1H8LA

Duck carboxypeptidase d domain ii in complex with gemsa
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
380
structure length
380
Chain Sequence
QAVQPVDFRHHHFSDMEIFLRRYANEYPSITRLYSVGKSVELRELYVMEISDNPGIHEAGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVQSTRIHIMPSMNPDGYEKSQEGDRGGTVGRNNSNNYDLNRNFPDQFFQVTDPPQPETLAVMSWLKTYPFVLSANLHGGSLVVNYPFDDDEQGIAIYSKSPDDAVFQQLALSYSKENKKMYQGSPCKDLYPTEYFPHGITNGAQWYNVPGGMQDWNYLNTNCFEVTIELGCVKYPKAEELPKYWEQNRRSLLQFIKQVHRGIWGFVLDATDGRGILNATISVADINHPVTTYKDGDYWRLLVQGTYKVTASARGYDPVTKTVEVDSKGGVQVNFTLSRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the inhibitor-complexed carboxypeptidase D domain II and the modeling of regulatory carboxypeptidases.
pubmed doi rcsb
source organism Lophonetta specularioides
molecule tags Carboxypeptidase
molecule keywords CARBOXYPEPTIDASE GP180 RESIDUES 503-882
total genus 132
structure length 380
sequence length 380
ec nomenclature ec 3.4.17.22: Metallocarboxypeptidase D.
pdb deposition date 2001-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 1h8lA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1h8lA01
5K8MA 5JM6A 4OC1A 5D29A 3GB0A 3G3LA 1VGYA 1HEEA 1BAVA 1BPNA 1LAMA 4P4EA 5ELYA 3MN8A 3DLJA 3S9NA 3FH4A 4FUUA 5J1QA 3D7DA 1Z8LA 3SJFA 4FL4C 2HC9A 2JBJA 3KHZA 3D4UA 3VATA 3WT4A 5LRKA 3D7HA 3K2KA 2RFHA 3PEIA 3IFEA 4PXDA 4ZI6A 3FEDA 4A94A 2ZEOA 1ELLP 5K8NA 1IGBA 3FVLA 4MMOA 2PJ8A 3LWUA 2PJ3A 1LOKA 1TXRA 5K8OA 1Z5RA 3BXMA 2WZNA 4B6ZA 3CDXA 4H2KA 1XRYA 4Q7AA 3HUVA 5IB9A 1FNOA 5JGFA 4NFRA 3BHXA 2QVPA 5THWA 1CP7A 1XJOA 3E8VA 3H8FA 3K9TA 4A37A 1HDUA 4W9YA 4ZY1A 3H8GA 4P44A 3D67A 4O23A 2ZEEA 3VH9A 1EE3P 2G9DA 1DE4C 3D7FA 2J9AA 3CT9A 2C6CA 1VHEA 3KL9A 3FECA 2OOTA 5LYLA 4UEEA 1QQ9A 1Y0YA 4P45A 2XEFA 7CPAA 4PXCA 4PXBA 3ISXA 4A38A 3NA6A 3WABA 4MHNA 4NGNA 3D66A 4DUKA 2FVGA 4JZ0A 4YOKA 1LFWA 4R8FA 4WJBA 2IJZA 3PB6X 2Q4ZA 4OP4A 1R3NA 4NGTA 1TKHA 4IHMA 2EK8A 4OC5A 3RZAA 2NSMA 2PRQA 5K8PA 2ZEHA 3SJGA 1F2PA 1UWYA 4F9VA 5DS0A 2V77A 1VIXA 2PJ9A 4ZY0A 1CPSA 3B35A 3CPAA 2ZEDA 4EWTA 4MRIA 3NJXA 1F57A 2ZENA 3KCPA 2CTCA 1YW6A 5CPAA 3PBBA 2PJ1A 2GLJA 2PJCA 1R43A 3S9MA 3HN5A 1ZG7A 4MHPA 4K3NA 2XEGA 4OC4A 3PBEA 2ANPA 5LRJA 2Q43A 3D68A 2GU2A 2OR4A 2ZEGA 4P6YA 4EMEA 4MXUA 2EWBA 4OC2A 5F09A 3NH4A 2AFUA 2I3CA 1AYEA 4NGRA 3B3CA 2C6PA 1Q7LA 4MCPA 2BOAA 3SI0A 2GLFA 4PPZA 1H8LA 6CPAA 4EFDA 1FT7A 4NJRA 4NJQA 2QYVA 4OMEA 2JEWA 3KGQA 4MCQA 4R7MA 3PFEA 2PJ5A 1RTQA 1LAPA 4NGMA 1M4LA 2F8HA 4UF4A 2ZOGA 4MHZA 3N5FA 5K39B 1Y7EA 2CIJA 8CPAA 1KWMA 1IY7A 4RUHA 3GLJA 4BD9A 5CBMA 2WYRA 3KR4A 1XMBA 2AFXA 4P4DA 1CX8A 3B2YA 2DEAA 1XFOA 1TF9A 4X2TA 3NH5A 3BI1A 1QMUA 4OC0A 4FAIA 2PJ0A 3TX8A 4CPAA 4MCRA 4Z65A 2JBKA 3FEEA 3KHXA 3KASA 1ARLA 3LMSA 4ZX9A 2ZEPA 4TNUA 2BCOA 3JRUA 3B3TA 1VHOA 1OBRA 4R76A 2PCUA 4NGQA 4NGSA 2XHNA 2QJ8A 2O4HA 4PQAA 3V7ZA 4MCSA 3FX6A 4GM5A 4A39A 1CG2A 3PFOA 3FMCA 4LQGA 3B3WA 2BO9A 4P4FA 3SI1A 2PVVA 5HVHA 3D7GA 1CP6A 2IQ6A 2PVWA 4UIBA 4NGPA 2V8VA 1ZG9A 2HB6A 3KZWA 4OKOA 4P4JA 4TWEA 1BLLE 2C6GA 3FF3A 4X3RA 2Q51A 3SI2A 4KSIA 1ZLHA 5LYIA 1YW4A 3BI0A 3FJUA 1CBXA 3S9LA 4OIWA 3PB9X 3IIBA 3PRTA 2IMOA 5HVGA 4PXEA 3IEHA 2ABZA 3MRUA 2ZEFA 2PJ4A 1TF8A 1PCAA 1ARMA 2XEJA 1PYTB 1YLOA 1NKGA 4P4IA 1AMPA 1ZLIA 1F2OA 2EK9A 3NFZA 3PB7X 2B59B 1GYTA 4IAVA 4WI0B 2PJ7A 2PJ6A 3SJEA 2NYQA 4G1PA 3IO1A 4EIUA 3KR5A 4MHYA 1TKJA 2F7VA 4F8ZA 1HDQA 4JYWA 4OIDA 2PIYA 1YMEA 4R6TA 4AXVA 3L2NA 3V38A 4YU9A 4ZY2A 2GREA 5HVFA 5LYFA 5LRGA 4ONWA 4X8IA 4IK2A 5I4MA 5LYDA 3HLPA 3IC1A 1Z2LA 3B7IA 2PIZA 3RBUA 1JQGA 2RB7A 3WC6A 3WC5A 4ZYQA 1ELMP 1DTDA 4UEZA 3KQXA 2PJBA 2AFMA 1LANA 4ZX8A 3PB4X 3KQZA 3H8EA 4FBEA 1YSJA 3T8WA 3WC7A 5JH9A 5G5DB 3RAMA 3ISZA 4DYOA 5D8NA 2CTBA 3DGVA 3I1UA 2V8DA 3IWWA 4IYKA 3GUXA 4U3SB 4F9UA 4UIAA 4FXTA 2AFOA 3B3VA 5AQ0A 1XBUA 3PB8X 4OC3A 2AFSA 4UEFA 1TKFA 1Y0RA 3NH8A 3NJVA 2ZOFA 3SJXA 3TC8A 2POKA 1ZG8A 3B3SA 3KI9A 4YWYA 2V8GA 2VL1A 3IJ3A 1BPMA 1LCPA 1NSAA 2ZEMA 4FWUA 4WWVA 2CF4A 4P4BA 2PE3A 2AFZA 4DJLA 2AFWA 2PJ2A 2O53A 3QNVA 2PJAA 2XEIA 2V8HA 4P10A 3CPXA 5HXDA 2ZELA 2C1CA 1CPXA 3VARA
chains in the Genus database with same CATH superfamily
5JM6A 4WTQA 3JVFC 1D2PA 4EZLA 2PW1B 4UQAA 1J1PH 3VYNA 2ZG2A 5D2NB 5D2LB 1SOSA 3T04D 2CDFB 4JRYE 1UXMA 1DVFA 3ESUF 2OFQA 4KUCD 4A6YH 5DRZB 5A3ID 4ZX3A 4OAEA 1LAMA 5EU4B 1SEQL 5I66A 3MN8A 1T0NB 3NRPA 2P45B 3W9DA 3DR8A 4DN4H 3JWNG 4F3FA 5JQ6H 2BSRA 3D33A 3P77B 5HDBF 5AB1A 3D51A 2DTML 3JTTB 2HFGL 2JBJA 5F49A 4BZ2A 2WVVB 5HVHC 3PQYE 3VATA 1DVFC 1S46A 3CK0H 3UTTB 2AJ3A 3NSCA 1WFOA 5C3TA 4JFVA 4HIIA 3HI5L 4NM4L 1KTRL 1G7HB 3OC5A 4FG6D 3K2KA 4U1JA 1JXGA 1KT2A 1NLDL 1IGYB 5DLLA 2FR4A 4YDKH 1JNJA 4M6IA 4A94A 1NANH 3FQUB 3VWJA 5JOEA 4XVUC 4H8WC 2BDNH 3ESMA 5B39B 2HYMA 4L9LA 1D5MB 1FP5A 5CGBA 5K8NA 2X1QA 2NY0C 4UUJB 2HCZX 4HJ1A 4NO0D 4GQRA 3S35L 4DP0X 3MLYH 3MV9D 1D5IH 1Z5RA 1Z8TA 1QFUH 2VLMD 4JN2B 4BFRA 1OQXA 4MBUA 1XGQA 3AMKA 2WB1A 3IXTA 4U1SB 3UTPD 3VFWA 4BBWA 4LOEA 1I4FB 1T2QL 5I1HL 2F8XC 1KB5L 1CICB 2O30A 1BZ9A 3E6FB 3VGHA 1ZHKB 5CN1A 1XGYL 2GIYA 4W6WB 2JLPA 4AEIL 1CP7A 5F9WC 4PRBB 4ZTPH 1ZTMA 1SBSH 3BP4A 1YNTB 5FXCH 2R98A 1KCBA 2DQUH 4FQJL 1CGYA 4L8SA 4QRSB 1JVLA 2VSKB 2FX7L 2GAZA 5I1LB 4F9LC 1RZ7L 4JANA 4TLKA 3CMGA 2YRZA 3R1GH 1HL4A 3VGAC 2ZKWA 5ESQA 1H0DA 2XJKA 4IEFB 2J9AA 1CR9L 1YQVH 5BO1H 5F7BA 2WINB 1X4ZA 3SKOB 2I9TA 4G43B 4GI6A 4EVNB 1CLYL 4ES9A 4LOFA 2NXYD 1B0GA 4JX0A 3ZDXB 3UMTA 3L3KB 5CZVL 1Y7VA 1FC2D 2X2YA 3LRGA 3P3UA 5LCVH 3MRLB 3SY0A 1RP9A 3VACA 4BK8A 2Y7MA 1LDPL 1BXXA 5D8JL 3MBEA 3MRBB 2CK2A 2Z8RA 2ED9A 2OI9B 5C0BD 1LEGB 3TC9A 2X7LB 3KVDD 3B7UX 4N8VB 4OIFA 5HHMD 2OQJB 4P5TD 5CZKA 1DEEA 1YNKH 2HN7B 3DUSB 1NCNA 4ZO9A 3B37A 4Y16C 4X6DF 1AQKH 4XMPL 4NCC2 2ZE0A 4IRSB 4E5XG 1NCCL 3ARFA 1RAMA 1FAIH 3W11D 3DJTA 4O58H 1S8DA 1MWOA 5CN3A 3WCYA 2EK8A 4U5YA 3GEFA 2ZCLH 2IWFA 4F7EA 4PJGE 5AEAA 5AYUL 3N6YA 3T6ZA 5IQ7H 2OMVA 4K3JH 1QSFD 5HHVL 3MCYA 4J28A 5IHBA 1GW6A 3G6JA 2LAGB 4YBLB 4XBMA 1VZGA 2VLJD 4Y5YA 3DGGA 1DSWA 3MDJA 2AJYL 2IV9A 3NP4A 4S1DC 3KYNB 5IMOA 5I82A 3UAEA 5AKSA 3NJXA 1HCFX 2V8LA 3BDBA 4LPYA 4KJWD 2CTCA 1G7IB 3WKPA 4MAYC 5KYYB 5CPAA 2LT9A 3BDYH 2CIKA 3L3OA 3NAAL 3VRLF 3NH7H 2PJ1A 4GXFA 3MHZA 3ATFA 2BHUA 1J88A 4ZMPA 2BVQA 4OU3A 5CD5C 2GKIA 2FSRA 2TAAA 3KJ6H 2EE2A 4QHMB 2CBPA 3FFCD 3B7SA 4DW2L 3MBED 1XFPA 5EBVA 4FD4A 1JHLL 3CZNA 3WFHB 4XBEL 2GU2A 3MNZA 5JIHA 5E2UL 3V6OE 1KIRA 1JPSL 1G9MH 1AGFB 1PCXA 2ROYA 3KG5A 4NWUL 5IB2A 4MYWB 5E5MA 3LRLA 1OTTD 1XSKA 4OC2A 4ANXA 6TAAA 4NGRA 1JPGB 4ZQKA 3VE0B 1E5ZA 2C6PA 3TV3H 4PP1D 4JFEB 3LKPA 5CP3H 1RMFL 1DBAH 3HZMB 3RZWA 4X4YA 3Q05A 1OEZW 1QLFB 2AJSL 3TM6A 5DLML 1H8LA 1AP2B 4KVOE 1WRFA 4X7SL 4P2OB 4I0PC 1QBBA 5HP5A 4FADA 4Y1AE 3TYGL 3GLAA 1FSKB 3G6DH 5D7IE 2VLJA 4TQEH 4V1DD 3MV9B 1OPOA 4RFNB 2QZ5A 2O26U 3TURA 2HWZL 4PCKA 4M6OH 1XTMA 2V8MA 3E2HC 3C5ZC 1GIGL 3UBFA 4YFEA 3WXWL 2UY6B 4N6RA 2XWTB 4R2GC 3VI4A 2JKWA 2P4AB 4GPVA 4AYBA 3UG5A 4ABVA 3IDIA 3RWIB 3F12B 4RGNC 1UB5A 3L1FA 3O8XD 4MVBC 2Y7OA 2N7AA 3L7EA 4F2FA 1RPUA 4C4KO 4RUHA 1KELL 4ANWA 4H26A 1JI2A 1BJ1J 3PPEA 1NM4A 1PBYA 5F97E 2R0ZH 4G59C 3GS7A 3X11A 3KR4A 1RPKA 5T3XL 4PP2A 2I27N 3ZDZB 3IJSB 4FXKA 4WO0A 1DN0A 2YPVH 3RKDC 1CX8A 1ANUA 1WS7A 4PB0L 1A7BA 3OB0H 2R0WH 3KLDA 4U1GB 3ZR6A 2F58L 3TWCL 3UAJA 3VNZA 2AJ6A 5DA0B 4TNWF 1FJ1B 1JMXA 3AXLA 4OJEH 3WFEL 43C9B 2MCPL 1QWUA 3HN8A 5C2BH 4S1QL 5FUZH 1ZVSA 2Y2WA 3INUH 4BINA 1UTDA 1JS4A 2NXYB 5DRWA 4M8QA 2PJ0A 1NZRA 2KH2B 4FQXB 1HE8A 1XGTB 5D1QE 2ZKHH 1L3WA 1EJ6A 5HGHA 2QR0B 1DDHA 4M4PA 5KJ4A 4KKLC 4QRPD 3QQ3B 1MPAL 2NZ9C 2J6EH 1CQKA 4NUQA 2VE6A 3VSUA 3HNTH 4HWBA 4JQIA 4AC4A 2CCVA 5J8CA 2WBJA 4HJIA 3C12A 4DP4X 4R76A 3VI3F 5FK9B 4FEMA 1RUMH 1YN7A 1JV5A 3TO6A 2GYSA 1FC1A 4M6OL 2VZ1A 1DANU 3T2NH 2YD0A 5BUPA 4CYPA 3UC0L 2J1KA 1XEUA 2XCMC 5E9DE 1TQBC 1CFVL 5C82A 3NCWA 3VTAA 2CPUA 3HCVA 3TCXA 3UZQB 3HR5B 2B4DB 5I5MA 4AZ8B 3K6SA 1W8NA 1X5AA 1NEZA 3LSOB 3UGXA 4IRJD 4X8CA 4AJYV 4K7PX 3KWTA 2CHDA 2GY7B 3LJ3A 2G2RB 4S1RL 1XIWB 5FGCE 1J05A 4AQAA 1CVRA 1FORH 2FYYB 4PJHE 2A99A 3KW7A 2IJ0C 5TDOA 2VC2L 1KEGH 3T6VA 4KK9D 2I69A 3A0OA 2VXKA 2EE3A 4JPSA 1LO4L 2ZSWB 2R2EA 4J27A 3EGXB 4N86A 3MKKA 4XCNB 4NJAH 1TPXC 1NAMB 2OX5A 5ID1A 2Q8BL 4N2HA 3IIBA 5GSVA 4PV9A 2V2WB 3IDMB 3LPPA 2IBZY 4JM2A 4XO5A 2EYSB 2P49B 3GUTB 1UWEH 3T0EA 1O9WA 3ZE2E 3FU7B 3TTYA 4BSVB 12E8H 3L9EA 2BP0B 2XPGA 5KBMA 4EIBA 1IQWH 4ZAKB 1V0CA 3ZGIA 5C0BB 1PCAA 3CLFH 4B5OA 4ODWA 4TULH 2FNBA 5I71B 3QCUH 3U2JA 5GS1B 3QNZA 2C3VB 5H37H 3UYRH 4EMZA 4JRYA 5AAWA 4OLEA 3UO1L 2QBWA 3ZBMA 1AJ7L 1D5RA 3SBPA 1HXYB 4KKAD 4EDXB 2IQ9H 5D7JC 5EORL 2VISA 1ZLIA 4E36A 5D1ZB 5DSCB 1V3KA 2XKNB 1ITBB 4F2MB 2H3NB 4ES8A 2YAEA 2P8LB 3G5XA 3V4PL 3BRDA 4WI0A 1K4CA 4TNFA 5I6OA 2HV2A 1EAJA 3LZRA 3RPKA 3U7WH 5EBLB 1KBVA 2AVGA 2PTVA 3HI5H 4KV5E 4NM4H 4UZUA 1YYML 1RIUH 2R7EA 1GJUA 4L5FL 3R0MA 1NOLA 1VGKB 3QDMB 5I9QC 2QADC 3NACH 4DUXA 2FEJA 5EH1A 3EJYC 4PJDA 3V38A 1U8QB 4AQ1A 3OKYA 5E9DB 2UY7B 2D2OA 4UDUA 2WIIA 5DJAA 1HEJC 1BV8A 3MR9B 2Y5QA 3UPCA 2JCCE 4BH7B 2IDTA 3LXCA 5A6IA 4PJ7B 1EHXA 1HOCA 3HVDA 4AQEA 5DK2A 2DLFH 4WU7B 2EO8A 3HLPA 1AY1H 1T7WA 4RAHA 2BWQA 2Q7BA 1JYWA 4LBEA 2EQDA 4R6UA 3ARED 1NJ9B 5DVLA 2D3NA 5IMKB 1ZAGA 3WS6C 3UTQB 1HCZA 1AQHA 3K4ZA 3DHMA 2YMTA 3FYEB 2V9RA 5F1KC 3NZ8B 3QJRB 4PREA 2DY2A 5F7DB 5JHDE 2V17L 3IRZA 3U0PA 2ALAA 2CZNA 2YARA 4MD4A 5L2JB 2AMGA 2QLVB 5DD1H 2W65B 4UF7C 4YH6A 4M1CC 5I0XA 1RZ7H 1CB4A 1S7WA 3EY5A 1JCVA 4H6UA 5IJCC 4PJXE 5EHFA 3FIXA 2PYFA 4ZOCA 3PIQB 3B9VA 3SGDI 3H4QA 2CNYA 2QDVA 1ZHLB 4JFED 5HI4C 3U4KA 4CC0A 3D4YA 1GY1A 5EBWA 3SPCA 1GGUA 3I3EA 1H9DA 5SV3A 5IMMA 3AAZB 3LRSA 2OCCB 3BEWA 3DMMB 2YBRA 2X89D 3R18A 4UIAA 4PRIA 4WWKC 3B3VA 1CLCA 1Z5LB 2A73A 4IUSA 5T3XD 5J9PA 3X1NA 3FSVA 3ERXA 4KHXL 4OJFL 3VQMA 5C9JB 3DYPA 4PJAB 4PW9A 5AQ0A 3RGHA 2DL2A 4QXWA 4CSSA 1BD2E 1ZV2A 1QSMA 2AANA 3N1FC 4I7ZC 4UNTA 4ZUSB 2WBXA 3CUPB 4BK5C 3H42L 4OY9A 1AQDB 3CDGA 5C0FA 3QAZC 3PWPD 5DHXB 1FCGA 4S10A 3KBPA 4WW2C 4F92B 4AE0A 2POKA 4S1RH 3SQRA 2EDDA 4YWYA 5F71A 5JQ4A 3OGCB 2F08A 4NZUL 5I8EB 5A6MA 2B5GB 2QSVA 1A6TB 1XGUA 3B2PA 5EPMA 1NSAA 1GW0A 3B83A 2B3IA 4KZ0A 4Y2OA 1TQCC 2AVFA 1DJHA 2JVUA 4F37F 1E3XA 5G4MA 4JW3A 2BY2A 3TBVA 5IIEA 3C8KB 4D0BA 4HUUB 4H88L 2XEIA 1B90A 3QEQB 4X50A 1AR1C 1WWWX 4XCEA 2X6MA 5B39G 3G5YB 4ODSH 1I8LA 1E4JA 4TNVF 1S9KC 5E8EA 3CFDA 3HFML 2B16A 1R3LA 3X3GL 2K8MA 4Z8FL 3VARA 3C5ZD 1SXZA 2D03H 4S1SL 2DQGH 2AJVL 3GWJA 5HYFA 1NTDA 1Q9KB 3RLSA 3BPOB 1A2YA 2E86A 1Q94B 1XAKA 3T0XA 4YUEL 1NCGA 2YD9A 4I5BA 2I5YH 5EF3A 4G7QB 4QF1B 3DLJA 4N85A 5HGAA 4AGNA 1L0XA 2D0HA 2WTRB 3G9AB 3BPNB 4UV7H 2WLMA 5J13B 1IC4H 4MASA 1M7DB 1FBIL 4JM4H 4OIAA 3CXDL 1QI5A 2NYZA 2E0PA 2NYYD 3INOA 4OZIE 3TV3L 4UOZA 2VDPB 3IGFA 3WJLA 1S7UA 3EJPA 3UP6A 3I9GL 5E6ID 4HJGB 4JL2A 4XWOC 4O51A 4O4YH 4I0KA 3RVTD 2VAAA 3P11H 2FGWH 3FB8B 3EBGA 4GKNB 3ZRFC 5C9KA 5E8DH 3MZTA 1FVCA 3HKFA 1CICC 1FHGA 1LD9B 2FBJH 2WLLB 4LXFA 3N1MC 1O7SA 2CGRL 4QB9A 1MFDL 1RZIA 3ELAT 3VYPA 1B0RA 3ARBA 4JB9H 1KZFA 3AG3B 4OF6A 5HBBA 5C0RH 2ICWA 1UA7A 1R5WA 2D7OA 2EABA 2O6CA 4PJEB 1U2CA 1S3RA 3BHBB 4LVNB 1QOKA 3GSUA 1JWUB 2X4QA 2WWNA 3MRNB 3OX8A 4NC1E 4LNRB 4Q9BA 4X9YA 3WGUB 2NTSP 4R7DB 3QUMB 1JZDC 2XG4B 4MA3B 2A3TA 4BM7A 2GHZA 4N2IA 4RMBA 3M1CA 2XN9D 5EG6C 5IFHL 1K4JA 3AQZA 4WNQA 4N0YL 5AB2A 4BQBA 3W0WA 3QQ9D 3CDZA 1FGVL 3TE4A 1I85C 1MI5D 3SGEI 3MRGA 5BRZD 4NKIH 3U4EA 4M6AA 4K73A 4X7SH 1FA4A 4ZAKD 4MMYB 4M3SA 2NY3C 1X44A 4QY8A 4ZMZA 4HLJA 4UV7L 4B27A 3TS8A 1QBAA 1X7QA 2ARHA 1FIEA 3RYOA 1Z4RA 4OFVA 1X3DA 1D5XA 2GPZA 5DZNA 2BSCA 2AGJH 3LD8C 5HDRA 3QUYA 1LNUB 4MHHI 1BQHG 4Q89A 2F1AA 4NPKA 2ZP9A 4UWIA 1TJHH 2X1OA 4JCMA 4Y1SA 4C83A 4FFYA 1BQSA 5ADPL 5JDJA 2XNAB 5IHUH 1ITCA 4PXCA 1XL4A 4PXBA 3K46A 2G5BB 3VXNA 1GSKA 2DQEL 3WHE0 4MHNA 3D66A 2X42A 2C4FU 1AOHA 1H15B 2NUPA 4YZWA 1UOKA 5AD0A 2GBUA 3PPSA 5KUKA 4DT2A 3DIFB 1NE9A 1SQHA 4P5RA 4HH9A 4ZMTA 5DMKA 2YQ2A 4PGBA 2DXQA 1NEPA 2YA0A 2WTOA 1DJYA 2X4RB 3FSZA 1G43A 4PJFF 3GSNH 2FD6H 4QXGH 2FHBA 5KSBE 4L0PB 5DYOA 5F9JA 4ODTH 2YFNA 2Z0BA 1E5UI 3O11B 4U1HB 2FDBP 4F9VA 5DS0A 1NGYA 5IEKA 4J3BA 5GRYA 3S2CA 5KYXB 4AGPA 2PJ9A 1FFTB 4PJ8C 1YEJH 5IWLC 3KYMA 1LL1A 4WFFE 3L3GA 1KJ2A 4JL1A 1MH5A 1XF3A 2EVHA 4CC4C 4Z0XA 3HZYB 3X2QB 1T89C 3N1QC 4M5ZH 4ZW7A 3CXSA 1IEHA 1XCQA 2VH5L 4KTEH 5DD3L 2D03L 4S1SH 4PY7B 5CSZB 5DR5L 1EEYA 2ITCB 3P3YA 3LXUX 4OKVA 4OLXL 4U1MA 3UC0H 1QSRA 5IBTL 5D2LE 3KW8A 3SKNB 2PPDA 2GTWA 3LZNA 3S36L 1YREA 2F61A 4IMLA 4HUXB 2EDLA 4U05A 4X6DE 3RQ3A 4HCGA 2Z31C 4F9PA 3FTUA 3GXUB 4M00A 2YPVL 3KPMB 4JE4B 1JUFA 1DQDH 1YMHA 2VQ4A 2ZEGA 3MXVH 4QYOA 3LRHA 5KN5B 4G9FB 3BN3B 3BZFA 3KBFA 2MCPH 1RP8A 1H5BB 1XXDC 1BIIB 4DEPB 5B38A 5JW4R 1PG7W 3DVNB 1AYEA 2I3CA 1E40A 4RGMB 1FL3A 5AW3B 3ECBA 2X05A 3W5MA 1Q38A 2DQDH 4FULA 1LO4H 4N2MA 1EDYA 1MZYA 1NFDF 4J6IA 2WXFA 4OR1A 1EZVX 4E9TA 4GI9A 1M9WA 4JG1L 5FR3A 5KVGH 3QJHA 3ETSA 3P2TA 4QVTA 4G6ML 4MMZA 3NIGB 1FV1B 3AWGA 4IIQA 4Y5VB 2JKSA 3KGQA 1E42A 4MZ2A 5C0GA 5GRXG 2FB4L 1INEH 3WYRA 5DD3H 1RV6X 4YN3A 3GKRA 3QNXA 1RTQA 4R90L 5I6XC 1WYJA 1QO3B 5FYJE 1HS6A 1Z66A 4MJID 3O45A 3QUZD 2XXFA 2HRPL 3ESVF 3O3EA 1KPUA 3W9EB 1C8PA 1KN2L 3Q5OA 3U2SB 2JB6B 3ZT7A 1R3IH 2GI7A 1NAMH 1U58B 2FXFA 3QXUA 1HZHL 1S7RB 4X2UA 1DR9A 3D50A 3EG9B 5F1NB 3CDYA 1DN2A 1JYNA 5C2UB 1YEFH 4KORA 1QFPA 4FQCH 1Q90A 1XFOA 2F7IA 4Y9FA 4YE0A 2E7HA 1WA1X 2VR3A 3LZQA 2HA1A 3UBXA 4NPYA 1DE4B 2J1ZA 3I02B 1NBVH 3HW7A 4X6BA 3TN0C 4CPAA 3BAIA 5BJTA 4H8QA 1OLZA 4Z65A 2XWXA 5DURB 2QADB 4MS8D 3W1ZA 2DLIA 3Q1SL 3AITA 7TAAA 1N26A 3ZL4H 4ONHA 4DPAX 4WUUD 4G6MH 2N3JA 3ZKSD 2DTSA 4IJTA 2GCYB 5IESH 5JXEA 5BRZE 2HT2C 5AVUB 1FVEA 4O58L 2GJZB 1KNOB 4OSUL 2D9QB 2R0LL 3MLZH 3IEAA 4JZJA 4PJ5E 4Y4HD 4LHUB 3QFJA 3F0AA 2R29L 3UJTL 4BA0A 4NGQA 3BZEB 3I6GB 3DX8B 1Z8WA 3C8DA 2PW2A 4Q9QL 3HE6B 5EORH 1IBZA 1BMWA 5H4YA 4LLYA 3SODB 1PKQE 2JDCA 3VG0L 4LEXL 1M1XB 4IBQA 1SJEA 3TNMA 4Z7NB 3WTYA 1T1XB 2W0LA 4M62L 3FRMA 4KOYA 3MLXH 3N1PC 1L5GA 3H4FA 2E8ZA 5KVFH 5IROA 4LSSH 5DQDL 2CO7B 4EN3C 3OKKA 4JJOA 3V5HA 3OR7A 4K30A 1FGNL 4NXSA 2VR7A 2WZ0A 3AU1A 4L0ZA 4MZRA 3FXTA 2K4AA 1MHHA 5FGBC 4XHJD 4IBWA 2YWYA 2C34A 3MX0A 3QFJE 3G7TA 1RK1A 1C8QA 2N56A 4FQCL 5DEFA 4LVHC 3G3SA 4I49A 5KSUB 4N90D 1F4XH 5JHDA 1OAJA 2CA3A 4DFHA 2Q51A 3J27A 4MQXD 3BPCA 4PRHD 5LYIA 3BKMH 3MLTB 4HWZB 5DEZA 2BNQD 3N44B 2HVJB 3D85A 2F7OA 4MCZB 1NKRA 1I7TA 5C0EB 3U46B 2FEEI 4WW2B 5DJ0A 4XP6H 4XNUH 2NY5C 3EFDL 3FPYA 4MFJA 3W57A 3MA9L 1WIUA 2XTJC 4CAEA 4JXQA 1IM9B 2IFFH 2HVBA 3SOTA 5CD3B 4FXLA 4L4TD 1XF2B 2ID5A 3L48A 4NBZB 5E1QA 5MEOA 1HHGB 4HF5H 1ARMA 4MWFB 2AXWA 3W5NA 3TF4A 5EN2B 1E4KA 5E2VH 2YGVA 2X89A 2O4EA 1KBWA 1MUJB 1R3KA 4ANVA 4YHIA 1VZHA 4H25B 2QECA 4N87A 5FHAL 1N64L 3TNNB 1ZV5A 5KVGL 4XMPH 5F7KC 3M88A 2JB5L 4XP9L 3RHWF 3EGSA 2HTLD 2JCWA 4CU8A 5JXAL 4MXWH 1NCOA 3P0VH 4UAOC 3IAGC 5IBUG 1QLRB 3DX9A 2DQGL 4Y19A 3UACA 1KJVA 3CHQA 1BA9A 4MX7B 1G9NL 3PNRB 3F7LA 1IX2A 3L5JA 4CC1A 2ICWI 4YU9A 2NX5A 4TVPD 1JZEA 5C0AB 4JNXA 1VFBA 4R7XA 5HDBB 1ZA6A 3RBGA 3TJPA 4JG5A 1A6UH 4PJDF 4Z7AA 3BH9A 2XFXB 4ZYKA 5LYDA 3WL9A 3QEGH 3R7RA 2VDKB 3O41B 4JXRA 5LLIC 5T1DH 1SXSA 1PS3A 3MA9H 2FQEA 3VI3E 2JKXA 1IM3B 3NGBB 3RWCB 1JQGA 1A25A 4OGXL 1MJUL 3BDXA 3CGTA 3WFEH 3OM3B 1CDJA 1XZ0B 3QH3A 1R0AL 3F83A 1V10A 2QQLL 5IP4A 4X7TB 1D7DA 1EO5A 2JJVA 3U0TB 3V5DB 4GB9A 4KI5F 1NOFA 3W0WE 1CD1B 4CAGA 4YRHA 3B3BA 3OXRA 1TOXA 3ULVH 1BQLH 2AXFA 4BZ1H 3T8WA 1FNGB 2ITEA 3R8BB 2BSED 2KYIA 3PWJA 4MCMA 4QUOA 1G9ML 5D7IA 4LAQH 5CUSL 3GI9L 3FQTB 3CFJB 3PHOB 2XQ0A 3M17B 3C75A 4GS7B 3CDFA 1OAYL 1TITA 1U8NB 2JXMA 1MAML 5ANME 2MNUA 2YSSB 1R6VA 3WENA 4XBPA 4LUAA 1TZIB 1OTTC 1I9JL 1XD1A 1YC7A 2EDRA 3C60D 3QHZH 3KLLA 3TZVB 2AJSH 1VKXA 3BP6B 5LDSA 1ZE3C 1QUPA 4WFHD 2DPTA 4TLTA 4OLVH 2WO4A 1FFNA 3HE6D 5IW1B 2VL5B 3IDJA 5E1AB 4OC3A 5KVFL 3VQ1C 2K0RA 2CLVA 3RE0A 4JM4L 4XRCA 5AOIA 4Q36A 5KJ7E 2X6VA 2X4TA 3E0GA 3STLA 2D31B 2BWDA 3LNGA 2R29A 2OYKA 1TFHA 4KMTL 4RMRA 1T20A 3T2QA 3II1A 4L8CA 3LEVL 3MQIA 2E7DA 5KS9E 2L7QA 4E2OA 2UZYA 1JN6A 2VDPL 2VUYA 1U6AH 2NDGA 2HX8A 3P3RA 2OZGA 3MXWL 2A1WH 1OAQH 2OYPA 3D39A 2G2NA 2Q2LA 4HQQL 4JB9L 4E9VA 1ID2A 3ZY7A 1MCSA 1RIHL 4PRHA 2CRYA 3Q2LA 4YDNA 4MQSB 3G5VB 4IJ3C 4GAGL 3NIFB 4GLRH 4KFMA 4HPOL 5T1LB 3X3FL 2ZX8A 2O6FA 2UXVA 2C1CA 4LLWB 5LGHH 2AJYH 5BCAA 3IGUA 2PTTA 3VD3A 5FYKD 1INQA 1BVLA 4GAYB 1QNIA 3QZWA 4JDVB 4AWJC 1YEDB 4HFUH 1HE7A 2C1PA 2CLZA 2Q9OA 2NLJA 1A1NA 4H8PA 1X7TA 4CKQA 4JO3H 1RUKL 5F7FA 4QI3A 5ISZB 4W9IC 4XNZC 2DW5A 3QE5A 5IY5B 2APVA 4Z95H 5GGSY 3UPAA 1BPNA 1T5KA 2JQMA 3MRIB 4BJLA 1G0DA 1AXSB 4LRIA 4CMHB 4LHUD 1F11B 1ZXQA 3GMOB 5GSRB 5AVWB 2MKWA 3CSBA 3FMGL 3SPJA 4AH2B 3SDCD 1YYMH 5E1GA 5C0CB 4KZEL 3BP5A 4PWGA 4N2OA 1BFVL 2IOIA 5CSBA 2QMKA 1CD0A 4ZNEE 4A31A 2PSWA 4BQCA 5TK2A 2P6GA 4O2CB 1IFHL 1OGAB 5FYLD 2ATRA 3WIHA 5I74C 1KB3A 1O5PA 1GZHC 2RFHA 2HG0A 4HOWA 3ZTJH 1LEKB 2DBLL 3JZYA 3UZEA 3L45A 5JPMB 3FB6B 2ERJC 4HJJL 1NBZA 4XP4L 5K9QI 1CI3M 2AE6A 4K07A 1R19A 3AG4B 3C5XA 1XGPB 3AXIA 1KCUH 4GIOA 4K4KA 4NBYB 5DQJB 1TVHB 5A16A 3B3IA 1TXRA 1QI3A 1CMOA 1JGLL 1AYOA 4JY5H 2VERN 3EO0B 4N0CD 1FZMA 1T03H 4CBZA 3IDXL 2FWSA 1EFXD 2CALA 2A6DA 2KQMA 4ORGA 3VD5A 1I8IB 1Z1WA 4ELKA 3Q0HA 5DD6B 3FOLA 3HRZC 3TXAA 3D2TA 3NG5A 3TO9A 5EU6D 4NFRA 2YD2A 4NJAL 4GSDH 1SY6H 1UUNA 3SPGA 3ZMRA 2NR6A 2NZ1A 1J1PL 3BVTA 4JFHE 1YEJL 3SDXE 5CKAA 4HU8A 1JI1A 2ZX9A 3K0YA 3N55A 1M2OA 2WV3A 5I76B 4IHOA 4NOFA 4F2EA 4HAKA 1IEAA 4KOUA 1ZPLA 4DZ8A 3L3IB 3NCJH 3OL2A 1T80A 2G9HB 4XXCC 1XT5A 5IFAH 4JLRB 3FECA 1KTJA 1GJWA 3D18A 4N9GA 1IFHH 3U6XS 2ZICA 3PHQA 2MRYA 1N8ZA 3TBWA 1QRNE 4U1NB 4HCRH 5IEHB 4F58H 5JOFA 2HMID 5D1QB 7FABL 1A3ZA 1YN6A 2A83B 4UQIM 4HGWB 4RAUA 1NLDH 3W39B 4IOFD 2B4BA 4GQ9L 2IADB 2BNQE 1NSNH 3DJ9A 1C16B 1ZS8B 1A9EB 1FDLL 1KTCA 1TZAA 2VIRA 2YD4A 3IDGB 4U6HA 4ODXB 5D4QA 2CO3A 5ANHA 1BVOA 4GW1B 3BJ8A 3SDYL 5EU7E 4JO2H 1MHPL 3PP3K 3DI3B 4R8FA 2Q3AA 2X09A 1KB9J 3GINA 4G8IA 3UERA 1EFXA 3ESPA 2EICA 2XXGA 1OCZB 2J44A 2AQNA 2BIQA 4TPRL 5GGVY 5C0JA 2NXZB 2EILB 1QRNA 4XO4A 3UROR 2BP5M 3VFRA 3MV7B 3THML 3OGOE 5HDWA 3HHMA 4HK3J 4FX5A 4N1CA 3KPSB 1TXKA 3ARGA 2ZOUA 3O4OC 4U0QB 2RH0A 3I50L 1URZA 3G9VA 4OJDH 2Y0MA 3T8MA 3KWUA 2C1OB 1YQEA 4XB3A 1CFTA 4YDMA 2XX1A 35C8L 4AI7A 2FO8A 3KPNB 1PZ2A 2WW8A 2A4CA 1OK0A 2OMWA 1A7RH 1IL1A 1TG8A 2YKLL 4Z7VF 4JFFD 4F58L 4OV5B 2BOBA 2R4SH 4K3NA 5KYUA 4HEPG 5FOJA 4XXCA 4OH2A 2ISDA 4LSSL 1NINA 1T22A 4HUMB 2Z3MA 3HA0A 3RL1B 4FHJA 5I2IA 5C0IA 4MDIA 2G3AA 3WN5A 2OR4A 1KLFA 2VLRB 3II2A 3BWAB 4W1TA 3FRPB 1WFTA 3ASNB 3QIUA 2PCPB 2DM3A 4OBRA 1M6UA 4ACTA 2IAMC 2D9CA 3H0TA 1DJIA 3F85A 4LSPH 4U1KB 1WEJL 1RJYA 3NH4A 3Q2CA 3M7OA 4KQ4H 3F5WB 4MFZA 5E8DL 2K78A 1KGIA 1NBVL 5LBVA 5FECA 1W6LA 1WICA 4JKLA 4E9YA 1WZAA 3SCMD 3NE7A 5DK0A 5HHPB 3FQRA 3BWSA 4XNMA 4TPRH 4WWKD 3O3DA 4WEBH 3N40P 3P9MB 4PJIE 3UPRB 3FQWA 4MNHA 2R8VA 1EJ8A 3TBYA 3WIAA 6CPAA 4X9FA 2HJFB 5AALA 1W8EA 3QRGL 1I8KB 5BOZG 3QARA 2GUOA 1AFVH 5SWQB 5ACZB 3HNVL 2DWYA 4FNPA 4B9JA 5EC1A 5I66B 4YFLF 5B3NA 5BQ7A 4NJQA 1XR8A 1T03L 3IMTA 4HX1B 4DGVH 1EAQA 5IVXE 3L3DA 4XWOD 4AOFA 1QFOA 3B9EA 2XSKA 2APXA 3A23A 3PWUA 5EZLA 5D72H 1A4JB 2Q2EB 3EFFB 1Q9LA 3L5WA 3MUHL 1MNNA 3CZSA 4NGMA 4YSTA 4YPGB 4PJ9A 1Z9SB 5EU6B 3F7PC 1BJ1H 4OBSA 4NQCD 2JKRM 5FB8B 3CJJA 3EYSH 3FQUA 5LNEA 2MKLC 5FKPB 4FHKA 3SKUD 4KMLB 4YSAA 2YO3A 5AVZB 1BOGB 2CO2A 3HFMH 4HMEA 4BD9A 1S7XB 3NRQA 5BRQA 4OZ4B 3EJQA 5MHSD 3FTWA 3UDWC 5TPWL 1OAUH 43CAB 2VDLH 4JFTA 4P23D 3LS4L 4HPSA 5TQ2L 1FAIL 1TZHB 1XGQB 1AKJD 3E80A 4JFPB 5FV1L 3B1UA 5CZXC 3UAAA 4PJCE 4JR9L 5E24E 3NIFE 5JA8B 3MODL 5CEXA 5F6HJ 4UDTA 3TA3D 1UWXH 1OOAA 3GO1L 4PLJC 3GMQB 4ADJA 1Z9NA 3TX8A 2NY2C 2YXWA 1I7ZB 2XPYA 1XF8A 2JBKA 2XOTA 3KASA 4HD9A 2ENPA 1CD8A 1KGYE 2LU4A 2NNRA 2QKIA 4XPBH 4GRWE 3KPLA 3VWDA 3RTQB 3TYGH 5D7KE 3D9AL 32C2B 2BSDA 1LP9F 2CIIA 1DBML 3GMPA 1JNNL 3L3HA 4HS8H 4NM8L 3X14B 2PTUA 5FWQA 2WN2A 3FPXA 4DIXA 2D0FA 1N5AB 4M93B 1HSAB 1UD4A 2XHNA 4WFGE 4ODVL 1JK8B 4Y19E 2J2ZB 4IBZA 4LKCB 3SKOA 3LIZA 3OSKA 3HI1A 4LQFH 4MA8H 5JQIB 5DUBB 5DEGB 3Q6GL 5DMGC 3CSFA 2BO9A 2OP4H 4UFXA 2VLME 2ROXA 2CLRA 2IBZX 4NQCA 3CSYA 4GUPA 2NCMA 3GI9H 3X12B 1EAPB 3QFDB 3ARGD 4PSWA 5IVXB 2X7LA 5IHHA 4FFVD 1LK2B 5BV7B 3PHSA 1LRZA 1MCWW 3WNIA 2VRKA 4G7SB 3MRMA 5DR5H 4Y4FD 4N8VG 3VFPA 4TUKH 3V4VH 2EIMB 3BIKA 4Y2DD 1YYCA 1BLLE 3NK3A 4Y5XA 2QGCA 1ETB1 1Q9WB 4ZO7A 5C86A 2VDRL 1AD9A 1QATA 1UATA 2W9LA 3BDYL 3PQYD 4X6FB 1A65A 4QTFA 1UJ3B 4MNQA 4M6MH 4R96B 2GC4C 4S0HA 1IVTA 2P44B 4X6CE 2X4PA 2FBRA 1ZY9A 4XXWA 4NPJA 4P3CL 3IPBA 2FQGA 1IC1A 3M6DA 4AUJA 2P5PA 4JRYD 2AK4B 3O6FA 2NNAA 5DZ9A 4CGLA 2P5EB 3IFPA 3QXTA 2OW7A 4PJGB 5DGRA 3S5ZA 4A7TA 5ADPH 2OK0H 1JE6A 3BI9X 4P9ML 1X5IA 1VGEL 1G7IA 4WCYH 4C4UA 1W0VA 5T3ZH 4JZNB 2PR9A 3D0LB 4JKKA 4QLWA 3QJFB 3SDAC 4LCYB 3UIYA 4QHNB 1RI8A 1VPOH 1N68A 3CN3A 4JO1H 3DO4A 3EGDA 3MLUH 3JT2A 3UYPB 4F8ZA 1VB9A 4GKZA 5ETUB 3LPGA 1YAZA 1KLUB 5DQ9B 5C6TL 2BW4A 4AXVA 4KTDL 1JPFB 1H3VA 2MPAH 1C12B 5EIIG 2VC2B 1P9MC 2VT0A 3VFNA 3TV8A 2IC2A 4ALAH 3GMNA 4PQXA 4N2FA 3QDGB 3AQDA 2BVOB 3VGFA 1SXBA 2BIIA 3ATDA 2A2QT 1Z3GL 2Y06L 1Q9OB 3DK0A 3NJNA 4X8IA 1B9KA 1R3IL 5L9DL 3K81A 4A33A 3DRTB 2CJ3A 1IVLA 3HG1A 5ENWA 1NL0H 2R2BA 4R5XA 1MWAA 3QEHB 2ZD0A 2B4CL 2VW7A 1QA9A 3BQUA 3B7IA 2DM4A 2IH1B 4WFED 4DN3L 5ERWA 4FI7A 3WEXA 1SVBA 5EN3A 4L89A 3QUML 1DFBH 4XC3L 1JD9A 4IRZL 3ATAA 5C0ND 4QJ3B 4OKDA 1NWPA 4CKVX 4KH9A 1PD1A 2C6CA 2YNCC 1SDAB 1AUGA 2ADYA 3TVMB 4AJ0A 4MMXB 4KZCA 2J43A 4LPXA 4NEHB 2JJSA 3NDZE 3V6OC 1S5HB 2J3SA 3ZTJG 4HG4J 4KTGA 1E30A 4NO3A 5IKCA 3FHQA 3FDWA 4OSUH 4OZFH 3T90A 1U42A 2ZUQB 1MJBA 4XN5A 3SCMB 1GTNA 3I1UA 3SDDB 4DKTA 1QNZH 2YUWA 3TBCA 4XNZB 3FQ4A 3ZDXF 5GHWH 2X6CA 1DFXA 3MNWB 5D6DA 3FT2B 4D9LL 3BPNC 3ZR5A 5KVEE 4AENB 4F9UA 5T33H 4JZOA 4AL8C 3VG0H 2MPAL 3FQNA 4CADA 2VI7A 3A6BL 4ABQA 3NIDE 3TN0D 1HESA 1IZKA 3L5IA 4HK0B 3EH5B 4HSQA 4U0RB 4IRZA 3GSNB 2OH1A 3HPLB 1UGNA 5F3HB 1P4IL 1WHOA 2ENQA 3E8UH 2YC1B 3K91A 4KI1A 3S4SG 1E4XI 1MJAA 1NCBL 4XMZA 1OZUA 4TTGA 3BGMB 3MOQA 1Y0RA 3SDYH 2YNEA 4EN3A 3SYOA 2EE9A 3VFTB 2X4NA 5ISVA 4KKCC 4GRLA 1YECL 2HFEA 4NYLB 3IT8D 3L9BA 4K71B 5FEBA 5I16A 3OAUH 4JFXA 2NY4B 2VE6B 2ZXDA 3AY4A 4L1BA 2Z11A 1NMTA 3FC8A 1VEMA 5ITBH 4XVUD 4E9LA 4XO9A 1R3JA 5HHOB 3P30L 3SZ6A 1EHNA 2BDNL 2EEXA 4NO0A 4AUYA 5L4MA 2GW5A 5E4IA 3IKCB 4FLRA 2AV7B 4KJPC 2O53A 1ED3B 4UCMA 1QW8A 4GAAA 2MCMA 2J8UA 2F5AL 1BD2D 4KK5D 1TT6A 4BFJA 5ADOL 1UD2A 1IAOA 5AG4A 3C5ZB 5BZWB 4R0LC 2K7QA 2VQ1A 2LE9A 3FB3A 1DBKL 3ENEA 4PHZA 2DS4A 4KJWC 2F53D 1E8XA 3GSQB 1I7UB 1G1KA 2ZAGA 3X17A 2ORBL 4AK1A 1IO4C 2W60A 3VRJB 5IJVA 3S3CB 1UOVA 5I1JH 3KM1A 4MQXC 4Z78B 5J3HC 1MNUL 4NZDA 1QI4A 4XB8A 1J05B 3GB7A 5IQ9B 1IAMA 4NP4L 1TETH 1HEEA 3RTQD 1OV8A 1BAVA 1Q72H 3JVGA 3HR6A 4DEUA 1O6SA 2QPDB 1CK0L 2FX7H 2NY6C 2IO5A 3P1VA 2WLKA 5EUOF 3AT0A 1UFUA 3B34A 1CIDA 4DPBX 1Q0YH 1J1XL 1I8MB 3D4UA 1TLMA 2CDGA 2ESVD 2FECI 3WT4A 4C68A 3T0EB 2GVYA 3KL3A 2R15A 2YAPA 2FZ3B 4P2RA 3NPSB 3TTSA 4BSVA 4WDIA 1DQTA 2EIZA 1VEPA 3Q13A 4BWWA 5HHQB 1JRHI 5L8LB 2PQ8A 4EZKA 3VQLA 1YEIL 4HHGA 2BCKB 1IGML 1NC2B 2Z4QB 2M2DA 1G1YA 1FGNH 2ZP8A 1FVDA 1SEQH 2OCFD 2PLTA 3CVHH 3EBAA 3HZKB 3O2WL 4IIQC 4BSWA 3QXDA 2BFVH 4JZJC 2QQQA 4DN4L 2IH9A 3HZ3A 1YEGL 1KGCE 1JK9B 1YYLL 2KL6A 1TTRA 2IGFH 2KPWA 5BZXA 1JSYA 2V2XA 3FT1A 3PGCB 2KCWA 1M4DA 1QPPA 2EE6A 4H2KA 1QSNA 1UM6L 4OCWL 1CL7I 4Q7AA 1U95B 4OQTH 2OM5A 4Z7QE 1PEWA 1A4KB 2CKBA 1MI5A 2AEQL 1Q0XL 1SDDA 1UXSA 1YC8A 1YY9C 2XQYA 3MV8E 4KY1H 3WLBA 4N22A 4BH8B 3H8FA 5I6PA 1JPTH 3O9WD 4XP6L 2HLAB 1OD7A 5CUSH 2DYRB 5E9DA 3ZKXB 4P2QA 4IOFC 1ECZA 3QA3B 4CRPA 2NR6D 3BMVA 3MBWB 3OAYH 5DHVH 4NHUA 1M71A 3C87A 4FZ8L 3GIVB 2CH8A 5DZOA 2MH4A 3S8WA 2VDLB 1HOCB 4AQEB 2VXSL 1TVBA 2WQVA 2IPUG 4NN6B 5FA4A 4RI1A 1KB5H 1MAJA 1U36A 2QFPA 2FWOA 2LVEA 4RMTA 1INDH 1NJ9A 4C2ZA 4P8QA 3D08A 1ORQA 4G8GB 4Y89A 4OLVL 5TK4A 5CD5D 4P46C 2MMXA 2JFCA 1E4WH 3RJOA 2QQKH 1T5XB 1QEXA 5MEPA 3T1FB 1K85A 4D9RE 4KI5C 4KKLD 3EYSL 1UZ8B 5CBAB 1AZUA 1Y0LB 4HD5A 1NDMA 4F20A 2ZOTA 4KZDL 2FVGA 4CAXA 5G4OA 1GKEA 1MRFH 5C0RL 3UZVA 4ETQB 2H7WA 5HJ3B 3NEEA 5D7LE 2UWEA 3RGVC 4M02A 2HG5A 4G1MA 4LQFL 3VXOA 5JW3H 4JGNA 3GSOA 4O9HL 3AAZA 3LRSB 5F0PB 4RBPH 4X4ME 4AV0A 2CE6A 5CCKL 3MRQB 5IFHH 1AFVL 2C9VA 2QVTA 4PRNB 2C3GA 5E5UB 1URIA 5KSAB 3KR3L 2V77A 2WPXA 1UM4H 4MKMA 2CNTA 1MFAL 5DS1A 1SF5A 3D48R 4CW1B 1CPSA 2CRIA 4JAMB 2J73A 4WHTB 1AQKL 3W91A 1ZSDA 2WVUA 1FYHB 4K9EL 4MSWA 3DXAB 4F6AA 4F7MB 2ZWZA 5JHMA 1L0QA 1ZT7B 1C5BH 2KT6A 4ZO6A 3I85A 5D7LA 2ODFA 4F37K 1MCOH 3PCYA 3DTXB 5C6PB 1LYQA 5DVOA 3VW3H 4MNGE 4PGDB 4F7KA 4R3KA 3T8XB 2F53E 1EH9A 5D8JH 3FXIC 2Y25A 3EO1B 4WK4B 1EZVY 5L88L 5LN8A 4FLHA 2YA2A 4X6CA 3TBSA 4Z7VA 4XNHB 3CFEB 3R7QA 4C7IA 3TO4B 2BERA 1C5DA 3MPCA 3WHXA 4AG9A 4G83A 1HVXA 4EF3A 4YHNA 1J9QA 1RURL 3TN0B 1U8PA 1TQUA 3IGAB 1VACA 1PJ9A 3VXMB 3OLDA 4Y9BA 4UINL 1R4XA 1DL7L 2W0KA 4GQQA 1N6VA 3HMXH 3QI9A 2E7MA 4AV5A 3D2PA 3DBXA 3ROLA 2UXTA 2YPLA 3BUYB 5FUZL 5AAPA 5C0DB 5FF6B 2NRDA 4PH8A 3ZSTA 4DP1X 1PTZA 1QLEB 1Z7JA 4PWFA 5KANI 1ZGLB 4EO5A 5IT2H 5T3ZE 2C9AA 2CDEB 4QJ4B 1R75A 4PLOB 1NCJA 3QXAA 3GRWL 1WQVT 4I0PD 4ZODA 5I0ZA 3C26A 4XVOA 4UTBA 1JPSH 2V5RA 5HHOD 3WJJC 4JDEA 2R23B 3ABZA 1UEMA 3Q5YA 3DSFH 4JN1H 4MA7H 3MJ9A 1T21B 4P23C 4W9LC 4OZIF 3QUZB 4F80A 2DQCH 4P5KB 3ZTNL 2JEVA 3LKRB 2CNZA 3ULAB 2VDRB 5SWZB 4BK5A 3TU6A 1U6MA 1BZOA 1S7UB 4PJCF 4MGXA 3APFA 3H3PH 3QUYC 4PBWD 2EVIA 1ZVHA 2FLRT 2EVFA 3IU2A 2V0AA 5D9SA 3V8IA 3O9WB 2Z92B 4MVBD 4PK3A 4P2QD 4FXGB 3EZ8A 3QUKA 1G4MA 1A0QH 3RFZC 1CTMA 4WWPA 3EJZC 5E08L 4JY6A 4GRWF 1DUYB 1S7QB 3BWUC 4O2EA 2C7UA 4HJEA 1CE1L 3CU1A 2K8QA 3BHBA 4YMPA 4XPGH 3CQFA 3BO8B 5J6GB 2OXGB 2YOAA 2YD8A 1HOEA 3TYFA 2WIMA 1XTLA 4NO2A 1MFEL 1GJIA 2FT6A 1X6LA 4Z3JA 1TJHL 2JTDA 4YEFA 5LAXA 1IQDA 4LCWB 1GTFA 4H2CA 1JZIA 4ETYA 2IOMA 1WVZA 3L9RA 3FO9B 5DJCA 1DBJL 4N0FA 2XVLA 1KJMA 3U4EB 5EA0H 8CGTA 1QTSA 3JRUA 3L95B 4CSTA 5T5FA 1J10A 4R3LA 3IB4A 3F64A 4FFVC 1HINL 5G1ZA 2XWRA 4RMVA 3FFCB 4B9KC 5KW9H 1X7QB 3CLFL 3NK4A 4QXUL 3GJEB 5DRZA 2DEWX 1YLBB 3DO7B 1MAMH 5EF0A 4JFOB 3GMMB 1T0NA 2K9FB 3FUEA 2L3BA 4WTWA 4Y16B 2GT9A 2WQWA 3RDTD 1CLVA 3WNOA 5B7MA 1ZJAA 3DECA 3ARBC 3CHXA 4M48H 4C83B 4TUOA 4P5MB 5JLZB 5FUCE 1YJDC 5HD8D 4WQOA 2V3DA 4WUUE 1MIML 3DV4B 1Q1JL 1E6JH 2IWEA 1TU2A 4CRYB 5DHDA 4P2CG 1W6WA 1DLFL 2G3TA 2ZT9C 2BP8A 3A4FA 3LEVH 3QR0A 3T65A 4PJBF 4UUJA 2FJFB 1C08B 1MFVA 3ULVF 3KPRB 4KGLA 5D6DC 3WKQA 5EUKB 3UABA 1L0PA 3GJFB 3CZFA 3MA7B 5I17B 1LK3L 4K71C 1CBXA 1DTUA 3EH3B 3HAEA 4U1SA 3NCXA 1I9IH 3D2UB 5AWNH 1AD0B 4PR5B 4RWHA 4PSPA 5IFAL 4NENA 1EDQA 4PJIB 2H45A 1M4KA 3QW9A 2ZWYA 5DS8B 5E5RB 1ZHKA 1HEZB 4PJBE 5F9OH 2B0SL 3TO4D 2UVEA 1YVKA 1CD9B 1KIUA 3WJMA 2NY5H 1PLBA 3MU3A 1MW1A 3J2PA 2BIOA 3JV6B 3KPQB 4GBXD 4K3DH 1R5IA 1J5HA 5AG5A 2QQNH 4ZPVA 1GS7A 1T3FB 1XCQB 3MJ7B 3QEQE 4JO5A 5I1LA 1ETZB 3DDFA 4KK8C 1NKGA 3VNYA 4BXVA 1D2OA 1XCXA 2G9KA 4P3DB 4Z77B 1BM3H 4WLCA 2DF5A 5CZRA 3W37A 1BGXH 4U6TA 5ESQB 1SUHA 4HALA 2KZBA 3TCTA 1QPKA 4W9DC 3BKYH 1LE5A 3NEXA 3RZCD 4HAFA 4DK5A 4JHWL 4KPHH 5F7MC 3R1KA 3KGTA 2NYYC 3U0WL 4MHYA 3U48A 2DPSA 5K69A 2E75C 2B4CC 3MBEB 1FL5A 3BW9A 2OSLB 3ILQC 5EDXA 1LEGA 2IL4A 5IROD 4ONWA 3P9LB 4KSAA 3N50A 5AVXB 5D93B 2V5SA 1ZTXL 1S7SA 1SRDA 2NUTB 2QHLA 2VDOH 3GMRB 4OUOA 4TMPA 5F6HI 2MOVA 2BRRL 4DGWC 5E9AA 2VDLL 3C5JB 1O5DT 1G9NC 3ZW3A 2YAFA 4F0YA 3QQDA 3S6KA 3S3PA 5K1VA 3VH8A 4PB9L 5J57B 3ES6A 1CE1H 3KNBB 1UT2A 4P2OD 3EC4A 1D5BA 4OGZA 4IIQB 4Y5VA 2VRQA 3BUQA 5BQDA 3TT3L 2EC9T 4EQ2A 3J7HA 3MO1A 5EBMB 1Z0NA 4PJ8B 3U2IA 1VF5C 5K9OB 1FFQA 4G11A 2QSQA 4S1QH 5GS2H 4Y5YB 3NIFF 4HIHA 4AUUA 3N0AA 3KD4A 1RK0A 2Z7ZA 1BDYA 3KLSA 4PSRA 4FD5A 1TCMA 4NKMA 4QRRA 1PQZB 4AL8L 1ES0A 3KYNA 4EEEA 4K94C 4ELMF 5I6LA 5ICYA 4MI4A 4GW5A 4OIBA 1U2HA 4P2YA 4WU5B 4XOAA 4U4IA 1VEOA 1WLHA 1MY5A 4WFFD 1TCRA 1WFMA 2WMPB 1M7IB 3NJJA 1J5OH 1RIUL 1OVZA 1TEFA 3VFVB 4UIMA 4Y0GA 5KW9L 2XPZA 1U8JA 2IAMD 4K7FB 4QHKI 2NY6B 3MV8D 4R4BB 3I6KB 1PIGA 1L7TH 1A6VH 2WLNA 4UQ9A 4R9MA 4LVNC 5JOPD 2ESVA 1K6QL 1XCTA 3D4GA 3CTTA 3LKOB 3IKKA 3V0IA 4CGPA 1PKQB 2GFBA 4JFYB 1QYGL 4G1EB 2XDHA 4R4ND 1N0XH 4Y2LA 2VABA 4M48L 4RDQG 3EDKA 2WQSA 4Y4KA 1SM3L 4UNUA 3SJVE 4KK5C 5H2BB 4OI8A 2X2JA 4ATWA 1KGCD 1JPGA 3ULUL 1IC5H 5MERA 3KPPA 1G87A 1SJHA 3KWWA 4DP2X 3ZKXC 3K6DA 1TSHA 2Y07L 3FRUA 5I26A 1JWMB 5JW3L 1VAHA 3KGUA 3K4AA 3LKPB 4MB5A 5AL8A 2GCYA 2RACA 1HHHB 2PC1A 3HI6L 1RU9L 3O6MH 3PXHA 4KHTH 4QOKA 2ED6A 4LSRH 4U6VH 5FIEA 4KC3B 1FIGH 1EJOH 2AFWA 1RFDH 2ADGA 4L3CA 2ESVE 3BN9C 4WJG3 4YSDA 1FZJB 3LN5B 4MZ3A 3KJ4B 3IU3A 3HJEA 2NY4C 1ZA3A 4G3YL 1AIFB 1FH2A 5DFAA 2IXQA 1YVLA 5CR8A 5E9DD 1YNKL 3QSKB 2G5UA 1BSIA 3WGVB 5GXBB 4XPLA 3AM8C 2FIKA 3FULA 5HH1A 2VZUA 1N3NA 1WIOA 5AW2B 1ZHNB 3RUGA 1MHHB 1IU1A 1OB1A 2LGNA 3SGJC 1B87A 3ELQA 1AHWB 1QZNA 2IBGA 5IB4B 3U36B 5D29A 2F53A 2COVD 4PVNA 4F8OA 3WR7A 4YNYB 4G8EB 5J1AB 1MJ7L 4FI6A 1DQQA 1OCRB 4L3ED 1ON0A 4FZ8H 4QRPE 3KDMA 4P4EA 3O81A 3LXBA 4FXKB 2UVFA 2DWTA 2EACA 5D1QD 4AM0A 1DBMH 4A6YA 3M7FB 4WY7H 4ZFFA 3BLNA 3ZDWA 3NSXA 3FHAA 3DURA 2P28B 1I7TB 3PWVB 3FJTA 1TSRA 4UBRA 2HX9A 3KHZA 5DZAA 4ZMWA 4L5FH 4DUWA 2JKTM 1DJWA 2H32H 2XYCA 3BX7C 4GXUN 5AW6B 4H1LH 2UWEE 8PAZA 2OTUA 1I1AA 4PXDA 2EDYA 3VGEA 2Z3OA 3AWEA 3MMEA 4LF3B 1FHNA 1YDPA 3KL0A 3WUWB 2ZNXA 3QR2A 1ZTXH 2ADJA 5K1NA 4BA8A 2PJ3A 3QORD 2DWDA 2JCCA 4LL9A 4Z7UE 3FO2A 2DLFL 3IAQA 4FOMA 4L8BA 3EYQC 1UZ6E 5GGRB 1JV5B 4M7JL 3BGFB 3CFTA 2H26A 3L7FA 1IBHA 1FBIH 2Z8WC 2VEZA 4R3SB 3T0WA 1A1MA 1RUAH 2DWEB 3KPSD 5CP7A 2CJUH 4XXDB 4I9WE 5HDLA 4KVCL 3Q48A 4F8NA 4YXHL 1DL7H 2G75B 4G8AC 5JTWA 5EEZA 3AS0A 2HKFH 3OD3A 5CLYA 5IQ7L 5CIPB 2BOCB 4OUUA 2FD6L 3B5TA 3LN9A 1XJOA 4NNYB 3PDOB 3QPKA 1CFQB 4P46D 2WBKA 5F1OB 5C09A 4HNYB 5SWSD 5D7EA 4PJ8D 3D69B 3P3TA 4P44A 3LSOA 2UV3A 1U8OB 1KBPA 1ZA6B 4FQIH 4DETA 1KPVA 1LO2H 3MLSH 1OSZB 4JFFB 1DZBA 1R1CA 3ZKQD 3FCSA 4L3EE 5B1JC 4IHBA 5A2AA 3WEBA 3A6CH 4R26H 5HYJE 4MA1C 4DJMA 3VGGA 3D8PA 1RZKC 5FS5A 5C0NC 5E0FA 3DWTA 3OHXB 4MJJA 4XNQB 1WCBB 1YNLH 2PDOA 1Y0YA 1P1VA 3PU7A 3FU9A 4BUHA 3BUIA 1MG2C 3NIDB 5INCB 4Q6IA 3GUTA 4IU2A 3CSTA 4UTBL 2FK9A 3CFUA 4RX4A 3FO0L 2APBA 4FAAB 3PL6D 4U6YA 3PWPE 3NA6A 2WCPA 4B5EA 1OCWL 2EEAA 3OMNB 2HVKA 3TZVC 4OZIA 2X4UA 4ODUB 3ZZ1A 4MFKA 2VDMB 2Y7SA 1U8HB 3CFJA 1XQ4A 1MFBL 4B53A 5IZ7A 4FG6C 3B8YA 3GBMH 5I5RA 1NOAA 3Q6FA 4NQDD 1AO7A 2I00A 3RX5A 4LSRL 5EFIA 2I9LA 4XX1G 5LN4A 4FE9A 3GXNA 3NFPB 4FFWC 2ZEHA 1NEUA 1YMMA 2AJZA 2F1EA 1CDCA 2NY0D 1H9VA 1K4CB 2AV1B 2VJ8A 4RVBA 2EUXA 5JR1H 1U91B 3HC4H 4UZGA 1MIMH 3BAKA 3UJJL 4F8PA 4PGCA 2VWEC 1DZ0A 4DP9X 1XV8A 1E9QB 1KIPA 3T0AA 2P0WA 3NT0A 2CHXA 5BS0A 3LH2L 4E41B 2ZENA 1CVSC 1NBQA 4JM2C 2CA4A 1B6BA 4U6XB 4G6FB 1JF1A 2VOTA 5HSFA 4PBDA 2JLLA 4MJIA 3O2DL 2OMYB 3STZB 1Y18A 2DH2A 3OHMB 3LQMA 3SKMB 1JGEB 4GAFB 4XXWC 5HI5D 4JMXA 1DBAL 4YLBA 1JWSB 4OZFB 2KERA 4UM9A 1MXGA 2MEJB 5IK3B 5T1JA 1I9RL 1Q0EA 1OAXL 4KU1A 4PWJA 1GYWA 4LGSB 2HKHH 3HG2A 5ESVA 3PY9A 4F9LA 1X4XA 1KC5L 1HZHH 3T0VA 3QWOB 4HUWB 2K45A 3BRGC 5GJSH 4KTYA 3KH3A 3VCLA 1PU9A 1MFMA 1IT9L 2PXYC 4KKZA 3B3CA 2TSBA 2PWGA 4ZOAA 1Q7LA 1L9SA 1M2VA 4I3SL 3SI0A 3JV4A 5IB1A 5F44A 2GTZA 4NQDA 3I9SA 3C6LA 4PPZA 1H3UA 3A21A 3BD4A 1KTLB 1ZHLA 4Z3FA 2AK4E 3RDTA 4HYTB 2ZOLB 1MCDA 3A4EA 2OBGA 5GJTH 4O5LH 3DMMA 2QKIC 2FJUB 2XRAL 3GMOA 3RVWD 3MOBH 3BEVA 2OS7A 1FQ9C 4GT0A 4NN7C 5A2LH 4ACPA 4EE2A 5C0CA 1FZOB 3PV6B 5BS0D 3GTNA 5J1TC 3MRDA 3IPFA 2D7PA 1BCIA 3CH8A 3LMJL 3K6FA 2DQDL 4K2UH 4AT6B 3FOMB 1LAPA 1UD6A 4WFGD 1LM8V 4X7EC 4R4NC 3IJYA 2EDFA 1FO0H 2ZKHL 4A32A 2UYLB 4P23B 1CR9H 1KPRA 4PB9H 3VVWA 3TBTB 5LKNA 1XMBA 3WFZA 2YS4A 2YZ1A 3TCLA 1U8CB 4NZRL 5FUOL 5C0AE 2X44D 1F4YL 1A6ZB 1XL6A 3EYFB 3N40F 1KEGL 1EMTL 1PLGL 2K1MA 3D3VD 3MRHA 2DEAA 3DC0A 3MTRA 1IEBB 4PTTA 4XI5C 1E7UA 3DPBA 3S96A 1G9EA 3BI1A 4KFZC 4E9WA 1I8IA 3NH5A 3TBVB 3EH2A 3HN3A 5IM7A 3S5LA 2WM0A 2OSXA 3A5VA 2NR6C 1J12A 4OZHE 5EULV 3PXJA 3VFOA 4RS2A 1RSYA 5E8EB 5F47A 3E9TA 4ANKA 3HKZA 4JPQA 5CN2A 1JXJA 2VSMB 3KE0A 4MS8C 1M44A 4IDJL 2MQ0A 4D3CL 4RA0C 3SOBH 3GZKA 4H8WH 4PJ7E 3PREA 2PCUA 1GRWA 2X7BA 4JM2F 5FO8B 1Y07A 2OI9C 4GT7A 2PWEA 1KYOK 1QQDA 2UZPA 4TYUA 5CU9A 4DZ8B 1I53A 5DO8A 4DWHA 3IS0X 3LQZB 1IGMH 4LSDA 1IILE 4PHXA 1BM3L 4QF1A 2JI1A 3P3SA 4FFZL 5HGAB 3AQYA 3GSNL 5AENA 2A9AA 2LR4A 2VZTA 3N85H 1GOHA 2VN3A 4LLUA 4L4JA 1QUNB 2XWZA 4OCRL 3T09A 5KSBA 1OGSA 2WSAA 4LQGA 2AZUA 2Y23A 5EO1B 2EIDA 4G7YH 5HVHA 1KTKE 2Y07H 2BC4A 2ADFH 2CY2A 3OG4B 4U7MA 1RZJL 1TQCB 2FRGP 1ACYL 3D2MA 1EEZB 1C16A 4RZCA 4YK4B 2V8VA 1A4AA 5MENA 1B2WL 5IHLB 4JHAL 1NH6A 5FAAA 5KJRL 2ODIA 4XX5A 1UB6B 5SWZE 2RGSA 3K1DA 3TFKC 5JNYB 3QUXB 4J3OG 1AR1B 2O5YH 4J3TA 4X80L 1I8MA 1T5WB 2Z93A 3CFCL 1GS8A 4NQQA 1YSOA 4JDTL 4FMVA 1THAA 5BW7C 1AY1L 3CE1A 2OV0A 3MLVL 5FYKH 1G7MA 4FLSA 1OAXH 3GSUB 3MRNA 4W93A 4X6DA 3V0FA 4DNLA 2GJPA 3FB5A 4NT6A 4WJ5B 4FQXD 2XG4A 5CILH 1VA9A 2ZUVA 1JV2B 3LKQB 1N2RA 5HVGA 4L2YA 1ZDQA 1JTTA 1INDL 3F7VB 2ABZA 1AGDB 1F6AB 3H9HA 4L4VE 1N0LA 2OL3L 3MGOB 3MUGA 1H8NA 4JFFE 2F2HA 3TIEB 4HVBA 3WTTA 1VKCA 2OTWB 1E4WL 2R1WB 2WCGA 3G5ZB 3QFJD 4PV8B 4WO4C 5GRWA 4CN6A 2DJMA 2R0KL 2QPUA 3RB5A 3VXTA 4I3SH 4D94A 2RC4A 1GGTA 2W38A 2GIMA 3PGFL 4Q9RL 4POYA 1XH3A 1BX2A 4IGBB 4ZW8A 5C07B 2A6IA 2NSXA 3FQXA 3F01A 4KKNA 4XVSH 4MDRA 3SJVA 5FFLA 5IHZA 4NSKB 4G1PA 2CHNA 4KOBA 2LQRA 1WZLA 1X7SA 1CZ8H 2Q7YB 1HHJB 2H32B 4UT9L 5JPMC 2ZPKH 3GSRB 4OM1H 1M1DA 4XGZA 4BV1A 1E50A 2QSCL 3P73B 1EXUB 1Z0MA 4IDLA 2EXWC 1OP3H 5D1XE 3V52H 3OPZH 5I73C 2J8OA 3QIWB 2VLKB 5CF3A 3BZDA 4QAMB 4Z7UA 3PL6C 4QXTA 2YD7A 4KOCA 4K5LA 3Q5TA 1P1ZA 1REIA 2BNQA 2Q0ZX 2IH3A 1MJ8H 1N67A 5JIDA 2W91A 4GMSH 4HH8A 4OD1H 4HGKC 4DKEL 1OALA 3QVAA 4HZAA 4WIQA 4XPHL 5E00B 4AIOA 5E2JA 1XR8B 1E9PB 1KB5B 2YGQA 1GZPA 3RX8A 4AC2A 1OAUL 5DRNA 4HEPA 4YLCA 1PZ5A 4Q2ZB 2FEEL 2AQPA 4OV6F 4F0XA 4N2GA 4QRFA 5HPOA 5D1ZI 1KSRA 5I8KL 3CMOL 4G3YH 3WI9A 1MH5B 2FO4B 2VO8A 1NC4B 3HZYA 3QEGL 5F7EH 5GGTA 4EDWL 4APQD 4L3EA 3M1OA 4I18C 4QRRD 4IIZA 1NGZA 4AITA 2VCOA 2OMTB 4KQ3H 4PY7A 5GS3A 4OF0A 3G5WA 4YSRA 4YFJA 3SJVD 3IM1A 3HMXL 5CFHA 4LASH 4U1MB 4Q0XL 2P80D 4B5PA 2WN3A 2EZ0D 2W92A 3KHOA 4F3FB 3ULUC 3GHEH 1NMAH 1JZ3A 5EU6E 5GZOC 2A74A 5J06A 3AUVA 3SKJH 3WLWC 4YHYC 3Q7JA 3RY6A 4H1LB 1RZQA 5B8CC 3N85L 4GRMA 1TKWB 3DGDA 5DJZB 1I1AD 1IGTA 4XMTA 1JTPA 5EMYA 4GXHA 3V55A 4A30A 1A3LL 3LXAA 1V3JA 2AZAA 3CXDH 4GRLD 4YHMH 2NY4D 2G0KA 4PJIF 4Y4KC 4PTUA 5HTSA 3QZMA 4BQ6A 3QK0A 5C08A 1D9KD 1E4XH 5HHME 1GIGH 5B39A 3ATEA 3WN6A 1TJGH 2QADD 3DX7A 3KI9A 4JKNA 5DI8A 3F6IA 2N4IA 3CX5K 3NMEA 3MROA 3GXIA 1SBBA 3BD5A 3MJ9L 1XB3A 4WWVA 5EC4A 4AIZB 1YMME 5FYLE 1HI6A 3C6SA 2E7LA 2ZW5A 3GDCA 1MRCL 3V6ZA 2Z8VC 5EF1A 2HRHA 2Y5TA 2RA1A 5E08H 2BSEA 4F7TA 3D85D 3VI3A 1VPOL 4G5AA 5DUBA 1DVYA 4AMXA 1N6QL 1CT8A 5C0AD 1VENA 4ZX5A 5INDB 4K0OA 4X9IA 4YGVA 5JZ7C 4XT1C 1W15A 2HKFL 3X12A 1I1FB 3CXHJ 5IVXA 1ETA1 3LS5H 4W4NA 2H0JA 1LK2A 3QZNA 4DEWA 4F8LA 3HHSA 3IFNL 3JZ7A 4MAZA 5E4EB 3GB0A 3WSQH 3WIIL 3SKJL 3U2SA 4QXGL 1DVXA 5ES4B 4OVUA 4G5ZH 1VGYA 3DJZA 4P05A 3V0WL 4UOQA 1NWOA 1KFAL 1CQYA 4G8GD 4MTMA 3FONB 1S7RA 4CSPA 5A2JH 5BPPA 1G7LB 1AD9B 4UCFA 3ROOB 3EG9A 5L2KA 1KULA 3CNKA 4M3KB 1KYDA 4NN5C 2JNZA 1DVSA 3ET9F 5D93C 2F5IA 3DSBA 1F4AA 2AW2A 2FECL 3H7BB 3TOPA 4AYID 5AVVB 4GBXC 3LDBC 3UBXB 4NPYB 1IKNA 1FG9C 4LCIH 1NC2D 2VDMH 4NQSA 4XVTL 2JIXB 5GRJL 2HMIC 2Q3ZA 1RZ8A 5AVYB 1KV7A 5KSBF 2GSIA 2AEOA 4A7VA 3RWFA 2NT1A 2XA3A 4IQHA 4RNRB 1ELLP 5BOPA 4ZUVA 1AO7D 2PJ8A 1B2YA 4L4TB 1OPGL 4QDGA 1YRKA 2Y06H 2EIJB 2C7FA 3QIWD 4AGQA 3WTSA 4L1SA 2ICWJ 5ABZA 4GP8B 1DQMH 4KDTA 3RGVA 3MOAH 4QBJA 1QBML 2WOYA 4HJUA 3RO0A 3MJGX 3GBML 1K4DA 1TNMA 3OKOA 5DZVA 1BPVA 2OMVB 4NFCA 3HLKA 2OZ4H 2YRLA 4LLYB 5TE6L 3T3ME 3DVIA 3EGDB 1CC3A 1Q8MA 3COOA 4PGEB 4PYHA 4DK6A 3HBPA 4CYQA 3LEXB 4P4KA 2PF6A 3DGGB 4KOTA 2G4EA 2Q5BA 2D7QA 5EZIL 1CFSA 4XMXA 3KVPA 1I9IL 1NQBA 2BMKA 5FGCB 3ZJAA 4WZ9A 1JF5A 1SJVA 2PXYB 2WYTA 3ARVA 5KS9B 4P46A 4HC1H 5ITFA 3CN4A 3UP1A 2WLYA 3WMSA 4TNWK 2GJ6A 1SXCA 4ZI8A 3RFZA 4DVBB 5I19H 4KRLB 4I85A 4IBLT 4PJEF 2R2BB 3W2DH 3CT9A 1BLNB 1T1ZB 3RILA 4RAVB 1X5MA 1RKRA 2ATKB 4D9QD 4TLSA 1I8UA 4TTDC 4ZZKA 1WBZB 4RWYH 3PFUA 5ERWB 4PB0H 1J1XH 2IQ9L 3MNZB 4GS7C 5EO0A 1TJIL 3WAKA 5CMAA 5DYFA 1HU8A 1RCYA 4NQDE 1KUYA 3ME0A 1CN4A 3Q8EA 1SEBB 5G22A 4PIBA 2LLLA 4FFYH 3US9A 1EX0A 2BJML 5MEOB 1ZLSL 3CX5J 4YOKA 5GGUA 2CUHA 1WZMA 3KYKH 4U0RC 1QLFA 5JPHA 4CJ0A 4HJ0C 2Q4ZA 4N3UA 1P5UA 2J8RA 4J2XA 4JDZB 3VXUE 4V33A 1XMEB 3HB3D 5EZJB 3RZAA 1ILSA 2VDOB 2E46A 3FT2A 1B88A 2YGOA 5DJ2A 1IKOP 1TETL 4EIZC 4JZOB 2BRRH 1CCZA 2P7TB 4MZIA 5E8NB 3UBGA 1EFQA 3NVQA 3X1BA 4UQDA 4EBQL 1CFNA 3ASWA 1BBDL 3V8OA 1NFDA 1OP4A 4N68A 5DJXA 3B5GA 5F9WB 4Y19B 4W9EC 1JDAA 3MV7E 3PP4L 3V6FA 3IDIB 3EYOB 3FKUS 1SGKA 4JHZA 3T6WA 1OM9A 1EXGA 2Y2YA 3OKEB 4LEOB 5C0AA 1F57A 2KBGA 4TSAL 3G04B 1MFNA 4HWBL 4JO8A 3BKJH 4YHPA 1SFHA 3VFGH 5IUCA 1CG9A 4ZYKB 1HWGB 4G8FA 2GLJA 2B14A 3JUYA 2HJKB 3MRFA 5EDSA 5ID0A 1Y7RA 2H4EA 4HKFA 1IM3A 1BM7A 2NY3D 2OPCA 5HHNA 5AAMA 4A6YL 5JPNA 5D2NC 1ZPUA 3BZ4A 3DRQA 43C9A 3FYIB 3KPSE 1JZHA 2WUBH 3OQ3B 4IS6B 1ZLSH 1YAIA 1H8OA 3LN4A 2BNUA 3RL2A 2XWJB 1TO4A 1HAUA 2GITB 2W88A 5T3ZD 4PEEA 4EMEA 1E90A 3LS4H 5ICZA 1ASPA 2FNWA 2X1WL 1J4JA 3OWCA 4YBQD 1FNGA 2B0SH 3GKZA 3OSVA 4JM0A 4PIRF 2WSKA 3PWJB 3S3JA 3GO1H 4G42A 4J2QA 5B7EA 3OZKA 3CFCH 3HUJF 2QQNL 1JRHH 4YDKL 2X87A 4WEMB 5D2LA 4B7LA 3M17A 3H2WA 3TASA 3SDAD 2X4SB 4YHZH 4HIJA 3MGDA 2RR3A 4MS6A 2YIHA 1O6SB 3BXNA 2W80C 3C09B 3JWNH 4XBPB 4NM8H 3IDXH 3NJKA 1KN4L 4JHWH 4ZMOA 5E2WL 2EO7A 5TE6H 3HE7D 4R7MA 2M1KA 3EOBB 5JDSB 1NMBH 3V52L 4HF5L 3VH8G 1QSFA 4M62H 2BZCA 2CDGB 3APMA 3KWXA 5IVZB 2R0KH 2ZX7A 1WBYB 4P4KD 4XRCB 1A7RL 2AQ3A 5IR1B 4PW3A 2P42B 4ATTA 1NM9A 5IREA 1HWHB 1T20B 3D87B 4FQ2H 8CPAA 4LSUH 3ML8A 4HZLA 5T1KB 1KGUA 5GS0D 5TQ0H 1I1CA 3KPRD 4OFPA 3VXRB 5JHLA 5CEZL 3QHFH 5I1DB 4BSWB 5BMFH 5TE7H 4FI8A 5IESL 1MRFL 3FBUA 3MREA 4ADGA 2DYPA 4YE4L 3WELA 4Y2DA 2B58A 2D4PA 3ZHDA 1LO3H 4LOUD 3GTTA 2FSEA 3WTVA 1YQVL 2WKLA 1OT2A 2A6JA 4XBGB 4UINH 1QMUA 1QR4A 3GT6A 4UWQB 4OC0A 3H8EA 1U95A 3MRCB 5J8FA 3UGEA 2ZP0T 3ZTDC 3ZE0B 2EVNA 1T7VA 4KKQA 4FABH 2ZAHA 1WT5A 1R24A 4U7SA 1SDDB 1UXSB 3KR3H 1OO2A 3FEEA 4PRBA 1ARLA 5LWYH 4C59B 3UY5A 5JW5B 3AS1A 1E27B 1IAII 2YA1A 1ZLUH 1RSFA 3DVGA 1NEZG 4M4RA 4MDJA 3B3TA 3D3SA 3QCTH 2WOBA 4J3GA 1S7NA 4Y16D 4TSBL 1R9FA 5ISZA 4J7RA 4JGUA 3P02A 1JYXA 4C56E 1XWVA 4IEFA 4CS0B 1CFMA 2YGPA 3RNKA 3QDJE 1S7VB 3ZKMD 2P8PA 1AI1L 1DDTA 3MV11 1T2JA 4PJDE 5E7BA 4EVNA 2Q4YA 5HYQB 1N64H 3HB3B 3QIBD 3DR6A 3PFOA 4Y1AB 4RFOH 4GUQA 2J72A 4GSRA 2CO4A 5E70A 2ODHA 3QUXC 2ADIB 1HKLH 5L8KB 3QS3A 5KS9F 1AE6L 4IOIA 4ZMVA 3Q2VA 2CQVA 2DDQL 5A2BA 3QZBA 1A4CA 5AKRA 1UM5L 4UIBA 2MSPA 2QKSA 1A7OL 2NTFB 4M7KL 3BUPA 4X5XA 2JWYA 3BUBA 3O8XA 4NLAA 3VFGL 5M95B 2DBJA 5F21B 1JHKH 4OFDA 4Y2DC 3ORJA 2OR7A 2BSBA 2IPKB 3FT4A 4NUMA 5IW6A 1QWNA 2AI0L 1IE4A 2MHAB 3UTQA 2KZ1B 4I87A 4QRUB 5CU5A 4GS4A 3POCA 4OAWA 2OP4L 4H2AA 1T89A 2YRBA 3HTLX 1DQLH 4LSVH 4ZUUB 3SD2A 4R4FL 4ELMB 3UTZA 3ULSA 4EI6B 3JTSA 2DM7A 1CFBA 5DD6A 1S9WA 1NGPH 2IMOA 1ZVNA 3ZDYB 2WUBL 1XF4A 3IEHA 3ZZLA 1E5CA 4GW4B 4WUUB 5DMIH 3ISWA 4KUBA 1V05A 4W4OA 1UH3A 4WHTA 2WLIB 5I1GH 4G5ZL 4Y4HB 1D6EB 2GHWB 4JPWL 4LAJH 3X1EA 4AVAA 5E94A 5HYJB 3RWGB 1ZT7A 2Y72A 5DRXB 5ECGA 1CUOA 1RULL 1QVOB 1LO5B 2NY6D 4NN6C 5F96L 5AB9A 3JWNE 3MCG1 1KIQB 1EEUA 1AKJB 4JQIH 4X0KA 3UAFA 4H8UA 3L1EA 4AEHH 2QL1A 4UT6A 3ULUF 5DDHB 1N6QH 1M42A 4XAKD 1EQWA 5E4EC 5F7UA 5CJQL 2WVTA 3SIKA 3BJLA 4FNRA 4P59L 3LZLA 3GHEL 4JYWA 3WD5L 2PIYA 4G9DA 1I3RA 3CUPA 4LCCB 3QRFM 4R0LB 4AVKA 1QABA 1UOLA 1USQA 2XIDA 2Q4VA 2XQYG 5CIPH 2IAAC 4ZQKB 2ARJQ 1BVKA 3RY6C 2EKSA 3HRZB 3UG3A 4ZG1A 1JNLL 1UQSB 3DARA 4WI5A 1B6UA 2VXTL 5FO7B 3NCYS 1CGWA 4PS3A 2Y1VA 2BNRB 3F62A 1NGPL 3LRKA 3MLUL 1KY6A 2BVTA 4RGNB 4DH2A 1OF2B 3IJHA 2RB7A 2R4RL 3VXQA 4UQ3A 4GG6F 4ZYQA 3VFRB 2OR9L 1I85A 2VLJB 4XE0A 1XB8A 2VAJA 3IDNA 4GG8B 4X4XA 4CVXB 2AFMA 2PJBA 1P0SE 4FG2A 4BRVA 1KEMH 4M1CD 1M3IA 4H5SB 1D3CA 4JPKL 2VN6A 2KUTA 4FBEA 3NAAH 4YDJB 3SE8H 3GI8L 4CVZB 2WSPA 1ECYA 4EUPH 2F5AH 2XBDA 3MUY1 3F7RA 1M4IA 2EKJA 4WEEA 4GUOA 3IJEB 3RB7A 1EGJH 4MXVF 5B8CB 2FJSA 4JGJA 4OLZH 2ZF9A 4PW4A 5D1ZC 5H37A 3QUKB 3KLHC 2XN0A 4M5YH 2FGZA 2X2HA 1P7KA 5D1XD 3U82B 3IXAB 5KSVB 5J3HD 1J8SA 4LEXH 4XPTH 3HLAA 3NYKA 2ZCZA 3V9FA 4LESA 1SLXA 1EWHA 2F18A 4IBTA 3RWJB 3GPEA 1BQHB 2JELL 2VDNL 3MRJB 1PZUB 4HIEB 3FB7B 4CAWA 3FRPA 1T1WA 3S36X 1PDKA 2VAAB 4Y1AD 3RGBA 3B2XA 1XGTA 2VJXA 3SJXA 1A7QH 2NYKA 3F5WA 1CXFA 1G1CA 4Y7MA 2DQHH 3SPVA 2F8OA 3FQRB 1PZ3A 1J0IA 3UPRA 4K3DL 1UXWB 1B0RB 2X1PA 3ARBB 1E6JL 4X8JA 3N7ZA 2VL1A 1PG7L 4APXB 1J5IA 3IJ3A 1R5WB 5L8JB 4FWUA 4X6CF 3H54A 4JPKH 4MCYA 1GGCH 4HXAH 3KS0H 2DI8A 4F33B 2FHFA 4MJ8A 3ARRA 5C7XH 4PAZA 5IF0B 4YSUA 2UUDK 1E43A 5AAWC 1NCBH 3GKWH 1A21A 3NABL 3PWUB 4TN9A 4ZNEA 1JZGA 4NO5B 3NA4A 3MRGB 1DLHB 2IIJA 4OLWL 3L5WB 3L5XL 2XWCA 2PCFB 4YPGA 5I0WA 1A1OB 5T33L 2I07A 3O6FD 5KBPA 4M6HA 4Q8BA 4FL4B 5FB8A 3QB7C 3DTUB 5KVEL 3MLPA 4IKLA 4KY1L 1BFSA 1CYGA 2R1YB 4FNLH 4GRWB 2IANE 2W1NA 4RSYA 3RWHA 1L7TL 2P52A 2VXQA 5CJXA 2XV3A 4OZ4A 1D5XB 3S9NA 5IGXH 3MBXL 4H8WL 4XOEA 2OXHA 3PWLA 5DD0H 3TVMD 5D7JB 1PLCA 3PL6B 1JHTB 4NSQA 1J8HD 2G2PA 5I6NA 2CHWA 5C6TH 5LRKA 5H94B 5LGJA 4HKBA 2PPAA 4HWNA 5F93C 2G3NA 3I9AA 1C5CH 4V11A 5EC2B 3CVHB 1QSED 3D7HA 2FYVA 3KCWA 2LAAA 4O2FA 4B9YA 5C0BA 1E4HA 1LDPH 1D5MA 4LHUG 4PJ5B 4YLQT 4NQEB 1CE6B 4HH9B 5M94B 2W0FA 4P5TB 3MJ7A 5DTFA 2AKRB 1GC1L 1KCVL 2VLKE 5FYLL 2PP9A 4YXKH