1H8LA

Duck carboxypeptidase d domain ii in complex with gemsa
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
380
structure length
380
Chain Sequence
QAVQPVDFRHHHFSDMEIFLRRYANEYPSITRLYSVGKSVELRELYVMEISDNPGIHEAGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVQSTRIHIMPSMNPDGYEKSQEGDRGGTVGRNNSNNYDLNRNFPDQFFQVTDPPQPETLAVMSWLKTYPFVLSANLHGGSLVVNYPFDDDEQGIAIYSKSPDDAVFQQLALSYSKENKKMYQGSPCKDLYPTEYFPHGITNGAQWYNVPGGMQDWNYLNTNCFEVTIELGCVKYPKAEELPKYWEQNRRSLLQFIKQVHRGIWGFVLDATDGRGILNATISVADINHPVTTYKDGDYWRLLVQGTYKVTASARGYDPVTKTVEVDSKGGVQVNFTLSRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Carboxypeptidase
molecule keywords CARBOXYPEPTIDASE GP180 RESIDUES 503-882
publication title The crystal structure of the inhibitor-complexed carboxypeptidase D domain II and the modeling of regulatory carboxypeptidases.
pubmed doi rcsb
source organism Lophonetta specularioides
total genus 132
structure length 380
sequence length 380
ec nomenclature ec 3.4.17.22: Metallocarboxypeptidase D.
pdb deposition date 2001-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 1h8lA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1h8lA01
3H8EA 2PJCA 3D7GA 1OBRA 3KGQA 1TF9A 5LRKA 3T8WA 1LAPA 7CPAA 3B3TA 3WABA 3SJGA 1XRYA 4NGPA 5K8OA 5JM6A 4FAIA 1ZLIA 4OC4A 3GLJA 1YMEA 4YU9A 2G9DA 4GM5A 4Z65A 4P4FA 5IB9A 4YOKA 2RB7A 2POKA 4G1PA 2C6CA 3H8GA 4IAVA 2J9AA 1YSJA 3GUXA 4P4IA 1Y0YA 5AQ0A 2CF4A 5HVFA 2NSMA 3IWWA 2C1CA 4H2KA 2V8GA 2WZNA 2JBJA 1XJOA 3GB0A 4UF4A 3HUVA 1EE3P 5DS0A 3SI0A 4FUUA 4R7MA 4FXTA 3K2KA 4R6TA 4B6ZA 1FNOA 3VH9A 3D7HA 3B3VA 2V77A 3B7IA 1HDQA 2PJAA 3FJUA 3K9TA 1F2PA 4W9YA 5LYDA 2QVPA 3IEHA 1VGYA 1CBXA 4PXCA 4ZY1A 1AYEA 4ZX9A 3NH5A 4IYKA 3NH8A 1TKJA 2ANPA 3BHXA 4NJQA 4OC5A 1CG2A 2PJ3A 4OP4A 2F8HA 2VL1A 4IHMA 3D68A 3ISXA 3B3WA 4NGMA 4MCPA 1R3NA 4OC1A 1BPNA 4ONWA 3KASA 4Q7AA 3NA6A 5HXDA 2IMOA 2C6PA 2CTBA 1F2OA 2PJ1A 2GLFA 1LAMA 2JBKA 3PB4X 4P4JA 2XHNA 4JZ0A 2PJ7A 4DUKA 4TWEA 1RTQA 2F7VA 3KR5A 2PIYA 2ZENA 2PJ4A 3FEDA 3E8VA 3V7ZA 1Z5RA 2PRQA 4MHNA 4P6YA 3FMCA 2PIZA 4P10A 4ZY2A 5HVGA 3KQZA 4WI0B 4EIUA 3KL9A 4MMOA 3ISZA 3L2NA 3SJEA 5K39B 3I1UA 3TX8A 3HN5A 1PYTB 2DEAA 4O23A 3WC6A 4DYOA 2AFUA 3CPAA 4NFRA 1JQGA 2GU2A 2PE3A 5THWA 4NGRA 5K8MA 3KR4A 3G3LA 1VHOA 4K3NA 4A37A 4BD9A 4FWUA 3IFEA 4NJRA 3KQXA 4RUHA 2GLJA 3D66A 1TKHA 2XEFA 2I3CA 3RBUA 5LYLA 2ZEDA 2O53A 2Q43A 3SJXA 1UWYA 3RAMA 1BAVA 4MHZA 3CT9A 2AFOA 1YLOA 2V8DA 3D7DA 3D67A 3LWUA 4FBEA 4JYWA 3PBEA 4WWVA 1CP7A 1TKFA 4P4BA 1R43A 2AFZA 1LCPA 5LRGA 1IGBA 3PB7X 1DTDA 4A39A 5LRJA 2XEIA 5JGFA 5K8NA 5CBMA 2V8VA 1LANA 4ZX8A 4EWTA 2B59B 4MXUA 3NJVA 4OC3A 2O4HA 3PFOA 2BO9A 1ZG7A 3KZWA 1ZG8A 1QMUA 1M4LA 2BCOA 1HDUA 5K8PA 4UEEA 2C6GA 3MRUA 3WT4A 5JH9A 3SJFA 2XEJA 2EWBA 2AFWA 3PB6X 2HC9A 2PVVA 3FX6A 2EK9A 2ZOGA 4OIWA 1NKGA 3S9MA 2CIJA 4WJBA 4DJLA 4TNUA 3FH4A 1CX8A 3KHZA 2AFSA 1VIXA 1Z2LA 2NYQA 3FECA 1ARMA 3FEEA 1HEEA 4U3SB 4A38A 3NJXA 4X2TA 4A94A 4F9VA 3VARA 3FVLA 1KWMA 3KHXA 2IQ6A 4ZYQA 1Y0RA 3PB9X 1F57A 3CDXA 4UEZA 1VHEA 4P45A 4CPAA 5LYIA 4MCRA 4UEFA 3PEIA 2PJBA 5LYFA 2PJ0A 1XBUA 5ELYA 2ZEHA 3IJ3A 1BPMA 3H8FA 4YWYA 1LOKA 4NGNA 4PXBA 4MCQA 1TF8A 4AXVA 6CPAA 3JRUA 2ZEPA 2PJ5A 3PFEA 3CPXA 2BOAA 3D4UA 4EFDA 4ZY0A 2OOTA 2WYRA 3KCPA 3B35A 1ZG9A 3IO1A 4PQAA 4FL4C 4R8FA 4X3RA 2XEGA 4F8ZA 2PJ8A 2PJ9A 3SI2A 4P4EA 3KI9A 4MHYA 1ELLP 2ZEEA 1CPXA 2ZEMA 2PJ6A 4MCSA 2ZEFA 3LMSA 1IY7A 4OIDA 4NGQA 2QYVA 4F9UA 1AMPA 1Z8LA 4X8IA 2V8HA 1CP6A 4LQGA 2PJ2A 2EK8A 3BXMA 4KSIA 3PBBA 5I4MA 1H8LA 1YW4A 3BI1A 3FF3A 3DGVA 3S9LA 3V38A 3IIBA 1PCAA 2Q51A 1ZLHA 3B3SA 4R76A 4OC0A 1GYTA 1ELMP 4PPZA 2ZELA 3SI1A 3HLPA 3PRTA 1LFWA 3PB8X 4EMEA 2AFXA 4UIBA 3QNVA 4UIAA 2CTCA 4MHPA 5D29A 5HVHA 4NGTA 5D8NA 3DLJA 4MRIA 3IC1A 2PCUA 2ZEGA 1CPSA 1ARLA 5CPAA 1XMBA 3D7FA 1BLLE 8CPAA 3S9NA 3B3CA 4IK2A 4PXDA 3N5FA 2FVGA 3BI0A 4NGSA 1Y7EA 1TXRA 2PVWA 2ABZA 1YW6A 4ZI6A 4P44A 4OKOA 3NFZA 1Q7LA 2HB6A 2OR4A 3NH4A 1DE4C 3WC5A 4OC2A 2ZOFA 5F09A 2ZEOA 2JEWA 2QJ8A 3MN8A 1XFOA 3RZAA 1NSAA 5J1QA 4PXEA 2AFMA 5G5DB 4OMEA 2RFHA 1FT7A 2IJZA 3B2YA 2GREA 1QQ9A 2Q4ZA 3TC8A 4P4DA 3WC7A 3VATA
chains in the Genus database with same CATH superfamily
4H8PA 3RJDA 2IC2A 3H8EA 1FZKB 1JPFB 3CSFA 3DIFA 4KTEH 2REEA 3O4OB 5DD6B 3WFZA 3GZPA 2IADA 5IB2A 1CBVH 4DPCX 3TBWB 2SEBB 3JWNE 2DYPA 2XV3A 3QXTA 3B3TA 4FQ2H 4QF1B 1WBZB 1TZ8A 2Z7WA 1WZLA 4J8RA 4LF3B 3NJIA 5BUGA 2ESVD 4Z65A 2YSTA 5GRJL 4NT6A 3NCBB 4XPGL 3CC1A 3RGHA 1WF5A 5SV3A 1MREH 3IDIB 4GH7B 5EPMB 4QRUA 3G5WA 4WEMB 1LEKB 3DYMA 4MMZB 5ABAA 4AQ1B 5KSVA 3CMOL 4C2YA 1DJWA 3RPBA 2C1CA 4N2IA 3GGWB 1UWGH 4FG2A 2W59A 5HHOE 1MPAH 1Y6KR 3HNVL 3B43A 1FZKA 1JPFA 1G0XA 3ZZLA 1IM3D 4GUPB 2C3VB 2Y7SA 1A1NB 4OADA 1T5XA 5MP6L 3TBWA 1XGQB 5BRQA 4E0RA 4KTDH 5DA0B 3AS1A 2IJ0C 4BHUI 3EC4A 3FTZA 3KHOA 4QHKI 1WBZA 3SCMB 1CXLA 4FXTA 4JDZB 3VG0L 4JHBA 4JFEE 2XN0A 1VEPA 2P5EB 2DLTA 4M4RB 3WY1A 3BZ5A 4L0YA 4P3DB 3VH9A 5CP7B 3MX0B 4FDWA 2VLME 3U1PA 5AKTA 3V9EA 3GSNH 4BH7B 2F8XC 1KIQB 3GXUB 2V7HB 3RFZC 1LO0H 4XXDB 2E7BA 3IDIA 4N2CA 1AQDA 3CPLA 1UXSA 1MH5B 1Z2KA 3DO3A 4MMZA 3GKZA 1LEKA 4AQ1A 2EILB 3E0GA 5AYUH 3KVPA 3GGWA 1N7MH 5CCGE 3HCVB 3RX8A 1ZWIA 2Z3OA 4F15B 1A6UH 4MZ2A 3S37X 4E5XB 2J8HA 4EI6A 5E08H 4IYKA 4GUPA 2C3VA 5HDQL 1A1NA 1UM6L 4QUSA 2Z4TA 4C56B 4KROD 4ENED 3TOAA 4N6RB 1WEJH 3EYSL 1KLGA 3NP4A 3TJEH 3ZE2E 1WIPA 1CFQB 2W0LA 4UWQB 5CUSH 1AHMA 1PZ5A 4OCXH 1ZLUH 4OP4A 3SCMA 4UILH 5ALBH 2XYCA 3GSQA 4JDZA 5PCYA 1T5WB 4RWHA 4GO6B 4XN5A 2P5EA 1KJ2H 3HUJF 4OC1A 1SXSA 3LYRA 5CEZL 4I0PD 2ZWSA 1J0JA 2V7HA 4JKPL 4NQSB 4XXDA 5B22A 1CR9H 1KEML 4XP5H 5DJAB 5HYJE 1NJ9B 1MH5A 3SO5A 5JMOC 3BRGC 1GXEA 2JDDA 2VBQA 3TCLB 2HG5B 1R5VB 4JGJA 2JSFA 2UWEE 2DEYX 5SX4I 3SDXA 5C0CE 4ETQB 2MCPL 1DLHB 4OFQA 4E5XA 3DVFA 4TN9A 5D4HA 1T03L 2K3TA 4HEMA 5IQ9B 3HZ3A 1TMQA 4KX9A 4PY7A 4GXUM 4C56A 2E9WA 4GINA 2BCKB 2IL4A 3EJSA 3CVHH 1OAUL 2BL1A 2ZX9A 4WFFE 2V8LA 2HB0A 2PIYA 1CFQA 3GBMH 3FEDA 1M1SA 1T5WA 1YEGL 3AQXA 2DM2A 4FFZL 4KH9A 4ZZKA 5AUMB 3T1WA 4DGUA 1K4CB 3VXPB 5A28A 2YA1A 1BM3L 2OQJB 1X5GA 4DGIH 2OMTB 3BEVA 4D9QD 1Q72L 2JCCF 2ED8A 4NQSA 4WI0B 3I9PA 2QSCL 2AQ2A 4KK9C 3V0EA 5DJAA 2R2CA 4EBQH 1CGXA 1N8OE 1NJ9A 5JPMB 2B1HH 2HG5A 2R56H 3ISZA 3QUKA 2IG2H 3Q1EA 4ETQA 3I1UA 1DLHA 4R0LC 1ZY9A 4E9VA 4CVZB 2DD8H 1CFTB 5ENWB 2WBXA 3VA6A 4NWUH 3TNMB 3UBXI 4F33B 1CLZL 2YXVA 3TZVB 2QGCA 5TQ0H 4KNQA 3OKDB 2REFA 2B9BA 2BY2A 5F7HA 3X14B 4FTVB 2G4GA 1MVUB 1DBAH 5DC0A 4GRWH 1Y6MR 3ARTA 1H5BC 3KR4A 3GXDA 1YCSA 2OKMA 1WFOA 2VITB 3CK0H 4IOFD 4O2CB 4KZEL 2OQJA 4FULA 5DQ9A 3FT1A 5JPHA 2OMTA 4WSGA 4HSCX 1S7WB 4WI0A 1EERB 5KVFE 2GTWA 3BAKA 1B2WL 3QARA 4FX5A 5DJ0B 5JPMA 3QZPA 2BSSB 2HRGA 3WSQL 4EN3D 2QECA 3IAGC 4F80A 3VXOB 3STZA 4DKFH 3ZZQA 1PJWA 1TVBB 3NE8A 1BAVA 1DQJB 4NUJB 1CFTA 5ENWA 4UZSA 1RPUA 4CYPA 3EOAB 4F0YA 3TNMA 4JQIH 5LBSH 4NBXB 4F33A 3U4KA 5KN5B 2FJGA 3GUFA 3D67A 3OKDA 5LB1A 5FR3A 4PV1C 4OF0A 3X14A 4FTVA 4WWVA 5AZUA 4TQEL 3JVGA 3MXVL 5C08E 1TKFA 1CICB 4RQQB 2AFZA 4E42B 2F53B 5JR1H 3NA9L 3APFA 3I50L 2AKRB 2NUPB 2VITA 2WXFA 3MACL 3BSZL 3PP4L 5GGVY 3SO3C 2XQYK 1OP4A 5AKVA 1Z0MA 2B0SH 2NZ9C 2WLIB 1G7JA 3CZKA 3FAWA 3K72A 2R0LL 3M8OH 3CVBA 1E5AA 2ZWKA 5DJ0A 3TGXA 3QIBA 2BSSA 1EZUA 1N2RB 1ZG7A 2NXZB 3CHRA 3QEQA 3VXOA 3WJLC 1PQZB 1DQJA 4UQIM 1A5FH 4NUJA 4ONFH 2BOCB 2DV6A 4N20A 2MSPA 3C5ZB 5KN5A 3BFWA 4S2SB 1UOVA 5IJVB 1ZO0A 3PB6X 5EFIB 4HJ0C 4DNCA 1KG0B 2BNUA 5ESQB 3V0GA 4OIWA 3S9MA 1JWMB 1CICA 2HWZL 4RQQA 4JFTA 3MLTA 4E42A 4YDLB 4PJHB 3EOYG 3G08B 2D3LA 2NUPA 5B21A 3UAJD 3ZL1A 2AFSA 4M5TA 3BMWA 3T3ME 2WLIA 3QWQB 4I18C 1FO0L 1MWAA 5IB4A 1HEEA 4YWGL 3NCJH 5ADOH 5D2NB 3IK2A 3LIZH 3F12B 3SDAD 5L9DL 5F48A 2X2JA 3NZSA 3BWZA 4GXHA 1D5IL 4FA6A 1E2VA 1URZA 3UTTE 2TRYA 3KCPB 1PQZA 5L4JA 4L1DA 1JRHH 1NCHA 3AABA 2YMOA 4P46C 4K8RH 1KTRL 3PDOA 5J8OA 1VHEA 1MVFA 3C5ZA 3Q2NA 4OSUH 1SDAB 4MCRA 1YYLH 4S2SA 4JJOA 5IJVA 5EFIA 2FECI 3A4AA 1T22B 1KG0A 2PP7A 4O02H 4POZC 4DPRA 1WO2A 1IC4L 2MQ3A 4KUBA 1JWMA 3IJ3A 4PJHA 2IPKA 5H4ZA 3G08A 2NNFA 5T1KB 4G7VL 4AZ8A 1X5LA 1JHLL 1O5PA 2EVFA 1ND0B 2Z0BA 2PYFB 4PRPB 3SJVA 2EXWC 3A6BL 3SKUD 3NGBC 4ESKA 5D2NA 1S7UB 2J56A 4XX1G 5C82A 1HKFA 1AJ7H 1M56B 3HRZC 4GB9A 4JKLA 4G9FB 4JO2L 3KCPA 1C8PA 2OL3B 3QUML 3ZOAA 4X3RA 4NNPL 5EIIG 5A43C 4KJWD 4UOQA 1HYSD 2A73B 2PJ9A 3GYRA 2PO6C 3GDBA 3IRZA 1KC5H 3T2LA 4B9KC 3GXFA 3IPBA 3QEUB 1FIEA 3ZO9A 1T22A 2D0HA 2ZCKH 5DUML 5CN3A 4F57H 4M6OH 3REVB 4PP1C 1MQ8A 3D12B 4MCNA 3IJ9A 3W0WD 3VU1A 2Y0MA 5DZLA 3D0VB 4X4KA 1NBQA 2AEPL 1SHSA 2DOCA 5T1KA 2QPEB 4KAQL 3DARA 1RPKA 4OF7A 1UM5H 3RTLA 4FTDA 4HDIB 3MYJA 2ZAGA 3HI5H 4W9FC 5CIPB 3SBWC 5JHAA 3BLNA 4BSVA 4WUUE 3O9WC 2F54D 3ZZSA 2RR3A 2IANB 2VRKA 4GMTH 2B2XH 4IKJA 2E7CA 4DHLA 3O3AB 4BJLA 4J39A 3QJOA 1FFQA 3KS0J 2RJMA 3KPPB 3VD5A 4FFWD 1QSRA 4HF5L 3MRLB 1OD9A 3OAUH 4J4PD 4TNFA 5LXVA 4ZW3A 4JN1L 1EDQA 2OL3A 1QRNE 1A6WL 3BPNC 2R1XB 3OGOE 1ZV2A 3MV8B 4Q6IC 4FFYH 5GHWL 1M3JA 2APVA 3LQZB 4EZLA 3BPOB 3QEUA 4L37B 1V0CA 5HDBB 3FO1B 2EVHA 3IFNL 4KI5D 4HNYB 4NKIH 3WHXB 5FYLE 3QZNA 4EVYA 5C07B 1R9FA 3D0VA 4X4XB 1R3LB 1D5XB 3S2AA 4EMEA 1FG2B 1G7HB 3BH8B 1NCDL 1N6UA 43C9B 4HJIA 4HDIA 4Z78B 4ZTOL 3LDBC 1EGJH 5CIPA 1P0SE 4FI8A 3CZSA 3PYCA 3QT2A 4PG2C 5BVJB 3T9YA 1OAYH 2GJJA 2IANA 2QLVB 3DJ9A 5IHWA 2DQ6A 1UD8A 4KOVA 3ASOB 3KPPA 4R8WL 3B83A 5HH1A 1PFCA 3FQ2A 3MRLA 2CHZA 2MOGA 3TBTA 4HU8A 5HJGA 4OFVA 3L9EA 2EH8L 3LRSA 2KQNA 5AG5A 2YEQA 4HPOH 2R1XA 3GJFH 3CIQA 4M62H 1RU9H 3QPXL 4NZTH 3ZHKA 4P5SA 4X5PA 4CJ1A 1TJIH 3LQZA 1EIBA 4L37A 3D7FA 3LZPA 4N8PA 1BBDL 5DHVH 3WHXA 4XCEB 4ISVB 1JPSL 1PD1A 1T1WB 4OKVA 5C07A 3OKLB 1RUAL 2X09A 4TVPE 4NO2B 1R3LA 1D5XA 3RPKA 3TXAA 3WTUA 3TNNB 1G7HA 2C9QA 3BH8A 2MQCA 2GIXA 1M44A 43C9A 2A9CA 2P9RA 4FXKC 4RGOH 4F2EA 4Z78A 1YW6A 1MFVA 6CGTA 1BYPA 1A6TA 4YZWA 4HC1A 2GFBB 2DPKA 2CNMA 1XMTA 3IDJA 4Y16D 2Y3NA 3BUYB 5AYUL 4UDUB 2AW2A 5ICUA 4HJJH 1QVOB 1RZ8A 1I9IH 4CUCA 1YLEA 3QFGA 5GGTH 2FCKA 4WUKH 1XF3B 2V7NB 4JN2B 3MJ9H 4HS3B 3HFML 5AG7A 2WOYA 5G5DB 4GW1A 5EMYA 4ATWA 4ONHB 5DD0L 4L0ZA 2I9TB 5CBEA 1Z3RA 2X3CA 4XCEA 4NC2B 4YLQT 4OCXL 1T1WA 2LW3A 4BQCA 2XA8L 2E9GA 4NO2A 4XMVA 2GREA 3TNNA 2NY1D 3QXVA 1MCEA 4K9JA 1IUZA 5L88H 2J20A 1N0LA 4JFZL 4XP6H 4G80B 1VA9A 5BVPH 1PL3A 4R7NB 1FCGA 4DP6X 3X3GH 4BFEA 1IB5A 4KWUA 2GFBA 3BPCB 3WUZA 3TBBA 4B0MM 1S7VA 2GCYA 4N0FB 3B1TA 3OBAA 4WI9A 5AVUB 3F65A 5ISVA 1MFMA 4X50A 1QVOA 1F8TL 4X6DE 4KVME 4NGPA 1S6NA 1SJEA 2M83A 5JM6A 3KXFE 3UTSD 2QJDA 2V7NA 4JN2A 3WO4C 1MFBL 4HS3A 3NIGB 1ZLIA 1LDPL 2YRPA 5EZLB 5D8JH 4ONHA 4JJ5B 3SKNB 2IPTH 2YZ1A 4BZ1L 2RB8A 1LK2A 5FO2A 4YUEH 2AF2A 2Z31B 3GSXB 4P3CH 4P9HH 2HXAA 4FE9A 4OCWL 1IQWH 1U9KA 4ZW6A 2UUDK 4HWZA 3X13A 2CF4A 4GLRH 2OZ4A 4R0LB 2IH9A 4OZIF 3FH7A 4R7NA 1IIKA 4DGIL 1D9KC 5T3ZH 1YMME 3E2HC 4RA0C 3BPCA 4PJIB 4AIEA 4Z1PA 2WLHA 3B7YA 5C0AB 3T0VA 2B1HL 2K7QA 2XXCB 1ZDQA 5DS0A 3MRGA 2WBJC 4M6HA 4U7MA 2NY0B 3M1BA 3OKEB 1ZLSH 3BDYH 3MR9B 5EO0A 4Q9BA 3ERXA 5AOMA 4K5NA 1FL5B 2IH1A 4R6TA 4G6AD 1FZOB 4CVXB 1I8IB 3GXPA 2D7TL 3WGUB 3SKNA 3L6FB 3PGFH 4JZJB 3B3VA 4U7KA 1R3HA 3FTXA 4Q2ZB 2BNQE 3KYNA 2OPCA 4NHCL 3W1ZA 4EKXA 2Z31A 4X5WB 3WFBL 1HDQA 2NY4C 2PJAA 4N2AA 1AQ8A 2PW2B 1FQ9C 2BFGA 4RDQG 4NYLA 3DV6B 4MVBD 1U95B 5GGVL 1YVLA 5DI8B 3V4PH 3UJTH 3VWKC 1RZ7L 3KWUA 3D0LB 3DRTB 4ODXB 4TXVB 3U4BL 4NIKB 4H0HB 5D7IA 2CDFB 4G59C 4HUCA 2IDQA 2UXGA 5CJXC 5C0AA 4E2AA 1S7SB 3GTVA 4NJQA 1J5CA 4X80H 3OKEA 1ZJBA 2QHRL 3FSAA 1T7ZA 5I0VA 3MR9A 2OXHB 4X2UA 2PJ3A 4IHMA 4Y9FA 4XN1A 2YAPA 3FQNB 4QTHA 1FL5A 4HISA 2WXPA 4JQIL 5LBSL 4CVXA 3TVMB 3NSJA 5HVWA 1JDAA 1A4JB 2NT0A 2QFRA 2W88A 3U25A 3JWOL 1C9SA 3IJSB 2BWIA 4HFUL 3NA6A 5KSAC 1T7WA 2OCJA 4ZOAA 3L6FA 4I13B 1BIHA 3E1ZA 4JZJA 4H8QA 1F6LL 4JDVB 4N90E 3QNYA 2QVKA 3NH7H 4ALAH 4X5WA 5F7BA 1IBGL 5IWLA 5T5NG 5K9JH 1HNGA 2PW2A 2H2PC 2YD5A 4FLHA 4ZTPL 2J25A 2ZG1A 3DV6A 1U95A 1X4XA 2F1AA 3V0WL 3HG1B 5DI8A 2O5YH 4ZSOB 4L48A 5DEGB 4X7CC 2XLLA 3DRTA 4ODXA 5AKRA 1JNLL 1FN4B 3VSUA 1BOYA 3BGFB 2NY3D 3BGMB 4FLSA 4PJGA 4XNQB 2GUOB 4CJ0A 1S7SA 3H53A 3QDGD 1CD9B 4YHKH 4YRHA 4N2KA 1P5VB 4NB7A 1LQBC 1KJMB 1W80A 2BIOA 2JQZA 4UQBA 2PJ4A 2OXHA 2NYKA 3P9WB 4HV8A 2XOTA 4ONFL 4R97C 3B2XA 2VL4A 2XXFA 1LK3H 3FPXA 3NIFE 3TVMA 3S34H 2X3BA 1AKJB 4I18B 3IJSA 3RJOA 3RUGE 4ZX6A 5E1GA 2VI7A 4JDVA 3GIVB 2VWEE 4NX0A 4XVSH 4MCYB 2CCVA 1A7OL 2FEEI 2ADJB 2KZKA 1XV8A 4U1JB 2EKSB 3MO1A 3N9GL 4ZSOA 5HY9B 2NMSA 2VXQH 5DEGA 4ZD3H 3ARXA 3VWJC 3I74A 3MRCB 3BGMA 1J8HB 2X2HA 3LQAH 2KUTA 2GUOA 4K55A 2GU2A 5I75B 4DF9A 2R51A 3CH8A 2OH1A 4YHYB 4AKOA 3ISYA 1KJMA 4YDVB 5I26A 2AK1H 2R69L 3AREB 1U8IB 2FL5A 4K8RL 3IWUA 3MYZA 3K7UA 1IJNA 5CR8A 3RKDD 3RWGA 1JBJA 2ARHA 1F3RB 1TETH 2RTTA 1AKJA 2E75C 5CKGA 2Q86B 1UURA 5CEZE 4PGJA 4A37A 3NGBB 4DKEL 3PXJA 4BGLA 2CXKA 4BMHA 3QCVH 4LSQH 3IFEA 3FFDB 2JKJA 1Q2YA 3EO1B 3KQXA 1S7QB 3MNZB 3UTPD 6FABH 4N2MA 3U30B 2ADJA 4U1JA 5D1ZB 5B1CA 2EKSA 3QJQB 1KTDB 3PQYB 4LMQE 1PZDA 1OCWH 2X4UB 3RAMA 3RB7A 4FNRA 4DWHA 2F74A 3CXDH 3ZTCC 2L7EA 2PO6B 1IGYA 3MRCA 4MDJB 1EFXD 4P8QA 1OGAB 3ZKMC 2IO5A 3EIFA 1AJ7L 4HEPG 1SEBB 3DK0A 3KJ6L 2GK0B 3FXIC 4XGZB 1YDPB 5ANME 1BXAA 1JN6B 3KLDA 1CDHA 2VDML 4YDVA 2FEJA 3BXNA 3AREA 1U8IA 4YSAA 4HWBL 3RI5F 3FQYA 3RIAF 4ADJA 1DTDA 4A39A 5E03A 4M02A 4OCYL 1HOEA 5D6CA 4Y4KC 2WLYA 4BELD 4M6OL 2R2BA 2ZP9A 3FFDA 3U2IA 2B4BA 1LYQA 1TEGA 3GMNB 3C6LD 3EO1A 1S7QA 2FD6H 5JHLH 3MLXH 4W4NA 3MNZA 2R29A 1S9XA 1BHGA 5D1ZA 4F2MA 3VWDA 1KTDA 3FHEA 3NJGA 3PQYA 1QHPA 3NCFB 1QMUA 1DJYA 3NZUA 4MRCA 1EJ8A 1NGWB 5K8PA 3WNOA 1OSYA 5JW3L 4KKAC 3NUKA 1X5ZA 4MDJA 4G7SB 2LR4A 4CDHA 1OGAA 1OHZA 1XEUA 3I6GB 4GMTL 3X3FH 5KANI 4PW9A 5ECJE 2VKWA 1OM9A 2GK0A 3E6HB 4LEEA 5IMKB 1YDPA 1JN6A 3OAZH 5IQMA 4GRLD 4LSVL 4HNWB 1KBGH 2P80D 1MF2H 2CKBB 4MNQD 2G5UA 4GQQA 3VXSE 3W56A 2CIJA 1KGUA 4WJBA 3W91A 5D1XD 1A65A 4K30A 4FFYL 1ZS2A 4JNXA 3RKPA 3LHPL 3LZLA 3PDDA 3TT1H 3QZLA 4W1TA 4JPWL 1T5KA 3ARZA 3I75B 4NKIL 5L4MA 4PV9B 1P2CB 1BMWA 2HT4C 1NM9A 5JW4M 5B4MD 3QNFA 2WUCH 3SYQA 3OJVC 5FA4B 1RQ5A 3CFDA 4HGMA 2HKHL 3IGAB 3NJMA 4PJEF 5D1QB 2MIZA 4L5FH 2DJ4A 1OPGH 2VZUA 3FONB 1EGJL 2GEEA 5EOQH 4QHLB 3U0WH 2C9PA 3R0MA 3FRPG 2JKWA 1T66C 2R4RH 2RHEA 1L9PA 1KIPB 1M7DB 2B7DT 3M6DA 3P40A 1HWWA 3QDJB 4IRZL 4FQCH 3NBNA 5CFHA 2J1ZA 1FFOA 4KDTA 4QHNB 5HI3C 3V0DA 2YD9A 1PEWA 1EEZA 1DCLA 2GHZA 2X7LA 5D70L 3MV7B 3QJFB 1RU9L 4EZKA 3BP6B 4KXZI 2X4OA 3HKFA 2L8AA 5DZOA 4J3OD 1XGYH 2BFVL 3BQUC 2CR6A 2ZUQB 4M1GL 5KSBA 1INEL 4PV9A 3ZL4H 5ALCH 5E95B 4Y19E 3O4LB 3TLRA 1A22B 1KCLA 3WIHA 2DIEA 5FA4A 2YD6A 3V79C 4P06A 3IGAA 4MXVE 5GRWA 5D1QA 2OOTA 2D03H 4PQXA 3D6GA 3A47A 4QHLA 3B35A 4Y88A 4ZYKA 3Q06A 4B14A 5KJ7E 5LCVA 3FUIA 1FVCB 3GIZL 2IH8A 3QDJA 2QVMA 1E9PB 1KIPA 1M7DA 4FG0A 3SI2A 3UBGA 3OKYA 4NQQA 4OUOA 5CU9A 1AUGA 4CNIB 2NXYB 1JZJA 1FNEB 1ELLP 3KI9A 2VNCA 2XVBA 4QHNA 4DO6A 3C75A 3I3DA 4I9WE 2X2UA 3PJSB 4PJXE 4TF4A 1LRZA 2Z3NA 4JFSA 3BP6A 3OJMB 4MB1A 3ZE1F 1ONQA 1I1AD 3JWOC 1WD8A 3OHXC 3RVTC 4OIDA 3SGDH 2AJXL 1ZXKA 2OMNA 4N3UA 4ZUVB 2Z64C 3V0VB 2VM9A 1IC5L 1UHVA 3O4LA 4N22A 5EC4A 3MNDA 3FUJA 4JO4H 2J8UB 1SVZA 3RY5A 5L88L 4CMMB 2W65B 1RZJL 4JRXD 4CSPA 3CLFL 2J5WA 1QSED 1OCCB 4P57B 2GEQA 1YW4A 4WNJA 4PK2A 5F9DC 3DJRA 4L9LA 4L4TB 4XNHC 1FNEA 5FV2A 5ADPL 4J3XA 1JPST 1UYWL 2FATL 3JSSA 3POHA 3S3JA 3KBHE 4J3TA 1AO7D 1XZ0B 4YFLF 3WKML 3EJRA 3NFNB 4BFBD 3BLPX 4NI3A 3C60A 1KCVH 2A9ML 2N1TE 2AGJH 1BBJB 3QUXC 4JFFA 2A77L 5DJZB 5D8JL 4MFHA 4FNLL 3FF7A 2ZSVB 4ZUVA 3V0VA 3BLKA 3GDCA 4NP4H 1ZRUA 1DBMH 2G3ZA 4P9HL 3H55A 1PYWA 1TR7A 3O6FB 2WBJB 3WIIH 2J8UA 2BERA 5FGSA 1NGZB 2BY0A 2W65A 2IFFL 4S1SH 4XP4L 4BZ2A 2HVBA 1U8CB 4P57A 1HSBB 4OCSL 5HHQB 2VKXA 3OV6A 2NCEA 3MKGA 1OT2A 1ILUA 1UOWA 4RAUB 1E3FA 4KTGA 4PS3A 4LCWA 3S8WA 2B4DB 2LU3A 4WO4C 2YIHA 8CPAA 5J6GB 1CGSL 5F6HJ 1XZ0A 1DQDL 3QQDA 3NFNA 2FVGA 3ARBD 4ZUUB 3B7TA 4K8RC 4K5PA 3F5BA 5AAMC 3EO9L 4GFXA 4MAUH 4RRPM 1LVEA 2JCWA 1BBJA 2OYLA 4UTAH 5DJZA 1AQHA 3WHE1 4EZJA 4N5EC 4XTRC 4OAWB 5EC1B 2DF3A 2XETA 2ZSVA 3PGFL 3NFZA 4BKTC 4PFEA 3RWJB 4AL8L 1QWHA 2I69A 7PCYA 4FA7B 5J0BA 4HW6A 3O6FA 3PAYA 5JA8B 3L5WA 1NGZA 4BWWA 5F09A 3FCGA 1GOGA 5GS1B 1U8CA 3ILQC 1QHOA 1HSBA 5HHQA 1UWEH 3B4NA 1CQKA 4RX4A 2A4ZA 3KAAA 1SOXA 5AB9A 3K4ZA 3PWPA 4PW3A 5AW3B 1AGDB 5HJ3B 2B4DA 2ENPA 3UJJL 4JMNA 1H6UA 2QQNH 3BWUC 3KR3L 4ODBD 1PG7X 4MD4A 1DFXA 2H6PA 5HTSA 4ZUUA 4B3VA 1KUMA 2Q7BA 1BVOA 5I18H 4YDIH 4JRWA 2I5YH 1EZSA 3BAJA 1U8HB 1YPZF 4JLRB 4MZIA 5CNHA 2J1KA 4C58B 1X4ZA 4HKZB 1YNKL 4LASH 1LL1A 4TVSa 4XOCA 3RWJA 3NH7L 1QSOA 3O2WL 4CS0B 4CW1B 4HWNA 3MLPA 4N0UB 4LLDB 2NX5A 1RFDL 2EXYD 5EIQA 3S5LG 3N1QC 4YGAB 3DR8A 2O5YL 5GS1A 1FRGL 4RETB 3O2DA 1HJCA 4IU2B 3T4YB 3TWCH 1RPQA 4N0CC 2V37A 1I82A 1CVSC 1AGDA 2NOYA 3VXMD 5HJ3A 1KN4H 4QOKD 3TTYA 1V54B 4YU9A 1MHHA 3SPGA 4OGXH 3ATDA 4H7VA 4UM9D 4YHKL 2QPSA 1DJZA 4WK0B 2AABH 3GO1H 5D1ZI 4UT6H 3LXBA 2XTJD 1BQHB 1FG9C 3PHAA 3S34L 1U8HA 4JLRA 5M94B 4NJ9H 3D05A 1G9EA 1L6ZA 1LGVA 4HKZA 3UDWC 4R9HA 1RSFA 2Z3PA 4OAEA 1PSKH 5KYNA 4JFEB 5EBGA 5H37A 4CW1A 3K81A 3B6SB 2YGOA 4XAWL 4LLDA 2DWXA 4XVSL 5ICZB 4AENB 4QKTA 3PP3H 2X40A 4WW2B 1NC2D 1R4XA 1JGEA 3IGUA 2YPLB 3SSGA 2ZQKA 5DLML 4R7MA 3T4YA 2XBZA 1FDLH 2CH8A 1AE6H 3DDFA 2DZEA 3NMEA 1B0IA 2F18A 3VXUD 3WY3A 5A6LA 2X1OA 1GA2A 2EO1A 5HHOA 4ZUSB 5LAXB 3LB6C 3PNWA 5GZOA 2TSBA 1CM0A 5C6TH 4ABQA 2EDNA 3VQ2C 1BQHA 1NEZG 5DTFB 5LQBH 1BZ8A 2EC9U 5HDWA 4Z7QE 1LD9A 3Q2LA 3ZE2B 3R4DA 1KIRB 2G2PA 3FQ1A 2DRUA 3GSNB 2DQIL 4MMXC 5GGSY 3IEHA 1TJHL 1VGYA 4JFEA 2D4DA 3A24A 4LSQL 4I0KA 5HSFA 3QIWC 2QPUA 4M5ZH 1P0HA 4KOXA 3B6SA 5ICZA 4AENA 3QCUH 4JK0D 1U41A 4ODSH 4PVLA 4WW2A 2Q8AL 4QUOA 4NXSA 5CWSB 4QRPE 4G8EB 3LKQA 1MJ8H 2JJSC 3CXDL 5AOIA 2VISB 1F45A 4O5LH 5EG6C 1ANUA 3AQYA 5E6IA 5F89B 4X9GA 5FO7B 4F91B 4DP1X 1NFDF 4Y4KB 1OE1A 3HRPA 2X42A 4L8BB 4ZUSA 5LAXA 2JJTC 1A4BA 3RB5A 1ZT7B 1KJ3H 2HFTA 3DX8B 4CGNA 1F2OA 4DGVL 1E43A 4LARL 3RI5K 4XB8A 3RIAK 4PP2B 1KJ2B 2GTZB 5DTFA 1DUYB 3GI8L 1ORQB 3GZQA 1KIRA 3OG6B 2VIRB 3GSNA 4ZMXA 5IHBA 1HDMB 2PF6A 1VFOA 3QPQD 2YC1A 3QRLA 5ES4B 1F4XH 4PUBH 4MQ7B 1B87A 2ODHA 3ARPA 2NQCA 4X99B 2D73A 1TU2A 2IWGA 4DUKA 3KEDA 3OX8B 3H9ZA 5D7JD 3JZYA 1EAJA 1RZJC 5CWSA 3AITA 4R7VA 3B1UA 4G8EA 5HYJA 2VISA 4WWKA 3BSGA 5FO7A 1QI5A 3CVHB 4FXGA 4L3FA 5IQ7H 4XP1L 2WVUA 5E9AA 3WEBA 1UJ3C 4OLLA 5DRXB 1D5BB 3WELA 3HUJE 2DJSA 1HHIB 2HTKC 1FNGA 4KH2A 5C0CA 4N5UA 4MI4A 2XFXB 2PRQA 3FXTA 3DX8A 2YAOA 4A95A 4AITA 4PP2A 1KJ2A 5INDA 1DUYA 2NY5H 3X17A 2BVTA 4Y4HD 1ORQA 2VIRA 1HDMA 4RMQA 4DN3L 5C9JB 3PL6D 5IW3A 2ORBH 5B38B 3AWGA 4OH2A 5JIHA 3DR6A 2PNDA 1WAAA 4MQ7A 4U1HB 3F58L 4X99A 4P9HC 1U3YA 2BO0A 4UT9H 3AXLA 3OX8A 2ZXEB 4Y4FC 3IFLL 4GKNB 5KEZA 3M45A 3GBNH 3D2PA 1IE4A 2ROXA 1CFVH 3LS5H 2ZW6A 4GS7C 3CVHA 1BFVH 5I8KL 5DRXA 1D5BA 1HHIA 2WUBH 1G7LB 1KY7A 2YMXH 2WXJA 2XFXA 3FU3A 4GRWB 4Q7DA 3OF6D 2JCCE 2J8MA 4XC3L 3FULA 1WWAX 3CZXA 1YY9C 2A74C 5AB0A 2J88H 3DX9B 4QTFA 4U1LA 5F6IC 2ALAA 4ZXBC 4AUUA 1PAMA 3HI1A 5C08B 1XGYL 1MCCA 3S35L 5B38A 2Z4QA 2XBTA 1UWYA 3KKWA 3HN8A 4AL8C 2VXUL 4XPDB 3DA0A 4GKNA 4QXGH 1CDGA 3A3YB 5DD5L 5T3XH 2DEWX 3L4TA 4WW1A 1FGVH 5DMJB 1QBLL 5F97E 4AEIH 3V5HA 4YFJA 4XN7A 2FIAA 4LX9A 1GPOH 2DTSA 2WGNB 1G7LA 3AY4A 1VGKB 4OQ1A 1NAML 5FGRA 3IBEA 1XMWA 5B1JA 5KOMC 1KXTA 4HOXA 1K5WA 4TNGA 5DVOA 3UEQA 3O2VH 4E9XA 3LH2H 2VW4A 4AJVA 3DX9A 4WTZA 5E24E 2AJSH 4JRYD 4L1SA 4UBDD 1J88A 1IBDA 1IKNC 1L4IA 2YN5A 3DBSA 3H4HA 5C08A 4B9FA 1NCBH 1I1YA 1M4LA 2JQMA 1JUFA 4J3OG 3FF8A 4NNXB 4QWWD 3TESA 4TTGA 5J89A 2XG5B 1TZHA 3T3MB 3SQOL 1NMCB 1I3VA 2EWBA 4OCLC 2FR4A 2GI0A 4PWKA 2OZGA 4JB9H 3WTTA 3B2VL 3QUXB 1VFUA 1DL7L 1N64H 1R6VA 4CMHC 1RKRA 1VGKA 1KELH 4KKPA 5TDNA 4MS8D 3B3BA 3QHZH 1JK8B 3WDIA 3LNDA 3UP1A 3DX0A 2FIKA 4GAYB 1M71B 1CPUA 3ESUF 3VI3F 4M8RA 4LPWA 1GIGH 3WKYA 5IW1B 8PAZA 5DZVA 3II3A 4AQAA 3VGEA 1MCSA 4F5CE 3RPIA 2VERN 4NP4L 4QDGA 3H6JA 4NNXA 4XHJC 4UEZA 1DJGA 3UAAA 1KBVA 1A7RH 1OLZA 2A6KA 4YJZL 2A7BA 4QJ4B 3PEIA 2ARJA 1NCJA 1MI5D 3GRBA 5E56A 2E47A 1OP9A 5AW2B 3WMSA 1AR1B 5BS0E 3D39D 3EJZD 1QQDB 3X11A 4DVRL 2OTWB 3Q1SH 1P6AB 4L4VB 3BC9A 2WWMD 3LQAC 3LQMA 2P8MB 3Q9PA 3MLRL 1VADA 4O02B 4Y2DB 2RQEA 3N43B 5G4MA 5T5FL 3A6OA 3IJEA 2VC2L 1Q0YH 1JK8A 4WSJA 2HX9A 1INQB 4YH6A 5AB1A 3BKCH 2ZEPA 2XSKA 1CDBA 4GAYA 3D4UA 2A38A 1DBKH 2PP8A 1M71A 3KYKH 4FNTA 3U1SH 1SUJA 3IPEA 4Y49B 4UTAL 5C6PB 1P53A 1V3LA 4XO9A 2VLJD 5ERWA 3W39B 3THML 2YGNA 4G70B 4Z7VF 4FP8H 1Q0XL 3SB3A 1Q9LB 3HG4A 3DVGB 5IROC 1ZSHA 2K4WA 4NPJA 1NIEA 4XCYB 2EXSA 1EHNA 1ZT1A 1FJ1A 1XIXA 4MHYA 1TOXA 3MUUA 4NZUH 4A6YA 2CR0A 3PWJB 1UWEL 3KCWA 2OTWA 2J7LA 5SWZD 4MJID 1BF5A 2ZEMA 4Y2DA 2P8MA 4O02A 3C5SB 2JI2A 4KOYA 2X88A 4LVNB 3P11H 4O00A 4G1EA 1ZK5A 1TZGL 1WYJA 2AP2A 4E41D 3SDCB 2TRHA 1INQA 4IIQB 3T0EE 2QYVA 3EUDA 2L7UA 3NCMA 3WEAA 1KB5A 4GS4A 1EEQA 2ICES 2OV0A 5J1TC 1CP6A 3FBKA 1KWGA 2Y6SC 3W39A 3T2PA 2MOVA 1NBVH 3SQBB 3EJPA 3Q6GL 4LASL 4DFHA 1GZHA 4R2GD 1Q9LA 3DVGA 4AUJA 2MTPA 3B34A 3BCDA 3HG3A 4XCYA 1ZHKB 3QQ9D 4L3EB 1ORSB 2WO4A 4WUUA 2FE7A 1DLFH 4PPZA 1I75A 3R0NA 1I21A 3PWJA 2PTUA 2B16A 3WOVA 5SV4A 1J48A 3HLPA 4L9DA 3GMMB 1CIUA 2PPAA 1T1ZB 3P3RA 5IHZB 5HDLA 4W6YB 4NS0A 3C5SA 2PCFB 1CCZA 4NGHH 4NN6B 2APBA 1KCSL 3CFKA 1A1MB 4U0QB 1ASQA 4MDRA 3SDCA 3QDMD 2R0ZH 3EG9B 1N68A 4NC0B 4OGQC 3K5SA 4UT6L 2ZW5A 5HVHA 4RN7A 1BVNP 5LDSA 5SWSE 3EH1A 2OJ1A 3EOTL 4NJ9L 4GG8B 2OYMA 5DC4B 3V0FA 2HMID 3NACH 2NY7H 3CX5J 1KFAL 4AI7A 2A4EA 1HESA 2KCWA 3FHAA 4B97A 4N2HA 1P4IL 1COBA 1ZHKA 3OR6B 4MYPA 3PHOA 1ORSA 2XTSA 3L08A 3RVVD 4TNVF 1PD0A 1XGRB 1HN1A 2CQVA 4GQPH 1Y9WA 4U1MB 4HQQH 4KK5C 3AG1B 3GJFB 3ZDYF 4FC3E 3TL5A 3TN0B 2XTLA 4OCNC 2DBJA 1EAOA 1J9QA 3O8XC 2PWHA 1T1ZA 2YGVA 1TYEB 3H54A 3P3SA 4MMXB 3VQMA 5IHZA 2PCFA 3H3PH 5DHVB 2XIDA 5SX5K 1BFSA 2O6CA 1A1MA 3P30L 5ITBH 2OMYA 5DR5H 1IGCL 4P3WA 4IHBA 2DQFB 5BOPA 4X6CB 4R87A 3M7OA 1V27A 1A0QH 4GG8A 1XE4A 1CZ8H 3LZFL 1IJ9A 3GKWL 1NSNH 3R9EA 5C3IA 3SE3C 1XCTA 2DKSA 3E0KA 3OR6A 3K6SB 3QCUL 5J1QA 4NM8H 4ODSL 4RNRB 1Z5HA 1XGRA 3UACA 4EDWH 1SQHA 4U1MA 3ABMB 3GJFA 3L1FA 3TN0A 3V0JA 3KPSB 3U7AA 4LCIH 1FIGH 1UUSA 2CHWA 3FU7A 4PJBF 3ZY7A 4R90L 2Y69B 2H47C 3E6FB 4KHXL 4OF6A 4PLJD 1TJMA 2VW7A 4MA8H 4XMZA 1KN2H 15C8H 2L7QA 1KJ3L 1UXMA 4MCMA 2CBOA 2KZBA 3KXFB 2VR3A 3KPNB 2DQFA 3EDDA 3GIUA 4YHLH 2YUWA 1OD7A 2YNCC 4TSBH 2EDQA 2SODB 4PD4J 5I66B 2VMDA 5IKCB 3SCMD 4GQRA 3QG7H 5I19L 1NMAH 3CFCL 1RD6A 3ECQA 4HJTA 2ZWLT 1HCFX 2P5ED 1QYGL 4II9A 4RNRA 3L5XL 2KPNA 1EBPA 3AGWA 4BFOA 1GC1H 4Y1TA 1BSIA 1B0RB 1G7QA 4QRAA 3CNKA 2AVFA 4P2OB 3WFEL 4YOKA 4E9SA 5IBLD 4HKJB 2EBJA 1ADQH 2CCWA 2EUIA 1YSJA 1Q9WB 4X6DA 2NSMA 4PGDA 3IWWA 2VR8A 1G7IB 5L0QB 3KXFA 4XAKE 5CJ5A 1UFUA 1JNNH 1HH6B 3KPNA 1RUKL 4PU2A 3DJSA 4C56D 1A9BB 3C09C 3NEOA 4ZODA 4JHZA 1YN6B 4LU5L 4XO5A 3B8SA 2BNQB 3MKKA 5I66A 1TSRA 1UKSA 2WTPA 2HLEB 5IKCA 3HNTH 3OG4B 3WIAA 4MA1B 4YSSA 4UTCA 3Q3GB 4OKDA 2DI8A 4OZFH 4HCFA 4UT9L 5BUAA 3LZRA 4QY8B 3GBNL 2DQEL 1YMMA 1B0RA 5D9SB 3P0VH 4P2OA 1DFBL 1HQRB 1TCMA 2J72A 5D55A 1CFVL 3LS5L 4BFKA 4HKJA 1FP5A 4NXKA 1P7QA 2Z91B 2EUWA 4KI5F 4J12A 1AZBA 4U49A 4Z7WF 3CFUA 2DI9A 2DYSB 5I0DA 2Q6WB 3V95A 4OZIE 1JD9A 1G7IA 1JVLA 3T6VA 3TCVA 4AC2A 1HH6A 4PR5B 4DVBB 3U46B 3G5YB 4ZX9A 1UC6A 3V4PB 2GPZA 2J88L 3AMLA 3HS8A 4LIQL 1J1OH 1YO4A 3T4AC 1T0MB 2BNQA 4C2XA 4LL1A 5CCHE 2KC0A 3DUSA 1H8SA 4CGMA 3Q3GA 4KZ0A 4V1DE 5DT1H 4A66A 4JVUA 2AV1B 4OLUL 3I6SA 4QY8A 2Z3MA 4CKQA 1EO8H 1NFAA 2IQAA 5D9SA 4N2NA 3X1EA 5F8QC 2K70A 4KROC 1HQRA 4ENEC 3JVFC 4ZBJA 4WAFA 2Z91A 1LAMA 4S1RH 5I1JH 1GPOL 5F0JB 2Q6WA 2X4RB 3PB4X 4WHTB 3A5VA 2BX5A 3WS6C 2A9DA 4DZ8B 4PR5A 3F01A 1XR8B 2RGSA 3G5YA 3O2VL 4N2GA 2OMVB 3G6DH 4I0PC 4IMKC 5HDOA 3FKUS 3TZVD 1SPDA 4UCNA 2DN7A 4QJ3B 2WCSA 2D7MA 4FTVD 5J6SA 1BFOA 1FF5A 4FRWA 1F58H 4PJAE 3SYAA 4MJHA 4CGUB 1WAPA 5C6WH 2WLLA 3L2LA 3BP4B 2FB4L 3V4LA 3DSNB 4XPHH 5HHXH 5F72S 3LIUA 2GFQA 4AEHH 1WA2X 2AV1A 4Z95H 5BRZB 1NPNA 2YS4A 3SYCA 4IRSB 4ZS7L 4QIRA 4LQFL 4PHZA 1C16B 1N64L 1MAMH 3R1GH 3QIBD 2VJXA 2X6AA 3QEQD 1BPVA 1OTUD 2X4RA 4R5TA 3VFSA 1IAIH 4WHTA 4MX7B 4DZ8A 4P5MB 5JXAL 2IBGA 1XR8A 5EWIH 1KGIA 5T8IA 1PW3A 4EVNB 2FS5A 5DC9B 3EW3B 2OMVA 5I5JA 3RUGA 5IX3A 2MNWA 5FHBH 4I7ZC 2PE3A 4NGRA 4IU3B 2Q10A 5G20A 5K8MA 4A2GA 1GIGL 1OARL 2W95A 3MBEA 1CUOA 1R3KB 1CICD 3VFMB 4KVNL 2F53D 3OLDA 1FNSL 5B7EA 4M85A 1XMEB 1RIUL 1EPFA 1MZYA 1WAEA 2VRQA 2C1OB 4R4FH 4H8UA 1T89C 5BRZA 3DROB 2CLVA 1RSYA 3BVDB 3H7BA 1JZ7A 4BYHA 3H2QA 1TENA 4NJRA 1R46A 2VR4A 5LXGH 5C09E 1C16A 1D7BA 3WN5C 3GC3A 2CY2A 5I6KA 1V7MH 1OSPL 4OT1H 1VZGA 4P59H 2NXZD 4PBDA 4H6UA 3BSHA 2KHAA 4DKAA 1X5MA 4YHMH 3FSWA 2Q43A 5I1LB 3QWNA 2RA1A 1SDDB 4U6YB 1Q0YL 1MFUA 2AC0A 1IRAY 2ADIB 4G6JL 4P5MA 5C0BE 5F1OB 3UC0L 4IOFC 5AZ2H 3SGKA 4EVNA 1GKOA 3I85A 2H32H 3C5ZD 2X0UA 3KYKL 3DMMB 2VXQA 4X7TB 2K78A 3PCYA 3QDHA 1B6BA 2JB6A 5JIIA 4MJJA 4IU3A 1FCCA 3C08H 4OZGF 5B3NA 2D9CA 3ROLB 4EN3C 4KQ4H 1DO6A 3VWEA 2EIZB 2F19H 2VJ0A 4PRHE 2CBPA 4OTXH 4EUPG 1YK3A 3WTSA 2X9WA 5JORB 1KCWA 1UACL 5IBTH 1T04B 3DROA 4MD5B 4WU7A 5C0JB 1BX2B 4OJYA 3UBXG 4Z0BL 3CQFA 4ES9A 4HPSA 4HIJB 1KLUA 2EH7L 3B5TA 5ANMA 2I32A 1GYVA 4G7YH 3ZE0F 7PAZA 3PFOA 4JWPA 1JZ6A 2R15A 1Z4RA 1SDDA 4U6YA 3DI2B 2ADIA 2HPOA 1UT1A 1U30A 5E2VL 2RBLA 1RI8A 1Z5LB 2GY7B 1REIA 1YEKH 1JGVL 4ORZC 5TTRA 3DMMA 5EBWB 2EDFA 1XB3A 2EEAA 2JQAA 4BUQA 2AFWA 4HGKC 1OKEA 3SE9H 5L2JB 1FH2A 3L16A 3IGFA 3ROLA 5GGRA 4DGYH 1NKGA 3DX4A 1ZHLB 3AT0A 3FQTB 5I24A 1RXLA 3W9DB 3GS0A 1WRFA 5T1KD 1J0KA 3FH4A 5AAWC 4NLHA 5EDSA 2PR9A 5JORA 2JKNA 1T04A 1SQMA 1WIOA 1DLFL 5IK3B 4L8DB 3KHZA 1QBBA 2E8YA 5C0JA 1BX2A 4PRPD 3UYRL 5GS0H 3FECA 5JOEA 4HLEA 4G7QB 4YPJA 4HIJA 2E7HA 4QHKJ 3NJXA 1QBAA 4A94A 4CVWA 1FZMB 2JJUA 5I1GL 1J9TA 1P7KB 4M7LT 4G9FD 4QI3A 2G0LA 3VXSA 3ZYJA 1KWMA 3NABH 1FORH 4YSQA 4JR9L 1L3NA 3OSVA 3UAJC 4X8JA 2Y0SA 1Z5LA 4BD4A 1AD9B 1CK0L 1RZKH 2B5IC 3P9MB 2NY5C 4I3GA 5DJCB 5EBWA 2W9EH 2LU4A 2XZAH 3NACL 5L2JA 3KM2A 4JREC 4I9XA 5E0FA 1VF5C 3SDAC 3MNVB 5IBUB 1TFHA 3FQTA 3W9DA 5EU5B 4IBZA 3R1KA 1FL3A 4OI7A 4TNVK 1HL9A 3Q44A 4BE5A 2E6QA 2CG9X 4S0SD 2EO9A 5IK3A 4L8DA 4K71C 5FM5M 3IJYA 4J1UB 4KXCA 2C4XA 2BOLA 2OI9C 2CNYA 4CDGC 4LNRB 4TV3A 2D0GA 2IAND 5IT2L 3SPIA 3IVKB 1FZMA 3NDZE 2XWJA 4XODA 2J73A 2XIIA 3H3PL 3CLWA 4F8LA 4PJEE 1ZLWH 4GAGH 4BV1A 4Z3GA 4PJXB 3ZQWA 5TQ2H 1W6WA 4PQAA 4UTBH 2QIRA 1I8KA 5I1AB 1QSTA 4Q36A 2ATKB 5JQHC 1AD9A 3P9MA 5DJCA 2GIVA 2CAKA 1FYHB 3GHPA 4JQXA 1DBBH 5D7KD 1CZ8L 3ARGB 3WMQA 5T1DL 3MNVA 4GP4B 5ID0A 1YEIH 5TD4A 4UM8A 5C07D 3UTQA 4JFHD 4FQIH 3LNIA 4QAMB 2WC7A 5EU5A 5C88A 1JMXA 1MCBA 1X9QA 2VRAA 5B1AB 2QMLA 3LMSA 4KJWC 1E67A 4NZJA 1HYSC 2C9XA 2R2HB 3BAEL 5D4QA 1EV2E 3RU8H 2JLMA 4C7HA 3KWVA 4LNRA 1W0YT 4MKMA 2IDSA 3BVNA 2YPVH 1SXNA 2V0AA 3GTNA 3NZHH 3GJEA 5K1JA 4PJXA 1J9CT 4ZPTB 4OVVA 1QEXA 4Q4IA 1DP0A 3RL2B 2ATKA 2B1OA 3HLAB 4YDKH 1I12A 3GI9H 3P2HA 2A6IB 4R76A 3GBDA 4BKLB 3LV3A 3ARGA 3TT3H 1FFNB 5F9JB 4MY3A 3D4ZA 2WVTA 1AXSB 2WZAA 4XNXH 1CLYH 5CJ8A 4IBVA 4HAFA 3QYCA 1NMAL 5I1HH 4J4PC 2GIMA 4B3EA 5FWRA 4RLDA 1N4XL 1TITA 2D0FA 3ZE1E 1JZ2A 1HXYB 4WZ9A 4K23L 1GC1L 2R2HA 1AZRA 4GBXB 5BXFB 2CTCA 1PZBA 4MA7H 2YSSB 1KCRH 1H5BA 4HH9B 4WWOA 3S2CA 1P69B 2P7TB 4QD2E 4KI5C 1BD2E 1SJHB 3CFNA 4M3KB 3VMPA 3L4UA 5T33H 2P3YA 1F1GA 2XQYA 2X5PA 2BOBB 4I48B 4XPAL 4ZPTA 1JWQA 1ZVNA 4WENB 3MJGX 1JNNL 5FW8A 1IGIH 1L5GB 25C8L 1KBKA 1CPSA 1A7PL 2AQ1A 4MLIA 2WN2A 1IM3B 1B2YA 1F90L 2A6IA 2PCXA 4AV4A 1CC3A 4BKLA 3F7QA 5F9JA 1FFNA 4QR7A 3F5WB 1BLLE 4MLSA 3FRMA 2R7EA 1AXSA 1KT2B 3NG5A 3X1GA 1YNTF 1NLBH 5B1KA 1A6VL 1EFQA 2QPFA 2BNRB 3UGUA 1WD9A 4K94H 1CDCA 4NP9A 1INDL 5KBMA 2ZYIA 4YQXH 1HXYA 1PF3A 2N59A 4F9PC 3P54A 2OJEA 4GBXA 2WYZA 5CEYA 3OMNB 2OMBA 5BXFA 4CRYB 2YSSA 4HH9A 5E99L 4GJTB 2ICEB 4OLZL 2P7TA 4YHOH 1FNFA 1G7MA 1IGFH 2FX8H 4FG4A 4WTWA 3DV4A 1WK4A 1E90A 2ZOFA 4I48A 4ODTH 4I3SL 2FWUA 5F7YC 1NPJA 3H0TB 3LRGA 4AOFA 4Q0XH 5JPNC 2CPCA 2E86A 1IYKA 1C8QA 4PW4A 4E5XG 4PJ8B 1XFOA 2Q3AA 3W6XA 3QRGL 5G4NA 4R7XA 1H9DA 3F5WA 4KROB 4M5SA 5GSVB 4F8QA 1KT2A 5ICYB 2Z31D 4Y16C 5BQ7B 4F92B 4YHIB 4GW5B 5FUZH 5DT1L 1AXTL 1UH3A 4X9BA 5AL8A 3POCA 4IOIB 4LSTH 4GAJL 5I73C 1U6MA 2PR4L 3AT9A 1EO8L 4PVNA 4GO9A 4PJ9B 5D93C 3VATA 1EAPB 3FFCE 3IXAB 2ICEA 1JF1A 4PV6A 4YXHL 5LN8A 3AXHA 4J3OF 1MIEH 5C0AD 1NDMB 5SWQB 3N0PB 1P4UA 3GSRB 3QXWA 4QYOB 4YGOA 5FA3B 2NY0D 4LMQI 1PNDA 1TF9A 2NY1C 2XZCH 2BY3A 3L81A 4KXDA 2O5ZH 4G5ZL 4TQIA 4ILDA 5D2LF 2E7LA 1XWVA 2W9LA 4LLUB 4XXWC 3HZVA 2MTAA 1P4LB 3QFJE 4WCYH 3FYEB 3ULVH 4R26H 2V17H 2E59A 3IRPX 1UQSB 2BC4B 1CI5A 1HCZA 5BQ7A 5K9QI 4G1PA 4HUMB 3TEYA 4XPHL 1P4NA 4YHIA 4GW5A 1WSST 1KYUA 2FBOJ 1YPZE 4ODUB 2J9AA 5AQ0A 3CSYB 3UOAB 4CAXA 2HRHA 2LV4A 3ESMA 4PJ9A 5E4AA 1OTTD 3IXAA 3FTUA 4O51B 4Y5YA 1GS8A 1BIIA 3K1KC 3KLAB 4APXB 2ZXVA 1SEQH 1T0NA 3H42H 2FLBT 1NDMA 1GJWA 1EXHA 4PTUB 3QAYA 1ZLEA 3GSRA 4QYOA 2A1WL 2PQ8A 1M7XA 2CWRA 4TQ8A 1PEZA 1FH5H 1QLEB 3HPJB 3KPQB 4Z7QB 3ZJAA 1L7TL 4LLUA 3TVMD 5L4FA 2OMWB 1CFSB 3MJ8A 3FO0H 2J8RA 4AYMC 3Q6FB 2EIEA 1FNOA 1IT9L 5C0GB 1G7PB 4K3DH 2P6EA 3D7HA 3HMXL 5ESVB 3J07A 2BC4A 3DTDA 3IGLA 4X0KB 5JW4R 1AHWB 5IFAH 4WI6A 3HG1D 3CXQA 1A7NL 2BRQA 5KVGL 2P8PB 1IIDA 1S60A 1EQWA 1GOHA 2JKTM 4GG6B 4G6AC 4HUWB 1E6JH 4EO5A 4XP9L 1CT8B 4UFVA 4O51A 4I2XE 2AJUH 5AG8A 4FHKA 3EH4B 3KLAA 2WWNA 3ZTEA 4APXA 4YS4A 3NH5A 3IMSA 3V6OA 2E74C 4E0AA 2CJUL 4P59L 1KLFA 1VFBB 5F1SA 3CCHA 1OAZH 3RWIA 1L9OA 1WWWX 2VZVA 5GGQH 5HHME 4KJQD 4O4YL 1Z1WA 3REWA 4EOWH 3HPJA 3KPQA 4MVBC 1CG2A 4TLTA 5AZ2L 2H0EA 2VL1A 1GY2A 4LLWB 3AMKA 2CUMA 2OMWA 4OV6F 2JIXB 4MCPA 5IF0B 4YSUA 1AKJD 3Q6FA 3EGXA 1IC7H 1X5FA 4HS8H 5BOZG 2HH0H 5ESVA 4HXAL 2OSLA 3L9RB 2VDKH 2F19L 4PS4H 2BIHA 4HWEH 1AHWA 5I8EB 5K33A 4QRPA 2P8PA 1JHTB 5IBTL 4NQCE 1U8LA 4G42B 3OWCA 1DDTA 2VDLH 3CV5A 1ACYH 1CT8A 4F2FA 4FFZA 3LKRB 4OI8A 6PAZA 2NDGA 1J8HD 3RWHA 4ELMF 4B9PA 5BW7C 2YRBA 1G0DA 3T1FB 2VR5A 2PC1A 3A6CL 1VFBA 1JJUA 4NAMA 4Z8FH 3PWUB 3ZDZF 4WK4B 2G30A 4PG2A 1KPVA 3ARED 3FU6A 1CLOH 1ET7A 5IJDC 2HZHA 2PTTB 4FZEH 2JIXA 2OTPA 5IF0A 1NFDE 5J12B 3VFOB 3OMIB 3V7ZA 3EDFA 1PZ2A 2DICA 4FQJH 3FCUB 4BK8A 5DD1L 1E4XI 4DKDC 4XMLH 4APQA 5I9QC 4IDLA 5IOPA 2R8SH 3VA2C 1O7DC 3LY6A 5HGHA 2VLRE 5I8EA 5D1ZD 1G6RH 1JTTA 3PPEA 4KORA 3PQYD 1JCVA 1KZQA 4M6AA 1JHTA 3PAUA 1NCWH 4W9JC 3LD8C 3IU2A 1GC1C 4G42A 5JW4Q 3ATBA 3FU9A 3Q9QA 2PO6D 2CPUA 3LKRA 1OGAD 3WC6A 3HUJA 1C5CH 1MHPH 1A6AA 2AEIT 2AI0H 3T1FA 5EF2A 3H5ZA 1HIMH 2G75B 3IJ8A 3L5IA 4DIXA 4EUPH 3LPFA 5ID1B 3PWUA 4HD9A 3JUWA 4DAGH 2ZX5A 1IVLA 2D8KA 3SY0B 5IUSA 5DZJA 1QR1B 4F8PA 4HHAA 5JQIB 3PWLA 2VN7A 3FBUA 4K71B 2C9RA 3VFOA 1H8OA 3CE1A 5JYMA 1R47A 3GPEA 4Z3IA 1J05A 2J71A 2XZAL 3QC5X 5HPOA 4P2RE 5KS9F 1LO3H 2ENQA 4LBEA 1PFOA 4E9TA 4BGDA 3DHPA 4MQTB 5CLYA 4QHUB 3ZVVA 4UWJA 4RZCA 1JFQH 1JGUL 1XF5B 5DRWA 2VGLM 2YD7A 4JG1L 3TX8A 1FFRA 3C9NA 4XNUL 4YL4A 1AZCA 2WXQA 1DSFH 1LXMA 1SXBA 3QHFH 3RKDC 1A02N 4HIEA 3OAYH 3FCTA 1F2QA 2WXNA 2AFOA 3BSZA 3SPVB 3PFUA 2G75A 3HC4H 4JDTH 4Y1AE 2AQQA 4AMKH 5ID1A 4LSSH 4HIIB 2JCCA 3G6JE 3L5HA 4GAGL 4MJ2A 4YSOA 2FK9A 3SY0A 2ATRA 1DYZA 4XPBH 5C8JB 5A16B 3HS0B 1MRDH 2IOMA 2VZSA 3INUL 2PPFA 4YIQB 1IGBA 2Q0YA 3PGDA 4PBXA 4X8GA 1DBBL 1ET5A 3LSOB 2QZQA 4NEXA 2XEIA 4UQDA 1HX0A 4ZX8A 1K3IA 1MFEH 1LANA 3D5OF 5DWMA 1YEIL 2B59B 4HALA 1MELA 4QHUA 1N70A 5I74B 5PAZA 2AQRA 2YR3A 3ELQA 1K8IB 5GZND 1XBRA 3PY9A 5D1QD 3VW3L 3S0PA 3WTVA 1JXKA 4TLKA 2X05A 2O5XH 2ED9A 4UEEA 1TNNA 2F54B 4WV1C 3QDJD 4LQ1A 3WT4A 4JHAH 3SPVA 4ZMTA 4AVAA 1DQLL 1XBDA 5JIPA 2EEBA 5ACLA 2EXTA 4L8CB 5JUEH 3C6LC 2O6DA 1CJYA 4RZKA 2DPTA 2J6EA 2ZJSH 3OB0H 4PS7A 2DLHA 2ZPKL 3ARFB 5C8JA 1NMBL 3HS0A 3T0DA 4M7LH 3MV7D 5D7SH 1CO1A 1DVSA 2YAEA 5L2KB 4YDKL 1P1VA 2WKLA 4QRBA 2EJ1A 1L7IH 3AG4B 3GI9L 4PJCE 5GRXG 1X7SA 2DPSA 2P47B 2DQDH 1UM4H 2B59A 2X70B 4NZ8A 2Z0UA 2WJ7A 3O4LD 3DX6B 4JO3H 3QUZB 5I1HL 2BIMA 3DOSB 4GRLC 5E5MB 1K8IA 4L4JA 5FW7A 1XH1A 3VAEA 4A1RA 1WFIA 2IAMA 4X98B 5D1XC 5FYKH 3IRCA 4LGSB 3DXAE 3T8XB 1JNHA 1HC1A 2UXFA 4V2BA 3MA9H 1Q8MA 1UZGA 1H8NA 4X7SL 2NXYD 4L8CA 5B4MC 3NCEB 4Z7UB 1KZFA 1II4E 3ARFA 3QFDA 4D3CH 4U5YA 3ZPDA 1IGIL 1I3GL 3GLDA 3RGVB 4YWYA 4M48H 1XH2A 4LVHC 1OCOB 4CC1A 4GUOA 4F5CA 1WZAA 5CP3H 3K6OA 1SMOA 2CE6A 1FUNA 2X70A 5KANG 3DX6A 3QUZA 5EU7C 5F2FA 1QW8A 5KTEL 3KYMB 3I2CH 4Q74A 3C2AH 3VI3E 5KSAA 4IKIA 1XF2B 4X98A 4PV8A 2A9AA 2WYRA 4P23B 1SXAA 2J2ZA 4MKTA 3HVNA 3T8XA 1KY6A 1LMKA 2BSCA 4EI0A 4J3OC 3CZUB 4TL4A 4Y2LA 1IGFL 2FX8L 4WEEA 2IBBA 2CLRA 3T0EB 4JL1A 4Z7UA 2ZEEA 3CC5B 4C4UA 1BVKB 1GAFH 1TKWB 5TDOA 5TE7H 3RGVA 4C83B 1KCUL 1ZT4B 4IOSD 4X6FB 1IFGA 4PJ7B 2IGLA 2XBDA 5I73B 5D93B 3CFMA 1YAIA 2GITB 1M7IB 4KV5F 1PJ9A 3KYMA 4MMYA 2Z92B 3O6FD 2WBJD 1R57A 3VFWB 1YUHB 3K4DA 5FUZL 4D9QE 2H3KA 4N2EA 1XF2A 3JTBA 1SLVA 2MOQA 4LCUB 5IOKA 4P23A 4Z7VE 4Y1SA 3KH4A 1V5JA 2DLFH 2ZG2A 4OM0L 1GHEA 5DJXB 2VDPL 3NTCH 3RGBA 4RX4D 1I1AC 2XJKA 4M29A 1TQCB 3CX5K 1A66A 4V11A 3V4VH 3T0EA 4OC0A 3CC5A 4WY7H 2DMKA 3N41F 4WJG3 3MRBB 1QFOA 4OLYL 2VQ4A 4M61B 5SWSB 2O5ZL 4C83A 1BZ7A 4X6FA 1NZRA 1IKOP 1R5IB 3NQKA 4PJ7A 5E2UL 3PB8X 2Y1VA 3C5JB 3MXWH 1H0DB 1TJXA 3KG5A 1R5WB 2YD0A 5D5MF 4Z0XB 3QEHB 4WCYL 5F21B 1ZTXL 1L3WA 2F8OA 4RSYA 2BVPB 1VHPA 3NN8A 4KQ3H 4DCQB 2V17L 2GITA 4QXTB 2G5BB 2AEWA 2QZ5A 3PHQA 2Z92A 3S96A 4DQOL 1DANU 2NX5D 1P7HL 1YUHA 1KYOJ 4LCUA 2FX9L 3PXHA 1LM8V 4MRIA 5MHSD 5DJXA 3LNFA 2UZYB 3VG9C 4G6MH 4DP0X 4LKCA 3BZEB 1PU9A 1IGJB 2J43A 3BT0A 1TCRA 4X4ZA 3H42L 5CPAA 2QGDA 4KJPD 3EXLA 1FL6B 3T08A 3BKJH 2P6FA 4LSRH 3ZU8A 1YRKA 3EHBB 1QSVA 1FBIL 4M61A 5SWSA 2ADFL 3K2IA 4AIXA 1R5IA 2CALA 4AVBA 4F9LA 4L8SB 1H0DA 2ABZA 4K7FA 5H2BB 5D4IA 4KVXA 3QEHA 2Y7MA 1XGPA 3DYOA 3DECA 2YNEA 4OKOA 2BVPA 1NQBA 4DCQA 4QXTA 3ET9F 5AW6B 1MCPH 3D7PA 1WE5A 4NQDB 1SLUA 4D0DB 4KBPA 4ZQKB 2XVGA 3LPGA 1OP3H 1N5AB 3ARBC 2NZIA 1ZIAA 3LS4H 1W9XA 2JEWA 5DDHB 1KGCE 5J8CA 1E6JL 2UZYA 4WFED 4XCNB 3BZEA 1Z5YD 1R17A 5JTWA 1OOWA 1IGJA 1ZGLP 4PD4K 4PVMA 4Z9KB 2IWKA 3UBHA 1MFAH 4BBHA 5ILTH 2WB7A 4JO5A 2X10A 5CBAA 1FL6A 5GZOD 3LZQA 1O9WA 1ZE3H 5KBPA 4JUSA 3ZDYE 3ETBJ 1K8DB 1VGEH 2QTEA 3HZMA 1HWGB 1I7UB 1WGOA 2AFNA 3H6AA 5A40E 2BMKB 5H2BA 4AKQA 2ZKWA 1Y07A 4YAQB 4OJAA 4JFED 2EE9A 1PZSA 1TTFA 5J1AA 3BO8B 3SE8L 2QADB 3VXNB 4PS4L 4UV4H 1VFAB 1E28B 4ZQKA 5DS1A 1HE8A 4D0DA 5FKPB 3FTGB 2MMXA 4KNUA 4ELKA 1MIMH 3RHWK 4BZ1A 1LO2H 3VFTB 2E46A 3V7AG 1HINL 2WQRA 2YPLD 1SVCP 3LTVA 2VDLL 1WBYB 1AD0B 3KNBB 1SDYA 1FSKC 4ZI8A 2QGBA 4RGNB 3JUZA 3CN2A 3TA3B 1SFDA 3G6AA 3IEAA 2WQSA 1P9MA 5I9QB 3VNYA 1K8DA 2N01B 2EXYC 3BVWA 5E96A 5IB9A 4IGBA 2E9JA 2I25N 3O41A 2RB7A 1YQ2A 3OC8A 4N2OA 4Z3HA 4PJBE 1B4RA 2H5UA 4FZEL 4YX2H 4IAVA 1GHFH 3L7FB 4JJXA 4M3SA 2BMKA 2ZKYA 3JUYA 4KX7A 4JY6A 1CGTA 3WNPA 5HYQB 3APDA 5IESH 3IDXL 4YAQA 2HJLB 3N04A 4BUGA 1ICTA 2CR3A 3BO8A 2Y7OA 3VXNA 1VFAA 2JBJA 3IWEA 3FTGA 3S35X 4OF8A 4P0DA 3BQUA 3HFFA 4YFEA 4LIQE 2I60H 1B4LA 2XTJC 4JPIA 3SN6N 3VFTA 2VT0A 3GKRA 4K3EH 1CJWA 2DEXX 1WBYA 2ERJC 1AD0A 3FN0H 2BZ7A 5IHLB 1MHPL 2WTOA 2VSMB 2ZKHL 1W15A 1ZA6B 4Y4KD 4A2MA 3FZUC 1HOCB 3TA3A 3KGRA 5C0CD 2CDEB 4BH8B 4OJEH 4ZFGL 5LGHL 5GRUL 1C5BL 3QJZA 2XQBH 5EUOF 1WH0A 3KLKA 3V0AC 4CVUA 4AGMA 4OZFB 5I0WA 1FHNA 4OF3A 5F7EL 1AGEA 1MWAH 5CJOL 3ZYIA 3EFDL 4AIOA 3TU6A 1LO4H 2BWQA 1KBPA 2EUXA 5I6XC 2HJLA 3RNZA 2FLMA 5T1MB 1ADQA 4V1DB 2BP8B 3AZUA 4IMLB 4JDEB 1JFQL 1G87A 5EBMA 1EHXA 4AZUA 5GJTL 5CLZA 3AACA 2YFNA 1EZLA 3BHXA 3QHFL 1M42A 1HEHC 4V33A 1W8NA 4A55A 3BZFB 3SDDA 2HFGL 5B7MA 3OKNA 3EBIA 4HMDA 4MJ4A 5CMAB 1E4WL 3J2PA 4KY2A 3B3WA 4OZIA 2VXVL 2Z34A 4O9HH 4BH8A 3B9EA 3KWWB 4DP2X 4LSSL 2FAUA 1QLRA 2K0RA 3H4FA 3OAWA 2EO8A 2ZG3A 2WSDA 2XN9B 4OZFA 4CAGA 2CK2A 1UXWB 4YEEA 5CCKL 1EJFA 4KI5E 4Z7WE 5EEXA 3EZJB 1RULL 4PJAB 4PWIA 5IVXF 1E8XA 1ESOA 1MFEL 1T21A 1T66D 3HZYA 1D6VH 5T1MA 4V1DA 4L18A 4IMLA 4JDEA 1PKOA 5E1HB 3GQFA 3I6KB 2VQTA 4RAVA 1DQVA 2PWGA 1D5RA 4C57C 3BP5B 3BZFA 1VKXB 2UV3A 3L4ZA 2XWDA 4XCCL 2FH6A 1QLFB 4LCCC 1OIOA 4RISL 5CMAA 2GQHA 2ZAIA 3E8VA 3FTVA 2JKLA 3QPQC 3KWWA 5KTCA 1Q90A 4G2AA 3BN3B 2ZUWA 4OIFA 1Z5RA 5JLZB 1WV7T 2CMRL 3P9LB 1LE9B 1YX0A 5IFHH 5D7JC 2R39A 4MA3B 1OWRM 1XSIA 2QKIB 3DHJA 1I7ZA 4HXBL 3R9FA 1DTUA 4FQ1H 1CE1H 4RA3A 3L1GA 5C08D 4PJAA 2A9BA 1WGVA 2R69A 4UV7L 4Q14A 4X5KA 4JO3L 2IVFC 4ANKA 1IBZA 3DVIA 3NSFA 1OAKL 3V2AR 4EZMA 5A6IA 4P07A 4O23A 2OL3H 3QE5A 1KENH 1WA0X 3I6KA 2V2XB 1NFIA 3G5ZB 4Y4HC 1YYCA 3FH8A 1VKXA 2I00A 4QO1A 1QLFA 3CZFB 2GHWB 2NY6B 3VSVA 2I85A 5HP5A 5JOPE 3PL6C 2X9XA 3FU5A 3IFOB 3MU3A 4WWNA 3D52A 1PY9A 2WSPA 3F7KA 1F1DA 4GQZA 1GYUA 3ATFA 3KD4A 3DETD 5C0BB 5JXEA 4XN4A 5E8NB 1CFNB 3P9LA 1LE9A 1XTMA 4MA3A 5FOBB 2BP0A 2ITDB 2QKIA 3KW8A 1JE6A 2GLJA 1G5GA 3WEMA 4W6WB 1ECYA 4XVOA 4BWTA 2FECL 4DP8X 1C08B 3F2LA 4K7PH 5I0ZA 1UZ8B 3T65B 5CCJA 4PRHB 3FHQA 4HWBA 4G6FB 4WWPA 5A2FA 3ARVA 2O72A 3HB3B 1BMGA 2OJZH 2V2XA 3T0BA 4JY5H 3Q48A 1HZHL 5C09A 3U7WH 2H32B 3G5ZA 2VLKE 1KNOA 3G5XA 2BHUA 3CZFA 4LVOC 1GYCA 4RDBA 3IFOA 5LRGA 3W3BA 1U8MB 2ZWZA 1QTSA 1ZAGA 4PS8A 1RURH 5BNXD 5JNYB 1IAOB 3K8KA 3FU0A 4UYQA 1BWMA 1N67A 5C0BA 5E8NA 3V8OA 3UTSE 2QPDB 2V5MA 2ALWA 4OLWL 1CF8L 1RJZA 3GMRB 1K2DA 4XNMB 2ITDA 5FOBA 3T3PF 5TE7L 3SGJA 3TYFB 1KSRA 5KUMA 4ANVA 4MXUA 5I1EH 4TPRL 4QTIL 1M4IA 1BAFH 5C2BL 2G3MA 1C08A 3IF1A 4B13A 2GSIB 1UZ8A 3CX2A 4PWEA 3T65A 3HI6L 2CGRH 2PXYB 1BEYH 4ZO8A 5TF0A 4PRHA 4PJDB 5F7FA 1W72B 3L1EA 1NFKA 2B77A 3RDTC 3QA3A 2QFPA 4Y0GA 4K0OA 3VXRB 4LEXH 1UG9A 4PTTB 1AR1D 3EO4A 2H32A 1OEZW 2Z8RA 1SF5A 4K5OA 4UBDC 5A6MA 4B5EA 2CBQA 5EBLB 1TPXC 4L4VD 4Y2DD 3PIQB 3APMA 4N5ED 1U8MA 3MFGB 4M8UA 1IAOA 2ZUYA 4JXQA 4RFNC 2HJKB 2BIIA 4DFIA 2FT8A 4WY7L 5DQDH 1E7VA 3UO8B 5KYXA 4BRJA 4ZFQA 3GMRA 4IRZA 4XNMA 3TYFA 4U0RC 3FEEA 4A38A 3LVTA 2CD0A 4U3XA 5CSGA 3FVLA 3ZE0E 1QSFB 2GSIA 3Q5TA 3VG9B 1F5WA 1MRFL 1QBML 4XPFL 2PXYA 3K9UA 3MRRA 4LAQH 5AVXB 3MLSL 5TF1H 1TTAA 3DUUB 3HBZA 1W72A 2A6JB 1WICA 5C70A 3K6DA 1YYMH 3K6NA 1RIVH 3HE6B 2FNBA 4MS8C 1S7RB 1X7TA 2PETA 4WEBL 5ELYA 2WB1A 4KVOE 4PSRA 5KG9B 1RO5A 3QIWA 4JM4L 4G6ML 4PY8I 4UNIA 4TYUA 1NBYA 1QNZH 5EBLA 4EI5B 2ZP0T 4F58L 2HJKA 3SDCD 1E27A 3WTXA 5F7DB 3BKJL 2DQHL 3PFEA 1QPKA 3ZQXA 1KMGA 2WXGA 1O9ZA 4FABH 3EJZC 4MNHB 4EFDA 1YQVL 3T2NH 3RAJL 1F41A 3EO0A 2WWMC 3DK2A 4LRIC 5FHAH 3DUUA 5HI5D 3AAZB 2A6JA 3VFUB 3UTOA 3HJEA 1MCPL 1NKOA 2XEGA 3HE6A 2BS8A 1LE5B 3GTTA 2H41A 4L3ED 4OD1H 4AC4A 1S7RA 4BBWA 1EXUB 1MCIA 5KG9A 3BAYA 3US9A 3GLZA 3WHE0 2Y36H 3QCTH 1ASPA 1SOSA 2IDCA 1GGCH 4PLKD 4WI5A 3FQRB 3QDGE 3LRHA 4FCHA 2GJPA 4PJEA 5F7AA 4EI5A 5BV7B 1IICA 1MFAL 1O7DE 2W9DH 3JXAA 4EE2A 2P8LB 1WS8A 4U3HA 4DUXA 1SY6H 2WTRB 1OAXH 3ILEA 5I71C 1HEZB 3NDYE 5GRZA 3WIFB 1UZ6E 3JV5A 1GJIA 4HBQA 4F9UA 4C4KT 2CBTA 4MZ3A 5K9KA 1PLAA 5DJYA 3RE0A 3A4FA 4MNHA 4PJFF 2GAZB 1UCBL 3PBBA 1IGMH 1MOEA 1E4KA 4TVPD 4IJ3B 4IS6B 4PCSA 3FMGL 3ZE1B 3NJLA 3A21A 3UO1H 1BJ1H 5KJRH 1LE5A 3GINA 1K4JA 1KV7A 1EXUA 1LO2L 4UTBA 2C9SA 5F88A 2FHCA 3WXVH 5AZEL 1GY1A 1MDAA 3TN0D 3UL4A 3TTHA 3EYUH 2R2EB 3QZWB 4KKCD 4M03A 4AGNA 1AY1H 3FQRA 3PWVB 1LILA 3J7HA 4I3RL 3T8VA 4UA3A 5AG6A 3VGDA 1UUNA 2ZE0A 4R2GC 4YXLH 1MAKA 5CGYD 1EHKB 2P8LA 3OM3B 1VLXA 3KDMB 4UQCA 1DQQB 4JFDE 4WRLA 5DUPH 5AOZA 4MFPA 3QQ9C 3ZTNH 3TC9A 3DOIA 1TO5A 1UADC 4MHPA 1OB1B 7FABL 1MW2A 2FQDA 2NR6A 1BQHG 2GBTA 3X1NA 1N59B 2GAZA 5G55A 3K4AA 1K6QH 2OCCB 4N4YB 4U1GB 5JYLA 1DUZB 4OB5L 3LN4B 2DI7A 3AB0C 4J5VA 4P49A 3UTPE 3O0RH 4XB3A 4F7CA 3WR7A 3KM1A 4IS6A 1R24A 4JGUA 2ZYSA 2YPVA 1I1DA 5CU5A 3SE4A 1VESA 1GCYA 3FT2A 4M43H 1I9JH 4OQTA 3T90A 4BZYA 3ZBMA 4YHPA 3KPSD 2X12A 2R2EA 4O58H 3P73A 3TYGH 3PWVA 4XZUB 1IZJA 4FKKA 3DHUA 2Q7NA 2NCMA 3ILPA 3KDMA 2YGQA 1ZS8B 2WXLA 1SOKA 4YSPA 3KXFD 1EHAA 4P5TB 1J5DA 3RVVC 1ROWA 1OB1A 1ZSDA 4UYPA 4XNZC 1N59A 2NTFB 4S1QH 5I28A 3UYOD 1DUZA 4CADB 1MUJB 2OMUB 5TE4L 1QR4A 1WIUA 3VXQB 4J3WA 3BPLC 4F8TA 2Z0ZA 4NZRL 1JDDA 1UJTA 5DFTA 5I0XA 3RZAA 2VDQH 4WTQA 1CWVA 1H6TA 3WV0A 1PKQB 2L04A 5E8OB 3O4OC 1YMMD 3QIUB 2Q3ZA 4P2OD 2GJ6E 4AEFA 3AGVA 2E7DA 2N7SA 1M2OA 1P7QD 4IRJB 1VPOH 1PG7L 3JT0A 3LRKA 4HIHB 2OAAA 1XXFC 3F8KA 4MNQE 4O9HL 3VYPA 4LSPL 5IQOA 2EVGA 3TC8A 1ZS8A 3U4EA 3EJUA 1AMXA 1D7CA 5C7XL 3SXNA 4PRAB 1L9RA 1IAII 4NN5B 4UNUA 4P5TA 5E0QA 5IV0A 2P5WB 5T1LB 1S7XB 3D7GA 4M1DH 2H0FA 2BNQD 4HBCL 4DW2H 4UT7L 3ULAB 1MUJA 2X6BA 3MNMA 4CADA 1CU4H 1MQKH 1PVHA 4MMZC 4W9ZA 2YOAA 4AQ1C 3T8WA 2OMUA 4PLJC 4KSAA 3VXQA 1F1AA 1AGBA 1KTKE 2Y25A 3KL5A 4B50A 1Z3GH 3GLJA 2XV6B 1P5UB 4NO0B 3S37H 5CKAA 2Z3LA 3UZEA 3FFCA 2EVNA 1MJ7H 1OAQH 1RIHL 2FZ3B 3SOTA 3ZHNA 3O6KH 4U33A 2ARJQ 2UX7A 4AW4A 1QWNA 3RWFA 2WSKA 2G2RB 1O6SA 5HDBF 3TV3H 3ZYOA 1WUZA 3ARDA 4IRJA 4DN4H 5IMLB 4GMSH 4HIHA 3VFGH 1X3DA 3SCMC 2WQUA 2PP9A 3U7YH 2UZXA 1Y0YA 4DJMA 2AJYH 5KVDL 3MMEB 5KVGE 4R96B 5AVYB 2HG0A 4I77H 2P5WA 2Y5QA 5T1LA 4CN6A 3CPUA 3D3VE 5EORH 3QFJA 3WO3B 3WNNA 2C5DC 1T0PB 4ODWB 5B39A 5EEWA 4N90D 3OC5A 4Y4HB 5IBLC 2VXKA 1U91B 1NGYB 1C12A 4XHQA 1UOLA 3IYLW 4X4ME 3RA7H 3B9KB 1JZFA 3AS3A 1UXLA 4CU7A 5B38G 3FB5A 1YPZA 3GRWA 5D2LE 3SOBH 1RP8A 1UA6L 1RERA 2OL3L 4F15C 3ARSA 2JNZA 3B2UD 3K2UH 1XF1A 5KUKA 1P5UA 4NO0A 3ULUH 2WPGA 4N24A 2BSEA 4TSAL 5BO0D 1AZNA 2FZ3A 3ETBF 3RZCB 2O28A 3KLLA 4NN7C 4J2XA 4H26B 3IXTA 4JL2A 4OZHB 4JKNA 5IMLA 1N26A 3Q8EA 4QHMB 3ARRA 1SRDA 1FLRH 1F56A 2YLKA 4R96A 4RIRA 4F7MB 1TTRA 4UNVA 2WXIA 1VAHA 1LNUB 1YVOA 3OD3A 3N1GC 4P9MH 4Z7AA 1PUAA 4XXCA 2DM4A 1TLKA 4ODWA 1FGNH 4ZNEE 3NH8A 1JPTL 4WTZG 5GXBB 3LZOA 3IFPB 1U91A 2N56A 4Y7MA 1UB6B 1ZANL 1YZZA 3DURA 3B9KA 2FXFA 2K7PA 1ON0A 4KMLB 3LEYL 4P2YA 4ZOBA 2YK1L 1BQRA 3MOBH 3AU1B 3LVEA 3BIAX 4QMEA 1I85A 5BRZD 3UMTA 1E4HA 5IGXL 3GUTA 5A2JH 3P4OA 4KUZL 4IRSD 3U7WL 4RMVA 4Y9EA 1EJ6A 4DK6A 4H26A 4FD0A