1H8LA

Duck carboxypeptidase d domain ii in complex with gemsa
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
380
structure length
380
Chain Sequence
QAVQPVDFRHHHFSDMEIFLRRYANEYPSITRLYSVGKSVELRELYVMEISDNPGIHEAGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVQSTRIHIMPSMNPDGYEKSQEGDRGGTVGRNNSNNYDLNRNFPDQFFQVTDPPQPETLAVMSWLKTYPFVLSANLHGGSLVVNYPFDDDEQGIAIYSKSPDDAVFQQLALSYSKENKKMYQGSPCKDLYPTEYFPHGITNGAQWYNVPGGMQDWNYLNTNCFEVTIELGCVKYPKAEELPKYWEQNRRSLLQFIKQVHRGIWGFVLDATDGRGILNATISVADINHPVTTYKDGDYWRLLVQGTYKVTASARGYDPVTKTVEVDSKGGVQVNFTLSRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXYPEPTIDASE GP180 RESIDUES 503-882
publication title The crystal structure of the inhibitor-complexed carboxypeptidase D domain II and the modeling of regulatory carboxypeptidases.
pubmed doi rcsb
source organism Lophonetta specularioides
molecule tags Carboxypeptidase
total genus 132
structure length 380
sequence length 380
ec nomenclature ec 3.4.17.22: Metallocarboxypeptidase D.
pdb deposition date 2001-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 1h8lA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1h8lA01
3RAMA 4MHYA 1LAMA 3IO1A 1R3NA 3NH4A 2IMOA 4JYWA 3GLJA 2CTCA 2V8DA 3D67A 4R6TA 1TKFA 4GM5A 5F09A 3DGVA 1ZG9A 2JBJA 2DEAA 5D8NA 2Q51A 4IYKA 2ZEDA 3SJXA 4P4FA 2POKA 1LCPA 2EWBA 5JGFA 2PJ8A 3D66A 1AMPA 2PJ7A 4KSIA 4U3SB 5AQ0A 1Z5RA 1ARLA 4G1PA 4NJQA 4DYOA 4P4JA 2XEFA 2RFHA 4OIDA 1ZLIA 3PBBA 4R7MA 3PB9X 4MRIA 5HXDA 1YW6A 4AXVA 1HDUA 4NGTA 3T8WA 4UF4A 2GLFA 3PEIA 4OC4A 3S9MA 1LOKA 4PXBA 3V38A 1RTQA 4OKOA 5LYIA 3CT9A 3KQXA 4ZY1A 1LANA 3HN5A 5HVFA 3FH4A 5THWA 3B3VA 4IK2A 3SI2A 2FVGA 1JQGA 2VL1A 8CPAA 3D7GA 4WI0B 3BI1A 2NYQA 1IGBA 1IY7A 3WC6A 2ZEOA 4OC1A 2CTBA 5J1QA 3K2KA 5HVGA 1XMBA 4H2KA 3RZAA 2OOTA 1EE3P 4EIUA 4P45A 1YLOA 3QNVA 5LRKA 4FWUA 3PRTA 2EK9A 3SI1A 3E8VA 2PVWA 2AFMA 4OMEA 3KZWA 4A37A 2GREA 2I3CA 3ISZA 3MRUA 4JZ0A 5G5DB 3PB6X 1YSJA 3B3SA 1YMEA 2O4HA 4DUKA 5I4MA 4W9YA 5DS0A 3RBUA 2WZNA 4ZX8A 3GB0A 1HEEA 4WJBA 1BAVA 5K8MA 2Q4ZA 1CP6A 5K8OA 4NGRA 5CPAA 1TKHA 1Y0RA 4UIBA 5HVHA 5K39B 1Z8LA 2IQ6A 2XEIA 4FXTA 3S9NA 3I1UA 4NGPA 1XJOA 1Z2LA 1CX8A 4OP4A 2PIYA 4TWEA 1LAPA 4NJRA 3BXMA 3KCPA 1BLLE 3G3LA 3K9TA 5LRJA 1CG2A 1QQ9A 3PB4X 1ZG7A 4LQGA 2F8HA 1Y0YA 4O23A 2C6PA 2C6GA 3NFZA 4MHZA 4PPZA 1TXRA 4PXCA 3IC1A 3PB7X 4RUHA 2V77A 4F9VA 3ISXA 1R43A 1TF9A 2V8GA 3SJFA 3FJUA 2BO9A 1M4LA 2C6CA 4IAVA 3BI0A 2PCUA 4YOKA 3NH8A 4P4DA 2CIJA 3B3CA 3FX6A 1ELMP 1DTDA 2ZELA 3KHXA 4OC5A 4PQAA 3L2NA 4OC2A 4NFRA 3PFOA 1CP7A 4P4BA 4UEZA 5JH9A 1CPSA 4MXUA 1HDQA 3NJVA 1UWYA 4PXDA 3SI0A 3FEEA 3NJXA 4X3RA 2PE3A 4MHPA 3BHXA 4P44A 1LFWA 3KR5A 2ZOGA 4EFDA 1F57A 3H8EA 1ZLHA 2O53A 2AFUA 2AFXA 3WC7A 3D7FA 3KASA 1F2OA 1BPMA 2AFOA 4NGQA 2ZEGA 2CF4A 2AFSA 2ZEPA 4R8FA 2QVPA 3B2YA 3IWWA 4CPAA 2OR4A 1QMUA 1TKJA 3FEDA 1GYTA 4ONWA 3VARA 3KGQA 2GLJA 4FUUA 4ZY2A 3KL9A 3D7HA 1VIXA 3NA6A 4FBEA 3H8FA 4YWYA 3SJGA 2JBKA 3CDXA 4FL4C 3KI9A 4OIWA 5K8NA 2IJZA 4IHMA 4MMOA 3FVLA 2ZEHA 3WC5A 3PB8X 2XHNA 2HC9A 3FF3A 3MN8A 2AFZA 3B3WA 1TF8A 3VH9A 5LYFA 4A94A 4OC0A 1Y7EA 5D29A 1CBXA 3B3TA 4YU9A 3WABA 4MCSA 3KQZA 2PJCA 2ABZA 4P4EA 1NKGA 7CPAA 1VHOA 2QJ8A 4OC3A 3CPXA 2ZEEA 4NGNA 2AFWA 1VGYA 2V8HA 3DLJA 2WYRA 4A38A 3IIBA 1XBUA 3LMSA 6CPAA 4F8ZA 5ELYA 2ZOFA 1ARMA 5JM6A 3VATA 1FT7A 2ANPA 2F7VA 2XEGA 1Q7LA 5LYLA 5IB9A 1PCAA 4P6YA 4DJLA 4PXEA 1FNOA 2EK8A 3B7IA 3PBEA 4A39A 1CPXA 4MCRA 3HLPA 1VHEA 3S9LA 3B35A 1XFOA 4WWVA 2G9DA 3D68A 1H8LA 2PJAA 5LRGA 4X2TA 5K8PA 1PYTB 4R76A 1ELLP 2PJ6A 4UEEA 3N5FA 4X8IA 3H8GA 3D7DA 2PJ5A 2PJ3A 1F2PA 2GU2A 1OBRA 4BD9A 3GUXA 4FAIA 2PVVA 4NGMA 2PJBA 4MHNA 2V8VA 3IFEA 3V7ZA 2PJ1A 4TNUA 3LWUA 2PIZA 3HUVA 4Q7AA 4F9UA 1KWMA 3PFEA 4Z65A 3KHZA 3TX8A 1NSAA 4MCQA 3JRUA 1DE4C 2QYVA 2B59B 2BOAA 1YW4A 2ZEMA 4ZYQA 2PJ9A 2BCOA 2J9AA 3IJ3A 4EMEA 4P10A 2NSMA 1ZG8A 4UIAA 3SJEA 2ZEFA 3FMCA 4B6ZA 3NH5A 2JEWA 2PJ4A 3FECA 3IEHA 2XEJA 2PRQA 5CBMA 4ZX9A 4P4IA 3CPAA 4ZI6A 4ZY0A 4UEFA 1XRYA 4EWTA 4MCPA 1AYEA 3WT4A 2C1CA 3D4UA 3KR4A 4K3NA 2PJ2A 3TC8A 2RB7A 4NGSA 1BPNA 2PJ0A 2ZENA 2Q43A 5LYDA 2HB6A
chains in the Genus database with same CATH superfamily
1UXLA 5TTRA 3FNCA 3HLKA 2CKBL 3KXFD 5GGUB 4NJ9H 4HNXB 1AACA 1RZFL 4JHZA 3UBXI 5KSVB 1LDPL 1EEQA 2YZ8A 3IPBA 4KVCH 2C3WA 1R3NA 4KY1H 1UB5B 1DSYA 1FYHB 2VMEA 4JO4H 5IHWA 5IVXA 4LXFA 1CGTA 4Q9QL 4DO6A 2QVIA 4P48A 2JXMB 3ELAT 4XRCA 4DP8X 3TEZA 1LWRA 2Y07L 2QKIB 2Z91B 2JMRA 1O5PA 3V0VB 3C6SB 7PAZA 1JJUA 1DDHB 4UINH 1P1ZB 5KTDA 1PJ9A 3DGDA 5KG9A 3TYFA 4ODUB 3ECWA 2GC4C 1U95A 1SOSA 2GY7B 4JFFD 3ZE1B 3MV7B 4M93B 2XX0A 2AABL 1NFKA 4F2EA 4EZKA 5DUJA 5KVMC 4RX4A 4HJGB 5GGSA 4LF3A 3U7WL 4MBUA 4XWOC 4NJQA 2C1PA 4BWTA 4KMLB 3VXRD 2GJRA 1IEHA 4BH8A 1UM5H 2XEFA 5BS0B 5KJRH 4U6YB 3SD2A 4DN3L 5ID0B 4CVUA 3S6HA 2F19H 4W6XB 1O9ZA 5FM5O 4P5TD 5EB9A 1CK0L 1FZOB 3D39D 4GRWB 1XXFC 2YMXL 5EU7C 2BZCA 2AK4A 3BI9X 4UI2A 5JMRA 1A6ZA 1Y0LA 3ULUL 3Q9PA 2VM4A 5L4JA 3AGWA 1CFNB 5DC0A 3H4FA 4QB9A 5DRXA 1U21A 1RIUL 4K15A 4K4KA 4PXBA 4PRPD 1A64A 1O0VA 5AW2B 4LLDB 3ZTJG 5CJOL 5J0BA 3GUTA 1OO2A 1P4BL 1FNLA 4M7JL 2IH1A 3KLSA 1XAKA 4RZCB 4X98A 3IRPX 5DK3A 5LYIA 4IRSC 4UQ3A 5B7EA 4U1MB 1ADQL 3V4LA 1F8TL 1S7VB 5I30H 4N8VG 5ABAA 1Y6MR 1SBSL 4H5SA 4N2KA 3LKRA 2WKOF 4NQCA 2X6UA 5E00A 1X5JA 1XDTT 2PP7A 3FOMB 4HKXA 5JHDE 2WXIA 4X99A 1IGJA 1NAMB 1NGZB 1USZA 3C6LC 2FL5B 4JFED 4YHLH 4LCYB 5L6YH 1MCJA 3S36L 5AAPA 4NHUB 1X5FA 5GRJH 1EAJA 4M29A 3POCA 3K8MA 3VU1A 4C2ZA 1IC4H 3MA9H 3PDOB 4P4KA 1KGCE 1TVHA 3LKOB 1J0JA 4XN2A 3V5DA 3DX8B 3PHQA 2LHAA 3MR9A 3R0NA 1ZGLB 1LJMA 3WEXB 3R1GL 1M1XA 1OVZA 2GCYA 3TN0B 3DHPA 2FR4A 3HG4A 2WXRA 2B5IC 4KPHH 4JB9H 3I2CH 4KJPC 1G1KA 4BWUA 2ILLA 4AB7A 4D9LL 3FU7B 3ZDYE 1A7QH 5C0IA 2M2DA 5DHMC 3V2AR 4M62L 3MRDA 3BEVA 2H0EA 2IV8A 5EMIA 5MEPA 5KSBA 4JZ0A 3P9MA 1UADC 3GJFB 1KCUL 4IQHA 2WQVA 3PB6X 3HIZA 1CYGA 4GFTB 3T71A 4NUPA 1U8CB 4G6FD 5D70L 2NTFA 4CAFA 4R26H 4QYOA 2XV2A 1YSJA 3RDTA 4LLYA 2X70A 2SEBA 3BPCB 1CTOA 2FIKA 3KWXA 1D7FA 2XYCA 1MUJA 3GKWL 2DYSB 4JFVA 1NC2A 1RERA 1LNUB 3MYJA 4QY8B 2WPGA 4UBDC 5FW8A 5IF0B 4Z3GA 12E8L 2OZ4L 1BAWA 3TIEA 1H15A 2FEJA 4P2QB 1TTUA 1J5HA 5HY9B 3IGLA 1JF1B 1GZPB 1G9NH 1GVIA 1E50A 3NJHA 1KJ2H 1KLGA 1F5WA 1HNYA 2LTQC 5K93A 4GI9A 3CFMA 3KNBB 5KVDH 1PF3A 1Z8LA 4CVWA 3BAYA 3ZE0F 4PGJA 2A2QT 1KC5H 3ZTNH 4NGPA 1BZQK 4ZD3H 1MHCB 3C09B 4KK6C 1VFMA 4ALAH 4RMUA 2WLLA 3L4UA 2VYRE 2L0DA 2XU9A 2FJGA 3MQIA 3T3PE 3TLRA 2I60H 4F93B 1XR9B 4LSTH 1W0YT 3FRMA 4U3SA 3PIQA 4XXWA 4XAKE 3PQYD 5A16A 2HFGH 2ZOLA 5A2LH 2JDCA 4R7VA 3D9AL 5F88B 3NFZA 4MHZA 3PLYA 2MHAB 1I7ZA 2DTSA 2V77A 4BZ1L 4KHTL 3ROOA 5JXAL 5CN3A 1DDTA 2MNJB 3CHPA 3N41F 6CGTA 3CHOA 3ISXA 3CH1B 3SJFA 2ADYA 2WYZA 5AKRA 4QMEA 2XDHA 4YHIA 5C3IA 1S7NA 2R15A 3ESVF 5CEXA 1W2KT 2BX5A 5IMLA 4P23D 3IU2A 1OF0A 2DH3A 4FD5A 5BWAB 4JX0A 1RHHA 4TVPL 3CFDA 2DDQL 4XB3A 4HJJL 3O4LE 1I8AA 4GY4A 4UFWA 4OD3H 3AREA 4IRZH 3ATDA 3DJ9A 3HE6B 4JG1L 4NYLA 5J6SA 3NPSC 2CK2A 1KLUB 1SDDA 2A3TA 3FONA 3D3VE 3SPHA 2AVFA 3OHXA 2OMWB 4YMPA 4MA7L 3VG0L 1GSMA 1AZVA 4WCYL 4GSDH 1C5CL 3HZVB 3B2UD 1YEHL 1PKQB 2VLKD 3MCLH 3MHZA 3PHAA 4ICXA 1BG1A 1RUAL 1T22A 4KQ4L 1Z8WA 4P5KA 2PE3A 4OAWB 5C3TA 1RUPH 1MJ8L 3U30C 2IQAB 3GLDA 4XBEL 2VR6A 4MNHA 4XMWA 5ITBH 1CZ8L 4ORGB 4PJ7E 4WU5A 4OZHF 2JTYA 5E4IA 5AALA 4L8BB 4BA0A 5I66A 1E2WA 5EF1A 1KPRB 3B7RL 4TUJA 1OP3H 3KASA 4G1EA 5DD5L 1CLZH 3OHXC 1T3FB 2R4SH 4XXDA 4P46B 2HVKB 1IC7H 2DTMH 2B0SL 1F1DA 4RESB 1HILA 2CF4A 5DHVA 3UCQA 3K2UL 2I7OA 3RWDA 4AMKL 2B4DB 3IMWA 4KY2A 3KYMB 4Y4HD 2G0LA 1CDUA 4LK4A 4NJAH 4XH2B 2AQPA 3CVIH 4ONWA 3EYQD 3VSVA 3KGQA 1MCPL 2YD1A 2AMUA 2R1YB 3B9KC 3CSTA 3N1PC 1DQDH 3BOVA 4J3OH 5C09A 3CHXA 3MRCB 1JNLL 5F1NA 4Z7WE 1YMHA 4GXUN 4ZUTA 5C0BE 1Q2DA 3S98A 2V4LA 4NP4L 1QFWI 4H20H 1XQ4A 1AJ7H 2FT0A 2IAMB 1F58L 2GBVA 3PWPB 2IV9A 4FL4C 1CM0A 2MMXA 2IJZA 5IB4B 2IANE 1A1MA 2XICA 3QPQC 2A73B 3F6LA 5CEZE 2QKSA 2G0KA 4DQAA 1M53A 3E3QC 5D1XA 2XHNA 3VI3A 4G70B 3K6IA 4H13C 3QBTB 1F4AA 4WW2B 1RXLA 3GHBL 3FUMA 2BSBA 1GGUA 2GYSA 4PJAE 3LXCA 1U91B 4XP6H 1VHOA 4ZMPA 5A27A 2G5RA 3Q1SL 4ZX4A 5AZEH 2R2HB 4H26A 2BMKA 1U92A 1IBBA 1IGYA 4PGZA 7CGTA 2FJUB 4XMZA 2DWTA 3K0YA 3MKKA 1QBLL 4HOMA 2E75C 3AY4A 4CAXA 3GIZL 4MA3A 4NKOA 1TTRA 3U2IA 3E38A 3QR2A 1FFPB 4EZJA 3EZJB 3ABZA 3VFSB 3RUGF 2NY6B 4XCNB 5CIPB 1JZ6A 1A7NH 4HCFA 1L9TA 1KUVA 1A6UH 1U8NB 2A74A 2FSDA 3LRHA 4GRLB 2ZSVA 2JJTC 3F12A 3PNRB 1D9KB 1QG3A 3M1BB 3HA0A 1AZNA 3ARGA 3IMBA 4UYPA 3CSFA 3UZVB 2IJ0C 3JV0A 5C08A 4QRRD 3UBXA 2Q04A 4KZDH 2ZUXA 3DVNA 4KVXA 2AFWA 4ZUSB 2WYRA 2YD5A 3V9FA 4Q2ZA 5EZIL 4J8RA 1SBBA 5DEJA 3TGXA 4DUWA 3VXSD 5E8PA 1TEGA 2E27L 4KK9C 1IC5H 1DJSA 5IQ9B 1O5DT 1JN6B 5KSUA 4XBGA 2IH3B 5AG5A 4ZW7A 2R9HD 4E68A 1T7YA 5JIKA 3VQ2C 4ZFGH 4RSVA 4OV6F 5E6SB 5K9QG 3BXNA 3JZYA 1S7TB 5AWNL 4UANA 4NUGH 5EORH 5T3XH 5B3JF 5I6KA 4UWJA 3DHUA 4HPYH 2WVVB 2AVGA 4HFUL 3QCTH 3QIWC 2BNRB 3B35A 4ZT1A 2VR7A 1NFDA 5F7EL 2PXYC 5KW9H 5T1KD 1WZ1L 4CVZA 3V4VB 2LVEA 5D6CB 3WTYA 5I1AA 2BOCA 1CXFA 1PYTB 1Q9KB 1H6UA 2NY0D 3J8F7 4ZW5A 1QQDB 2BVPA 4YHKH 4J4PA 2XLLA 4KLVA 1BF8A 1NICA 1M71B 1E90A 2C9SA 3RAJL 3BPNB 1DANU 1J88A 4NQVB 3WKYA 5IW1B 2CNTA 3EO4A 3PPEA 1QFOA 5D4IA 2DLIA 3TX4A 2P44B 1F2PA 4K5PA 4C59B 1X5AA 2VXQL 1Q1JL 1J05B 5JDSA 1UB6A 2OS7A 2EEXA 5FO7A 2AHIA 5AUMB 1ZLEA 3TEWA 1RXTA 4JAMA 2W95A 3QIUB 4Y4KB 2B7DT 2FLRT 2YMOA 1QRNA 5GGRY 2WZ5A 1EXUA 3WFHA 1TTFA 4JO2H 4QDGA 3HLPA 4NM4H 5D7IF 2OCCB 4L29A 3MNWB 4NBYB 3ARQA 1MF2H 1AXTH 1YN6A 3MI6A 3U1QA 2Y5QA 1JWUA 3RTQA 2ENQA 4AE1A 3WIAA 1Z3GL 5E70A 4OADA 1R0AH 4KDWA 4FFTA 3DBSA 1CBJA 1N7MH 1TPXB 2NNXA 4H89A 2ATPA 3L9EA 5BZDA 1IAKB 3D34A 3O8XB 5CCKH 1F18A 5F49A 3WFDH 2IQ9L 3LN5B 1AANA 3ZDZB 1NCJA 2DYPB 4YHYB 3AITA 3HZKB 2EXYD 4AIZB 4GI8A 5AVUB 3TURA 3CXQA 4F0YA 1VAHA 1IAOB 4EUPH 3QRGL 5I1HH 2EIZA 3O6KL 4X5LA 1P9MA 3BKYL 4R3LA 2HTKD 3NH5A 3LD8C 2WWKO 4IKNA 3X11A 2FJHB 4FEIA 3QUMH 2J5LC 3FBUA 5DRZA 5DVLA 5ERWA 2NQCA 3DECA 3GHEL 3APDA 3VFVA 4MJ4A 2QBWA 4PRHA 4QXTA 1JWSA 3GTNA 4N2EA 4PP2A 4S1DD 5T5FL 4ZUVB 3IDIB 2DY2A 4E9VA 2VLJE 1PNCA 3ELQA 4XVTL 2P5EA 4RQQB 2H9GB 2BWQA 3CWGA 2FJSA 1AMYA 2APFA 2CPCA 4M3HA 3D25A 4LBEA 4TSAL 4JGJA 3NDZE 1CT8A 5DC4B 2C3HA 1DQJA 3ZK0A 1PZ5B 2NR6D 1S9VB 4TS6A 5ENWA 1SJHA 2CO6B 1I8LA 3BAEH 3OJMB 2DIBA 4DEWA 4J7RA 1LILA 2F5IA 1P7HL 3NCFB 3TNMA 3GZPA 2CIKB 4KTYA 5F09A 4K8RH 4HCGA 4PW3A 2FO4B 5IMOA 1RMFH 3G6AB 2MTAA 4EN2A 6TAAA 1HXMB 3QQXA 1QNZH 3MLZL 4JWPA 3NFNA 4HW6A 3ZQ9A 1OP5H 2ZW5A 1AS8A 5GXBB 2C27A 4GG8B 4JLYA 4NDMB 4W9JC 2FWSA 2XETA 5BV7B 4NBZB 5ALCH 1EHLL 1CLCA 3NK3A 4G3YL 4P4FA 4AG4H 1I8LC 1DEEA 1G7HA 2NX5D 3BP5A 4A2ZA 4YWGL 4G6JL 4U05A 3S35L 1MG2C 4X6FA 3FB8B 4KSIA 1MLCA 3OKLB 1DQTA 1TLKA 1E4XH 5DD3L 5C07B 4JZJC 4DKEH 5F97E 2REFA 5JOEA 4PK3A 2HRLA 4MZ3A 1D6EB 1KNOB 1WRFA 2G4EA 3W6SA 4PRIA 1RKRA 5EPMB 4Q52A 3D0VB 3ZKSD 5I6NA 4KI1A 4JR9H 4TNGA 1JZJA 3F3HA 3QUYA 4MTMA 3RNKA 3PBBA 2AQNA 4X6BB 4A2GA 3LEXB 4AVBA 4OZGE 4RDBA 2OZUA 4GKLA 1CGSH 3TT3H 1KN4H 3MJ9A 2B4BA 3ZKNC 4KO9A 4BKLA 3BCDA 1MXDA 1S7RB 4LGSB 5E8OB 3U4AA 3CX5K 3LY6A 2NW2A 4LSSH 2QIRA 3W0WE 2WQSA 4XCYB 3BZ5A 1U36A 3IDXL 1E3FA 2O5NA 2TAAA 3CSBA 3HN5A 3FH4A 1SUHA 2B4CH 2D0HA 2FHCA 1P7BA 3O3DB 2HX8A 1KXHA 2AGJH 4OCSL 3WY3A 1NE9A 1TJHH 4I18C 1WWCA 4NHCL 5DWUL 5IQ7L 1V05A 1MJ7H 3KCWA 4WI0B 4H2AA 3GXMA 4IJ3B 1UWXH 4QF1B 5T1DH 1UD6A 1WCQA 2P6GA 2BO0A 1IY7A 5HJ3B 2ZOWA 1ED3B 5I6PA 4DEPC 1BVKA 4W4NA 2CM5A 4KSFA 3GBDA 4YFDB 3T4AA 1P2CB 2IPKA 3PY9A 5DI8A 2H1LM 3BZDA 1NCBL 1YEGL 3SQBA 4UFVA 3CC1A 1R9FA 2IDUA 3UJTL 1EE3P 3EIFA 1MRDH 1MHEA 4U0QB 3T0VA 4CC1A 1KZFA 4XZ4A 3BSZH 1DJGA 3PWNB 4XNYL 2DLTA 5DA0B 1ZANH 4PBDA 4PN6A 1N0XH 4AYMC 3GPSA 4FNRA 4A6YB 1NMAL 3LIUA 1W80A 1RJYB 3V0GA 1XD0A 2EC9T 1FNGB 2VDNH 4N2IA 4XT1C 3C60B 5E1HB 2DQIL 2KZ1B 5BVJA 2GEQA 1O7DC 3MPCA 1ORQB 1HX0A 2GI0A 1ZLVH 4V1DB 1LO0H 4NN7B 4BINA 4WK2B 4U4IA 3AXLA 4OLUH 4B41A 3TVMB 3IMVA 3L9RA 4XNMB 1E4KC 2WXKA 4I8DA 4G2AA 2ZCKH 3FQNA 4KVNH 4RRPM 4PJ8B 2BPBA 3D09A 3G7TA 4X9FA 4FA6A 1YC8A 2EDWA 3EJUA 3O4OB 3D4YA 2FL4A 1KCSL 1NDTA 3MOBL 4FCHA 1INQA 1FBIL 3QNYA 4HWZB 4TLSA 4DAGL 2B3UA 1OW0A 4OZ4A 2XVKA 2DQMA 4G6ML 4ZTPH 3C8KA 3B4NA 2DI9A 4PJBA 4I0PB 2NLJA 3RVVC 3GB0A 2FD6H 1S5HB 1B4RA 1YMMD 5CLZA 5EU3B 4F7PA 3N04A 4OIIL 4FYSA 2NY2B 3K4AA 2YLKA 2NZ1A 2CCWA 4UIBA 3BIBX 4QRPD 1RZ8B 4AL8H 1XEDA 5AVSB 1CE1H 4DH2A 1R3LA 5LXVA 2DN7A 3ARYA 5GS2D 3OSKA 1F56A 1U8OB 3MRLA 5I1JL 2OSWA 3ME0B 1AKJA 1UG9A 1N5AA 3P69A 5MI0C 3ZXAC 1IE5A 1I7TB 3BH4A 3PWJB 5HGGS 35C8L 2JH2A 1DUYB 3E6HB 3BXMA 4HUWA 4Z0XA 4PY7A 5KAQG 1BLLE 4OKVA 5A2JH 1RZ7H 5A2IH 5AZ2L 3H0TA 4YDKH 1P1VA 4X7DC 1FYTB 1VGEH 2J12B 1VDGA 4DP4X 5C70A 5G1ZA 4U3HA 4OF7A 3GRGA 5J6HA 2IH8A 1D6VL 5CZXD 3TF4A 2XFGB 5F1IA 3L4WA 3AADB 4Z18A 2OP4H 1TQTA 3DVGA 2WWNA 2X4SA 4DW2H 4LVHB 1K72A 5IV0A 1PYWB 2A83B 3IFOA 5FB8B 1QA9B 4IUSA 1S9WA 4BXSV 1TF9A 3VFRA 4ZK8A 2GIMA 3OPZH 3NBNA 3BUPA 4KOYA 5DJ6A 4GMSH 4LARH 2E4TA 3MLVL 1FNEB 1NSNL 2VLRB 3Q8AA 3HFMH 1GZHC 2O1AA 4K3JH 1U42A 2P7TA 4E9TA 3IDJA 5DYOA 1SHMA 1LD9B 5E5MB 3VWJD 3NIGB 4R97B 2CBTA 2Y3NA 1W72H 2CJSA 1QUNB 4YHML 2V3DA 4XVJH 4HD5A 4PIRF 2WSPA 2HA1A 2X40A 1CD8A 2Z92A 4K3DH 1EANA 3KZ8A 4L8AA 1XMWA 4E9RA 2AANA 3QR1A 4PJ9D 1P6FA 2AXHA 2K70A 1HNFA 1WAAA 4MXQD 4EAEA 4ELDA 3CVHA 4PJHF 5D7SL 4RN7A 3GMNA 4QRRA 4LQ6A 1U8JB 4MB3A 1BIHA 4ZJ9A 5I0XA 4UB0H 5IY5B 1MI5E 4XMVA 1MCNA 5HJDA 4PJIA 4NRYB 3EAKA 2JKNA 2JF1A 4MHPA 2H2PD 1M7DA 3RPKA 3KR5A 4EFDA 1ECZA 1DFBL 2Y2YA 2VZTA 1YHPA 2BFGA 3PAUA 2W5PA 4JDTH 5E2UH 2BVQA 3VXPB 4A66A 4ZO7A 4OF6A 1DBKL 3KHQA 4TNVK 1KIPA 4MD5B 1CIDA 3TT2A 2J8UB 4R2GD 3CNKA 3DRQB 3MGOB 4KDTC 5DLLA 2HYMA 4WTWA 2VW4A 3RRQA 2RA1A 2EO8A 4DGWC 1N64L 4NX0A 4FUUA 2YK1H 4KI5E 3US0A 4OLWL 5L88L 4UQAA 3QR0A 2CDEA 1EVTC 3RKPA 1M2VB 4XC1H 1IGIH 1T7VA 1P4LA 2X4PB 2PC1A 2JKWA 4O02A 3U4BH 3HKFA 4L3EE 4CRPA 1W8NA 1ORSB 4LCUA 4Y2NA 4UBRA 1KFAL 1CL7L 2BVOA 4P57B 3TBVB 3U2SA 2F5AH 3L3DB 5TK2A 1UXWA 3OXRB 3CMGA 3KPLA 1ET7A 5KZCD 1Q0EA 3PB8X 1XSJA 1VCAA 2BCMA 3EO0A 4LNRA 5DJ8A 3I50L 4FD7A 1H8SA 2IBGA 1RHFA 3C5JB 4U2YA 3F04A 2WP3T 4R7DB 2XG5B 4RWHA 2YNCA 3A6CH 1DCEA 2BCKA 2X4NB 3VFGH 3NCXA 2ATKB 3F0AA 4OC0A 3NIFE 2X4QB 4UIKL 4B0MB 1U33A 3NTCH 4XWGL 1C5BL 1U2CA 5HGBB 3DUSA 3F5WA 5EN2A 1RZKL 4LPTA 3UAFA 3BO8B 2YKLL 4CGPA 5D1ZD 1Z5LB 2Q6WA 5J9PB 2CKBB 3BWAB 3BE1L 3ARBD 3ILPA 3HUJE 1M4IA 2J8RA 1H3GA 5CKGA 1QKZL 3OJ2C 4LAQH 3EUUA 3SYAA 3VXMD 1OGAB 4MYPA 1DQML 1OE3A 5KYYB 5B8CC 2R23B 5C7XH 1YEKH 5IBUG 2A1WH 3WNOA 1LE5A 2WWOA 1J12A 2XPGB 4U1SA 2VRAA 4NO0B 2BSCA 4JREC 1A14H 2AJSL 4IU3A 4Y4FA 1HZLA 1UT9A 2WO2B 1M7UA 2JSFA 2QDWA 3IPFA 4YIQB 2O5ZL 1KUMA 2P46B 5ICXA 3KWTA 4KKZA 3KG5A 3RX7A 1RY7B 3PWUB 4OZFA 3F5BA 1KACB 4I2XB 3SDDB 3V0WH 1NGPL 1Q94A 2P5WA 3UPAA 4NZRL 1KV7A 1UVQA 3M8OL 2HKHH 1ZS2A 4U6TA 4ZO6A 3U9PH 3GIUA 4A55A 4HP5A 2QHRL 2ITCA 3FQTB 2BHYA 1IKFH 3F7YA 5D1ZI 1U6AL 3ZY7A 5HYSB 2YN5A 1D5XA 5E23A 4KFMA 1HYRC 4R8WL 1M1DA 2N4IA 2ANPA 3F7VB 5A2BA 2MCPH 1DP0A 2VAAB 1DCLA 1EFXB 3GSXB 1NCCL 4MA8H 5HDOA 1UWGH 3MCYA 5JW4M 4JM2C 1LK3L 1J1PL 4G6KH 3VMPA 2E7DA 3EYVA 3T0EA 3MV8A 2J4WL 2C3GA 1WWWX 2RR3A 3QISA 5C9JB 4XMTA 5J8CA 3ZYOA 5HBBA 2A6IA 3RNZA 4JS7A 4ELKA 1AO7E 1E6OL 4ETQB 2VQUA 5D7JC 5F9OL 4G43A 4KX9A 2P80D 4YSPA 5G21A 4FTVA 2BOBB 4NO5B 1TJIH 4IMLB 2Y24A 3KD4A 3MRIA 2W81C 4AK2A 4NQDE 1ELLP 5JQ6L 3NYKA 4N2FA 4KWUA 3BQUC 4II9A 3WFCH 3THMH 5BO1H 1E67A 1Z9PA 3V4UH 2PJ3A 1PU0A 3PV7A 3ZE2B 1OBRA 3HE7C 4M6GA 1T2XA 4P99A 3OGCA 3FB6A 4YFJA 3ZT6A 2WUCH 3GSUB 2OL3A 1OT4A 4OSUL 4P5MA 3ZQXA 4N5UA 4PJXA 3Q13A 3DXAB 2I32A 1NJ9A 4F0XA 4WI6A 3ESOA 5JLZA 1FNSH 1AVAA 2DKSA 4PYGA 2J6EA 3LWUA 3AABA 3MX0B 4M6NL 4XWOD 2KI6A 4GRMA 5DCCA 3TH2T 4YLCA 1PEZA 5JIQA 5DMKB 1KV3A 2R56L 3KHZA 1QEWA 3TX8A 1HESA 2VM3A 1M56B 1NLDL 2NYKA 4XVSL 3OBAA 2MNUA 1AS7A 3DETC 3QORB 5FA3A 3TZVC 4PS3A 4PG9A 3SPJA 5CJXC 3MLWL 4OB5H 3G9VA 4K2UL 2WTRA 3CMOH 3V0AC 1EFQA 4RGNE 3A6BL 3RZCB 3S9DB 3NRQA 4YXKL 3TO2B 4NQQA 4KO6A 3I6LE 3UABA 3ZR5A 5I1GH 5I6XB 4OI7A 2YAQA 5E51A 4PBVC 2WIMA 3EDEA 3MBEA 5E2VL 2WQXA 1OEZW 2UVFA 5EOQL 4J23A 4HNWB 4IRSD 5A3IC 4JM2F 1MFDH 3OKOA 2HVJB 5E8EA 4GRWH 4WFFD 3GSVA 4PJDE 1KG0A 4ZY0A 2WBWB 5CP3H 2D4DA 3JV4B 2DI7A 3ARSA 3C6LD 4KXBA 3VVWA 4LVOC 1VA9A 1NGYA 1ZTXH 1PZSA 2WLNA 3J7HA 4G7SB 4M6OL 4PJGB 5KYUB 3MJ7A 3UROR 4HH9A 4NM8H 4KNQA 2C9RA 4OV5A 1VEPA 3L5WB 1T7XA 2BIMA 5IG7A 1G7LA 1DBBL 3F8UB 1VFAA 1F3DJ 1Z9SB 2AAVA 1JZDC 4DVBB 1W6LA 5IFHH 4MAYB 4P2OA 3PCYA 4LMQI 4YSQA 1T1ZB 2KLSA 4K7PY 2QMKA 4AEIL 1XMTA 4Y0GA 2OMXB 3QUZC 4CW1A 3VD0A 1IGFL 2BP8A 1PY0A 1TKFA 4JANA 1NAMH 3KPTA 4LSQH 4K94L 5GJTH 2ED8A 4NUMA 4KJPD 5T3ZH 3P2HA 2YC1A 3AXHA 1BQHA 3STZA 3FYIB 1RJCA 2YA1A 4KKQA 4R4BA 3GSOA 1OP9A 5D9SB 3BVTA 3HJEA 2ZX7A 4PRAB 4M8VA 4ZX5A 3EG9A 5IKCA 1H6EA 2IFFH 5M94B 1CE6B 2VQYA 4M1CC 4HC1H 3QS3A 4XN9A 2CAKA 4QGYA 1J9CT 3WN5B 3HAEB 1LCPA 5IB5B 2VZYA 2E46A 1CR9L 3MRPA 4L5FE 4PVNA 2PJ8A 3MRJA 5A6MA 1EJFA 5I5IA 5DWNA 2UYLA 2X3AA 1OAZH 3ARDB 3T0XA 4G8FB 4UM8B 4JPWL 5EU4A 3CX5J 5K5YA 3NQIA 4RAUB 1Z5YD 1UT1A 4UBDD 5D6DA 4YEEA 4F7TB 2QGEA 4K5OA 1ON0A 1KXTB 1ET5A 4PHXA 1CICB 2WCPA 1AI1H 1U58A 1NKOA 2H5UA 3HC4L 3IGUA 3WIFA 3H1ZA 4N9GA 3D5OF 2HQYA 3CPUA 3GJFH 5FW7A 1IEBA 1PMYA 3MA7A 4AYSA 3KPRB 1I7UA 4C56E 2PABA 3L95B 1P7KB 4JQIH 5EUKA 3Q2NA 3WLBB 4FKKA 1QSFA 4QNPE 1R5IB 2IDQA 4FNTA 4RETB 3EJCA 5HYJD 4RMSA 2UXVA 2FWOB 2H8PB 2H6OA 1N6VA 4XNZC 4KK6D 2X4OA 5I23A 2ZG1A 4M8UA 3TA3C 5HP5A 2EADA 3L48A 3OAUH 2PYEE 3CLWA 5HJGA 3W38A 1TU2A 2Q20A 3DC0A 5LBSL 1GS8A 5JYMA 5BJTA 1FGNH 1HQ4B 2VQTA 2J2ZA 1KEMH 3KXFE 1BREA 3ZRSA 1HZKA 3MJ9L 5I18L 5SWSA 5F3BA 3V9CA 3D7GA 3UP6A 5I1KL 3WS6A 2FATL 3L3GA 4MMZB 3JUWA 1OSPH 3KL5A 1OANA 4QOKD 4QI3A 3MNVA 4IHOB 5AW4B 5SWZB 5TGBB 1SMAA 4XX5A 3EDFA 2EH7L 4ZMXA 1UOKA 1KZQA 4K71C 5FFLA 43CAA 3OX8B 2F9BT 5T5NF 1RIVH 2PCYA 1HWHB 3U36B 1GY2A 1I9EA 2BNQB 3RZAA 4KJQC 3BP7B 4XGZA 2WLIA 3P4NB 2D3VA 3S5LB 4Y5VA 2QQKH 1J9TA 2EVHA 2OXGB 3I02A 4KKNA 2MQ0A 1ZT1B 5BCAA 4F92B 1UTDA 1WWAX 2CUAA 1HCFX 3SI1A 3L16A 4EN3B 3LMJL 3L3HA 5TQ2L 1S8DA 5INCB 4MCYB 4ERSH 2FEEI 3QCUH 3FYEB 4S2SB 4F33B 1M9WA 5HDBE 2A77H 5I9QB 3FRUA 2AQ2A 3NSYA 4UT9H 5G5DB 3ROLB 2HRPH 4YR6A 4NNYA 5LNGA 3D39E 4CC4C 4Y5VC 4PJ9A 3P3TA 4GUPA 5LAPA 5F3HA 1LQBC 3MREA 3UAJC 3I9IA 3QEHA 4OTXH 1H5BB 3K5SA 5JA8B 5DC2A 4K3GA 3QEQA 3ARXA 5E96A 1EJ6A 4DESA 4MZIA 3PWVB 4F15B 2HTLC 3SCMB 2WZNA 4PREB 1MHPL 1H3PL 5IJVA 1R3IH 3PRZA 4HMEA 3ZKXB 4P2YA 1I8IA 1BFOA 4C55A 1NWPA 1F6FB 1A6AA 1QSEA 1A1NB 4WLCA 3JTTA 4HGMA 5CFHA 3HI6L 5D55A 1Y0RA 2VH5L 2YA2A 5IESL 2GTZB 2X9YA 2ZXCA 3BDYH 4A67A 4CN1A 2X0UA 4Z7NB 2WLYA 5H35A 2YNDA 4JO1L 4XNXH 5FDWA 4XCFL 1QFWL 3DSFL 5DD6A 2PO6C 1RZJL 4XAWH 4PJEA 2J1YA 4L9LA 3CQQA 5DS8B 1B87A 3V0DA 1E5UI 5FUZL 2PIYA 1DEDA 2ZPKL 4U6VL 1IGML 1WA2X 3MXVH 2H3NA 1KXQA 3B9KD 4HIEA 3MACH 1M7IA 5EC1A 2Y36L 4RFNB 3D18B 4HEPA 4MNQD 2Y06H 3TWCL 5D93C 5ISZA 4G80B 1V8HA 3NSJA 2Q8BH 4NUQA 4MI4A 4EIGB 3RGVB 3ARPA 4Z23A 4EIZC 4O23A 5IR1B 2JJWA 4IBLT 2F7QA 2V3FA 1O7SA 1FE8L 2ZAHA 4PPZA 3BZ4A 1K2DB 1EJOL 1SOKA 4GBXA 1RZGB 4Y1AE 2IPTH 3QWQB 1BBDH 5ICZA 4I7ZC 3TE4A 1KYAA 5DS1A 5FF6B 4WGWB 1DQQB 3V55A 3QPQD 1BMWA 3M46A 1UQSA 4L4JA 5HGHA 3RL2B 2ZOKA 2TSBA 4HULB 43C9B 5CR1A 4LKXA 2YWZA 1AZBA 2BO9A 1E9OB 1M4LA 1RULH 1BIIA 1XVSA 1K8IA 1C1EL 2Q86A 3BGFB 3SPVA 3UGXA 2VISA 5HDQH 3BH8B 4JZNA 1KJ2A 4F1SA 4RMQA 2WBXA 5CJ5A 1LTXA 4EDXA 1ZSDB 2XXMB 3DMMC 3UIZA 1TUPA 2ZELA 3IVKB 4X5KA 2X1QA 4N2HA 4MFHA 1ZLWK 5FKPB 3H2QA 2VR9A 3SDXE 4EO5A 4ZOEA 4QXGL 2ZW7A 5MEOA 3T65B 1JNNH 4FADA 2EYTB 4JRWA 4UEZA 4LHQB 4Y5XB 3UZEA 3V8OA 5B21A 2VO8A 1CPSA 5AG7A 3HLAA 5J13C 3MV9D 2DLHA 2PN5A 1G9NC 5CN2A 3HNTH 1AIFA 2YSSB 3BUTA 4PSRA 4BFRA 3PYCA 3US1A 4KNSA 2OFQA 2GIYA 3FCGA 1TOXA 4X6DF 3KWVA 1FH5H 3G04A 2PWDA 4KV5E 5JOPD 1CD1A 1QHQA 5I74B 1VESA 5D1QA 3SGEH 4KK9D 2EDKA 4I3SL 4M5ZL 4JFZH 1MJJA 3WC7A 2G5UA 1H9DA 3CVHL 5CIPH 3FTSA 5EV7A 2EDEA 3PQYE 2ZEGA 4LEXL 3AJ7A 5HHPB 1W0VA 4K7FB 2ESVD 1MCRA 1QR1A 4N2CA 2GTWA 5F48A 4PU2A 2QVPA 1T0NB 4CPAA 2YJLA 4LCWB 3DO7B 2F53B 3H9SA 2W59A 2C1OB 4W93A 5HI4C 2WINA 3QSKB 2H45A 2WKOA 4HX1B 4GQQA 1RUML 3QIWD 2NUTB 4LCCC 4U1JB 5D1QC 5DF0A 2DMCA 2LABA 4GXVH 3K4ZA 3LQAH 2PXYD 1EEZB 4LSUH 3VSUA 3S96B 1XCQA 2Y7OA 4NKDB 2JLLA 2A9AA 4TQEH 1KCBA 1YNKL 5GZNA 3B3IA 2J6WA 1SN5A 5FHBL 1IC1A 1G6RA 3G5YB 2UY7A 4CGOA 4D9QD 4IHMA 2JNZA 2ZEHA 2OTWB 4OJCA 2WBKA 5C0NC 3ZT5A 3MO1B 1E9PA 1WIOA 3NQKA 3O2DH 3QQ4A 4PV9A 4GS4A 1T7WA 4JW3A 1JMZA 2BXZA 3V8CA 2E9GA 1HWGB 2VE6A 2OK0H 3SYPA 4FQCL 4ZODA 4I4WB 2BFVL 1KGIA 2GSGA 4OC1A 4HAGA 5I2IB 5LWYL 3AFLA 4MX7A 1KIUB 2OB0A 5MENB 2X09A 2FBJL 4KUZH 3T8MA 2BY1A 3WDHA 4FQ2H 3LEVL 3Q3GA 5D72H 4AM0A 5IB2A 3QDMA 1EO8L 1TYJA 5HHOD 4QHMA 3KLAB 5KBPA 2F7IA 1FRGL 5JPMB 5TQ0L 3KPSE 3I9GL 4M48L 3NSXA 1PX8A 2WD0A 3S3PA 2VI7A 3QHZL 2CNSA 3HPLA 2H1PH 4HIPA 4MMYB 5DFVC 3I84A 5KS9B 3I9AA 3FCBA 4TSCH 4PWFA 2QQQA 4APXB 3DLJA 2CCVA 4PJCE 5TPWL 3SBQA 5CUSH 2VZZA 3QG6B 2YD2A 5LCVH 2OU2A 3VD1A 4XRCB 3CGTA 2VUYA 3BVXA 4XC3L 1MEXH 3M7OA 4JN1H 3CLEH 2UWEA 1URIA 4Z3IA 5DD1H 4PTTA 1MW1A 1NM9A 1I1FA 5KG9B 3TYFB 2VLLA 2EIBA 1YN7A 3EXLA 4P3CL 3V6OC 3A67L 1CBVL 4FJYA 1NSLA 1FL6B 2ZYRA 1YEEL 3MKGA 4W9GC 3MRNB 2H0JA 3LDBC 2DWSA 5EZLB 1FGVL 5CINL 4OZIF 5B3SB 1P5UC 5ANMB 2GHZA 3BP4A 4G8GE 4BH8B 2E7LA 1XF2B 4N2DA 1YPZF 4JM4H 5DVNA 1KTLA 4RS2A 5LRGA 4X2TA 3T3MB 3ML8A 3WS3B 4JXQA 3L9YA 3FULA 3UO8B 3WSQH 5CJ8A 4YDIH 5I1CL 5IB0A 5FYKU 1Y0LB 4HFWA 1D5IH 1VLXA 4OLXL 1N4XL 4ICWA 2CCLA 5DRXB 2ADFL 1TKWB 4XP1H 5FM5M 3L7EB 4DUXA 5KTAA 2O6EA 3G6JE 4BK4A 1B9ZA 1MVUA 2V5TA 4NPYB 3GUTB 5LN8A 2IH1B 1FN4A 4X98B 4NN5C 2ZNXA 4UQ3B 1FVCA 4HT1L 1XL4A 4KMTL 4XO9A 4P0DA 4DNCA 2UXTA 3CHSA 1C08B 1YYLH 3QZOA 4Z7VB 4H5SB 4LLVA 3KGUA 5E00B 25C8L 2VB5A 4HKXB 4XB8A 4UTAH 1GGBL 2CO2A 4RI1A 1TQUA 1JZFA 3BUBA 3IDUA 3WD5H 4NCDA 3HUVA 3MGAA 1KWKA 3OSVA 4JKWA 4NN6C 4X9HA 1MN4A 4HH8A 4IGBC 2IGFH 3WIIH 5CEYA 3VXSE 3LEYL 3LNGA 1J1OL 2CSPA 2WZ0A 2XI9A 3KBPA 2UY6A 5TE6L 3SOBL 3CHRA 1TCMA 4P4KB 5BV7H 2B59B 3MU3A 3FSAA 3V5DB 5BRZD 3BP6B 1FZKA 1OHQA 2GJ6D 3PHQB 1CF8L 1MFBH 3QFGA 1M1XB 2XVGA 4J3WA 2JIXD 3IJ8A 3ZKND 1H3VA 4WK4B 2FR4B 4RMVA 2GITA 1TTBA 1EGJH 4BKSC 3ATAA 2OCJA 4PSXA 1ZA3A 1LWHA 1SXBA 3IB4A 2BRRL 3DGGA 4HIHB 3O9WB 2PWEA 3U79A 4QHKI 2JEWA 2EUZA 3GSRB 3MRDB 3BEVB 3D2UB 1K3ZA 4PJ6A 4U1KA 5C0CD 5MEPB 4HHAA 2P43B 3P30L 4FHKA 2ZP9A 4QYAA 5KSBB 3IF1A 2CLVA 5FOJA 3UTTE 4RA0C 1DO5A 3FMGL 2W9LA 4JPIA 4LSVL 3WY1A 2C1CA 4CGNA 4XMKH 2ADJB 4JRYB 2IBZY 3TO4B 2NTFB 1JFHA 4QYOB 4XNBA 1YG9A 3RDTB 4BFKA 1D2OA 1ZSHA 5E6UB 2HB6A 1P7QA 3U7YH 1MUJB 5DJZA 3RAMA 4KVME 1NC2B 3MYJB 3NZ8A 1A9EA 2DD8H 4APQA 1DVFB 4ZXBC 3G08A 1XIWA 1Q0YH 3VG9B 3HOGA 1UH2A 2WSKA 5C3LD 1FNHA 1MY5A 3MFFA 3RHWK 3RU8L 2BIPA 4MA1C 4BYHA 1DQVA 4N2MA 1C8QA 2Q5BA 4FFYH 3OAZK 5I0ZA 1JHLL 3W39B 2X2HA 4OVUA 3RIFF 4HOXA 4UNVA 1G6VK 1NC4A 3OLGA 4QTIL 4WNJA 2XQBL 5J6GA 4JDEA 3OLDA 1RIHL 4N2LA 3LXBA 5EN3A 4IDJH 3CVDA 3V0EA 2VR4A 2PW1A 1R1CA 2W0FA 3F7QA 4EUPA 2WLLB 1ACXA 2DQFA 1L9RA 2XQYA 3BWZA 3O2WL 3OB0H 3TO9A 2WUUA 5DJ2A 2FJGB 4ELME 4FD6A 2JVUA 2N01B 5IROA 2B3RA 4U3SB 3PIQB 3QUMA 3FFCA 1BD2D 4P07A 3MLUH 2A4ZA 3ARFC 4X6CE 3ULUE 3RUGA 1YVOA 2X41A 3H9HA 1QSRA 4A6YH 4UIMB 4OM0H 3RVVD 3NFSL 4BE6A 4OIDA 1ZLIA 4F27A 4H44C 4DKDC 1MPAH 2VSMB 1I7ZB 3GMQA 4U9ZA 3JWDC 3I3BA 1WA0X 5AW7B 5ITFA 2HKAA 4NQUA 4CRZB 2ZCLH 2YGWA 3V0IA 1PY9A 2XVBA 4H6ZA 2XJKA 5DZPA 2YRPA 4L8SB 4M9OA 4XZUA 1PEWA 4YHIB 4DGIL 1LOKA 5CEXB 4U0RC 4PIBA 3X13B 3V38A 3ZDYF 3ZE2E 1SYVB 5K69A 3R9GA 3X3GL 2PPEA 2HN7A 1UASA 1P6AB 1A3LH 4MQXC 4UYQA 5AVYB 5TDOA 1E7UA 4L8CA 2B5GB 3RX8A 3ZHDA 3TP4A 4KX8A 5EF0A 3AREB 4N0YL 3EYUH 1INEL 1P84K 4PSPA 1XH0A 3HB3C 2Y0SA 2VL1A 5FYKH 4NYLB 8CPAA 5KTEH 2P8LA 4TV3A 4KRPB 3FONB 3LRLA 1DE4B 4GS7B 5CZVH 1FORH 1NDGB 1PZDA 4LLUA 3ZHLA 4DSYA 4WFGD 3KEHA 4WV1C 5EU6A 3E9TA 1OLZA 1WBXA 3L4TA 1PZBA 4K8RC 3T8XA 1LP9F 1CGYA 3IFNH 3VQLA 1UEMA 4P5KB 1JYWA 3JZ7A 5E7BA 4GKSB 2CMRH 1KJVB 4UINL 3RIAF 5HVGB 4EOWL 1YSOA 3UO1H 3D48R 4MNHB 1MFAH 3BPOC 3CUPA 2AF2A 3C5SA 3VFPB 1AFVL 2Z0UA 1MREH 4G1EB 4LPYA 5IWLC 2AFMA 4XXDB 3PGFH 4FQJL 3HZMA 4XBPA 2OW7A 2OAAA 3VFWB 2BEIA 1E5BA 3RWDB 4DPBX 2YZ1A 3T3PF 2Z64C 2EH8H 5KJRL 1D5MA 2F19L 4LP4A 3M86A 3M6DA 5KVGL 1BBJA 3FH8A 1EEYA 2GAZA 4QHLB 2CNMA 2IMMA 3SO5A 3RWJA 3WFBH 1QZNA 5ECGA 4JVPA 4LSPH 4FAAB 2MOVA 4UCFA 5F1NB 1L9NA 1YMHB 1MH5B 2PPDA 2R29H 5DS0A 1ZHNA 1IGTB 4WO4B 1UACL 2X0VA 3JWNH 1XF5A 1VZIA 3N1MC 3K1DA 2XXCB 1BGXH 2YQGA 1A1MB 2UZYA 3ET9F 3KW8A 1P4IH 4LVNB 1TKHA 2W9DH 3ZHFA 1YNLL 3TH3T 4HXBL 5DQ9A 5HVHA 4YBQC 3S6CA 4X9GA 2RQ8A 4GG6A 1CN4A 1KJ3H 2OYKA 2JQAA 5A43C 1F4WL 2RCSL 4FYQA 3HJ0A 3FQ4A 5CCHE 4JVUA 4L4VA 2DQGL 2YRLA 2OMYB 5GRJL 1IJNA 2C4XA 2ICWA 5AKSA 1VHPA 1YDPA 5IIEB 5I71B 2VXKA 4TWEA 2WCGA 1U8HA 3BCFA 3QHFL 4LLWA 3DV4A 2BMKB 1IC4L 1CG9A 1IGYB 1O75A 3LQMA 4F9LC 1KEGL 3ZSSA 4NZFA 2HV2A 2OZGA 4NKOB 1EX0A 4AC4A 3VSTA 3O6FC 3L5JA 5HVHC 1HKLL 1GIGH 2EQDA 3CDGB 5IBTH 2CRZA 3CZFB 1A8JH 2YGOA 2ZD0A 2Z8WC 2ICCA 4RVBA 4ZMOA 3PB7X 3Q2WA 4O4YL 4CJ1A 4WHCA 2ZSVB 3F12B 2QSVA 3QDGA 4Y8DC 4Z3EA 3ARGB 3K80A 3KL0A 3MRFB 5GSVB 3S37H 1Z4EA 2ITDA 3ESMA 3HEIB 5E08H 2AJZB 5C08B 3FCSA 1L7TH 3UBXB 4AQAA 4PJ7F 4Y19A 5FS5A 1VEOA 3QZLA 1MCSA 2BSDA 2MPAL 2YR3A 4DZ8A 5GGVY 1HOCA 1M1SA 1DVXA 2DWDA 3I6GA 2NMSA 1U3HA 3MLRL 4YE4L 1A5FL 4QAMB 2WXFA 5CKAA 4KROC 3V6FA 5K1NA 4N8CH 5H86A 5KSUB 4IEFB 4XBGB 4NO3B 3IETB 1LMKA 1CD0A 1OZPA 1I8MB 5C0AD 3RI5F 3RY4A 4WFEE 3B7TA 3HG1D 4HOWA 2R0LL 3TM6A 2DBJA 3BXNB 1YMME 3MJ6A 3W3BA 2XWBA 1NIBA 3RWGA 5E6IB 5IQLA 4MAUL 3LQZB 4Z7WF 2PTUA 5DFTA 3GMPA 1U3HC 1ZJBA 3T08A 4AM0Q 4CJ0A 1NFDB 3TV3L 4QRPE 1N71A 4CVZB 4XE5B 3FW6A 5D2NC 3ZTNL 4AL8C 3WJJC 1WYJA 1U4FA 5CM1A 1OCCB 4TNWK 4BQ9A 3VXTB 1QLEL 4QTHA 3UOAB 2B9BA 1RZFH 3DYOA 1JXGA 1LDPH 2GEEA 4LKCA 1M05B 1RSYA 5E8NA 1TVDA 1Y9WA 2TRYA 4LSTL 4OF0A 4PJAF 3SGKC 4Q9QH 4JG0L 3GT6A 2XG4B 2HFGL 4E41D 1E27B 2AQQA 1KCVL 3B34A 2GBAA 4JFFB 5IMKA 2IDCA 2CO7A 5FO7B 1XBDA 2VABA 2EUIA 4JAMB 1ETB1 2C4FT 1RH8A 2WN3A 2YFOA 1GXEA 3F2LA 4JM2D 2GLJA 3FUFA 3NSFA 5FO8B 5T8IA 2Y1AA 3IXTB 4HPSA 4D0DA 2HPOA 3VXRB 4L29B 5AOJA 1W72A 3LZPA 4OVVA 2AABH 1E43A 2NSXA 5E1IA 1S3RA 3GEFA 1JWUB 2FSEA 3RTQB 5JPNA 1NGXB 3H7BB 3U7WH 4BIKA 5D7JD 3JXAA 4M8QA 5AAWC 1MLBA 2K9FB 4OFQA 5HYEA 4XE0A 1S7QA 5K8NA 1U41A 4GQPH 4DN3H 1A02N 3BQUD 4RNRA 1ND0B 2OQJA 4PSWA 1CK0H 2F15A 1OARL 2YMXH 3B83A 4YUEL 2VDRL 4PRPB 5DZAA 1R46A 3QPXH 4A68A 2W94A 3HE7D 3H9ZA 4J3VA 1HH9B 4M6HA 3LPFA 4CU8A 4YU9A 3INOA 3VX1A 5IQOA 1IKOP 1G6RL 3UTSD 4ZPTA 1RIUH 2UX7A 5E9DA 5IX3A 1X9UA 1YCSA 2X1XR 5CHNA 5CJOH 1PZ2A 1CDJA 3ZQWA 2ZOUA 1P4BH 5ERWB 4M7JH 2JEVA 4M3SA 5D2LA 3B7YA 4JFEB 1QSOA 3VFVB 3ZZIA 1ADQH 4PP2B 4NQED 1SBSH 2DPSA 1RU9L 3EJJX 3V10A 3BIKA 2P5EB 2TSAA 3FUNA 1F11B 3A5VA 4YSAA 3N55A 5DEGA 1FVEA 1LEIB 3S36H 4Q8BA 5D5MA 3GBML 3DETD 3TZVD 4F7EA 4J3UA 4YJZL 5DVPA 4I89A 4Y5YB 2DWYA 5ENWB 2H6PB 3NFPA 1TSRA 4E9LA 4KRMB 4WGVB 5IW6B 2ZUVA 3QDJA 3T6XA 1OE2A 4Z3JA 4WHTA 3TNMB 4X5PA 4LL1A 1B4LA 1U8MB 2J3SA 2EDNA 3CVIL 3LN9A 2P24B 2ZWZA 3HBZA 3R1GH 4UQ2B 5IMOB 4N0FA 1ZJAA 4I77H 4F3FA 5F96L 4HSCX 4JRXA 4KGJA 5FXCH 3RY6A 3UTPE 5ELYA 2J56A 3NFNB 5A3ID 1DQDL 1DLHA 2QQLL 2C9AA 1YY9C 1OAQH 1UJ3B 2ZKHL 1QPKA 4JJHA 4D9LH 5FYLE 3LPPA 4M62H 1DEEB 5FV2A 5IB9A 4DVRL 5D7LA 4X6FB 3PBEA 2JLMA 3DSNA 3Q8EA 3QWRA 1KCUH 1F41A 3DPBA 1HOEA 5EHFA 4EPSA 3U9WA 5AVZB 3DX9A 1ZLUK 3VGEA 1XFOA 5D70H 4PVMA 5L7XL 3RWHB 4R0LA 1H8LA 1KTDA 3GZKA 4CGLA 4XHJC 1UZ6F 3QUYB 5GS1A 9PCYA 3QUZD 3RNKB 4CVXB 3GKWH 4XP6L 4MJ6A 2DXQA 1BHGA 12E8H 3CZKA 2OZ4H 3VRJA 2XZAL 3BLNA 1Z0MA 1SFDA 4XNHB 3BISA 4OCWH 3SDAC 3NT0A 4UDTA 4BKLB 3SO3C 5TQ2H 2AERT 3VXME 1WFJA 5ETUA 4M1CD 2JCCE 3BVNA 4EE2A 3PAZA 1XZ0A 4HUXA 2JB6A 4NQXA 5FC9A 4DUVA 2HG5A 3DVIA 4TUOB 1FG2A 3SBWA 3R8QA 3ULVE 3AG4B 1MCKA 4DT2A 3RWIA 1J8HA 1R6VA 3WR7A 1UJTA 4PGCA 3L5XL 4UMSA 4P04A 4ZUWA 2YPLE 4DJMA 4M43L 1G0DA 4L0YA 5AB9A 4KSAA 1JPFA 1BVKB 2APSA 1MDAA 1A2ZA 2NNAB 3D9AH 4JFDA 4PJHA 3T4AB 4MVBC 5JORB 2IPKB 3KBFA 1IAIM 5DI8B 4LIQE 4Q6IC 3HAEH 1JZHA 4MCMA 4DETA 4BZ1H 3IFPA 3R4RA 4KHTH 2NY4C 5JXAH 1F6LL 2YEZA 5FEBA 2EIKB 4JJ5B 1S7WB 1ZAGA 4P23B 4ONFL 2NSMA 2EC9U 4NUGL 1T1WA 2Z8SA 4CL7A 1EZLA 4HPYL 4OJAA 2XIBA 3ZUCA 5HHNA 4U7MA 4Y9EA 3SGEI 3TA3D 5BVJB 3OC5A 3VGHA 4WWKA 5KW9L 4XR8C 4ZUUA 3L3OC 4LCIH 4TVPH 4XCEA 5D7HA 3QFDA 2DDQH 1Q4NX 4HJJH 2WM0A 2IVFC 1WG3A 4NPJA 4R7LA 3BLKA 1JTTA 1O6TA 3TH4T 1IM9A 3V5HB 4RDQF 4YHKL 5LBVA 5AG4A 3QFJD 5GGUA 3HCVB 2VLKB 4O58L 1BQLL 2Y22A 5E0QA 1B4TA 2XN9A 5GS3A 4F8OA 1INQB 4EQ3A 5EUOE 4Q9CA 2FEEL 2ZQKA 3QXWA 3D2PA 4WEEA 2P28B 4KJQD 4MA7H 1BJ1H 3VG0H 4X4XB 1AHWC 4WCYH 1C5CH 2PWGA 2NLJB 1YEHH 4PJBB 4YGAB 5ALBL 2IMOA 5GCNA 1RUAH 2CU9A 4KQ4H 3X1EA 3ASWA 2ZKXA 2QKIA 4OF3A 4OZGF 4F7PB 2FZ3A 3R7QA 2OTUB 3NESA 5IVXE 5DGQA 4XBEH 4J27A 3T2NL 4ODUA 1CZ8H 1R3LB 2UXGA 1TJMA 4LNVA 1KWGA 3PF2A 4FYTA 3B9DA 2ZEDA 2Y69B 3MRLB 5DD5H 5DJAA 3SJXA 2JDDA 4R9HA 1GTNA 1AKJB 2WBJA 1N5AB 3BVVA 4HJGA 3W81A 4WKZA 4Q9RL 1K8DB 1AGEA 5JGFA 3EJYC 3K2UH 3GYAA 2QKIC 3UAJD 4OKVB 5BS0A 4PBXA 4U6YA 5ID0A 2BVUA 1HCZA 3CAFA 1GRWA 1MCPH 4XPFL 3O11B 4EKJA 1IB5A 5J6HB 2KC0A 5CP3A 1XF4B 1OKEA 2HTLD 4M93C 2I9TA 4KBPA 4NS0A 2V7HA 1P84J 1JNLH 1CFNA 1NCWH 3CTTA 2EIMB 2NDFA 2X4SB 4NP4H 3H3KA 4Y8AA 5EBMA 2FX7L 1F58H 5CO1A 3IFOB 2BVYA 3WHE0 5DK0A 4NGTA 4LLDA 2AK4E 4NRXA 1YGHA 1A6TA 4WFFE 3VFRB 3QDAA 4RZCA 4AT6B 5DJ6B 2F74A 1XL6A 4U1MA 4XMPL 3RPIB 2PO6D 4TMPA 1THCA 3SY0B 5HSFA 2P7TB 5DYOB 1NAMA 1NGZA 4H8WH 4LCYA 4F7KA 1ETJA 3CXHK 1PKOA 4CBZA 3GINA 2EICA 2VR3A 1GYVA 3BAEL 4NQCE 5FFGA 4AYDC 4MFLA 3LKOA 3VRIB 3EOBB 3UXFA 1ZIBA 2AJYL 2Z92B 3UMNA 4ADJA 3WXVL 1QBLH 4FG0A 3EC4A 3GIZH 4KQ3L 4RFOL 1ZGLA 2D3JA 1EZVY 1GCYA 1N8OE 4N0CC 3N1QC 4OFIA 1SN2A 4Q7DA 3TN0A 1ERNA 3CVHB 4I0KA 1MCHA 4LPWA 3GMNB 4QRRB 1ZE3C 4D3CL 5FYJD 2DV6A 4FXKA 2YGVA 4AYBA 5IOPA 4MQ7B 2GFBA 5ALCL 1QPPA 4XPAL 3BEWA 4OLLA 4L1BA 4Z76B 2FB4L 3U82B 2G75B 2BVQB 3WE1A 3GJFA 4OMEA 5EZIH 1ACYL 5DZOA 5ES4B 1IYKA 2R2BA 2I07B 2WP3O 1U8CA 2E27H 5E5UB 1KIPB 4MB1A 1FHNA 3DMMD 4N2GA 4A7QA 4QT5B 3K5RA 3T2QA 3QJFB 5L8JB 2OR7A 4ZMLA 2F5BL 1UFGA 2KHAA 5KVFE 4U33A 1U4EA 4N22A 3H42L 4M3KB 2L04A 3UJJL 3NAAH 1CS6A 3KKWA 5IF0A 3WDIA 1H8OA 5T1KB 5AWNH 3U0TA 2EEBA 4FE9A 4HLZH 3BGMA 4WI8A 5HY9A 2CDEB 1G9MH 3QRLA 1JF1A 4HFUH 3TT3L 3WNNA 2IEPA 3HRZB 2WAHA 1RUQL 4N26A 1EUUA 4LCUB 3GYRA 1WZ1H 2BVOB 3KNBA 1A2YA 3NEXA 1BAVA 5DZNA 5JW5B 4H6UA 3OZ9L 3AQXA 2KZBA 2EVIA 1UXWB 3BHBA 3IAQA 4A33A 3KPLB 5GGSY 3NGBB 4WFHD 5FCUL 1MHCA 4LNRB 3EO0B 5DJ8B 3O0RH 4FXGA 4RMBA 2B4CL 1WJ3A 3RAJH 4RMRA 1BQKA 1XR9A 4BFFA 2FECI 6PAZA 5T1DL 3R9EA 1BLIA 1K4JA 2A9MH 3BUYB 2VXQH 1Q1JH 3DUSB 3F5WB 4PRDA 5EN2B 3S97C 4KZTA 2FIAA 1T5KA 2RGSA 5HI4D 3INUH 2HG0A 3TIDB 1BECA 4PH8A 2WOYA 5F88A 5IT2L 2Q6WB 3FTGB 2VBQA 2A9CA 2MHAA 1PIGA 1E5ZA 2ZUWA 5GIRB 3C09C 4G59C 4WRLA 1MRDL 4Z7IA 4OU3A 4M02A 2MSPA 2C6GA 3KBEA 2LLGA 1EHAA 2YBRA 3PREA 4LPCA 3CH1A 3SE3A 4YSCA 4TL4A 5HGDB 5L2KD 1Z3GH 4AKOA 4Y4FB 2X89A 4ZSOB 3TBYA 5C0ND 1CURA 5ICXB 1GYWA 2YGPA 4KUCF 4NOFA 1YYMH 3BQVA 4OZFB 5CZRA 2QMLA 2IQ9H 3BWSA 3BI0A 2WO4A 5CLTA 1Q94B 4EMZA 1NIFA 4YOKA 2V33A 5B3NA 4BSWA 4G9DB 5BOPA 2ITCB 3LJ3A 3FRPB 3QRGH 4JDZB 3VXUA 2HWZL 4MLSA 2DJ4A 1EVUA 3BKYH 2D2OA 4JY4A 1DQKA 5ESAB 5F46A 2ITEA 4JCMA 1PKQA 4ONOA 4KI5F 3D0LB 1V5JA 3DNKA 3E0GA 4P4BA 1BZ8A 1WEJL 4HJSA 2F8IA 2JCWA 5T5FH 3LS4L 1Z5HA 4OAWA 3FAXA 2JJSA 2Z3FA 4ABUA 4GSQA 2G3XA 4XVTH 1MFCL 3HE6C 3KVQA 3GLZA 4PJFE 4HA1A 2A6IB 4ORGA 1GHEA 5LGJB 3D51A 4TSAH 5DFVD 3NJNA 2AJ3A 1YJDC 4A7GF 3H8GA 4FTVB 5DTFB 1AOHA 4EVNA 1RSFA 1KTBA 3EZ8A 2PWHA 3H8EA 4HEME 4ANWA 4BUGA 1TXKA 3ZRCC 4MGXA 1JVOA 1RZ7L 4KAQL 4MNQE 2AFOA 1EJ8A 4IIQB 3NIFF 4XH2A 4HWBL 1VGEL 5FWRA 1SEBA 2HUZA 2Q10A 2NX5B 3FB6B 1P53A 3MLZH 3PP3H 4U3CA 4ZFFB 1S6NA 5FVJA 2DQ6A 3FEDA 4M5YL 2KQMA 3IJYA 4F2MB 1EHLH 1NJ9B 4P46C 2FT6A 4G3YH 2D7OA 5JLZB 3HUJF 2YAPA 3AROA 2IAMA 1NMCC 4YWGH 1X9LA 3DX6B 3EFOA 3E3QE 3PWPA 4G6JH 4HQQH 4HS3B 1MQ8A 4KFZC 4N24A 3S35H 4C7HA 3RE0A 4GRMB 4QRTB 5C09E 5DD3H 4QVTA 3VFMB 1M9SA 3D6GA 1QEWB 3D4ZA 5IK3B 1BQHG 2BVTA 4N0UA 1ET8A 1FFNB 4PG9B 1SY6H 3HBQA 2WTRB 1U91A 4ZBJA 4JL1A 2DKMA 1LO2L 1B90A 2ZIDA 2BIHA 2R2HA 5D1XE 3RPBA 2P47B 3T6VA 3VI3E 4RGNC 4K3DL 5AW8B 4HDIA 2X12A 1FFPA 2OMBA 3OKOB 3QIBC 4YL4A 1SPDA 5CIPA 2XBZA 3S5YA 1HEZA 1OTUC 3G5ZB 3GSVB 1KG0B 4WW2C 2Q3AA 3IDXH 2QGDA 3DTDA 4GRLA 3REVA 2PJCA 1D9KA 4FHBD 1NGYB 3LX9A 4IGBD 4IM8A 4JLRB 3W9DB 3UZVA 5JHDD 1SHSA 5DWUH 5IQ7H 1CJYA 4OV5B 3BPLB 5E2UL 4ZUSA 1G7LB 1RK0A 1S3KL 3EGSB 1VFAB 1XD1A 2VLMD 4R87A 1WDAA 4P2OB 2ESVE 1IILE 3EH4B 4O2CB 1G5AA 2BZ7A 1DN0A 4CW1B 1NCBH 1YEGH 3OGOE 2GG1A 3QZMA 1XBUA 2X2YA 3NG5A 5CU5A 4BCXA 3UJTH 2GABA 4ZOCA 1UKQA 2EDFA 5T3XD 4Y2OB 3DWTA 2YC1B 1QASA 2MIZA 5AYTA 5K59E 1S7TA 4WUUD 4MJID 3STZB 1W0WB 2CBOA 1C7SA 3LKQA 1NMAH 4JRLA 1GGTA 5F7YC 3BT2L 5DZ9A 4XPKA 3G6DL 2BNRA 2DQIH 4FG2A 4OF5A 3U4BL 3IGKA 1X4XA 3MLXH 1FC2D 1MK4A 1P4UA 3GJEA 4K7PX 4G6AC 4LCVA 2F5AL 2XZCL 3MRPB 5I6MA 1WA1X 2D4OA 2UYLB 2YQ3A 5B22A 5TH2B 3FHEA 2H2SC 1JVLA 1Q9KA 1T89A 3F83A 4JCLA 3FUHA 1PZCA 4DGUA 1KB9J 2WB7A 2XTJB 2G9DA 4NQVA 5I8OL 4FI6A 4ZXBD 2NTSP 1FBIH 1OV8A 4JN2B 4N2AA 5TK4A 4XP4L 4DAGH 3RFZA 3DSBA 3WIFB 3VVVA 4WI3A 3S0PA 4R76A 5LGHL 3NJJA 4G6MH 4E0RA 1UATA 1IM3D 2VUKA 1IEBB 3MA7B 1IX2A 1I7UB 2PJ5A 1E8WA 2AFNA 5AOIA 5EUKB 4OFKA 3L8QA 4Y4KA 4BELD 4OIIH 3GUXA 5HHOE 4IOSD 4CN6A 1TTCA 4DP2X 3CD4A 3BPNC 5E4AA 1PAMA 5AW9B 1I1RA 4PJDF 4NWTL 1NLBL 1YEKL 5JO5A 1ICTA 1RURL 1KGXA 1TTGA 5CJQL 5L4IA 5LCVA 5I1JH 5CLYA 5BJTB 5DWPA 4AVIA 1QRNE 4OCRL 4A7UA 5SWSB 2Z4QA 5F3BB 3ARFD 5BW7C 4ZZKA 1IAKA 1JZEA 3O8XA 4QPEA 3QIUC 3L3GB 4Y4KC 1E6JL 5JZ7C 2REEA 4XAKD 5FGCE 1HYSC 1UOLA 3MNVB 4B5PB 3KS0H 2DYPA 3E1ZA 1T83A 1TETL 4AIZA 1A7BA 1D6VH 1BOGA 1X7SA 1IAOA 1SVBA 1V3JA 4G5AA 1I7RA 3D85D 3RP1A 4HS6A 5JXEC 2F54A 3A6OA 2LU5A 4XGZB 1Q9LB 1XX9C 3FKUS 4X6DA 1FLTX 3QXTA 1WQVT 2CZNA 1TPXC 3ZMRA 4P10A 3RWFA 1AZZC 2AZUA 3O8XC 4MA8L 4HEPG 2BSRB 1TQBB 5BNXD 3MLVH 1OP3K 1NSNH 3L3HB 3IDIA 4GP5B 4MQXD 1J10A 1WT5C 2QTVA 2H7WA 1C16A 3Q2VA 4YHYC 3R1KA 5GHWH 1YQEA 5GS0L 4F8TA 1VRSA 2RMNA 4A95A 4TOYL 2VN3A 3S3DB 3HB3D 4NNYB 4DN4L 4E5XA 1Z8TA 1T1XB 3WT4A 4PRHE 4R4NC 1TIQA 1IU8A 4PJ9B 1YZZA 4XN7A 1S9VA 4YHMH 3VI4E 4YDVB 2CO6A 2N7SA 2R59A 4KTDL 3QEQB 2J20A 3QXDB 5KSAA 3G3SA 3COOA 3D3VD 3IE4A 3LZFL 2CIKA 4MXWH 3SKOB 4MJHA 2FO4A 4OIAA 4G71B 1HXMA 2GB2A 1QRKA 4F7MA 1BYOA 1X5IA 1OCOB 5IJVB 2W92A 1I8IB 2Q4VA 4QNPF 4BA8A 2BS8A 4GG8A 4NDMA 3DGVA 4M1GL 1HT6A 1Q0XL 2DEAA 2VOTA 1DFBH 4HS8L 5H35B 4P2RA 1CDYA 2ODFA 3ML9A 1J1XL 4R2GB 3L81A 4G8EB 2YD8A 3FB8A 1L0CA 3Q9QA 4JFPA 5KVEL 5C07A 1MCEA 1AC6A 1VERA 4GW4A 4L9LB 1DBKH 3D3SA 2BW5A 2ZWYA 2XRAL 3F58L 4OGXL 1CQYA 1QP1A 3SE8L 1CVSC 3D0VA 1IOIA 1M7IB 1UFUA 4WEBL 5EC1B 1EXHA 5AQ0A 4QUSA 2PTTB 3N40P 2YFNA 1N64H 3SE4C 5I1GL 3SKMB 4PV8B 4U6XA 2CDFA 1XZWA 5L88H 4FNLH 1WIUA 3CXHJ 4PRIE 1OL0A 5ICZB 1F42A 5IBLC 2APVA 4WNQB 5EBVA 4MRIA 2KLTA 3FZUC 5E8OA 3ZGIA 1KFAH 1CL7H 4G42A 5HGHB 4KH9A 3WIHH 2VKXA 4ZW6A 2JELH 5E1AB 4YBQD 1IRAY 4L3CA 4XCYA 2IAND 3L1OH 1BIIB 1IARB 3EH1A 1IBDA 2VMDA 2Q86B 3JWOL 2NZ9C 3L5IA 1TCRA 1ZTXL 3K6FA 3O3DA 5I8CB 3A23A 3TU6A 4ACPA 2LFGA 2MCAA 1CYXA 5HDBF 5D1ZB 4WDIB 3IDYB 4UIKH 3NSDA 4FFYA 4WI0A 4EDXB 2AW2A 4KOCA 4QF1A 1C5BH 2A9DA 4P4RA 3ARBB 3GTTA 1ED3A 4PJ5A 1RZKH 2O6DA 1P2CA 2X88A 3O6FD 2YKLH 3LB6C 3O3UN 1U8IA 3U46B 7TAAA 1QLEB 2CXKA 4F24A 2FHBA 3BE1H 5JW3H 4OZIA 3L54A 4JY6A 1QKZH 1JHKL 1DQMH 1O7DE 3REWA 1YPZA 3AQYA 2GIVA 3EKCA 3B8GA 1LO4H 3WJLC 5J4MA 3ECBA 1FNGA 2OA9A 3JV6B 4OJDH 1CD1B 3DBXB 8CGTA 2ZWNA 4YXHL 1W9XA 1SYSB 4ZOBA 5JNYB 4OBRA 3CZGA 3Q05A 1XB8A 5BZWA 1JGLL 2D7NA 5HVHB 3F7LA 1NGPH 4KROD 4JHAL 3M8OH 2P42B 4PJ8A 4RIRB 1DJYA 1W0VB 3GMRA 3PJNA 4I3GA 4MMXB 5SX5H 2QHRH 4HMDA 3U6RB 1QR1B 2NQDA 1CIUA 3AQDA 1U6AH 3CFBB 3GBEA 4JGMA 4R8WH 4HWZA 4CMHB 3X2QB 5HYQB 3C60C 5EF3A 4J3OG 2GTQA 3SDYH 1TO5A 4MHDA 3OZLA 4NN7C 3HS0A 1B6BA 2I79A 3W37A 4I0PA 3SPGA 5AW6B 5F7WC 1DVZA 1S5HA 3TVMC 1NCCH 2YGQA 2C9VA 4MDRA 4W9YA 4AQ8C 2VDRB 1LK3H 4HKFA 2CA3A 2Z3OA 1XF3A 4LEOB 2J4WH 2G0BA 3B3IB 4JHBA 3LH8A 1FV1B 1RZ8A 3O4OC 4YX2L 3DDDA 4UT6L 4PCTA 1G6RB 5I6OA 1TYRA 1E6OH 2UY7B 2HJFA 1PD6A 4O9HL 4NGRA 3OAUL 3TFKC 1U8OA 5CPAA 3ME0A 1I7TA 1NUNB 4LRIA 1E9PB 1KEML 2UZXA 3NCWA 4PV9B 5JQ6H 1SJEB 3C5ZA 3MNMA 4LHUD 4AEEA 3SGJC 1GAFL 5AD0A 4JO3L 1Z2LA 4R96A 1S7XA 5SV4A 4AJYV 1OSPL 1FYTA 2P8PA 4WFGE 4RGOL 4BK8A 2E8ZA 3VGBA 3OKKA 4MX7B 4OSUH 3SDXF 3U4KA 3SJVD 3BVUA 1I8KB 3O0LA 2IC2A 3ECVA 4AM0B 1LQSR 5IB2B 4IBUA 2V2XA 4QHMB 2YPVL 4GINA 4KKAC 1NM4A 4ZZFA 4NB7A 4D8PA 3MNDA 1H8NA 4PQXA 4AGPA 5IW3A 5SX4I 3U48A 4EZMA 3BKML 2EILB 4H1LA 4MCZA 5FGRA 3HPLB 2R56H 1FNEA 3K6NA 4OLEA 1N2RA 1JK9B 2E8YA 4KV5F 1I1AA 1NLDH 4XVSH 2ZW4A 1UGNA 3QG7L 3QCUL 1JHTB 2O61B 2A77L 1LD9A 3BJ91 5F1SA 3MLWH 5CP7B 1CLYL 4K2UH 4AQEA 5LXGL 1EDYA 2FNBA 3A6BH 4QRSA 4U5YA 4W4OA 3L1EA 4IRSB 4HUKB 3VM7A 1W8EA 1QUNA 2ERJB 4L3AA 1A0QL 1T4KA 2ZXDA 4XOCA 3F7KA 3ZE0B 2Q0ZX 4WWPA 1T6WA 3ATEA 1OP5K 5E2VH 1P0SE 5EOQH 3HHRB 4A2EA 4ZW3A 1YN7B 2XN1A 3T90A 2WNWA 1U8JA 1R3IL 1G7MA 2H3KA 3CC5B 4R97C 3TBBA 1SDAB 1PLGL 3JWNC 3CFKB 3UTQA 3OZKA 3S6GA 3HZ3A 4M6OH 3FEEA 1V54B 1EXGA 1AC0A 1WAAE 4UQ9A 2ENSA 1DYZA 1KTLB 1WAPA 3CXFA 4GO8A 3B7SA 3VXPA 4P44A 1KBPA 1V7NL 4PTUA 4PJIE 3N41B 3EADA 1DUZA 4Q4EA 1F57A 3T6QC 2PPAA 4HFWB 4KKBC 3VWKC 3S2AA 3LZLA 4RZKA 4X80L 3MGOA 2C9QA 4NGQA 2BP5M 5KANG 2CXAA 1JV2B 4K94H 3VFOB 5FA4A 1YY9D 2Q8BL 3HMWL 1ZOXA 5DURB 1NEZA 3W91A 4EI5C 4R8FA 3B2YA 4HXAL 5MP6L 1OOAA 1YR0A 4LLQB 4XOBA 2LLLA 1TKJA 3NVQA 1KELL 1FVCB 2OTPA 2X4PA 4C58B 1USQA 4YN3A 2KERA 2R1WA 4LLVB 4E2AA 1JOIA 4P57A 3KL9A 1CR9H 3L3DA 3EJQA 4JPWH 3GHPA 5IFJB 1UWXK 1ZK5A 2ALWA 3QE5A 4U1GB 4XHJD 3AS0A 2UY6B 2XPYA 5FKAB 1J8KA 4R7DA 1EH9A 2LTQB 1N5YL 3CXPA 1DBAH 1LP9A 2X4NA 3QYNA 4N3TA 1BF5A 4FX5A 2X4QA 2EEFA 4EUPG 3HG1E 3DX1A 3MRHB 1Q2YA 4PJCF 1ZVSB 3SDAD 2GQHA 3DK0A 3BO8A 2GITB 4OZHB 1CBXA 1AS6A 1H3WM 1L7IL 5J9PA 1ZA3B 5DVMA 4NC1E 3DGGB 3BWAA 3WABA 3ATBA 4MS8C 1IAII 1LL1A 4JFWA 1ZLVK 3HNTL 4FJ6A 4U1KB 3FHQA 2QADC 4HHAB 1ZKAA 3GKZA 5D4QA 2R23A 3W0WD 3BAIA 3IF1B 5E7FA 5LBSH 4JPIB 1JZIA 2Z8VC 3MJ9H 5I18H 3ETSA 3CPXA 1B0RA 2XCMC 4W6YB 2ZP8A 5AEAA 5I1KH 2FATH 1A4JB 4MVBD 4MWFA 4I2XA 3SDDA 2KYIA 3DX3A 1BFVH 1P7QB 2YS4A 5DJZB 4UV7L 2GSMB 5KAQF 5KBNC 4AY0A 1ITCA 1A9EB 3NZ8B 1FO0A 4JVWA 4UMGA 2EH7H 5E8DL 3VM5A 3G08B 4E41E 2BP0A 1XIWB 2NY4D 3FQTA 1KOAA 1X44A 5HYSA 4APQB 3MFFB 5C71A 4B9FA 3IJHA 2OZHA 4UOJA 3B2VL 2CUMA 2IADA 1YEIL 1QSZA 3EF4A 2P5WE 3F7VA 2IBZX 4NQTA 4ADGA 4BSJA 4GJTB 3V0JA 4E2OA 4URKA 3G6JF 4KTEL 3QUHA 1EFXA 3D2TA 4IBQA 3GSXA 4ORFA 3VH8A 4PP1C 3LMJH 2V9QA 3RO0A 3O4LA 2DM3A 3HRPA 3GRBA 5IHZB 4G9FA 4HF5H 1G1CA 5LUMA 2DQFB 1FUNA 1YEDB 1VKXB 4Z95L 2C3VB 3ZIMA 1QO3A 2DL2A 3H7LA 5F6HI 3FFCB 5JA9A 4KO5A 4OD1L 3FU3A 2VSKB 4NO5A 3T0EE 3MV8E 2F68X 3RUGB 1XGYL 3H9HB 4U6HA 3U30B 1B0WA 5K8PA 4FFZL 5C0EB 3ULUC 3GMQB 2QV2A 3UTSE 2PJ6A 5ITFB 4G7VL 1H3PH 4G83A 4LFHD 3PGCB 4PJ7A 1E42A 1ODUA 2A7BA 3WYRA 2ZW6A 2XWJB 4XZUB 5CNHA 3WEMA 4BD9A 1URZA 2BY0A 2W07B 1LK2B 1JGUL 4XP5H 1GH7A 2VH5H 5K1VA 4NGHL 4X5WA 3S34L 1PFCA 2CIIB 4JO1H 1AQHA 1B6DA 4XCFH 1QFWH 5TDOB 3B9KB 3DSFH 4RGMC 1CXLA 3EJYD 1AD9A 3A4AA 1J87A 4PJXE 3ILQC 4WUKH 2NXYC 1A7RH 5FUZH 3H9YA 4JFTA 3QZNA 3GK8L 4KHXL 2ZPKH 4B27A 4U6VH 1ZVYA 1IGMH 2E7HA 5JDJA 1NBVH 3JVGC 2Y36H 2M26A 3MV7D 3TWCH 4P59L 5C0BA 2PP9A 3RZCA 4LLUB 1ITBB 2WKLA 4OKDA 3QUGA 3B2XA 5EU6B 3IN0A 5LCVL 1WBXB 1J5CA 1QI4A 1FE8H 4CGTA 1Y1DA 2QZQA 3T8XB 1EJOH 4ZQKB 1MEXL 4JN1L 1KB5L 3VGAB 2HLFC 2WLKA 1MG3C 1XGPA 3H4QA 1BQSA 4U31A 3QORC 5GGRA 3CUPB 5EC2B 1MFVA 5E5RB 3FMCA 1UHVA 3C5SB 2OZ4A 1C1EH 4PJAA 1K9TA 2X6BA 4XBPB 2R1XB 2MWCA 4OLVL 1Q9WA 2BXYA 1XRYA 4ELMF 1T5XA 2BY3A 1JVKA 1D5MB 4UZUA 3TA4D 1KYOJ 4N68A 3GPEA 1I9JH 2ZWKA 3ULSB 2QPUA 1BQ5A 3MV9B 3UCRA 3GBNL 3E0KA 3RWJB 2CHNA 4MJ5A 4O2FB 4X6CF 5D7IB 4OT1H 1MDTA 4QXGH 3D7PA 4NGSA 1A66A 2ZENA 5BPPA 5LYDA 3BZFB 1OPGH 4AUUA 1ID5I 1DJIA 2VRQA 4ZMAT 5IJCC 1G5GA 5FDYA 2N7AA 1I12A 1ZHNB 3DX2A 4ODHL 2OJ1A 3OWEA 4MNGB 3U6XA 5D9SA 1FNAA 2NNCA 3PGDA 1QFPA 3TJPA 2UZYB 1MI5D 2E56A 4YLQT 2FEDC 3GDBA 3V9EA 1F13A 4MAYC 3AT8A 2VMCA 2BW4A 1CCZA 2XV3A 2V5RA 5FYJL 1XH3B 2KBGA 4BZ1A 1TEYA 4I3SH 4M5ZH 3FTXA 4KUCD 4XVUC 5FGBA 1PU9A 2PR9A 1YQVH 2VJ0A 3ARDA 4G8FA 4TRPL 4L4VB 1PPIA 2GK0A 4FQXA 4PS7A 2ENJA 3T2PA 4GW5A 4LEXH 4UQDA 4LLWB 1U8HB 3WUWB 3QIWB 3DV4B 4F7TA 3MVSA 5L9DL 4YSEA 5JOFA 4J28A 1CICA 1F86A 4B5OA 3D52A 2H0FA 1Z5RA 4A04A 1KFGA 3WN5C 4I88A 3UFIA 1RUMH 2FECL 2XBDA 3GIVA 3WLWC 1MW2A 3KPRA 4DQOL 3FO9B 4B13A 3L95A 1P7KA 3WLBA 4I3RL 2N1TE 3FPYA 3FTUA 3QDGB 1CJWA 4JBSA 5FM4A 2QL1A 1MY7A 1CXIA 1NIEA 5FHBH 2XA8L 1A7OL 4NC0B 2WCSA 4XCCH 3FIXA 4AQAB 1CICC 3X3FL 3WELA 2B1HL 2CLRB 1NCUA 2DJUA 4P2QD 2NCMA 4BQCA 4N86A 2DWDB 1QSFE 2ODIA 5AKTA 5L4FA 3I6GB 2VXTL 4LHJB 4TLTA 4OGAC 1K5WA 3HKZA 3KQXA 4PWJA 4XBMA 1TZHB 3V6FB 5HD8C 5IEHA 3MLTB 4JUTA 4RSYA 4FQCH 4MMZA 2I85A 4TNVF 3LACA 4G8IA 3VGFA 2VWEE 4GQZA 2BFVH 1IEAB 3J07A 2IGTA 4IHOA 2RJMA 3EGXA 5LWYH 5TF1L 2CXGA 1Q0YL 3U36A 1QW9A 1I3GH 1FNFA 2FBJH 4BK5C 1R4XA 1WSST 2BNQA 5SWSE 3VFUB 3RWGB 1BAFL 3RWEA 3LEVH 3MNZA 3JYBA 3PAVA 1G94A 3P4NA 1EO8H 4FQHA 3S5LA 1UM6H 5B1JC 1BPLB 2BM3A 2X9XA 3NIDE 4KS9A 1FRGH 1G0XA 4FFYL 5TQ0H 2BY2A 3I9GH 1ZT1A 3P0VL 4M48H 4NZJA 1V0CA 1JCVA 3ZIYA 4A7TA 1KSRA 1Z2KA 3QHZH 3CXDH 4OIFA 3BYYA 1A1OB