1H8LA

Duck carboxypeptidase d domain ii in complex with gemsa
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
380
structure length
380
Chain Sequence
b'QAVQPVDFRHHHFSDMEIFLRRYANEYPSITRLYSVGKSVELRELYVMEISDNPGIHEAGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVQSTRIHIMPSMNPDGYEKSQEGDRGGTVGRNNSNNYDLNRNFPDQFFQVTDPPQPETLAVMSWLKTYPFVLSANLHGGSLVVNYPFDDDEQGIAIYSKSPDDAVFQQLALSYSKENKKMYQGSPCKDLYPTEYFPHGITNGAQWYNVPGGMQDWNYLNTNCFEVTIELGCVKYPKAEELPKYWEQNRRSLLQFIKQVHRGIWGFVLDATDGRGILNATISVADINHPVTTYKDGDYWRLLVQGTYKVTASARGYDPVTKTVEVDSKGGVQVNFTLSRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXYPEPTIDASE GP180 RESIDUES 503-882
publication title The crystal structure of the inhibitor-complexed carboxypeptidase D domain II and the modeling of regulatory carboxypeptidases.
pubmed doi rcsb
source organism Lophonetta specularioides
molecule tags Carboxypeptidase
total genus 132
structure length 380
sequence length 380
ec nomenclature ec 3.4.17.22: Metallocarboxypeptidase D.
pdb deposition date 2001-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
A PF13620 CarboxypepD_reg Carboxypeptidase regulatory-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 1h8lA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1h8lA01
4F9VA 3PFEA 1BPMA 4PXCA 3BXMA 4OC2A 4ZX9A 3SI1A 2PIYA 5JH9A 2NSMA 2QVPA 1DTDA 4UEFA 1YW4A 3V7ZA 4FAIA 5LYFA 2V77A 4EFDA 1HEEA 3IFEA 4MXUA 4OC5A 2ZEEA 4OP4A 2F8HA 3KI9A 2XEGA 3D7GA 4RUHA 4NGSA 5LRJA 3CPXA 5HVHA 2Q43A 3IJ3A 4IYKA 1RTQA 1TKJA 3TX8A 3FEDA 4PXEA 2WZNA 1ELMP 2DEAA 4OMEA 3B3VA 5K8MA 3DLJA 2PJ1A 2V8HA 4P4FA 2FVGA 4PQAA 3RBUA 1TF8A 3D7DA 3HLPA 2CTBA 3KZWA 2BOAA 1TKHA 1OBRA 3D7FA 4UIAA 3G3LA 4A39A 4P4EA 3S9MA 3WT4A 1ZG9A 5HVFA 4MCPA 2HB6A 4Q7AA 2AFUA 4EMEA 3VH9A 2JBJA 4NGQA 2ZELA 4WI0B 3SI2A 3KR4A 1YMEA 4KSIA 3T8WA 4A38A 3BI1A 4W9YA 2GLFA 3BHXA 2EK9A 1FNOA 3KQZA 4JYWA 4FL4C 3D4UA 4BD9A 2C6CA 3LWUA 2OR4A 1LANA 3GUXA 1ZLHA 1R3NA 3E8VA 4YOKA 3B3TA 4MRIA 4ZX8A 2AFMA 1BLLE 2PJCA 2ZEFA 4YWYA 3PBEA 1IY7A 5ELYA 2PJ6A 4O23A 2V8DA 4NGMA 1PYTB 3S9NA 4ZY2A 2ZOFA 3KQXA 4DYOA 5JGFA 3DGVA 3MRUA 3NFZA 4R8FA 1ELLP 3B35A 4R76A 1XJOA 4UEEA 5F09A 4MMOA 1QMUA 1BAVA 5K8OA 2POKA 1HDUA 4GM5A 2ABZA 2PJ5A 4OIWA 4PXBA 1TKFA 1Y0YA 2XEIA 2G9DA 1UWYA 3WABA 2PIZA 3VATA 3FF3A 1YSJA 2O53A 4YU9A 1LAPA 4DJLA 1QQ9A 1VGYA 4FUUA 2GREA 2HC9A 1VIXA 4MCQA 4P45A 5LRGA 2C1CA 4OC3A 1Y0RA 3FX6A 3D68A 5LYIA 2GU2A 3PB8X 3SJFA 3PB9X 3MN8A 1DE4C 4OKOA 2PJAA 4K3NA 2XEFA 3KCPA 1R43A 3L2NA 5D8NA 4P10A 3WC6A 5JM6A 2V8VA 5LYLA 4F8ZA 5LYDA 1CPSA 2PCUA 4NGRA 4AXVA 3JRUA 1YLOA 3WC5A 5I4MA 1Z8LA 3SJEA 1XBUA 4G1PA 2ZEOA 3FEEA 4NGTA 2JEWA 1IGBA 5AQ0A 1F57A 4MCSA 2V8GA 1CG2A 2Q4ZA 2IJZA 3H8FA 4A94A 3FJUA 2BO9A 3B3WA 1FT7A 1ARMA 1LOKA 1XRYA 5K8NA 4MHPA 2PE3A 4DUKA 2IMOA 4P4IA 2PJ0A 1NSAA 4TWEA 3PB4X 1HDQA 1F2OA 2PJBA 3B2YA 3RAMA 3D7HA 1XFOA 4X2TA 3IEHA 3FECA 3IC1A 2PVWA 4IHMA 4B6ZA 4MHZA 3D66A 4UIBA 2O4HA 3ISZA 2XHNA 4UEZA 1H8LA 1GYTA 4UF4A 4F9UA 2RFHA 3CT9A 3KL9A 1ZG7A 2PRQA 2ZEHA 4P4BA 5K39B 1BPNA 5DS0A 4WWVA 2CF4A 3IIBA 6CPAA 4MHNA 4P4DA 5IB9A 2JBKA 1LCPA 2IQ6A 8CPAA 4H2KA 4IAVA 3FMCA 2PJ3A 2XEJA 3PFOA 2NYQA 2QJ8A 3K9TA 4NGPA 3NH8A 1YW6A 4MHYA 2PJ2A 3QNVA 3CPAA 2PJ7A 3KR5A 3HN5A 2VL1A 2J9AA 2ZEMA 1XMBA 4PXDA 5J1QA 3SI0A 4ZY1A 4MCRA 2C6PA 1NKGA 3WC7A 1VHEA 2EK8A 4ZYQA 4ONWA 3GLJA 4TNUA 3RZAA 4R7MA 2PJ9A 4CPAA 4R6TA 1VHOA 2PVVA 2QYVA 3NJVA 3TC8A 2GLJA 3I1UA 1CX8A 4ZY0A 3H8EA 2Q51A 1M4LA 2AFWA 2PJ8A 1TF9A 1CP7A 3PEIA 4EWTA 2B59B 3KASA 5THWA 2BCOA 1CPXA 4OIDA 3PB7X 3NH4A 3LMSA 4IK2A 4NJQA 1Q7LA 4P44A 3KGQA 2CTCA 1ARLA 2C6GA 4JZ0A 3B3CA 2AFZA 2I3CA 1Z5RA 3SJGA 1KWMA 2ZEPA 4P4JA 2EWBA 3H8GA 4WJBA 4FXTA 4NFRA 4X3RA 1EE3P 4ZI6A 3CDXA 3D67A 2ZEDA 1AYEA 3HUVA 2ZOGA 2AFOA 4NGNA 4OC1A 5CPAA 2F7VA 3PBBA 2WYRA 3GB0A 5D29A 3B3SA 5HVGA 3KHXA 5K8PA 3ISXA 4NJRA 1F2PA 2AFXA 3VARA 1ZLIA 3FH4A 5HXDA 4A37A 3BI0A 3IWWA 3NA6A 2RB7A 2ZEGA 2OOTA 4FWUA 1LFWA 1ZG8A 3B7IA 3PRTA 2AFSA 4PPZA 4P6YA 4U3SB 3PB6X 3SJXA 2ZENA 1CBXA 1LAMA 4X8IA 4Z65A 4FBEA 1CP6A 1AMPA 2ANPA 3V38A 7CPAA 5LRKA 1TXRA 4OC4A 1Y7EA 5CBMA 4EIUA 3K2KA 3NJXA 1PCAA 1JQGA 3NH5A 3IO1A 4LQGA 3KHZA 4OC0A 3FVLA 2PJ4A 3N5FA 3S9LA 5G5DB 1Z2LA 2CIJA
chains in the Genus database with same CATH superfamily
3HCVA 5B3JE 1J5IA 4LT7A 5I5RA 3EH2A 4PV9A 3DUSA 4OD1L 5FYJH 2QQNL 1V7NL 2WXNA 4JQXA 3Q3GA 1JNLL 3MUY1 4GMTL 3G6AA 3IGAA 1P4IL 1L0PA 3NFSH 5DEGB 3C08H 5DHMC 3N42B 3S2CA 2AJXH 4ZX9A 2FT7A 4YDMA 2VXSH 2EDRA 2VR7A 3K8MA 1KZQA 1G43A 3QPXH 4ZO8A 4CA4A 5J57B 1JK9B 3JZ7A 1L9MA 1EZLA 3EOTH 5KANI 2GUOA 4WNSA 1YYML 3QIWB 1I8IA 4NEHB 4X50A 3ESOA 4J4PD 1CLOH 4QRTA 1AAJA 2C8NA 5EIIB 3LKQA 2WPGA 2AE6A 4AKPA 4C4KT 1YA5A 2ZEEA 1AP2A 4KZ0A 3WNJA 3N42F 1D7BA 3V4UL 1IZJA 1W16A 1DVFD 3SIKA 4KKZA 4I1PA 5DQDL 5B22A 5IFAH 5D4HA 3WEBA 5BJTA 3JV6A 1DLFL 4PJEE 5HVHA 2VISB 2CHNA 5EDXA 4M7JH 3WY2A 5IB4A 1A25A 1NAMA 1NGYB 1H8NA 4G80A 4HXAL 4ALAC 5G1ZA 1L7TL 3BEWA 4NEXA 4C58B 4S1RL 3RL2B 2CGYA 3ARYA 5F47A 4JJOA 4UB0H 5AOMA 2FYYB 1FLRL 2HKAA 4WGKA 5F7YC 5HHMD 3ZJAA 2R7EA 4DJMA 3KAAA 5GS0L 5JQHC 1IL1A 2CO6B 1U8PA 1MFBH 3RE0A 3O4LA 4YSEA 3X1NA 1OW0C 4ZK8A 4Y2DA 2LTQB 5AKTA 2VXTH 1HH9A 2OSLB 2BOAA 4QRPA 2OR8A 3QUXA 3AWFA 5KBPA 3AG4B 1SJVA 2E7DA 3ABKB 3ROLA 3S9MA 3II2A 4LSPL 3MJ9A 5I8CA 4OTXH 5CMAA 3IRPX 2FUQA 2IADA 3CHPA 1U95B 4F7MA 4M6AA 3SQOL 1J0YA 2Y2TA 3CXHJ 4OD3L 3RPKA 1XMWA 2WYZA 1FQ9C 1NBCA 3W38A 2WWOA 3KR4A 4NCDA 1EJOH 2UZIH 2YBRA 4HS8L 3WL9A 1SXCA 5T8IA 1IARB 2WNGA 5J11C 3Q5TA 3X11B 2FIWA 1A1MB 3KQZA 1RXLA 2YD9A 3MLUH 4FL4C 1X5HA 5AVSB 5BS0A 5AYUH 1KPUA 4AQEB 1Z9SB 1Q4NX 1JZ5A 3U46B 3LWUA 1QSEE 1NUGA 3MNDA 3TZVA 1UWEH 5ID0B 1QABA 1FE8H 4LSUL 3FB3A 1S9WA 3INUH 1JFHA 4ONFL 4HUWB 4ZFOL 1KXTB 2IOIA 4YDVB 5H2BB 2R2CA 3IT8D 5B7MA 1BLLE 4JPQA 2UZXB 4FEIA 4DO5A 3RLSA 2PJCA 5DYFA 5IHWA 4PLJD 3IFLH 3P1VA 1EGJA 1JRHI 1X6NA 1H9VA 2EXWD 4FEMA 4ZY2A 1CTMA 4LVHC 1GJUA 3TWCL 1NGWB 1EAJA 2VCOA 1J1OL 3GNMH 4HHAA 2A6IA 3NN8B 3OXSA 3KWWA 2IIJA 4KFZC 4POZD 2IMNA 5I0YA 5DD1H 5EN3A 4RIRA 4UI2A 4F2MB 3KWXA 1F1GA 1VADA 4OD1H 2QQNH 1V7NH 2PP7A 4PBDA 2BVTA 3TBCA 3ZXAC 5F3FA 1JNLH 1XOVA 4P8QA 3US9A 3VXSE 1BAVA 4GMTH 1P4IH 3UZEC 4GM5A 1HDUA 3MCLL 5H35A 1OOWA 3EJUA 4AV0A 1NGQL 1XVSA 2RTTA 5M94B 1FVDA 4M93C 2DQTL 1JZ8A 2PIZA 2OTUA 4M8RA 5KSBE 1Y6MR 5K1JA 5IFJB 1YSJA 2AKRA 2C5DC 1CUOA 1X9LA 1YYMH 1EWHA 3CDZA 4H8UA 4OD2B 4V2BA 5AW9B 5BRZB 4FUUA 5CJQL 4M85A 3EBIA 5CR8A 2ZJSL 3HMXH 3ZKQD 3BPLC 3H9ZA 4R2GD 3JV4A 5DJ6B 1OGTA 2BOBA 2ISDA 3S36X 4XPGL 5E9DB 2PP8A 1P5VB 4DGUA 4F37K 3AITA 3HS0B 3PAYA 3AC0A 3FTYA 4MQSB 1F3DJ 2P24A 3OR6A 5F49A 1AGEA 2UUDK 5DQDH 1P2CA 4YDKH 3MRRA 1URIA 4JM2B 3ECQA 1DLFH 1FL6B 3NGBB 4N2MA 4MI4A 1CFTB 4OGQC 1OTTC 3B9KA 1DE4C 2EXSA 4R9HA 4RGOH 4HXAH 3ARBB 3UZEA 2YRLA 2ADGA 3LPFA 5HJ3A 3ZKXB 4BFIB 5SWQB 4S1RH 3DPBB 3T0XA 3HG5A 1TJIL 4HEME 3Q2NA 5HHQA 2DYSB 5AG4A 2GJRA 3OMIB 3S6GA 4O51B 2WQAA 3AY4C 1X5LA 3TVMB 1X6LA 5BZDA 2ZWNA 2C9QA 2GK0A 4JM2F 2VLJD 5EOCL 5GISH 3KHOA 3TNMA 1IBGL 4P2RE 4JHWL 4PD4K 2A74C 4BA0A 4HJEA 4FLQA 4JS7A 1FG2A 5BZWB 1TF4A 1FNLA 1GJWA 3RVTD 1HTYA 2BRRH 4PHZA 3KVQA 4FOMA 1N5YL 1CU4L 4KX9A 4MRCA 4ENEC 3GJFB 5B4MC 3DNSA 4A94A 3SQOH 4NQEB 4G8GA 3FOMA 2FT0A 3B3WA 1FT7A 1ZA3B 3GD1C 4HWNA 3M1OA 3ARFD 1ZT4A 4PCYA 3NZSA 4HS8H 5K9KA 1DE4A 2PE3A 1QBML 3SBPA 1UXLA 4PRNA 3DJRA 5C08A 5GZOA 5KYWA 1E28A 4MQTB 4K9EL 4L1BA 2L04A 5T5FL 2AVGA 3FPYA 2HKHL 1BJMA 3TBSA 3AY4A 4GKLA 2BVPB 1WWZA 4RESB 4ZDHB 1OAKL 4K55A 4LSUH 4D0BB 4PJFB 3VXQA 3RHWK 2NYYC 5ITFA 4ZMVA 2VERN 3DIFA 3I75B 4ONFH 3C5ZC 4V1DA 3VA6A 2LABA 4JMXA 4N2HA 3O4LD 1DCEA 1PY4A 2R9HD 4PJBA 4Y2DD 3QHFH 3OKOA 4HK3J 4QRPD 3QUXD 4PJDF 4YSPA 1JWSB 2UXTA 4JKPL 3GLDA 1ZLUH 2OMUB 2ZQKA 4A2DA 4OZGB 1WZMA 3VYNA 5TFSH 1GYTA 2CLRA 1AHWC 3OHXB 4IJTA 4RETB 1S7RA 1W72L 4X8JB 3WKPA 3FQXA 4PRAB 1SXSA 5IBLD 4FFVC 4X5QA 2PWHA 2FCKA 2CO7B 5EZJB 2IL4A 3RB5A 2DD8L 4Y2NA 2PRQA 1LGVA 5IJDC 4P4BA 3MCLH 1R3IH 2OZUA 5BS0D 4Y4KB 1NGQH 1SGKA 2VABB 4IHOB 4NO3A 1S3ZA 1XIXA 4OZGF 5IJBC 4P06A 2DZEA 2W92A 3TZVD 1C8QA 2YPLA 1QTYT 5E2VL 1S4IA 3M7FB 4YEEA 3WEMA 4X9IA 2QGCA 1L6XA 4MSWB 2WLKA 1BZDA 3HNVH 4WFFE 3ULUE 2DLFL 4JL2A 3BP5B 2ZJSH 1KTLA 5HHOE 4GAYA 1XE4A 4XPGH 1LJMA 4ACPA 5C6PB 1UB5A 5J13B 2CR0A 3PFQA 3RTQD 4UOW0 2YUVA 1S9KC 1WE5A 2BNRA 4MHYA 4FXKA 1T6BX 4WI6A 3APCA 3LKNB 3FB8B 3BAYA 4NCZA 1MSPA 2R2HA 3CHQA 3HN5A 2ICWJ 4FFZA 3C5SB 4ODBD 3WKML 1ZY9A 2GHZA 3D2MA 1E65A 1U91A 2AANA 5T1JA 4I49A 4Y1AD 4Z0BL 4JRYB 4N9OB 4RA3A 5T33L 2CY2A 3LQAL 1DUZA 4MCZA 5EC4A 1K4DA 1TJIH 5CP7B 4BZYA 2ZKYA 3F2LA 1JTPA 1MW3A 2NY6D 3O3BB 3ZYZA 2EUXA 5DMGC 4NQDA 1EJ6A 3ARGB 3V0HA 4NPYA 5FGCE 2FE7A 1E8WA 4KVOE 4Q74A 4ANKA 3PXJA 5DEJA 5EOCH 2ZCHL 3F84A 1COBA 1IBGH 1NCTA 4JHWH 3IDYC 3LD8B 1AOHA 3PREA 2QJDA 1FVEA 3AUWB 4MMZB 1TJMA 5IB5B 1MCBA 4X5XB 1CU4H 4HP5A 1G0XA 1E8ZA 1ASQA 1NIFA 4NKMA 4KX8A 3UP1A 3SKNB 2P4AB 4ZY0A 1QRNB 2EJ1A 5DTFA 3BGAA 4AGOA 2VMJA 3TF7C 1LDPH 2BSDA 4OF5A 5DMKA 4AT6A 1QBMH 3IJHB 3H1ZA 1TU2B 3NJGA 3CCHB 1GCYA 1AKJB 4K9EH 4PIRF 1M56B 1I75A 3QJHA 1B0RA 2OMYB 1GPOL 4ZSOB 4MXWL 3CFNA 4FQ2L 5E1IA 5FUCC 1M42A 2GITB 2PYEB 2G4GA 4QRFA 1OAKH 2FSEB 3N04A 1CICC 2YFOA 3HAEB 1R3KA 4XCYB 2QMJA 5D7KD 5EU7E 2J5LC 4NRXA 3AREC 2VLRA 3TJHD 4FQQA 3ZGIA 3BT0A 2WLIB 5F8RC 2ZEPA 3MXVL 4NHUB 1JV5B 4XH2B 4K3HA 4F3FB 3BN9C 1WVZA 4JKPH 6PCYA 4JFFA 1UATA 1JTTA 4PGCB 1NOAA 1PVHA 5C0CE 4I8DA 5I1JL 3JWNC 1OB0A 4E42B 1BOGB 3MR9B 1F45A 3C6EA 2G60L 3QIUB 1KNOB 5AOZA 3PQYB 1MDAA 2ICEB 4UQCA 2DD8H 1DBML 3FTGB 3MV8E 1BM3H 5ICYB 3GXFA 5GZOD 1D9KA 1HOCA 3FSZA 5HI5C 1AR1B 2J1YA 3HI1A 3DYMA 1MHEA 1OCCB 2AI0L 2JI1A 2HRPL 2BIOA 5E2VH 2VBQA 4YDJB 4RA0C 2PXYD 3NA6A 1P5UA 1ONQB 4ZTPL 3G5WA 1YNKL 2DLFH 4V1DD 3QDJA 4G6FB 3N55A 2D0GA 4HGMA 3UTZA 3D25B 3HKZA 3ZKSD 2VL5B 2VJXA 5T3ZE 2NYZA 4MDJB 3SGJA 2WWKO 3B5HA 4WQOA 1JPSL 1PKQA 4NFCA 4QHNB 1XEUA 4U6HA 1I7TA 4UT9H 3ZQWA 2V2WA 4PRIE 2VDQB 4I3SL 1GA2A 1QQDA 2VAAA 1NSNL 1GS7A 1X9UA 3HE7A 3P4MA 3WKMH 2B4DA 3DSNB 2KERA 3QFJE 1U8HA 1MK4A 2WY3B 1UG9A 2K0RA 3AWGA 4Z0BH 5GGRY 1LVEA 4TULL 3LQAH 3WKQA 1HAWA 4G43B 2MQ0A 1DQLL 2NY1C 3M6DA 4XNHC 3ATBA 1KCVH 2IG2L 2DQCL 2ZOLB 1PLGH 4APQD 3QUMB 3KLHC 1TSHA 3WMQA 1MIEL 5J8CA 2Z64C 2AQTA 4YC2B 3DXAA 4X4XB 2KBGA 3BD5A 2XA3A 3BESR 2YPLD 1G6VK 2ZCHH 2N0MA 4TNEA 3WJJC 3M45A 4YHOH 2F1BA 2YJQA 3PU7A 4MA1C 1BYNA 3I6KA 1RP8A 1JK9A 3SQBA 2Z3FA 5F21B 4L37B 4B9GA 4PJGE 3NEEA 3LRGA 4W9EC 4MQ7B 2J7LA 3FBQA 3MI6A 4I18B 1M53A 1MCWM 2IANB 3FO0L 2WO3B 1XCXA 3F05A 3LSOB 2DQDL 3MLZL 3A9LA 2NTFB 3FQWA 2BNRD 1YEKL 3NJKA 1M3IA 2QVPA 1FCGA 2XC8A 3JWOL 3NJHA 4ZOEA 2JK5B 3OM3B 4BUQA 5C9JB 3CV5A 3OAYK 2IVFC 1U8LB 3BZ4A 3R9FA 3LKOB 3BP7B 1ZS8A 2VISA 1S9XB 4F0XA 3NUKA 1X7SA 4HALA 3RQ3A 2OXHB 4MXWH 3VD7A 3T65B 2QIRA 4FQ2H 2AXWA 4ZT1A 1NGYA 4IKLA 4KC3B 1AOZA 2GY5A 4Z7VE 1JG9A 4L8SB 1CDHA 5I76B 3WJJA 4Z7UA 5FGRA 5ADOL 2FECL 3LHPL 2WZPA 2CO6A 4IRSB 5HXMA 5EU5A 1OP3K 3NJIA 2WLHA 3MBEB 4P5RA 4KZTA 3BUTA 3PFUA 4IHBA 5LGKA 3SB3A 4E9LA 4CAFA 3EG9B 5I1JH 2OSLA 3I74A 3V8OA 1IC1A 3VD2A 3VWKB 1O7VA 4PRHB 4TTDD 3WELA 2Z91B 4BE6A 2J6EH 2VMFA 4ETQA 5FGBA 2G60H 3C09B 4F58L 4OMEA 1KFAH 3WY1A 2MKLC 3UBXG 5GS2H 1CO1A 1JGLL 4IKNA 2OMZA 3B2UC 4QXVA 2BRQA 1CBVH 1Q2CA 3N3EA 5IROC 1MFEL 4P5KB 1QD0A 4LDCA 4KNSA 1M1DA 1RURL 4OFVA 2HRPH 3OLGA 1A1MA 3GZPA 2FR4B 1EAQA 1IU1A 4FD0A 2N56A 1YNKH 3BFOA 4X5RA 5CGYD 4CSZA 3L5JA 4HYTB 1FRGL 3EO0B 3K72B 3QGVA 3VU1A 2LOEA 4HJJL 4EI5D 1KDIA 3VGFA 1E8XA 2NTSP 2WMPB 5IMLA 3V7AG 3NCYS 1LE5B 1KCLA 3CIAA 4G72B 4YDVA 4AH2B 4XPBL 5H2BA 4JYWA 2AV1B 2UZXA 1Q72L 2XZQL 3QCTH 4I3SH 4EUPB 5DEFB 1NSNH 2AQNA 3WIAA 1E5UI 2CJUL 2ZKXA 1NGWA 3B9AA 1Y6NR 5EU6A 3NN8A 2VZ1A 1NC4D 2P1YA 4HWBL 4L9LC 2ITEA 4OZFH 3UL4A 4EZKA 2WBWB 5IROA 1JXJA 3F12A 4B9YA 2IG2H 4Y4HB 1D9KD 5ANHA 1MAJA 4QTFA 5EBWA 2ZUVA 4M7KL 1MIEH 3DMMC 1E4HA 2BMKB 2RFXB 4UFXA 5FIEA 2GEQA 1JK8B 2BXYA 2QGBA 2CCWA 2WN2A 4Q52A 4QRAA 5ISZA 4B0MM 1GHEA 1XJOA 3TVMC 3QDJD 3FT3B 4OFIA 2ZSVB 2Z7UA 3F62A 5BRZA 3FUMA 4LLWB 1OF0A 5LGJA 4U2ZA 4DK3A 2DQDH 4XVOA 1FFPB 3MLZH 5KZCB 3PP3H 9CGTA 3G9VA 3H2WA 1JVOA 5DJ6A 5CD5C 2YSTA 1YEKH 2GJ6D 3H7LA 3VE0A 1NM4A 4IBWA 2W9EL 2HT3C 3T3ME 1GY2A 1LMIA 3O2VL 4MFPA 3HE7D 1KV3A 5CLZA 4DOHE 4P23D 4G7QB 4GW4B 5I24A 3KPPB 1IGFL 1TMCB 1UZ6F 4JM2A 4DGWC 1B0WA 3EDJA 3Q9QA 3MNVB 1CZ8H 4UOQA 3MA7B 1QUPA 4KKBC 3WY4A 3ZZ1A 2EO1A 2ETWA 3RWFB 1RZGA 2DLTA 2O5YL 3ARBA 1LD9B 3DMMA 2C1CA 4M6GA 2Z10A 4M6ML 4U05A 2FYVA 3VRJA 2ZX8A 3NEXA 4YZFE 3S9DB 3TT3L 1I1RA 1NMCB 3SPJA 5LYIA 5ADOH 2X9XA 1LO3H 3SDCB 4KKRA 1AGDA 1KWGA 3TVMA 3II3A 1NIDA 1SDDB 4UM9D 1R43A 2QSQA 4Q4IA 3KWUA 4KFMA 4RDQG 1NM9A 3LKRA 2WK2A 1TZAA 2Y1VA 3QIWD 3GSRB 5BZWA 3HLKA 2L7UA 1VFAB 3SYQA 4F8ZA 4AW7A 5HYSG 4TL5A 4PRDB 1UWXH 3MFFB 4F58H 4AM0A 4B14A 4B60A 3FRMA 2EDHA 3GJFA 3ZW3A 1IEBB 4EQ3A 1M1XB 4NQEA 4OI7A 4JXQA 5LRKA 3GSQA 5DHEA 3WYRA 1JGLH 5K59E 1ZA3A 3CX2A 1F02I 1NCHA 4R3SB 3BP4B 4FS0A 2QKIB 2YD6A 1U36A 2R0KL 3S4SA 2NY5C 3IMUA 2YMXL 2OAAA 1RURH 2RQEA 1YEDA 4R3LA 5EOQL 3G6JE 4PJDA 5BWAB 3VFOB 2H2PD 4M7ZC 1UJ3C 1CGSL 5D2NB 2IBZY 1AZZC 5K8NA 4HJJH 3D39E 1J1XL 3NACH 1HCYA 3I75A 3GI8L 1SXNA 3WN5B 3WEXA 1O5PA 4CL7A 3DX3A 4YIQB 3UGEA 1PZCA 8PAZA 2XZQH 1Q72H 3IS1X 2DM2A 3OTTA 3NZ8B 4A31A 4G6JL 2H0PA 1JWSA 4PJ9B 2OMUA 1G9MH 4OZGA 2N59A 2IBBA 3A5VA 2DLEA 3REVB 4HWBH 1DJSA 4PLKC 5FO8B 1YG9A 2XY1A 4WRLA 4MHHI 2NSQA 3ME0A 2UZYB 4X9GA 5K9OB 3WDIA 1N59B 3OSKA 1I1AB 5D2LB 2HVJB 2CO7A 4OGXL 2ARHA 3Q5OA 3SPVA 2IGFL 3Q44A 4TVSa 4FC3E 3HB3B 3QRBA 1UJ3A 2OULB 3C5JB 1NEZB 2VABA 3QDME 4Y89A 1W8NA 4H4NA 4NI3A 5HJBA 4XOEA 4B9CA 4PS8A 2VI7A 5MEPA 1CK0L 1WBZB 4GT0A 4X5WB 4G9DA 4R7XA 4MSWA 4BKSC 4UINL 4QCIA 5D1ZI 2Z3LA 1J7VR 3RVVD 3BP5A 1OE1A 2VZUA 1VHSA 4RAHA 4OJCA 3H7BB 4NNXA 2W9EH 1OHZA 3X2QB 1ET8A 3O2VH 2VN7A 4R7VA 1IGFH 4H2KA 3FT9A 5ABDE 1MNNA 3LKNA 2W5PA 2G3XA 4XBEL 3P2BA 3C5SA 3JYCA 1MG3C 5EPMB 3L08A 2O5YH 4Z8FL 2XEJA 1ORSB 4W4NA 4JRYA 1AZVA 3EYSL 3TT3H 3ARQA 3QQDB 3NH8A 5BUGA 1HDMB 4EDXA 1W0YT 5GZNC 1ADQL 1N71A 2GTZB 2ED9A 4XODA 5BPPA 1YRKA 1CWVA 2HZHA 3E2HC 1GSMA 1I8KB 4LRIC 3RVUC 5D93B 1FZKB 1UT2A 4FQCL 5SWSE 5BRZD 4UU9A 2AERT 1NKRA 5I1AA 2YSSB 4MMZA 1SQHA 4MNGB 4YR6A 5KJ4A 4X5XA 5HYJE 5E9DD 3OKLA 2XJKA 4QHLB 1JZ2A 1WLHA 3GSWB 3A4AA 5CZRA 1IYKA 3FH5A 4RNRB 1OWRM 3D8MA 4TNUA 3PAZA 4HPYH 4OF0A 5E6ZA 2R0KH 3A47A 1OAUL 1DQML 2FX8H 4JM2D 1KULA 1TU2A 2CKBL 1YECL 5F1IB 1T1XB 1WD8A 1MW1A 3D1MC 1TZHA 3NJVA 2ICEC 4ICXA 2OMTB 2DQHH 4TN9A 2L0DA 3EF7A 5EOQH 3MDJA 4I4WB 2GLJA 3GM8A 3ALWA 5DJDB 1RZ8A 1CGSH 4HWZA 4HA1A 2GITA 2VDOH 1V10A 2FSEA 3HZ3A 4XCYA 2YAPA 3RX5A 3GI8H 3QEGL 1II4E 4LRIA 3DIDA 1T2XA 3VXOB 2Q2EB 1PJ9A 4MMXB 2GHWB 5DMJB 1E67A 2X3CA 4K8RL 1JV5A 4G6JH 4XH2A 4W9KC 1A4AA 1TT6A 3LZOA 4HAGA 4F3FA 3KGQA 3W9DB 1ARLA 3NRQA 4PGCA 4O58L 5IP4A 4RFNC 4E42A 1T6VN 1BOGA 2AFZA 3NK4A 4NHCL 3FS9A 1U0QA 5D5MA 5KSUB 2F8XC 3QIUA 2BHUA 2F53A 5D1XC 1KNOA 1FNSL 3PQYA 5I1IH 4NO2A 2W81C 2VL4A 5DJ8B 3D39D 2C1PA 4PVBA 1PFCA 3C8KB 2ICEA 2IGFH 5EF0A 5FM8A 1ZGLM 5BV7C 1MJ9A 1A66A 1JZHA 2DWYA 1IGJA 3UIZA 2DMKA 1D5ZA 3JQOB 4J3TA 1U92A 1J5OL 4YDJA 4F57L 1AS8A 4RFEB 5T1DL 2UWEE 2VO5A 4QMEA 1ONQA 2PPFA 2GBUA 3OMNB 4D9RE 1CE6B 1WH0A 5FYKE 5AZ2H 1FYTB 5DLLA 3MRFB 4JX0A 2ZXCA 4XHJC 4LHUB 4WI7A 3DJ9A 1REIA 3SZ6A 4BQ8A 1RK0A 3L5IA 1CLZL 2AVFA 4MNQE 2F8VA 2Q10A 2XBZA 3OC8A 4XBPB 3O45A 3MRCB 4EN2A 3QXVA 2QMLA 1ZLWH 3BYYA 2WZ0A 3EHBC 4XBEH 3W6SA 2O6PA 1B4RA 3ZHDA 3CSTA 1MFAH 2P46B 5GRVK 4K3DL 1NCCL 2ZD0A 4U3SB 4Z8FH 2RC4A 3IF1A 2W0KA 3OKEB 2IC2A 1U8OB 2EQDA 3AXLB 1QBAA 1QPXA 4G43A 5D96B 4U1JB 1S7XA 3KW8A 3RIAF 1J0JA 5C09E 2VZSA 4Y4KD 2X2UA 3SJVE 3KPRB 4WGWB 2ZNXA 3LXCA 4X4XA 4L8SC 1QOKA 1LWJA 4B53A 2R0WH 2DIEA 3IAQA 4KKNA 1WICA 3U2SB 2H1LM 4FQCH 1EHXA 5C0DB 5JPMB 3CXPA 1NIBA 2ZYSA 1DVSA 4L37A 4NRZB 1TNMA 2M2DA 1MEXL 4JFXA 4KVPA 4OJYA 4WK2B 4NOFA 1W8OA 1PD6A 2ROYA 4BMHA 1LP9B 4C56E 2IANA 2RALA 4ZS6D 1YZZA 4OCYH 3CU7A 4AVJA 3QNFA 3KPSA 5EEVA 2RD0A 1FV1B 3TCLB 3MU3A 1DBBL 1CT8B 1DQMH 1CFNB 1OAUH 1U41A 1OPOA 2X4RB 4KY1H 4M3KB 1A9BB 2CKBH 1YECH 5C9JA 1ZIAA 4MB5A 3QJRB 3S8WA 4HSQA 4H40A 1TPXC 4NZTL 2VGLM 1WAAF 3LKOA 1DJYA 3H9SB 4NKQB 2IFFL 2I9LB 5F7EH 1NINA 3MOQA 3LZFL 4JRYD 2MOQA 5F7UA 4CSTA 2YK1L 2OXHA 5IBTL 3T65A 3V6FB 3VRLF 1XH2A 3RIFK 1LP9F 1EQWA 4HEPA 2NXYC 4QC6A 5HYJD 4L8SA 3ARGD 5I76A 4H5SA 1UXWA 3HG2A 3UTTB 2Y3AA 1SJEB 2V77A 1OEZW 1HEEA 4ABQA 4JFDB 5J1SC 5EOTB 4HIHB 3CMGA 1CFQB 5CN2A 4MLIA 3V6OA 1TNNA 1Y07A 1J87A 3TN0C 4OP4A 3EG9A 1N7ML 4O58H 2CSPA 2BNUB 5CJ5A 3VWKA 3G5VB 3EFAA 4JXRA 3HNSH 4RUHA 2FB4L 2Z91A 4A32A 4KQ0A 1A02N 1OOAA 3ZKMC 3HG3A 3RL1A 4BK8A 1QRND 1ZLEA 1FNSH 3ARVA 4ZZFA 2OYKA 3D0AA 4KGLA 1MOEA 1WFUA 4F7KA 3Q01A 5CWSB 1U93B 2WYTA 3MV7E 3T8XB 5A40E 1NCBH 5IOKA 1H15B 5KVFL 4S2SB 2B1AL 4I1NB 1TKJA 3GHBL 1AKJD 5G2NA 5KYYB 2B3UA 4P5KA 1Z9UA 3WHXA 4ZUUB 2WZNA 2XWCA 3T04D 2LAAA 1Q1JL 1PDKA 1FNGB 1AO7E 1I9RL 1J5OH 3CSYB 1S7VB 1HSAB 2FR4A 2PYED 3DO3A 3HFFA 5T1DH 2VRQA 1PZBA 3IU1A 4B7LA 1CGXA 4WV1C 2FVGA 4HOWA 1Q0EA 3B2DC 3HI5L 2VM9A 5DHDA 4BV1A 2CTBA 3D7DA 3K72A 2XCMC 3MLWH 2WMPA 1CLZH 2XBTA 3LPWA 4FP8L 2Z0ZA 1LE5A 4JGJA 4G8FB 2B4CH 4AH2A 4WDIB 4N26A 2AV1A 1B3IA 3MLXL 3VH9A 2JBJA 2X2HA 3RBGA 1T5XA 4JHUA 3QWOA 5AEAA 2J56A 4NENB 1L3WA 3UAFA 4K3DH 3QIUD 4YJZL 1NCCH 1HQ4B 2FO1A 2H5UA 2C3WA 4A38A 4ZFFB 1JWUA 3BHXA 2QFPA 3FHEA 4Y4HA 1AR1D 3VFTB 1AVAA 4BZ2A 2HG5B 3SBWA 2P8LB 4OF3A 5I5MA 1GRWA 4ODUB 3C9NB 4NS0A 2BMKA 2YXMA 2RFXA 4XXCA 4X4YA 4AQ1B 1U30A 2LVEA 5IHLB 1NMCC 1SYVB 4IS6B 3AT0A 1WGVA 3VWJB 1CFMA 4W70A 2ATPB 1MEXH 3ISWA 4G6FD 2WINB 3VFPB 2ZSVA 3BYTA 2UXGA 4U1LB 1PYTB 4LLWA 4M8UA 4ZTEA 4P2AA 3AM8C 3GBNL 5DXWA 1FFPA 1IT9H 1OT2A 5JHDB 5JGFA 4BFJA 4BKTC 2DDQL 1DBBH 1CE1L 2L8AA 1I53A 4XMVA 3FTUA 2QDVA 5E8NB 3SJVD 3KLSA 2LAGB 3HBPA 5CF3A 4ZW5A 5JOFB 4MJ5B 1SVZA 4GW4A 1QPPA 4A7UA 2AHIA 4MMOA 1U3HC 4NZTH 4N1EA 1FBIL 2IPKB 2IFFH 5T3XH 1NCJA 3MNVA 3H6AA 3LZFH 4GXUM 4EI0A 2YK1H 3MA7A 5IBTH 1BBDL 5FO7A 3RWFA 4EN3C 8FABB 1ZV5A 4PJ7A 5HHPB 2G9DA 3EYOB 4Z3HA 1RL1A 1S3RA 3V0JA 2BHZA 3IFOA 4BFBD 2Z0UA 3H2QA 3QJFA 1QQ9A 1EFXB 3SDCA 2KPWA 3HBZA 2DYPA 3ZO9A 1HAUA 1VIXA 4JREC 2YAEA 1A5FH 1UENA 4I13B 1J11A 1SDDA 4G6ML 4WI9A 5ADPL 1C5CL 2VDNL 4OZ4B 3V4PL 3NSDA 1ND0B 1Y0RA 3AM8A 3FFCB 5IB3B 4JFEE 1N2RB 3CFBB 3RUGB 1N7MH 3V5HB 2IAND 3GSRA 4GXHA 2FB4H 3B2XA 1G84A 2NNCA 3DOSA 5AKVA 3G08A 1U8MB 3MFFA 1X5MA 3SJFA 3B37A 2GSMB 1S7NA 1IEBA 1TJHL 1M1XA 4OF8A 1VAHA 3MN8A 4HIXH 5F70A 5B1KA 3TEYA 3FFDB 5KVFH 3L2NA 2B1AH 1IC7H 1KDJA 1WWCA 1TEGA 2I85A 3BP4A 4R3SA 4Y9CA 4JJ5B 4OQTL 2BSTB 2QKIA 2ZUXA 4DGIL 3QYNA 2L4OA 3K2MC 2E9BA 3RVWD 3BUDA 3NJFA 1X9QA 3RUGF 4DVRL 3GXUB 4AXVA 2YUWA 3VI4E 4X99B 2B5IC 1ZK5A 4LP5A 2AMGA 4BQBA 2FD6L 3KYNB 2MWCA 3HI5H 5C0AE 1MZYA 1GJIA 1JCKA 3S8FB 3OAUL 2VZYA 4XC3L 2JEWA 4A6YL 1F57A 2WO4A 4FP8H 2ZXEB 4IRSD 3U9UB 2PKDA 1U8KB 2V8GA 1RFDL 3EJRA 3JVFC 3MBED 3SKJH 5JPNC 3FJUA 4H8QA 3MLXH 3VXPB 3NZ8A 3WGVB 3VWKD 3ZUCA 4N8UA 4PRHD 3U1PA 4DKFL 4ZMTA 4EZLA 1LOKA 1CCZA 4KZCA 1BA9A 4OJAA 1HU8A 2VQYA 1SOXA 2OJEB 4X9HA 4ZG1A 4KY2A 5E1HB 3REVA 4II9A 1IZKA 1BBJB 2ADYA 4HCRH 2R1XB 4W9LC 5BRPA 5IQ9B 5DZAA 1XGTB 2AK4A 4EOWL 4L0YA 3UZQA 2UZYA 4JHZA 5F7FA 2ZPAA 2PPCA 2HVJA 3PB4X 1HKLL 4TF4A 3MMEB 3MGTA 3CFEA 1BXXA 1KYFA 5ALCL 4DUXA 3C5JA 5CILL 1NEZA 4H8HA 5F0PB 4X2TA 1F86A 4FYQA 3VVWA 2RH0A 4XPDC 1DVYA 3BH9A 2PVWA 2MQGA 2XN2A 3UERA 5C3IA 1EHKB 5C8JB 1A1OB 4X5WA 2NY2B 4W81A 5JPNA 4MTMA 3VMNA 3Q8AA 4C55A 2JB6B 3GBNH 4FD5A 3BPOB 2XHNA 5DRXB 1OTSC 2Z1PA 2DDQH 4MY0A 3KPTA 4OZFB 3QA3B 4KOSA 5DC4B 3APDA 3LRSA 4AITA 4NIYE 5FX3A 1BLIA 3TPKA 4AX3A 2ESVB 4JO4H 5CJXC 2GE3A 2J21A 1I8AA 4N8PA 1FBIH 4GS7B 2H6OA 4JRWA 4R90L 2FL5A 4FQ1L 3C5XA 1HL4A 4WTZA 2WTRB 2X4NB 1BBDH 1K3IA 5EPMA 2PW1B 3V0VB 6CPAA 5DVKA 3BGFC 1KELH 4Y4HD 5I5IA 1F11A 4WNQB 5GS0C 4LOUC 1IGML 2WQSA 3VQ2C 5D7JB 5E2JA 3RNKB 3ZE1E 3D06A 3DI3B 2XOTA 4PJAB 1ADWA 4CJ0A 4AVHA 1JZ3A 1X3DA 3UCRA 2VDNH 3WIIL 1QO3A 4HUUA 2ZX6A 4GKSB 2PJ3A 4MFZA 1JHTB 1I8KA 3E38A 5FR3A 3PFOA 2E0PA 3RWCA 1FZKA 3QNZB 2PRBA 1P4UA 2ZZUT 4J3OC 2QJ8A 5BO1H 5JIPA 1YLEA 4PRPE 2YKLL 2YSSA 3I2CL 1TETL 3GMLB 3O8XC 4MNGA 5EF3A 3L9RB 4IRZA 2X7LA 3QQ4B 3PHOA 1K72A 3KEHA 3S3BB 4QHLA 4EVNA 3GSWA 1MLCB 3O4OC 4I0CC 5CJXA 4AYSA 1NGPL 3QFDA 4GKZA 4RNRA 4PJAF 3LPGA 3GSNA 4H26B 2BP8B 4YPGB 5FYJD 4DGIH 1MCIA 4OQTH 5I82A 5FDWB 2K6WA 1ZWIB 3SGEI 3PL6C 4U33A 2XVLA 5F1IA 2O6CA 1T1XA 5T5NF 5KWYC 4QXWA 4DVRH 1KF9B 2ZTBA 3W81A 5EIIG 2EZ0D 4RI1A 5DJDA 2NQCA 2FD6H 4H0LC 3LB6C 3OAUH 3SDCD 4XC3H 1M44A 4HX1A 2BIIA 4Y5YB 4A6YH 4CPAA 3GBDA 5KW9L 2QYVA 1RFDH 4MXVE 3QORB 1IV8A 1SMAA 4M8QB 5CHNB 3VXOA 3ZTNH 3FT1A 1XF2B 4ELKB 4CJ1A 5C07A 3NCBB 4FI8A 4LL4A 5INCA 4DKFH 2JXMB 3C6LC 4PCKA 3NABH 1F0LA 3PGCA 1CJWA 2H3KA 3MRJB 3DDDA 2YQ3A 2EDKA 4AYGA 1H9DA 2VDML 2F2HA 5KSUA 1QW8A 5AVYB 2NY3C 4EOWH 3QULB 4UNIA 3LXUX 5F7NC 3RDTC 3O6LH 3NH4A 5DJ8A 2XRAH 1ZGLP 4UQ3B 3RRQA 5ALCH 3EJJX 4DPRA 2C6GA 3D0VB 5CILH 4LGRB 2EVHA 5LXGL 1A7RH 1M05B 4GLRH 4ZFOA 3BVTA 3HE6B 2EXYD 2CALA 4RFEA 3IM1A 1IGYB 1QFWL 1T3FB 1X10A 4ZAKC 1LE9B 1EFQA 3WFDL 1F4XL 5IVOA 1Z32X 4ZBGA 2F7IA 1FYTA 3D4YA 3MRFA 3TEUA 2F7OA 4LHUA 1MFCH 5EG6C 4NN7C 3WV0A 5L88L 1H6EA 2EIMB 3MJ6A 1A7NL 3I84A 1P1VA 4KK5D 4PJ9D 4XBPA 1QASA 4E0AA 4DGYL 3ROOA 3IXTB 3D2UB 3V0WL 3CSFA 5HGAB 2KZKA 4FQ1H 4R90H 3RDTA 4P57A 1GL4B 4ANWA 2BWIA 3HHMA 1LEKB 1W8EA 3IDNB 3CZLA 4U3SA 2RMNA 1F2PA 4CAGA 1KC5H 1IC5L 3FH4A 1I1AD 2QVTA 3ZRCC 3QDHA 1U8OA 3ZUNC 1IGMH 5GJTH 4R0LC 3HB3D 3HHRB 1WEJL 1S46A 3FK3A 1NPJA 1SFDA 3BZ5A 2ZXVA 3B7IA 5DF0A 3HBGA 3KPRA 2XIDA 2ZW6A 1KTCA 4B5OA 4UWIA 3WIIH 2VR8A 1KLGB 3FAXA 5DD5H 3FPXA 2MSPA 4LPUA 4ZUTB 4LSTL 5AWNH 3DSFL 4DIXA 5JPHA 4H0IA 5C0DA 2EINB 3SDYL 4HIQA 1WAAA 2YKLH 2ZENA 1RUML 1YAZA 1TETH 1W9XA 2D7TL 3I2CH 4NRZA 3VI3B 3O3EB 4OM1L 1CBXA 3BP6A 3U6XS 1CP6A 5SWZB 1HHJB 2ED6A 4B9ZA 1TCMA 6CGTA 2K78A 1LP9A 3EADA 1KCSL 3HNTH 2H7WA 3QZWA 5FV1L 4C7IA 1UUNA 3UH8A 5DFVC 4KJYA 5D9SA 3NJXA 4QKTA 3SY0A 1CFNA 1CT8A 2CHWA 2X4RA 1T2QL 2PO6C 1A9BA 1KGCD 3F58L 4K3JL 3QPQD 1D5MA 3U0TB 4HJ0C 2R23B 1GC1C 3IO1A 4DAGL 4KMTL 2FEJA 4LQGA 4R3KA 3VI3F 5MEQB 4MD4B 3RGVC 5ID1B 3V6FA 3F6LA 2EILB 1H3TA 5LN4A 4LDEB 3I9SA 1N68A 3I02A 3V5DB 4DW2L 4A2LA 1ROWA 3DARA 2TSAA 5E00B 3APMA 4LKXA 1BFTA 5KW9H 1MCLA 3UTTA 3T1FB 4HXBH 2OU2A 3NH7L 3C75A 3JTSA 5EOTA 2VTFA 2LQRA 4HIHA 2B5GB 1FJ1A 1CFQA 2HJFB 4JGUA 4NN6C 3IGRA 1NAKL 1MCPH 7PCYA 2PWDA 4BYHA 1WTGT 4IIQB 4N20A 5EULV 3HKFA 5JUEH 43C9B 3FB5B 4W4OC 1SEQL 2BNUA 2DAVA 4ZNEA 3G5VA 2A0LC 4Z3JA 2MNJB 2VDMH 1FI8C 1FO0L 1ZANL 3RVXC 3X14A 1WBYB 1KEGL 5T5FA 3Q05A 5CWSA 3T8XA 1U93A 4KXZI 1SLUA 1H15A 4PSRA 1RZ7L 4S2SA 5GSVB 4NQCE 2VDOB 4MZ3A 5EZIL 3KM2A 1NCUA 3RGVA 3BVUA 3U4EB 5KYYA 3LHAA 2K4AA 5LXGH 4HZ1A 1FNGA 2ZUQC 4AENB 1JYWA 3CSYA 5KBDA 1HSAA 4LCCB 2WGXA 1QFWH 1LXMA 4UT7L 5CBAA 3PJSB 5G4MA 2LGNA 3GEFA 1JZ4A 2KUTA 1WP6A 3WFDH 1F4XH 2HFEB 3EJCA 3S4SG 1EXUA 4O02H 1JGUL 1KIUA 1NLBL 5DVLA 1RLWA 3B1TA 5JHMA 4OJDH 1A7NH 1W72A 4G8GE 4W4OA 4WDIA 3DV6B 5IEKB 4X5LA 4ZUWB 4GEIA 4DGYH 4PP1D 3HLAB 1E50A 4QRRE 5DJCB 4DFHA 3V0WH 5AW0B 2BSED 2PNDA 1UQSA 3SYAA 3CDYA 4KROC 2JEVA 3N0AA 1NSLA 2J1KA 5TDPB 1GXEA 1OD7A 5I9QC 2IWGA 3F6JA 2GPZA 1DSFL 2E47A 2VDLL 1HQ4A 5C08E 2DMGA 1T22B 5J6GB 5LBSL 4CGMA 1IC5H 3GK8L 4G7YL 2P6FA 2X1PA 3ETBF 4FRWA 4HUVA 2OMWB 4NUGL 4JY6B 4LCWB 1J5HA 1CXKA 5BO0D 4XMLL 5F1KC 1WEJH 3VFTA 3D12B 2YNCA 2CAKA 2HG5A 2P8LA 5DZPA 1SOKA 2CNZA 1S9VB 2EDLA 3L4WA 1SYVA 3F7YB 4IS6A 4LSTH 3RJOA 5I28A 3DSFH 3KVPA 3SDYH 3VWJA 5AW5B 3P02A 2D7TH 2H41A 2VITB 3VFPA 3KHQA 2GFBA 4MX7A 5GRJL 5BZXA 1ZLHA 4NQTA 1KCSH 2W8CA 3GXNA 4GMSL 4A63A 1WUZA 1KLUB 5JHDA 4DPBX 2MOVA 3CFJB 4YFEA 5IIEB 5LWYL 1D5IL 3SE4C 5JOFA 4K3JH 4NC2B 4QOKA 5DGQA 2E7LC 4KSAA 3ILQD 1S8DB 4DAGH 3TF4A 1Z4EA 1F4YH 2IPKA 5IHZA 2I60L 4V33A 5F6IB 5H4ZA 2TSBA 3KWTA 4U1HB 4A95A 4HKJB 3EJTA 1DZBA 2ITCB 4GG6A 4M1DL 3X12B 1Z8TA 3EYOA 3KPRD 4J2XA 3T77B 3VB8A 1BZ9B 2N4IA 4NFBA 1SOQA 2WQRA 3NSCA 3TTYA 3ZU8A 4L3CB 2Q2LA 4PJHA 4MZIA 1VPOL 4AEHL 5DHYA 2YN3A 5BOZG 2PJ5A 3BOVA 3H6JA 5E8PB 2HN7B 4OIWA 1ND0A 3Q8FA 2WOYA 2A4CA 3FFCA 4HCGA 5IB3A 4AEFA 3CFBA 1QBLL 1SEQH 4TNWF 2CKBB 4R26L 1FO0H 1PG7X 1ZANH 3BKYL 3SE4A 1KEGH 2E7LA 1TFPA 3DURB 2WBJC 3FFDA 5DYOA 5J7CC 1HYSC 2DKUA 3DETC 4XGZB 3FOLA 5B21A 5FECB 4JJ5A 2BSTA 4WWNA 5HYFA 5IKCB 3C87A 3H9SD 2CQVA 5E03A 3WJMB 2Z8VC 1S7UA 4QXUH 1HS6A 1ZIBA 4EI6A 4W9IC 3X17A 1J88A 1QUNA 1V5JA 3PUCA 2ZAIA 4GUQA 1J9TA 4X6EA 4UT7H 3AT9A 1GZHC 1ZLSL 1T20B 4GUCA 3EJZC 4KGJA 3KYNA 3E6FB 4W9DC 3VFWB 1KT2B 3UTTD 1PY9A 4NZUL 3CXFA 1NC2B 3OKYA 4KO7A 1ZHLA 1D5XA 1JGUH 4N0UB 4BK4A 4JFDD 3F8KA 5LYLA 1NLBH 2BY1A 4MBRA 5LYDA 2PCUA 1BVLB 3RZCC 4GXVL 1ACXA 4KNQA 1PLBA 3M86A 2AABH 5IMKB 1DL7H 1JV2B 4YH6A 1LK2B 1MI5E 1RJLB 4GAJL 4XO9A 4HIJA 4FYSA 3FT4B 1JPFB 3HAEG 1R5WB 2KT6A 4IEFB 5CN1A 5JDJA 4NGTA 2Z6FA 2WBJA 1DSFH 2VDLH 3CVHL 5AQ0A 2OJEA 1AZRA 4LL9A 5LBSH 3L95B 3B1UA 3GK8H 4OADA 1BBJA 3WMPA 2AJ6A 5IQ9A 2R1XA 3C60C 1XGTA 2KMWA 5E8EA 4OV5B 5BQ7B 4E41B 1F6AB 2V9RA 4XMLH 4Y1SA 4E5XB 4K7PX 3IU2A 3ECWA 3MMEA 2Q76A 2D7PA 2VXVH 2PCPB 3CG8A 3GEWB 4KOXA 1SN2A 3B2MA 3NFPB 2FRGP 2BOCA 1HHIA 1N64L 2FO4A 2VLRE 3L2LA 2AJZB 1KB5L 2GB2A 3HG4A 1OTTD 5AAMA 3WS3A 1FLTX 5DJAA 2QADC 2K3HA 4X83A 2BCMA 1NSAA 3VFUB 1A1OA 3NSYA 4JFFE 4WKZB 1TFHA 5GRJH 4GRLB 4NWUL 4LHQB 4H89A 4C7HA 3HOGA 4G8IB 3RZCA 4LNVA 3CNKA 1DJXA 3KS0J 3T8MA 1EEYB 2VLLB 3JWOC 4OUOA 2JJVA 2ZWYA 1BVNT 1PKOA 1URLA 4FMFA 1EVTC 3IWUA 2BIQA 1VGEL 1D5IH 5IHUL 5LWYH 3LODA 1G5AA 2Z9TA 3GM0A 1LEIB 4K23L 2A6JB 3QUZB 3EGSA 1A6ZB 3P9MB 3QEHB 4XB7A 3NT0A 4U1NB 4GFXA 3P3TA 2Z1KA 5FUCE 2XN9E 3RBSA 2WTRA 2GBVA 2PW1A 4CDHA 4OFYA 3V0VA 1D5BB 4U1GB 2NY4C 3O41B 4M1DH 4JKLA 1EVUA 4JANA 4Q6IC 4U1KB 4WNQA 3PWUB 4UF4A 1KZFA 1IAII 5DC9B 4G7RB 5D7JA 1PZ5B 3U4AA 1SHXA 1LMKA 2CDFB 5MERB 3NSFA 1RH8A 2BPBA 2E8YA 4FULA 4PJAA 5C9KA 3OMAB 1RAMA 1T0PB 1TCRB 1VPOH 4JM4L 3VWJD 4AEHH 5I23A 4G8EA 4GKSA 1MUJA 1PQZA 1NZRA 2ZKHL 3GI9H 3JWNE 3QNZA 4YGOA 1QBLH 3K5SA 5IJCC 1OSEA 5JA8B 1DJHA 4R26H 3GMLA 3EYQC 1X4XA 3BKYH 3L9RA 5JHDD 3NFNB 3QQ4A 1BX2A 4Y7OC 2CIIA 1NCWL 4ZO6A 2GSGA 1FWXA 2VMEA 4H26A 4YPGA 2PABA 4RGNC 5GJSL 2NYQA 4H1LA 1ZWIA 5I6MA 5AW4B 1YW6A 4CBPA 4ZX4A 3VWEA 4X7SL 2I7SA 1SM3L 3DXAE 4Q6IA 2EIEA 1AQKL 5F7AA 4L4TB 4WK0B 1TTUA 2JELL 4JO1L 3T6VA 4OCXL 3DR8A 3IKCB 3PY9A 2C7FA 2WVVB 1ZLSH 4FG6D 1BD2E 1CI5A 2QLYA 3J27A 5AVTB 4NZUH 1EFXD 2CKNA 1UM5L 2G2PA 2X4OB 4Y5YA 3BAIA 4L1TA 4CRPA 3QORA 1E43A 4M8QA 5CHNA 3MBWB 4GXVH 3FFCD 3D85B 1UEMA 3OKMB 4N5UA 3QXAB 2WP3O 4GAJH 2DIJA 5FGSA 3DO7B 3GMQB 4F33A 4K94C 3MRJA 3NPSC 5EMYA 5HHXL 3QE5A 3FU0A 3WAJA 1K3ZA 5L2JB 3WIFB 4JR9H 3HG1A 3TC8A 1BQKA 1RERA 2IQAB 1BAFL 2E46A 3HI6L 2VXUL 3B9VA 3H4HA 5LNGA 3RJQB 3IJEA 3NP4A 3QR2A 3AXHA 4JN2B 1IICA 2DYRB 1X5ZA 2OM5A 4Z7UE 4ENZA 1CP7A 4BBWA 4DEUA 4J3GA 2Y23A 3PF2A 3IJ9A 1M05A 1KB5H 2E27L 2HT2C 2BCOA 3HE6A 3TONA 4YL9A 1CYXA 1UASA 3LEVL 4OLEA 2AXFA 3UO8B 4P4KB 1T3FA 2HWZH 4NWUH 2Q8BL 5E5UB 5F48A 4NUMA 1LE9A 1ES0B 4RWHA 4H20L 1S3KL 4F91B 2OSWA 2B15A 2DJUA 4HWBA 5GS2D 3WIHL 1UACL 5IHUH 3AUVA 1VGEH 1W0VB 4AK1A 1HWWA 3L4UA 1K2DB 3ES6B 4K23H 1S9YB 4G7VL 2XETA 3C6SA 3ISYA 2DEYX 3D2UA 5HGAA 2EO9A 3UBGA 1SDAB 5EO9B 5FO2A 1IAIM 5KYNA 2APBA 3X13B 3CDXA 2KL6A 1U6AH 4G5ZL 4JZOB 1DEEB 2VDRL 4EUPG 1Q9LB 2P80D 1DSWA 2BOLA 4Y4FC 3PBBA 3IMRA 3DGGB 3UACA 5B38A 1TUPA 3ISXA 2NY7L 1KLGA 3L1OL 5FHBL 3TOPA 2ZKHH 4LSDA 4P2YA 2AQ2A 2HVBA 4X80H 2Y0MA 2NY2D 5TH2A 2ZXAA 4AK2A 3NIFE 2RB7A 4CYPA 3ZDZB 3O3EA 3P73B 1FN4B 1HHJA 3GBMH 3RX9A 3TA4D 4PPZA 4R7NA 5EU6E 1BXAA 1NCWH 3QIBB 3MRMB 2WWNA 2CZNA 2ESVD 3T6WA 4X98B 5F3BB 5GJSH 4M5TA 3K91A 1NUFA 3N44B 2HQYA 3P0VL 3U0TA 1Y0LB 3BD4A 1SM3H 2R23A 4KK8D 1AQKH 3A6CH 2BSRB 3RKDC 4IBSA 5MEQA 4BELD 4Y4FA 4JJXA 2VDNB 4N8CH 2HTLD 4MMYA 1E5AA 5ISZE 2ZPKL 4OSUL 1NCAL 4AY0A 4ZFGL 3UMNA 1ZMYA 5FAAA 4L48A 3V5DA 4U1MA 3QUYC 4OLWL 1INDL 5E00A 2DOCA 2BWDA 4FQXB 3VDCA 3VFRB 3APFA 3MUGA 1BZ7A 3T1FA 3W0WA 2I9TA 2K4WA 3DBXA 3DKHA 3N44F 4AWJC 5I8KL 4Z3IA 4FG2A 5MEOB 3AFLA 2B5GA 4OC0A 3QZNA 1G1YA 2HJFA 2Y06L 3Q43A 5DI8B 5T1LD 2G3TA 3FIXA 1ETZA 2MTPA 3KLAB 3VFVA 2AITA 3NRFA 2X9ZA 3T0EC 3TA3C 1UC6A 1I3GL 1OE3A 4M5SA 1ZA6A 4E0RB 4ZD3L 5DMYA 1QFHA 1G9NL 4XVUD 1FORL 2X6MA 3P9WB 1X5XA 1I3UA 1OE2A 3LH9A 2VXUH 4PXCA 1Q2DA 3V6ZB 1T66D 4XN2A 4ONUA 2YAFA 1WK4A 1F3JB 4A6YB 4KZDL 4N6RA 1RUAL 1YQVL 3LN9A 1RJZB 1L9NA 1YW4A 4YHNB 2E27H 5E4IA 1KLFB 3LEVH 4XHQA 3ZE0E 1HC1A 2G0KA 4LCCA 5IG7B 1KJVB 1ZEAH 3BWZA 3NA9L 5TJWK 1RCYA 3ATFA 3CH8A 3J2PA 4OC5A 4D9QE 2HFEA 1A7BA 5I16B 3QORD 3AB0B 4H20H 4ODVL 1S3KH 1O9ZA 3ZTEA 2QMKA 3KLHD 2ITDA 4LP8A 1J0HA 1C12B 4OZIB 1UACH 2XTJB 1RIHL 2Z92B 1JZJA 4A33A 4JFHE 2A4ZA 4WLCA 1IE5A 3TA3A 5KBLA 4ZUWA 3QAYA 4G7VH 3E9TA 5DJCA 2WYIA 2NZ9C 4I48A 2VN6A 4XP6H 3VXRA 5CLWA 2RJMA 3JV5A 5TDPA 4XXWC 5AAWC 4PXEA 2H9GB 4KTEH 5ECGA 2WN3A 1Z5HA 2X6UA 1T22A 2DLHA 5J6GA 4PJDE 1NIEA 4R6UA 4G5ZH 2VDRH 1ZE3H 2K7QA 2OMWA 4CMHB 4JY6A 4LCWA 4OZIF 3HVDA 1WS7A 2WUBH 4ZMWA 1P84K 1TYEB 1Q94B 3HE6D 3VGAB 4ZO7A 1S9VA 3L1OH 3FQYA 3GPEA 4A39A 1TTBA 2Z7ZA 3GINA 3F7YA 3AY2A 5EBMA 2A2QT 4Y8AA 1I4FB 1BAGA 1D2PA 2HTKC 5I71B 5E4OA 1NE9A 1CXHA 1KB9J 3H9HB 1YMMA 3NDZE 4JFVA 3SDAC 2YBGA 1NEZG 1TIUA 1ACZA 2DRUA 4U6XB 1N3NB 1Z2KA 4P3DA 1WC7A 3E1ZA 2BP0B 1NICA 3FT0A 5IIEA 2Q04A 3D2UD 3VA2C 4Q9RH 1F1DA 5C0RL 3P0VH 3K81A 2H5MA 3SXNA 3FQNB 1CG9B 1F90L 5F8QC 1ADQA 3CVDA 3O3DB 1ZAGA 2W9LA 3ZR6A 2YXWA 2VMDA 4LRNL 3ZKND 2OSXA 4U1HA 2Q5BA 2ZPKH 4HKJA 3V55A 4LIQL 1XAKA 2WIMA 2X53A 3SO5A 3X12A 4OLWH 4A2MA 1INDH 3BSZL 2AS5M 2HLAB 1E27B 4MFQA 4YDZA 4K8RC 3W57A 1DDHB 1KJMB 5B1CA 4WTZG 2PJ6A 2YLKA 5I8KH 4NGMA 2EYTA 3QQ3B 2VSMB 4CGOA 1KXVC 1ZDSA 4QXTB 1GYWA 3EYVB 4E9VA 4EPSA 5IR1B 4HV8B 4RSVA 2VDPL 1KXQA 3MX0B 4JCMA 4LVNC 3TOBA 1F4AA 5SWZD 4M7LL 2CKBA 3T3PE 1I3GH 3NYKA 4AUUA 5IQMA 4JK0D 4Y5VB 1XCWA 3BWAA 1G9NH 5GGVL 1OZPA 1WCQA 3SCMB 3NK3A 1YO4A 4FTVB 1PU0A 1UYWH 3U2JA 2WXKA 2EE6A 1GW6A 3U36B 3GSOB 4XGZA 3FCGA 4XNMA 5F88A 3VGGA 4CC1A 4KZDH 3WABA 1ED3A 4MCYB 1RUAH 1YQVH 4NO5A 1INEL 3PWPB 3RIFF 1A9VA 1S5KA 1TG8A 3H42L 4FAAB 1S7LA 4MDIB 1TJGL 4FX5A 4MCQA 3NA9H 3WE6A 4P3CL 1M7DB 2APTA 4YGAB 1YEIL 4L4VB 2AAVA 1NDGA 2BS9A 4AGMA 1BECA 4UT6L 1NC2A 4MWFB 4YHML 2FE0A 3R9GA 4M4RB 3UAJD 2VDMB 4OZHB 3ZGHA 3EJPA 1FG9C 1T7YA 1QHPA 4QYOB 2CG9X 1FF5A 4WEUD 4OKOA 1JV2A 1RJLA 4I77L 2CPUA 3WXVL 1JPFA 1OWWA 3FCSA 4IEFA 3R96A 4G83A 1MCRA 3OC5A 5L2KE 4XPTH 3WNKA 4AIOA 1IYLA 3BO8B 2PP9A 1NH6A 1NOLA 4TXVB 4XTRC 1IEAB 5DJ0B 3WC5A 3P2HA 3AS2A 4E41A 4OZHF 5I4MA 2EO7A 3IVKA 5A2BA 1M3JA 3BZFB 4OU3A 3M88A 2APSA 4HK0A 2ENSA 1X7QB 1RJYA 1WRFA 1XD0A 2A1WL 4HKBA 3G5ZA 5CKGA 3BPNB 1F41A 4XN5A 3SN6N 3TO4C 4O02B 2X42A 4ZOAA 5MI0B 1MCNA 1O6SA 3W3BA 1IFHL 1AQHA 2CR3A 2XG5A 4URTB 1HJBC 12E8L 4WKZA 1T1WB 4HOMA 1URZA 3K80A 2W1NA 5DHXB 4G8IA 1DN0B 4YAQB 1KTDB 1U58B 4DP9X 4UYQA 4LKCB 2FIAA 1UH2A 2ALAA 1LO0L 2J72A 2M8XA 1AQDA 5D5ME 3CDCA 5D7HA 2F53E 4WO4C 4UTAL 5I6KA 4L1HA 3UROR 5C0RH 3SD5A 2IMOA 1E9OB 4P4IA 2WLNA 5ETUA 4WUUE 2DQFA 4ATTA 3CC5A 3BEVB 2HP4A 5JQ4A 1A6ZA 5DC0A 1S7WB 2CM6A 3P9MA 2F54E 4XP4H 4LHUG 4U1NA 4OAEA 3EFFB 4U31A 4LRNH 1YPZB 1UD2A 5E2TL 4MAUL 3LACA 1LHZA 4LCWD 1HXKA 1D5BA 4HPSA 3TO4A 4Q14A 2OPCA 3IS0X 2Y5EA 4HKFA 3PWUA 2AJYH 4NIKB 3MV9E 2Q6WB 3A4EA 1KJ2H 4NNYB 2UZPA 2XKNA 3HBQA 2WZAA 4MCMA 3QCUL 4UQIM 1PZ5A 5GIRB 4AE1A 2WUUA 1ZV9A 5MERA 3LIUA 4K2UL 3MNMA 3NDYE 4NJAL 1TCRA 3JBG7 3NG5A 2VDPH 4LHJB 4PVLA 1H8LA 1HNGA 1MHHA 3UAEA 1YPZF 2ZOKB 4M7LH 3T0WA 2Z3MA 4NPKA 4GSDL 4WO4A 1TZ8A 5D1XE 5M95B 5GGVH 3F00A 3NFNA 4N6QA 4HGWA 3ULVC 4HKZB 4HIPA 3GSXB 4G6AD 2XYBA 2CHXA 5AW7B 3LZQA 2CK0L 3OJ2C 3KW7A 2D73A 3GRWH 4K5PA 3S96A 3UJIL 4BH7A 1B88A 1GZQA 2XA8L 2GY7B 3APNA 5FW8A 1INEH 2DBJA 5E2UL 2A83A 2O4EA 1KUXA 1DO5A 4PN6A 5DFTA 4EXPX 1VKXA 5GHWH 1YREA 4FADA 2H3NA 4L4TA 1TJGH 4PW4A 4KMQA 1RD6A 5FA4B 3F7RA 4U1IB 4P48A 1CFSB 1L9RA 1YEIH 3NCXA 5DWMA 3AMLA 4ZRGA 3UXFA 1WZKA 3GMNB 5KVEE 2R1WB 4MQXC 4I0PC 4UT6H 4WHDA 3NRPA 4YHMH 3U9PL 3D18B 2PJ2A 2I07B 1FO0B 3MRQB 2HA1A 3QZMA 1SPDA 1QFPA 3PLYA 3OKKB 4RMTA 1XGUB 3KPSE 3MBWA 3VCLA 1KZYA 3ZMEA 1Z5LB 4AQ8C 1V8HA 4CN4A 3D85A 2A9BA 3OKMA 3U0PA 1A3QA 3QXAA 2FH6A 4I77H 4Q6YA 1G7HB 1Y9WA 4M61A 3CN4A 3WXVH 3V8IA 3GMQA 2L3BA 3LV3B 1TEFA 4H8WH 4HVBA 1CF8L 1BGXL 4G9FB 4WCYH 5EC2A 3EXNA 3HFML 5DRZA 2ZNWA 5JHLL 3ULUL 1J1PL 5L2JA 4UCNA 2WD0A 4ETYA 4YBQD 4D8PB 2IQAA 2EIZB 3P4OB 4Z7OF 5E5RB 4ONWA 4FQIL 3GLJA 4LLUA 4GH7B 3GMMB 1T0OA 1RZKC 3T4YB 2KLTA 4P2QB 1BHGA 4JN2A 4ZUVB 2G3MA 5DHVH 5F7MC 1SQ2N 4X2UA 3T0VA 1EZUA 1VHOA 1YHPA 4W6WB 1IC0A 1IFHH 3CFTA 2X4QB 4I0PA 1NANI 1OGPA 4YSDA 3VXMA 1U3ZA 2PQ8A 5DRNB 4X7DC 4NDMB 12E8H 4I9XA 5L2KD 3DVIA 1NC2D 2Y7NA 2UY7B 5KN5A 2H0EA 3H8EA 3TC9A 1ES0A 4JZJC 2WXIA 3VD0A 1RZFL 2CNMA 1LO0H 2VDLB 3MRHA 2ODIA 4DN4L 4UTAH 3ESNA 1BIHA 3FZUD 3K46A 3FYNA 2CDGB 2D3VA 1S9YA 3DTXB 1U4FA 2H32A 5IMOB 2XTLA 4PR5B 3N6YA 2QVMA 4FZEL 3IXAB 2E9WA 2FJUB 2RQ8A 5E2TH 4Y19B 5EO9A 1T03L 1H3PL 1YAIA 3L16A 4E41D 3MHZA 5BOPA 4JZOA 3F0AA 1Q9LA 1IAOB 3ZL2A 3JT2A 4M8VA 1KJ3H 4N5EC 3RPIA 3QCUH 1KUVA 4FXTA 4PJ8C 2EWBA 4RGMB 4K2UH 3FW6A 1XCTB 4PY7B 5EFIB 5DSCB 3I6LD 1T7VA 4NJAH 4P3WA 3VFNB 5ICZB 4MAYB 4L23A 3SE6A 5ESAA 4KQ4L 4N90D 4GRLD 2F54D 4PI0A 4P46B 1IC4H 4XB8A 4GSDH 5DUML 1KWKA 3D8PA 1MH5B 1R3LA 1SLVA 5E96A 1J8HA 4C57C 1FN4A 1KV7A 3QI9C 4GUOA 2V5TA 4Z5RA 1UXSB 4S10A 4DZ8B 5K8PA 2MEJB 4UAOC 4HS3B 3QIBA 4UZUA 1OT4A 2A3TA 3OWEA 1XIWC 2CK0H 3MRMA 4FLRA 4PWKA 5LAXB 5AD0B 2Q3ZA 2VLKB 3QUZD 1QATA 5F3BA 4X98A 3UJIH 4JPWH 3GJFK 1I7UA 5J12C 4PG2C 3PV6B 1MLBB 2N1KA 5KOMC 3MCYA 1Y0LA 4PD4J 1HEZA 3NTCL 3GHEH 1A8JH 2IV8A 1SEBA 2BSRA 2ORBL 1WUNT 2YQBA 3R1KA 2P8PB 1RIUL 3EOBB 3L9EA 3QRLA 1E9QB 4FNTA 4PJ8A 5D1QC 3PB6X 3V4PA 3GDBA 2QGDA 5D1XD 3I3GA 4AVBA 2ZAGA 2OBGA 1XF4B 3VH8B 1WDAA 3U9PH 2WW8A 3UMTA 1QA9B 3VFRA 2V37A 1JYXA 5I74C 1CF1A 2QPEB 4UA3A 2FWUA 3ATDA 4ZUSB 1I8MB 1AMPA 1I7RB 2A99A 3ULSB 1CD9B 4FNUA 2E59A 2PPAA 2C4FT 4APXB 4KK6D 4PTUB 4EIUA 3TNNA 3QI9A 4OQTA 1OZTG 1CF8H 3E9UA 1CI3M 1BGXH 5TTRA 5T3XD 1KN4L 4HBQA 3QCVL 1FAKT 3FUKA 4M43L 1BF5A 3HFMH 1PCAA 2Q7SA 1OGAE 4GI8A 2XG4A 2XWEA 5JHLH 5CJOL 1J1PH 3SDXB 3ULUH 1Z9MA 2DWDB 4L1DA 1AD9A 1MFVA 4FQIH 4KO6A 4KRPB 4PJ7E 5E24E 1V54B 1NWOA 5F89B 3SQRA 2FWOA 1MIML 4L5FE 4ORGA 4A6YA 3EHBD 4L4TD 4XCEB 4CMHC 1E9PB 4YHNA 5C3LD 1G0YR 1C8PA 3T9YA 1BVNP 1IB5A 1KLFA 1FNFA 3CFDB 3QJSB 1QVOA 2DLIA 4IU3B 3TXAA 1HSBA 4PB9H 4NC0B 3SDXF 2E9IA 1EH9A 4FNRA 5C0JB 2GJJA 4YX2L 3TT1L 4UQBA 4Q9BA 4I9WD 4O2EB 1RZFH 2R2EA 1E4XI 1DSYA 3HC0B 4LNRB 4D9LL 4JWPA 1C12A 4OZIA 1A4BA 4L9DA 1XR8B 2C1OA 3D85D 4P2OC 2Z92A 4GPVA 4PCSA 4F5CE 5ABZA 1E2VA 2OMXA 3UPRB 4CU6A 4HJGB 2QKSA 5LQBH 4FZEH 4KUZL 5T1KB 5JYMA 4QY8B 1AZCA 2H9GA 5AW2B 1H3PH 4FD6A 1S7QB 1MJUL 1KB5B 4PRBA 4PM1A 4O2FB 5GRWA 4TVPE 5LRJA 2DTML 4LAQL 2D9QB 3IJ8A 5CIPA 4MFJA 1ZPLA 3CPLB 4X0NA 4MFLA 4FNSA 3PPSA 3OL2A 5DQ9A 4YMPA 1K6QL 2D4DA 5JXEC 5I6XB 4EJ1C 2OJZL 3LNFA 2EYSB 5CD3A 3INOA 3IYLW 2C34A 4XP5H 2WTOA 3L4XA 3MODL 4JFZH 4KQ4H 4P4KD 4QLWA 3QPKA 2DEAA 2SEBA 3PUUA 4GI9A 4XBGA 3NJLA 4OF6A 5DUMH 4AB7A 1OD9A 1T21B 6TAAA 4KK9C 4P2OA 5IM7A 3O9WC 3FU8A 5ERWA 1TF8A 3BVDB 4WWKB 3LDBB 3S36H 4YDIL 4DEPC 4ANVA 3N1QC 4U6XA 1A4JA 2BP0A 2AK4E 3HUJB 7CGTA 3ATEA 1FH5L 1CG9A 3NTCH 3S8GB 4WI0B 2ZXQA 3TBWB 2ORBH 1YMEA 4JUTA 1TOXA 4XN1A 1AI1L 3A0OA 4RLDA 1GYUA 2G0BA 2GYSA 4L3FA 2V3FA 4JPKH 3VFSA 4ZI8A 1ET7A 5G55A 1ESOA 5JO5B 2XWXA 2HX7A 3VTAA 4FG4A 4JPVL 4ZZKA 3AABA 4AZ8B 2Q8AL 4U9YA 2X4TB 1AANA 1UCTA 3EJYD 1DDHA 4NN5C 3GUXA 3HUJF 5HYIA 3QQ3A 4KLWA 2NX5E 3SKUD 2NY0C 1PG7L 4QXTA 3EYVA 2FEEL 5FC9A 4MKMA 3O9WA 4AIEA 3MX0A 4MJIA 3IRZA 4KVNL 1MAKA 4JLRA 4NWTL 3F7VB 2PR8A 5I6NA 1HZHL 1KN4H 2XN0A 3QCVH 3MCG1 4M43H 3TJEL 2HV2A 3BQUC 2KZ1B 2QLVB 1T1YA 3QIBD 5CJOH 4FNLL 4KHXH 3SCMA 5C0BE 4FTVA 4BQ6A 4NUPA 3I3EA 5C92A 2VO8A 2JIXA 5T5NG 4ES9A 4FFYA 5J89A 4R8FA 1UM6L 5T3ZH 1TZGL 3U36A 1NFDB 5F97E 4JLYA 1MIMH 3ALPA 1AZBA 3U83A 4MCYA 1DVXA 3B43A 5F09A 3PWPA 2K7PA 4HS6B 2CXGA 5KTDA 3FONA 4FLSA 1K5NB 2ZKMX 4XVJL 1SNRA 1M7DA 4L8DB 4FQXD 4HT1L 4YX2H 4BK5C 2OQJA 1RIVL 4RSYA 2W94A 3IGKA 4MWFA 4D9LH 1NBYB 1I1DA 1LQSR 1E4KA 3U1QA 1NFDF 3S0PA 3N43B 3N1MC 1ZLVH 1BEYH 4ZPTB 4QYOA 2BK8A 4X4ME 2C3VA 1FGNL 3FCTA 4TPRL 4TUJB 2DWXA 4KUZH 4QHKI 4J3UA 5J1TC 3D5OF 3EH5B 3GIZL 2X05A 5KYUA 3K0YA 2W0PA 5DDHB 2WLMA 3L3IB 1MJUH 2DXQA 3D68A 4W1TA 2GU2A 4LAQH 1IEAA 2V7HB 5DJ0A 1PUAA 3N43F 3SE3C 3TBTB 4TV3A 3FRUB 3O6FB 2PJAA 1CLYL 3BZFA 3BJ7A 4GXUN 1K6QH 1X7QA 2OJZH 4X6CB 2AJSL 4QKXB 3CZFB 4PTTA 1JPTH 3H85A 2ZG1A 4DSYA 3MODH 4BK5A 1KGUA 1AR2A 2IDCA 3B56A 2NCMA 1JZIA 1JRHH 5C07E 1R6VA 5FHAL 1T1WA 1DVFB 3KCPB 4AYFB 4G1PA 2W60B 2XTJD 4YAQA 1KTDA 1VKCA 3BHBB 3T2NL 4PJ5B 5EF1A 1RK1B 2GC7C 4U1SA 3EXJA 4X6CF 5E6YA 2VDRB 1P6WA 1E9OA 4ZPVB 3ZL4L 3AS0A 4MA7L 3GKWL 2W95A 4LVOC 4Z3FA 1S7WA 1UA7A 3TPUB 4UYPA 2X38A 3EFFA 1MCQA 1YEWA 3SE3A 1AI1H 1E0OB 1UM4L 1YPZA 1Z9OA 2Q20A 5LBVA 4MD5B 1QPKA 2ERJC 2P5EB 3N9GL 1YJDL 4HC1L 2Q6WA 3IWGA 2JKSA 5I1DB 4PJCE 4NNYA 1XGRA 3BFQG 3O6ML 3CIQA 2FX7H 3WOVA 1UFGA 2BY3A 2J1ZA 5J3HD 1WSST 1NFIA 3VTTA 1N18A 4R96B 2D4FA 1VF5C 4NWTH 2ZOKA 4WI5A 1CD8A 1WQVT 1HZHH 3TCXA 3TJEH 3WO3B 4IHMA 2HRGA 4M56A 4ONHB 4XP9H 4RZCA 1PCXA 3DVGB 5B38G 1T83C 1XDTT 4KTDL 1RSYA 4FGMA 3GSXA 3H55A 1MRDH 1UM6H 1TZGH 2P48B 2YARA 3F3HA 4JDEA 1P7QB 5H4YA 1HQRB 4M5YL 4BBHA 1KCBA 3T0DA 3EDKA 2QL1A 4BZ1L 2RFHA 3S3JA 1VSCA 4O5LL 4F0YA 3Q48A 1S7FA 1CDIA 5A3IC 2DQEL 1XEDA 2V8MA 4MXQC 1ZXQA 3EZJB 1HWGB 4XVJH 3HZKA 1UZ8B 4U1IA 3IIBA 3K71B 4J3WA 1XL4A 4EZMA 4YPJA 3GMNA 2R1WA 1G4MA 5C0BD 2IQ6A 3L3JB 4WSKA 3UGUA 1X4ZA 2I07A 1V7ML 1FO0A 2X6AA 4HUCA 3HPLB 2WUCL 3OKKA 2NUPB 1XGUA 3UP6A 4IAVA 3T2LA 1CMOA 1FGNH 1Z5LA 4TPRH 2EIBA 4ORZC 3BKJL 1T83A 1G7HA 3FSVA 2QVFB 4UDUA 4UNVA 1N6QL 4XVSH 5A2CA 3LV3A 3GIZH 1D2OA 5CS7A 3ZR5A 3ZHNA 3CUPB 4H8PA 5JW5B 3SCMD 4G9FA 5HI3D 4FTVD 3GZQA 3D48R 4JHAL 4M9PA 3TM6A 1KB3A 2UXVA 4P5TC 4FFWC 3KXFB 2G0LA 4D8PA 2VL1A 1SF5A 1ZPUA 1CGTA 1IB1E 4C2XA 1WFJA 1CLYH 1C5BL 3P4NB 2BIMA 2X1WL 4NB7A 1J0ZA 2ZEMA 2H0FA 3GMMA 3QO1A 3PWPD 4JRXB 5H94A 3R7RA 5J1QA 3T4YA 2F19H 4U6VL 1FAIH 4ZUVA 3RFRA 4F7EB 2Q7BA 1CGWA 4KU1A 5KBKA 2YZ1A 3L5HA 1RPUA 2C6PA 3LRHA 4RGMC 3L7FA 4L4VD 1NKOA 5FHAH 3WS6C 4A2EA 2W07B 1X12A 3TYFB 4KI1A 2UY7A 2VDKL 2G5BB 4Z0XA 4CVZB 5D6CB 4ZNEE 3T2NH 4LLYB 2GIYA 1KEML 4BEIA 5I1KL 2DQGL 3PJLA 4OJFL 4LE8A 5F7DB 5JOPE 3VD4A 5B3JF 4HCFA 5HHNA 1MN4A 3DRTA 4X0KA 3VSQA 3DTXA 3PHAA 4MA7H 3FTZA 3TO2A 3GKWH 3UPCA 3MLYH 5IMOA 3PXHA 2B14A 4PR5A 3GMRB 3RFZC 3PWJB 2BVUA 2R39A 5KEZA 3ZDXE 3KPQB 4PU2A 2Q51A 5CUSL 1W2KT 1NJ9B 2YXVA 3LPOA 1GOFA 4MJ2A 4PBXA 4YHYB 1UB6A 3MRGB 4Z7NE 1BQRA 3N40P 1YJDH 3N9GH 4EE2A 4F9LA 3P0YL 4PJEB 1IAOA 4NNPH 1VJSA 1RO5A 2GI0A 1M57B 2WXOA 3IDGA 1V55B 3O6MH 2FIKA 2VB5A 3EOYG 4ISVB 4XP1L 1BG9A 5DWUL 1SHWA 5ACMA 4B50A 1XCTA 4PY7A 5DSCA 3G8WA 1ZKAA 2DMCA 4F7CB 2CO1A 1PBYA 3B3CA 4ZMOA 3FUHA 4J12A 3QDGA 4TTGA 3DX8B 4BGLA 5IQ7L 2Z31B 4P46A 1IJ9A 2E4FA 2D2OA 1KYOK 3BZEA 3FQUB 1OP9A 4A7GF 4PJEF 5DK0B 4JG9A 1XCQB 1G6RL 1Z9PA 2ZXDA 4DZ8A 1UXSA 3WFEL 1M4IA 4HS3A 2F5IA 1JXKA 1PTZA 3RA7H 2A9ML 2R56L 1L9TA 1CDYA 2V5SA 4P0DA 1KACB 1R5VB 3NP3A 4TQHA 2ZEDA 1IKNA 5JXAL 2APVA 3PV6A 1KJ2B 1JF1B 1MLBA 3BIBX 4OCWL 4S1SL 4O5LH 5LCVL 1KENL 1AXTL 2DQEH 3ERXA 4JDVB 4IOFD 5ICXA 5C70A 5D29A 2EDTA 1P9MC 3ZJ0A 5F72S 3GMOB 2P8PA 4HWEL 3EOBA 2YKKA 4FMKA 3VRIB 1XL6A 2VDPB 2NY3D 1CXIA 1OB1B 5LNEA 1IKFL 3BCDA 3ARSA 2PC1A 2UY6A 4NRYB 1A6VH 3VH8A 2ZUWA 1NFAA 4RMQA 1GOHA 1YY9C 3KL0A 4B5EA 1LFWA 1V7MH 1QSEB 4HLZH 2WUCH 1J05B 3SHSA 2LU4A 1CXFA 1T4WA 4CBZA 3ULSA 3HG0A 2H26A 1QG3A 4KUCD 5IY5B 4GG8A 2GJZB 3IDIA 3BKJH 5IW1B 1VESA 4APXA 3BGMA 3SJXA 4PTUA 2DWEA 2DQMA 3KG5A 5I66B 3ZTJH 4QOKE 3MRDB 4GXFA 5CM1A 1R4XA 4U4BA 3TFKC 4X8IA 2JFCA 4FBEA 1G7JB 4JHAH 4L3EE 1JWMB 3DTDA 7CPAA 1RZJL 1KYUA 2WWKT 5FYKL 5GRXG 3CFUA 2DS4A 2H2SC 1CDCA 4R97B 4GG6E 1C5BH 1U8QB 5CBMA 3VSUA 5F89A 4X4ZA 4MB1A 1OLZA 5DJ2B 3QAZB 2G4EA 1V3JA 4XCEA 1CXEA 2EYRB 5F0MB 5D7LA 1OCOB 1ZJBA 4F7TA 2XIIA 1G7MB 3CQFA 1JQGA 4PJHE 1F8TL 1OM9A 3VXSB 1CL7I 3RTQB 5J8FA 3L3OB 3UTPE 5EA0L 3UBFA 3FU3A 2VDKH 3M17B 5IMMB 1UD8A 3TTHA 1W91A 4WFED 1C5DB 3EO9L 5BXFB 1KEMH 3CVHA 5I1KH 3HC0A 5KSBB 1VACB 3EGDA 4OJFH 5GGSB 5DO2D 1NLDL 1O7DC 1XR8A 5EB9A 2J57A 3KL5A 2QBWA 4OGAD 2VDQL 5E6RB 1YN6A 2K8QA 3AS1A 5TE7H 3CN3A 5ISVA 3I9GL 3LDBC 3DTUB 5FCUL 4OC2A 4Q0XL 3OJDA 4G9FD 4Z7WA 3SI1A 3FCBA 5DJZB 2NSMA 4AGLA 2KQMA 1MW2A 3IJYB 4G42B 5DHVB 3RY6C 4F8LA 1VFUA 5F1NB 1KB5A 1BQUA 1U4EA 2KLSA 4O2FA 1R3HB 2IALB 2JF1A 2FLBT 4PJXE 3P0YH 5JHAA 3QUML 4E9WA 3A22A 3OJMB 3FU7B 5ENWB 3CFCL 5DFVD 1HL5A 4P2QD 2OI9B 4M4PA 4XP1H 5DWUH 1WA1X 3FUDA 3MRPB 4LPTA 5JOPD 3ABGA 3L7EB 2XEGA 5CBEB 3FDWA 1OCWL 3LNDA 1PFOA 2MNWA 5DRWB 2J4WL 2P9RA 4NGSA 5DC2A 5GS1B 5IQ7H 1I9IL 4E5XG 1JNNL 3TEZA 4CU7A 1T21A 4K5NA 4XCFL 1NUNB 1C7SA 1NBZB 4GBXB 5F1SA 1RTQA 1G6RH 3CPUA 3BJLA 4JDZB 4P2RB 3WNLA 4YSQA 3WFEH 2V33A 3L1EA 2X87A 2HKFL 3ARDB 2PYFB 2A9MH 2R56H 3MVSA 2KHAA 3FN0L 4AL8H 3EZ8A 3HUJA 4YL4A 1ZTXE 3DLJA 3NVQA 2B39A 4OCWH 4X5KA 4S1SH 5LCVH 4Y19D 3MV01 4PQAA 3RBUA 1AGCB 1KENH 4JGMA 4WI0A 4YK4B 3UBXA 4Q97A 4QLRA 2JDDA 1WT5C 2VM4A 4KKCD 4F2FA 4HWEH 2QGEA 3PNWB 1ZVHA 4JFUA 1OBRA 3RVXD 4JKWA 3QHZL 2ZXBA 3P9LB 1PX8A 4AZ8A 2HB6A 3GB7B 3ZSSA 1E4WH 2X4TA 3KR3L 3N1FC 4ZFGH 4ZMNA 5JNYB 5KS9A 3OR7B 5EEWA 2IBGA 2YPVL 4MAYD 3PAVA 3REWB 5F7HA 1G7LA 4XT1C 4KV5E 5IJVB 1MELA 4P46D 1BLNB 5ALBH 2EH8L 4YHIB 2EDDA 2FATL 1SF3A 1RUKL 1KPRB 2EDOA 2FWLB