1B6BA

Melatonin biosynthesis: the structure of serotonin n-acetyltransferase at 2.5 a resolution suggests a catalytic mechanism
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
168
structure length
168
Chain Sequence
ANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSLRGHAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (ARYLALKYLAMINE N-ACETYLTRANSFERASE)
publication title Melatonin biosynthesis: the structure of serotonin N-acetyltransferase at 2.5 A resolution suggests a catalytic mechanism.
pubmed doi rcsb
source organism Ovis aries
total genus 43
structure length 168
sequence length 168
chains with identical sequence B
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 1999-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1b6bA00
2FL4A 4UWIA 3MGDA 5H84A 5HH1A 3F5BA 1CJWA 1IICA 3BJ8A 4RI1A 4XPDB 3TO6A 1GHEA 4B5PB 4R3LA 3N7ZA 2ARHA 2C27A 2OH1A 3ZJ0A 5J8CA 1NMTA 2OU2A 1YVOA 2PR1A 4KVOE 5FVJA 4ORFA 4JD6A 3CXSA 2PR8A 3TE4A 2REEA 2QIRA 2ZXVA 2B3UA 2BUEA 2BSWA 4KVME 2B3VA 4KLWA 2PSWA 3TO7A 2VBQA 4AVBA 3F8KA 2VEZA 2FCKA 2KCWA 4YFJA 4UA3A 1KUXA 1BOBA 2F5IA 2ZPAA 4FD6A 1S5KA 3CXPA 5KTDA 2FT0A 3I9SA 5H86A 1Z4EA 4CS0B 2DXQA 2FIAA 4M3SA 4PSWA 2PDOA 4R57A 1XMTA 2P0WA 4PV6A 3R1KA 2VQYA 3FNCA 5ISVA 4IF5A 5JPHA 1WK4A 1ON0A 5DWNA 5HMNA 3S6HA 4R9MA 2Y0MA 5JQ4A 2Q7BA 5I0CA 4XPDC 1S60A 2GE3A 2VXKA 4ZBGA 3W91A 1KUYA 3PP9A 2R8VA 1YREA 2VZYA 4H6ZA 2I00A 2NMTA 3IWGA 1PU9A 2AJ6A 1V0CA 1PUAA 1NE9A 4B5PA 1RXTA 3GY9A 3GKRA 4KORA 2IL4A 2WPWA 4I49A 4QB9A 3BJ7A 1S3ZA 1Y7RA 2Q4YA 3B8GA 3QAHA 4PSXA 2CNMA 4JLYA 2Z10A 2R1IA 1IB1E 2P6GA 1YX0A 1QSOA 2X7BA 2ZW5A 4J3GA 3V8IA 3R9EA 3VWEA 4B5OA 2PC1A 1VHSA 1YLEA 3LD2A 1Y9KA 4AG9A 1S7KA 2BEIA 1QSNA 1M44A 3DSBA 1UFHA 4KVXA 2J8MA 3WR7A 5IX3A 4YGOA 3S6KA 4U9ZA 2P6EA 2JDCA 4MY0A 3TFYA 4AB7A 4R3KA 3E0KA 4CAVA 4UBRA 3DR6A 3EXNA 1OZPA 1SQHA 4U9YA 2Q4VA 1B87A 1IIDA 4MJ8A 4ONUA 2PQ8A 3DDDA 4KOUA 1B6BA 3R95A 2Q04A 3T90A 4E2AA 1KUVA 2EVNA 1RO5A 1M1DA 4F6AA 3K9UA 4Y49B 4MBUA 4LUAA 4AVAA 1YK3A 5DWMA 2HV2A 4L8AA 2G3AA 4PK2A 1M4IA 3FRMA 4BMHA 3FXTA 1IYLA 4DNCA 5C88A 4CAWA 2CNTA 4QUSA 1K4JA 2CY2A 3TT2A 3W6XA 1KZFA 1S7NA 3EO4A 2FIWA 4AVCA 3R96A 1QSRA 1MJAA 1WWZA 3P2HA 4CRYB 1P4NA 4K30A 3IGRA 4KOSA 5E96A 3FIXA 2ZW4A 2AE6A 3ZZIA 3EC4A 5GCNA 2GIVA 1BO4A 4KOYA 4KZTA 2Q44A 4NEXA 1Q2DA 5KTAA 2FXFA 3EFAA 3KKWA 3P2FA 4KUAA 2JLMA 4HKFA 4II9A 4UWJA 4X5KA 4NCZA 4OAEA 4EVYA 2OZHA 2QMLA 1QSMA 2REFA 2CNSA 2Q0YA 1XE4A 3OWCA 1U6MA 3TOBA 4Y49C 4HNWB 4YRHA 4HNYB 3JUWA 1XIXA 3H4QA 2P6FA 2B4DB 2G3TA 4NXYA 2OZUA 3PZJA 4LX9A 3EY5A 3TCVA 4PK3A 3S6GA 3D2PA 5IB0A 1YVKA 4MY3A 1MJBA 4CAXA 2HQYA 3F0AA 1MK4A 3D8PA 1YR0A 3DR8A 3QB8A 5IV0A 1Q2CA 1MJ9A 4JWPA 4KLVA 2J8RA 2FS5A 4XPLA 5F47A 1VKCA 1Z4RA 4MHDA 1M4DA 2PRBA 5F46A 1M4GA 4L89A 4FD4A 1YGHA 5J8FA 5CNPA 1CM0A 1I1DA 3PGPA 4KOTA 2VI7A 4NSQA 4OADA 4QBJA 2R7HA 1J4JA 3TTHA 2J8NA 2FSRA 2ZW6A 3RYOA 3W6SA 3TO9A 3GYAA 3G3SA 2FE7A 2JEVA 4H6UA 4F0YA 1P0HA 4JJXA 1IYKA 3C26A 4U5YA 2O28A 2VZZA 4FD5A 5KTCA 3D2MA 2B5GB 3T9YA 1QSTA 4R87A 2D4PA 2B4BA 3G8WA 1L0CA 5C82A 2B4DA 2JDDA 4KOXA 2QECA 3R9GA 2WPXA 2D4OA 4XNHB 2OZGA 3R9FA 1S7LA 2BL1A 1TIQA 4QC6A 2R98A 2HUZA 3VWDA 1FY7A 3SXOA 3NE7A 3SHPA 1R57A 2I79A 3UY5A 2OB0A 1I12A 4NF1A 2H5MA 5EC4A 4RS2A 1LRZA 1XF8A 4KUBA 4KOWA 1XEBA 4IUSA 5F49A 3S6FA 3TOAA 2GANA 4M85A 2ZW7A 4KOVA 4JXRA 3LODA 2Z11A 4AG7A 2ATRA 2Z0ZA 1S7FA 4FD7A 3DNSA 4MI4A 4GS4A 1I21A 3FB3A 1NSLA 4H89A 2B58A 3FYNA 4JXQA 3CXQA 2B5GA 2EUIA 1Z9UA 3BLNA 4XPKA 4E8OA 4QVTA 3FBUA 4XNHC 3I3GA 5F48A 4OLLA 2A4NA 2G0BA 1Y9WA 3JVNA 3SXNA 1N71A 2RC4A 4HNXB 4CRZB 1Q2YA 5EBVA 2K5TA 3D3SA 4E0AA
chains in the Genus database with same CATH superfamily
2FL4A 4UWIA 3MGDA 5H84A 4F8ZA 5HH1A 3F5BA 4BINA 4ONWA 1CJWA 1IICA 4UCMA 4P6YA 3BJ8A 4RI1A 3SI0A 3S9LA 4MMOA 3CPAA 2AFWA 4XPDB 3TO6A 2JBJA 1GHEA 3NE8A 4M6GA 4NJRA 4NFRA 4A39A 3WC6A 4YU9A 4R3LA 3D66A 5LRGA 4B5PB 4Q36A 1X12A 3N7ZA 4ZY0A 5CBMA 2ARHA 2C27A 2OH1A 3ZJ0A 5J8CA 1NMTA 2OU2A 1ZG7A 1YVOA 2PR1A 4KVOE 1VHOA 5FVJA 3VARA 4ORFA 1AMPA 1IU8A 2CIJA 3CXSA 4JD6A 2PR8A 3TE4A 4C2XA 1Z8TA 2PJ7A 2REEA 2ZEPA 2QIRA 2ZXVA 3PFOA 2B3UA 2BUEA 1CBXA 3MRUA 4DYOA 2BSWA 3B3CA 2JBKA 3HUVA 4KVME 2B3VA 4KLWA 3PEIA 4CYNA 2PSWA 2NSMA 2ZEHA 3TO7A 2VBQA 1GYTA 4KSAA 3QAYA 4AVBA 3F8KA 1YLOA 4KSIA 1LAPA 2AFUA 1TKJA 2VEZA 2FCKA 2WUUA 4OC0A 4Q38A 2PJBA 2KCWA 4YFJA 4UA3A 4MFQA 1KUXA 2JEWA 4MFZA 1BOBA 2F5IA 2YNDA 2ZELA 1XBUA 2ZPAA 3L2NA 4CGPA 4FD6A 4M6HA 1S5KA 5G20A 3FH4A 3PB9X 4PXCA 5G21A 2ZEFA 3CXPA 4EWTA 5KTDA 1Q7LA 2EBJA 4DUKA 2FT0A 3I9SA 5H86A 1Z4EA 4CS0B 4A95A 2DXQA 2FIAA 5J1QA 4M3SA 4PSWA 2PDOA 4R57A 4MHZA 1XMTA 5AG4A 2P0WA 4WWVA 1X10A 1XRYA 2O4HA 3R1KA 4PV6A 3WC7A 4TNUA 2C1CA 2VQYA 3FNCA 5ISVA 1YW4A 4IF5A 5D29A 1WK4A 5JPHA 1ON0A 3PBBA 5DWNA 5HMNA 4UF4A 3S6HA 1CX8A 4MCSA 4R9MA 2AFXA 2Y0MA 4B12A 4OKOA 4BD9A 5JQ4A 4OC3A 4P4FA 4UIAA 2Q7BA 5I0CA 1HDQA 3PB6X 4XPDC 3B3TA 3JRUA 1S60A 2GE3A 2VXKA 2XEIA 3NFZA 4ZBGA 1KUYA 3W91A 3KL9A 4GXHA 2PJ5A 8CPAA 3PP9A 1NSAA 2R8VA 4P4DA 1YREA 2VZYA 3NH8A 4ZX8A 4YWYA 4H6ZA 5LYFA 2I3CA 1RTQA 2I00A 3IO1A 2NMTA 3IWGA 1PU9A 3KQXA 2AJ6A 4X8IA 4CPAA 2ZEMA 5DS0A 5A27A 1V0CA 1PUAA 1LANA 1NE9A 4B5PA 1RXTA 1OBRA 3IFEA 4A94A 3GY9A 3SI2A 2PVVA 1CPSA 3GKRA 2PVWA 4KORA 1VIXA 4CGNA 3D7DA 5HVHA 3MN8A 2IL4A 2WPWA 4I49A 4QB9A 3BJ7A 3RBUA 1TXRA 1S3ZA 1Y7RA 2IQ6A 4NGMA 3H8GA 2Q4YA 3H8EA 5K8MA 4II9A 3B8GA 3QAHA 4FAIA 1Z2LA 2AFMA 4PSXA 2C6GA 2CNMA 2DEAA 2PJ8A 4JLYA 2Z10A 2R1IA 1IB1E 2P6GA 1YX0A 1QSOA 2X7BA 2ZW5A 2C6CA 2NYQA 4EMEA 4UEFA 2Q51A 3CZXA 4J3GA 3GB0A 3QNVA 3V8IA 3R9EA 3VWEA 4UEZA 4ZGYB 5JM6A 3D4UA 4B5OA 2PC1A 1ZG9A 1VHSA 1YLEA 3GLJA 3LD2A 1Y9KA 3DGVA 2ANPA 3GIUA 2PRQA 2IJZA 4AG9A 1S7KA 2F8HA 2Z3PA 3K9TA 1M4LA 2DF5A 4GM5A 2BEIA 4OC2A 1QSNA 3FECA 2Q4ZA 2OR4A 1M44A 1ARLA 3DSBA 4KS9A 1UFHA 2PJ3A 4KVXA 2J8MA 2PJ2A 3WR7A 5LRKA 5IX3A 4YGOA 3KHXA 3S6KA 4U9ZA 4MHYA 2P6EA 4MFKA 7CPAA 4RUHA 4B13A 2JDCA 4MY0A 3SJXA 1XMBA 2CF4A 1Y0RA 2GLJA 3TFYA 5G22A 2Z3OA 4R3KA 5AG6A 3E0KA 4AB7A 4B10A 5A28A 4CAVA 4UBRA 3DR6A 3EXNA 4C68A 1OZPA 2ZEGA 1SQHA 4U9YA 4FWUA 2Q4VA 4X2TA 1JWQA 1B87A 3VH9A 1IIDA 4MJ8A 4ONUA 1TKHA 4A2ZA 2PQ8A 4CYOA 3DDDA 3KI9A 1B6BA 1Y0YA 4KOUA 3D68A 3CDXA 3NA6A 3FEEA 3R95A 1YQEA 2Q04A 3T90A 1TKFA 4E2AA 2ZEDA 1FNOA 1KUVA 2EVNA 1IY7A 2GREA 3ISZA 1RO5A 1ZG8A 1M1DA 4P4BA 3V7ZA 4F6AA 3K9UA 4MXUA 2IMOA 4Y49B 2ODFA 5HVGA 4UFVA 3WABA 4MBUA 1CPXA 4LUAA 4AVAA 5K8PA 1YK3A 5DWMA 2HV2A 5LYLA 4L8AA 2G3AA 4PK2A 4K3NA 4LQ6A 1M4IA 3KASA 3FRMA 1DE4C 3NH5A 5THWA 4CAEA 4W9YA 2QVPA 4BMHA 4EFDA 5ELYA 3FXTA 2VL1A 1IYLA 4DNCA 5C88A 4CAWA 2CNTA 3D7FA 4QUSA 1K4JA 2CY2A 5AG5A 3TT2A 1Z8WA 1F2OA 1KZFA 3W6XA 1S7NA 3EO4A 2FIWA 4A32A 4AVCA 4OIDA 1LAMA 4A31A 3R96A 1LCPA 2V8VA 1QSRA 1MJAA 1WWZA 3P2HA 2EWBA 4CRYB 2AFOA 1UWYA 3RAMA 1A2ZA 1P4NA 3IGRA 4K30A 4OC4A 2F7VA 2QJ8A 4UEEA 4KOSA 1EE3P 2GFQA 5E96A 3S9MA 3FIXA 3IU1A 4ZYQA 4A30A 2ZW4A 2AE6A 2CTBA 5G1ZA 3EC4A 3ZZIA 1VGYA 2Z3MA 1CP6A 5GCNA 1QQ9A 4R7MA 2GIVA 1BO4A 1DTDA 2EK8A 3B2YA 2Q44A 4KOYA 1Q2DA 4KZTA 2FXFA 3EFAA 3KKWA 4NEXA 5KTAA 3P2FA 4KUAA 3B35A 2JLMA 1LFWA 2YNEA 1VHEA 2AFZA 3IC1A 4HKFA 4M6IA 4NGNA 4UWJA 4A38A 5HXDA 4X5KA 4CGLA 4NGSA 4NCZA 3PB8X 4X3RA 4OAEA 4EVYA 1TF8A 3KZWA 2OZHA 1YSJA 2QMLA 3FEDA 5AG7A 2DPTA 1QSMA 2HC9A 2REFA 2YNCC 4UIBA 4C7IA 2CNSA 2Q0YA 1XE4A 3OWCA 3N5FA 1U6MA 1XJOA 4RN7A 3PB4X 3TC8A 2PJ4A 3GUXA 4B14A 4H2KA 1FT7A 2GLFA 3K2KA 3BI0A 3NH4A 2YNCA 3TOBA 4Y49C 4F0XA 4HNWB 4YRHA 2ZENA 4HNYB 5K8OA 3D67A 3JUWA 2EO8A 3IEHA 1XIXA 4OC1A 3H4QA 2P6FA 3KR5A 4IK2A 4OP4A 2B4DB 2G3TA 2FVGA 2OZUA 4NXYA 3PZJA 4LX9A 3WT4A 3EY5A 1ARMA 4UCPA 1IOIA 3TCVA 4F9VA 4PK3A 3S6GA 2AFSA 3IWWA 3D2PA 5IB0A 1PYTB 4CYQA 1YVKA 4OC5A 4MY3A 2BCOA 1MJBA 1XFOA 3KR4A 4CAXA 2HQYA 3ISXA 3F0AA 2WYRA 1MK4A 2O53A 1TF9A 3D8PA 4P45A 1BAVA 1YR0A 3I1UA 3DR8A 3QB8A 5BWAB 1YMEA 4FBEA 2DPSA 4CGMA 2POKA 3SI1A 1CG2A 4ZY2A 5IV0A 2V8GA 1Q2CA 1MJ9A 4MFJA 5D8NA 2RB7A 4PXBA 3BHXA 4JWPA 4P4EA 3A9LA 2Z3KA 4KLVA 2J8RA 2FS5A 4XPLA 5F47A 1ELMP 1VKCA 1Z4RA 4OMEA 5EMIA 4NJQA 4HPSA 4MHDA 2ABZA 1M4DA 2PRBA 4ZI6A 5F46A 1M4GA 1ZLIA 3JTKA 1XOVA 3FJUA 4FD4A 4L89A 1YGHA 3VATA 5J8FA 3HLPA 4P10A 5CNPA 1CM0A 1I1DA 3PGPA 3B3SA 4CGOA 3LACA 4KOTA 2VI7A 4NSQA 2WSAA 3PBEA 4OADA 4QBJA 2R7HA 4MRIA 4FUUA 1J4JA 3TTHA 2J8NA 2FSRA 2ZW6A 1ZO0A 4IHMA 3RYOA 3W6SA 3TO9A 1LOKA 3S9NA 3GYAA 3G3SA 4MCRA 2FE7A 2ZEEA 4NGPA 5JGFA 2JEVA 5F09A 4H6UA 1IOFA 3T8WA 4F0YA 2V77A 5HVFA 5K8NA 4MCQA 1P0HA 5JH9A 4JJXA 1IYKA 2PJ9A 2Q43A 3C26A 3FVLA 2C6PA 4U5YA 4MHNA 3TX8A 2O28A 2VZZA 4FD5A 3H5ZA 4UFXA 5KTCA 3D2MA 2B5GB 1YW6A 4A33A 3DLJA 3T9YA 1IGBA 3B3WA 1QSTA 4R87A 1AYEA 1PCAA 6CPAA 2D4PA 4OIWA 5IB9A 3B3VA 1HDUA 2B4BA 1BPMA 1L0CA 3G8WA 4P4JA 3FMCA 3SJGA 1CP7A 2B4DA 5C82A 2JDDA 4KOXA 4O23A 2QECA 2ZEOA 3R9GA 2CXAA 4KSFA 2WPXA 1BLLE 2D4OA 2EK9A 2OZGA 2PCUA 1S7LA 3KHZA 4R8FA 4XNHB 3R9FA 2BL1A 1ZLHA 3D7HA 1TIQA 2J9AA 2QYVA 2R98A 2HUZA 4QC6A 1ELLP 4ZX9A 2ZOFA 3VWDA 1FY7A 2PJAA 3RZAA 3SXOA 3LWUA 4NGTA 3NE7A 2PJCA 3SHPA 1R57A 2I79A 2HB6A 5LRJA 3UY5A 4ZY1A 2OB0A 2Z3NA 3CPXA 4LQGA 4NGRA 1I12A 4Q7AA 4MCPA 4TWEA 4NF1A 4R76A 2H5MA 3FF3A 4NGQA 1LRZA 4RS2A 5EC4A 3CT9A 3IJ3A 1XF8A 1H8LA 5LYIA 4BBHA 1Z8LA 5LYDA 1HEEA 4JZ0A 4KUBA 4Z65A 2XEJA 4KOWA 1XEBA 2XEFA 4IUSA 4P44A 5F49A 2ZOGA 3PFEA 4JYWA 2WZNA 2Z3LA 4UCNA 2PIYA 3SJEA 2BOAA 3S6FA 3TOAA 1R43A 2G9DA 2GU2A 3WC5A 2GANA 1R3NA 3IIBA 4M85A 4DJLA 2PJ0A 3B7IA 4CYPA 4MFPA 3RO0A 2ZW7A 4KOVA 1Z5RA 2PJ6A 4JXRA 3LMSA 3LODA 2Z11A 4A37A 4C2YA 3KQZA 2ATRA 2Z0ZA 4AG7A 1S7FA 2YGWA 4FD7A 4C7HA 1KWMA 5I4MA 3BXMA 3DNSA 3PB7X 4MI4A 4GS4A 5AGEA 1F2PA 2RFHA 1I21A 4UFWA 1QMUA 1AUGA 3FB3A 1BPNA 3IWEA 3KGQA 4G1PA 4AXVA 4MHPA 1NSLA 4PXDA 2CTCA 4H89A 4F9UA 4C2ZA 2B58A 1Y7EA 3FYNA 4JXQA 3V38A 4PQAA 1F57A 3RNZA 4B11A 5CPAA 3CXQA 3BI1A 4B6ZA 4CAFA 2B5GA 2EUIA 2XEGA 2Q7SA 3FX6A 3PRTA 2PE3A 1Z9UA 3BLNA 1Z8XA 3IU2A 2PIZA 4XPKA 4E8OA 4PPZA 4QVTA 3SJFA 3FBUA 3D7GA 3I3GA 4XNHC 5F48A 4WJBA 4PXEA 2BO9A 1JQGA 4OLLA 2A4NA 2G0BA 1Y9WA 2V8DA 3JVNA 2PJ1A 3SXNA 1N71A 2RC4A 3H8FA 4R6TA 4HNXB 4CRZB 1Q2YA 4MFLA 5EBVA 4IAVA 4P4IA 2K5TA 2V8HA 2OOTA 3D3SA 4E0AA
chains in the Genus database with same CATH topology
2FL4A 4UWIA 3MGDA 5H84A 5HH1A 3F5BA 1CJWA 1IICA 4UCMA 3BJ8A 4RI1A 4XPDB 3TO6A 1GHEA 4B5PB 4R3LA 4Q36A 3N7ZA 2ARHA 2C27A 2OH1A 3ZJ0A 5J8CA 1NMTA 2OU2A 1YVOA 2PR1A 4KVOE 5FVJA 4ORFA 4JD6A 3CXSA 2PR8A 3TE4A 4C2XA 2REEA 2QIRA 2ZXVA 2B3UA 2BUEA 2BSWA 4KVME 2B3VA 4KLWA 2PSWA 3TO7A 2VBQA 4KSAA 4AVBA 3F8KA 2VEZA 2FCKA 2WUUA 4Q38A 2KCWA 4YFJA 4UA3A 4MFQA 1KUXA 4MFZA 1BOBA 2F5IA 2YNDA 2ZPAA 4CGPA 4FD6A 1S5KA 5G20A 5G21A 3CXPA 5KTDA 2FT0A 3I9SA 5H86A 1Z4EA 4CS0B 4A95A 2DXQA 2FIAA 4M3SA 4PSWA 2PDOA 4R57A 1XMTA 5AG4A 2P0WA 4PV6A 3R1KA 2VQYA 3FNCA 5ISVA 4IF5A 5JPHA 1WK4A 1ON0A 5DWNA 5HMNA 3S6HA 4R9MA 2Y0MA 4B12A 5JQ4A 2Q7BA 5I0CA 4XPDC 1S60A 2GE3A 2VXKA 4ZBGA 3W91A 4CYNA 1KUYA 3PP9A 2R8VA 1YREA 2VZYA 4H6ZA 2I00A 2NMTA 3IWGA 1PU9A 2AJ6A 5A27A 1V0CA 1PUAA 1NE9A 4B5PA 1RXTA 3GY9A 3GKRA 4KORA 4CGNA 2IL4A 2WPWA 4I49A 4QB9A 3BJ7A 1S3ZA 1Y7RA 2Q4YA 3B8GA 3QAHA 4PSXA 2CNMA 4JLYA 2Z10A 2R1IA 1IB1E 2P6GA 1YX0A 1QSOA 2X7BA 2ZW5A 4J3GA 3V8IA 3R9EA 3VWEA 4ZGYB 4B5OA 2PC1A 1VHSA 1YLEA 3LD2A 1Y9KA 4AG9A 1S7KA 2Z3PA 2BEIA 1QSNA 1M44A 3DSBA 4KS9A 1UFHA 4KVXA 2J8MA 3WR7A 5IX3A 4YGOA 3S6KA 4U9ZA 2P6EA 4MFKA 4B13A 2JDCA 4MY0A 3TFYA 5G22A 2Z3OA 4R3KA 5AG6A 3E0KA 4AB7A 4B10A 5A28A 4CAVA 4UBRA 3DR6A 3EXNA 4C68A 1OZPA 1SQHA 4U9YA 2Q4VA 1B87A 1IIDA 4MJ8A 4ONUA 4A2ZA 2PQ8A 4CYOA 3DDDA 4KOUA 1B6BA 3R95A 2Q04A 3T90A 4E2AA 1KUVA 2EVNA 1RO5A 1M1DA 4F6AA 3K9UA 4Y49B 4UFVA 4MBUA 4LUAA 4AVAA 1YK3A 5DWMA 2HV2A 4L8AA 2G3AA 4PK2A 1M4IA 3FRMA 4CAEA 4BMHA 3FXTA 1IYLA 4DNCA 5C88A 4CAWA 2CNTA 4QUSA 1K4JA 2CY2A 5AG5A 3TT2A 3W6XA 1KZFA 1S7NA 3EO4A 2FIWA 4A32A 4AVCA 4A31A 3R96A 1QSRA 1MJAA 1WWZA 3P2HA 4CRYB 1P4NA 3IGRA 4K30A 4KOSA 5E96A 3FIXA 3IU1A 4A30A 2ZW4A 2AE6A 5G1ZA 3ZZIA 3EC4A 2Z3MA 5GCNA 2GIVA 1BO4A 4KOYA 4KZTA 2Q44A 4NEXA 1Q2DA 5KTAA 2FXFA 3EFAA 3KKWA 3P2FA 4KUAA 2JLMA 4HKFA 2YNEA 4II9A 4UWJA 4X5KA 4CGLA 4NCZA 4OAEA 4EVYA 2OZHA 2QMLA 5AG7A 2DPTA 1QSMA 2REFA 2YNCC 4C7IA 2CNSA 2Q0YA 1XE4A 3OWCA 1U6MA 4B14A 2YNCA 3TOBA 4Y49C 4F0XA 4HNWB 4YRHA 4HNYB 3JUWA 1XIXA 3H4QA 2P6FA 2B4DB 2G3TA 4NXYA 2OZUA 3PZJA 4LX9A 3EY5A 4UCPA 3TCVA 4PK3A 3S6GA 3D2PA 5IB0A 4CYQA 1YVKA 4MY3A 1MJBA 4CAXA 2HQYA 3F0AA 1MK4A 3D8PA 1YR0A 3DR8A 3QB8A 5BWAB 2DPSA 4CGMA 5IV0A 1Q2CA 1MJ9A 4MFJA 4JWPA 3A9LA 2Z3KA 4KLVA 2J8RA 2FS5A 4XPLA 5F47A 1VKCA 1Z4RA 4MHDA 1M4DA 2PRBA 5F46A 1M4GA 3JTKA 4L89A 4FD4A 1YGHA 5J8FA 5CNPA 1CM0A 1I1DA 3PGPA 4CGOA 4KOTA 2VI7A 4NSQA 2WSAA 4OADA 4QBJA 2R7HA 1J4JA 3TTHA 2J8NA 2FSRA 2ZW6A 1ZO0A 3RYOA 3W6SA 3TO9A 3GYAA 3G3SA 2FE7A 2JEVA 4H6UA 4F0YA 1P0HA 4JJXA 1IYKA 3C26A 4U5YA 2O28A 2VZZA 4FD5A 3H5ZA 4UFXA 5KTCA 3D2MA 2B5GB 4A33A 3T9YA 1QSTA 4R87A 2D4PA 2B4BA 3G8WA 1L0CA 5C82A 2B4DA 2JDDA 4KOXA 2QECA 3R9GA 2CXAA 4KSFA 2WPXA 2D4OA 4XNHB 2OZGA 3R9FA 1S7LA 2BL1A 1TIQA 4QC6A 2R98A 2HUZA 3VWDA 1FY7A 3SXOA 3NE7A 3SHPA 1R57A 2I79A 3UY5A 2OB0A 2Z3NA 1I12A 4NF1A 2H5MA 5EC4A 4RS2A 1LRZA 1XF8A 4BBHA 4KUBA 4KOWA 1XEBA 4IUSA 5F49A 2Z3LA 4UCNA 3S6FA 3TOAA 2GANA 4M85A 4CYPA 4MFPA 2ZW7A 4KOVA 4JXRA 3LODA 2Z11A 4C2YA 4AG7A 2ATRA 2Z0ZA 1S7FA 2YGWA 4FD7A 4C7HA 3DNSA 4MI4A 4GS4A 5AGEA 4UFWA 1I21A 3FB3A 3IWEA 1NSLA 4H89A 4C2ZA 2B58A 3FYNA 4JXQA 4B11A 3CXQA 4CAFA 2B5GA 2EUIA 1Z9UA 3BLNA 3IU2A 4XPKA 4E8OA 4QVTA 3FBUA 4XNHC 3I3GA 5F48A 4OLLA 2A4NA 2G0BA 1Y9WA 3JVNA 3SXNA 1N71A 2RC4A 4HNXB 4CRZB 1Q2YA 4MFLA 5EBVA 2K5TA 3D3SA 4E0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FL4 A;  4UWI A;  3MGD A;  5H84 A;  5HH1 A;  3F5B A;  1CJW A;  1IIC A;  3BJ8 A;  4RI1 A;  4XPD B;  3TO6 A;  1GHE A;  4B5P B;  4R3L A;  3N7Z A;  2ARH A;  2C27 A;  2OH1 A;  3ZJ0 A;  5J8C A;  1NMT A;  2OU2 A;  1YVO A;  2PR1 A;  4KVO E;  5FVJ A;  4ORF A;  4JD6 A;  3CXS A;  2PR8 A;  3TE4 A;  2REE A;  2QIR A;  2ZXV A;  2B3U A;  2BUE A;  2BSW A;  4KVM E;  2B3V A;  4KLW A;  2PSW A;  3TO7 A;  2VBQ A;  4AVB A;  3F8K A;  2VEZ A;  2FCK A;  2KCW A;  4YFJ A;  4UA3 A;  1KUX A;  1BOB A;  2F5I A;  2ZPA A;  4FD6 A;  1S5K A;  3CXP A;  5KTD A;  2FT0 A;  3I9S A;  5H86 A;  1Z4E A;  4CS0 B;  2DXQ A;  2FIA A;  4M3S A;  4PSW A;  2PDO A;  4R57 A;  1XMT A;  2P0W A;  4PV6 A;  3R1K A;  2VQY A;  3FNC A;  5ISV A;  4IF5 A;  5JPH A;  1WK4 A;  1ON0 A;  5DWN A;  5HMN A;  3S6H A;  4R9M A;  2Y0M A;  5JQ4 A;  2Q7B A;  5I0C A;  4XPD C;  1S60 A;  2GE3 A;  2VXK A;  4ZBG A;  3W91 A;  1KUY A;  3PP9 A;  2R8V A;  1YRE A;  2VZY A;  4H6Z A;  2I00 A;  2NMT A;  3IWG A;  1PU9 A;  2AJ6 A;  1V0C A;  1PUA A;  1NE9 A;  4B5P A;  1RXT A;  3GY9 A;  3GKR A;  4KOR A;  2IL4 A;  2WPW A;  4I49 A;  4QB9 A;  3BJ7 A;  1S3Z A;  1Y7R A;  2Q4Y A;  3B8G A;  3QAH A;  4PSX A;  2CNM A;  4JLY A;  2Z10 A;  2R1I A;  1IB1 E;  2P6G A;  1YX0 A;  1QSO A;  2X7B A;  2ZW5 A;  4J3G A;  3V8I A;  3R9E A;  3VWE A;  4B5O A;  2PC1 A;  1VHS A;  1YLE A;  3LD2 A;  1Y9K A;  4AG9 A;  1S7K A;  2BEI A;  1QSN A;  1M44 A;  3DSB A;  1UFH A;  4KVX A;  2J8M A;  3WR7 A;  5IX3 A;  4YGO A;  3S6K A;  4U9Z A;  2P6E A;  2JDC A;  4MY0 A;  3TFY A;  4AB7 A;  4R3K A;  3E0K A;  4CAV A;  4UBR A;  3DR6 A;  3EXN A;  1OZP A;  1SQH A;  4U9Y A;  2Q4V A;  1B87 A;  1IID A;  4MJ8 A;  4ONU A;  2PQ8 A;  3DDD A;  4KOU A;  1B6B A;  3R95 A;  2Q04 A;  3T90 A;  4E2A A;  1KUV A;  2EVN A;  1RO5 A;  1M1D A;  4F6A A;  3K9U A;  4Y49 B;  4MBU A;  4LUA A;  4AVA A;  1YK3 A;  5DWM A;  2HV2 A;  4L8A A;  2G3A A;  4PK2 A;  1M4I A;  3FRM A;  4BMH A;  3FXT A;  1IYL A;  4DNC A;  5C88 A;  4CAW A;  2CNT A;  4QUS A;  1K4J A;  2CY2 A;  3TT2 A;  3W6X A;  1KZF A;  1S7N A;  3EO4 A;  2FIW A;  4AVC A;  3R96 A;  1QSR A;  1MJA A;  1WWZ A;  3P2H A;  4CRY B;  1P4N A;  4K30 A;  3IGR A;  4KOS A;  5E96 A;  3FIX A;  2ZW4 A;  2AE6 A;  3ZZI A;  3EC4 A;  5GCN A;  2GIV A;  1BO4 A;  4KOY A;  4KZT A;  2Q44 A;  4NEX A;  1Q2D A;  5KTA A;  2FXF A;  3EFA A;  3KKW A;  3P2F A;  4KUA A;  2JLM A;  4HKF A;  4II9 A;  4UWJ A;  4X5K A;  4NCZ A;  4OAE A;  4EVY A;  2OZH A;  2QML A;  1QSM A;  2REF A;  2CNS A;  2Q0Y A;  1XE4 A;  3OWC A;  1U6M A;  3TOB A;  4Y49 C;  4HNW B;  4YRH A;  4HNY B;  3JUW A;  1XIX A;  3H4Q A;  2P6F A;  2B4D B;  2G3T A;  4NXY A;  2OZU A;  3PZJ A;  4LX9 A;  3EY5 A;  3TCV A;  4PK3 A;  3S6G A;  3D2P A;  5IB0 A;  1YVK A;  4MY3 A;  1MJB A;  4CAX A;  2HQY A;  3F0A A;  1MK4 A;  3D8P A;  1YR0 A;  3DR8 A;  3QB8 A;  5IV0 A;  1Q2C A;  1MJ9 A;  4JWP A;  4KLV A;  2J8R A;  2FS5 A;  4XPL A;  5F47 A;  1VKC A;  1Z4R A;  4MHD A;  1M4D A;  2PRB A;  5F46 A;  1M4G A;  4L89 A;  4FD4 A;  1YGH A;  5J8F A;  5CNP A;  1CM0 A;  1I1D A;  3PGP A;  4KOT A;  2VI7 A;  4NSQ A;  4OAD A;  4QBJ A;  2R7H A;  1J4J A;  3TTH A;  2J8N A;  2FSR A;  2ZW6 A;  3RYO A;  3W6S A;  3TO9 A;  3GYA A;  3G3S A;  2FE7 A;  2JEV A;  4H6U A;  4F0Y A;  1P0H A;  4JJX A;  1IYK A;  3C26 A;  4U5Y A;  2O28 A;  2VZZ A;  4FD5 A;  5KTC A;  3D2M A;  2B5G B;  3T9Y A;  1QST A;  4R87 A;  2D4P A;  2B4B A;  3G8W A;  1L0C A;  5C82 A;  2B4D A;  2JDD A;  4KOX A;  2QEC A;  3R9G A;  2WPX A;  2D4O A;  4XNH B;  2OZG A;  3R9F A;  1S7L A;  2BL1 A;  1TIQ A;  4QC6 A;  2R98 A;  2HUZ A;  3VWD A;  1FY7 A;  3SXO A;  3NE7 A;  3SHP A;  1R57 A;  2I79 A;  3UY5 A;  2OB0 A;  1I12 A;  4NF1 A;  2H5M A;  5EC4 A;  4RS2 A;  1LRZ A;  1XF8 A;  4KUB A;  4KOW A;  1XEB A;  4IUS A;  5F49 A;  3S6F A;  3TOA A;  2GAN A;  4M85 A;  2ZW7 A;  4KOV A;  4JXR A;  3LOD A;  2Z11 A;  4AG7 A;  2ATR A;  2Z0Z A;  1S7F A;  4FD7 A;  3DNS A;  4MI4 A;  4GS4 A;  1I21 A;  3FB3 A;  1NSL A;  4H89 A;  2B58 A;  3FYN A;  4JXQ A;  3CXQ A;  2B5G A;  2EUI A;  1Z9U A;  3BLN A;  4XPK A;  4E8O A;  4QVT A;  3FBU A;  4XNH C;  3I3G A;  5F48 A;  4OLL A;  2A4N A;  2G0B A;  1Y9W A;  3JVN A;  3SXN A;  1N71 A;  2RC4 A;  4HNX B;  4CRZ B;  1Q2Y A;  5EBV A;  2K5T A;  3D3S A;  4E0A A; 
#chains in the Genus database with same CATH topology
 2FL4 A;  4UWI A;  3MGD A;  5H84 A;  4F8Z A;  5HH1 A;  3F5B A;  4BIN A;  4ONW A;  1CJW A;  1IIC A;  4UCM A;  4P6Y A;  3BJ8 A;  4RI1 A;  3SI0 A;  3S9L A;  4MMO A;  3CPA A;  2AFW A;  4XPD B;  3TO6 A;  2JBJ A;  1GHE A;  3NE8 A;  4M6G A;  4NJR A;  4NFR A;  4A39 A;  3WC6 A;  4YU9 A;  4R3L A;  3D66 A;  5LRG A;  4B5P B;  4Q36 A;  1X12 A;  3N7Z A;  4ZY0 A;  5CBM A;  2ARH A;  2C27 A;  2OH1 A;  3ZJ0 A;  5J8C A;  1NMT A;  2OU2 A;  1ZG7 A;  1YVO A;  2PR1 A;  4KVO E;  1VHO A;  5FVJ A;  3VAR A;  4ORF A;  1AMP A;  1IU8 A;  2CIJ A;  3CXS A;  4JD6 A;  2PR8 A;  3TE4 A;  4C2X A;  1Z8T A;  2PJ7 A;  2REE A;  2ZEP A;  2QIR A;  2ZXV A;  3PFO A;  2B3U A;  2BUE A;  1CBX A;  3MRU A;  4DYO A;  2BSW A;  3B3C A;  2JBK A;  3HUV A;  4KVM E;  2B3V A;  4KLW A;  3PEI A;  4CYN A;  2PSW A;  2NSM A;  2ZEH A;  3TO7 A;  2VBQ A;  1GYT A;  4KSA A;  3QAY A;  4AVB A;  3F8K A;  1YLO A;  4KSI A;  1LAP A;  2AFU A;  1TKJ A;  2VEZ A;  2FCK A;  2WUU A;  4OC0 A;  4Q38 A;  2PJB A;  2KCW A;  4YFJ A;  4UA3 A;  4MFQ A;  1KUX A;  2JEW A;  4MFZ A;  1BOB A;  2F5I A;  2YND A;  2ZEL A;  1XBU A;  2ZPA A;  3L2N A;  4CGP A;  4FD6 A;  4M6H A;  1S5K A;  5G20 A;  3FH4 A;  3PB9 X;  4PXC A;  5G21 A;  2ZEF A;  3CXP A;  4EWT A;  5KTD A;  1Q7L A;  2EBJ A;  4DUK A;  2FT0 A;  3I9S A;  5H86 A;  1Z4E A;  4CS0 B;  4A95 A;  2DXQ A;  2FIA A;  5J1Q A;  4M3S A;  4PSW A;  2PDO A;  4R57 A;  4MHZ A;  1XMT A;  5AG4 A;  2P0W A;  4WWV A;  1X10 A;  1XRY A;  2O4H A;  3R1K A;  4PV6 A;  3WC7 A;  4TNU A;  2C1C A;  2VQY A;  3FNC A;  5ISV A;  1YW4 A;  4IF5 A;  5D29 A;  1WK4 A;  5JPH A;  1ON0 A;  3PBB A;  5DWN A;  5HMN A;  4UF4 A;  3S6H A;  1CX8 A;  4MCS A;  4R9M A;  2AFX A;  2Y0M A;  4B12 A;  4OKO A;  4BD9 A;  5JQ4 A;  4OC3 A;  4P4F A;  4UIA A;  2Q7B A;  5I0C A;  1HDQ A;  3PB6 X;  4XPD C;  3B3T A;  3JRU A;  1S60 A;  2GE3 A;  2VXK A;  2XEI A;  3NFZ A;  4ZBG A;  1KUY A;  3W91 A;  3KL9 A;  4GXH A;  2PJ5 A;  8CPA A;  3PP9 A;  1NSA A;  2R8V A;  4P4D A;  1YRE A;  2VZY A;  3NH8 A;  4ZX8 A;  4YWY A;  4H6Z A;  5LYF A;  2I3C A;  1RTQ A;  2I00 A;  3IO1 A;  2NMT A;  3IWG A;  1PU9 A;  3KQX A;  2AJ6 A;  4X8I A;  4CPA A;  2ZEM A;  5DS0 A;  5A27 A;  1V0C A;  1PUA A;  1LAN A;  1NE9 A;  4B5P A;  1RXT A;  1OBR A;  3IFE A;  4A94 A;  3GY9 A;  3SI2 A;  2PVV A;  1CPS A;  3GKR A;  2PVW A;  4KOR A;  1VIX A;  4CGN A;  3D7D A;  5HVH A;  3MN8 A;  2IL4 A;  2WPW A;  4I49 A;  4QB9 A;  3BJ7 A;  3RBU A;  1TXR A;  1S3Z A;  1Y7R A;  2IQ6 A;  4NGM A;  3H8G A;  2Q4Y A;  3H8E A;  5K8M A;  4II9 A;  3B8G A;  3QAH A;  4FAI A;  1Z2L A;  2AFM A;  4PSX A;  2C6G A;  2CNM A;  2DEA A;  2PJ8 A;  4JLY A;  2Z10 A;  2R1I A;  1IB1 E;  2P6G A;  1YX0 A;  1QSO A;  2X7B A;  2ZW5 A;  2C6C A;  2NYQ A;  4EME A;  4UEF A;  2Q51 A;  3CZX A;  4J3G A;  3GB0 A;  3QNV A;  3V8I A;  3R9E A;  3VWE A;  4UEZ A;  4ZGY B;  5JM6 A;  3D4U A;  4B5O A;  2PC1 A;  1ZG9 A;  1VHS A;  1YLE A;  3GLJ A;  3LD2 A;  1Y9K A;  3DGV A;  2ANP A;  3GIU A;  2PRQ A;  2IJZ A;  4AG9 A;  1S7K A;  2F8H A;  2Z3P A;  3K9T A;  1M4L A;  2DF5 A;  4GM5 A;  2BEI A;  4OC2 A;  1QSN A;  3FEC A;  2Q4Z A;  2OR4 A;  1M44 A;  1ARL A;  3DSB A;  4KS9 A;  1UFH A;  2PJ3 A;  4KVX A;  2J8M A;  2PJ2 A;  3WR7 A;  5LRK A;  5IX3 A;  4YGO A;  3KHX A;  3S6K A;  4U9Z A;  4MHY A;  2P6E A;  4MFK A;  7CPA A;  4RUH A;  4B13 A;  2JDC A;  4MY0 A;  3SJX A;  1XMB A;  2CF4 A;  1Y0R A;  2GLJ A;  3TFY A;  5G22 A;  2Z3O A;  4R3K A;  5AG6 A;  3E0K A;  4AB7 A;  4B10 A;  5A28 A;  4CAV A;  4UBR A;  3DR6 A;  3EXN A;  4C68 A;  1OZP A;  2ZEG A;  1SQH A;  4U9Y A;  4FWU A;  2Q4V A;  4X2T A;  1JWQ A;  1B87 A;  3VH9 A;  1IID A;  4MJ8 A;  4ONU A;  1TKH A;  4A2Z A;  2PQ8 A;  4CYO A;  3DDD A;  3KI9 A;  1B6B A;  1Y0Y A;  4KOU A;  3D68 A;  3CDX A;  3NA6 A;  3FEE A;  3R95 A;  1YQE A;  2Q04 A;  3T90 A;  1TKF A;  4E2A A;  2ZED A;  1FNO A;  1KUV A;  2EVN A;  1IY7 A;  2GRE A;  3ISZ A;  1RO5 A;  1ZG8 A;  1M1D A;  4P4B A;  3V7Z A;  4F6A A;  3K9U A;  4MXU A;  2IMO A;  4Y49 B;  2ODF A;  5HVG A;  4UFV A;  3WAB A;  4MBU A;  1CPX A;  4LUA A;  4AVA A;  5K8P A;  1YK3 A;  5DWM A;  2HV2 A;  5LYL A;  4L8A A;  2G3A A;  4PK2 A;  4K3N A;  4LQ6 A;  1M4I A;  3KAS A;  3FRM A;  1DE4 C;  3NH5 A;  5THW A;  4CAE A;  4W9Y A;  2QVP A;  4BMH A;  4EFD A;  5ELY A;  3FXT A;  2VL1 A;  1IYL A;  4DNC A;  5C88 A;  4CAW A;  2CNT A;  3D7F A;  4QUS A;  1K4J A;  2CY2 A;  5AG5 A;  3TT2 A;  1Z8W A;  1F2O A;  1KZF A;  3W6X A;  1S7N A;  3EO4 A;  2FIW A;  4A32 A;  4AVC A;  4OID A;  1LAM A;  4A31 A;  3R96 A;  1LCP A;  2V8V A;  1QSR A;  1MJA A;  1WWZ A;  3P2H A;  2EWB A;  4CRY B;  2AFO A;  1UWY A;  3RAM A;  1A2Z A;  1P4N A;  3IGR A;  4K30 A;  4OC4 A;  2F7V A;  2QJ8 A;  4UEE A;  4KOS A;  1EE3 P;  2GFQ A;  5E96 A;  3S9M A;  3FIX A;  3IU1 A;  4ZYQ A;  4A30 A;  2ZW4 A;  2AE6 A;  2CTB A;  5G1Z A;  3EC4 A;  3ZZI A;  1VGY A;  2Z3M A;  1CP6 A;  5GCN A;  1QQ9 A;  4R7M A;  2GIV A;  1BO4 A;  1DTD A;  2EK8 A;  3B2Y A;  2Q44 A;  4KOY A;  1Q2D A;  4KZT A;  2FXF A;  3EFA A;  3KKW A;  4NEX A;  5KTA A;  3P2F A;  4KUA A;  3B35 A;  2JLM A;  1LFW A;  2YNE A;  1VHE A;  2AFZ A;  3IC1 A;  4HKF A;  4M6I A;  4NGN A;  4UWJ A;  4A38 A;  5HXD A;  4X5K A;  4CGL A;  4NGS A;  4NCZ A;  3PB8 X;  4X3R A;  4OAE A;  4EVY A;  1TF8 A;  3KZW A;  2OZH A;  1YSJ A;  2QML A;  3FED A;  5AG7 A;  2DPT A;  1QSM A;  2HC9 A;  2REF A;  2YNC C;  4UIB A;  4C7I A;  2CNS A;  2Q0Y A;  1XE4 A;  3OWC A;  3N5F A;  1U6M A;  1XJO A;  4RN7 A;  3PB4 X;  3TC8 A;  2PJ4 A;  3GUX A;  4B14 A;  4H2K A;  1FT7 A;  2GLF A;  3K2K A;  3BI0 A;  3NH4 A;  2YNC A;  3TOB A;  4Y49 C;  4F0X A;  4HNW B;  4YRH A;  2ZEN A;  4HNY B;  5K8O A;  3D67 A;  3JUW A;  2EO8 A;  3IEH A;  1XIX A;  4OC1 A;  3H4Q A;  2P6F A;  3KR5 A;  4IK2 A;  4OP4 A;  2B4D B;  2G3T A;  2FVG A;  2OZU A;  4NXY A;  3PZJ A;  4LX9 A;  3WT4 A;  3EY5 A;  1ARM A;  4UCP A;  1IOI A;  3TCV A;  4F9V A;  4PK3 A;  3S6G A;  2AFS A;  3IWW A;  3D2P A;  5IB0 A;  1PYT B;  4CYQ A;  1YVK A;  4OC5 A;  4MY3 A;  2BCO A;  1MJB A;  1XFO A;  3KR4 A;  4CAX A;  2HQY A;  3ISX A;  3F0A A;  2WYR A;  1MK4 A;  2O53 A;  1TF9 A;  3D8P A;  4P45 A;  1BAV A;  1YR0 A;  3I1U A;  3DR8 A;  3QB8 A;  5BWA B;  1YME A;  4FBE A;  2DPS A;  4CGM A;  2POK A;  3SI1 A;  1CG2 A;  4ZY2 A;  5IV0 A;  2V8G A;  1Q2C A;  1MJ9 A;  4MFJ A;  5D8N A;  2RB7 A;  4PXB A;  3BHX A;  4JWP A;  4P4E A;  3A9L A;  2Z3K A;  4KLV A;  2J8R A;  2FS5 A;  4XPL A;  5F47 A;  1ELM P;  1VKC A;  1Z4R A;  4OME A;  5EMI A;  4NJQ A;  4HPS A;  4MHD A;  2ABZ A;  1M4D A;  2PRB A;  4ZI6 A;  5F46 A;  1M4G A;  1ZLI A;  3JTK A;  1XOV A;  3FJU A;  4FD4 A;  4L89 A;  1YGH A;  3VAT A;  5J8F A;  3HLP A;  4P10 A;  5CNP A;  1CM0 A;  1I1D A;  3PGP A;  3B3S A;  4CGO A;  3LAC A;  4KOT A;  2VI7 A;  4NSQ A;  2WSA A;  3PBE A;  4OAD A;  4QBJ A;  2R7H A;  4MRI A;  4FUU A;  1J4J A;  3TTH A;  2J8N A;  2FSR A;  2ZW6 A;  1ZO0 A;  4IHM A;  3RYO A;  3W6S A;  3TO9 A;  1LOK A;  3S9N A;  3GYA A;  3G3S A;  4MCR A;  2FE7 A;  2ZEE A;  4NGP A;  5JGF A;  2JEV A;  5F09 A;  4H6U A;  1IOF A;  3T8W A;  4F0Y A;  2V77 A;  5HVF A;  5K8N A;  4MCQ A;  1P0H A;  5JH9 A;  4JJX A;  1IYK A;  2PJ9 A;  2Q43 A;  3C26 A;  3FVL A;  2C6P A;  4U5Y A;  4MHN A;  3TX8 A;  2O28 A;  2VZZ A;  4FD5 A;  3H5Z A;  4UFX A;  5KTC A;  3D2M A;  2B5G B;  1YW6 A;  4A33 A;  3DLJ A;  3T9Y A;  1IGB A;  3B3W A;  1QST A;  4R87 A;  1AYE A;  1PCA A;  6CPA A;  2D4P A;  4OIW A;  5IB9 A;  3B3V A;  1HDU A;  2B4B A;  1BPM A;  1L0C A;  3G8W A;  4P4J A;  3FMC A;  3SJG A;  1CP7 A;  2B4D A;  5C82 A;  2JDD A;  4KOX A;  4O23 A;  2QEC A;  2ZEO A;  3R9G A;  2CXA A;  4KSF A;  2WPX A;  1BLL E;  2D4O A;  2EK9 A;  2OZG A;  2PCU A;  1S7L A;  3KHZ A;  4R8F A;  4XNH B;  3R9F A;  2BL1 A;  1ZLH A;  3D7H A;  1TIQ A;  2J9A A;  2QYV A;  2R98 A;  2HUZ A;  4QC6 A;  1ELL P;  4ZX9 A;  2ZOF A;  3VWD A;  1FY7 A;  2PJA A;  3RZA A;  3SXO A;  3LWU A;  4NGT A;  3NE7 A;  2PJC A;  3SHP A;  1R57 A;  2I79 A;  2HB6 A;  5LRJ A;  3UY5 A;  4ZY1 A;  2OB0 A;  2Z3N A;  3CPX A;  4LQG A;  4NGR A;  1I12 A;  4Q7A A;  4MCP A;  4TWE A;  4NF1 A;  4R76 A;  2H5M A;  3FF3 A;  4NGQ A;  1LRZ A;  4RS2 A;  5EC4 A;  3CT9 A;  3IJ3 A;  1XF8 A;  1H8L A;  5LYI A;  4BBH A;  1Z8L A;  5LYD A;  1HEE A;  4JZ0 A;  4KUB A;  4Z65 A;  2XEJ A;  4KOW A;  1XEB A;  2XEF A;  4IUS A;  4P44 A;  5F49 A;  2ZOG A;  3PFE A;  4JYW A;  2WZN A;  2Z3L A;  4UCN A;  2PIY A;  3SJE A;  2BOA A;  3S6F A;  3TOA A;  1R43 A;  2G9D A;  2GU2 A;  3WC5 A;  2GAN A;  1R3N A;  3IIB A;  4M85 A;  4DJL A;  2PJ0 A;  3B7I A;  4CYP A;  4MFP A;  3RO0 A;  2ZW7 A;  4KOV A;  1Z5R A;  2PJ6 A;  4JXR A;  3LMS A;  3LOD A;  2Z11 A;  4A37 A;  4C2Y A;  3KQZ A;  2ATR A;  2Z0Z A;  4AG7 A;  1S7F A;  2YGW A;  4FD7 A;  4C7H A;  1KWM A;  5I4M A;  3BXM A;  3DNS A;  3PB7 X;  4MI4 A;  4GS4 A;  5AGE A;  1F2P A;  2RFH A;  1I21 A;  4UFW A;  1QMU A;  1AUG A;  3FB3 A;  1BPN A;  3IWE A;  3KGQ A;  4G1P A;  4AXV A;  4MHP A;  1NSL A;  4PXD A;  2CTC A;  4H89 A;  4F9U A;  4C2Z A;  2B58 A;  1Y7E A;  3FYN A;  4JXQ A;  3V38 A;  4PQA A;  1F57 A;  3RNZ A;  4B11 A;  5CPA A;  3CXQ A;  3BI1 A;  4B6Z A;  4CAF A;  2B5G A;  2EUI A;  2XEG A;  2Q7S A;  3FX6 A;  3PRT A;  2PE3 A;  1Z9U A;  3BLN A;  1Z8X A;  3IU2 A;  2PIZ A;  4XPK A;  4E8O A;  4PPZ A;  4QVT A;  3SJF A;  3FBU A;  3D7G A;  3I3G A;  4XNH C;  5F48 A;  4WJB A;  4PXE A;  2BO9 A;  1JQG A;  4OLL A;  2A4N A;  2G0B A;  1Y9W A;  2V8D A;  3JVN A;  2PJ1 A;  3SXN A;  1N71 A;  2RC4 A;  3H8F A;  4R6T A;  4HNX B;  4CRZ B;  1Q2Y A;  4MFL A;  5EBV A;  4IAV A;  4P4I A;  2K5T A;  2V8H A;  2OOT A;  3D3S A;  4E0A A; 
#chains in the Genus database with same CATH homology
 2FL4 A;  4UWI A;  3MGD A;  5H84 A;  5HH1 A;  3F5B A;  1CJW A;  1IIC A;  4UCM A;  3BJ8 A;  4RI1 A;  4XPD B;  3TO6 A;  1GHE A;  4B5P B;  4R3L A;  4Q36 A;  3N7Z A;  2ARH A;  2C27 A;  2OH1 A;  3ZJ0 A;  5J8C A;  1NMT A;  2OU2 A;  1YVO A;  2PR1 A;  4KVO E;  5FVJ A;  4ORF A;  4JD6 A;  3CXS A;  2PR8 A;  3TE4 A;  4C2X A;  2REE A;  2QIR A;  2ZXV A;  2B3U A;  2BUE A;  2BSW A;  4KVM E;  2B3V A;  4KLW A;  2PSW A;  3TO7 A;  2VBQ A;  4KSA A;  4AVB A;  3F8K A;  2VEZ A;  2FCK A;  2WUU A;  4Q38 A;  2KCW A;  4YFJ A;  4UA3 A;  4MFQ A;  1KUX A;  4MFZ A;  1BOB A;  2F5I A;  2YND A;  2ZPA A;  4CGP A;  4FD6 A;  1S5K A;  5G20 A;  5G21 A;  3CXP A;  5KTD A;  2FT0 A;  3I9S A;  5H86 A;  1Z4E A;  4CS0 B;  4A95 A;  2DXQ A;  2FIA A;  4M3S A;  4PSW A;  2PDO A;  4R57 A;  1XMT A;  5AG4 A;  2P0W A;  4PV6 A;  3R1K A;  2VQY A;  3FNC A;  5ISV A;  4IF5 A;  5JPH A;  1WK4 A;  1ON0 A;  5DWN A;  5HMN A;  3S6H A;  4R9M A;  2Y0M A;  4B12 A;  5JQ4 A;  2Q7B A;  5I0C A;  4XPD C;  1S60 A;  2GE3 A;  2VXK A;  4ZBG A;  3W91 A;  4CYN A;  1KUY A;  3PP9 A;  2R8V A;  1YRE A;  2VZY A;  4H6Z A;  2I00 A;  2NMT A;  3IWG A;  1PU9 A;  2AJ6 A;  5A27 A;  1V0C A;  1PUA A;  1NE9 A;  4B5P A;  1RXT A;  3GY9 A;  3GKR A;  4KOR A;  4CGN A;  2IL4 A;  2WPW A;  4I49 A;  4QB9 A;  3BJ7 A;  1S3Z A;  1Y7R A;  2Q4Y A;  3B8G A;  3QAH A;  4PSX A;  2CNM A;  4JLY A;  2Z10 A;  2R1I A;  1IB1 E;  2P6G A;  1YX0 A;  1QSO A;  2X7B A;  2ZW5 A;  4J3G A;  3V8I A;  3R9E A;  3VWE A;  4ZGY B;  4B5O A;  2PC1 A;  1VHS A;  1YLE A;  3LD2 A;  1Y9K A;  4AG9 A;  1S7K A;  2Z3P A;  2BEI A;  1QSN A;  1M44 A;  3DSB A;  4KS9 A;  1UFH A;  4KVX A;  2J8M A;  3WR7 A;  5IX3 A;  4YGO A;  3S6K A;  4U9Z A;  2P6E A;  4MFK A;  4B13 A;  2JDC A;  4MY0 A;  3TFY A;  5G22 A;  2Z3O A;  4R3K A;  5AG6 A;  3E0K A;  4AB7 A;  4B10 A;  5A28 A;  4CAV A;  4UBR A;  3DR6 A;  3EXN A;  4C68 A;  1OZP A;  1SQH A;  4U9Y A;  2Q4V A;  1B87 A;  1IID A;  4MJ8 A;  4ONU A;  4A2Z A;  2PQ8 A;  4CYO A;  3DDD A;  4KOU A;  1B6B A;  3R95 A;  2Q04 A;  3T90 A;  4E2A A;  1KUV A;  2EVN A;  1RO5 A;  1M1D A;  4F6A A;  3K9U A;  4Y49 B;  4UFV A;  4MBU A;  4LUA A;  4AVA A;  1YK3 A;  5DWM A;  2HV2 A;  4L8A A;  2G3A A;  4PK2 A;  1M4I A;  3FRM A;  4CAE A;  4BMH A;  3FXT A;  1IYL A;  4DNC A;  5C88 A;  4CAW A;  2CNT A;  4QUS A;  1K4J A;  2CY2 A;  5AG5 A;  3TT2 A;  3W6X A;  1KZF A;  1S7N A;  3EO4 A;  2FIW A;  4A32 A;  4AVC A;  4A31 A;  3R96 A;  1QSR A;  1MJA A;  1WWZ A;  3P2H A;  4CRY B;  1P4N A;  3IGR A;  4K30 A;  4KOS A;  5E96 A;  3FIX A;  3IU1 A;  4A30 A;  2ZW4 A;  2AE6 A;  5G1Z A;  3ZZI A;  3EC4 A;  2Z3M A;  5GCN A;  2GIV A;  1BO4 A;  4KOY A;  4KZT A;  2Q44 A;  4NEX A;  1Q2D A;  5KTA A;  2FXF A;  3EFA A;  3KKW A;  3P2F A;  4KUA A;  2JLM A;  4HKF A;  2YNE A;  4II9 A;  4UWJ A;  4X5K A;  4CGL A;  4NCZ A;  4OAE A;  4EVY A;  2OZH A;  2QML A;  5AG7 A;  2DPT A;  1QSM A;  2REF A;  2YNC C;  4C7I A;  2CNS A;  2Q0Y A;  1XE4 A;  3OWC A;  1U6M A;  4B14 A;  2YNC A;  3TOB A;  4Y49 C;  4F0X A;  4HNW B;  4YRH A;  4HNY B;  3JUW A;  1XIX A;  3H4Q A;  2P6F A;  2B4D B;  2G3T A;  4NXY A;  2OZU A;  3PZJ A;  4LX9 A;  3EY5 A;  4UCP A;  3TCV A;  4PK3 A;  3S6G A;  3D2P A;  5IB0 A;  4CYQ A;  1YVK A;  4MY3 A;  1MJB A;  4CAX A;  2HQY A;  3F0A A;  1MK4 A;  3D8P A;  1YR0 A;  3DR8 A;  3QB8 A;  5BWA B;  2DPS A;  4CGM A;  5IV0 A;  1Q2C A;  1MJ9 A;  4MFJ A;  4JWP A;  3A9L A;  2Z3K A;  4KLV A;  2J8R A;  2FS5 A;  4XPL A;  5F47 A;  1VKC A;  1Z4R A;  4MHD A;  1M4D A;  2PRB A;  5F46 A;  1M4G A;  3JTK A;  4L89 A;  4FD4 A;  1YGH A;  5J8F A;  5CNP A;  1CM0 A;  1I1D A;  3PGP A;  4CGO A;  4KOT A;  2VI7 A;  4NSQ A;  2WSA A;  4OAD A;  4QBJ A;  2R7H A;  1J4J A;  3TTH A;  2J8N A;  2FSR A;  2ZW6 A;  1ZO0 A;  3RYO A;  3W6S A;  3TO9 A;  3GYA A;  3G3S A;  2FE7 A;  2JEV A;  4H6U A;  4F0Y A;  1P0H A;  4JJX A;  1IYK A;  3C26 A;  4U5Y A;  2O28 A;  2VZZ A;  4FD5 A;  3H5Z A;  4UFX A;  5KTC A;  3D2M A;  2B5G B;  4A33 A;  3T9Y A;  1QST A;  4R87 A;  2D4P A;  2B4B A;  3G8W A;  1L0C A;  5C82 A;  2B4D A;  2JDD A;  4KOX A;  2QEC A;  3R9G A;  2CXA A;  4KSF A;  2WPX A;  2D4O A;  4XNH B;  2OZG A;  3R9F A;  1S7L A;  2BL1 A;  1TIQ A;  4QC6 A;  2R98 A;  2HUZ A;  3VWD A;  1FY7 A;  3SXO A;  3NE7 A;  3SHP A;  1R57 A;  2I79 A;  3UY5 A;  2OB0 A;  2Z3N A;  1I12 A;  4NF1 A;  2H5M A;  5EC4 A;  4RS2 A;  1LRZ A;  1XF8 A;  4BBH A;  4KUB A;  4KOW A;  1XEB A;  4IUS A;  5F49 A;  2Z3L A;  4UCN A;  3S6F A;  3TOA A;  2GAN A;  4M85 A;  4CYP A;  4MFP A;  2ZW7 A;  4KOV A;  4JXR A;  3LOD A;  2Z11 A;  4C2Y A;  4AG7 A;  2ATR A;  2Z0Z A;  1S7F A;  2YGW A;  4FD7 A;  4C7H A;  3DNS A;  4MI4 A;  4GS4 A;  5AGE A;  4UFW A;  1I21 A;  3FB3 A;  3IWE A;  1NSL A;  4H89 A;  4C2Z A;  2B58 A;  3FYN A;  4JXQ A;  4B11 A;  3CXQ A;  4CAF A;  2B5G A;  2EUI A;  1Z9U A;  3BLN A;  3IU2 A;  4XPK A;  4E8O A;  4QVT A;  3FBU A;  4XNH C;  3I3G A;  5F48 A;  4OLL A;  2A4N A;  2G0B A;  1Y9W A;  3JVN A;  3SXN A;  1N71 A;  2RC4 A;  4HNX B;  4CRZ B;  1Q2Y A;  4MFL A;  5EBV A;  2K5T A;  3D3S A;  4E0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...