFA 4FD4A 1IIDA 1QSNA 2KCWA 4AB7A 4B5PA 4OAEA 2FT0A 2B4DB 5F48A 2R1IA 1S3ZA 5EBVA 4KVOE 4QBJA 1MJBA 4K30A 4PSXA 1IYLA 4UA3A 4YFJA 4XNHC 2I79A 4PK2A 4AG7A 1RXTA 2RC4A 3DNSA 2J8MA 2J8RA 3SXNA 4KUAA 3E0KA 1RO5A 1YX0A 1I12A 2QIRA 2GANA 3TOAA 4R9MA 4XPDB 1OZPA 3W91A 3I9SA 3K9UA 5KTAA 1MJ9A 4AG9A 4OLLA 4F6AA 4MY0A 3CXPA 4CAVA 4KZTA 2PSWA 2R8VA 4E2AA 5I0CA 4E0AA 1SQHA 4HKFA 1YREA 3S6HA 2B5GB 3VWDA 2Q7BA 1IICA 1NE9A 1V0CA 2G0BA 4U5YA 1YR0A 3QB8A 4KOWA 1QSTA 3TO9A 3SXOA 4FD7A 1XE4A 1B87A 3F8KA 2QECA 2ZPAA 4HNWB 3JUWA 2Z0ZA 5IV0A 1FY7A 1WK4A 3LODA 1J4JA 5H84A 2K5TA 4M3SA 3W6XA 3FRMA 4JXQA 1KUXA 4KOUA 3TE4A 4JWPA 3BJ7A 1CJWA 4E8OA 4JJXA 3LD2A 2FIAA 5F49A 3S6GA 2FXFA 3DR8A 3P2HA 4MJ8A 2B4DA 3NE7A 2HQYA 2P6FA 2FS5A 2OB0A 3VWEA 1Q2YA 3IGRA 3CXQA 3ZZIA 4H89A 2P0WA 3R1KA 5J8FA 4HNXB 4KLWA 3PZJA 2B4BA 2C27A 2PQ8A 2GIVA 5KTCA 2OU2A 3PP9A 4KOTA 4IUSA 1BOBA 4R3LA 3TTHA 4R87A 3V8IA 5F47A 5IB0A 1Z4EA 3D3SA 4XPDC 4QB9A 4KUBA 3W6SA 1ON0A 4RI1A 2B5GA 2VQYA 4H6UA 1P4NA 4KOSA 4DNCA 5EC4A 2G3TA 2R98A 3DSBA 4OADA 3BJ8A 1IB1E 4F0YA 3ZJ0A 3EC4A 4BMHA 5CNPA 3R95A 4FD6A 2X7BA 1PUAA 3T9YA 5IX3A 2Q44A 1M1DA 1BO4A 4JLYA 4NF1A 1QSOA 2CY2A 4GS4A 4LUAA 4KLVA 3F0AA 2Y0MA 3JVNA 2J8NA 4X5KA 3S6FA 5J8CA 3IWGA 2PRBA 1NSLA 4CRZB 2REEA 1I21A 1S7NA 3D8PA 4YRHA 2BL1A 3BLNA 1U6MA 2DXQA 2AJ6A 3FBUA 2ZW5A 5GCNA 3R9GA 1GHEA 2PC1A 1KUYA 1S7FA 3QAHA 4XPLA 1B6BA 4CS0B 1Q2CA 3R9EA 2Q04A 3PGPA 5C88A 3EXNA 4MI4A 3UY5A 1YVKA 1KZFA 4NCZA 4KOYA 2VI7A 2FE7A 5JQ4A 5HMNA 2F5IA 3GYAA 3R9FA 2QMLA 2FSRA 2BUEA 1QSRA 2OZGA 2H5MA 4XPKA 4UWJA 1S7LA 2JEVA 5F46A 2B58A 4KVME 4Y49B 1YLEA 2D4PA 4KORA 4MY3A 2ZW4A 4AVAA 1P0HA 2O28A 2PDOA 4M85A 2FIWA 1Z9UA 2PR1A 3FNCA 4L89A 3C26A 3D2MA 3F5BA 4PV6A 4R3KA 3G8WA 1XMTA 1KUVA 2NMTA 1VKCA 4QUSA 4YGOA 5KTDA 4MHDA 1M4DA 4NXYA
chains in the Genus database with same CATH superfamily
3EFAA 4MBUA 1NSAA 1Q2DA 5DWMA 4H2KA 2G9DA 4UEFA 2ABZA 4NSQA 5THWA 2ATRA 2BEIA 4HNYB 4KSIA 2GU2A 4DJLA 2QJ8A 3IU1A 1LRZA 4NGTA 2Q4YA 3RNZA 1XIXA 3DR6A 2ZXVA 3R96A 1R57A 1K4JA 1S5KA 1MK4A 3FECA 3FYNA 2ZW6A 4FD5A 3TO7A 3EO4A 4OC0A 4AVCA 1LFWA 5HH1A 1IYKA 3KZWA 3GB0A 3B3CA 4F0XA 3GY9A 5K8MA 1XFOA 1L0CA 4PXEA 2BO9A 4U9ZA 4B10A 1XF8A 3CT9A 3GKRA 4J3GA 4UBRA 5H86A 2Z3MA 3D2PA 4UWIA 4B5OA 2B3UA 2PJ9A 1MJAA 2REFA 4M6GA 2QVPA 4MXUA 2FCKA 5FVJA 1PYTB 2JDCA 1EE3P 2PJ3A 4H6ZA 4A39A 2FVGA 4C2XA 3P2FA 1ARLA 3TOBA 4F9VA 5IB9A 1Z8TA 3ISZA 3NH8A 2ARHA 1LAPA 2PJ1A 4R6TA 1N71A 2ZOFA 3I3GA 2V8HA 4NGSA 3TCVA 1TIQA 3H8GA 3I1UA 4CAWA 4CRYB 1YVOA 2G3AA 2V77A 2VZYA 4LX9A 1HEEA 1PCAA 3FEEA 4A30A 4I49A 3GUXA 4ZBGA 4KVXA 4EMEA 1LOKA 2YNCA 4U9YA 3H4QA 3RZAA 4Q36A 1XRYA 2AFOA 5BWAB 1ZG9A 4NEXA 5LYLA 2Q51A 3KKWA 4OC5A 4BD9A 3N5FA 3FX6A 4PK3A 3MN8A 3WC7A 2OR4A 2PVVA 2WPXA 4NGQA 4R57A 3WT4A 4CYPA 5JPHA 1YK3A 5ISVA 4CGPA 2YNCC 5D29A 3VARA 2Q4VA 5HVFA 5G20A 2Z11A 2GREA 3B3VA 4B5PB 4C7IA 2R7HA 3N7ZA 3RYOA 4A32A 2JDDA 1R43A 2BSWA 2P6GA 4XNHB 1Y9WA 1S7KA 4B14A 4CGOA 3PB6X 5CBMA 1QSMA 2WPWA 1AYEA 5E96A 4AVBA 5HXDA 1Y9KA 4Y49C 5G22A 3KI9A 3PB7X 3MGDA 5C82A 1F57A 2C6PA 4A94A 2ZOGA 3FB3A 1YGHA 2HUZA 2OZUA 2PJ5A 2VXKA 3L2NA 3PBEA 3SJEA 2Q7SA 1X10A 1VHSA 4ZY0A 2I00A 4NGRA 1ZG7A 5LYDA 2QYVA 2Q43A 3T8WA 3G3SA 1XEBA 2PIZA 2V8GA 3T90A 4QC6A 3CPXA 4NFRA 2CNMA 1M4IA 2PIYA 3DGVA 4JD6A 4ONUA 3CXSA 2B3VA 3TX8A 4EVYA 1NMTA 3PFEA 2Z10A 2CIJA 4KSAA 4II9A 1YW4A 1WWZA 2WSAA 3K2KA 4O23A 4W9YA 4MCPA 4AXVA 2VBQA 2ZEPA 3A9LA 3S6KA 2JLMA 5DWNA 2CNTA 2V8DA 3DDDA 4A95A 2VEZA 2ZEDA 2EVNA 2PJ7A 5CPAA 1YLOA 2HC9A 4MFPA 2CNSA 2O53A 2AFUA 3TFYA 3WR7A 4CAXA 2A4NA 1TKHA 2PR8A 3RO0A 4CAFA 1M4GA 1YQEA 2P6EA 1Z8WA 3FXTA 3PEIA 2EUIA 2OH1A 2OZHA 4IF5A 4QVTA 4TWEA 2VZZA 3FEDA 2IMOA 4KOXA 4RS2A 2GE3A 3FIXA 2AE6A 4JXRA 3B8GA 4RUHA 3TT2A 4P4BA 1PU9A 4M6IA 2CF4A 2Q0YA 3EY5A 2CTBA 2D4OA 4L8AA 4B12A 4FWUA 4EFDA 5A27A 4UFXA 1DE4C 1LANA 2IL4A 1S60A 4PSWA 4KOVA 2ZW7A 3KR4A 2HV2A 1IY7A 1I1DA 1Z4RA 1Y7RA 4MHPA 5D8NA 3D66A 3TO6A 2PJ4A 1A2ZA 1Z8XA 1CM0A 5F09A 2ODFA 2XEGA 2RB7A 4OP4A 3IWWA 3KGQA 2FL4A 3SHPA 5AG7A 1UFHA 4CGLA 2Z3PA 3OWCA 1M44A 4ORFA 4MCQA 3BXMA 4FUUA 3BHXA 4FD4A 1IIDA 3BI0A 1QSNA 4MHNA 2EWBA 6CPAA 2KCWA 1IOIA 2ANPA 4AB7A 1CX8A 4B6ZA 4B5PA 4OAEA 2FT0A 2B4DB 2GFQA 4DYOA 1R3NA 5F48A 2R1IA 2OOTA 1IOFA 4MCRA 2GLFA 1S3ZA 5EBVA 4KVOE 1VGYA 2DEAA 4UEEA 5ELYA 4QBJA 5AG4A 4ZYQA 1F2OA 1MJBA 4K30A 4PSXA 4MHYA 1IYLA 3WABA 3JRUA 4UA3A 5HVHA 4YFJA 3PFOA 4GM5A 4XNHC 3V38A 4OIDA 4A38A 4DUKA 2I79A 4F9UA 3FJUA 4PK2A 4B11A 2Z3LA 2WUUA 4AG7A 4GXHA 1RXTA 2RC4A 3DNSA 2J8MA 1VIXA 4KS9A 2J8RA 1UWYA 3PB8X 3SXNA 4UF4A 4KUAA 2J9AA 4MCSA 3E0KA 4A33A 3IEHA 1X12A 1RO5A 1YX0A 1I12A 2QIRA 4Q7AA 2GANA 4P45A 2BOAA 4UIAA 3IU2A 3TOAA 4R9MA 2YNDA 4XPDB 1OZPA 3W91A 2WZNA 1Z8LA 3I9SA 1IGBA 4P4EA 2AFXA 3NH4A 3K9UA 5KTAA 3B3SA 1MJ9A 4PXBA 4AG9A 1BLLE 2JBKA 4OLLA 4MY0A 4F6AA 5JH9A 3CXPA 4UCNA 4KZTA 4CAVA 1CG2A 2PSWA 2R8VA 2VL1A 4E2AA 4E0AA 1SQHA 2ZEOA 3D68A 5I0CA 1XBUA 4ZX9A 4HKFA 1YREA 4WJBA 3S6HA 2B5GB 2XEIA 3PB9X 3VWDA 1JQGA 4JYWA 2Q7BA 4UIBA 4PXCA 5AG6A 5HVGA 1IICA 1NE9A 4OMEA 1V0CA 4MFLA 4R76A 2G0BA 4U5YA 1YR0A 3B2YA 3QB8A 2EBJA 2DF5A 2PJ6A 4KOWA 4ONWA 4X3RA 4C7HA 1QSTA 2DPSA 3TO9A 4CYQA 2JEWA 2ZEEA 3SXOA 4FD7A 1XE4A 1B87A 4C2YA 5JGFA 3F8KA 2QECA 2ZPAA 4HNWB 3JUWA 1ZG8A 4ZY1A 2Z0ZA 4FBEA 1TF9A 3H5ZA 5IV0A 1FY7A 1FT7A 4P4JA 4R8FA 4UEZA 4OKOA 1WK4A 3LODA 1J4JA 5H84A 4PXDA 1TXRA 2K5TA 4M3SA 3CPAA 2IQ6A 3FVLA 2HB6A 3W6XA 5LRJA 4C68A 3FRMA 4JXQA 4OC3A 2PJ0A 1KUXA 4KOUA 4P4IA 3TE4A 4OC1A 4JWPA 4CYOA 1LCPA 2Q4ZA 3D7GA 3IFEA 3BJ7A 3FH4A 4NGNA 4F8ZA 3LWUA 2PCUA 1CJWA 4A37A 4E8OA 4YU9A 1HDUA 3IIBA 4JJXA 4A2ZA 3LD2A 5K8NA 2FIAA 3B7IA 5F49A 5LYFA 3S6GA 1CPXA 2EK9A 2FXFA 3DR8A 1QMUA 3P2HA 3RAMA 3QNVA 5G21A 3SJFA 1FNOA 2AFZA 2JBJA 3KQZA 2B4DA 4MJ8A 2WYRA 3GLJA 2C6GA 3NE7A 2PJ2A 1AUGA 1YW6A 2HQYA 2P6FA 1XJOA 2FS5A 2ZEMA 3CZXA 3KHZA 1F2PA 3NA6A 2OB0A 3VWEA 1Q2YA 2ZEGA 4UFVA 3IGRA 3CXQA 3ZZIA 1XMBA 2XEJA 5LYIA 7CPAA 1YMEA 2ZELA 4H89A 3S9LA 3GIUA 4C2ZA 4P44A 3NFZA 2P0WA 2IJZA 3R1KA 5J8FA 2AFWA 4HNXB 4IHMA 4B13A 1HDQA 5DS0A 4MFKA 4KLWA 3PZJA 2B4BA 2C27A 5AGEA 2PQ8A 2GIVA 5KTCA 1RTQA 4MFZA 2OU2A 1BPNA 3QAYA 3PP9A 2I3CA 1Z5RA 4KOTA 4IUSA 1BOBA 4CGNA 1Y0YA 4R3LA 2POKA 1CBXA 3NE8A 4R87A 3TTHA 3SI1A 3V8IA 5LRKA 1DTDA 1XOVA 3D67A 5F47A 5IB0A 4CAEA 4OC4A 1Z4EA 3D3SA 4UFWA 2CTCA 4XPDC 3SI0A 4QB9A 3PBBA 3SJGA 1VHEA 4G1PA 5AG5A 4NGPA 2PVWA 2ZEHA 5JM6A 2PJCA 4KUBA 1ON0A 4RI1A 3W6SA 3B35A 2B5GA 4UCPA 2VQYA 4MHZA 4H6UA 1P4NA 4KOSA 4TNUA 3VATA 2PE3A 4NJRA 1CPSA 4DNCA 5EC4A 2G3TA 2R98A 1TF8A 3DSBA 3VH9A 4OADA 2Z3OA 3BJ8A 1IB1E 2BCOA 4F0YA 3IO1A 3SJXA 3ZJ0A 3D7FA 3EC4A 3KHXA 2V8VA 2C1CA 4BMHA 5CNPA 3R95A 1Y0RA 2ZEFA 2DPTA 3KL9A 4FD6A 4KSFA 4MRIA 4ZGYB 4X8IA 3D7DA 4OC2A 2X7BA 3IJ3A 4K3NA 1H8LA 1PUAA 3PRTA 3T9YA 5IX3A 2Q44A 1M1DA 4MFJA 5LRGA 1KWMA 1BO4A 4ZI6A 1ARMA 4JLYA 4Q38A 3CDXA 3LACA 1QSOA 2CY2A 2O4HA 4NF1A 4GS4A 4LUAA 4KLVA 1IU8A 2Y0MA 3F0AA 3S9MA 1CP7A 5G1ZA 1AMPA 1Q7LA 2XEFA 3JVNA 3SI2A 2J8NA 2NSMA 4PQAA 4CPAA 3FMCA 4X5KA 4HPSA 3S6FA 3LMSA 1Y7EA 5J8CA 3IWGA 2PRBA 2ZENA 3FF3A 4LQ6A 4MFQA 1NSLA 2F8HA 3HLPA 2REEA 4CRZB 1I21A 4ZX8A 1M4LA 4CYNA 1S7NA 3D8PA 4EWTA 4IAVA 4YRHA 3IWEA 1LAMA 3RBUA 3B3WA 1ZLIA 2BL1A 2PRQA 3BLNA 5K8OA 1QQ9A 4R7MA 4JZ0A 1U6MA 2DXQA 2AJ6A 1CP6A 3FBUA 2ZW5A 3ISXA 5GCNA 3R9GA 1GHEA 1ZLHA 2PC1A 3K9TA 1KUYA 2PJBA 1S7FA 3QAHA 2PJAA 4A31A 4XPLA 1B6BA 5A28A 4BINA 4CS0B 1Q2CA 3R9EA 2Q04A 3PGPA 4OIWA 3BI1A 5C88A 3EXNA 4MI4A 4P6YA 1YVKA 1KZFA 4NCZA 3UY5A 5J1QA 2Z3NA 4KOYA 2F7VA 4Z65A 2AFMA 4YWYA 1YSJA 2RFHA 2VI7A 3V7ZA 1BPMA 1TKJA 8CPAA 2FE7A 4PPZA 1VHOA 5JQ4A 3TC8A 5HMNA 3HUVA 2F5IA 4UCMA 4NJQA 3D7HA 3NH5A 3GYAA 3R9FA 2QMLA 2FSRA 3PB4X 4P10A 2BUEA 1QSRA 2CXAA 2OZGA 2H5MA 3D4UA 3H8EA 2EO8A 3B3TA 4XPKA 4UWJA 1S7LA 2JEVA 5F46A 2B58A 3IC1A 3DLJA 4KVME 1TKFA 4Y49B 2EK8A 1YLEA 4IK2A 2D4PA 4KORA 4BBHA 4MY3A 4NGMA 2ZW4A 4P4FA 5K8PA 1OBRA 3WC5A 1P0HA 3WC6A 4X2TA 4AVAA 2O28A 1GYTA 1JWQA 2PDOA 4M85A 1Z2LA 2YNEA 1ELLP 5EMIA 2FIWA 1Z9UA 2PR1A 3FNCA 2Z3KA 3KQXA 4L89A 4CGMA 3C26A 3D2MA 3JTKA 3F5BA 4FAIA 1BAVA 2YGWA 4PV6A 3KASA 4P4DA 3G8WA 4R3KA 2C6CA 2AFSA 5I4MA 1XMTA 4ZY2A 1KUVA 2NMTA 1VKCA 3MRUA 4MMOA 4QUSA 4YGOA 5KTDA 2GLJA 4MHDA 4WWVA 1ELMP 4M6HA 1M4DA 3S9NA 4RN7A 4LQGA 1ZO0A 3KR5A 2PJ8A 3H8FA 4NXYA 2NYQA
chains in the Genus database with same CATH topology
3EFAA 4MBUA 1Q2DA 5DWMA 4NSQA 2ATRA 2BEIA 4HNYB 3IU1A 1LRZA 2Q4YA 1XIXA 3DR6A 2ZXVA 3R96A 1R57A 1K4JA 1S5KA 1MK4A 3FYNA 4FD5A 2ZW6A 3TO7A 4B11A 3EO4A 4AVCA 5HH1A 1IYKA 4F0XA 3GY9A 1L0CA 4U9ZA 4B10A 1XF8A 3GKRA 4J3GA 4UBRA 5H86A 2Z3MA 3D2PA 4UWIA 4B5OA 2B3UA 1MJAA 2REFA 2FCKA 5FVJA 2JDCA 4H6ZA 4C2XA 3P2FA 3TOBA 2ARHA 1N71A 3I3GA 3TCVA 1TIQA 4CAWA 4CRYB 1YVOA 2G3AA 2VZYA 4LX9A 4A30A 4I49A 4ZBGA 4KVXA 2YNCA 4U9YA 3H4QA 4Q36A 5BWAB 4NEXA 3KKWA 4PK3A 2WPXA 4R57A 5ISVA 4CYPA 5JPHA 1YK3A 4CGPA 2YNCC 2Q4VA 5G20A 2Z11A 4B5PB 4C7IA 2R7HA 3N7ZA 3RYOA 4A32A 2JDDA 4XNHB 2BSWA 2P6GA 1Y9WA 1S7KA 4B14A 4CGOA 1QSMA 2WPWA 5E96A 4AVBA 1Y9KA 4Y49C 5G22A 3MGDA 5C82A 3FB3A 1YGHA 2HUZA 2OZUA 2VXKA 1VHSA 2I00A 3G3SA 1XEBA 3T90A 4QC6A 2CNMA 1M4IA 4ONUA 4JD6A 3CXSA 2B3VA 4EVYA 1NMTA 2Z10A 4KSAA 4II9A 1WWZA 2WSAA 2VBQA 3A9LA 3S6KA 2JLMA 5DWNA 2CNTA 3DDDA 4A95A 2VEZA 2EVNA 4MFPA 2CNSA 3TFYA 3WR7A 4CAXA 2A4NA 2PR8A 4CAFA 1M4GA 2P6EA 3FXTA 4IF5A 4QVTA 2EUIA 2OH1A 2OZHA 2VZZA 4KOXA 4RS2A 2GE3A 3FIXA 2AE6A 4JXRA 3B8GA 3TT2A 1PU9A 2Q0YA 3EY5A 4L8AA 2D4OA 4B12A 5A27A 2IL4A 1S60A 4PSWA 4KOVA 2ZW7A 2HV2A 1Z4RA 1I1DA 1Y7RA 3TO6A 1CM0A 2FL4A 3SHPA 5AG7A 1UFHA 4CGLA 2Z3PA 3OWCA 1M44A 4ORFA 4FD4A 1IIDA 1QSNA 2KCWA 4AB7A 4B5PA 4OAEA 2FT0A 2B4DB 5F48A 2R1IA 1S3ZA 5EBVA 4KVOE 4QBJA 5AG4A 1MJBA 4K30A 4PSXA 1IYLA 4UA3A 4YFJA 4XNHC 2I79A 4PK2A 2Z3LA 2WUUA 4AG7A 1RXTA 2RC4A 3DNSA 2J8MA 4KS9A 2J8RA 3SXNA 4KUAA 4A33A 3E0KA 1RO5A 1YX0A 1I12A 2QIRA 2GANA 3TOAA 3IU2A 4R9MA 2YNDA 4XPDB 1OZPA 3W91A 3I9SA 3K9UA 5KTAA 1MJ9A 4AG9A 4OLLA 4F6AA 4MY0A 3CXPA 4UCNA 4KZTA 4CAVA 2PSWA 2R8VA 4E2AA 5I0CA 4E0AA 1SQHA 4HKFA 1YREA 3S6HA 2B5GB 3VWDA 2Q7BA 5AG6A 1IICA 1NE9A 1V0CA 4MFLA 2G0BA 4U5YA 1YR0A 3QB8A 4KOWA 4CYQA 4C7HA 1QSTA 2DPSA 3TO9A 3SXOA 4FD7A 1XE4A 1B87A 4C2YA 3F8KA 2QECA 2ZPAA 4HNWB 3JUWA 2Z0ZA 3H5ZA 5IV0A 1FY7A 1WK4A 3LODA 1J4JA 5H84A 2K5TA 4M3SA 3W6XA 4C68A 3FRMA 4JXQA 1KUXA 4KOUA 3TE4A 4JWPA 4CYOA 3BJ7A 1CJWA 4E8OA 4JJXA 4A2ZA 3LD2A 2FIAA 5F49A 3S6GA 2FXFA 3DR8A 3P2HA 5G21A 4MJ8A 2B4DA 3NE7A 4UFXA 2HQYA 2P6FA 2FS5A 2OB0A 3VWEA 1Q2YA 4UFVA 3IGRA 3CXQA 3ZZIA 4H89A 4C2ZA 2P0WA 3R1KA 5J8FA 4HNXB 4B13A 4MFKA 4KLWA 3PZJA 2B4BA 2C27A 5AGEA 2PQ8A 2GIVA 5KTCA 4MFZA 2OU2A 3PP9A 4KOTA 4IUSA 1BOBA 4CGNA 4R3LA 3TTHA 4R87A 3V8IA 5F47A 5IB0A 4CAEA 1Z4EA 3D3SA 4UFWA 4XPDC 4QB9A 5AG5A 4KUBA 3W6SA 1ON0A 4RI1A 2B5GA 4UCPA 2VQYA 4H6UA 1P4NA 4KOSA 4DNCA 5EC4A 2G3TA 2R98A 3DSBA 4OADA 2Z3OA 3BJ8A 1IB1E 4F0YA 3ZJ0A 3EC4A 4BMHA 5CNPA 3R95A 4FD6A 4KSFA 2DPTA 4ZGYB 2X7BA 1PUAA 3T9YA 5IX3A 2Q44A 1M1DA 4MFJA 1BO4A 4JLYA 4Q38A 4NF1A 1QSOA 2CY2A 4GS4A 4LUAA 4KLVA 3F0AA 2Y0MA 5G1ZA 3JVNA 2J8NA 4X5KA 3S6FA 5J8CA 3IWGA 2PRBA 4MFQA 1NSLA 4CRZB 2REEA 1I21A 4CYNA 1S7NA 3D8PA 4YRHA 3IWEA 2BL1A 3BLNA 1U6MA 2DXQA 2AJ6A 3FBUA 2ZW5A 5GCNA 3R9GA 1GHEA 2PC1A 1KUYA 1S7FA 3QAHA 4A31A 5A28A 4XPLA 1B6BA 4CS0B 1Q2CA 3R9EA 2Q04A 3PGPA 5C88A 3EXNA 4MI4A 3UY5A 1YVKA 1KZFA 4NCZA 2Z3NA 4KOYA 2VI7A 2FE7A 5JQ4A 5HMNA 2F5IA 4UCMA 3GYAA 3R9FA 2QMLA 2FSRA 2BUEA 1QSRA 2CXAA 2OZGA 2H5MA 4XPKA 4UWJA 1S7LA 2JEVA 5F46A 2B58A 4KVME 4Y49B 1YLEA 2D4PA 4KORA 4BBHA 4MY3A 2ZW4A 4AVAA 1P0HA 2O28A 2PDOA 4M85A 2YNEA 2FIWA 1Z9UA 2PR1A 3FNCA 2Z3KA 4L89A 4CGMA 3C26A 3D2MA 3JTKA 3F5BA 2YGWA 4PV6A 4R3KA 3G8WA 1XMTA 1KUVA 2NMTA 1VKCA 4QUSA 4YGOA 5KTDA 4MHDA 1M4DA 1ZO0A 4NXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EFA A;  4MBU A;  1Q2D A;  5DWM A;  4NSQ A;  2ATR A;  2BEI A;  4HNY B;  1LRZ A;  2Q4Y A;  1XIX A;  3DR6 A;  2ZXV A;  3R96 A;  1R57 A;  1K4J A;  1S5K A;  1MK4 A;  3FYN A;  4FD5 A;  2ZW6 A;  3TO7 A;  3EO4 A;  4AVC A;  5HH1 A;  1IYK A;  3GY9 A;  1L0C A;  4U9Z A;  1XF8 A;  3GKR A;  4J3G A;  4UBR A;  5H86 A;  3D2P A;  4UWI A;  4B5O A;  2B3U A;  1MJA A;  2REF A;  2FCK A;  5FVJ A;  2JDC A;  4H6Z A;  3P2F A;  3TOB A;  2ARH A;  1N71 A;  3I3G A;  3TCV A;  1TIQ A;  4CAW A;  4CRY B;  1YVO A;  2G3A A;  2VZY A;  4LX9 A;  4I49 A;  4ZBG A;  4KVX A;  4U9Y A;  3H4Q A;  4NEX A;  3KKW A;  4PK3 A;  2WPX A;  4R57 A;  5ISV A;  5JPH A;  1YK3 A;  2Q4V A;  2Z11 A;  4B5P B;  2R7H A;  3N7Z A;  3RYO A;  2JDD A;  4XNH B;  2BSW A;  2P6G A;  1Y9W A;  1S7K A;  1QSM A;  2WPW A;  5E96 A;  4AVB A;  1Y9K A;  4Y49 C;  3MGD A;  5C82 A;  3FB3 A;  1YGH A;  2HUZ A;  2OZU A;  2VXK A;  1VHS A;  2I00 A;  3G3S A;  1XEB A;  3T90 A;  4QC6 A;  2CNM A;  1M4I A;  4ONU A;  4JD6 A;  3CXS A;  2B3V A;  4EVY A;  1NMT A;  2Z10 A;  4II9 A;  1WWZ A;  2VBQ A;  3S6K A;  2JLM A;  5DWN A;  2CNT A;  3DDD A;  2VEZ A;  2EVN A;  2CNS A;  3TFY A;  3WR7 A;  4CAX A;  2A4N A;  2PR8 A;  1M4G A;  2P6E A;  3FXT A;  4IF5 A;  4QVT A;  2EUI A;  2OH1 A;  2OZH A;  2VZZ A;  4KOX A;  4RS2 A;  2GE3 A;  3FIX A;  2AE6 A;  4JXR A;  3B8G A;  3TT2 A;  1PU9 A;  2Q0Y A;  3EY5 A;  4L8A A;  2D4O A;  2IL4 A;  1S60 A;  4PSW A;  4KOV A;  2ZW7 A;  2HV2 A;  1Z4R A;  1I1D A;  1Y7R A;  3TO6 A;  1CM0 A;  2FL4 A;  3SHP A;  1UFH A;  3OWC A;  1M44 A;  4ORF A;  4FD4 A;  1IID A;  1QSN A;  2KCW A;  4AB7 A;  4B5P A;  4OAE A;  2FT0 A;  2B4D B;  5F48 A;  2R1I A;  1S3Z A;  5EBV A;  4KVO E;  4QBJ A;  1MJB A;  4K30 A;  4PSX A;  1IYL A;  4UA3 A;  4YFJ A;  4XNH C;  2I79 A;  4PK2 A;  4AG7 A;  1RXT A;  2RC4 A;  3DNS A;  2J8M A;  2J8R A;  3SXN A;  4KUA A;  3E0K A;  1RO5 A;  1YX0 A;  1I12 A;  2QIR A;  2GAN A;  3TOA A;  4R9M A;  4XPD B;  1OZP A;  3W91 A;  3I9S A;  3K9U A;  5KTA A;  1MJ9 A;  4AG9 A;  4OLL A;  4F6A A;  4MY0 A;  3CXP A;  4CAV A;  4KZT A;  2PSW A;  2R8V A;  4E2A A;  5I0C A;  4E0A A;  1SQH A;  4HKF A;  1YRE A;  3S6H A;  2B5G B;  3VWD A;  2Q7B A;  1IIC A;  1NE9 A;  1V0C A;  2G0B A;  4U5Y A;  1YR0 A;  3QB8 A;  4KOW A;  1QST A;  3TO9 A;  3SXO A;  4FD7 A;  1XE4 A;  1B87 A;  3F8K A;  2QEC A;  2ZPA A;  4HNW B;  3JUW A;  2Z0Z A;  5IV0 A;  1FY7 A;  1WK4 A;  3LOD A;  1J4J A;  5H84 A;  2K5T A;  4M3S A;  3W6X A;  3FRM A;  4JXQ A;  1KUX A;  4KOU A;  3TE4 A;  4JWP A;  3BJ7 A;  1CJW A;  4E8O A;  4JJX A;  3LD2 A;  2FIA A;  5F49 A;  3S6G A;  2FXF A;  3DR8 A;  3P2H A;  4MJ8 A;  2B4D A;  3NE7 A;  2HQY A;  2P6F A;  2FS5 A;  2OB0 A;  3VWE A;  1Q2Y A;  3IGR A;  3CXQ A;  3ZZI A;  4H89 A;  2P0W A;  3R1K A;  5J8F A;  4HNX B;  4KLW A;  3PZJ A;  2B4B A;  2C27 A;  2PQ8 A;  2GIV A;  5KTC A;  2OU2 A;  3PP9 A;  4KOT A;  4IUS A;  1BOB A;  4R3L A;  3TTH A;  4R87 A;  3V8I A;  5F47 A;  5IB0 A;  1Z4E A;  3D3S A;  4XPD C;  4QB9 A;  4KUB A;  3W6S A;  1ON0 A;  4RI1 A;  2B5G A;  2VQY A;  4H6U A;  1P4N A;  4KOS A;  4DNC A;  5EC4 A;  2G3T A;  2R98 A;  3DSB A;  4OAD A;  3BJ8 A;  1IB1 E;  4F0Y A;  3ZJ0 A;  3EC4 A;  4BMH A;  5CNP A;  3R95 A;  4FD6 A;  2X7B A;  1PUA A;  3T9Y A;  5IX3 A;  2Q44 A;  1M1D A;  1BO4 A;  4JLY A;  4NF1 A;  1QSO A;  2CY2 A;  4GS4 A;  4LUA A;  4KLV A;  3F0A A;  2Y0M A;  3JVN A;  2J8N A;  4X5K A;  3S6F A;  5J8C A;  3IWG A;  2PRB A;  1NSL A;  4CRZ B;  2REE A;  1I21 A;  1S7N A;  3D8P A;  4YRH A;  2BL1 A;  3BLN A;  1U6M A;  2DXQ A;  2AJ6 A;  3FBU A;  2ZW5 A;  5GCN A;  3R9G A;  1GHE A;  2PC1 A;  1KUY A;  1S7F A;  3QAH A;  4XPL A;  1B6B A;  4CS0 B;  1Q2C A;  3R9E A;  2Q04 A;  3PGP A;  5C88 A;  3EXN A;  4MI4 A;  3UY5 A;  1YVK A;  1KZF A;  4NCZ A;  4KOY A;  2VI7 A;  2FE7 A;  5JQ4 A;  5HMN A;  2F5I A;  3GYA A;  3R9F A;  2QML A;  2FSR A;  2BUE A;  1QSR A;  2OZG A;  2H5M A;  4XPK A;  4UWJ A;  1S7L A;  2JEV A;  5F46 A;  2B58 A;  4KVM E;  4Y49 B;  1YLE A;  2D4P A;  4KOR A;  4MY3 A;  2ZW4 A;  4AVA A;  1P0H A;  2O28 A;  2PDO A;  4M85 A;  2FIW A;  1Z9U A;  2PR1 A;  3FNC A;  4L89 A;  3C26 A;  3D2M A;  3F5B A;  4PV6 A;  4R3K A;  3G8W A;  1XMT A;  1KUV A;  2NMT A;  1VKC A;  4QUS A;  4YGO A;  5KTD A;  4MHD A;  1M4D A;  4NXY A; 
#chains in the Genus database with same CATH topology
 3EFA A;  4MBU A;  1NSA A;  1Q2D A;  5DWM A;  4H2K A;  2G9D A;  4UEF A;  2ABZ A;  4NSQ A;  5THW A;  2ATR A;  2BEI A;  4HNY B;  4KSI A;  2GU2 A;  4DJL A;  2QJ8 A;  3IU1 A;  1LRZ A;  4NGT A;  2Q4Y A;  3RNZ A;  1XIX A;  3DR6 A;  2ZXV A;  3R96 A;  1R57 A;  1K4J A;  1S5K A;  1MK4 A;  3FEC A;  3FYN A;  2ZW6 A;  4FD5 A;  3TO7 A;  3EO4 A;  4OC0 A;  4AVC A;  1LFW A;  5HH1 A;  1IYK A;  3KZW A;  3GB0 A;  3B3C A;  4F0X A;  3GY9 A;  5K8M A;  1XFO A;  1L0C A;  4PXE A;  2BO9 A;  4U9Z A;  4B10 A;  1XF8 A;  3CT9 A;  3GKR A;  4J3G A;  4UBR A;  5H86 A;  2Z3M A;  3D2P A;  4UWI A;  4B5O A;  2B3U A;  2PJ9 A;  1MJA A;  2REF A;  4M6G A;  2QVP A;  4MXU A;  2FCK A;  5FVJ A;  1PYT B;  2JDC A;  1EE3 P;  2PJ3 A;  4H6Z A;  4A39 A;  2FVG A;  4C2X A;  3P2F A;  1ARL A;  3TOB A;  4F9V A;  5IB9 A;  1Z8T A;  3ISZ A;  3NH8 A;  2ARH A;  1LAP A;  2PJ1 A;  4R6T A;  1N71 A;  2ZOF A;  3I3G A;  2V8H A;  4NGS A;  3TCV A;  1TIQ A;  3H8G A;  3I1U A;  4CAW A;  4CRY B;  1YVO A;  2G3A A;  2V77 A;  2VZY A;  4LX9 A;  1HEE A;  1PCA A;  3FEE A;  4A30 A;  4I49 A;  3GUX A;  4ZBG A;  4KVX A;  4EME A;  1LOK A;  2YNC A;  4U9Y A;  3H4Q A;  3RZA A;  4Q36 A;  1XRY A;  2AFO A;  5BWA B;  1ZG9 A;  4NEX A;  5LYL A;  2Q51 A;  3KKW A;  4OC5 A;  4BD9 A;  3N5F A;  3FX6 A;  4PK3 A;  3MN8 A;  3WC7 A;  2OR4 A;  2PVV A;  2WPX A;  4NGQ A;  4R57 A;  3WT4 A;  4CYP A;  5JPH A;  1YK3 A;  5ISV A;  4CGP A;  2YNC C;  5D29 A;  3VAR A;  2Q4V A;  5HVF A;  5G20 A;  2Z11 A;  2GRE A;  3B3V A;  4B5P B;  4C7I A;  2R7H A;  3N7Z A;  3RYO A;  4A32 A;  2JDD A;  1R43 A;  2BSW A;  2P6G A;  4XNH B;  1Y9W A;  1S7K A;  4B14 A;  4CGO A;  3PB6 X;  5CBM A;  1QSM A;  2WPW A;  1AYE A;  5E96 A;  4AVB A;  5HXD A;  1Y9K A;  4Y49 C;  5G22 A;  3KI9 A;  3PB7 X;  3MGD A;  5C82 A;  1F57 A;  2C6P A;  4A94 A;  2ZOG A;  3FB3 A;  1YGH A;  2HUZ A;  2OZU A;  2PJ5 A;  2VXK A;  3L2N A;  3PBE A;  3SJE A;  2Q7S A;  1X10 A;  1VHS A;  4ZY0 A;  2I00 A;  4NGR A;  1ZG7 A;  5LYD A;  2QYV A;  2Q43 A;  3T8W A;  3G3S A;  1XEB A;  2PIZ A;  2V8G A;  3T90 A;  4QC6 A;  3CPX A;  4NFR A;  2CNM A;  1M4I A;  2PIY A;  3DGV A;  4JD6 A;  4ONU A;  3CXS A;  2B3V A;  3TX8 A;  4EVY A;  1NMT A;  3PFE A;  2Z10 A;  2CIJ A;  4KSA A;  4II9 A;  1YW4 A;  1WWZ A;  2WSA A;  3K2K A;  4O23 A;  4W9Y A;  4MCP A;  4AXV A;  2VBQ A;  2ZEP A;  3A9L A;  3S6K A;  2JLM A;  5DWN A;  2CNT A;  2V8D A;  3DDD A;  4A95 A;  2VEZ A;  2ZED A;  2EVN A;  2PJ7 A;  5CPA A;  1YLO A;  2HC9 A;  4MFP A;  2CNS A;  2O53 A;  2AFU A;  3TFY A;  3WR7 A;  4CAX A;  2A4N A;  1TKH A;  2PR8 A;  3RO0 A;  4CAF A;  1M4G A;  1YQE A;  2P6E A;  1Z8W A;  3FXT A;  3PEI A;  2EUI A;  2OH1 A;  2OZH A;  4IF5 A;  4QVT A;  4TWE A;  2VZZ A;  3FED A;  2IMO A;  4KOX A;  4RS2 A;  2GE3 A;  3FIX A;  2AE6 A;  4JXR A;  3B8G A;  4RUH A;  3TT2 A;  4P4B A;  1PU9 A;  4M6I A;  2CF4 A;  2Q0Y A;  3EY5 A;  2CTB A;  2D4O A;  4L8A A;  4B12 A;  4FWU A;  4EFD A;  5A27 A;  4UFX A;  1DE4 C;  1LAN A;  2IL4 A;  1S60 A;  4PSW A;  4KOV A;  2ZW7 A;  3KR4 A;  2HV2 A;  1IY7 A;  1I1D A;  1Z4R A;  1Y7R A;  4MHP A;  5D8N A;  3D66 A;  3TO6 A;  2PJ4 A;  1A2Z A;  1Z8X A;  1CM0 A;  5F09 A;  2ODF A;  2XEG A;  2RB7 A;  4OP4 A;  3IWW A;  3KGQ A;  2FL4 A;  3SHP A;  5AG7 A;  1UFH A;  4CGL A;  2Z3P A;  3OWC A;  1M44 A;  4ORF A;  4MCQ A;  3BXM A;  4FUU A;  3BHX A;  4FD4 A;  1IID A;  3BI0 A;  1QSN A;  4MHN A;  2EWB A;  6CPA A;  2KCW A;  1IOI A;  2ANP A;  4AB7 A;  1CX8 A;  4B6Z A;  4B5P A;  4OAE A;  2FT0 A;  2B4D B;  2GFQ A;  4DYO A;  1R3N A;  5F48 A;  2R1I A;  2OOT A;  1IOF A;  4MCR A;  2GLF A;  1S3Z A;  5EBV A;  4KVO E;  1VGY A;  2DEA A;  4UEE A;  5ELY A;  4QBJ A;  5AG4 A;  4ZYQ A;  1F2O A;  1MJB A;  4K30 A;  4PSX A;  4MHY A;  1IYL A;  3WAB A;  3JRU A;  4UA3 A;  5HVH A;  4YFJ A;  3PFO A;  4GM5 A;  4XNH C;  3V38 A;  4OID A;  4A38 A;  4DUK A;  2I79 A;  4F9U A;  3FJU A;  4PK2 A;  4B11 A;  2Z3L A;  2WUU A;  4AG7 A;  4GXH A;  1RXT A;  2RC4 A;  3DNS A;  2J8M A;  1VIX A;  4KS9 A;  2J8R A;  1UWY A;  3PB8 X;  3SXN A;  4UF4 A;  4KUA A;  2J9A A;  4MCS A;  3E0K A;  4A33 A;  3IEH A;  1X12 A;  1RO5 A;  1YX0 A;  1I12 A;  2QIR A;  4Q7A A;  2GAN A;  4P45 A;  2BOA A;  4UIA A;  3IU2 A;  3TOA A;  4R9M A;  2YND A;  4XPD B;  1OZP A;  3W91 A;  2WZN A;  1Z8L A;  3I9S A;  1IGB A;  4P4E A;  2AFX A;  3NH4 A;  3K9U A;  5KTA A;  3B3S A;  1MJ9 A;  4PXB A;  4AG9 A;  1BLL E;  2JBK A;  4OLL A;  4MY0 A;  4F6A A;  5JH9 A;  3CXP A;  4UCN A;  4KZT A;  4CAV A;  1CG2 A;  2PSW A;  2R8V A;  2VL1 A;  4E2A A;  4E0A A;  1SQH A;  2ZEO A;  3D68 A;  5I0C A;  1XBU A;  4ZX9 A;  4HKF A;  1YRE A;  4WJB A;  3S6H A;  2B5G B;  2XEI A;  3PB9 X;  3VWD A;  1JQG A;  4JYW A;  2Q7B A;  4UIB A;  4PXC A;  5AG6 A;  5HVG A;  1IIC A;  1NE9 A;  4OME A;  1V0C A;  4MFL A;  4R76 A;  2G0B A;  4U5Y A;  1YR0 A;  3B2Y A;  3QB8 A;  2EBJ A;  2DF5 A;  2PJ6 A;  4KOW A;  4ONW A;  4X3R A;  4C7H A;  1QST A;  2DPS A;  3TO9 A;  4CYQ A;  2JEW A;  2ZEE A;  3SXO A;  4FD7 A;  1XE4 A;  1B87 A;  4C2Y A;  5JGF A;  3F8K A;  2QEC A;  2ZPA A;  4HNW B;  3JUW A;  1ZG8 A;  4ZY1 A;  2Z0Z A;  4FBE A;  1TF9 A;  3H5Z A;  5IV0 A;  1FY7 A;  1FT7 A;  4P4J A;  4R8F A;  4UEZ A;  4OKO A;  1WK4 A;  3LOD A;  1J4J A;  5H84 A;  4PXD A;  1TXR A;  2K5T A;  4M3S A;  3CPA A;  2IQ6 A;  3FVL A;  2HB6 A;  3W6X A;  5LRJ A;  4C68 A;  3FRM A;  4JXQ A;  4OC3 A;  2PJ0 A;  1KUX A;  4KOU A;  4P4I A;  3TE4 A;  4OC1 A;  4JWP A;  4CYO A;  1LCP A;  2Q4Z A;  3D7G A;  3IFE A;  3BJ7 A;  3FH4 A;  4NGN A;  4F8Z A;  3LWU A;  2PCU A;  1CJW A;  4A37 A;  4E8O A;  4YU9 A;  1HDU A;  3IIB A;  4JJX A;  4A2Z A;  3LD2 A;  5K8N A;  2FIA A;  3B7I A;  5F49 A;  5LYF A;  3S6G A;  1CPX A;  2EK9 A;  2FXF A;  3DR8 A;  1QMU A;  3P2H A;  3RAM A;  3QNV A;  5G21 A;  3SJF A;  1FNO A;  2AFZ A;  2JBJ A;  3KQZ A;  2B4D A;  4MJ8 A;  2WYR A;  3GLJ A;  2C6G A;  3NE7 A;  2PJ2 A;  1AUG A;  1YW6 A;  2HQY A;  2P6F A;  1XJO A;  2FS5 A;  2ZEM A;  3CZX A;  3KHZ A;  1F2P A;  3NA6 A;  2OB0 A;  3VWE A;  1Q2Y A;  2ZEG A;  4UFV A;  3IGR A;  3CXQ A;  3ZZI A;  1XMB A;  2XEJ A;  5LYI A;  7CPA A;  1YME A;  2ZEL A;  4H89 A;  3S9L A;  3GIU A;  4C2Z A;  4P44 A;  3NFZ A;  2P0W A;  2IJZ A;  3R1K A;  5J8F A;  2AFW A;  4HNX B;  4IHM A;  4B13 A;  1HDQ A;  5DS0 A;  4MFK A;  4KLW A;  3PZJ A;  2B4B A;  2C27 A;  5AGE A;  2PQ8 A;  2GIV A;  5KTC A;  1RTQ A;  4MFZ A;  2OU2 A;  1BPN A;  3QAY A;  3PP9 A;  2I3C A;  1Z5R A;  4KOT A;  4IUS A;  1BOB A;  4CGN A;  1Y0Y A;  4R3L A;  2POK A;  1CBX A;  3NE8 A;  4R87 A;  3TTH A;  3SI1 A;  3V8I A;  5LRK A;  1DTD A;  1XOV A;  3D67 A;  5F47 A;  5IB0 A;  4CAE A;  4OC4 A;  1Z4E A;  3D3S A;  4UFW A;  2CTC A;  4XPD C;  3SI0 A;  4QB9 A;  3PBB A;  3SJG A;  1VHE A;  4G1P A;  5AG5 A;  4NGP A;  2PVW A;  2ZEH A;  5JM6 A;  2PJC A;  4KUB A;  1ON0 A;  4RI1 A;  3W6S A;  3B35 A;  2B5G A;  4UCP A;  2VQY A;  4MHZ A;  4H6U A;  1P4N A;  4KOS A;  4TNU A;  3VAT A;  2PE3 A;  4NJR A;  1CPS A;  4DNC A;  5EC4 A;  2G3T A;  2R98 A;  1TF8 A;  3DSB A;  3VH9 A;  4OAD A;  2Z3O A;  3BJ8 A;  1IB1 E;  2BCO A;  4F0Y A;  3IO1 A;  3SJX A;  3ZJ0 A;  3D7F A;  3EC4 A;  3KHX A;  2V8V A;  2C1C A;  4BMH A;  5CNP A;  3R95 A;  1Y0R A;  2ZEF A;  2DPT A;  3KL9 A;  4FD6 A;  4KSF A;  4MRI A;  4ZGY B;  4X8I A;  3D7D A;  4OC2 A;  2X7B A;  3IJ3 A;  4K3N A;  1H8L A;  1PUA A;  3PRT A;  3T9Y A;  5IX3 A;  2Q44 A;  1M1D A;  4MFJ A;  5LRG A;  1KWM A;  1BO4 A;  4ZI6 A;  1ARM A;  4JLY A;  4Q38 A;  3CDX A;  3LAC A;  1QSO A;  2CY2 A;  2O4H A;  4NF1 A;  4GS4 A;  4LUA A;  4KLV A;  1IU8 A;  2Y0M A;  3F0A A;  3S9M A;  1CP7 A;  5G1Z A;  1AMP A;  1Q7L A;  2XEF A;  3JVN A;  3SI2 A;  2J8N A;  2NSM A;  4PQA A;  4CPA A;  3FMC A;  4X5K A;  4HPS A;  3S6F A;  3LMS A;  1Y7E A;  5J8C A;  3IWG A;  2PRB A;  2ZEN A;  3FF3 A;  4LQ6 A;  4MFQ A;  1NSL A;  2F8H A;  3HLP A;  2REE A;  4CRZ B;  1I21 A;  4ZX8 A;  1M4L A;  4CYN A;  1S7N A;  3D8P A;  4EWT A;  4IAV A;  4YRH A;  3IWE A;  1LAM A;  3RBU A;  3B3W A;  1ZLI A;  2BL1 A;  2PRQ A;  3BLN A;  5K8O A;  1QQ9 A;  4R7M A;  4JZ0 A;  1U6M A;  2DXQ A;  2AJ6 A;  1CP6 A;  3FBU A;  2ZW5 A;  3ISX A;  5GCN A;  3R9G A;  1GHE A;  1ZLH A;  2PC1 A;  3K9T A;  1KUY A;  2PJB A;  1S7F A;  3QAH A;  2PJA A;  4A31 A;  4XPL A;  1B6B A;  5A28 A;  4BIN A;  4CS0 B;  1Q2C A;  3R9E A;  2Q04 A;  3PGP A;  4OIW A;  3BI1 A;  5C88 A;  3EXN A;  4MI4 A;  4P6Y A;  1YVK A;  1KZF A;  4NCZ A;  3UY5 A;  5J1Q A;  2Z3N A;  4KOY A;  2F7V A;  4Z65 A;  2AFM A;  4YWY A;  1YSJ A;  2RFH A;  2VI7 A;  3V7Z A;  1BPM A;  1TKJ A;  8CPA A;  2FE7 A;  4PPZ A;  1VHO A;  5JQ4 A;  3TC8 A;  5HMN A;  3HUV A;  2F5I A;  4UCM A;  4NJQ A;  3D7H A;  3NH5 A;  3GYA A;  3R9F A;  2QML A;  2FSR A;  3PB4 X;  4P10 A;  2BUE A;  1QSR A;  2CXA A;  2OZG A;  2H5M A;  3D4U A;  3H8E A;  2EO8 A;  3B3T A;  4XPK A;  4UWJ A;  1S7L A;  2JEV A;  5F46 A;  2B58 A;  3IC1 A;  3DLJ A;  4KVM E;  1TKF A;  4Y49 B;  2EK8 A;  1YLE A;  4IK2 A;  2D4P A;  4KOR A;  4BBH A;  4MY3 A;  4NGM A;  2ZW4 A;  4P4F A;  5K8P A;  1OBR A;  3WC5 A;  1P0H A;  3WC6 A;  4X2T A;  4AVA A;  2O28 A;  1GYT A;  1JWQ A;  2PDO A;  4M85 A;  1Z2L A;  2YNE A;  1ELL P;  5EMI A;  2FIW A;  1Z9U A;  2PR1 A;  3FNC A;  2Z3K A;  3KQX A;  4L89 A;  4CGM A;  3C26 A;  3D2M A;  3JTK A;  3F5B A;  4FAI A;  1BAV A;  2YGW A;  4PV6 A;  3KAS A;  4P4D A;  3G8W A;  4R3K A;  2C6C A;  2AFS A;  5I4M A;  1XMT A;  4ZY2 A;  1KUV A;  2NMT A;  1VKC A;  3MRU A;  4MMO A;  4QUS A;  4YGO A;  5KTD A;  2GLJ A;  4MHD A;  4WWV A;  1ELM P;  4M6H A;  1M4D A;  3S9N A;  4RN7 A;  4LQG A;  1ZO0 A;  3KR5 A;  2PJ8 A;  3H8F A;  4NXY A;  2NYQ A; 
#chains in the Genus database with same CATH homology
 3EFA A;  4MBU A;  1Q2D A;  5DWM A;  4NSQ A;  2ATR A;  2BEI A;  4HNY B;  3IU1 A;  1LRZ A;  2Q4Y A;  1XIX A;  3DR6 A;  2ZXV A;  3R96 A;  1R57 A;  1K4J A;  1S5K A;  1MK4 A;  3FYN A;  4FD5 A;  2ZW6 A;  3TO7 A;  4B11 A;  3EO4 A;  4AVC A;  5HH1 A;  1IYK A;  4F0X A;  3GY9 A;  1L0C A;  4U9Z A;  4B10 A;  1XF8 A;  3GKR A;  4J3G A;  4UBR A;  5H86 A;  2Z3M A;  3D2P A;  4UWI A;  4B5O A;  2B3U A;  1MJA A;  2REF A;  2FCK A;  5FVJ A;  2JDC A;  4H6Z A;  4C2X A;  3P2F A;  3TOB A;  2ARH A;  1N71 A;  3I3G A;  3TCV A;  1TIQ A;  4CAW A;  4CRY B;  1YVO A;  2G3A A;  2VZY A;  4LX9 A;  4A30 A;  4I49 A;  4ZBG A;  4KVX A;  2YNC A;  4U9Y A;  3H4Q A;  4Q36 A;  5BWA B;  4NEX A;  3KKW A;  4PK3 A;  2WPX A;  4R57 A;  5ISV A;  4CYP A;  5JPH A;  1YK3 A;  4CGP A;  2YNC C;  2Q4V A;  5G20 A;  2Z11 A;  4B5P B;  4C7I A;  2R7H A;  3N7Z A;  3RYO A;  4A32 A;  2JDD A;  4XNH B;  2BSW A;  2P6G A;  1Y9W A;  1S7K A;  4B14 A;  4CGO A;  1QSM A;  2WPW A;  5E96 A;  4AVB A;  1Y9K A;  4Y49 C;  5G22 A;  3MGD A;  5C82 A;  3FB3 A;  1YGH A;  2HUZ A;  2OZU A;  2VXK A;  1VHS A;  2I00 A;  3G3S A;  1XEB A;  3T90 A;  4QC6 A;  2CNM A;  1M4I A;  4ONU A;  4JD6 A;  3CXS A;  2B3V A;  4EVY A;  1NMT A;  2Z10 A;  4KSA A;  4II9 A;  1WWZ A;  2WSA A;  2VBQ A;  3A9L A;  3S6K A;  2JLM A;  5DWN A;  2CNT A;  3DDD A;  4A95 A;  2VEZ A;  2EVN A;  4MFP A;  2CNS A;  3TFY A;  3WR7 A;  4CAX A;  2A4N A;  2PR8 A;  4CAF A;  1M4G A;  2P6E A;  3FXT A;  4IF5 A;  4QVT A;  2EUI A;  2OH1 A;  2OZH A;  2VZZ A;  4KOX A;  4RS2 A;  2GE3 A;  3FIX A;  2AE6 A;  4JXR A;  3B8G A;  3TT2 A;  1PU9 A;  2Q0Y A;  3EY5 A;  4L8A A;  2D4O A;  4B12 A;  5A27 A;  2IL4 A;  1S60 A;  4PSW A;  4KOV A;  2ZW7 A;  2HV2 A;  1Z4R A;  1I1D A;  1Y7R A;  3TO6 A;  1CM0 A;  2FL4 A;  3SHP A;  5AG7 A;  1UFH A;  4CGL A;  2Z3P A;  3OWC A;  1M44 A;  4ORF A;  4FD4 A;  1IID A;  1QSN A;  2KCW A;  4AB7 A;  4B5P A;  4OAE A;  2FT0 A;  2B4D B;  5F48 A;  2R1I A;  1S3Z A;  5EBV A;  4KVO E;  4QBJ A;  5AG4 A;  1MJB A;  4K30 A;  4PSX A;  1IYL A;  4UA3 A;  4YFJ A;  4XNH C;  2I79 A;  4PK2 A;  2Z3L A;  2WUU A;  4AG7 A;  1RXT A;  2RC4 A;  3DNS A;  2J8M A;  4KS9 A;  2J8R A;  3SXN A;  4KUA A;  4A33 A;  3E0K A;  1RO5 A;  1YX0 A;  1I12 A;  2QIR A;  2GAN A;  3TOA A;  3IU2 A;  4R9M A;  2YND A;  4XPD B;  1OZP A;  3W91 A;  3I9S A;  3K9U A;  5KTA A;  1MJ9 A;  4AG9 A;  4OLL A;  4F6A A;  4MY0 A;  3CXP A;  4UCN A;  4KZT A;  4CAV A;  2PSW A;  2R8V A;  4E2A A;  5I0C A;  4E0A A;  1SQH A;  4HKF A;  1YRE A;  3S6H A;  2B5G B;  3VWD A;  2Q7B A;  5AG6 A;  1IIC A;  1NE9 A;  1V0C A;  4MFL A;  2G0B A;  4U5Y A;  1YR0 A;  3QB8 A;  4KOW A;  4CYQ A;  4C7H A;  1QST A;  2DPS A;  3TO9 A;  3SXO A;  4FD7 A;  1XE4 A;  1B87 A;  4C2Y A;  3F8K A;  2QEC A;  2ZPA A;  4HNW B;  3JUW A;  2Z0Z A;  3H5Z A;  5IV0 A;  1FY7 A;  1WK4 A;  3LOD A;  1J4J A;  5H84 A;  2K5T A;  4M3S A;  3W6X A;  4C68 A;  3FRM A;  4JXQ A;  1KUX A;  4KOU A;  3TE4 A;  4JWP A;  4CYO A;  3BJ7 A;  1CJW A;  4E8O A;  4JJX A;  4A2Z A;  3LD2 A;  2FIA A;  5F49 A;  3S6G A;  2FXF A;  3DR8 A;  3P2H A;  5G21 A;  4MJ8 A;  2B4D A;  3NE7 A;  4UFX A;  2HQY A;  2P6F A;  2FS5 A;  2OB0 A;  3VWE A;  1Q2Y A;  4UFV A;  3IGR A;  3CXQ A;  3ZZI A;  4H89 A;  4C2Z A;  2P0W A;  3R1K A;  5J8F A;  4HNX B;  4B13 A;  4MFK A;  4KLW A;  3PZJ A;  2B4B A;  2C27 A;  5AGE A;  2PQ8 A;  2GIV A;  5KTC A;  4MFZ A;  2OU2 A;  3PP9 A;  4KOT A;  4IUS A;  1BOB A;  4CGN A;  4R3L A;  3TTH A;  4R87 A;  3V8I A;  5F47 A;  5IB0 A;  4CAE A;  1Z4E A;  3D3S A;  4UFW A;  4XPD C;  4QB9 A;  5AG5 A;  4KUB A;  3W6S A;  1ON0 A;  4RI1 A;  2B5G A;  4UCP A;  2VQY A;  4H6U A;  1P4N A;  4KOS A;  4DNC A;  5EC4 A;  2G3T A;  2R98 A;  3DSB A;  4OAD A;  2Z3O A;  3BJ8 A;  1IB1 E;  4F0Y A;  3ZJ0 A;  3EC4 A;  4BMH A;  5CNP A;  3R95 A;  4FD6 A;  4KSF A;  2DPT A;  4ZGY B;  2X7B A;  1PUA A;  3T9Y A;  5IX3 A;  2Q44 A;  1M1D A;  4MFJ A;  1BO4 A;  4JLY A;  4Q38 A;  4NF1 A;  1QSO A;  2CY2 A;  4GS4 A;  4LUA A;  4KLV A;  3F0A A;  2Y0M A;  5G1Z A;  3JVN A;  2J8N A;  4X5K A;  3S6F A;  5J8C A;  3IWG A;  2PRB A;  4MFQ A;  1NSL A;  4CRZ B;  2REE A;  1I21 A;  4CYN A;  1S7N A;  3D8P A;  4YRH A;  3IWE A;  2BL1 A;  3BLN A;  1U6M A;  2DXQ A;  2AJ6 A;  3FBU A;  2ZW5 A;  5GCN A;  3R9G A;  1GHE A;  2PC1 A;  1KUY A;  1S7F A;  3QAH A;  4A31 A;  5A28 A;  4XPL A;  1B6B A;  4CS0 B;  1Q2C A;  3R9E A;  2Q04 A;  3PGP A;  5C88 A;  3EXN A;  4MI4 A;  3UY5 A;  1YVK A;  1KZF A;  4NCZ A;  2Z3N A;  4KOY A;  2VI7 A;  2FE7 A;  5JQ4 A;  5HMN A;  2F5I A;  4UCM A;  3GYA A;  3R9F A;  2QML A;  2FSR A;  2BUE A;  1QSR A;  2CXA A;  2OZG A;  2H5M A;  4XPK A;  4UWJ A;  1S7L A;  2JEV A;  5F46 A;  2B58 A;  4KVM E;  4Y49 B;  1YLE A;  2D4P A;  4KOR A;  4BBH A;  4MY3 A;  2ZW4 A;  4AVA A;  1P0H A;  2O28 A;  2PDO A;  4M85 A;  2YNE A;  2FIW A;  1Z9U A;  2PR1 A;  3FNC A;  2Z3K A;  4L89 A;  4CGM A;  3C26 A;  3D2M A;  3JTK A;  3F5B A;  2YGW A;  4PV6 A;  4R3K A;  3G8W A;  1XMT A;  1KUV A;  2NMT A;  1VKC A;  4QUS A;  4YGO A;  5KTD A;  4MHD A;  1M4D A;  1ZO0 A;  4NXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...