1H8LA

Duck carboxypeptidase d domain ii in complex with gemsa
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
380
structure length
380
Chain Sequence
QAVQPVDFRHHHFSDMEIFLRRYANEYPSITRLYSVGKSVELRELYVMEISDNPGIHEAGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVQSTRIHIMPSMNPDGYEKSQEGDRGGTVGRNNSNNYDLNRNFPDQFFQVTDPPQPETLAVMSWLKTYPFVLSANLHGGSLVVNYPFDDDEQGIAIYSKSPDDAVFQQLALSYSKENKKMYQGSPCKDLYPTEYFPHGITNGAQWYNVPGGMQDWNYLNTNCFEVTIELGCVKYPKAEELPKYWEQNRRSLLQFIKQVHRGIWGFVLDATDGRGILNATISVADINHPVTTYKDGDYWRLLVQGTYKVTASARGYDPVTKTVEVDSKGGVQVNFTLSRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXYPEPTIDASE GP180 RESIDUES 503-882
publication title The crystal structure of the inhibitor-complexed carboxypeptidase D domain II and the modeling of regulatory carboxypeptidases.
pubmed doi rcsb
source organism Lophonetta specularioides
molecule tags Carboxypeptidase
total genus 132
structure length 380
sequence length 380
ec nomenclature ec 3.4.17.22: Metallocarboxypeptidase D.
pdb deposition date 2001-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 1h8lA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1h8lA01
3B3VA 4UEZA 2ZENA 1YW4A 2POKA 1CP7A 1ZLHA 4EMEA 4ONWA 5LRKA 2ZEHA 2VL1A 4X2TA 4R7MA 1NSAA 2XEFA 3D7HA 4P45A 2PJ5A 2C1CA 2AFWA 2PIYA 4TWEA 1XBUA 3WC5A 3KI9A 4PXCA 3MRUA 5K8PA 4JZ0A 5LYDA 2PJ4A 4MXUA 4UEEA 3FMCA 2NSMA 4OMEA 4P4IA 3NH5A 3S9MA 2V8DA 3NH4A 1VIXA 1CBXA 2ZOGA 3FX6A 3NFZA 2Q43A 4FXTA 1VHEA 5JGFA 2Q51A 5CBMA 3LMSA 4FWUA 4MCPA 5LYIA 5D8NA 4YU9A 4FAIA 1VGYA 5F09A 3V38A 2ZEDA 3FVLA 3JRUA 1YLOA 3IJ3A 2G9DA 4FL4C 4MRIA 3WC6A 1ARLA 3K9TA 4NFRA 1CPSA 8CPAA 3DLJA 1UWYA 4MCRA 2BO9A 3B3CA 4ZY1A 1FNOA 5K8MA 2GREA 2BCOA 1Y7EA 3S9LA 2CF4A 4WI0B 3KHXA 3GUXA 4GM5A 2PJ2A 4NGTA 2QYVA 1LANA 1BPMA 4OP4A 4UEFA 4P4FA 4LQGA 3H8GA 3ISZA 3SJGA 3KASA 3KQZA 2Q4ZA 2C6PA 1PYTB 1HEEA 1JQGA 4H2KA 4ZX9A 5D29A 3B7IA 3NA6A 3HUVA 4IAVA 4P4DA 1Q7LA 2AFXA 3D68A 3FJUA 1AMPA 3NJXA 2QVPA 4IHMA 1BLLE 3TC8A 3B3TA 2GLFA 3K2KA 1ELLP 4P44A 4P4BA 4P4EA 3SI0A 4OC3A 1XRYA 5HVGA 2PJBA 1ELMP 4IYKA 3CPAA 2PVWA 4RUHA 4ZI6A 3HLPA 2RB7A 4A37A 3HN5A 2ZEFA 3PEIA 3V7ZA 2I3CA 1M4LA 3PB8X 2F8HA 2GU2A 4NGPA 4A38A 4EIUA 1R43A 1F2PA 4NJRA 4WWVA 4UF4A 4OIDA 2AFZA 2PJ1A 1Y0YA 3FH4A 1RTQA 4FBEA 4UIBA 4DYOA 3FEDA 1VHOA 2OR4A 3BHXA 4MHYA 3DGVA 3PFOA 2PJ3A 2EK8A 3I1UA 1IY7A 3QNVA 4MCSA 3PRTA 4OC4A 2ZELA 1H8LA 2EWBA 3VATA 4P6YA 2J9AA 2AFMA 5CPAA 2ZEPA 4JYWA 4R76A 1DTDA 3D7GA 3CDXA 3SJEA 5AQ0A 1DE4C 2RFHA 4UIAA 1LAPA 4TNUA 2NYQA 3L2NA 3FF3A 3CT9A 4NGMA 2WZNA 4ZX8A 5LRJA 1XJOA 2V8VA 1FT7A 4K3NA 4ZYQA 5K39B 1ZG8A 1Z8LA 3GB0A 3KR5A 3KR4A 2B59B 4MHPA 3PBBA 1YMEA 2IQ6A 4NJQA 1TF8A 1YSJA 2JEWA 4MCQA 3SI2A 3PB7X 5JH9A 1ZG7A 4FUUA 4NGRA 4PXBA 3SJFA 4OC1A 4NGQA 5LYFA 2BOAA 1KWMA 1Z2LA 2PCUA 2PRQA 3FECA 2EK9A 2C6GA 1XFOA 4F9UA 3VH9A 3BXMA 1PCAA 2GLJA 4OC5A 2HB6A 3KQXA 1F57A 3CPXA 1CG2A 5ELYA 4YOKA 4OIWA 3BI1A 3KHZA 3B35A 7CPAA 5HVHA 1NKGA 4MHZA 4NGSA 2OOTA 4PPZA 2PJAA 2QJ8A 1BAVA 2CTCA 1Z5RA 2PVVA 3B2YA 3B3WA 5DS0A 3T8WA 3D7FA 4BD9A 1LFWA 2ZOFA 4Q7AA 1TF9A 3KCPA 4CPAA 3IEHA 4WJBA 2IMOA 3N5FA 4X3RA 3GLJA 4R6TA 1R3NA 4G1PA 3IO1A 2JBKA 1ZG9A 3SJXA 4PQAA 3H8FA 5THWA 2CIJA 3PB9X 4AXVA 3NH8A 1CX8A 1YW6A 4IK2A 2PJCA 4F9VA 1HDUA 2PJ8A 2CTBA 1QMUA 2PIZA 4DUKA 3PB4X 3IC1A 2O53A 4O23A 3D7DA 3NJVA 4R8FA 5G5DB 4W9YA 4OKOA 3WABA 3RBUA 1XMBA 4MHNA 5LYLA 5JM6A 1LAMA 3IFEA 3ISXA 2XHNA 2JBJA 1OBRA 4MMOA 2V8GA 4OC0A 2ANPA 4A39A 3D4UA 1TKJA 2PJ0A 6CPAA 1EE3P 4ZY2A 3S9NA 2DEAA 3LWUA 1AYEA 1HDQA 2PJ7A 1CPXA 2V77A 5K8OA 2FVGA 1GYTA 2AFOA 2PJ6A 3H8EA 1LCPA 3PBEA 5HXDA 5K8NA 2O4HA 1CP6A 5J1QA 2ZEEA 4DJLA 2XEJA 1F2OA 2XEGA 1TKHA 5LRGA 4EWTA 1TXRA 4PXDA 4U3SB 2WYRA 3WC7A 4P10A 1ARMA 4YWYA 1TKFA 4P4JA 5IB9A 4EFDA 3SI1A 3RAMA 2F7VA 3VARA 4OC2A 4PXEA 3IWWA 2AFUA 3TX8A 1QQ9A 3KL9A 1LOKA 1IGBA 3KZWA 3MN8A 2PE3A 5HVFA 3E8VA 1ZLIA 2V8HA 3IIBA 1BPNA 3PB6X 2ABZA 4F8ZA 3B3SA 2XEIA 3PFEA 2HC9A 2ZEOA 3G3LA 4A94A 4KSIA 2IJZA 3WT4A 1Y0RA 2ZEMA 4X8IA 3BI0A 3D67A 2ZEGA 2C6CA 5I4MA 3RZAA 4B6ZA 4ZY0A 2AFSA 3D66A 4NGNA 3FEEA 4Z65A 3KGQA 2PJ9A
chains in the Genus database with same CATH superfamily
3RIKA 4XVJL 1CXFA 3G5VB 1N3NA 2BSTB 2WWMD 1QR1A 1DEEB 3TS8A 4G7VL 3V8IA 4X2TA 4DGIL 5JXEA 2ATAA 1EGJH 1DBJL 1ORSA 2PXYA 5GS0L 3EKCA 1CFSB 4OGQC 4YMPA 5MEQA 4W9GC 1HINH 3FCTB 2ZJSL 5SWQA 3FT3A 4H8UA 4X4XA 5I18L 4WEMB 2BOCA 4KKCD 2OQJB 1W8NA 4K9EC 4QLWA 1F58H 2ICWB 5F0PB 2OYKA 3IDXH 5E4OA 1QO3B 3ARWA 1LE9A 1FG9C 3P3TA 4Z78A 1UT2A 1ID2A 2CR0A 4BBWA 1WBZA 5K8PA 3HZMB 3LS4H 1NGYA 4KAQH 3SDDD 2ZXQA 4U1IA 2XIBA 2NYZA 4PRNB 1IKFL 3LRMA 5ITFA 2B1AH 2JXMB 4MQ7B 4I9XA 3KAAA 4V2BA 4P3CL 5IT2H 1Q72H 5T33H 1II4E 2FECI 2H1XA 1S7LA 5AAWC 4S0TD 3MCKA 4P59H 3UXFA 3LKQB 5FCUL 1AZCA 2ZOGA 3QXTA 3KH3A 3NIGE 1MY7A 5EC2B 3DSFL 3BVXA 3GO1H 1KYUA 5HHMD 2YZ1A 1UACH 1G5GA 1A7QL 4JM2C 4LEOB 1FFTB 5LYIA 5JIKA 4HEMA 1ORQA 1RZ7L 4MFHA 4BUQA 1M4KA 3IU3A 4K8RC 4OIIL 1BEYL 3VD4A 1N9PA 4L8CA 3LN5B 2JMRA 4ZX5A 3LXAA 3CXDH 4HKJB 4YSRA 4NM8L 4OADA 5D93B 1UM6L 4O58H 4AE0A 2F5BL 5CP3A 4LLWB 5F7EH 3NEEA 2FVNA 2YEVB 1H8SA 2WQWA 2R83A 1CFVL 2YKLL 5FFOA 4UT9H 4HPYH 4HNXB 2Z31D 1PDKB 3JV6A 4Z0XA 3ARDA 1YJDL 2HZHA 4N3UA 4NOFA 3G04A 1I8AA 3DLJA 3ZE1B 4LCCA 1NDGB 1QWNA 3JWNG 4EUPB 3D4CA 4L8SB 4JZNA 3JYCA 3MR9B 2F19L 2XV3A 3ZRSA 2B5GB 3DVIA 4YS4A 5J8FA 1TJXA 1ZTMA 2WVVB 4FHJA 1XH2A 4M4PA 2VITA 4GLRI 4NNXA 3S9LA 2IWFA 4PCYA 3UAAA 2MFNA 3KHXA 4MWFB 3ZYZA 4WJG3 4FTVB 1ES0B 4WI7A 1DVFD 1JWMB 2A4ZA 2J55A 4W6WB 4KQ3L 1ZK9A 4MCYB 4PJXE 4DGIH 1WGOA 4LRNH 1ULVA 1JZ3A 3WEBA 5GS0H 1S7XB 3QUZB 2P47B 1F2QA 2BEIA 1OM3L 2EDLA 4HUNB 1TNNA 3RWEA 3G8WA 5D29A 5J9PA 2Q3ZA 3LPFA 5BS0A 4IUSA 3KJ6L 3FFCB 1A1NB 2I60H 5DRWB 1WBXB 1XXDC 1E67A 1P7QA 2FO4B 3IAPA 5IBTH 4YSQA 3U9UA 5KS9E 1MFBL 3FO9B 2CXAA 3QR1A 5IMMB 1A3ZA 1I9RL 2A0LD 2AAVA 4C56D 4DQAA 2FS5A 5JA8B 2PUQT 4X6FA 3JWNH 4IYKA 5CN2A 3V95A 3D39A 1OB1B 5CJXC 4PREA 1LO5A 1N26A 3NEXA 4NFBA 5CEYB 1BF2A 1XAKA 5E6IB 4G6JL 1OGAA 2NUTB 4JG0H 4WK4B 5FCUH 4R4BB 3TONA 2O61B 2N7AA 4QNPE 4EIUA 4NKQB 1ITCA 3V7AG 1KCRH 2OL3B 3GRWL 3IMVA 3RGHA 1YMMD 1A7QH 2DIBA 1IEBA 1YNTB 4GKSA 5L0QC 1LP9A 5K9OB 4OFPA 3B9EA 1NPJA 1BAWA 3QEQB 4NNPL 1IC4H 4R7NB 4YNYB 4Z9KB 1LEKA 4JUTA 2NY2C 5FYJD 3HBPA 5E8OA 1BECA 1U30A 2OTPA 2XICA 3REWB 3Q2CA 2JCCE 4FQPA 5E6IC 4QVTA 4R3SA 1F6FB 3DV4B 2N59A 5AW3B 3SGJC 1L9OA 1DVQA 1EXGA 4Y4FC 3IT8D 3BIAX 3AWEA 3GEFA 5HI4C 1XGYL 5CILH 1AGEA 4APQD 3MRMB 1JN6A 2O72A 1DZBA 5MP6L 2BP0A 2YRLA 3PGPA 1P0SE 4N90D 3JYBA 3TL5A 1A7OH 2VJ0A 3HOGA 3HZKA 5LN8A 5BXFB 4ZUSA 4TN9A 1G0DA 3PQYE 3LSOB 4HPOH 5CCJA 4AV0A 2CALA 3O3EB 3T3PF 3MGAA 5F46A 2Y5TA 1I9JL 1GGBL 3NJJA 4CUCA 2EECA 4N0FB 1KTDA 3WELA 1U6AH 4UILL 4K9EL 1FA4A 1KLGB 4LLVA 4PFEA 3HNVL 1OO2A 1CZ8H 5ANMB 2R2EA 2BNRD 2OKMA 4GIPD 3L2NA 4PJFA 3RA7L 3V4PL 2JLMA 1JXJA 1ACCA 3I9PA 1JTOA 1AHKA 4OZHA 1AQKH 1S9WB 3TO4B 3GHBL 1K4JA 1SLXA 2A38A 3R9FA 4KOWA 2GIYA 1OP3K 3V6ZA 5A27A 5DQJB 4CN6A 2RALA 1N6QH 1N2RB 3KR4A 3ES6A 5AVWB 3KJ6H 3HC3H 3MJ8B 1A4JB 1J1PH 2BIIA 3A22A 3X12A 3B2UD 1CQYA 3GSRA 1MFBH 2ZOLB 3BVNA 3QHZH 3PB7X 5JH9A 1I9RH 4WJ5B 5E2WH 2NPLX 2BNQD 1XF2B 3MV7A 1KENH 2PCUA 1O9VA 4NPJA 4PP1C 1MJUL 4TL5A 1MI5A 3C5SA 4K8RL 4L05A 1AY1L 4X7SL 5EOQH 1ET5A 1J8HE 2DXQA 1TFHA 3TH3T 5EEXA 2XKNB 3IPFA 4U3XA 3KBPA 4YLBA 5IBLD 1BYOA 4DKFL 3ILQD 2ZTBA 4A2HA 3WSQH 1PD6A 2I69A 1UCBH 2F0CA 3G5YB 4NS0A 4LHUG 4YXKL 3UZQA 5I1HL 4P9MH 4K30A 3VXQB 1TITA 5K9JL 4AEEA 2YGOA 1OAUH 2FD6L 1JDAA 3UDWC 2K6YA 3GZOA 4PJ7E 4TLTA 3VQ1C 3BKCH 5I1DA 1IB5A 3Q05A 2ETWA 3ERXA 2ZX8A 3GMMB 1BVOA 2J2ZA 4U6YA 5B3NA 3FTXA 3ZK0A 4MRCA 5LN4A 1WV7T 3N41F 4U1GB 3LKRB 1T7WA 4JQXA 2DQUL 1MJ8H 2VB5A 1NGWB 4AK2A 5IQOA 2GBVA 2OV0A 1PAMA 4JFVA 1YG9A 3KL0A 4LLDB 5IJKC 3RU8H 3DMMA 5CFAA 2Y3NA 3LEXB 1RZIA 3GDBA 2AS5M 5FW6A 2HVKB 3ZGIA 4Z7VF 5F48A 4BXVA 3TIDA 1QPPA 3ARGD 1H9VA 3QIWB 2CIJA 2Z1PA 2XWTA 4KKZA 2AKRB 3MNZA 1UFGA 2DQEH 2YUXA 1I9JH 5J11B 3KLDA 3AQDA 3QZNA 3RVWD 4X5KA 4UILH 5JIPA 2P5EE 4JL1A 5CR8A 2CBTA 3QUKB 1KCVL 3KPNA 4N2AA 2WB1A 3RA7H 1RHHA 4HZLA 4XNXH 1PLAA 4XO4A 1U8OA 2YGVA 1JV2B 1Q9WA 1TYRA 3DNSA 3IAGC 4KKRA 1NBQA 1U91B 1FIEA 3EGSB 3BIKA 1JPFB 2WWKT 3D25B 3DX2A 1CLOH 3F6JA 4JY5L 1Z9MA 3FO2A 4JFFD 4PV1C 5E4EC 3QSKB 5CBEB 2ZW4A 4MQSB 2IH9A 2OZUA 5LQBH 4ATTA 1U2HA 2V0AA 5CIPH 4KX8A 4PGJA 2P80A 1X5LA 1YEJL 1OAYL 4XP1L 3IE9A 1CE6A 5D8JL 3T5WA 3GSOA 5I1AA 4AVBA 1FH5L 2FAUA 2ZOUA 5EIQA 4EKJA 4TQEL 4P9HH 1WWWX 3F7KA 1WZ1H 1MJUH 5EUOA 4ZY2A 4K8RH 5E2UL 5DMGD 2VZUA 4R26L 4E0RB 1TVHB 2HKFH 1GYTA 1PIGA 1TETH 3WEXA 2EIMB 3MLTA 1ZSDA 5JW4N 4EUPG 2N0MA 4D9LL 4MB5A 2HH0L 3T6XA 2Z3MA 5KZCD 1DO6A 4YXKH 1OD9A 3L7EA 4NLAA 3LRSB 1Z5LA 3VU1A 4PJBE 2BS8A 5ACZA 2LVEA 2V2XB 2YXWA 4OLYH 5K9JH 2OL3L 1KN2H 4AE1A 5MENB 4DJLA 2OMZB 1S5HA 4FXGA 2VXUL 1CTMA 2G3XA 4NZTL 2UUDH 3F58H 5IOPA 1ZE3C 2JK5B 3WGVB 1TXRA 2F53E 3CZXA 3QVAA 5E08H 1A7PL 5IB5A 3RIFF 4PLNC 3NSCA 3RTLA 5CN3A 2RFXB 1JGDA 4M5YL 2BHZA 4GH7B 3ZSSA 2WBXA 3QQDB 2W5PA 2NY5C 1CYWA 5AVRB 3QCUH 5EBGA 2V7NB 3N55A 4UNTA 1Z8WA 3KNBA 4MXWL 3UTOA 1A6PA 4HWBH 5GZOC 5I23A 2R23B 2X70B 1M3IA 1QLFB 4KSAA 3GHPA 3GJEA 5IHBA 5AAMC 1IM3A 1S7TA 4ZMTA 1NCOA 3GYAA 1WBYB 1FPTH 5DJ0B 1G7PA 3GSWA 4GNKB 4EUPH 1CFNB 3KZWA 2OZ4A 5BUAA 3IDNA 1HIML 2HLEB 1E9OB 3L48A 2FHCA 3X3GL 1J0JA 3L17A 3WDIA 4PVBA 5J6SA 3WUWB 1ANUA 3WYRA 2W59A 2ATKB 4JE0A 5B1AB 3SJVD 4AG7A 2YMTA 5DUJA 1SFDA 4F7PB 2P8LB 4EI0A 2QZQA 1B4LA 4YSCA 5LGYA 5DVOA 1XF5A 1GGCL 3MRDA 1BOYA 2W38A 3POCA 3KGSA 4JY5H 4V1DD 4A94A 3TO7A 1F4XH 1NFIA 4NEXA 4KK6D 1U93A 3QS2A 1NFDB 3SE3A 3BEWB 1KGJA 2VLJD 3C2SA 3UZEC 4PJAE 3LV3B 5CJ5A 4FNRA 3QUYA 5DZJA 5D8JH 5AG6A 5G20A 1L6PA 3RZAA 3TF7C 3PGCB 5JW4M 1JI2A 1J8RA 1F1GA 1NCBH 3BQUD 1QZNA 3MODH 3CLWA 5AZEL 4HP5A 5DC9B 5E2UH 1DFBL 3FEEA 1A6ZB 2CNYA 3SCMD 4ZJ9A 3DGGB 2KLSA 1E8YA 3B5HA 3F83A 3CE1A 1TEGA 4AV5A 1KTKE 4GAAA 2ZENA 1EGJA 3MMEA 3GNMH 3FUEA 1OP5K 4EDWL 3QCTL 2R27A 2Z6FA 2YMOA 4YZFF 5C07A 2OL3H 4PGEB 3IJHA 4U31A 4Q74A 4HYTB 5L9DL 5DF0A 4TV3A 4QWWD 1UCTA 4X83A 3IGAB 3QDGE 1NLBL 1DANT 4QYOB 1YNLH 4FQQA 5C9JA 4B9GA 5FHBL 3HG1E 5JXEC 2PW2A 3L5JA 2GTZA 4HOZA 1BD2D 1LK2A 2R2HA 4TM9A 2DQJH 1MCKA 3NJGA 3MRPA 4HMEA 2EKJA 3NCMA 4YGAB 5JW4Q 3H9SE 5J6HA 2WXOA 1T7ZA 2CR3A 4B95C 4ETQB 1RI8A 1OTSC 3I9IA 4NZ8A 3APFA 3ILPB 4JL2A 3NH5A 3DPBB 3NTCL 1R5VB 5F7WC 5H2BA 2EUZA 3N0AA 4V11A 3RVTC 2DKUA 3EO1B 5EIIB 1NDMA 1TZGL 4TUJB 1I3RB 2E8YA 1AJ7H 3B3IA 1NCAL 2DB8A 3HMXL 1C7TA 5EU4B 5FC9A 3WKNA 2Q51A 5CBMA 3G5XB 3D0LB 4P2QD 5HJDA 3S7GA 4QTHA 4UQ2B 1Z2KA 3CIQA 2N01B 1T4KB 2AEIT 3NZSA 4MMXA 4R3KA 4LSQL 1T80A 4MDRA 3HKZA 2ZOOA 4OT1L 5CSZA 1RL1A 5T8IA 1JVLA 3LKPA 4M1DH 3OLGA 4CJ0A 4UT9A 3KJ4B 3IJ3A 5FECB 1FP5A 1J7VR 4M61B 4YPGA 2ADIA 3W9EA 2NY6B 1F3RB 1T5WA 5CKGA 3BZEA 1ARLA 5IEHA 4LSTH 5IKCB 4ZFQA 3PWNB 1VFOA 1CJYA 1OY3B 4KC3B 2Y06L 3BKYH 2GIVA 3F04A 2ITCB 4XWOD 2CIIB 3UTSB 2J1XA 2WXIA 3FTYA 1DANU 3B7TA 2W0LA 4MA8L 4ODHH 1M4GA 3EYQD 1GOHA 3FB5A 2XKUA 3SN6N 1DFBH 1I7UA 2W60B 3MRRB 4UMGA 3WXVH 3DBXB 4HJ0D 5CZXC 1DQLH 2UWEB 1MCEA 4ZPVA 3NAAL 1MPAL 1HCFX 5D9SB 2A1WL 2X7LA 2H0JA 1AOZA 5I6NA 1FFQA 2REFA 2NY5L 2CQVA 1ND0A 3MV9E 1RK0A 4QBJA 2E7MA 4UDUA 3RP1A 3QCTH 4F37F 2P8PA 2NY6C 2X4PA 3QIUA 4OY9A 4PLJD 4YXLL 1UVQA 4GM5A 4ZUWA 4IBVA 5LAPA 2WLIA 4WSGA 1QQDA 2QVFB 3AABA 3LTVA 1KXQE 4FQXD 2TSBA 1NUNB 2CJUH 5DK0B 4CNIA 5IQMA 2WJ5A 4XBGA 4FQJH 5EO0A 1Y6KR 4RGOL 1QSEB 2JKWA 3RB7A 2BXYA 4WU5A 3X14A 3PWLA 2KUTA 5KVGL 1EHXA 3HUVA 4AGLA 5J7CC 3MGOB 1LEIB 3L1FA 4G8IB 5F3BA 5ICYB 3H7LA 4OLVL 3BKJH 3AZUA 3QUXA 5HHQB 1HEZB 1PZSA 1Z32X 2DYPB 4MMZA 1BLLE 1M9WA 3TVMB 3V6BR 5EF2A 3MACH 4N9GB 3SDCD 4W70A 5ACLA 1R46A 5GGSB 3EYUH 2GUOB 1THCA 2EO9A 4PV9A 2XN9B 1JK9A 5I1LA 1U8CB 2A6JA 2E9BA 4GKLA 3QWNA 5FFLA 4OLZL 5BUGA 3F5WA 2BSRB 4ODUB 1UKSA 5AOLA 4L4JA 5EEWA 2YN5A 1LQSR 5GGTH 5F6IB 4NGPA 4ZFOA 2FNWA 3TVMC 3EDJA 3HMXH 1TOXA 1A7RL 1M6UA 1R43A 1FFOB 4JY4B 4FI8A 1RURL 3CLEH 2AQNA 4Y89A 1GYVA 1C5BL 3SKMB 3I9GH 4GEIA 4OAWA 2EVNA 3D30A 1QFPA 5D2LF 4QHKI 3UBGA 1SN2A 1XSIA 4KZEL 2O6PA 4R7DA 2VDLB 3K9UA 3DOHA 4PJ9A 4PS7A 4NWUH 4MHYA 3COOA 3MREA 5GS1A 5F6IC 3H8NA 5HI5C 1XGRB 4D0DA 3PFOA 4MZIA 2WVSA 3GKRA 1VPOL 2GJ6E 2FX7H 1S7VA 1DSFH 3MUGB 5C07E 4HKFA 2Y06H 3ATAA 3NABL 2WBJA 4KK5D 3KWUA 4XPGL 5FEBA 1NGPL 4P6YA 5CM1A 5AL0A 1TCRB 4FXLA 4HIIA 1O0VA 2XVGA 5HGDB 3S5LB 3VFGH 1KMGA 4LPYA 2FB4H 4JO4H 5GGQH 3U25A 5HYSG 3FSAA 4ELMB 4KK9D 4NIKB 1MRFH 2WNWA 4X5LA 3SHSA 4UIMB 3DO4A 1P6AB 4U4BA 2A9MH 1FL5A 1ZV5A 4JFEE 2GUYA 2OSWA 1HDMA 5G1ZA 5J13B 3TN0C 2NY5H 2ZP9A 2BCKB 2PO6D 1LAPA 4I18A 5AYUH 1FFNA 4GIOA 1UD4A 5C7XL 3KM2A 1ZGLM 2WZNA 4MX7A 2ZYSA 3WUWG 1P69B 4WUUA 2QDVA 1S9XB 4K3NA 4NRZB 1A4KB 3I74A 1RHFA 4JFHD 5FO8B 3EH1A 3KR5A 4AQ8A 2FGZA 5FYKH 4KVCL 1NJ9A 3VXRE 2YA2A 4XI5D 4A2MA 1DN0A 3RZCA 3T0EA 1YMEA 4A95A 1A9VA 3I75B 3IDJA 2BSEA 1MHCB 1PZAA 3C6SA 5AW6B 1YSJA 1U4FA 5GGRB 3C9NB 3P4MA 4PY8J 4KZTA 3WAJA 2L7EA 3GMPB 5E70A 5TQ2H 4LVHC 1IGIL 3PQYD 3G7TA 3QZWA 5CKAA 1ZVHA 3D9AL 2H1LM 4UWQB 5JHDD 3CVIH 1RULH 3RWFB 4B5OA 1MCWM 2E9WA 5E2TL 1FGNH 2H8PB 3V6FA 3V9EA 5FV2A 5IGXH 4TUKL 1LK3L 4U1SB 5DD5L 5IREA 2XFXA 1YY8B 2B3RA 3UAJC 4E9QA 4M6AA 4OZFB 5AYQA 1SJEA 2BIQA 3ZO9A 5E9DE 2D31A 1CJWA 4HJJH 2CLRA 1NBYA 1RK7A 2OULB 5GS2D 2I9TB 3QZPA 3W6XA 4POZC 1WZMA 1RURH 3TBVB 1FORL 3CDGB 4GUPB 2YWZA 4HS3A 1ONQB 12E8H 1SRDA 4Y5YA 3MRFA 2I7SA 3VXSA 2AQRA 4J3GA 2CCVA 2EIKB 4YFLF 4U0RC 4KZEH 1YVLA 4LLQB 2LU5A 3MTXA 4MQXC 1BQLL 4JFDB 2E6PA 4BWUA 3ATFA 1G7QB 1DJHA 1NCHA 2X3AA 3K0WA 2Q8AL 1M1XB 2YMXH 2B3UA 2ICEB 3GEWB 4KOTA 1BVKA 1FVCB 3F12A 1QFOA 3LPGA 4J12A 4XT1C 5ERWA 4ZUVB 2LR4A 5JHLH 4R8WL 3TLRA 1G1YA 4G1PA 3IO1A 3W39B 4OGYH 4BSJA 4BUGA 4BDVB 5FM5O 2CD0A 3K2IA 3UO8B 3X1FA 4PG2A 4JVWA 3OHXB 4OD2A 4PRID 1SXAA 1OCCB 2J4WH 4EDXB 2BSTA 2E8ZA 3DMMC 3ZTCC 4CGOA 3FU3A 4LASL 4F3FA 3FU6A 3ZDWA 2ICEC 2VT0A 1EXUA 5EIIG 1M4DA 3MZGB 5LAXA 4WFFE 3JWNE 3KPPA 2BWQA 3LH9A 5HJ3B 4F27A 3DUUA 2GI0A 2X1PA 3NUKA 2W07A 5TFSL 3NOIA 5KBMA 4ZX4A 5E8PB 2XXFA 5LYLA 1KBVA 1N5AB 4IRZA 3HMWL 5CIPA 5DO2C 2ICWA 4X6BA 1JPTL 4P2YA 3OHXC 5J12B 1SM3H 2XZAL 3G3SA 4X4YA 5FO9A 3ARFA 5KTCA 2YD8A 3L3IA 1NMBL 4G3YL 1INEL 1QRNA 3DXAD 1S9YB 1ASPA 2JXMA 2W9EL 4WO0A 5I66B 2Q9OA 1TDQA 2KZKA 3HHMA 4Y4HD 3D9AH 4XMXA 3KYKL 1MFCL 3MRNA 4O2CA 5T3ZH 2X6BA 4LL1A 4XN4A 6CPAA 5E2TH 1JPGB 5I5JA 2V17H 3EJZC 1WYJA 3LKQA 3U7AA 2RCSH 1AYEA 5DHVB 5LGKA 5DD5H 3E2HB 2ZXCA 3CDZA 4WFEE 3AW5A 4WO4C 2J6EH 3GMRB 2ADYA 1NGZB 4JMNA 3C6EA 1E3ZA 4NHCL 4FP8H 3RTQD 4F92B 1MG3C 4QRTB 5PAZA 4JRXA 1RJZB 4GS7C 5E8DL 1BM3H 4IOSA 1Z3GL 3QRGH 4ZQTA 1BXXA 3C12A 4TVUA 4KROB 1E5BA 5DZPA 3V7AE 4A6YB 1IC5L 4A7VA 3E2HC 4ENED 5A40E 3ZR5A 4UTAH 5I30L 2VDLL 4JO3H 1IYKA 2I5YL 4R97B 4XNDA 1B6BA 1FHGA 2E56A 5TGBB 2FO8A 2FJGA 3WFEL 1R19A 1MRDH 3K2MC 2J6WA 3WFBL 4Z7IA 3GB7B 5I0XA 2V5RA 4S10A 4OAEA 5BRQA 1LTXA 5DFAA 1QSRA 3Q3GB 3CBJB 5AGEA 4NUPA 4B14A 1AKJA 4R8WH 4NNYB 3EJYD 1JAEA 1ZAGA 1KTJA 5CP7B 4KSFA 4HH8A 1RO5A 4ZMLA 1LOKA 1R3HA 3MX0A 1L0XA 2HKHL 4H0LC 4LSRL 3DRQA 1JGUH 2C9XA 2ROXA 4KTDH 4R97C 5DJZB 4A33A 2OX5B 2I32A 1JWMA 4KJYA 3GXUB 4MCYA 2V8HA 5DEGB 3QUZA 3FUDA 4XPHL 3E7JA 4D0BB 3ZT7A 3A6CL 1NSLA 5AOIA 3CFJB 2WGNB 1ZHKB 2UYLB 3PABB 1KBKA 3Q44A 2XBTA 1AXSB 1SDDB 3B7YA 3BZ4B 1QSFB 5F9WB 3G6JB 4D8PB 5DRWA 2IMMA 1NINA 1TZIB 4YFDB 4KUCF 1G87A 4RQQB 4P4KC 2IADB 5IW1B 4O4YH 5IMMA 2GBAA 4N2OA 3TWCL 1NEZA 3D69B 3S8GB 1DUYA 4DTGH 4UQ3A 5IV0A 3B5TA 5HHXL 5HVGB 3I6GB 1WA1X 1SLUA 5CEYA 4BK5C 4WI9A 1MCRA 4KFMA 3WKPA 1QTSA 4NRXB 4R4ND 1B2WH 4BRVA 4Z7OE 4M6IA 2M8XA 2FEJA 1BJMA 1YUHA 2XTSA 5SX5K 2O61A 3VXSE 5K59E 3BPOB 3KGQA 2AP2A 2Y23A 3D85A 3QUYC 5FGCB 3S5LG 2B58A 1QVOB 1MVYA 3DJSA 5B7FA 2EILB 1EAJA 1XR8B 2E0PA 1F1AA 5MEPB 4DP1X 5L88L 2UZXB 2XYBA 3T90A 1ZGLB 1OAZL 1FBIH 4L48A 1IO4C 4HK0A 3TASA 2WYZA 4R7MA 2BVYA 1V0CA 3S3PA 4AQ1A 2Y5EA 5E8DH 3B2PA 1QA9B 2OP4L 3MRHA 4BUHA 4BA8A 1E2WA 3Q7JA 2X2UA 2PJ5A 4HBCL 5G4OA 3L5XH 4P0DA 2D2OA 3H7BA 1PKQB 2G60L 4PG9B 4ODXA 5DA0B 3Q1SH 2VDLH 1S9KC 3QNYB 1KEGH 4TWEA 3AY4C 2ZG1A 4I9WD 1RY7B 1KFGA 3G6AB 3WFBH 3IDMB 2K70A 1KCBA 2FWUA 1DO5A 2WUCL 1FZJB 1X4ZA 4JVUA 1W0VA 3O3EA 3J27A 3SDAB 2W9DH 2P45B 3NCBB 3VFUB 3QQ9C 3LN4B 3D2TA 1V3JA 1VIXA 3LH2L 4P23B 4DW2L 5HYJB 2VE6B 3TU6A 4BFIA 2SEBA 3BPNC 3R19A 3ZO0A 3M8OH 4AUYA 2BP3A 3FT4A 1MCFA 2UXGA 3EGXB 4UDTA 4OZFG 1T6BX 3JTTB 4OCMC 4YDIL 4A30A 4I85A 5D70H 1S9WA 1XV8A 4Y2OA 4W4OA 4MLIA 5DTFB 5DJCA 2QIRA 5D8NA 2EICA 2YA0A 5GJSL 3CH1B 5KYXA 4FNQA 3SDAC 3DDDA 1JGLL 3QS3A 4U1JA 4X5XB 4M7LH 2AJXH 4L0YA 3FRMA 4KTGA 2APSA 3GUTB 3N04A 1U3HB 3AB0B 1IX2A 4MXQC 2EADA 1FN4A 2ZOLA 4P3WA 4X8CA 4Y16B 5I19H 2ITDA 2NX5A 3UADA 3FF8A 1MUJB 4MMXC 1IAKA 2I9LA 2FSEA 5CGYD 1XF2A 5KSVB 3PPEA 5HHXH 4KS9A 4UINH 1GGIL 3D4GA 2XKNA 3WKMH 2Q04A 1HH9B 1K4CB 3CMOL 3B2VH 1HHIB 2Q8BL 4MJ6A 4HUUA 4JRFA 4XP5L 3SE9H 1SVCP 2BX5A 1FNOA 2E74C 3BD3A 4JGMA 4Z0BH 1BOBA 4OZFH 1U3HC 2BRQA 2UXFA 2Y07L 1BAFH 5FYLL 3N5AA 3AADB 2X2YA 3O3AA 5J5EA 4GW5B 2AAAA 2H3NB 4NXKA 4AJWA 2IFFL 1ZLEA 4QOKB 3LKNB 4ZO7A 4LQGA 5MEOA 3H42L 1CFQB 1A47A 4M43L 3ZE1E 2CSPA 1I1FA 3SQRA 2OP4H 1RLBA 5FF6B 4ESKA 3WTTA 5AOJA 1YVOA 1IGYB 4ORZC 4WNSA 3N7ZA 1XIWB 2AEWA 3IS0X 4HBCH 1Q7LA 3FJUA 4TNEA 5E6SB 1EEZB 5T1KB 2FX9L 3ZZLA 3FQNB 4IHMA 1HH6A 3S6KA 1I53A 4D7BA 2BXZA 4XBMA 5GZNA 2VR4A 1DJSA 3RNKB 4UAOB 3LRHA 4FTVE 3B9AA 2G9KA 2P6EA 2AXGB 1VFUA 3D3VB 2ZUTA 4A68A 5IEKB 3SPVB 1HSAB 2WUCH 4WEBH 4HHAB 3UYPA 3QRFM 4GT0A 3QIWA 4UZGA 4XH2A 2CUIA 3CPAA 2Q3XA 4EVNB 1NCWL 2PVWA 3FO0L 3BE1L 5GGTA 1GPOH 1TJGH 1XIWC 3LPPA 4RUHA 1U8QA 1K3IA 1FZKA 3TBBA 1BWMA 2PR9A 2EIZB 3FFCE 4W9HC 3IKCB 3MV9D 2QGCA 4NN6B 4OM0H 4XRCA 3P69A 3S35L 5C2BL 3NCYP 5I76B 4ZW3A 2P24B 4IOIB 3ILDA 5HI3D 3H1ZA 1OTTD 2ENQA 4GKNB 4HWNA 4P57A 3B1UA 4Q9QH 4E5XB 1G9EA 2VI7A 4CU7A 4OH2A 2JJTC 1JV2A 3U82B 1JZ7A 3VA2C 2FE0A 3MLXL 3T8XB 4FG4A 2IPUK 4YZWA 3WO4B 5GJSH 4DYOA 3ZDZF 3BP4B 4JFXA 1JGLH 3LRLA 3DRTB 5CBEA 2DBJA 2AITA 1BM7A 4P5KB 4WWOA 1JYXA 2A5UA 3VFOB 1RIHH 1G7HB 3MV11 2FATL 1DE4B 2ZXEB 3RB5A 5EDXA 2ILLA 4UF7C 2VUKA 2MOQA 3ZKSD 2BSDA 2KMWA 2NXYC 1T1XB 1N10A 1XIXA 2MPVA 4IRJD 5TE7H 3GBDA 2DJSA 3PRTA 1OE1A 1Q9LB 3QEQE 4TSAH 1XBDA 4FQCH 1D5XA 2X4SA 1SJHA 1KJ3L 3E80A 1IL1B 3MGTA 1GGIH 4PJ9C 4XMPH 3EJPA 3WO4C 3HRPA 3QWRD 3A6BH 4TLKA 4EBQH 3VFRB 4EI5B 5DHVH 1D5ZB 3TESA 4R2GC 1WJ3A 1IEHA 4ZOEA 5EOCJ 3CDXA 2MHAB 4XPLA 3H0TA 1DE4C 1J1XL 5EO9B 2Z91A 3ZTEA 1QLRB 1TQWA 2X28A 2MKWA 4HH9B 4N68A 4ZS6D 4TNUA 2ZUYA 3NZHL 3W11C 2BJML 3X1BA 1YO4A 1L0QA 3HPLB 2M26A 3EYVB 4ZX8A 1HHJB 2EDKA 2ESVB 3JTSB 3PJSA 4K5MA 4XHJC 2JK5A 2XQYA 5EPMA 4UOW0 4CSSA 2VLLA 3GBMH 2V8MA 1D7CA 3IYLW 4M7KL 1NCCL 3GD1C 3C5XA 1HZHL 2BOBA 2HFFB 3QQDA 4XMLL 4I18C 4EI5C 3GB0A 3KCWA 1O9WA 3T3MF 4PSWA 4A6YH 3PBBA 1MNUL 3Q5YA 5ICZB 3FOMA 3UG4A 5ANME 4AENA 1KELH 4ABUA 4Y0GA 3H6JA 1HHKA 1Y0LB 3OG6B 1JTTA 2MCPL 3DX6B 2X4QB 3QQNA 2XWJA 3QZMA 3RGVA 3SI2A 3FQUB 4X99B 4MS8D 3QEUA 3MCLH 4AQ8C 1T3FB 2D3JA 2H2SC 1WBYA 3IMWA 5TE6L 5DJ0A 3RZCC 3EG9B 3ML8A 3N41B 3T0EC 5IK3A 1F3JA 1CFNA 3PAZA 2XPZA 3TP4A 4JFED 4IHBA 5IESL 4APXA 4HNWB 1I8IB 3WTVA 4FYTA 4Q0XL 2NY3D 4TTDD 2HT2D 4WDIB 1KY7A 5IIEA 4XN7A 3QAZB 1ACYL 2HB0A 1NCUA 3FSVA 1XD0A 2ATKA 4CVZA 4X5WA 2B0SL 1A6VL 2YC1B 4QF1B 4I1PA 1U58A 4Z7VB 3OMAB 5C0JB 1WFIA 4GAFB 3VWKC 1NCGA 1FG2A 3VG0H 1RK1B 1WWBX 2QSCL 4NJ9H 4P2OD 4YE0A 4FFYA 4KPHL 4IKKA 4NO0B 1N7ML 4ABWA 4WKZB 1N0XH 4URKA 4PPZA 3EDDA 1CTNA 5LGJB 5B8CB 2EEAA 3ULVH 1BAVA 3B2XA 1MAJA 3FONA 1UYWL 4KRPC 4DPAX 1ADQA 3WO3B 4DVRL 3C6LA 3EGDA 1Q38A 2WBWB 4FNUA 4M8QB 3X2QB 3HN3A 5JZ7D 1UUSA 1OL0A 1JZFA 3QAZC 3NGBB 2PP8A 1TIQA 1TLMA 2J1ZA 5DWPA 1R3KA 4Y5YC 3FSWA 2NR6D 3RVVD 1ZRUA 1J5OH 2WOYA 2VZVA 1LWJA 3BVUA 2R4RL 4YN3A 4GRLD 2VZZA 1AZVA 1KJ3H 3FKUS 4CKQA 3GJFB 2AQ3A 5JOPE 3FL7A 2BVPB 2FR4B 1PZ5A 2CO7B 4FQ1L 2Q4VA 5B8CC 2Q20A 4KV5E 5CZRA 1J1XH 3N1MC 1GZQB 4QRFA 4S1DC 3PB4X 4UT7L 1W6WA 5E95B 4M7ZB 3NGBC 4PGEA 2IDSA 3IMTA 3NZHH 3D0VA 2BJMH 4KO5A 3A24A 4EN3D 2F54B 2AXWA 3LDBB 2XT1B 4FFVD 1A3LH 4NQDB 5ICUA 3KPLA 1SHXA 4QYOA 5DI8B 1H0DB 4Y5XB 4N6RA 1JGIA 2YPLD 4PR5A 4IK6A 1DLFL 2CIKB 5C0GA 3REVA 4DERA 3F62A 4PJHA 1NCCH 5DD1H 4OD1L 1CC3A 1UWFA 4HCFA 3CNKA 4CSZA 4ZTOH 3C60A 4N20A 3S98A 3VJ6B 4UIKL 5DS8A 2YR3A 1S5IH 4U6XA 2YSSB 4QRPD 1WD9A 2UY7A 5AVVB 2I07B 2YK1H 5LGHL 3GS7A 2X05A 1JRHL 4PY7A 4XX5A 4BSWB 3DUHA 4WZ9A 5JORB 1F56A 1UJ3B 1ZMYA 3D4UA 2PJ0A 3LDBC 4E68A 3QEGL 2DS4A 3K6FA 2CDEB 1Z8TA 4AG9A 3H9HA 4Y5XC 2OBGA 1BQSA 1T6VN 2PYEA 1LJMA 1JF1B 4J1UB 4ZFOL 1P84K 4TUJA 1TYJA 2AFOA 4GBXD 2WTPA 1BV8A 4BIKA 4WK0B 1KC5H 4RGND 1ETJA 3VXMA 2NY7L 4FKHA 1V7ML 5EBLA 1JD7A 3D0LA 3WLBB 5L2KB 2VL4A 1TZOA 4UQ2A 1AIFA 1F3DJ 1NKRA 2K4AA 3BAXA 5DJXB 5HHNA 4B7IA 5EO1B 2WPWA 5F9AC 4G9DA 2JELL 3EHBB 4JG1L 4MNGA 4DZ8B 4P46D 2XEJA 2EXWD 2EKSA 2QSCH 2WXPA 2YBRA 3MHZA 5AD0A 4UTAA 1TKHA 4KPHH 4WW1B 4L5FL 5D55A 4GW1B 2YQ2A 5D1QB 3DROA 1EEUA 5JIMA 2Q87A 3U46B 1UASA 2VW4A 4U3SB 5INCA 2HT4D 4XNZC 3V0WL 1F6AB 2AJSH 3GKWL 3PS6A 4Q2ZB 4UOZA 5C09B 1Q0XL 2IAMA 2Y7MA 3EJCA 5I6OA 4GI6A 3UTTD 5IKCA 4UUJB 2AANA 3A3YB 4ZMQA 5MENE 1A9BB 3MROA 2O5XL 5JO5A 3MCG1 3MJ9L 1WEJL 3EHBC 3OZ9H 4Y4KA 1MJ9A 3OMIB 3GRGA 1YSOA 2DEXX 2GT9A 4IRSB 4ZS7H 2W60A 5KVGE 5A43C 3DBXA 1MIEL 1CICA 4AZUA 5L4MA 5FYKE 3DURB 2AK1H 3KWWB 4EZMA 3X1EA 2Q76B 4KKLD 3MUJA 1KBWA 2H4EA 4W9EC 2ZSVA 3L4VA 3MN8A 3ZKMD 1ZEAL 1RUML 2OJEB 4N2CA 4B3VA 1FFPA 3TYGL 2PETA 5ALCL 5E23A 3FF7A 2Y7QA 2VH5H 3VACA 2XZCL 3KS0H 4UT7H 1BZDA 3FOLB 3DR6A 5C08D 2ODFA 4X5QA 1CGYA 1N59B 3O2VH 4KXCA 4E36A 4UYQA 3VXUA 4NQED 2VLRA 3OB0K 4F8ZA 1DLFH 2G3MA 5HHQA 4ZW8A 1UKQA 1X6LA 2XG4B 2HC9A 1R4XA 2WUUA 4DP8X 3VH8B 4OD1H 2Q7SA 3BEVB 1KIRA 4N9GA 5E5MB 4G9FD 1Y0RA 4UIKH 1EZLA 2GUOA 2XXCB 1S3ZA 1UZ6E 1MAKA 1RJYB 3UYRL 3FFOA 3PV7A 3CMGA 4WWPA 4RMQA 1QNIA 1GTNA 2KERA 4PBDA 4QGTA 4AEHH 2XZQH 2QHRL 5CSBA 3WU1A 3HHRB 4O02H 4WEUD 3QEGH 2OU2A 1VF5C 2AJYL 4M62L 3AXHA 1EZVY 3OKEA 4U1KB 2IPKB 4G1EA 5B1KA 3WR7A 4AQAB 2FYVA 2WZ6A 1S78D 1DCEA 1F11B 2Y2YA 1NFDE 4PV6A 4M6ML 1NLDL 3V0DA 2KZWA 1FFOA 5E99L 4JY4A 2NY7H 5D4HA 1XTMA 1HILA 5L8LB 4U7SA 3T4AC 1CD8A 4IU2B 2M83A 4H13C 3QAHA 2JELH 4P5TD 5ESVB 4MD5A 2LW3A 4N1CA 1ZSHA 1IM9A 3C09B 4U6HB 5AENA 4JCLA 4LSDA 8FABA 4L5FH 4M9PA 1VJSA 4I2XA 3VGAC 4QCIA 3MV8D 1FNSL 4PU2A 5JMOC 3T6WA 4CU8A 3ATEA 4OCRL 3CLFL 4ONGL 3PDGA 3HLAA 4Z3HA 1CDCA 1XT5A 3GKWH 4LSUH 3BDXA 2VW6A 2ZW7A 5HPOA 3EYSL 3O8XB 2XRAH 4AQ1C 1Q0XH 4X50A 1IU1A 1TNMA 1XH3B 2YXMA 4L8DB 3MUGA 3BISA 3IKKA 4F7KA 3GTVA 1QBLL 4J3OH 2J8UF 2YOAA 4MAUL 2EYTA 4QXVA 5IB3B 4ZO8A 1VEMA 3S5LA 3JXAA 3MJ9H 1ZO0A 1CG9A 5TDPA 1UD6A 2E4FA 3AXLA 5SV3A 3C09C 4ELMA 3LB6D 3O3BA 4OMEA 3T2NH 2X4NB 1MF2L 4XVUC 2E59A 3TNMB 1H6TA 4Y2DA 3QC6X 4NZDA 5CJQH 4HSQA 3V6OA 4YHYC 2OTUB 3BAEL 4MVBC 3UY5A 1TQVA 4H8WC 3RYMA 3TYGH 5ALCH 4MB1A 3PDOA 3U9PH 3PJLA 2GIXA 3DK0A 4N2KA 3BLNA 3PAUA 4R4FH 4GAGL 3TJHC 5JGFA 2YUVA 4OB5H 1MJJB 5C0CB 4CKVX 4DVBB 3LMSA 3NJHA 3VXNA 1T03H 1G1OA 1C12B 4IRZL 1Z9SA 3TA3C 4FA8A 1YLEA 4LHUD 2JI2A 4Z7UA 3QBTB 3GMQA 3P73A 5I0ZA 1WFTA 2GC4C 2XTJB 3VXOB 2W0FA 1CDGA 5T3XL 4FX5A 5C0EB 1ZA3B 1TVBB 1KBGL 5FM4A 3TO2B 4XGZA 5DJ6B 5D1XB 2A9CA 4W4OC 4ZUTB 2FIAA 3U1QA 3GMPA 3B43A 4YDVA 2RJMA 4MRIA 3FU7B 4ONHA 5JIQA 5AZUA 1ZTXL 3H4QA 1G9MC 3NRPA 2EINB 4Y5VA 4PRHB 4X6CA 4HX1A 2ARJA 1AXTL 3OV6A 4CAVA 5A3IC 5HPMB 2AEQH 1YY8A 4M62H 2ZX6A 1Z9OA 4JD6A 4LAQL 4OF6A 3TWYA 2OCFD 4YDJA 3L1GA 3O11A 1A1OB 2FZ3A 1PX3A 2HJLB 2R0KL 4JM2D 4M6MH 2OTWA 3FNKA 4PVLA 2I9TA 5E99H 3WNNA 3DVGB 4YDZA 4H20L 1DUZB 1HSBB 3EOBA 1LNUB 2ZYHA 2ZKMX 3WG7B 1XWVA 4GUPA 4PJCA 4ZTPH 3W0WA 1EUTA 2JQAA 3UTSE 4ZZFA 4ZMWA 5BJTA 3PGDA 1KB5B 4LCYB 3W37A 3HBZA 4CSTA 2EEDA 3T65B 1USZA 1PL3A 2QVTA 2VLME 5IB2B 1PYTB 1W72A 3SQOL 4B12A 1G7QA 2UWEE 1NE9A 4ZXBB 3QYCA 3D18B 3ZYJA 1P6WA 3NJXA 2CHDA 1IMHC 4QRUB 2YD9A 5ABZA 1LE5A 1FVCA 1X6NA 1KYFA 3CX5K 1T20B 2X9YA 1YEGL 4UQEA 5EFIA 1RD6A 5DEFA 3NE8A 3DHJA 1G7MB 4PB0L 1INDL 1M56B 4Q7DA 5F7MC 1ACZA 2PJBA 1QSEE 4F15C 5K9QG 5D2LB 2BDNL 4AGNA 3QNZB 1AO7B 5I15H 1LHZA 3GJFH 1CS6A 4LZKA 2K7PA 2X4UA 5I2IB 3KPRB 1GYCA 4ZXBC 4UQIM 4PYGA 4RSVA 1D7DA 5HHOD 2I3CA 5EU7E 1YEHH 3BXNA 1IGTB 4F7TA 4G7RB 4L37B 4TRPL 5HJ3A 1GKOA 1SZNA 4GAGH 4P07A 3R7QA 1Q0YH 3AS2A 3VD3A 4JHAL 4PGCA 2XN9E 2WCSA 3UJIL 3DJ9A 4DGUA 4OFVA 5IB0A 3VXTA 3EFFB 3HS0A 3B1TA 3W81A 4JHUA 2VN5A 1B2YA 3GXNA 2FRGP 3QJZA 1T1WB 2YPKB 4RH4A 5DJYB 5F6HI 2O6DA 3SYCA 1YEIL 3BHXA 4B9IA 4K7PL 1ZS2A 2PR4L 4J27A 3WNOA 1S9YA 1IGJB 1JVOA 1AP2B 4KKPA 2BVEA 5I66A 4LT7A 4U4IA 4F8NA 4AW4A 2YRZA 1NTDA 3T0VA 1A3QA 4G11A 3VFMA 3MNVA 3B3BA 2ZELA 2ZWLT 5C86A 3JV4A 1Y18B 2NY0C 3GSQA 4KJQC 1NBCA 2VDRB 4RISL 1EAOA 3H3KA 2FHBA 1SYSB 4LAQH 2Q6WB 2UY6B 2EDDA 3BRDA 2D7QA 4B53A 3MLSL 5D1ZA 3I9AA 1H15B 1PVHA 4QRTA 4H20H 4N2DA 2VXSL 2CK0H 3FCUB 4Q9CA 2NY2D 2ZF8A 1SY6L 4KRNA 5E5UB 2XV2A 4D94A 1P9MA 1QBBA 5E6ID 1WFUA 4NQTA 2C1OA 4Y4FD 1T22A 4HLZH 3SXOA 1NM4A 4GXHA 4ELME 4PK3A 4OKVA 2D7OA 1F6LL 4YO0A 2IAND 1EZUA 3RI5K 1M05B 2ZAGA 4R87A 5EZPA 4FZEL 4OUOA 4XNQB 3ETSA 3QDMA 3D52A 4JJXA 5FGSA 2YEZB 3CXHK 3MRLB 4H8WL 3VH8G 1J0YA 2V37A 2YZ8A 5GGVY 4CC4C 4RGMC 1GC1H 1UJTA 5A6LA 2NNAB 2I85A 4RBPH 5JQ6H 1YMHA 2OCCB 3CBRA 3GMOB 2BVOA 4NGQA 1CD1B 3RUGF 7FABL 2ADGB 5A28A 5D7SL 2NYYC 4GAYA 4NFCA 5KYWA 4OC5A 2HB6A 3NDZE 3RGVC 4HA1A 4KOSA 2PP9A 5DEGA 4RAVA 4TRPH 4QPEA 2A4CA 4OJEH 1HXMA 1CLVA 3AT0A 3CFJA 5BO0D 4ZZKA 1PJWA 3Q6GH 1G9ML 1QSFA 1KGYE 2A4EA 4JZJC 3G6JA 5FWQA 5C6WH 1KFAH 5A2AA 2OFQA 5IMKA 1SJXA 1R5IA 3BW9B 4L3AA 5IFHL 1BX2B 4NGSA 2EUIA 5DXWA 4OQTA 4H0GA 4XBEL 3D69A 4FEIA 5CLZA 5EH1A 4ONFH 4GIAA 5HHVH 3SDDB 4NZRL 5LWYL 4IS6A 4JRWA 2PR4H 2E27L 3BT2H 3L3GA 4FNLH 4YHIB 1MELA 3PP4L 4JVPA 4U7MA 2O5ZH 5HDBF 4PP1D 5DD3L 4CPAA 4GQ9H 1B6DA 1BGXL 3F0AA 5EZJA 3FPYA 1URLA 2P52A 3FBUA 1E5YA 3HB3D 3C6LC 4NO2A 3PB9X 5HHMB 2F7QA 2QTEA 3QJHA 2YNEA 4JFDE 2PJ8A 1RUQL 2WXKA 1CK0L 5FHAH 3MLVL 3OKLA 3CZEA 1MIML 2A77L 4GKOA 3IBEA 4IMLA 3SDDC 4YEFA 2YRPA 1WPCA 4M7JL 2YS4A 1D9KA 3AQXA 1F8TL 4GMSL 4KI5E 2IV8A 3NESA 5F89B 1CLYL 4F5CE 2W0PA 3QFJA 3DV6A 4R8FA 2ALWA 5JDJA 4MJID 1KB5L 3UBXB 5JNYB 3TBYB 1PKQA 3SO5A 1E7VA 3AMKA 3VI4F 3QNYA 1R9FA 3KPOB 2Z3PA 2D3LA 1D2OA 2H32A 4FYQA 1MQ8A 2HLAA 5GXBB 3CZLA 2X38A 3IDMA 3IFEA 4I87A 2WO3B 2ARJQ 1S60A 4YHML 3N9GL 5I1JL 1JV5B 2PLTA 1VZGA 5ADPL 1IQDB 3WN5A 5TK4A 2FXFA 1CDBA 5DHMC 3OX8B 2AK4D 3ULUH 4IBWA 3BWAA 2VJ8A 4CAXA 4K07A 3C60C 1FZOA 3L3JB 4G5ZL 4W9ZA 3IU4H 4PWIA 2ROYA 5HYJA 3LZLA 4N87A 3LWUA 1MCDA 1R3LA 4J3WA 2UUDK 1D3CA 2ZP8A 3ECBB 3EGXA 4ISVB 4YLCA 1U9KA 4B60A 1JNLL 4N4YB 2OI9B 1JRHI 3S0PA 4YHPA 2VM4A 3ARRA 1X9RA 4WU7B 3EFOA 5KEZA 1XEDA 3K2UH 4WGKA 2F1AA 2P3YA 3CFDA 3QIBC 2IV9A 3NVQA 3RDTA 3LQZB 1MLCA 3ZRCC 1QSMA 3CH1A 5EOCH 4RDBA 1JHLL 1IGML 3CC5B 1GGUA 2J5LB 3BP6B 3GQFA 2VIRA 5EV7A 4YDLB 3GUTA 1LEGB 2F7OA 3BHBA 2F7IA 4Y1TA 3DBSA 1WZKA 4LF3A 4P10A 1SJMA 3P0YL 5K39A 1RV6X 2R29H 2ZT9C 4C56B 2V5TA 4XN2A 5BZWA 5ENWA 3X1GA 4EFDA 2IMNA 3BZDA 4DH2A 2R51A 4WWKA 4Y2LA 1VA9A 5DD6B 5J89A 4XNYH 3MBEB 2CRMA 1E4WH 1PTZA 3O6KL 2HRPL 3AMLA 3OKKB 1KLUA 5GIRB 1JWSA 5I17A 1A3RL 1EEQA 1K4CA 3I02B 5D71H 1MFDL 3S37X 4JO8A 5ID1B 4CS0B 1TLKA 4JXRA 4BV1A 5IR1A 1W8OA 5B38B 4U9YA 1OWWA 1FNEB 1KUVA 4OZIB 2CK2A 1YMMB 3BDYL 5GRWA 5BPPA 3BH8A 3Q5TA 3LNEA 1T2JA 1R3JA 3SIKA 3CG8A 4ZFZA 4XAKD 4Y4KC 3CD4A 5D7KD 4JHWH 4M7JH 2BSBA 3RFZB 3H3PH 2CGZA 3MBEC 2JB5H 4G83A 1F8TH 1TTCA 2ARHA 4HIQA 4A32A 4N5EC 4RZKA 5IMLA 2TSAA 1EQWA 1HX0A 1WWCA 1AGBA 2B15A 4RFEA 1IFHL 3QUMA 3B3SA 4APQB 3SDXF 2XEIA 3T4YB 3DJTA 5T1KA 3GIZH 3O4LA 2RMNA 2H5UA 1S7WA 2XN2A 3BMWA 4QEGA 4QHMA 3RNKA 5GZOD 3QK0A 2G2RB 3GMNA 3MRIB 1HCVA 3FRPB 3UMTA 3L9YA 5MEND 2FT7A 4O02A 1DVUA 3N9GH 5AALA 3RFZC 5D6CA 5IFJB 4RA0C 3NJNA 1GS6X 9PCYA 1QSFE 1UADC 2NYKA 4QKTA 3G6JE 3V52L 1H3TA 2GHWB 3KLSA 3G08B 3F85A 1AQHA 3D66A 5TDOB 1LD9B 5E2VL 2FQEA 3I3BA 3ZHLA 3T6QC 4F2FA 5E03A 3IXAA 3LZPA 4FG6C 5HY9B 4GKNA 1DJXA 1MH5B 1GZPA 2P48B 5T5FH 3WMPA 4E5XA 5HDQL 4PHZA 4ERSL 1R34A 2Y4SA 3IFNL 2LT9A 5EBMB 1S9VA 3KEDA 3QEHB 1JYWA 1BA9A 1E4JA 5I82A 4KHXL 1X5ZA 3MXVL 4GG6A 1S7RA 2A6IA 1IGMH 2ZONA 4P5KA 3FTVA 1ADQL 1WITA 1Y1DA 1OGTA 4PJ5D 5FGCE 1SXBA 3AU1A 3CZNA 3CSBA 5JW4R 1MLBB 1K4DB 2CJTA 3FN0H 4OZGA 5C0AA 2R8SH 1SOSA 3EH2A 5SWSA 1KIUB 2BNQB 2VMJA 3LJ3A 1M57B 3OR6B 5AVXB 3UBHA 1NAKH 3BUPA 4KVNL 1OT4A 3MNDA 3Q8BA 3LHPL 4XVSL 4GAJL 4ODWA 1DQDH 4D0CB 2OK0H 1KCKA 1DR9A 3GSXB 5BV7B 4Y7OC 1A2ZA 4BE5A 3PL6A 3WY4A 1I8MA 2V8DA 2O28A 3NH4A 2EIBA 2VDRH 2MHAA 2JIXB 4WV1A 1PKQE 1C7SA 1F4WL 3BDYH 3V4VL 1TT6A 2B14A 4OM1L 2ZCLL 2ENPA 1CM0A 3TFYA 4I3RH 2EUWA 1PZCA 4JKLA 2ESVA 1JZ8A 1TSRA 2WINB 1XMTA 2QFRA 2XUWA 4Y2DC 3O41A 3KXFD 3V6OC 3WL9B 2NLJA 3BN3B 5KSBF 3MYJA 2D0GA 1OANA 2XWRA 3CPUA 5JXED 4PJEA 4Z7AA 2DMKA 1KF9B 5HYJE 4QY8B 3SQBA 3NSFA 1K5WA 3PWVA 3QG7L 1P7BA 1ZCRA 1DQJB 1KB3A 1OEZW 4JKPL 3NG5A 2I24N 3DWTA 3ARGB 3DHPA 4C4UA 1OTSD 4IDLA 3ULSB 2E7DA 1UH4A 3MBWB 3JT2A 4XPDB 1TQBC 4Y1SA 3Q01A 2OMTA 3WJLA 3CHSA 3K9TA 1JTPA 4XNUH 3IVKA 3RVTD 3K71A 3KVPA 1L7TH 4ALAH 4AV4A 4DEPB 2V2WB 4GINA 2WYTA 1I8IA 5K93A 4PJIF 2QEJA 3LX9A 3AAZA 1I7TB 5B39A 1X4XA 4XP4L 5DZNA 4JRLA 5I73B 4Y5VC 3D51A 1I7ZA 2ZKYA 3IFNH 3GHEL 2CBPA 3ECQA 4C54A 3ZY7A 2PJ2A 3QQ4A 1BWWA 4PP2A 4BWTA 4DP0X 2QYVA 3NCJL 1BPMA 1KIQA 3MXVH 5BVPH 1I1AA 4JFFB 4LCUB 1B3JA 3RNQA 2Y6SC 3U1PA 5ILTH 4LPUA 2Q4ZA 2C6PA 2QECA 4GSUA 2Q86A 4QRRD 1HEEA 5LVEA 2G75A 4RSYA 1UQSA 2J21A 3UBXG 4K3JL 1RZFH 1XGZA 3TC8A 5BOZG 4GO9A 1EHNA 5K9KB 2HFTA 2DYRB 2HUEA 4OCLC 3O9WA 1YN6B 4MA3B 4PWFA 4RRPA 4X8GA 1XGUA 3KLAB 5EZOH 5IB4A 3LHPH 4QOKE 1U21A 3V0VB 3U2SA 3GJFA 1XRYA 4KOBA 4MA1C 5D2NA 3TBWA 3ZDZB 1U3ZA 3QXAA 5CZXD 4L9LA 1EERB 3MRBA 4OI9A 4YC2C 5JYLA 1I75A 2DPSA 2OXGB 3ETTA 3ZOAA 4K2UL 2BW4A 5KZCB 3HN5A 4JRYA 2DWTA 5C0ND 2NY6D 4Y7MA 5KVDH 2GE3A 1YCSA 2F8HA 4OM1H 5DLMH 2VMEA 3BP7A 4NEHB 2Z4QA 2OZNA 2F54A 4OCYH 3D3VE 3UTSD 4P5MA 4HZ1A 3O0LA 3Q2NA 4EKXA 5AEAA 5FYJL 5BUPA 5DMGC 1FO0A 4HNYB 4WWID 1CVRA 2VLMD 5MERB 4QHPA 3QJOA 4OLWL 1REIA 3LKSB 1MWAA 1K2DB 1W2KT 4ANVA 2KLRA 4MDIB 5AZ2L 4CSPA 1LDPH 3IDIB 2NT0A 3DSNA 4NYLB 4YHKL 3ATDA 3CK0L 5B1BB 4HD5A 4PV8B 1RZ8A 4M02A 2K3TA 1EUUA 2I07A 1SQMA 3Q5OA 3PWPA 3UIYA 4LX9A 1F00I 4HETA 5TH2B 4Z3TA 5BS0D 1UOLA 3LXBA 3OXRA 4ZMVA 5EA0L 1NC2D 4L5FE 1U92B 4WFGE 1JF1A 1ETA1 3ARBB 1NCDL 3EOTL 1IAOB 4E42A 3QZBA 4CVXA 1BQHA 3QJFB 1TZHB 1CFTB 2YQGA 2XSKA 1BJ8A 3CZUB 3D39D 1IBYA 1I8LC 1BW8A 1I8KA 3DYOA 3PXHA 4PS4L 5EUKB 2WPXA 3QHFH 4XP4H 2XQYK 4NQVB 5F21B 4R96A 3SJVB 1OGAD 3P3YA 3S3JA 5C71A 4DZ8A 2PCYA 4QMEA 3GHEH 2DWYA 5IVXA 4V1DB 4G8EA 3WXWL 5JDSA 2NMSA 2YJQA 3P9LB 2PCXA 2BVQA 1SJVA 4JFPB 4YSPA 3ESPA 3RY6C 4AQEB 4ZPTB 5LRJA 5L4JA 3ARBC 2O30A 5D1ZC 1FT7A 2VLJB 5EU3A 1ZY9A 2V9UA 3RLSA 5HI5D 1ZG8A 3ABLB 2WWOA 1FL6A 4BFJA 2D7TL 4ZMXA 4UCMA 2OMYB 4C55A 1JBJA 1P9MC 1QFWM 2N4IA 1A9BA 4H25B 3BQUB 1T2QL 2VCOA 3DX7B 1J9CT 1KV7A 3PGFL 3CXSA 2BERA 4NKMB 5CLWA 1MCLA 2ESVE 2EEBA 2ED6A 3N44F 4FUUA 3FRPG 3SCMB 2B1HL 1WTGT 1A02N 1UATA 3CN0A 4FJZA 5AOZA 3FB8A 4M3SA 5BV7L 4UWIA 1IKNC 1A14L 4DCQB 3AM8C 4QRQB 3A4FA 3SGEI 4PJGF 2IWGA 3SE8L 3TN0D 3KQXA 1YECL 3SOBH 1WG3A 4NFDA 2VM3A 4FQ2H 5AG8A 5DRZA 3AGVA 5DQ9B 2R7EB 3L4XA 5I6KA 4PGBB 1WC7B 3I6KA 3VI3F 4NBZB 1EO7A 2IL4A 1G4MA 2GITB 1KN4L 3GI8L 3TCTA 3W91A 1O5PA 4PTTA 5FYJH 5JW5B 4FJ6A 4AEIL 3C8KA 4F58L 1NKGA 3T9WA 4HOXA 3JWDH 2XG4A 4NPKA 4JY6B 5GPRA 2AJUH 1CL7H 4YWGH 3NJMA 4E9TA 1BD2B 4TQIA 1KNOB 5L6YL 5E5MA 3CK0H 1XX9C 3MRGB 4DFIA 1KGXA 3RWJB 1WFNA 4AVAA 4I3GA 2QL1A 4BD4A 3L2LA 3ZYIA 1AAJA 1UM4L 4HCRA 2OB0A 3BN9C 4ZO6A 3BUQA 4Z7VE 4MNQA 3AREA 2B5IB 1RIVH 5AKVA 4DAGL 5F7LB 4I3SL 1NAMB 2F7RA 1TQCC 4F8LA 4XO5A 4UM8B 3OF6A 4WHCA 3MV7D 1OW0A 2K8QA 3X1NA 2HN7B 3LEVH 4P2QB 1JZJA 4B11A 5AW9B 2WHVA 2X4OA 4POZD 3P2DA 1Q1PA 2ZYRA 4ZNEE 2V2TB 2R1WB 1T0OA 3U0TA 3BGMA 4HV8A 2QPFA 3W38A 2CY2A 4GEJA 1W72L 2B5IC 4LHQB 4B5PB 1J12A 1MREL 1YEDB 2AVGA 5G5DB 4U1MB 3SDYL 4MQXD 1JIBA 3TCLA 3CFIC 4ZTEA 4PIBA 2GSGB 1BIIB 5E1IA 4I88A 2CCLA 2X40A 3M86A 3O8XA 4RNRB 4X80L 2GW5A 3LPOA 3MLYL 1XH3A 3E1ZA 1IBDA 2VZOA 1YEKL 2DL2A 4FRWA 3LH8A 4L8DA 4UQCA 3SD2A 1CB4A 2Y24A 3RPBA 1JMZA 1LAMA 1OB0A 3P9MB 5KSUA 2EDJA 1BBJA 4ZQKA 3DTDA 2F54E 5ABAA 4NQDE 1FI8C 2VL5B 5T3XE 4LQ6A 1TKWB 5BV7H 2DBLL 2AJVL 1JG9A 1A14H 2YD7A 3FTGA 4JFDD 2JJUA 3DMMD 4HF5L 1D7BA 4XO9A 5T1LA 3X13B 5T1DH 1QEWB 3DDGA 1TU2A 3TZVA 3QXDB 4FADA 1ODUA 3FHEA 3WN5C 4MAZA 2IIJA 3PBEA 4FQXB 1HXYB 1AE6H 5F70A 3I84A 1L0YA 4P2RD 5F7FA 4WCYL 2CKNA 3CFMA 1FJ1A 4JREB 4XOCA 1KN4H 2A9NL 4QJ3B 4B97A 4KO6A 4KTEH 2OXHB 3S2AA 5GGVH 5DO2D 4HJ0C 3IJEA 1VGKB 1E2VA 2OJZH 4F58H 2YRBA 1JPSH 1UA3A 5DJ2B 3TO2A 1SXZA 1O7DE 3U4AA 1CDYA 4BZ2A 2R2BB 3SDCB 4PJDA 3WC7A 3RDTC 2LLNA 4PLJC 5GHWH 4RFOH 2DQMA 1ETZB 4RAUB 4QUOA 3FU7A 2L4OA 3N2JA 4UB0L 1K8IB 2KHAA 3HW7A 5L2KE 2ZPAA 4GQRA 1UB6A 3KPMB 3BH9A 2D4FA 4M3HA 2DWDB 3MI6A 4HUWA 2OMXA 4PRHA 2F7VA 2CRYA 3EJZD 1AD0B 2GFQA 5DUBA 4LP5A 4M1GL 4PMFA 4YX2L 2P80D 1MFEL 2AJZB 4J3XA 3MA7A 4TVPL 4WO4D 1XSJA 3NCEB 5D1QE 4JQIH 5DR5H 1PW3A 1T5XB 4LCWA 2HJLA 5FGBC 2H26A 5IQ7H 4GPVA 4WNQB 3SDCC 3CZJA 4JN2A 5G22A 5C09E 1QSTA 4GSXA 2CBOA 3SDXA 3FB7B 4CGTA 1SN5A 4ZMOA 4K23L 5GGUA 3US0A 5JPMA 3UTQB 2GJRA 1NC4A 3BPCA 4N2HA 4WW2A 1WISA 3H2WA 4FXKC 3TH2T 4IF5A 4CW1A 5GQBA 4GRWF 1QNZH 1RJLB 2R1YB 2R1XB 4I4WA 1VLXA 5FYLD 4JFOB 3LY6A 3HUJA 3LQAC 2JVUA 4M93C 1EBAA 1DFXA 2XJKA 7CGTA 1Y07A 3WENA 4NO5A 2Y7NA 4HWEL 4JKNA 4MI4A 4L29A 1WAAA 1GKEA 1ET7A 1G7MA 1XF3B 3SBPA 3C5JB 1MQKL 4XN8A 5IP4A 5E8EA 2ZEGA 4E41A 1GOGA 3O2DH 4JFSA 1SQHA 3K1KC 5DYOB 1HZLA 2AFSA 2YD0A 15C8L 3ZTDC 2AJVH 5I2IA 3EZJB 3H85A 4Q58C 5C70A 5HYIA 4OLUH 3FW6A 5KJ4A 5T5FA 3LODA 3FUIA 1R5WB 2PO6B 5IUCA 1U8JB 4I13B 1KCSH 4L2YA 2PJ9A 4DUXA 4AI7A 2EP6A 4LVOC 1ZS8B 2D7NA 4YZFE 5IY5B 1YUKB 1BMZA 4PJ6A 5GSVA 5JHAA 1G84A 1HI6A 2XV0A 4XP6H 4WCYH 3FQWA 5I8OH 1OCWL 3VD9A 3HZYA 3P9WB 2A9NH 5DVMA 3WIHH 1M2OA 3PHQB 1OIOA 3EFFA 1B88A 3T77A 4YFLI 4XPTL 4IEFB 4OF5A 4P4KD 1MCOL 1UA6L 2ZOWA 6FABH 3P2TA 2NUPA 3VYPA 2VOTA 4PS3A 4G2AA 1IGJA 4GMTH 1L0CA 3NT0A 3V5HA 1HESA 2YEQA 3TEZA 4JLRB 5JHDB 4HEPA 3BSZH 1PU9A 3PWUB 3J7HA 3KI9A 4QTIH 3E9TA 2EDMA 4JZ0A 2GYSA 1ID5I 3OAUL 1Y18A 3RBGA 4V33A 4M6GA 3QULA 1MW0A 2YFOA 3INUL 4LCIL 5JXAL 1TXKA 3QUYD 4U1HB 4FMFA 5LBSA 4ZYKA 1CDIA 1KIPB 1NAML 2DQGH 3KYNB 2V7HA 1XCQB 3QORA 1E3FA 4O2EB 4ZG1A 3CHXA 3MZTA 1KT2A 3ESUF 1CBXA 3P40A 4ANKA 4CMMB 1PQZA 3K3QA 1DBKL 3FQRB 5AUMB 3ZXAC 4JFTA 4PWGA 4XXDB 3ULUE 3OJDA 1A22B 1M9SA 2VAAB 3PL6C 4N8VB 5AW8B 1N70A 3ALPA 3CFKB 3UTZB 4BKLB 4L3EA 4P49A 2E5EA 3NJIA 3RJOA 5CN1A 4WV1C 4MMYA 4QGYA 5F9JB 1P84J 3L81A 4XR8C 1JXKA 3NQIA 1VKXB 4DEUA 3WLWC 5D4IA 2RTTA 4KKAC 2J8NA 25C8H 3LYRA 1XE4A 2X4RA 4X7TA 2CPUA 3VSQA 3UAFA 2Z1KA 4YE4L 2ZEDA 3HC4H 4AMKH 1UM5L 1H6UA 1JMXA 3VA6A 2Z8RA 1H5BA 2Z93B 3FH7A 5C0CE 4A31A 4WUKL 5CMAA 3WC6A 1AIZA 5KBDA 2EEXA 3ROLA 1SN0A 3KVDD 4AVJA 3QQ9D 2XXGA 1D2PA 1TMCB 4PRIB 2QKIB 2ADGA 5JPNB 2XTJE 1GHFH 3R4DA 4HHGA 5FDWB 3MAWA 3TBTB 4E0AA 4LL9A 8CPAA 5D7HA 3HE7A 4YXHL 3KM1A 3D4YA 5AVQB 4Z7WB 3P2HA 4AM0A 4DEWA 5D1XE 3KGUA 3R1GL 5ABDE 3I85A 3IBOA 3I3DA 1EMTH 2ZCHL 4S2SA 3X11A 4EOWL 1CT8B 3ZR6A 1L9RA 2GCYA 2R9HC 4LSSH 1OHQA 2ZUXA 1FAIL 1BPLB 3B56A 1Y6NR 4PRHE 3PP9A 4ZMPA 1WUNT 4IBTA 4Q4IA 4LOUC 2FX8L 2QADC 3APMA 4MQTB 3SJGA 1CU4L 2IALB 4XVTL 4YHZH 4MAYA 4C59B 2EH8H 4MXQD 4DUWA 1MCOH 1T7XA 1MFVA 2JLPA 2V3DA 2VO8A 3QZLA 5CO1A 3DXAB 2J44A 4JKMA 5F3HA 3R96A 2DD8L 3MJGX 1FH2A 3ABKB 3DVNA 4Y4HB 1M2VB 3FSOA 4C83A 3ORJA 5INDA 3IFLL 2ZOTA 4GRMB 2OR9L 2O93L 4WI8A 4N2FA 2NW3A 3SBWA 1ELLP 4YL4A 3FNCA 3PLYA 1KLFA 1D5IL 3HRZA 4KDVA 5AVZB 1I4FA 4XCCH 1GIGH 4YR6A 2QV4A 5FA3B 3CGTA 1I8UA 3QDJA 5AB1A 5KSAB 4BGLA 5K69A 5AYTA 3WJMA 2D9CA 5JXAH 3K72A 1WF5A 4XCEB 5DQDL 1DVYA 2CLVB 4BSVA 5HYQA 4JHBA 4NF1A 1I1YA 4LKXB 3RTQB 4LESA 1L0PA 4ZMNA 3LQAL 2CO3A 5ISZB 2ZXAA 3DC0A 2DWEA 3HJ0A 3OAYH 4OGXL 4KLVA 2PYFA 5D2NC 2G5BA 1VFBA 4PHXA 2FWOA 3L5WB 2WM0A 1UFHA 4G1MA 2PR1A 3KE0A 2N7BA 4WHYG 4P3DA 1F2PA 3C08L 3QO1B 2F61A 4Z7NF 3NIFB 1K5NB 2WKOF 1YEEL 4IGBD 3TBSA 4WWVA 1QPXA 1TJHH 3RBSA 3UBXA 1L6XA 5D2LE 4DZBB 5KSAC 3S3BB 2VISB 3BOVA 4I0PB 5ETUA 1AO7E 2ZP0T 5TQ0H 3FXIC 3VVVA 2L8AA 3MJ7A 4UIBA 3ENEA 1W15A 1RUKH 3KPRE 2Z31A 4X6DF 5DS2A 5E9AA 1OM9A 1NDTA 3LIZH 4YE4H 5B7EA 3WFDL 1PG7H 1MEXL 5DSCB 2RAMA 1JV5A 3A5VA 4M5ZL 3ZZSA 5F88B 1XGQA 4MD0B 1IY7A 3FZUC 4LAJH 4MCSA 1LO0L 4FLOA 1S7SB 5E5RB 4CADB 3L3DA 4F7CB 5KYYA 2FL5A 2ZNXA 4UOJA 4RS2A 2IGLA 2KKQA 3DJRA 4I0PC 2J3SA 1J05A 1NOAA 3ECBA 4ISVA 4KNTA 1DVFA 3US9A 1BLNB 3IDGB 4F9LC 4RDQF 3BWSA 1NFAA 4JO2H 4WU7A 3NIGF 1JNNH 3R1GH 1FE8H 3UZVA 4LOEA 4Y19A 4DKDC 5FK9B 3DIVA 3B6SA 3HZVA 1LO4H 1KTLB 2Z0BA 4GXUN 2JQMA 2XZZA 1FAIH 3FF3A 1MCIA 4NUGH 5GSRB 1JJUA 1SYVB 5C0BA 3RUGB 3D07A 5FA4B 1YEFL 4KRLB 2EC8A 1RXLA 4OV6F 3PWJB 1CU4H 1G4RA 1RZGB 3NZ8A 3VFWB 2W65A 5I75B 3KPQA 3VXPB 4C56A 2RD0A 2VLKB 3ZDYF 3P77A 2NXYD 3GXMA 4JAMB 5DD6A 1QFWL 1OLLA 4JW3A 4PJGA 2Q7AA 1IFGA 4HOWA 3S36L 1OSZA 1QR4A 1YPZF 3FO1A 4BZ1H 3CZKA 4PJ9D 4ZNCD 3OKKA 3IFOB 2XWCA 4CGNA 3AS1A 1ZG7A 1NMAL 2WAQA 3IXTB 3KL3A 5ID1A 3EADA 4N0UB 1TF4A 3FMGL 3UFIA 1CBVL 3SPGA 1S8DA 5B38A 1RERA 3NE7A 4R2GD 5DQDH 5HHPB 2KLTA 4NCZA 3MA9H 1YMMA 3OGOE 4YQXH 4F9UA 1JWUB 5I75C 4UOQA 4EIZC 2WBJD 5B1JA 1YREA 1WS8A 3I2CL 3VWJA 3ZQ9A 1A6UL 2DI9A 2H7WA 1G7IA 3FQXB 4HGKC 2ORBH 3S34L 4XHJD 1JHTB 5HVWA 1ZHLB 4HFWB 4X9GA 1E9PB 4WTZA 3D8MA 4J2XA 2V8LA 4PJXF 4L4TA 1HHHA 3MUHL 4OFDA 2G2NA 3QPQC 1IC0A 1KUMA 2IGTA 1XGTB 2HVBA 3CDFA 3CU1A 4P99A 4APQA 4EI5D 4EQ2A 4MBUA 3TFKC 5M95B 3U6XS 5FUOL 5DT1H 1NPNA 2EDFA 1A5FL 3FRPA 3IGLA 4QXGH 3IGKA 1A9EB 3WFDH 3WIIH 1UXSA 4GQPH 3D7FA 3KHOA 4AZ8A 1AHWB 1FV1B 2H2SD 3DO3A 1EIBA 1N8ZA 5PCYA 3RZCD 4KZDL 4LKCA 1OGPA 3T0ED 3ZJ0A 2DMHA 3U2IA 1LO0H 1F4YL 1P5UC 4WSKA 4XPBL 1MXGA 2BSED 4H1LH 2Z10A 4R6TA 2BVUA 2VXVL 1MW3A 5AB9A 2LU7A 5TDOA 1LD9A 3VI4B 3H8FA 2BNRA 1PBYA 3RO0A 4Z95L 5HY9A 5ID0A 4N1EA 3K74B 1CX8A 3SPIA 2BP5M 1HDUA 1KB9J 4FFZH 2V9QA 2CTBA 3L9RB 4ABVA 2XG5A 3R18A 5EBMA 1BBDL 2PRBA 4G59C 5D7IB 5JUEL 3VWKD 4MNHA 3IFPB 3IGFA 1X9UA 1UD2A 3ZKNC 3HI1B 1P5VB 1I7RA 3QR0A 4RVBA 2V5SA 2DN7A 2K3HA 3KLHD 4N8VG 3VU2A 1XFPA 1KPUB 3Q9QA 4A7QA 2OAAA 1U42A 4KRPD 5HHME 1IC7L 3RBUA 3EFAA 1E4XH 1ZT4A 1R75A 3U6RA 1C1EL 1T89C 1UWEH 2BSSA 4OZ4A 3UACA 1RU9L 3VGHA 4Q6IB 2C8NA 3LXUX 4KXBA 3WHXA 2DQCH 4D9RD 3OR6A 4DGYH 1QFWH 3X3FL 3KL5A 4JZOA 4POUB 1AFVH 2LAGB 3GSXA 1IZKA 3CHRA 5IQLA 4DN4H 1OPGL 4MMOA 2PCPB 5GRVL 2Z7UA 3UG3A 1HKLL 2DICA 2VW7A 5H35B 1F1DA 4K0OA 5SX4I 1PD1A 4A39A 4P04A 2ANPA 5E1AB 2CO4A 4S1SL 1PZBA 4JFZL 4HUVA 2ZICA 4FJYA 3K0YA 1OLZA 2XWXA 1WAPA 4UT6L 4HGWB 2CHXA 4S1DD 4HIXH 2ZWYA 1BFVH 1T0NB 5G21A 1S2EA 2WQXA 2N3JA 3TPUB 2HVJA 4MB4A 3HR5A 1YA5A 3MNWA 2NOYA 1VGEH 3ZT5A 2NQCA 3EYFB 3LKOA 4YBLB 1NUFA 2H6OA 1AGDB 4QHUB 3GBNL 4ZD3H 4XN9A 2ZEEA 2K0RA 2XI9A 2HX9A 1HEJC 2R0WH 2Q4YA 1BSIA 2GB2A 4GO8A 4FLHA 2Y7OA 4YDNA 1DQJA 2AGJL 2BWIA 4C8XA 1MZYA 4OV5A 2WYRA 3PXJA 2C4FT 5A1AA 1Z0MA 1QKZH 3KYOB 1PLCA 4QRSB 2PCFA 1LILA 4WEEA 2FYYB 1J0IA 3UAEA 4UCPA 4X7EC 4RWYL 3HS8A 2F9BT 1M42A 3K5RA 3O45A 1OAKH 1ML0A 3EBIA 5GJTH 3KVQA 5DJ8B 2XWBA 5T3XD 2C9RA 2Y72A 5JOFA 3UBFA 2QGDA 4EI6B 1PNDA 1A4CA 2LQRA 3PHAA 1R0AL 1L3NA 2Q2LA 1BZ8A 4UMSA 4JO5A 3R06A 1V3MA 5CLTA 2HJKA 4Z95H 1JNHB 3ILEA 2I25N 4C56E 3GGWA 3PIQB 3TEUA 1AI1H 4Q9RL 4R84A 3ZVVA 1BBDH 5HVFA 4YHLL 1G9NH 2MKLC 3A67H 5JUEH 3LNGA 4HJGB 1DQML 4A55A 3KPSA 4M8RA 4HVBA 4JFFA 2VXTH 4DQOL 2J5WA 3VFSA 2BIHA 1BPNA 1I9EA 1AR1B 2YUZA 5D1ZI 5DEZA 5F1NA 1BVLA 2CE6A 4IKLA 2JF1A 3HC0B 2YAHA 1RZJC 1U95B 3HI5H 4JPIB 4JRXD 3FHQA 4AQOA 5JPMC 3K6NA 4OZIE 1YMME 2WNXA 3D7PA 4G8GD 4IOSD 4UV7H 4M5SA 4WW2C 5IHZA 5L2KD 4NSQA 2F18A 4IRJB 3F7VA 2MNJB 3MQIA 1CXLA 1U3NA 3K6SB 1GW0A 2Z8WC 1K8DB 3JVFC 3NSJA 3WT4A 4BH8B 3BI0A 3EHBD 5FYJE 1DDHA 5EOTA 5DWMA 4DPRA 5F7DB 4LBEB 4B10A 4XMUA 4IHOB 4I7ZC 5IMOA 5FB8B 3RKDC 5FDYA 2P5WA 4KKQA 1AR1C 4W9KC 2EDTA 3ME0B 1Z6JT 1KWGA 1JWQA 4NGNA 5C09D 1Z5HA 1AKJD 4UT6H 2VXQL 1M4IA 4N90E 1JFQL 1X44A 4IBZA 2A83B 3RIAF 2J7LA 3WIHA 1KY6A 2GTQA 2WLJA 4HIJB 2P26A 3CQQA 5CEXB 1JK8B 3M46A 3WY2A 3UERA 4CJ1A 4OLXL 4AT6A 4KMQA 4HJ1A 5MERA 3LKSA 1M7IA 3EJRA 4J3SA 4OTXL 3GBNH 3IGUA 1A6AB 1AZNA 1KJVB 3HFML 4J2QA 4YGOA 4CDGC 1RZKH 3OKOA 5AVSB 1PY4A 2WUBL 4KBPA 4NN7C 1YQ2A 2WN3A 5IOKA 3GMLA 2AV1A 3MPCA 3ZBMA 2J88H 3BSZA 3SO3B 5EC1B 3EOYG 4HMCA 4XB8A 1IAIL 3SYPA 1Q9KA 3KYMB 5DRNB 3WTUA 1BREA 3S96A 5BZDA 2E7LA 3ECUA 3QB7C 1MHPH 4IMKC 4XBPB 3S4SB 4MXUA 1YN7B 2OSLB 4N9OB 3GM0A 2X89D 2FIKB 4JFEB 5KSBB 3QI9A 1A6TB 3QJFA 3KDPB 3EYOB 3SOTA 1YYML 3FRUB 3V0HA 4P4IA 4GLRH 3QQXA 4JPKL 2FLMA 4O51A 3V2AR 1CXHA 1GGYA 3CFTA 2VMFA 2VDOB 3SJVA 2GSMB 4BFRA 4X5RA 3SO3C 1EEYB 2ZKWA 2BNQE 4ICWA 5KYNA 3EUUA 3GINA 1XB3A 3U30B 4FL4B 4HWZB 3Q6FB 1MHHA 4UTBA 4P2OB 1FRGL 3DTXA 3D85D 2XWDA 1ECYA 4JDEB 4X7FC 4DKEL 3QORC 1SUJA 2X4TA 4MCPA 4JM0A 4ZPTA 3VE0B 2IOIA 4DN3L 5EC4A 2QVKA 1RIUL 5ESQA 5JLZA 2YNCA 3CFBA 5L7XL 1VCAA 3U1SH 2HUZA 4X8JB 4LQFL 3VQ2C 2ZCKL 3HZ3A 4LP4A 1XOVA 1IT9L 1ZLWK 3DJZA 3PV6A 2H1PH 1MJ7L 4GRLB 3U30C 4FL4C 4IIQB 4XZUB 1T5KA 4P5RA 2EJ1A 1BZ9A 3SKJH 2P7TB 1FLRL 4M29A 4PJFF 4G71B 5I6XB 1SVBA 2X6MA 4L1LA 4XVUD 5IQ9A 3ZE0F 1I3UA 3CDYA 3QQ3A 3SKOA 4OZHF 4KITB 4N0CC 5FO7B 2W88A 4MVBD 4O2FA 1BFOA 4F2MB 4FQHA 3MLZH 1H5BC 2R7EA 4PWKA 2VXQH 1HOCB 4D8OA 3VRIA 43CAB 4HUXB 1PX8A 3TA3D 1BZ7B 2GBTA 4I48A 3TJEH 4OLXH 2PKDA 2YPLB 2O6CA 2DIAA 3HE7C