1H8LA

Duck carboxypeptidase d domain ii in complex with gemsa
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
380
structure length
380
Chain Sequence
QAVQPVDFRHHHFSDMEIFLRRYANEYPSITRLYSVGKSVELRELYVMEISDNPGIHEAGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVQSTRIHIMPSMNPDGYEKSQEGDRGGTVGRNNSNNYDLNRNFPDQFFQVTDPPQPETLAVMSWLKTYPFVLSANLHGGSLVVNYPFDDDEQGIAIYSKSPDDAVFQQLALSYSKENKKMYQGSPCKDLYPTEYFPHGITNGAQWYNVPGGMQDWNYLNTNCFEVTIELGCVKYPKAEELPKYWEQNRRSLLQFIKQVHRGIWGFVLDATDGRGILNATISVADINHPVTTYKDGDYWRLLVQGTYKVTASARGYDPVTKTVEVDSKGGVQVNFTLSRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the inhibitor-complexed carboxypeptidase D domain II and the modeling of regulatory carboxypeptidases.
pubmed doi rcsb
source organism Lophonetta specularioides
molecule tags Carboxypeptidase
molecule keywords CARBOXYPEPTIDASE GP180 RESIDUES 503-882
total genus 132
structure length 380
sequence length 380
ec nomenclature ec 3.4.17.22: Metallocarboxypeptidase D.
pdb deposition date 2001-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 1h8lA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1h8lA01
3KZWA 2F7VA 4NFRA 3PB7X 2AFSA 4UIAA 4U3SB 3S9NA 2C1CA 4ZY0A 2PJ8A 3H8EA 4X3RA 4DJLA 3IO1A 1VHEA 4W9YA 5HVFA 4FL4C 3FX6A 2I3CA 3PB8X 3H8GA 4B6ZA 4CPAA 1BPNA 3CDXA 4OC0A 4X8IA 1FNOA 2ABZA 2ZEHA 2EK9A 3PFEA 3VH9A 5G5DB 5IB9A 5K8MA 4MCSA 2VL1A 1VHOA 5HVHA 2PJ2A 3WABA 3KR5A 4OC2A 4EIUA 2AFOA 3PB6X 1DE4C 3V38A 4P4EA 2WYRA 2PIZA 1HDQA 1Y0YA 2V8DA 4UF4A 2PJ5A 4MMOA 1CX8A 2ZEEA 2ZEPA 1Z2LA 1PCAA 4A39A 3B3SA 3FF3A 1VGYA 2IMOA 2XEJA 2XEGA 3CT9A 2PJ4A 4MCRA 3B7IA 2PJ3A 4PXEA 1NKGA 4YOKA 5F09A 1CBXA 8CPAA 3SJEA 1Z8LA 2HC9A 3VATA 1YLOA 2PVVA 4G1PA 4TWEA 1TKHA 1AYEA 5JH9A 4YU9A 2QJ8A 4OC1A 3K2KA 4NJQA 2GREA 2GU2A 3KQZA 3FEEA 2PJAA 4NGQA 1KWMA 2V8GA 5K8NA 4FXTA 3GB0A 3SJXA 1ZG7A 1M4LA 4UEFA 4OC3A 4OC5A 3TX8A 3K9TA 4ONWA 1XJOA 2ZEFA 3PB4X 1BLLE 2AFMA 2JBKA 1TXRA 1TKFA 7CPAA 2V8VA 4WI0B 2EWBA 1HEEA 1TF9A 3D7DA 2CTBA 1NSAA 1FT7A 2PJ9A 3RZAA 2PJCA 5DS0A 2RFHA 3RAMA 3FJUA 4OKOA 1JQGA 4DYOA 1F2PA 4WWVA 4NGPA 2V77A 3H8FA 2JBJA 4DUKA 3NFZA 3IC1A 3B2YA 2AFWA 3BI0A 2O53A 3IWWA 1TF8A 2PJ1A 3KHZA 3PBBA 3S9LA 2QYVA 2JEWA 2BOAA 4FUUA 4NJRA 4MHNA 3ISXA 4BD9A 1CPSA 3KI9A 2Q51A 3ISZA 4R76A 3HN5A 3FH4A 3KR4A 2PJ7A 2C6CA 3BI1A 3GUXA 3CPXA 4NGNA 2QVPA 3HLPA 3SJGA 4ZI6A 1ZLHA 2ZENA 3KL9A 2DEAA 3NH4A 1XRYA 3IEHA 3LWUA 2PJ0A 2PJ6A 4R6TA 3B35A 4LQGA 4Q7AA 4A37A 4UIBA 3JRUA 4OIWA 3SI0A 1CPXA 4ZYQA 4IAVA 2CTCA 4EMEA 1QQ9A 1GYTA 3PEIA 4OP4A 3NA6A 3NH5A 1UWYA 2G9DA 3IFEA 1ZLIA 3L2NA 4MCQA 2O4HA 3KGQA 5K39B 1EE3P 3G3LA 1IGBA 1F57A 2Q43A 5LYIA 4IK2A 5JM6A 4P4IA 1BPMA 2OR4A 4AXVA 4NGMA 3DGVA 3D7HA 4KSIA 4P44A 4MXUA 2ZOGA 2ZEDA 3TC8A 1ZG8A 3WC5A 1YW4A 2ZELA 4P4BA 4MRIA 1LFWA 3D68A 1LCPA 2PCUA 2PJBA 4GM5A 1ELMP 2C6GA 1RTQA 3FMCA 1Y0RA 3BXMA 4UEZA 5HVGA 3GLJA 4A94A 2NYQA 1CP6A 5I4MA 2FVGA 4F9UA 5J1QA 2IJZA 4WJBA 1XMBA 4JZ0A 5ELYA 1BAVA 1ZG9A 4YWYA 4P45A 3B3CA 2J9AA 4PXDA 2BO9A 5LYLA 1OBRA 4RUHA 5D29A 4NGRA 3LMSA 4FAIA 3MN8A 2GLJA 5D8NA 2ANPA 4PPZA 1ARLA 3E8VA 2PVWA 5K8OA 3CPAA 1H8LA 1ARMA 1LANA 4PXBA 4OIDA 3HUVA 4TNUA 3PFOA 4R8FA 1Q7LA 5LRJA 3QNVA 5CBMA 1R43A 3D4UA 3WT4A 3I1UA 2PIYA 1CP7A 4IHMA 1AMPA 1DTDA 1CG2A 2IQ6A 4P4DA 4MHZA 3RBUA 5JGFA 2NSMA 5CPAA 3BHXA 1LOKA 2BCOA 5HXDA 4NGTA 3KQXA 3T8WA 2CIJA 3FEDA 3NH8A 4PQAA 4R7MA 1ELLP 4K3NA 4MCPA 3NJVA 4P10A 2HB6A 3KHXA 4IYKA 3V7ZA 2B59B 4EWTA 2OOTA 2AFZA 2AFXA 1IY7A 1F2OA 2F8HA 3D7GA 2CF4A 4FWUA 4NGSA 4P4JA 2RB7A 3KCPA 2C6PA 2ZOFA 3B3WA 3FVLA 4Z65A 2XEIA 2PE3A 4ZX8A 2WZNA 1HDUA 3D7FA 4OMEA 3WC6A 1XFOA 4MHYA 2V8HA 5AQ0A 1YMEA 5LYDA 1Z5RA 4JYWA 1YW6A 2ZEOA 3KASA 4ZX9A 4ZY2A 2GLFA 3B3VA 3PRTA 3NJXA 4EFDA 4P6YA 4UEEA 2AFUA 1XBUA 1YSJA 2Q4ZA 3SI2A 4FBEA 3SI1A 3MRUA 4A38A 2XEFA 3FECA 2ZEMA 3B3TA 1Y7EA 5LYFA 3D66A 1TKJA 1PYTB 2ZEGA 3DLJA 4PXCA 3S9MA 2EK8A 4ZY1A 4OC4A 4F8ZA 4O23A 4F9VA 4H2KA 3IJ3A 5LRGA 4MHPA 1QMUA 2PRQA 1LAMA 5THWA 2POKA 3SJFA 3WC7A 1VIXA 6CPAA 4X2TA 1R3NA 4P4FA 3VARA 3D67A 3N5FA 3PB9X 2XHNA 3PBEA 5K8PA 1LAPA 3IIBA 5LRKA
chains in the Genus database with same CATH superfamily
1F8TL 3N1MC 1EAQA 1KELH 3HE7C 4UILL 3D48R 1H9DA 1FWXA 3FTWA 4X6CE 1TDQA 1U8OB 1RMFH 1I21A 2VQ1A 1G7LA 5AUMA 1GW6A 3ARQA 2CCVA 5ENWB 4ZPVA 4DOHE 2J88L 3U1SH 1AOZA 3AXHA 4U9ZA 3FT3B 4JANA 2BOBB 2B08A 4OJAA 5FW6A 3NZSA 5IV2A 3IO1A 4F80A 4LNRA 4J3TA 1G6VK 4PJCE 4PRHD 2X2YA 4KK5C 2REFA 5ADOH 1K4CB 1SUHA 5JDSA 3FX6A 3RFZA 3H8GA 5TD4A 4NQDD 2QJDA 4ORGA 4BDVB 2C1PB 2NW3A 4FHBD 1R5VB 1L9QA 4LP4A 3W5NA 5C0RH 1KGXA 2F5AH 3T9YA 1JK8B 2QQLH 3U1PA 5J3HD 4X7FC 3VH9A 4U1HA 2GJ6D 1NLDL 3WV0A 3H9SB 5DJCB 1YMMD 3TH3T 1IGIH 1A4KA 3ZJAA 5ILTH 4M03A 1YPZF 3JV4B 3V38A 1BFOA 2B7DT 5KVFE 4IRSC 1CQYA 4YE4L 3S8WA 6PAZA 1UWXH 2PIZA 2V8DA 1OWRM 3EFOA 3ZQ9A 5KVGL 4JO4H 4X4ME 3TOPA 3WHXA 4A32A 5CN1A 4L1LA 3BWUF 1R3IH 2QQKH 25C8L 3CX5J 4PWEA 4Q14A 1NPNA 4C54A 4L3EB 5IHZB 4K94H 1XIWB 4YH6A 4R4ND 1S5HA 3ELQA 4LKCB 2LAGB 1BOBA 1HINH 3SYQA 5C9JB 4MCRA 3BWAB 5AVSB 3FNCA 4E41D 4LGRB 2JMRA 2K8MA 4M29A 3RNKA 5DFVC 3RUGE 3OKDB 5F1NB 2ZE0A 1TKHA 4YHPB 3S5YA 5JH9A 5BVJB 1UWXK 3IMUA 5KW9H 2QJ8A 5I6MA 3T0VA 5DC4B 4OC1A 5KBLA 4KQ4L 1HE8A 4Y7MA 5MEOB 4UYPA 3BSZH 3T0AA 3WGUB 5AENA 4MDJA 2OYKA 1FHGA 1QAWA 3QULB 1T2QH 1MW1A 1FNSL 1NAKL 4GT7A 4AE0A 3DV4A 1GC1L 1MI5A 4O02L 4HEME 4UT9A 1JZ5A 3OSKA 1W0YT 1ADWA 4UTAH 2EYTB 4RGOH 3V6OE 3ULVL 2R7HA 1QSFA 3KPSE 4HWBL 4Y89A 1RUPH 1I8LA 1SN5A 1JGEB 3V7AG 2IJ0C 1E2VA 1EO8L 4AQ1C 1C08B 4UOQA 2BS9A 2C8NA 4GP4B 2BZDA 4LIQH 1I12A 4XN9A 3P9LB 4BZ2A 4PJHA 1AIFB 2RFXA 3EO0A 3EBIA 3GYRA 4GSDL 1TF9A 3O6ML 5FOJA 4WWPA 5FIEA 4G9FE 5CSGA 1PZ5B 2HH0H 2ESVA 3JYBA 4F5CE 4ZD3L 2FZ3A 3O4LA 4WF7A 4E9TA 2Y1VA 4RGNB 4PRIB 3K6IA 4UQAA 4X4KA 3O9WC 4WFHD 4DP4X 2LR4A 5J5EA 4JHAH 1EJ8A 2GG1A 2I27N 4LCCA 4LCWA 5CCJA 5FPIA 4AK2A 1U30A 2WLZA 3GUTA 4LSVH 5DWUH 3AG2B 2XY1A 4NI3A 1AHWB 2HJFB 5BMFL 3VD1A 3GLDA 4HJ0D 2V77A 3OKOB 1S3KL 5MEPB 2JBJA 3MMEB 4EIZC 4RFEB 1OB1B 4PVMA 1DJHA 3BMVA 1AR1B 1WV7T 2RAMA 2W07B 3ECWA 3P0YL 2V8MA 3U4KA 1MCDA 2O53A 1CFSA 4M62H 4ODBD 4JL1A 5EO0A 3NCCB 3MV9A 5HJBA 2XA3A 3NGBC 2H6PA 4LLUB 5IMOB 3BPLC 3GEFA 5JQ6H 1JZDC 1X6LA 3T8MA 2CJUL 5DRWA 1IM3B 3G7TA 3KPSB 5CEZL 4JRXA 5BRQA 1U58A 1A1NA 4AEEA 1PU9A 2FIKA 2ZOOA 4G6JL 4HV8A 2YD5A 3VXME 3W11D 3TIDB 5GZNC 1EZSA 4JFDB 5TK4A 4XB8A 5D7IA 1SVBA 3QQNA 1WWWX 2LTQC 4GI9A 3NN8B 1SY6H 3NA9H 4JS7A 5HHXL 5IHHA 3GUXA 1ETZB 1INDH 5AW2B 1T6WA 3MV8B 2ZJSH 3UPRB 4GG6A 1KN4L 3R8QA 1AMYA 1PX4A 1VERA 1TPXB 3S6FA 4CVZB 1JG9A 1FNFA 4HC1A 4XBGA 5IJDC 4P23C 1SLVA 1IQDB 3IEHA 3ULVF 2QHRH 1TCRB 4KROC 4YDIH 2XFXB 5FCUL 3S34L 3C6LA 5HXMA 1QEWB 4MJ5A 3NUKA 1H3XA 4MD4A 3FONB 2N3JA 3FU3A 4YBLB 5LG6A 1NH6A 3KMDA 1CFVL 4PM1A 4M00A 1AI1H 4GUCA 3MUHL 3A6CL 3C9NB 4R83A 2HTKC 4ZXBD 4GEJA 4TUKH 1CICA 2DTML 3TIEB 4KOXA 5D1QB 5F0JB 2QHRL 1S7RA 2F1BA 4QXGH 4DKEL 1T83A 1NWOA 3MBXL 1M05A 3TV3H 3FO9A 1FCGA 5D1QC 1KIQB 1RZKC 3TC9A 2BMKB 2O4HA 1G9NC 1JWMB 1Z3GL 4P3WA 1BFTA 3ARED 5BQDA 3EFAA 5K39B 2VDMH 1S2EA 1L4IA 2HP4A 4LVOC 4GAAA 5CMAA 2DIBA 3E3QE 4GSRA 4F7EA 4IK2A 3BQUB 1GVIA 2P8PA 4HGKC 2EVHA 1FFOA 2D7PA 4O9HH 5ICZB 3D08A 3AQZA 3ZKMD 2OR4A 4Y49C 1A3QA 1A02N 3VI4B 1WBYA 2IPKA 1S7XA 4KRPC 5DQDH 5JHDD 4WI0A 4WKZB 3DGGB 3DTXA 5JZ7D 3LZOA 2PR8A 4IEFB 3TA3A 4OI7A 1QYGL 2D7MA 1OP3K 1WWZA 1NGWB 4XX1E 2Q2LA 3S0PA 5EU3A 4GAYA 1JV5B 3PWJB 3WEMA 1ZRUA 5JA8B 2B8OT 1M6UA 1BYNA 4JHUA 4KZDH 3G6DH 1JF1B 5F88A 4YL4A 2FYYB 3HIZA 3QAZC 4Y1SA 3OKEB 3LXUX 3ZHFA 5E9DB 3VI3B 3PHOB 1HZHL 4N8CH 3MMEA 4O02A 5HYSG 3NACL 5FXCH 5K5YA 1DQLL 4EIGB 1UYWH 4PV9B 2NNAA 4PRBA 1N6QL 1LLAA 3V5DB 3QXTA 5EUKB 1FN4A 4H25B 5DSCB 4XVSL 4QOKB 2AAVA 2IJZA 4LSQL 2G5UA 4OLEA 4KQ0A 1UC6A 2YEZA 1PNCA 4U2ZA 3R9GA 2BSTB 3L5WA 1BAVA 3A9LA 1CXEA 4FQPA 4OTXL 3L6FA 5A6IA 1QRND 3TO9A 2BRRH 3MNWB 1Q0XL 3MCLL 2AV7A 1NGZB 5F2FA 2PDOA 4UTCA 3D52A 1O6SB 5C8JA 1RURH 3B34A 5I1CH 5IROA 4JFVA 2X42A 5E94A 4E9WA 3DIFA 1IU8A 4GRLD 1J48A 1I1CA 4A67A 3UBFA 1VSCA 1UACL 1ZKAA 4N68A 1CC3A 4NIYE 4Z7OE 5KTAA 2JIXD 2EVIA 4ZMQA 4X83A 3LEXB 4UQ2B 2NNXA 4N0RA 1DJZA 2G5BB 3OGCA 2AJXH 3MPCA 2L7QA 4Y7OC 1TIQA 2YIHA 2DLTA 3C2AH 3EXLA 5DT1L 5DZAA 4JY5H 2GSIB 1NC2D 2PCPB 4PWIA 4MAYD 4NQCD 5LRJA 1WF5A 4G1MB 1S7SA 2BP5M 1GGTA 2IOIA 3HG2A 1PLAA 3MYJB 4K5LA 4GAGL 5EG6C 3FFCB 3WKQA 3KJ4C 4AG4L 4CADB 4XWGL 1CD9B 4QOKE 3FN0H 3BJ7A 3CXDH 4PSRA 5I1EL 1IO4C 1GGIH 1U93B 1NL0H 4R96A 5EMIA 5GGSB 1GZPB 1Z5LA 1D9KD 1IC0A 1UCTA 2ESVB 4FYTA 5MERA 2DMBA 2Q4YA 3WFCH 1N68A 3JV5A 1PKOA 3EG9A 4MA8H 4P10A 2OPCA 1TZGL 1ADQA 1QFPA 3BVUA 3NN8A 5KANG 1WRFA 3RGVB 1JTOA 4AVJA 4Y4FB 4KY1H 3OR6B 2AKRB 2ZX5A 4M5SA 3ZZLA 4XHJC 5JDJA 2VM3A 4KNUA 4YZWA 4FQ1L 4JGNA 3I50H 5IQ9A 2ITFA 1ZLUK 5D1ZD 3H9SA 1J0IA 1X44A 2G0LA 4KTDL 3WIHL 2Y69B 1GC1C 4B11A 3OAYK 3F7LA 1JK8A 4WWOA 3U7WL 1LILA 3W9EB 3MAWA 3WY3A 5EO0B 1IIKA 3UTPE 2EUIA 1HIML 1BVKA 3IJYA 1Q9LB 2A7BA 4NO0A 2W92A 5AW1B 1ORSA 1U8QB 2J43A 5IB1A 2FO8A 5A3ID 5ADOL 1R3HA 4PRAA 1IGML 2Q5BA 5LN8A 3ECQA 1TQBC 4FKHA 3HRPA 4HIXL 2OYLA 5HDQL 4KXCA 1YNKL 3LZPA 2NX5E 5HY9B 4B12A 2ZKWA 1MFDH 4U1NB 3UGUA 2K4WA 3IJEA 1J5OH 3IGRA 5E2TL 2OMXA 4H2CA 2KERA 2QVFB 3U25A 1EAPB 1QBAA 2GSGB 5IM7A 3H4HA 4CRYB 4EUPG 2DEYX 4LBEA 4ESKA 3VXMD 2SEBA 3NIDB 4F2MA 4GKZA 2AFUA 3VGBA 4UEEA 2EXYD 4LAQL 4AQOA 3QUZB 8FABA 1QA9B 4I2XE 3X13A 1YEIH 3MRUA 1BECA 4KI5D 3LKRA 3MJ7B 5DHVH 4PJEA 2FUQA 4NJ9H 4NP9A 4PGCA 3X2QB 3A47A 2YGQA 4RGND 2YGWA 2OLDA 3EDDA 4PRPD 5ETUB 4IKKA 4I48A 2DBLH 4Y8DC 2AEQH 3CVIH 3UPAA 3HI1A 5BQ7A 2FYVA 2WN3A 2AERT 3X11B 3HC0B 1NDMA 3EGDA 4F8ZA 2E8ZA 3GDBA 5EN2A 4JFQA 4O23A 4JFFD 2ZCLH 2A99A 4H2KA 3CDYA 4YFEA 3D25B 4U1LA 1A3RL 3QR1A 2IWKA 3F2LA 1X6NA 3I50L 1QOKA 4MHPA 1NCOA 1SXSA 2JI3A 3MODL 4KJWC 3VVWA 1AAJA 4BFBD 5THWA 3ARBA 4X5RA 1E90A 2CO2A 5F7BA 1F3DH 4X2TA 1SXNA 1QSOA 5T1DH 2J5LC 5D7HA 3CH1B 5DEFA 4EXKA 2JIXA 3C5SB 4XPDB 5BRZD 1KJVB 1DFBH 1G6RH 3MR9A 4X99A 5B1BB 1HHKA 4LFHD 3LX9A 2NLJA 4F9LC 3V2AR 2D3JA 4B9ZA 4FJZA 1DEDA 4OIIL 4C55A 4JFDD 5C71A 3MFFB 2EDKA 1VEOA 1ADQH 4B95C 4K5NA 4Z7UB 4E2AA 1NCUA 1MN4A 4KKZA 3BPCB 2IO5A 3LMJL 3K2UH 4H0HB 5C0ND 2CHDA 3ZQWA 1HSAA 3CDGB 2R0WH 2YQ2A 1QR1A 2EYRA 4F3FB 1G9EA 4XP9L 3IMBA 1U91A 1SOKA 3WNPA 2FX8L 4QHNA 4OFYD 1RUMH 3KYNB 3GSUA 3AWFA 1NCGA 5KS9B 5CF3A 2G2RA 1AOHA 5BV7C 4FD7A 3SDCA 1QLFB 2YN5A 3WY2A 1G6RA 3CFMA 3FAWA 3T2QA 3EJRA 4CMMB 1LMKA 1I7UA 3E1ZA 5F7YC 2V2TB 3CDXA 4ZOCA 1CVSC 3QJXA 4PJ8A 3VQMA 4EI5C 1FNOA 5CIPB 3NSXA 2Q04A 3WIHA 1UJ3C 5IB9A 2X9YA 4IBYA 2VL1A 1DBBH 1J8KA 4CSZA 5TFSL 2AXFA 3IJ7A 3Q8EA 5AZEH 1Z9PA 3OKKB 1D6VL 1S4IA 5EFIA 5EV7A 1X7SA 2H1LM 1EZUA 3MLVL 1ED3A 5F1IA 1Q9KB 2DBLL 3LXAA 1XCTB 2PJ5A 2AJ6A 1J05A 4KOCA 5F7HA 1BAWA 1XEDA 4FDWA 4G1EA 2VSDA 2E4TA 4AL8L 3GMNA 3QDAA 1MFCL 5ALCH 4C4KT 2R0KH 3FULA 3BDYH 4MXWL 3R4RA 5EO1B 1AGEA 3G5XB 5HJ3A 1MHHB 5FW8A 4PWFA 3QJTB 4MXVF 4YHOL 2VZYA 1CXIA 1LHZA 2P24A 1QKZL 1NAMB 4Q6IA 4ELME 5IHUL 3GXNA 1SEQL 4HMCA 4KOWA 3O6FB 3GMMA 4DCQB 4R97B 4PIRF 5CUSL 4KKBD 3W0WD 4G71B 3BT2H 5DA4A 3FSOA 5AOLA 5JR1H 1BF5A 3MUGA 2HRPH 2OI9C 3K46A 4WU7B 5C0BB 5IVXA 4G1PA 1BHGA 1WT5C 1PX8A 5CJQH 3U7YL 2NY5L 1CTOA 2MTAA 4GOSA 1WFJA 4LMQE 2HUZA 5MENE 6FABH 5ABZA 5J8CA 3HUJE 3OBAA 4UWJA 3KZ8A 3QRLA 2YJLA 4YDVA 1IM9D 1MJ8L 2RCSL 3KQZA 3ELAT 4GH7B 2X6MA 1L0YA 3DUSA 3OWCA 2ED6A 1A5FH 5AL8A 1B4TA 1EAOA 1T1XA 2XZAH 3IMWA 4JRFA 2X2IA 3IXAA 1A64A 1N67A 5FGCB 4MB5A 2DL9A 4TQEL 3U7WH 5FYLH 4Q9RL 1T4KA 4HZLA 4ONWA 4FMVA 1J1PL 2PXYC 2YGPA 1OCZB 4V11A 1W8EA 2CBQA 3LVEA 5FYJE 3II3A 4OJYA 5BS0D 1KBKA 1DO5A 2VMEA 2JQZA 4K3GA 4O4YL 4XBMA 5AZEL 1QO3B 1CDYA 4ZUWA 5I6KA 1GXEA 2J8RA 2HX7A 5AVVB 1OP4A 4BV1A 2EH8H 1I3GL 5FO2A 5K1JA 5D8JL 5LN4A 4OIFA 2BPBA 4PJ9D 2YA0A 1FNHA 4R0LA 3BP7A 4EI6B 1EXUA 1WIOA 3O3DB 3Q01A 4DPAX 5INCB 4RFNB 1Y0LB 1NOFA 1MG3C 4WWVA 2WQVA 3JVGC 1MFMA 3FB8B 4Z3JA 1RK0A 2ORBH 4Y2NA 5FA4A 3JXAA 4X4YA 4ADIA 4RAVB 1E4XL 2G3ZA 3PGFL 3W6XA 4HHAB 1USQA 3IC1A 3EOAA 3QH3A 5ISVA 3HZYA 3EF7A 3BDBA 3G6JE 3VG0L 1HHJB 4KLWA 4F92B 4P9ML 5CU5A 3WDIA 4RCAA 3IGFA 1NPUA 3CVHB 2V2XB 3PZJA 1KXVC 3GMQB 4BUGA 32C2A 5I74B 4G43B 2GITA 1N8ZA 1AGBB 1INDL 4Z7NB 2R2BB 2HLAB 3HTLX 2IDQA 3BN3B 2VLMD 3VXUE 2WQSA 1VGKB 3U6RB 1ZTMA 1SQMA 5KS9A 3EYFB 3T4YB 5E6UB 1ANUA 5KSBA 2ESVD 1VEMA 2V5RA 2VR6A 3HN5A 3OXRA 5D1ZI 3WFEH 3FH4A 3ARBB 3OF6D 1KFAH 2NCEA 3SD2A 4OZ4A 3FL7A 1Z3RA 4H0GA 5EOTB 3VI4F 3R9EA 3E0KA 4Y4FD 3QEGH 5BOJA 1KZFA 1WHOA 1YK3A 2BVPA 1KJ2L 5C0IA 5J12B 1PEZA 4P07A 5ACZB 4FZ8H 3MJ9A 3W2DH 4AMKL 1E4XH 4OTXH 1M42A 5ISZA 2CUMA 2XN9A 1W8NA 5HPOA 1FFNA 2ZIDA 3MRKB 2NX5B 2Q7AA 2ADGB 2R1WA 1YN7B 3NRPA 3ROOB 4ODVH 4ZX3A 5E2JA 3HS0A 3NEXA 4BCZA 4KBPA 4FL4B 4RNRA 2PCXA 4WW2F 4B50A 4TQPA 3JRUA 2QZ5A 3AJ7A 5DZNA 5C70A 3SI0A 3HEIB 2V2WA 2YD2A 4QHNB 3BWUC 4LFHG 3P4OB 1L9PA 4HAKA 4P2QE 3D4YA 1SEBA 4ETQB 2BSSA 3BH9B 4L8DB 2CKBH 4K3JL 2ZG2A 3WO4B 3EYQD 3HS8A 3SIKA 3NH5A 4XVTL 1UWYA 1QSMA 2G9DA 4PY8I 4HF5L 1BOGB 4QLRA 2ALWA 3QZBA 4M4RB 4Y2DA 2F19H 3OMNB 1QKZH 3O8XD 2H9GA 1QR1B 3AB0C 1EZVY 1HHKB 3SDXF 1RJYA 2YSTA 3G3LA 5D71H 4JG5A 3GJEB 1QBLH 3LCYA 1UM4H 2NZ9D 5FB8B 1BPMA 4FXKC 3TCTA 3QWRD 4NUMA 4BWUA 3SDAD 4XCYA 3MLVH 5CHNA 5E8EA 3HB3C 4F7PB 3DGVA 4UF7C 4XODA 4K3EL 4NGMA 2ARJA 3EO1B 4HOMA 1YMMA 1KN2H 1I7RA 2CLZB 5CILL 1A4JA 2DQCL 4H26B 3BP6B 2Y36H 3P2HA 1DCLA 4J3SA 1PSKL 2D3VA 4NZRL 1R5IA 1AC6A 5AGEA 5F3BB 2AJVL 2Z3KA 1YW4A 3ZE1E 2X28A 5HVWA 5ICXA 1QSTA 3OKMB 5EPMB 5DUBA 4AEIH 2PJBA 5D1ZB 2NYYD 1LNUB 3OWRA 5FDWB 3D25A 2YARA 4LOUD 2GUOA 3PGDB 1RTQA 1EFQA 5I8KH 3NIGB 1UCBL 4MCYA 2AI0H 5GS0H 1SBBA 3O3BB 4WNSA 1HWWA 4HUVA 1QA9A 2ZUYA 5AKSA 3SJVE 3X13B 5I1KL 1Q2CA 2FVGA 2FLBT 2QT6A 2K6YA 3L4UA 3WFCL 2XBTA 5GHWH 4X6EB 4LKXA 4N22A 1WPCA 3GSRB 1XMBA 4BBHA 3IFLL 1E65A 4JZ0A 2IWEA 4HQQH 3RUGA 3WAJA 2Z31D 3IJSA 3N1QC 4M7LT 4TSCH 4Z78B 1ONQB 3LS5H 4WV1A 4OCMC 1EQWA 1SRDA 3DURB 3JWNG 3D3SA 1EIBA 3MGOB 1ORSB 3WEXA 2CO6A 1Z4RA 5LG1A 4Y2DD 1MWOA 4M9OA 1JRHI 5JXEA 4O51A 2GVYA 3PJLA 3LMSA 3HKZA 3GMPA 4MHHI 3FQ4A 1JNHA 1QRNE 4EBQH 4N8PA 2VXKA 3FYNA 4GAFB 5L7XH 4QT5A 1QBLL 3DUHA 1P84J 2OMVB 3CU1A 3MNVA 4UANA 4JO3H 2XXGA 3GYAA 3CXHK 3K8MA 1VGEH 2R9HC 4I5BB 4OSUH 3PP4H 3ZE1F 2AS5M 1KJVA 2AJ3B 3SE3C 3TO4D 1KUYA 3H7BA 3OLEA 4K7PX 3PFOA 4URKA 1S7UA 3UJIH 2CK0H 2YHGA 3MLRL 5MI0B 1HOCA 3QUHA 2D3LA 5I73C 2X5PA 4UB0H 5B3NA 1HL5A 3UTQB 2XN1A 1FE8L 3WEAA 1Z4EA 4R84A 3F6IA 1AMPA 1Q0XH 4UQEA 1FLTX 1A0QL 5FO9A 3ARGC 2P28B 2Z92B 4JN2B 3IDYC 2A6IB 4Y4FA 2Q6WA 2JH2A 1JN6A 5FA3A 5T3ZD 1DVSA 1VADB 2GTWA 4HBQA 4ENED 3TNMA 3D30A 5J6GB 5E8PB 2B1OA 1DJYA 4CYOA 4P2AA 1ET5A 3OF6A 4PSWA 3ARUA 4N0YH 5TQ0H 3RTQD 5T1JA 4KKPA 4RIRB 3AG1B 1RH8A 3IRPX 4JN1H 1OZTG 3SYOA 3GM0A 4F7TB 2V3DA 4HUMB 4FXGC 1MQKH 2EC8A 3F00A 4O58L 2AFZA 3QW9A 1IY7A 1I8UA 4WGKA 2GBAA 5EBLA 4NQSB 4E9SA 4KROB 4LK4A 4OZFG 3WS6C 1NGQL 4X5KA 1ZVHA 1HL4A 2BSWA 1IGMH 4LLMB 2XV2A 3UJIL 3TEXA 5B8CC 4TNVF 1FFOB 1GY2A 5C0AA 2KT6A 5DUML 4EZLA 4AKOA 3LKSB 2OULB 4M6OL 1KCRH 1XIWD 4K9EH 5EUOE 3DURA 1CFNA 1JZHA 4X7EC 6FABL 2X3CA 4F8OA 1GY1A 1A3LL 1MY5A 1JFQL 3QDGB 5T8IA 5JOFA 4K0OA 1DHKA 4RX4A 5HYJB 1TKWA 5I16A 3B3VA 2HX8A 2HT4D 2ADFH 5I82A 2FH8A 4MY3A 2A73A 2LV4A 4I18A 2L7JA 1XSKA 4JG1L 4RRPG 1J1OH 5HI4D 2QPUA 1TZGH 5TDOB 1HEZA 5IJCC 4UT6H 5LJYH 2R8VA 4LVNC 4MD0A 1XH1A 1E9PA 1UFUA 3JWDC 3MRIA 4HWBA 4EOWL 4IK7A 4JFPB 4WI4A 3SI1A 1ZT4A 1PY9A 5B38A 3ULUE 4NZJA 2ZEMA 3EG9B 2JKRM 3HS0C 7FABL 1NCDH 1CFVH 3GSXA 1HQ4A 3LEVL 3D66A 4NXSA 4RZCB 5L2JB 4DP5X 1L9MA 5E5RB 4LARH 4ZI8A 1B9KA 2KCWA 1FL3A 2Q8BL 4QHLA 4M1CC 3DA0A 4JY6A 3AXLA 1E5AA 3TWCL 1Y1UA 4OC4A 1U95B 3MRRB 1H3WM 2F58H 1V7NL 1NDGB 4PW3A 3RWIA 5ILTL 3O2WH 1F58L 1ETZA 1OK0A 1U3HD 3BE1H 3OQ3B 2O5ZH 2XKSA 3KBPA 4PJFB 4Y4HC 4Z0BL 2PRQA 3MRFA 5IG7B 1LAMA 2YPKA 4JRYA 5KZCD 1F11A 3K5SA 1SDDB 3MV11 1CD1B 3CXQA 1IB1E 2PQ8A 2UWEA 5EF2A 2Q8BH 2UWEF 1UH4A 3CC1A 4NQVA 4RLDA 2AQ2A 2YMXH 3H42H 4P4FA 3WLWC 3X3GH 1T4WA 2AJXL 4X7TA 1YPZA 3D67A 3PRZA 3VQ2C 3ZZQA 3JT2A 3RB7A 1N6UA 4DN3H 3F7VB 5GS2H 2EIMB 3RX9A 3LXCA 2CE6A 1T21B 5B4MC 5L2KB 1AHKA 4ODHL 4G3YL 1YYML 1SBSH 1SLWA 2YPLA 3HCVA 4M7JH 4MNQB 1TJHL 2F7VA 3LVTA 4PS4L 4NFRA 3IGLA 1JGDA 4FFYA 1ASPA 5E1QA 4PR5A 1OVZA 3ZYOA 3EGSA 3UO1L 1EDQA 2H1PL 1XSOA 1MJJA 2X89D 5MEPA 4HFUH 1HNFA 2OI9B 1EGJL 2V9UA 1KIQA 3US9A 5JIHA 3CHSA 3DX7A 3C6LB 1REIA 3C60C 2R1YB 4Q38A 3TO7A 5IMOA 4U3HA 1H6EA 3CSFA 3P4MB 1RI8A 4GXHA 1K5NA 3U1QA 3NP4A 1FDLH 4PJGE 2ZKYA 2JKNA 4JGJA 2WKOA 5F3HA 4GKOA 1YNTF 4U1GC 1YNTA 2UWEE 1Z0MA 5C0GA 2BUEA 5B38B 1PNDA 1YPZE 4JAMB 4R87A 3MLRH 2KYIA 4F8TA 4JHWL 2RR3A 5KSBE 1TOXA 4XNMB 2AFOA 5HH1A 2B14A 1T1WA 1U3YA 3ZKND 1JL8A 1Y0YA 3F12B 4CDHA 3RL2B 1F4YL 1U8CB 3EHBB 3U9PH 2FHFA 1S3RA 3TJHD 2VSKB 2Z91B 2IMOA 1KBBA 2F19L 3DPBA 4HS6B 3R1KA 5EBWA 4LLVB 4CYNA 3BQUA 4NAJA 2BFGA 2XNAA 3ME0A 1M1XA 2W5PA 4S0HA 5AG8A 4PRDA 1JN6B 1HSBB 1AQKL 2AQ1A 4J3WA 1F4XL 4ZO7A 3SGKC 1Z9MA 5EU6A 3U4EA 3NZ8B 2BDNL 1QSZA 1JNNL 2NXZC 1F6LL 2O93L 1O9ZA 1WSST 1QSFB 3QNZA 3TL5A 3VG0H 1M05B 3UERA 3S6GA 1PY4A 4X4MA 1MCEA 4NZ8A 3KPSD 1X4ZA 4XAKD 5DWMA 3G6JB 5JW5B 3RPIB 4NM4L 3U46B 3VWKC 1KB5B 4R2GD 4AY0A 3MX0A 4EDXA 2D4FA 3Q9PA 5K8NA 1A6PA 3OAZH 2ATPA 2WXKA 4FXTA 4ZUWB 3TPUA 2B39A 3GB0A 5I0DA 4JREC 3CTTA 1TQTA 2DLFL 2IGFH 1A6VL 1D5ZB 1X9QA 3C6EA 4AVKA 1Y6NR 2JFCA 1IKFH 3TX8A 1IZKA 1OCRB 3GKZA 3HOGA 1F18A 4PRPA 4JGMA 3MSPA 4LQ1A 5DJCA 4WUUD 1J8HA 4IJ3B 3B9KB 1A6ZB 2DM7A 3LDBC 5I8EB 5D7IF 5IB5A 4PGZA 7CPAA 3C5JB 2BX5A 1CS6A 3PGDA 3C75A 5KSVB 4ZFGL 1TENA 2D03L 1DTUA 2EYTA 2NY3B 3H6JA 3QIBA 1NGPL 3AROA 5I66A 3UJJL 2IDUA 4M6NH 2R69A 3HHSA 4Z7QF 1KMGA 1S9VA 2OX5A 1S5KA 1M7IB 4LIQE 5J0BA 4TVSa 4Y8AA 3IDJA 1L7TH 1R4XA 1R34A 1XF3A 1EJOL 4ZXBB 5C92A 4HBCL 2OZUA 2AI0L 2CSPA 4DW2H 3HUJF 4NRZA 1M57B 1A7QH 1UYWL 2H32B 4QI3A 2DJ4A 2K0RA 4GAGH 1GKEA 1LQBC 2WTRB 4B0MM 4LSSL 1DSFH 1D7CA 2B59A 4DFHA 3Q1EA 2X4QB 1KNOA 1NBYA 3L3HB 4OB5H 1YJDC 4NO2B 2NY5H 5E1IA 2E8YA 2YPVA 3A6OA 3FJTA 3N44F 3BI0A 5GRVK 3VA6A 3D85D 4PJIA 3AS0A 1T0NA 3TBYB 4OD1L 3BPLB 1UENA 3I9IA 4WI7A 1SYVB 1GL4B 4YQXL 1WG3A 4EKJA 1JCVA 3BPOB 4TN9A 5FGBC 2EXWC 2OTUA 5D6DC 3KLAA 1SOXA 3CFBB 1MRDH 3ISZA 5GRVL 1R0AL 2ZXBA 2FWSA 5HDBE 5JIQA 4S1SL 4IRZA 3UX9B 1Q2YA 4WI6A 1PZSA 3ARBC 1FV1A 4TLSA 2N4IA 5F0PB 3G5WA 4YHMH 1WK0A 1E2WA 3BRFA 4PK2A 1F2QA 3M7OA 3HI1B 5BQ7B 5GGVL 5J13B 3PF2A 4B14A 1SJHA 2NY2B 3OV6A 4TOYH 3SOTA 3ZDYE 1ZHLB 3GS0A 5ICYB 1KZQA 1AKJD 2ERJB 4AQAB 1YQVL 2I60L 3IK2A 2ZX7A 4R5VA 2K6ZA 3EYUH 1C1EH 3CN0A 3VGDA 1HESA 2A6JA 1DQLH 3IU4H 2B0SH 5GGUA 1FVCB 3BAEL 3MREA 2F54D 2O5YH 3Q8AA 3D2UD 3MRLB 2PYED 5GJSL 1U91B 4ZOAA 1FO0L 4H5SB 1IAII 1HVXA 4OJCA 1MVYA 4UDUB 2WBJD 2UXVA 2MQCA 4WFFE 3D50A 2R29H 3Q3GB 1GYTA 4U1NA 5E03A 3C26A 3Q6FA 1R3HB 2IPTH 5HYSA 5J9PB 4L3CB 3W37A 3KYOA 1MJAA 1B0GA 2GITB 4P0DA 4FMKA 5D1XD 3UBXI 4EDWH 2FECL 4X6DA 5IY5B 2ZKHH 1BQLL 1RUQL 2QTVA 5DD1H 3AM8C 2DWXA 2JDCA 1TJXA 1EFXB 3PREA 1HILB 3A3YB 3VXOB 4F33B 3QEHB 4R7LA 1M7IA 4WTZG 2BCKB 3H9HA 4QYOA 3TN0A 4P4IA 4EBQL 5LXVA 1PD1A 4FERA 3O3EB 3W1ZA 5D7JD 4BD4A 5IHZA 3P2TA 4IBQA 3DMMC 5EZOH 5T1KD 1VDGA 2XQYK 2KZBA 1N2RA 3M1BA 2JSFA 4O5LH 4BQ8A 3UCRA 3EO4A 3VSUA 1OHZA 1Q72L 3AU1B 1TPXC 4KNSA 3ARVA 1NLDH 4KUZL 2P80A 4XPGH 4Y5YC 2XN9B 1RIHL 2Z7WA 3ZE0F 3WY1A 2A83A 1OGPA 1S9WA 3MCKA 4DZBA 5IMLB 4GRLC 5FKAA 4IK6A 3P4MA 2C6GA 4NT6B 4R3SA 1FV1B 3DMMD 5FW7A 1YUHB 3E9TA 3QUZA 4QTHA 2XDHA 2ZXVA 1ZDSA 4YRHA 3QIBB 2ZKMX 2XVGA 1R3IL 1IIIA 1A14H 1QD0A 3CMGA 3DX7B 4OLXL 3I3DA 4MNGA 3A67H 9PCYA 1INEL 5ESVA 4DGUA 2ARJQ 1FGNH 2HKHL 1U2YA 2VR3A 4NQQA 1JVKA 2VRKA 4K8RD 4W6YB 1NQBA 4J3OH 3H55A 3QDGD 4YVNA 1D5BB 3NEEA 3BFQG 4JFFB 1NGPH 3RPIA 3C5ZD 1AO7E 4YWYA 4XNXH 5F8RC 4P45A 1HYRC 2J9AA 3QGVA 4XVJL 4XPFL 2HXAA 2CM5A 2IOMA 4UOJA 3CSYA 3TONA 1XCQA 4OIAA 1A47A 2VXQL 1JZ2A 4RVBA 1NMCC 2IWGA 5AG4A 4XNQA 3H2WA 1OSPL 4TVPD 2IVFC 3UZQB 3IAGC 3K8LA 2QFRA 3KEHA 5CEXB 3G8WA 3FIXA 1A5FL 4MQXD 4PMFA 3H6AA 5GS2D 4KU1A 3BWZA 1E3ZA 2D7TL 4RGOL 1AGDB 4ZXBA 2H3NA 2HG5B 3CHXA 3Q5OA 1O6SA 5C07E 3GLAA 4F37K 5IJVA 2Q1EA 4XXDA 5EU6B 3U4EB 1KXTB 5E8DL 3L3JB 4RISH 3HUVA 3HHSB 4R8FA 4JZJC 4QTIL 1O6VA 5EUOB 1N59A 4A2FA 4J6RH 2P80D 2IALB 4QLWA 4W9KC 2ED9A 4QHKJ 2OP4L 1A8JH 5MP6L 4LPYA 2QFPA 1R43A 5H84A 4N6QA 4FQJH 3EGXB 2PETA 2WCSA 2C3VB 4JUSA 4NBYB 3REWB 1FL3B 2ILLA 1Y18B 2J1YA 3HFFA 3KL5A 5IB5B 1B90A 3UEZA 3KPRB 3O9WA 4JPKL 3VMPA 3U7AA 3CDZB 5T1KA 3WNJA 4RWYL 3M8OH 5HD8C 1D5RA 2DYRB 3AMLA 1CYXA 3TJHC 5CZXC 2R0KL 3GRWH 5AVQB 4UU9B 1NBQA 2NZ9C 1IC7H 4MXQD 4PFEA 2HKFL 1PZ2A 2VM4A 1OGAE 2KKQA 4Z77B 4OZIE 2ZXAA 5KVGH 2V2TA 4JRXD 4RWYH 4K7FB 1GGIL 3HUJB 5D7LD 2AGJH 3FOMB 4Z8FH 4GT0A 1RUKH 4M4PA 5FYLE 4Q6YA 1RXLA 4ZUTA 2LLLA 3RIKA 3QI9A 4QTHB 2QSCH 2WLLA 3DX4A 4ZFFA 1KG0B 3NA9L 1B87A 5HGBA 2ICWB 1KUMA 1TQVA 4Y4HB 4ZRGA 4Z65A 1OTSD 2C5DC 3QHFH 3TBVA 3DO4A 1KTBA 2LVEA 3U0TB 1QW8A 1T7ZA 3O2VH 5KYYB 3DR6A 3FW6A 3SCMA 1HZKA 1TYJA 3RNQB 1Y1DA 2D7TH 4WW2A 1S3ZA 1URZA 3VMNA 1HDMA 1FIGL 1J9CT 2YA2A 4XBEH 5CZXD 3LOWA 1J5IA 4M1GL 3F6JA 3TVMD 2X12A 2P3YA 5EZLB 5INDA 5B1KA 4BZYA 2B4BA 3VD3A 5E6IA 3GDCA 2NLJB 1OQXA 4LHJB 1PVHA 3NJXA 3V52L 4H88H 2IG2L 1N5YH 3DSBA 1CDIA 1WS7A 5HHOB 3GMLB 4M93C 5I15H 3E0GA 1R6VA 4DAGH 4CN4A 4F3FA 4DEPB 2A1WH 4GBXA 4E42B 1WCBA 5J6GA 3TZVB 2MQ0A 2HCZX 2VAAA 1KELL 1R17A 3DX6A 3GUFA 5I8CB 5MENB 2FCKA 3FECA 3CV5A 1FAIL 2ICWJ 4HD5A 4P4KB 4GQZA 5DTFA 2VLRB 4X0KB 3GTNA 5AW7B 4PJXF 3MV9E 3ISWA 4YPGA 2OXGB 3CIQA 2YMXL 2HH0L 2BVQA 4ABVA 1MI5D 1K2DA 3E7JA 4IRSA 3AQXA 2DM3A 1HOCB 4PJEB 5GSVA 3HE6B 5BRZE 3BPNB 3W57A 4KUZH 3SKJL 1IBGH 1NFDB 3JWNC 2O5XL 3HE6C 1XOVA 5CMAB 1UA7A 4E5XG 3STLB 5E1AA 1OKEA 1TR7A 3EYSH 4N3UA 2H2PC 1U8KA 1XEUA 2QR0A 1UD3A 3IRZA 5K8PA 5PCYA 5KSAB 4B96A 2FWOA 5C86A 5G1ZA 4PCKA 1YC8A 1IEHA 3V0VA 3BUQA 2ZNXA 3SPHA 1JPST 4XP4H 3O6FD 5TE4L 4MFJA 2YAFA 4D0BB 3HN3A 2ITCB 3UJTL 2X70A 2J2ZA 5TDPB 4J3OD 5D1QA 3SO5A 2WLKA 3BT2L 4XN1A 5C0BD 1KF9B 2XLLA 1ONQA 3DKHA 4Z78A 2QVIA 4ZW6A 3ESUF 4JG1H 4EAEA 2X41A 5E8NB 1HC1A 3GK8L 1JPGB 1ZT7B 2VZ1A 5DO2C 1IX2A 3CK0H 3AITA 2XYBA 1YZZA 3BZFA 1YY8A 4J8RA 3BDYL 4LLAA 2QQQA 4DHLA 5D2NB 4C58B 2BSED 1FY7A 1VHEA 2EDJA 2CNSA 2VXTH 2DTMH 1JNHB 3RB5A 4P2RD 3IEAA 4CGTA 3R06A 2X0UA 5CBAB 4DEWA 4A30A 4IBZA 4L1DA 4J7RA 3WEXB 4PJGA 1EUTA 1JV2A 1YNLL 1Q38A 1HXMB 1IYKA 1BXAA 2E7DA 2DIEA 4HPYL 4PRHA 2E0PA 2WANA 3SKOB 3EYOB 3PWPE 1M9WA 2V5YA 2L3BA 3D39B 1ZGLA 5HMNA 3DVNB 3NJMA 3EFFB 2R0LH 2AITA 3H54A 1DE4C 3ULUF 3S35X 4CUCA 2R0ZL 3MRDA 4MI4A 4A6YB 3SBPA 1N4XH 3G04B 4A2DA 5CD3A 1DQTA 2A6IA 3EIFA 4WHCA 1U92A 4DWHA 1IVLA 1FFRA 2GUOB 15C8L 3PNWA 4KRMB 1PCAA 4O51B 2HZHA 3B3SA 3FF3A 1VGYA 4OAWB 2WWNA 1F97A 2AVFA 2VDRB 4PJIE 2V5TA 2CJUH 2OMVA 3B2VL 2XU9A 5JLZA 1RQ5A 2OZHA 3D8PA 2JKJA 5I6LA 4CGNA 4HIIB 3CZSA 1I3VA 1M7XA 1NKGA 2PKDA 3KPQA 3LMJH 4OLZH 5K33A 4IU3B 1UADC 4Z7VE 1U8KB 1KBWA 1YMMB 3BH9A 3KWVA 2NR6D 4FZEL 1MCKA 5EUOF 4Y5XC 3FU8A 3P0YH 4OB5L 3GIVA 1KY7A 3MUUA 5EBLB 3SJVB 3WN6A 2F18A 4A6YH 4F1SA 4LPVA 1XMEB 1CR9H 2CIKB 1F41A 4LRNL 2YGOA 1KCSL 2YPLE 4ZSOE 3OPZL 1U33A 1EHLL 4OLXH 1M71A 4NJQA 2MRYA 2FATH 1S9WB 4DZBB 3JWNH 1AMXA 1ZLSL 3WFBL 3NIDE 1X5GA 2Q3ZA 3ETSA 3LD2A 4P9HH 4ZMNA 3UDWC 3AU1A 1T7YA 3UYOD 1DVFA 5I19L 3BXNA 4E41B 4HUNB 1WD8A 4M48L 2JELH 1CQKA 3C5ZB 1UWGH 1A4JB 4N2GA 1I7RB 2CLZA 2X53A 1K3ZA 4K7FA 4TSBL 3UEQA 4GLRI 2EH7H 2Y07H 3IE9A 4JO2H 2Q7YA 3WMQA 5F3BA 2CTBA 2BNQD 3KR3H 5T3XL 1BO4A 2WYHA 4N9GB 2RD0A 1NM4A 4G8FA 4BFJA 5F1KC 3L7FB 5FDWA 3QIUD 5DD3L 4PV8A 1AQDB 2HJLA 4ISVA 5AYQA 4GUPB 4BWTA 1JHLH 4TKWA 2HKFH 4BKTC 4XX5A 4IBUA 1S7VA 2G60H 4XBPA 5IMMA 1I3UA 4ODSL 1FNSH 1NAKH 5F9JA 1CL7L 1EHKB 4S1RH 4YBQD 5KUMA 1RZQA 2A4NA 1DVFD 1MRCH 4D0DB 4YDKH 1IBFA 3HG1E 1JWSA 5G4NA 3LACA 3Q48A 1SEBB 4H8WL 2P8LB 4OCSH 2VM9A 4JFZL 1UB5A 2YAPA 1J10A 2CDEA 3D7PA 3IETA 3POCA 4EI0A 3RRQA 5G4OA 1NCAL 4QTIH 3IDIA 4PP1C 4KGLA 3TLRA 3QI9B 4XN8A 2BMKA 4S1RL 4POYA 4BD9A 1RZJL 4ORZC 2VQYA 2J56A 3MCYA 3HS9A 4QKTA 4OBSA 5DFVD 5HHVH 5HI3D 1PDKB 1ZIBA 5DD6A 1QNIA 4Z0XB 3MRNA 4ZX6A 5IBUG 4Q6KA 4OGAC 1QPKA 3L4ZA 2EIJB 2DEXX 3IKKA 1LK3H 3STLA 1RZKL 3BAXA 3CLEL 4MHDA 3WI9A 5C6TL 4IMLB 3VX1A 1NIEA 1G1KA 4JKPL 3AADB 1I1AA 5C0NC 3WFEL 4KQ3H 3LH9A 2IDCA 5AYUH 4NZTH 4LDEB 3ZDXF 1JD7A 1R3LB 5F97E 1I3RB 3O0RL 1IAIH 5EOQL 1N19A 5FYLD 5LCVL 5EWIH 5KVEL 4YE0A 1AZUA 4J4PD 4ZOEA 9CGTA 3TOAA 4OFVA 1W72L 3FTUA 3UAAA 3BN9D 5DHYB 2ZUSA 2DJMA 1IQWL 3DRQA 2JLPA 2UX6A 4YXHL 3HZYB 1KGCD 5DC2A 5FHBL 1MHPL 4RSVA 5FFLA 3RKPA 5T33L 5AG9A 1EWHA 2Y3AA 1DSFL 1K4JA 3KS0J 3UBXA 1FVDB 3HAEA 4GMTL 4GI6A 4HUCA 3ZHNA 5ESAB 1E8YA 4APQD 5HHXH 1OAYH 3I9AA 4QRPD 1VGKA 2J57A 2CGZA 4RGMC 4ZUTB 4KK9D 2AE6A 5LYIA 1V10A 2AMGA 3BLNA 4LOEA 1HAUA 1OB1A 2SODB 4X9IA 4MA1B 5L0QC 2CBPA 2MQGA 3FTSA 4HIHA 3DARA 5TE6L 3QEQB 1LP9A 3OJDA 1ASQA 4W9JC 2X87A 4Z7VA 4PREA 1F4YH 1J8HB 1T1YB 2NTFB 5AW8B 3IVKB 1Z5HA 5DF0A 1LO4H 4YR6B 5M94B 2QQNH 1T3FB 3KYMB 4WEEA 3O6FA 1MEXH 3ZE2F 2V17L 2ZP9A 1ZG8A 2UZYB 1GGCL 1E9QA 3L9YA 1E27A 4XN2A 2WBWB 2OZ4A 3D68A 3DDDA 1UVQA 2KL6A 4AH2B 3IWGA 2WXJA 3UTTE 4GM5A 3CD4A 1RUKL 3V79C 4HMDA 3BP7B 1E3FA 4GPVA 3FMCA 1J05B 4EXPX 4RFEA 3GXDA 3T2LA 3J07A 2J44A 1PYWA 2H32H 2CLRA 3P2BA 5I1JL 3D34A 1YMME 1NEPA 2O5YL 3QAQA 1JK9B 3IXAB 3CAFA 7PAZA 3TCLA 5F6IB 4ZUSB 4WK2B 1FUNA 4IJ3C 5JHDB 2BEIA 5T5FL 3LEYH 4KTGA 1NSNL 4V1DE 4N0UA 5CEXA 1P2CA 3FU6A 5E4OA 3UTSE 4HKJA 5HHME 4TSAL 1KCUH 1EGJH 3V8OA 1D5XA 2VW4A 5B7MA 5KZCB 5LYLA 4BFRA 4RUHA 1CL7H 1CXKA 1JF6A 2P26A 4LOUC 4A31A 3VTMA 1JBJA 4GBXD 5EUOA 4E9LA 5F7DB 5IGXH 3CXSA 2JJUA 2MOGA 4XN5A 4QRFA 4D9QD 3SDCB 5L4MA 1T1WB 1XCTA 1DBJH 4NQXA 1Z0NA 3QUXA 5I5JA 5F9DC 3ZSTA 1ARLA 4XPHL 5KUKA 4PPZA 3WIIL 4NFCA 3CH1A 2XZAL 2WXLA 5DEFB 2X7BA 1Y0LA 3EYSL 5T3XH 1UKTA 4PP2B 1YLEA 1H8LA 2HLEB 2Q7YB 1MHCA 4NEXA 1LANA 3S37H 1KLFB 5LUMA 4BUHA 1YQEA 3V4VB 2X4QA 4Z7UA 4NQEE 5CBMA 1A7NL 2Y7QB 2GQHA 1QO3A 3SEPA 4Q52A 1KYDA 3GSNB 1XMWA 2WXGA 2H2PD 1AANA 1KLGA 2BSEA 3KVDD 1BFOB 3GPSA 3SCMD 2BFVL 2X4PB 1U0QA 2BIPA 2DMKA 4Y1AA 4NHUB 2APSA 5LAXB 4KXZI 1KDIA 1Q9KA 3BGMB 5TE6H 4POZD 3GZPA 4UT7L 3SE9L 5IQ7H 2BCOA 3TEYA 1KV3A 4WWKA 3IDJB 2GJ6E 3L3OC 1YECH 1JGEA 1FGNL 4IBTA 1KBGL 1WUZA 3W9DB 1MVUA 2UZIH 2K5TA 4NJAH 1BMWA 5FGSA 2HB6A 4D7PA 2H7WA 4AYEC 1AXTH 5B4MD 3NP3A 4MAYB 4R7XA 2IFFH 4FNPA 4PJ8B 4EOWH 1G1CA 1DVFB 4EUPH 2AFXA 3SDDB 3U83A 1F2OA 1EHNA 1P6AB 2CF4A 4KOVA 2PW1B 4OKDA 4NGSA 3B2VH 1H0DA 5DJYA 4KS9A 2CK0L 5TK2A 5AB2A 4J5VA 1AVAA 5BO1H 5C0EA 1DN0A 5CEYA 1WT5A 4DKDC 1CI5A 3V4VL 2G2RB 1RXTA 3GSOB 4F7CA 1BBJA 5JOPE 4P2RB 3AVEA 4FHJA 4ZSOA 2VDPL 1A6VH 3DOIA 5IHWA 3K1DA 4N2AA 1YX0A 3T3ME 3HZ3A 3QJRB 1XGRA 4K94C 1E9OB 1HKLL 2NT0A 3RWJB 3T8XA 4BDVA 3GMNB 3TT3L 1BF8A 5CEZD 3KASA 4OD3L 3VH8A 5E00A 1M4IA 4Y5VA 1BZOA 1R3LA 4P5TA 1ZT1B 4DP1X 3VB8A 3EYVB 1B4RA 1L9TA 5DC9B 4LRIC 3NJIA 4RZCA 4PRDB 1KTLA 1Z9NA 4OAWA 1ZHLA 2AP2A 4K5PA 3BAIA 1JDDA 2O26U 5JW4R 4ODWB 4KHXL 2X05A 3MV8E 4JHAL 3Q3GA 4U1HB 2YRPA 3L7EA 4KI5F 4QRTB 2K7QA 4U1SB 1XIWC 1CD0A 1HFUA 1CBJA 1FP5A 1TMQA 1YEWA 2WYZA 1E0OB 2V9RA 2GBUA 2RHEA 3DROB 2Z3LA 2XY2A 4I18B 2NXYC 4XWOD 1DCEA 1TKJA 4CMMA 3N04A 4K3DH 2Q0YA 3C5ZA 2ZEGA 1CG9A 4PGJA 3T1WA 5T1DL 3QUYC 2WQUA 5K9OB 4JY4B 3RWEB 1D2OA 5I1GL 3S37X 4TRPH 2VE6A 3T3PF 3IVKA 4MB3A 1YNKH 1KIPB 5FDYA 1F1GA 4JHWH 4CSSA 3CBRA 1YNTB 2DLGA 2CHNA 1ZS8B 1CYGA 2FEDC 2JE8A 4PGBB 1PJ9A 3FH5A 1U8HB 4NRXB 3DMMA 3JZYA 1MEXL 3OX8B 4LASH 5E5MA 1NBZB 2JTDA 3GIZL 2GFQA 3ZT5A 2OW7A 3RFZC 1P1VA 1OM3H 4KHTL 2F8VA 5D6DA 4QRUB 3R0NA 3K71B 1FO0A 3TFYA 3VXQA 3BZFB 5D7LA 3VE0A 2DLIA 5I6XC 2MTPA 3LN9A 5IQ9B 3ZHDA 43C9B 3KZWA 4FD4A 3WJJC 1XF3B 4DERA 1UXWB 4Z5RA 4BBWA 4XNZC 2VXQH 1JNLH 2WXMA 4HIHB 3WOVA 4LOVA 4OZGE 1HQRB 4OM0H 2YMTA 2AFSA 1A6TB 1TIUA 2PR4H 35C8H 2HFFA 3KNBA 3DETC 2D73A 3RGVC 1C7SA 4KO6A 5T5FH 1AZBA 4IW4C 3TN0D 3D9AH 4B27A 4AYDC 5G55A 5C1MB 1DQML 1HXYB 2DMHA 2NY2C 3A23A 3O8XC 2VO5A 3PL6A 2N1TE 1Q4NX 1MOEA 1S7WB 4TUKL 5HVFA 4NO5B 4L4TE 5LCVA 4CMHC 3PB8X 4FJ6A 5BV7L 1M7UA 1I1RA 1TVHB 2OL3A 3F8KA 4B41A 4WUUB 2YUVA 3OR6A 4HWUA 2WXQA 4K8RH 5FCUH 3S34H 4B9CA 8FABB 4RSYA 1UZ8A 4BXVA 5KBNC 1VACB 3M07A 1Q0YH 1BWWA 3RZWA 3LNIA 2YRBA 2O5ZL 3D2UA 4KJQC 4CU8A 1WC7A 2BSDA 2UUDK 4TF4A 4E0RB 4KZ0A 2Y2TA 2NNAB 3GPEA 4PRBB 2D2CC 3GMPB 3QYMA 4S1QH 1AYRA 4GI8A 4GW5B 5DCCA 3BUDA 1UXSB 5CILH 4MJ8A 2KC0A 1RZPA 4PI0A 4U7KA 3SBWA 3BJLA 3ZDZF 3NSCA 2C9RA 2FJGA 1OAYL 2Y5TA 5CKAA 1TTCA 3SKNA 1YCSA 3GRGA 3TH4T 2KH2B 4HSCX 1M3IA 3OR7B 1S7SB 4HT1H 1BWMA 3LPPA 1N64L 3L4XA 3S88L 3TTHA 3WEBA 4GLRH 5F09A 4NC2B 1SXBA 2LABA 3H1ZA 4P04A 2UXTA 2BINA 3F3HA 1MFNA 1K6QL 3V6BR 4YS4A 3QNXB 3LNGA 5DSCA 3H2PA 1YDPA 5DWPA 4RMBA 3C9NA 3VVVA 1YEEL 2AJSL 2VLKD 4UINH 1N6QH 1CDCA 2AQPA 5I8CA 3UAFA 4YEEA 1FH5L 1B2YA 1GJWA 4EEEA 1U8MB 3CCHA 4MJ5B 3D85A 1F2XK 2VLJD 3QIWD 4WUUE 2GIVA 4ZYKA 1RJCA 3GBLA 4NQED 1KYAA 1LO3H 1XGPB 5EBGA 2WPGA 3V9CA 3SJXA 4JY6B 3MGTB 4G7VH 5BWAB 3H85A 2J3SA 4HJGA 4QRSA 1IQDA 2EIKB 2JKLA 4QRRE 5TGBA 4YO0B 2ZOLB 3ULVE 2FT6A 1LGVA 1CE6B 2ADJA 2BXZA 4AEIL 3RVUD 4O2EB 5D8JH 1ZDQA 3EDKA 4NSKB 5AWNH 4JDZA 4OLVL 1BMZA 4HUWA 5EF1A 1AQDA 1ECYA 4G8GA 4ISVB 3UFIA 1ACXA 4TOYL 1PL3A 4WW1B 2HRLA 4OKVA 1CD1A 4JFPA 1JPGA 1VPOL 3X14A 1GSMA 3S88H 3QB8A 1TVHA 2OL3B 5IP4A 1A1MB 1UXLA 4ERSH 5JHLA 4ELKA 4JNXA 1FT7A 5C2BH 4S1SH 4OLWL 1WCBB 5D1XA 4GBXB 3TA3B 5J11C 5DS0A 3QIBD 4MKMA 2NY0B 3DYMA 2ED8A 3PHQB 1M4KA 1PIFA 2VW6A 3ECBA 3QHTC 5SWZE 1KFAL 1VADA 1P5VB 1IFHH 1URIA 1C5BH 5GRUL 3ZDYF 2H26A 1MNUH 2F0CA 4TQIA 2WBJA 5FO9B 3DK0A 1J18A 1ZWIA 3ARBD 2ENYA 3ILPB 4HK3J 2X9ZA 3H8FA 1BD2E 4F7EB 2VRQA 1ZJBA 1IBHA 2NXZB 3FOMA 4J8QA 4ZT1A 5INDB 4QXGL 3CE1A 3L3JA 1HU8A 4JFFA 3N1GC 4W9DC 4C57C 3K91A 3HE6A 3K0YA 2EVNA 4FZEH 4LLDB 4EN3C 2OJEA 3PBBA 4HC1H 1AKJA 1QLRA 4U1MA 3QQ9C 4G6ML 4F24A 5KBDA 3KLHD 2XJKA 3TO2B 2BSTA 4KORA 1YYMH 4GQQA 3IFOA 4DZ8B 5EF3A 1AJ7L 3K0WA 4IOSA 1CPSA 4YK4B 3L5XH 3CFQA 1T21A 5L2KA 1WIPA 5EU7C 3CDZA 5T1KB 3AXIA 1CGVA 3RIAF 1A7RH 1UGNA 5EU6D 1CFNB 5MENA 1OAXH 2BCMA 2VUKA 5DQJB 5MHSD 1AP2B 1G9NL 2XTJB 4NM8L 4OLUL 4FTVD 4WUKL 3VXMA 1KGWA 4X6CF 4A1RA 5C0AB 2IMNA 2EVFA 3CPLA 1HZLA 1WJ3A 5DHXB 4MDIA 1NMTA 1HH9A 3T0BA 4A7UA 2VNCA 4OM0L 2PRBA 4PRPE 4NHCL 3UY5A 2CO4A 3EYFA 3T4YA 4MCZA 2YRZA 1OGAD 2PYEE 4K2UH 4NB7A 4I1NB 5F3FA 1A7RL 5F7EH 2DEAA 1NOAA 2J1WA 2I5YL 3NPSC 5C97A 2I79A 2O61B 4NNYA 2WXHA 2DQGL 3BQVA 2F5AL 3HPJB 1ZTXH 4L1TA 2NT1A 4W9ZA 2AF2A 4JM4L 2VISA 2VDRH 1BLIA 1QFUH 2WSPA 4CMHB 4UIBA 3VGAB 4KOYA 5KYUB 2FJUB 4HC1L 2ZAHA 4LU5H 5LDUA 3ATFA 4KVNL 1LWJA 1ZK9A 5HHOE 3VXQB 3CZUB 3KPTA 3FO0L 3PL6B 1QZ1A 1DL7L 4OCSL 4LHUD 3C8DA 5EA0H 4ZZFA 3NA6A 3AT9A 3IGUA 4TUJA 4LZKA 3BWAA 4I9WD 2AGJL 4Z8FL 3B5GA 3G6JF 4JM2C 4HCFA 4U6VH 2ITDA 3LJ3A 5KYNA 3OHXB 4PJIF 3KNBB 2WHVA 5GRUH 3W6SA 4W1TA 3K71A 5C0CB 3OZLA 3VXRB 2B1AH 5SWSB 1ZHNA 2EDOA 1KTRL 3BIAX 4B7LA 3V4PH 1UXWA 1N4XL 2PO6C 3DXAB 3RP1A 2W07A 3EFDH 3I6KA 1B0GB 5D70H 5ALCL 1E30A 1FO0B 2LHAA 1B0RB 3DVIA 4AEFA 5HBBA 5HVFB 4S2SB 4X5WB 4U31A 4XCNA 2ZOGA 5MP6H 3SKJH 4Z7OB 4W9CC 5DHDA 2ZELA 4F15C 5CLYA 4PJBF 2J8MA 1WTGT 1NC2A 2XVBA 2O6PA 2OMTB 3ARRA 4XVTH 1G5AA 5ELIA 2VGLM 4G7VL 1KDJA 2CKBL 3GO1H 4K3JH 1KCVL 5IR1B 3TZVD 2FL5B 3RFZB 1MLBB 3QYCA 3JTBA 3V4PB 2XQYG 3B37A 4IHBA 5KJRH 1WIUA 3MBED 1Q90A 1GJUA 2YS4A 1KEGL 1HHHA 4XRCA 1CP6A 1YVKA 4OZHA 5ECGA 3MNMA 4J4PA 1Y7VA 4LEOB 1OV8A 4DF9A 3UIZA 4HH9A 3C87A 3GTTA 3TEWA 5DTFB 4QEGA 4W6WB 5BZZA 4LCVA 1WTLA 1IGCH 4Y9CA 2OB0A 3G5XA 3O4OC 4PIBA 5HJ3B 4FFYH 4WRLA 2N59A 5D9SB 2O28A 3QJSB 3GM8A 3OX8A 1AE6L 2BO9A 4HFWA 4ZG1A 1PCSA 5H35B 2MPAL 3QPQC 3BESR 5BZDB 2FEJA 3PAVA 4G1EB 5BVPH 1A6TA 1A7QL 1FGVH 3TN0B 1SBSL 4JXRA 4DW2L 4BQ9A 3RBGA 1QTSA 3MN8A 1PKQE 1S7QB 1CMOA 3RUGB 1A4CA 1F90H 4PG9A 5KSAD 43C9A 3ULSB 2Z3FA 3KHOA 3W3BA 5IV2B 4NSQA 5EBMA 1LE5A 3P77A 1YEDA 2C3GA 4PJ7A 3VFOA 1X3DA 1TVBB 3HW7A 4NAMA 4R7DB 2F15A 3P30H 4YSRA 5G22A 1H19A 1YQ2A 3MRHA 3C5JA 1JMXA 4Q4IA 1G1YA 3I3EA 4FN0A 2UVFA 3S36L 4JJ5B 4X7DC 3S96A 5FECA 5JMRA 4PGDB 1A2ZA 5GISL 1U2HA 2BNRB 4PY7B 3FQRA 1G6RB 4MAZA 4R9HA 4UQ3B 3PGFH 1TQCB 5DJ8B 1OAJA 2NSMA 5KVDH 5AW6B 3ARDA 3MJ9H 4N85A 5DD0H 4NM8H 4OLUH 4XZ4A 1MFVA 5D2LE 3N1FC 2L0DA 4K23H 5DK0B 4BCXA 1R5VA 3HNVH 2DQEH 1CTNA 2VQTA 5EOCJ 4DOHB 2AEQL 2EXWD 4KKNA 4R7MA 5I1KH 2QMLA 1TETH 1GJIA 4EUPA 4KVCL 4X98B 4FXGB 3ZE2E 4ANKA 1N5YL 5CSZB 4YHNA 4RNRB 3LQAC 2ENQA 4LL9A 1EXHA 5B38G 3LPFA 4AM0Q 1J1OL 4ZSOB 4YE4H 2B59B 4E2OA 4OUUA 1A4BA 1PD6A 5J4MA 1KEML 1MWAH 4QR7A 4ZAKC 3ZTCC 4X6DB 2OOTA 2WTOA 3UZVA 5J3HC 4G43A 3Q43A 4ABWA 3KWWA 4LEOA 5EN3A 1CICD 5KAQF 1R3JB 5ANHA 1BOGA 3WKNA 5GGTA 5A7EA 4ZUVB 5CR1A 1AS8A 4N3TA 2LW3A 5FK9B 1HDUA 5ANMB 2ZP8A 1DFBL 1S9VB 1U3HA 2OX5B 5HGAB 4MCMA 4BFEA 3L4YA 4F37F 1S5HB 5PAZA 2ZOKA 3NSYA 4OF3A 3G3SA 1BZ9A 2DIJA 4N28A 4PJFE 4XGZB 2A5UA 5LGHL 1P7QA 2EO9A 3ZW3A 3MLYL 1U6AH 3VO0A 2RACA 1NC2B 3DX3A 2QSCL 4ZUSA 3GJEA 3QO0B 4MJIA 3DX8A 1QFWH 1TZ8A 2EDMA 2P52A 2HUEA 4F7MB 4NWTH 3F7QA 1QHPA 3G08A 1TNNA 2HX9A 4JQXC 2I07B 4BFKA 4X6BB 3VXUD 2ZXWB 4PTUB 4U1JB 4LHQB 3CJJA 3KPPB 4XX1G 3U0PA 2VERA 1OE1A 1RULH 4P5SA 3BSHA 3VCLA 4G7QB 5CNHA 2E9IA 5IB3A 1FQ9C 5KJ4A 1YSJA 3EAKA 1YEFH 2WLMA 3Q2VA 4E68A 1UB6B 3F12A 4UILH 5FYJD 5BS0E 1ZHNB 1X5FA 2MQ3A 5E7BA 1YEGH 2X1XR 1I3RA 2QADB 1U42A 2AVGA 1DBAL 3ZTJG 1G9MH 2J6EA 5BUAA 4PREB 2G2NA 4Z7VB 2Z31A 4X9YA 1N6VA 3S97C 3ET9F 3ML9A 4FI8A 2I9LA 4Z95L 2X6UA 3GO1L 4S2SA 4U1KB 1TFHA 5IEHB 5AB0A 3S3DB 1MIEL 4WY7L 1YEJH 3Q13A 2EDLA 3HBPA 1AP2A 4HEPA 4YXLL 4PWKA 5D93B 2CBMA 4FKEA 1UVQB 1LP9B 3OJDB 5F9OH 4AH2A 4QHMB 3KM1A 2NY6B 2X6CA 4AMWA 5DLMH 2FSEA 3WL9A 3G6JA 1CCZA 3N0PB 3KYKL 4G6FD 4WLCA 3N42F 3N5FA 4MZIA 2E9BA 2JCCB 5HHMD 3U30B 1QLRB 2XWRA 4XPDC 1KPRB 5FA4B 4X4YB 4KTEH 1QNZL 4FX5A 3U2SA 1LWHA 4KVPA 2EEXA 1JRHL 1IE5A 3LRHA 2X2JA 1GIGL 1RVFH 4JVUA 4H20L 3MRFB 4MAUH 3LQZB 4ZO8A 4YXKH 4D7BA 5IG7A 1S7KA 4MMYB 3MA7B 5JIIA 1CLOH 1TG8A 2G3NA 1OT1A 4L8CB 1U3HB 1MPAL 5IIEA 4M6GA 2YKLL 4TSCL 3H5ZA 3L08A 4B5EA 4WWNA 3O2DA 3ZYJA 4YUEL 3QG7H 3AS1A 1E27B 1RLBA 2ROYA 4I88A 2IXQA 4A2ZA 1GPOL 2GIYA 4P23A 3QCVL 3UADA 4WEBH 3L3DB 2P7TB 2WYIA 4YSAA 4NUQA 1Q9OA 1RV6X 1A9BB 1IQWH 1WS8A 3GIUA 4RN7A 1NMAH 1HX0A 4P4RA 4DGIL 3THML 3ZDWA 1DP0A 3ZRCC 4EDXB 3LKQB 1A7PL 1ON0A 4LPWA 1FNGA 3BUBA 1NEZG 4MWFB 2GY7B 1MFBH 2FD6L 1IAIM 4WSKA 4X9FA 2XKUA 2G5BA 3BH4A 3OGCB 3T90A 5F70A 3KR5A 3LQMA 1CLOL 4IRSD 1CGSL 3O81A 5J06A 5DMGC 4ZTPH 3V5KB 4QBJA 4JQIA 3TASA 1K4DB 1ZE3H 3T4AC 4P23D 5ISZD 5ICUA 3S98A 2DXQA 3G08B 5E94B 4BQ6A 1NCJA 4P59L 5DXWA 5I6PA 4WIQA 2H4EA 2OM5A 1IVTA 2AABL 1AFVL 2R51A 2ZX6A 3PV7A 3BQUC 2CIKA 5IUCA 3LIZL 5D4QA 2CRZA 3IPBA 2Y07L 3ZPDA 4M56A 1JP5A 3CMOL 3PQYE 5DI8A 2REEA 3IKCA 5AD0A 3RY6A 4ZNEE 2NNFA 2GJ6A 3FFOA 3QQ3B 4OZFH 5FUZL 1W16A 2HTLC 3OMIB 1IEAB 3VQLA 1JGLL 3DJZA 4Y1AE 5A2CA 4PLKC 1LWRA 3MOAH 1IGJB 1KBVA 4GY4A 2KI6A 2P8LA 2AXGA 5DJAA 4DKFL 2FH6A 4Z3EA 1AG0A 3CUPB 3PJNA 1X9LA 1OT2A 1NBVH 3HFML 4LPUA 1OHQA 2B20A 4JZNA 4NGQA 4N20A 1DE4A 1YYLH 3EHBD 4MD0B 2E7CA 3T6VA 5KSBF 5C3IA 3BISA 4ODSH 3SPVB 5ITBL 5LDSA 2ZW5A 4XNUH 4J1UB 4PJFA 2WCGA 4NZFA 1ZG7A 3BSZA 4BKLA 4BSVA 1MDTA 4IUSA 3FO1B 4G7SB 3CSGA 4MBUA 1X5KA 2D4PA 4PJGF 4JM4H 3S3SA 2E7HA 1ZGLB 1BLLE 3TVMC 1TXRA 2JLMA 5KS9E 2VR8A 1OZUA 4LL1A 4WGVB 4XNDA 3MNZA 4HXAL 4NC0B 4B3VA 1S7FA 2V8VA 5GRJL 4KITB 4MA3A 5LLIC 2Z1PA 1KXQE 3NJLA 4ONHB 3NAAL 1CURA 3QEGL 3HR5B 5L88H 3K7UA 3FH8A 4LO9A 2E7BA 3FBQA 1FA4A 1DBMH 1OOWA 1B3IA 4NIKB 5A7BA 2H3XC 1M1DA 3DGDA 2D7QA 4K7PY 4XPTH 4WNQA 5CIPA 3HC2A 1DUZB 2BRQA 3BPCA 1CVRA 3B9KA 2ZD0A 5LQBH 5GGSA 5JLZB 3INUL 1OP9A 1PTZA 3NDZE 3EJZC 4PPTA 1F00I 1P9MA 2V7NB 2WWOA 5C0JA 1FH5H 3NSFA 1DBML 4ZXBC 3I3BA 1SF5A 4GQPH 5IVXF 3RVUC 4H89A 3I75A 1AJ7H 3RWGB 5E8NA 3F0AA 2XBZA 3NFPA 3GT6A 4JDEA 4RFOL 1JZJA 4X9HA 4MJID 5J57B 3RIAK 4W4OC 1JNNH 1P7QD 2X4TB 2MSPA 2NY6C 1HSAB 3B3IA 4Q9QL 2G9KA 3VXPA 4WY7H 3DYOA 3OG6B 3R1GL 4GKSA 5I74C 2BOAA 3MLZH 5FA3B 1O7DE 5EN2B 3O3BA 4AYGA 5KS9F 3ZZ1A 4RMUA 3QORB 1FYTA 2A9DA 2CO6B 3C08L 1YJDH 1QFHA 3QG7L 4YFLI 5E6RB 4F8NA 1V3JA 3F7YB 2NUTA 2WJ7A 5I17B 1CM0A 3NMEA 2KBGA 4XPTL 3MJ9L 3K6DA 3FQ2A 3KPLA 3I74A 1OTUD 4GW1A 4KY2A 5ETUA 5KVDL 1YN6A 3KW7A 5JHLL 3QBTB 3JWOH 5JYMA 1FZJA 1SHXA 2AV1B 4GYBA 4P2RE 4UOW0 3N06B 2ADFL 2Y36L 3UBGA 1RFDL 5HDBB 1U93A 1LO5A 4NF1A 2B4DB 4PJ8C 5JIPA 2VDLB 3UJTH 2J1ZA 1XRYA 4FTVE 1B4JL 1X9UA 3LWUA 4R6TA 3FCUB 4OIBA 3UMNA 3HI5H 5FCSH 4KOTA 1EFXD 4HMEA 4Q7AA 1UM4L 4UAOB 4WQOA 3EJCA 4APXA 4JZNB 4FA7B 3AFLA 5HDWA 3HBGA 5F7MC 1UH2A 2CKBA 2ITCA 2E9JA 4P5MB 2ICWI 4JX0A 4IAVA 1UURA 5IJKC 5MERB 4PGEB 1XTLA 3MC0A 4ZMXA 1ROCA 2G9HA 3B9EA 4PJ8D 4PJCA 5DGQA 4YLBA 4UQ2A 3G6DL 3JYCA 3T09A 4KJWD 4JXQA 1A65A 3F65A 2R56H 4Y9FA 1T7WA 3BYTA 5E00B 1YY9D 4J8RB 3EBAA 4JN1L 4FFYL 2VXVH 2AZAA 5F7FA 1M2VB 1BG9A 5D72L 3AM8A 1S7XB 5IEKA 2ETWA 1RZ7L 3KGQA 3SDCD 5CEZE 2XX0A 3CMOH 5DMGD 3FHQA 4NQUA 3SDXA 1FL6A 5KSAA 4X4XA 3ZGIA 1F57A 1GA2A 3L9EA 3APCA 3L7EB 4J6IA 2OSWA 4A2GA 1DUZA 5A16A 3DMMB 3UIYA 1NAML 5IB1B 1F45A 5F96H 3T2NL 4D0BA 2YZ8A 5BS0A 2D9QB 1J0JA 2VDLL 4DP2X 4WKXA 4P59H 2QADD 1XH0A 4WVRA 3SPGA 4B9JA 2QQKL 2DQIL 2WBJB 1W72B 43CAA 4IM8A 4MYPA 3LNDA 5JZ7C 2Q6WB 5DZJA 1ORQA 3D3VE 4DK3A 4ELMA 2NXYB 1RO5A 2W65B 4CC4A 3ULUL 5E9NA 3UTZA 2L7EA 3GI9H 2YMOA 1RK1B 4Q2ZB 2NOYA 2FGWH 2BNUB 3EFFA 4MWFA 4OCWH 4XP6H 3ZJ0A 3T2PA 1AZNA 3QCTL 1RUPL 4G42B 4DKEH 3DIDA 2ARWA 3KCWA 1T03H 1TUPA 4Z3GA 3MBEA 2BOLA 2W0FA 4FQHA 4YN3A 3AAZA 3V9FA 5MEOA 3T0WA 3MV7D 4OM1H 2QQNL 3BXMA 4ODWA 3BJ91 5ADPH 5F47A 1I8AA 3IMVA 4Y1AB 4XO8A 5AYTA 2FHBA 2TSBA 5GZOD 3W0WA 2J5LB 4MNGE 2PYEA 3DYPA 1CR9L 3AXLB 4FQXC 4BUQA 5IREA 2Q4VA 4GS7B 5ACZA 2ZOLA 5TGBB 1KTKE 2X7LA 2OS7A 1N0LB 1GYCA 1WFOA 3UO1H 5L9DH 3TVMB 3S6KA 3ES6B 5EOTA 1ZPLA 3CXDL 5HI5D 1F6AA 4XP9H 4LKCA 3TS8A 2B5IC 2Q7NA 1AKJB 1IC1A 3B5TA 4MMYA 4U1MB 3KGUA 1JTPA 1EBPA 3HR5A 4N90E 4FNLL 4M7KL 4JDEB 2A2QT 1IILE 4BSWB 2NNRA 2J7LA 2RGSA 4TVPL 1A1NB 1OAQH 3OVUB 1OARH 5C0EB 1RLWA 4L3ED 4GRMB 3WUWB 4YXHH 2NMSA 4WAFA 4HH8A 4P5KA 3GJFA 5GS1B 4X0KA 1FJ1A 2XTSA 5L6YL 1TTFA 3VFPB 4Z7OF 3VRJA 4XZUA 2Y5TB 5DURD 4A7TA 4D0CB 5BO1L 2HT3C 1AD9A 2AJVH 2DV6A 1LEKB 4UNUA 2AXGB 5DJAB 1FNGB 3W9DA 2FYYA 3QVAA 4I0PC 3V4LA 3WT4A 2B5GB 5CZVH 4QUSA 4LCCC 1QATA 3ESNA 4TUOA 2BVUA 2IGLA 3O6LL 1PYWB 1A9BA 3GZKA 4OFYA 3RWFB 3NCXA 3EKCA 2NNCA 1W6WA 2E59A 3EH5B 3ERXA 3PPEA 5EOCL 4L4VE 4G8AC 2OR9L 4KKRA 4JQIL 5ISZB 4G72B 3FEDA 5KBKA 5FV1L 4YHKL 2VJ8A 1YEGL 3O4LB 1SMAA 1OGAA 3IWUA 4OCLC 3M45A 4I9WE 3NJVA 4NKIH 2CK2A 4ELDA 4JFDA 5E5UB 4U4BA 4QY8B 3OJVC 4YSDA 1GYAA 1S46A 1FBIL 3FB5A 4HHGA 1RJYB 3K6NA 4OZ4B 1L9NA 2HRPL 4EQ3A 3L17A 2WKGA 4FTVA 5E2VL 1NCWH 2FSDA 5DRWB 1GCYA 5JOPD 5HTSA 4WJG3 2Y4SA 3GS7A 2F8HA 3QARA 4GAYB 4R97C 4R5TA 4F9PC 1OF2B 1YDPB 4MJIB 3WS3B 3MV9B 2IL4A 2PC1A 2Z4QA 4FQ2H 4NQXB 5HHOD 2RB7A 2C6PA 1LTXA 1IAMA 3P0GB 3DGCR 1XZ0A 3QJOA 5DDHB 5JUEL 2PF6A 1C9SA 2PE3A 5HGDA 4V2BA 2WGNB 3HUJA 32C2B 3DV4B 4MB4A 1UD4A 2W9LA 1ED3B 5F1IB 4L8SC 1MCBA 1HI6B 5LYDA 3U30C 4P4KD 2D8KA 1KB9K 1YVOA 4JYWA 3LAFA 4YGOA 2ZUVA 2IDTA 3EOAB 4NQCA 4WFED 3I9GH 5D7LB 1OCWL 1FFNB 2CR3A 3MRKA 3PAZA 4IKNA 2QVMA 3BE1L 2NY4D 1IIDA 1RK0B 1PF3A 1LRZA 2EO1A 2BXYA 2P24B 1QRNB 3LRLA 4Q6IB 4TTDD 4AX3A 3S36H 1TZIA 5JPNC 1IGYA 4OF5A 5AOMA 1WA0X 3QUZC 4YX2H 2DTSA 1PZ5A 3II1A 3LYRA 5D70L 3M1OA 3ZKXB 1U6MA 2EDHA 5JHMA 3CSBA 4C2XA 3VFRB 2RFXB 5CINH 4P4KC 1HN1A 1QFWM 1NLBL 1KYOK 1KGCE 3BQUD 3MRLA 4OQTH 1KIPA 1JDCA 1LXMA 4YFDB 3S5LB 3VSTA 2J8NA 4K30A 3UTSB 4B10A 1N8OE 4F8LA 3Q7JA 2DOCA 3FF7A 1RK7A 3ABKB 2B1AL 2M2DA 3M1BB 4Z3IA 5IBLD 2VR9A 5H37A 4OJEH 2HVKA 3GINA 1NCBL 5TDNB 1AH1A 4NPKA 1VFOA 2IPUK 2E9WA 1K85A 2K6WA 2W94A 2MPAH 3W39B 1MAML 3DHJA 4Y5VC 3RJQB 3P4NA 5GSRB 5FKAB 3N85H 5IQMA 4MJJA 3U4AA 3IJ8A 4JLYA 4FQIL 1AGEB 1H3TA 1WISA 2YOAA 4JFOA 4H20H 4PG2C 1FNLA 4QD2E 5D1ZA 3UYRL 5B8CA 2ZUQC 3BKYL 2ZOKB 3KLLA 4J3UA 4L3CA 1VZIA 3CZNA 5AAWC 1AQHA 2Q8AL 1R3NA 3CFUA 2EUWA 1KCRL 1TXKA 2FBRA 2PYFA 3O2VL 3RIFK 4Z23A 1QHOA 3QO0A 4ZMAT 2JF1A 2WNXA 4HHWA 4FXKA 4POZC 3QWOA 4YK4C 5LRKA 1Z8XA 3B9KC 5HYSB 2TRYA 5J9PA 4L3EA 3VGFA 1A6WL 3FB5B 1KYUA 3HJEA 5IT2L 2UYLB 4OUUB 2Y1AA 1XCQB 4N5EC 3GRBA 4Q89A 3OXSA 2GY5A 3CFKB 1BYOA 2A9CA 3VDCA 1CGUA 1UKSA 3PYCA 2VYRE 4H5SA 4DETA 1SHMA 4KDVA 2OW6A 3H8EA 1PW3A 4U6HA 3BC9A 4KOBA 4LCYA 2EZ0D 2O5NA 1OALA 1R57A 1PFOA 1FVCA 3T71A 5FWRA 4IGBC 4W9YA 2PMZA 3B9AA 1W72H 3FF8A 5E1HB 3QIWC 4FXGA 4HLJA 1CG9B 5A2JH 1CGWA 4MAYA 1DO6A 1CUOA 2AQSA 3C6SA 2OKMA 4OC0A 3RYOA 2XWEA 3V4UH 1LP9E 3JWNE 3N7ZA 2VIRA 3LNFA 3U7YH 4NZTL 3WHXB 2B0SL 1ZANH 3VXRE 5T3XD 1ASOA 3JZ7A 3WY4A 5IMLA 2Q44A 4KV5F 3OKLA 3U0PB 1Z9OA 4PJ7B 3BLBA 2JB6A 4N0CD 4N8VA 2X4OB 3VWKA 2OSXA 5H8DA 1M7DA 2QECA 1R46A 3VB9A 2OTUB 1NBYB 5K9KA 2O4EA 4XPHH 3BRGC 3ZL1A 3FRPG 1XGYH 3MRMA 3GXMA 4X42A 3QZOA 1XE4A 1UD2A 3H56A 3VH8B 3E3QC 1ZTXL 4HU2A 3FXIC 1VJSA 4N90D 2MMXA 4P48A 3F04A 4KRPB 4MDJB 5FLUA 3HKFA 1J0KA 3AC0A 4JO2L 4QCIA 1HEHC 1YMHB 2NXYD 4XWOC 5F9JB 1CBXA 2KPWA 4M6AA 2DRUA 2EKJA 2IOOA 5IFJB 1P7KB 2JXMA 5F7DA 2DQJL 3P1VA 5H35A 3VA2C 4C68A 4YU9A 2AFNA 1J5CA 2OJZH 2P48B 4RX4D 1NEUA 4YSEA 1IYLA 1XF4B 4XMPL 3GXTA 2OL3H 1L6PA 4XO9A 3J8F7 3UO8B 4JFHE 3K4AA 4HKJB 4H0LC 4IKJA 2F1AA 4ZFOL 5DZOA 3QCVH 2H0FA 3EUDA 3U2JA 5DUPH 1E40A 1JTTA 3BVNA 3P77B 4PTTA 4FQLH 1HCVA 2YLKA 4XPBL 3SJVA 5JHDA 3QQ4A 5C0AD 4AXWB 3X12B 3QORC 4N26A 3MVSA 4G5AA 5KVEH 3K9TA 5JQHC 3F5WA 3HB3D 5I23A 2YD9A 1XJOA 1VENA 2JBKA 1HL9A 2QPEB 2P46B 5CWSA 5CCHE 4G1MA 4BINA