1B6BA

Melatonin biosynthesis: the structure of serotonin n-acetyltransferase at 2.5 a resolution suggests a catalytic mechanism
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
168
structure length
168
Chain Sequence
ANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFTEMHCSLRGHAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Melatonin biosynthesis: the structure of serotonin N-acetyltransferase at 2.5 A resolution suggests a catalytic mechanism.
pubmed doi rcsb
source organism Ovis aries
molecule tags Transferase
molecule keywords PROTEIN (ARYLALKYLAMINE N-ACETYLTRANSFERASE)
total genus 43
structure length 168
sequence length 168
chains with identical sequence B
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 1999-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1b6bA00
1KZFA 3TTHA 3TT2A 2J8NA 1CJWA 2CNMA 1QSOA 1S7NA 4JXQA 2CNTA 2ZW6A 3H4QA 4NEXA 1NSLA 2ZXVA 1RXTA 2AJ6A 4HNYB 2CNSA 4YRHA 3TOAA 2OZHA 4QVTA 1MJBA 3LODA 2PDOA 2H5MA 1VHSA 2GANA 2Q4VA 4NCZA 2HUZA 1N71A 3S6HA 4B5PA 3FBUA 5ISVA 2ARHA 1Y7RA 1YK3A 4CRYB 2P6GA 2QECA 4KVOE 1P0HA 2B4DA 3DNSA 3UY5A 1NMTA 4FD7A 2JLMA 3CXQA 2Z11A 4R87A 1Q2YA 4UA3A 5FVJA 1YVKA 4E0AA 3S6FA 4IF5A 5HMNA 1S60A 3TE4A 3TFYA 4OAEA 4CAXA 1LRZA 3FRMA 1IICA 3BJ8A 2FIWA 1QSTA 1QSNA 1B87A 2Z0ZA 4R9MA 2FT0A 4BMHA 3EC4A 4XPLA 5KTCA 4FD5A 3QB8A 4AG7A 3SHPA 4MY3A 4XPKA 4R3KA 4KOWA 5DWMA 5C88A 2I00A 3TO6A 3R9FA 4JD6A 1BO4A 1KUVA 4PK3A 4K30A 1P4NA 4R3LA 3F8KA 3SXNA 5JQ4A 3GY9A 4H6ZA 2B5GB 3IWGA 2OB0A 3IGRA 1S7FA 1IYLA 3MGDA 1S7LA 4OLLA 2ZPAA 4KVXA 3FNCA 3BJ7A 2Y0MA 2EVNA 4FD6A 4HNWB 5C82A 2VEZA 3G8WA 5IV0A 1Q2CA 1IB1E 3F5BA 3W91A 2GE3A 1KUXA 3DSBA 2PRBA 2R1IA 4KORA 3EY5A 2JDDA 5F46A 1XIXA 2X7BA 1Y9WA 2PQ8A 1U6MA 1Q2DA 3T90A 1K4JA 2JEVA 2IL4A 2PR8A 4XNHB 1YLEA 5F47A 4HKFA 3TO7A 2R7HA 1I21A 3W6SA 3ZZIA 2OH1A 4KLWA 4CS0B 4Y49C 3DDDA 5KTDA 4PV6A 4KLVA 4CAVA 4F0YA 4AVBA 4B5OA 3SXOA 1I1DA 4MI4A 2GIVA 1XEBA 4E2AA 4KOVA 3FXTA 2ZW5A 4DNCA 2WPXA 2HQYA 2BSWA 4KZTA 2C27A 2PSWA 2G3AA 1WK4A 2AE6A 3W6XA 4QUSA 4U5YA 3R9GA 1R57A 5J8FA 5H86A 3FIXA 5EBVA 2R8VA 1MJAA 3F0AA 1RO5A 1Z4EA 3PZJA 2B3UA 3TCVA 4QB9A 4CAWA 2EUIA 4L89A 3D2MA 4ORFA 2OZGA 3R96A 1M44A 3EFAA 4KOXA 4XPDC 4KVME 1NE9A 3CXSA 4KUAA 2WPWA 1XE4A 2REFA 5IB0A 5I0CA 3TO9A 2OU2A 2VBQA 4JWPA 2A4NA 2B3VA 2J8MA 3GYAA 3S6GA 4ZBGA 4F6AA 4H89A 4QC6A 3B8GA 3E0KA 3LD2A 2VZZA 4UWIA 1IYKA 1VKCA 5E96A 4KOSA 1S7KA 4AG9A 2JDCA 2P0WA 3FYNA 3PP9A 1QSRA 4CRZB 4I49A 3ZJ0A 3P2HA 1ON0A 4LUAA 3QAHA 2D4OA 3DR6A 3VWEA 2I79A 2Q44A 2FE7A 2VZYA 1M1DA 2PR1A 4YGOA 2B4BA 3CXPA 4AB7A 4KUBA 4ONUA 1CM0A 5CNPA 3N7ZA 1XF8A 3JVNA 2Q0YA 5GCNA 2Z10A 4NXYA 2FXFA 3FB3A 1YGHA 2O28A 4M3SA 1V0CA 1TIQA 5HH1A 4KOUA 2NMTA 3PGPA 4MBUA 1Z4RA 2B5GA 4U9YA 1GHEA 4JLYA 2CY2A 2ATRA 4EVYA 1YREA 2FSRA 4R57A 3V8IA 1Y9KA 2BL1A 2VXKA 4UWJA 4JJXA 2P6FA 3D8PA 5JPHA 3EXNA 2REEA 4J3GA 2OZUA 2QMLA 3GKRA 3JUWA 1QSMA 4JXRA 1I12A 5H84A 2FL4A 1B6BA 3T9YA 4E8OA 2B58A 2BUEA 1BOBA 2ZW7A 2BEIA 1SQHA 2QIRA 3KKWA 3EO4A 1FY7A 3R9EA 3G3SA 2F5IA 4B5PB 5KTAA 3R95A 2ZW4A 4PK2A 5DWNA 3DR8A 4LX9A 2Q04A 4NSQA 1S5KA 2FS5A 4PSWA 4II9A 1MK4A 2Q4YA 2B4DB 2G0BA 3P2FA 4AVAA 1YR0A 2KCWA 4PSXA 3WR7A 4XPDB 1S3ZA 5J8CA 4FD4A 4QBJA 1M4IA 2R98A 4IUSA 4MHDA 3BLNA 1MJ9A 2D4PA 1YX0A 4X5KA 4HNXB 1M4GA 4KOTA 2G3TA 4U9ZA 1OZPA 3C26A 4Y49B 1YVOA 2VI7A 4MY0A 4GS4A 2PC1A 4OADA 2FCKA 1PUAA 4MJ8A 4L8AA 1KUYA 1J4JA 3K9UA 3TOBA 4RS2A 2K5TA 2DXQA 5F49A 2HV2A 4NF1A 5IX3A 3OWCA 1WWZA 3D3SA 3I9SA 3VWDA 2Q7BA 5EC4A 4UBRA 3NE7A 1IIDA 4YFJA 2VQYA 4H6UA 3D2PA 1UFHA 5F48A 3RYOA 2FIAA 4AVCA 3I3GA 4XNHC 1M4DA 3R1KA 1Z9UA 3S6KA 4RI1A 4M85A 1XMTA 1PU9A 2RC4A 1L0CA 4KOYA 2J8RA 2P6EA
chains in the Genus database with same CATH superfamily
5CPAA 1F2OA 3IWEA 1OBRA 1KZFA 2Q51A 3KASA 3SJFA 3N5FA 2J8NA 3TT2A 3TTHA 4OC2A 3WT4A 4CGLA 2Z3KA 1CJWA 1VHOA 2CNMA 5G20A 4ZX9A 2ABZA 3KZWA 1A2ZA 1QSOA 1ZLHA 2YNDA 1S7NA 4JXQA 2CNTA 1AMPA 2ZW6A 3H4QA 1YLOA 4NEXA 3JTKA 4B13A 4CGMA 2XEGA 1NSLA 4KSAA 4P4JA 2IJZA 3CPAA 2ZXVA 1RXTA 4P4BA 2ANPA 2AJ6A 3B3SA 2CNSA 2Q43A 4HNYB 4OC3A 2GLJA 4YRHA 3TOAA 3VATA 2OZHA 3A9LA 4QVTA 1MJBA 3LODA 4MRIA 2PDOA 2H5MA 1VHSA 2GANA 2GREA 2Q4VA 2HUZA 4H2KA 4NCZA 4R7MA 1N71A 1NSAA 3S6HA 4B5PA 3FBUA 5ISVA 2ZEOA 4OC5A 3FMCA 2ARHA 1Y7RA 1YK3A 4CRYB 2GU2A 2P6GA 2QECA 4PPZA 4FAIA 2XEJA 4KVOE 1P0HA 2B4DA 3DNSA 4UFVA 4F9UA 3UY5A 5LYLA 2PJ1A 1NMTA 4FD7A 2JLMA 5AG5A 3CXQA 4MFLA 2Z11A 3IIBA 1ELLP 4R87A 4AXVA 1LFWA 3B3WA 2AFSA 4FUUA 4Q38A 1Q2YA 3D7HA 4UA3A 5FVJA 1YVKA 4NGNA 3SJGA 4E0AA 1YQEA 2PVVA 5THWA 4IF5A 3S6FA 4A32A 3VARA 5HMNA 1S60A 3KR4A 4NGSA 3TE4A 3LACA 5CBMA 3TFYA 2ZEDA 4OAEA 4CAXA 3B35A 1LRZA 3IEHA 3FRMA 1IICA 2YNEA 4G1PA 3BJ8A 2FIWA 2PJ0A 2WYRA 3S9NA 4UEFA 4PXBA 1QSTA 1QSNA 1B87A 4A37A 1Z8WA 2CTBA 1ZO0A 5AGEA 2Z0ZA 4R9MA 2FT0A 4B11A 4M6HA 1Y7EA 4BMHA 3EC4A 2Z3OA 4DUKA 1HDUA 4NJRA 4XPLA 4CYOA 3BHXA 5KTCA 4FD5A 3QB8A 4B10A 5LRGA 2RB7A 1ELMP 3D68A 3GUXA 5J1QA 4Q7AA 4X3RA 4MHYA 5LRJA 3SHPA 4MY3A 4XPKA 4AG7A 5HXDA 4R3KA 4KOWA 5DWMA 5C88A 4UFXA 2I00A 3TO6A 5JH9A 3R9FA 3MN8A 3NA6A 2PJ3A 4JD6A 1BO4A 3GLJA 4C2XA 1FNOA 3I1UA 4CGPA 1KUVA 1CP7A 1PCAA 3PFEA 4K3NA 4PK3A 1Z8LA 1CBXA 4K30A 4F8ZA 1P4NA 4R3LA 4W9YA 3F8KA 4A33A 3SXNA 3CT9A 4UIBA 2ZEFA 4CYPA 5LRKA 2PJBA 4B12A 5JQ4A 3GY9A 4ZY2A 4IAVA 4H6ZA 3LWUA 4A2ZA 5F09A 1LANA 4C2YA 1JWQA 2B5GB 3IWGA 2OB0A 3IGRA 1S7FA 4BBHA 4FBEA 1IYLA 3MGDA 3D7GA 4OC1A 4P10A 1S7LA 4OLLA 4HPSA 4ZY0A 2ZPAA 1XJOA 4KVXA 3FNCA 3KL9A 3BJ7A 2Y0MA 2EVNA 4FD6A 4X2TA 2AFXA 4HNWB 4O23A 2VEZA 3PB8X 4MFQA 3G8WA 5C82A 5IV0A 1Q2CA 1IB1E 3F5BA 3W91A 2GE3A 2V8HA 1TKJA 2V8DA 4FWUA 2Q7SA 1KUXA 3DSBA 2PRBA 2R1IA 3FH4A 4KORA 4OIDA 4P4EA 3WC6A 1AYEA 3EY5A 2JDDA 4Z65A 5F46A 1XIXA 3RZAA 4CYNA 2X7BA 2QYVA 3PRTA 2GLFA 4GM5A 2ZEMA 1Y9WA 4Q36A 3V38A 1BLLE 2Q4ZA 2F8HA 4JZ0A 2PQ8A 1U6MA 3KHZA 1X12A 1Q2DA 3T90A 1K4JA 2JEVA 4BD9A 1UWYA 2IL4A 2PR8A 4XNHB 1YLEA 5AG6A 4WWVA 4NJQA 4NGQA 4WJBA 5F47A 3H8EA 4HKFA 3TO7A 4RUHA 3RNZA 2R7HA 4P4IA 5DS0A 2PJCA 3IU2A 3TC8A 1I21A 3CPXA 3W6SA 3ZZIA 3B3VA 2OH1A 4KLWA 4KSFA 2XEFA 3RO0A 4CS0B 4Y49C 3DDDA 5KTDA 4PV6A 4KLVA 4OIWA 4CAVA 4F0YA 5AG4A 4AVBA 4ZI6A 3FVLA 3SXOA 1HDQA 3S9MA 2V8VA 4B5OA 4MFZA 5EMIA 1LAPA 2PJ8A 1TKHA 4EFDA 4A30A 1I1DA 4MI4A 4UIAA 2Z3NA 3H8FA 2GIVA 1XEBA 3B7IA 3IJ3A 4KOVA 3FXTA 2ZW5A 4MFKA 4E2AA 3NFZA 2PJ2A 1ARLA 4DNCA 2WPXA 2HQYA 1Q7LA 2BSWA 3T8WA 4KZTA 2C27A 2C6PA 2PSWA 5K8NA 2G3AA 4NGPA 5JM6A 3FF3A 6CPAA 1WK4A 1ZG7A 1TF8A 2AE6A 3W6XA 4OMEA 4QUSA 4U5YA 4F0XA 3R9GA 4A31A 1R57A 4A95A 5J8FA 4P44A 3KQXA 5H86A 3SI1A 1FT7A 3FIXA 2EBJA 5EBVA 1XRYA 2R8VA 1MJAA 3F0AA 4C7IA 1RO5A 1Z4EA 3PZJA 4M6IA 2B3UA 2PJ9A 2WSAA 3RAMA 3TCVA 2O53A 4QB9A 4CAWA 2EUIA 4L89A 3D2MA 4ORFA 2CF4A 5I4MA 3SJXA 2OZGA 1Z8TA 4IK2A 3H5ZA 1DE4C 3R96A 1CX8A 1M44A 1F2PA 3IC1A 3EFAA 4JYWA 1BPNA 1PYTB 3TX8A 3IWWA 4KOXA 4XPDC 4ONWA 3BI1A 2HC9A 4KVME 1NE9A 4UF4A 4YWYA 1HEEA 4NGRA 5K8MA 1Z8XA 3CXSA 4KUAA 2WPWA 1XE4A 4P4FA 2REFA 5IB0A 5I0CA 1YW4A 3TO9A 2PIYA 2OU2A 4NGMA 2VBQA 4JWPA 2A4NA 4LQ6A 4UCMA 2WZNA 3PB4X 2B3VA 2PJ7A 2J8MA 3D4UA 1Y0RA 3D7DA 4RN7A 1CPXA 3GYAA 3S6GA 4ZBGA 2EWBA 4MCRA 1ARMA 2ZENA 4P45A 4F6AA 3WC5A 2PRQA 2WUUA 4EMEA 5BWAB 1CP6A 1XFOA 4H89A 3CDXA 1F57A 2BO9A 2ZOGA 2G9DA 4QC6A 3B8GA 3E0KA 3LD2A 3WC7A 4R8FA 2VZZA 4A39A 3IFEA 3PB9X 4UWIA 1IYKA 1VKCA 3V7ZA 5E96A 4KOSA 1S7KA 4AG9A 3PB7X 2JDCA 2P0WA 3FYNA 3PP9A 1R3NA 1QSRA 2CIJA 3KQZA 3PEIA 4P6YA 1IOFA 3VH9A 4CRZB 4I49A 2ZOFA 3P2HA 3ZJ0A 3H8GA 1ON0A 3QAHA 4LUAA 4LQGA 5LYDA 2D4OA 2RFHA 4UFWA 4A94A 1CG2A 3DR6A 3ISXA 4NGTA 3KR5A 3VWEA 2I79A 2Q44A 3FJUA 3SJEA 1IU8A 2FE7A 4EWTA 1X10A 3D66A 4C68A 2BOAA 3GB0A 2VZYA 1M1DA 2PR1A 7CPAA 4YGOA 2B4BA 1LAMA 2AFMA 3CXPA 1QQ9A 4AB7A 3KHXA 4KUBA 1CM0A 3CZXA 2ZEGA 4ONUA 5CNPA 3N7ZA 5AG7A 1XF8A 3JVNA 2AFWA 5D29A 2GFQA 2Q0YA 2YNCA 5GCNA 4ZYQA 4TNUA 2Z10A 4MHZA 4KSIA 2FXFA 3FB3A 1YGHA 2O28A 4M3SA 4NXYA 1V0CA 1TIQA 4MCQA 5G1ZA 2C1CA 3IO1A 4ZX8A 5HH1A 1R43A 2HB6A 4KOUA 2NMTA 3PGPA 1RTQA 4MBUA 4MHNA 1Z4RA 3NH5A 4R76A 4CGOA 4P4DA 2PCUA 4NFRA 2B5GA 3QAYA 4U9YA 2EK8A 1GHEA 1YSJA 2CY2A 4JLYA 2ATRA 5K8PA 4X8IA 2QVPA 2ODFA 3NE8A 2OR4A 2EK9A 4CPAA 4EVYA 4ZY1A 1YREA 4UCPA 2FSRA 4R57A 1ZG9A 1Y9KA 3V8IA 3B3CA 4MCSA 4OC4A 3PFOA 1XMBA 2BL1A 3BI0A 2C6CA 2VXKA 4JJXA 4UWJA 4CAEA 2P6FA 3D8PA 3D7FA 1JQGA 3ISZA 5A28A 5JPHA 1YMEA 3EXNA 1QMUA 2REEA 3GIUA 1GYTA 2POKA 1IGBA 4J3GA 5LYIA 2OZUA 2QMLA 2PVWA 3LMSA 3GKRA 3JUWA 4MMOA 4UEZA 1QSMA 2EO8A 2J9AA 4JXRA 4R6TA 4MXUA 4PXCA 1I12A 3PBBA 5H84A 2FL4A 4A38A 4B6ZA 1B6BA 1ZLIA 1BAVA 2VL1A 3T9YA 2YNCC 5HVGA 4ZGYB 1TXRA 4E8OA 3HUVA 4DYOA 2B58A 4M6GA 1AUGA 2Z3MA 2BUEA 1BOBA 2JBJA 2ZW7A 1TF9A 2BEIA 2PE3A 1SQHA 2QIRA 3KKWA 3EO4A 1FY7A 3R9EA 1DTDA 2NYQA 2F5IA 2V77A 3G3SA 5D8NA 2BCOA 3BXMA 2IQ6A 2JEWA 3B3TA 4B5PB 4PQAA 3MRUA 4C2ZA 5KTAA 3R95A 3HLPA 1YW6A 2ZW4A 4PK2A 4PXDA 1Z5RA 3KI9A 5DWNA 3DR8A 2C6GA 2DF5A 1IOIA 1KWMA 4LX9A 2Q04A 1XBUA 4NSQA 4PXEA 1EE3P 1Y0YA 1S5KA 2FS5A 1VHEA 3PB6X 4PSWA 5HVHA 2XEIA 4II9A 1MK4A 2Q4YA 2B4DB 2G0BA 2QJ8A 4OP4A 2AFOA 3P2FA 1LCPA 1ZG8A 2DPTA 4AVAA 5G22A 1YR0A 2KCWA 4PSXA 3WR7A 3FECA 4XPDB 2Z3LA 1M4LA 1S3ZA 5J8CA 4FD4A 4QBJA 1M4IA 2AFUA 2JBKA 2R98A 3K2KA 4IUSA 4MHDA 3B2YA 4CYQA 3FX6A 3BLNA 1MJ9A 2D4PA 4UEEA 3KGQA 1YX0A 4X5KA 4HNXB 3NH4A 2DPSA 1M4GA 4KOTA 2PJ6A 4C7HA 2V8GA 2AFZA 4DJLA 2G3TA 2IMOA 4U9ZA 1XOVA 1OZPA 2ZEHA 3C26A 4Y49B 2I3CA 1YVOA 2PJ4A 2VI7A 4MY0A 4GS4A 1TKFA 2PC1A 4OADA 2FCKA 3S9LA 1CPSA 3L2NA 1PUAA 3DGVA 4MJ8A 4L8AA 5G21A 5K8OA 5HVFA 1KUYA 2CXAA 2PJAA 1J4JA 3K9UA 5JGFA 3TOBA 4RS2A 3WABA 4MHPA 2K5TA 5IB9A 2DXQA 1Z2LA 2F7VA 3PBEA 2CTCA 2O4HA 4TWEA 3RBUA 5F49A 2HV2A 4NF1A 5IX3A 4KS9A 3SI2A 2ZEEA 2Z3PA 2FVGA 2PJ5A 4YU9A 3JRUA 3QNVA 3OWCA 4IHMA 1WWZA 3FEDA 3D3SA 3I9SA 3VWDA 2Q7BA 2ZEPA 5EC4A 8CPAA 4OC0A 3IU1A 1VIXA 3NE7A 4UBRA 1IIDA 1H8LA 2YGWA 4MFJA 4YFJA 1BPMA 3FEEA 2OOTA 3K9TA 3D67A 4GXHA 4MFPA 2VQYA 5LYFA 4H6UA 4B14A 2DEAA 3D2PA 1VGYA 1UFHA 5F48A 4OKOA 4UCNA 4BINA 3RYOA 2FIAA 5ELYA 4AVCA 4F9VA 3I3GA 3SI0A 2ZELA 4XNHC 2PIZA 5A27A 1M4DA 3R1KA 1Z9UA 4CGNA 3DLJA 3S6KA 4RI1A 4M85A 4MCPA 1IY7A 1LOKA 1PU9A 1XMTA 2NSMA 2RC4A 1L0CA 3NH8A 4KOYA 4CAFA 2J8RA 2P6EA
chains in the Genus database with same CATH topology
3IWEA 1KZFA 3TTHA 3TT2A 4CGLA 2J8NA 2Z3KA 1CJWA 5G20A 2CNMA 1QSOA 2YNDA 1S7NA 4JXQA 2CNTA 2ZW6A 3H4QA 4NEXA 3JTKA 4B13A 4CGMA 1NSLA 4KSAA 2ZXVA 1RXTA 2AJ6A 4HNYB 2CNSA 4YRHA 3TOAA 2OZHA 3A9LA 4QVTA 1MJBA 3LODA 2PDOA 2H5MA 1VHSA 2GANA 2Q4VA 4NCZA 2HUZA 1N71A 3S6HA 4B5PA 3FBUA 5ISVA 2ARHA 1Y7RA 1YK3A 4CRYB 2P6GA 2QECA 4KVOE 1P0HA 2B4DA 3DNSA 4UFVA 3UY5A 1NMTA 4FD7A 2JLMA 5AG5A 3CXQA 4MFLA 2Z11A 4R87A 4Q38A 1Q2YA 4UA3A 5FVJA 1YVKA 4E0AA 3S6FA 4A32A 4IF5A 5HMNA 1S60A 3TE4A 3TFYA 4OAEA 4CAXA 1LRZA 3FRMA 1IICA 2YNEA 3BJ8A 2FIWA 1QSTA 1QSNA 1B87A 1ZO0A 5AGEA 2Z0ZA 4R9MA 2FT0A 4B11A 4BMHA 3EC4A 2Z3OA 4XPLA 4CYOA 5KTCA 4FD5A 3QB8A 4B10A 4AG7A 3SHPA 4MY3A 4XPKA 4R3KA 4KOWA 5DWMA 5C88A 4UFXA 2I00A 3TO6A 3R9FA 4JD6A 1BO4A 4CGPA 1KUVA 4PK3A 4K30A 1P4NA 4R3LA 4A33A 3F8KA 3SXNA 4CYPA 4B12A 5JQ4A 3GY9A 4H6ZA 4A2ZA 4C2YA 2B5GB 3IWGA 2OB0A 3IGRA 1S7FA 4BBHA 1IYLA 3MGDA 1S7LA 4OLLA 2ZPAA 4KVXA 3FNCA 3BJ7A 2Y0MA 2EVNA 4FD6A 4HNWB 5C82A 2VEZA 4MFQA 3G8WA 5IV0A 1Q2CA 1IB1E 3F5BA 3W91A 2GE3A 1KUXA 3DSBA 2PRBA 2R1IA 4KORA 3EY5A 2JDDA 5F46A 1XIXA 4CYNA 2X7BA 4Q36A 1Y9WA 2PQ8A 1U6MA 1Q2DA 3T90A 1K4JA 2JEVA 2IL4A 2PR8A 4XNHB 1YLEA 5AG6A 5F47A 4HKFA 3TO7A 2R7HA 3IU2A 1I21A 3W6SA 3ZZIA 2OH1A 4KLWA 4KSFA 4CS0B 4Y49C 3DDDA 5KTDA 4PV6A 4KLVA 4CAVA 5AG4A 4F0YA 4AVBA 4B5OA 3SXOA 4MFZA 4A30A 1I1DA 4MI4A 2Z3NA 2GIVA 1XEBA 4E2AA 4KOVA 4MFKA 3FXTA 2ZW5A 4DNCA 2WPXA 2HQYA 2BSWA 4KZTA 2C27A 2PSWA 2G3AA 1WK4A 2AE6A 3W6XA 4QUSA 4U5YA 4F0XA 3R9GA 4A31A 1R57A 4A95A 5J8FA 5H86A 3FIXA 5EBVA 2R8VA 1MJAA 3F0AA 4C7IA 1RO5A 1Z4EA 3PZJA 2B3UA 3TCVA 2WSAA 4QB9A 4CAWA 2EUIA 4L89A 3D2MA 4ORFA 2OZGA 3H5ZA 3R96A 1M44A 3EFAA 4KOXA 4XPDC 4KVME 1NE9A 3CXSA 4KUAA 2WPWA 1XE4A 2REFA 5IB0A 5I0CA 3TO9A 2OU2A 2VBQA 4JWPA 2A4NA 4UCMA 2B3VA 2J8MA 3GYAA 3S6GA 4ZBGA 4F6AA 2WUUA 5BWAB 4H89A 4QC6A 3B8GA 3E0KA 3LD2A 2VZZA 4UWIA 1IYKA 1VKCA 5E96A 4KOSA 1S7KA 4AG9A 2JDCA 2P0WA 3FYNA 3PP9A 1QSRA 4CRZB 4I49A 3ZJ0A 3P2HA 1ON0A 4LUAA 3QAHA 2D4OA 4UFWA 3DR6A 3VWEA 2I79A 2Q44A 2FE7A 4C68A 2VZYA 1M1DA 2PR1A 4YGOA 2B4BA 3CXPA 4AB7A 4KUBA 4ONUA 1CM0A 5CNPA 3N7ZA 5AG7A 1XF8A 3JVNA 2Q0YA 2YNCA 5GCNA 2Z10A 4NXYA 2FXFA 3FB3A 1YGHA 2O28A 4M3SA 1V0CA 1TIQA 5G1ZA 5HH1A 4C2XA 4KOUA 2NMTA 3PGPA 4MBUA 1Z4RA 4CGOA 2B5GA 4U9YA 1GHEA 4JLYA 2CY2A 2ATRA 4EVYA 1YREA 4UCPA 2FSRA 4R57A 3V8IA 1Y9KA 2BL1A 2VXKA 4UWJA 4JJXA 4CAEA 2P6FA 3D8PA 5A28A 5JPHA 3EXNA 2REEA 4J3GA 2OZUA 2QMLA 3GKRA 3JUWA 1QSMA 4JXRA 1I12A 5H84A 2FL4A 1B6BA 3T9YA 2YNCC 4ZGYB 4E8OA 2B58A 2Z3MA 2BUEA 1BOBA 2ZW7A 2BEIA 1SQHA 2QIRA 3KKWA 3EO4A 1FY7A 3R9EA 3G3SA 2F5IA 4B5PB 4C2ZA 5KTAA 3R95A 2ZW4A 4PK2A 5DWNA 3DR8A 4LX9A 2Q04A 4NSQA 1S5KA 2FS5A 4PSWA 4II9A 1MK4A 2Q4YA 2B4DB 2G0BA 3P2FA 4AVAA 2DPTA 5G22A 1YR0A 2KCWA 4PSXA 3WR7A 4XPDB 2Z3LA 1S3ZA 5J8CA 4FD4A 4QBJA 1M4IA 2R98A 4IUSA 4MHDA 4CYQA 3BLNA 1MJ9A 2D4PA 1YX0A 4X5KA 4HNXB 2DPSA 1M4GA 4KOTA 4C7HA 2G3TA 4U9ZA 1OZPA 3C26A 4Y49B 1YVOA 2VI7A 4MY0A 4GS4A 2PC1A 4OADA 2FCKA 1PUAA 4MJ8A 4L8AA 5G21A 1KUYA 2CXAA 1J4JA 3K9UA 3TOBA 4RS2A 2K5TA 2DXQA 5F49A 2HV2A 4NF1A 5IX3A 4KS9A 2Z3PA 3OWCA 1WWZA 3D3SA 3I9SA 3VWDA 2Q7BA 5EC4A 4UBRA 3IU1A 3NE7A 1IIDA 4MFJA 2YGWA 4YFJA 4MFPA 2VQYA 4H6UA 4B14A 3D2PA 1UFHA 5F48A 4UCNA 3RYOA 2FIAA 4AVCA 3I3GA 4XNHC 5A27A 1M4DA 3R1KA 1Z9UA 4CGNA 3S6KA 4RI1A 4M85A 1XMTA 1PU9A 4CAFA 2RC4A 1L0CA 4KOYA 2J8RA 2P6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KZF A;  3TTH A;  3TT2 A;  2J8N A;  1CJW A;  2CNM A;  1QSO A;  1S7N A;  4JXQ A;  2CNT A;  2ZW6 A;  3H4Q A;  4NEX A;  1NSL A;  2ZXV A;  1RXT A;  2AJ6 A;  4HNY B;  2CNS A;  4YRH A;  3TOA A;  2OZH A;  4QVT A;  1MJB A;  3LOD A;  2PDO A;  2H5M A;  1VHS A;  2GAN A;  2Q4V A;  4NCZ A;  2HUZ A;  1N71 A;  3S6H A;  4B5P A;  3FBU A;  5ISV A;  2ARH A;  1Y7R A;  1YK3 A;  4CRY B;  2P6G A;  2QEC A;  4KVO E;  1P0H A;  2B4D A;  3DNS A;  3UY5 A;  1NMT A;  4FD7 A;  2JLM A;  3CXQ A;  2Z11 A;  4R87 A;  1Q2Y A;  4UA3 A;  5FVJ A;  1YVK A;  4E0A A;  3S6F A;  4IF5 A;  5HMN A;  1S60 A;  3TE4 A;  3TFY A;  4OAE A;  4CAX A;  1LRZ A;  3FRM A;  1IIC A;  3BJ8 A;  2FIW A;  1QST A;  1QSN A;  1B87 A;  2Z0Z A;  4R9M A;  2FT0 A;  4BMH A;  3EC4 A;  4XPL A;  5KTC A;  4FD5 A;  3QB8 A;  4AG7 A;  3SHP A;  4MY3 A;  4XPK A;  4R3K A;  4KOW A;  5DWM A;  5C88 A;  2I00 A;  3TO6 A;  3R9F A;  4JD6 A;  1BO4 A;  1KUV A;  4PK3 A;  4K30 A;  1P4N A;  4R3L A;  3F8K A;  3SXN A;  5JQ4 A;  3GY9 A;  4H6Z A;  2B5G B;  3IWG A;  2OB0 A;  3IGR A;  1S7F A;  1IYL A;  3MGD A;  1S7L A;  4OLL A;  2ZPA A;  4KVX A;  3FNC A;  3BJ7 A;  2Y0M A;  2EVN A;  4FD6 A;  4HNW B;  5C82 A;  2VEZ A;  3G8W A;  5IV0 A;  1Q2C A;  1IB1 E;  3F5B A;  3W91 A;  2GE3 A;  1KUX A;  3DSB A;  2PRB A;  2R1I A;  4KOR A;  3EY5 A;  2JDD A;  5F46 A;  1XIX A;  2X7B A;  1Y9W A;  2PQ8 A;  1U6M A;  1Q2D A;  3T90 A;  1K4J A;  2JEV A;  2IL4 A;  2PR8 A;  4XNH B;  1YLE A;  5F47 A;  4HKF A;  3TO7 A;  2R7H A;  1I21 A;  3W6S A;  3ZZI A;  2OH1 A;  4KLW A;  4CS0 B;  4Y49 C;  3DDD A;  5KTD A;  4PV6 A;  4KLV A;  4CAV A;  4F0Y A;  4AVB A;  4B5O A;  3SXO A;  1I1D A;  4MI4 A;  2GIV A;  1XEB A;  4E2A A;  4KOV A;  3FXT A;  2ZW5 A;  4DNC A;  2WPX A;  2HQY A;  2BSW A;  4KZT A;  2C27 A;  2PSW A;  2G3A A;  1WK4 A;  2AE6 A;  3W6X A;  4QUS A;  4U5Y A;  3R9G A;  1R57 A;  5J8F A;  5H86 A;  3FIX A;  5EBV A;  2R8V A;  1MJA A;  3F0A A;  1RO5 A;  1Z4E A;  3PZJ A;  2B3U A;  3TCV A;  4QB9 A;  4CAW A;  2EUI A;  4L89 A;  3D2M A;  4ORF A;  2OZG A;  3R96 A;  1M44 A;  3EFA A;  4KOX A;  4XPD C;  4KVM E;  1NE9 A;  3CXS A;  4KUA A;  2WPW A;  1XE4 A;  2REF A;  5IB0 A;  5I0C A;  3TO9 A;  2OU2 A;  2VBQ A;  4JWP A;  2A4N A;  2B3V A;  2J8M A;  3GYA A;  3S6G A;  4ZBG A;  4F6A A;  4H89 A;  4QC6 A;  3B8G A;  3E0K A;  3LD2 A;  2VZZ A;  4UWI A;  1IYK A;  1VKC A;  5E96 A;  4KOS A;  1S7K A;  4AG9 A;  2JDC A;  2P0W A;  3FYN A;  3PP9 A;  1QSR A;  4CRZ B;  4I49 A;  3ZJ0 A;  3P2H A;  1ON0 A;  4LUA A;  3QAH A;  2D4O A;  3DR6 A;  3VWE A;  2I79 A;  2Q44 A;  2FE7 A;  2VZY A;  1M1D A;  2PR1 A;  4YGO A;  2B4B A;  3CXP A;  4AB7 A;  4KUB A;  4ONU A;  1CM0 A;  5CNP A;  3N7Z A;  1XF8 A;  3JVN A;  2Q0Y A;  5GCN A;  2Z10 A;  4NXY A;  2FXF A;  3FB3 A;  1YGH A;  2O28 A;  4M3S A;  1V0C A;  1TIQ A;  5HH1 A;  4KOU A;  2NMT A;  3PGP A;  4MBU A;  1Z4R A;  2B5G A;  4U9Y A;  1GHE A;  4JLY A;  2CY2 A;  2ATR A;  4EVY A;  1YRE A;  2FSR A;  4R57 A;  3V8I A;  1Y9K A;  2BL1 A;  2VXK A;  4UWJ A;  4JJX A;  2P6F A;  3D8P A;  5JPH A;  3EXN A;  2REE A;  4J3G A;  2OZU A;  2QML A;  3GKR A;  3JUW A;  1QSM A;  4JXR A;  1I12 A;  5H84 A;  2FL4 A;  1B6B A;  3T9Y A;  4E8O A;  2B58 A;  2BUE A;  1BOB A;  2ZW7 A;  2BEI A;  1SQH A;  2QIR A;  3KKW A;  3EO4 A;  1FY7 A;  3R9E A;  3G3S A;  2F5I A;  4B5P B;  5KTA A;  3R95 A;  2ZW4 A;  4PK2 A;  5DWN A;  3DR8 A;  4LX9 A;  2Q04 A;  4NSQ A;  1S5K A;  2FS5 A;  4PSW A;  4II9 A;  1MK4 A;  2Q4Y A;  2B4D B;  2G0B A;  3P2F A;  4AVA A;  1YR0 A;  2KCW A;  4PSX A;  3WR7 A;  4XPD B;  1S3Z A;  5J8C A;  4FD4 A;  4QBJ A;  1M4I A;  2R98 A;  4IUS A;  4MHD A;  3BLN A;  1MJ9 A;  2D4P A;  1YX0 A;  4X5K A;  4HNX B;  1M4G A;  4KOT A;  2G3T A;  4U9Z A;  1OZP A;  3C26 A;  4Y49 B;  1YVO A;  2VI7 A;  4MY0 A;  4GS4 A;  2PC1 A;  4OAD A;  2FCK A;  1PUA A;  4MJ8 A;  4L8A A;  1KUY A;  1J4J A;  3K9U A;  3TOB A;  4RS2 A;  2K5T A;  2DXQ A;  5F49 A;  2HV2 A;  4NF1 A;  5IX3 A;  3OWC A;  1WWZ A;  3D3S A;  3I9S A;  3VWD A;  2Q7B A;  5EC4 A;  4UBR A;  3NE7 A;  1IID A;  4YFJ A;  2VQY A;  4H6U A;  3D2P A;  1UFH A;  5F48 A;  3RYO A;  2FIA A;  4AVC A;  3I3G A;  4XNH C;  1M4D A;  3R1K A;  1Z9U A;  3S6K A;  4RI1 A;  4M85 A;  1XMT A;  1PU9 A;  2RC4 A;  1L0C A;  4KOY A;  2J8R A;  2P6E A; 
#chains in the Genus database with same CATH topology
 5CPA A;  1F2O A;  3IWE A;  1OBR A;  1KZF A;  2Q51 A;  3KAS A;  3SJF A;  3N5F A;  2J8N A;  3TT2 A;  3TTH A;  4OC2 A;  3WT4 A;  4CGL A;  2Z3K A;  1CJW A;  1VHO A;  2CNM A;  5G20 A;  4ZX9 A;  2ABZ A;  3KZW A;  1A2Z A;  1QSO A;  1ZLH A;  2YND A;  1S7N A;  4JXQ A;  2CNT A;  1AMP A;  2ZW6 A;  3H4Q A;  1YLO A;  4NEX A;  3JTK A;  4B13 A;  4CGM A;  2XEG A;  1NSL A;  4KSA A;  4P4J A;  2IJZ A;  3CPA A;  2ZXV A;  1RXT A;  4P4B A;  2ANP A;  2AJ6 A;  3B3S A;  2CNS A;  2Q43 A;  4HNY B;  4OC3 A;  2GLJ A;  4YRH A;  3TOA A;  3VAT A;  2OZH A;  3A9L A;  4QVT A;  1MJB A;  3LOD A;  4MRI A;  2PDO A;  2H5M A;  1VHS A;  2GAN A;  2GRE A;  2Q4V A;  2HUZ A;  4H2K A;  4NCZ A;  4R7M A;  1N71 A;  1NSA A;  3S6H A;  4B5P A;  3FBU A;  5ISV A;  2ZEO A;  4OC5 A;  3FMC A;  2ARH A;  1Y7R A;  1YK3 A;  4CRY B;  2GU2 A;  2P6G A;  2QEC A;  4PPZ A;  4FAI A;  2XEJ A;  4KVO E;  1P0H A;  2B4D A;  3DNS A;  4UFV A;  4F9U A;  3UY5 A;  5LYL A;  2PJ1 A;  1NMT A;  4FD7 A;  2JLM A;  5AG5 A;  3CXQ A;  4MFL A;  2Z11 A;  3IIB A;  1ELL P;  4R87 A;  4AXV A;  1LFW A;  3B3W A;  2AFS A;  4FUU A;  4Q38 A;  1Q2Y A;  3D7H A;  4UA3 A;  5FVJ A;  1YVK A;  4NGN A;  3SJG A;  4E0A A;  1YQE A;  2PVV A;  5THW A;  4IF5 A;  3S6F A;  4A32 A;  3VAR A;  5HMN A;  1S60 A;  3KR4 A;  4NGS A;  3TE4 A;  3LAC A;  5CBM A;  3TFY A;  2ZED A;  4OAE A;  4CAX A;  3B35 A;  1LRZ A;  3IEH A;  3FRM A;  1IIC A;  2YNE A;  4G1P A;  3BJ8 A;  2FIW A;  2PJ0 A;  2WYR A;  3S9N A;  4UEF A;  4PXB A;  1QST A;  1QSN A;  1B87 A;  4A37 A;  1Z8W A;  2CTB A;  1ZO0 A;  5AGE A;  2Z0Z A;  4R9M A;  2FT0 A;  4B11 A;  4M6H A;  1Y7E A;  4BMH A;  3EC4 A;  2Z3O A;  4DUK A;  1HDU A;  4NJR A;  4XPL A;  4CYO A;  3BHX A;  5KTC A;  4FD5 A;  3QB8 A;  4B10 A;  5LRG A;  2RB7 A;  1ELM P;  3D68 A;  3GUX A;  5J1Q A;  4Q7A A;  4X3R A;  4MHY A;  5LRJ A;  3SHP A;  4MY3 A;  4XPK A;  4AG7 A;  5HXD A;  4R3K A;  4KOW A;  5DWM A;  5C88 A;  4UFX A;  2I00 A;  3TO6 A;  5JH9 A;  3R9F A;  3MN8 A;  3NA6 A;  2PJ3 A;  4JD6 A;  1BO4 A;  3GLJ A;  4C2X A;  1FNO A;  3I1U A;  4CGP A;  1KUV A;  1CP7 A;  1PCA A;  3PFE A;  4K3N A;  4PK3 A;  1Z8L A;  1CBX A;  4K30 A;  4F8Z A;  1P4N A;  4R3L A;  4W9Y A;  3F8K A;  4A33 A;  3SXN A;  3CT9 A;  4UIB A;  2ZEF A;  4CYP A;  5LRK A;  2PJB A;  4B12 A;  5JQ4 A;  3GY9 A;  4ZY2 A;  4IAV A;  4H6Z A;  3LWU A;  4A2Z A;  5F09 A;  1LAN A;  4C2Y A;  1JWQ A;  2B5G B;  3IWG A;  2OB0 A;  3IGR A;  1S7F A;  4BBH A;  4FBE A;  1IYL A;  3MGD A;  3D7G A;  4OC1 A;  4P10 A;  1S7L A;  4OLL A;  4HPS A;  4ZY0 A;  2ZPA A;  1XJO A;  4KVX A;  3FNC A;  3KL9 A;  3BJ7 A;  2Y0M A;  2EVN A;  4FD6 A;  4X2T A;  2AFX A;  4HNW B;  4O23 A;  2VEZ A;  3PB8 X;  4MFQ A;  3G8W A;  5C82 A;  5IV0 A;  1Q2C A;  1IB1 E;  3F5B A;  3W91 A;  2GE3 A;  2V8H A;  1TKJ A;  2V8D A;  4FWU A;  2Q7S A;  1KUX A;  3DSB A;  2PRB A;  2R1I A;  3FH4 A;  4KOR A;  4OID A;  4P4E A;  3WC6 A;  1AYE A;  3EY5 A;  2JDD A;  4Z65 A;  5F46 A;  1XIX A;  3RZA A;  4CYN A;  2X7B A;  2QYV A;  3PRT A;  2GLF A;  4GM5 A;  2ZEM A;  1Y9W A;  4Q36 A;  3V38 A;  1BLL E;  2Q4Z A;  2F8H A;  4JZ0 A;  2PQ8 A;  1U6M A;  3KHZ A;  1X12 A;  1Q2D A;  3T90 A;  1K4J A;  2JEV A;  4BD9 A;  1UWY A;  2IL4 A;  2PR8 A;  4XNH B;  1YLE A;  5AG6 A;  4WWV A;  4NJQ A;  4NGQ A;  4WJB A;  5F47 A;  3H8E A;  4HKF A;  3TO7 A;  4RUH A;  3RNZ A;  2R7H A;  4P4I A;  5DS0 A;  2PJC A;  3IU2 A;  3TC8 A;  1I21 A;  3CPX A;  3W6S A;  3ZZI A;  3B3V A;  2OH1 A;  4KLW A;  4KSF A;  2XEF A;  3RO0 A;  4CS0 B;  4Y49 C;  3DDD A;  5KTD A;  4PV6 A;  4KLV A;  4OIW A;  4CAV A;  4F0Y A;  5AG4 A;  4AVB A;  4ZI6 A;  3FVL A;  3SXO A;  1HDQ A;  3S9M A;  2V8V A;  4B5O A;  4MFZ A;  5EMI A;  1LAP A;  2PJ8 A;  1TKH A;  4EFD A;  4A30 A;  1I1D A;  4MI4 A;  4UIA A;  2Z3N A;  3H8F A;  2GIV A;  1XEB A;  3B7I A;  3IJ3 A;  4KOV A;  3FXT A;  2ZW5 A;  4MFK A;  4E2A A;  3NFZ A;  2PJ2 A;  1ARL A;  4DNC A;  2WPX A;  2HQY A;  1Q7L A;  2BSW A;  3T8W A;  4KZT A;  2C27 A;  2C6P A;  2PSW A;  5K8N A;  2G3A A;  4NGP A;  5JM6 A;  3FF3 A;  6CPA A;  1WK4 A;  1ZG7 A;  1TF8 A;  2AE6 A;  3W6X A;  4OME A;  4QUS A;  4U5Y A;  4F0X A;  3R9G A;  4A31 A;  1R57 A;  4A95 A;  5J8F A;  4P44 A;  3KQX A;  5H86 A;  3SI1 A;  1FT7 A;  3FIX A;  2EBJ A;  5EBV A;  1XRY A;  2R8V A;  1MJA A;  3F0A A;  4C7I A;  1RO5 A;  1Z4E A;  3PZJ A;  4M6I A;  2B3U A;  2PJ9 A;  2WSA A;  3RAM A;  3TCV A;  2O53 A;  4QB9 A;  4CAW A;  2EUI A;  4L89 A;  3D2M A;  4ORF A;  2CF4 A;  5I4M A;  3SJX A;  2OZG A;  1Z8T A;  4IK2 A;  3H5Z A;  1DE4 C;  3R96 A;  1CX8 A;  1M44 A;  1F2P A;  3IC1 A;  3EFA A;  4JYW A;  1BPN A;  1PYT B;  3TX8 A;  3IWW A;  4KOX A;  4XPD C;  4ONW A;  3BI1 A;  2HC9 A;  4KVM E;  1NE9 A;  4UF4 A;  4YWY A;  1HEE A;  4NGR A;  5K8M A;  1Z8X A;  3CXS A;  4KUA A;  2WPW A;  1XE4 A;  4P4F A;  2REF A;  5IB0 A;  5I0C A;  1YW4 A;  3TO9 A;  2PIY A;  2OU2 A;  4NGM A;  2VBQ A;  4JWP A;  2A4N A;  4LQ6 A;  4UCM A;  2WZN A;  3PB4 X;  2B3V A;  2PJ7 A;  2J8M A;  3D4U A;  1Y0R A;  3D7D A;  4RN7 A;  1CPX A;  3GYA A;  3S6G A;  4ZBG A;  2EWB A;  4MCR A;  1ARM A;  2ZEN A;  4P45 A;  4F6A A;  3WC5 A;  2PRQ A;  2WUU A;  4EME A;  5BWA B;  1CP6 A;  1XFO A;  4H89 A;  3CDX A;  1F57 A;  2BO9 A;  2ZOG A;  2G9D A;  4QC6 A;  3B8G A;  3E0K A;  3LD2 A;  3WC7 A;  4R8F A;  2VZZ A;  4A39 A;  3IFE A;  3PB9 X;  4UWI A;  1IYK A;  1VKC A;  3V7Z A;  5E96 A;  4KOS A;  1S7K A;  4AG9 A;  3PB7 X;  2JDC A;  2P0W A;  3FYN A;  3PP9 A;  1R3N A;  1QSR A;  2CIJ A;  3KQZ A;  3PEI A;  4P6Y A;  1IOF A;  3VH9 A;  4CRZ B;  4I49 A;  2ZOF A;  3P2H A;  3ZJ0 A;  3H8G A;  1ON0 A;  3QAH A;  4LUA A;  4LQG A;  5LYD A;  2D4O A;  2RFH A;  4UFW A;  4A94 A;  1CG2 A;  3DR6 A;  3ISX A;  4NGT A;  3KR5 A;  3VWE A;  2I79 A;  2Q44 A;  3FJU A;  3SJE A;  1IU8 A;  2FE7 A;  4EWT A;  1X10 A;  3D66 A;  4C68 A;  2BOA A;  3GB0 A;  2VZY A;  1M1D A;  2PR1 A;  7CPA A;  4YGO A;  2B4B A;  1LAM A;  2AFM A;  3CXP A;  1QQ9 A;  4AB7 A;  3KHX A;  4KUB A;  1CM0 A;  3CZX A;  2ZEG A;  4ONU A;  5CNP A;  3N7Z A;  5AG7 A;  1XF8 A;  3JVN A;  2AFW A;  5D29 A;  2GFQ A;  2Q0Y A;  2YNC A;  5GCN A;  4ZYQ A;  4TNU A;  2Z10 A;  4MHZ A;  4KSI A;  2FXF A;  3FB3 A;  1YGH A;  2O28 A;  4M3S A;  4NXY A;  1V0C A;  1TIQ A;  4MCQ A;  5G1Z A;  2C1C A;  3IO1 A;  4ZX8 A;  5HH1 A;  1R43 A;  2HB6 A;  4KOU A;  2NMT A;  3PGP A;  1RTQ A;  4MBU A;  4MHN A;  1Z4R A;  3NH5 A;  4R76 A;  4CGO A;  4P4D A;  2PCU A;  4NFR A;  2B5G A;  3QAY A;  4U9Y A;  2EK8 A;  1GHE A;  1YSJ A;  2CY2 A;  4JLY A;  2ATR A;  5K8P A;  4X8I A;  2QVP A;  2ODF A;  3NE8 A;  2OR4 A;  2EK9 A;  4CPA A;  4EVY A;  4ZY1 A;  1YRE A;  4UCP A;  2FSR A;  4R57 A;  1ZG9 A;  1Y9K A;  3V8I A;  3B3C A;  4MCS A;  4OC4 A;  3PFO A;  1XMB A;  2BL1 A;  3BI0 A;  2C6C A;  2VXK A;  4JJX A;  4UWJ A;  4CAE A;  2P6F A;  3D8P A;  3D7F A;  1JQG A;  3ISZ A;  5A28 A;  5JPH A;  1YME A;  3EXN A;  1QMU A;  2REE A;  3GIU A;  1GYT A;  2POK A;  1IGB A;  4J3G A;  5LYI A;  2OZU A;  2QML A;  2PVW A;  3LMS A;  3GKR A;  3JUW A;  4MMO A;  4UEZ A;  1QSM A;  2EO8 A;  2J9A A;  4JXR A;  4R6T A;  4MXU A;  4PXC A;  1I12 A;  3PBB A;  5H84 A;  2FL4 A;  4A38 A;  4B6Z A;  1B6B A;  1ZLI A;  1BAV A;  2VL1 A;  3T9Y A;  2YNC C;  5HVG A;  4ZGY B;  1TXR A;  4E8O A;  3HUV A;  4DYO A;  2B58 A;  4M6G A;  1AUG A;  2Z3M A;  2BUE A;  1BOB A;  2JBJ A;  2ZW7 A;  1TF9 A;  2BEI A;  2PE3 A;  1SQH A;  2QIR A;  3KKW A;  3EO4 A;  1FY7 A;  3R9E A;  1DTD A;  2NYQ A;  2F5I A;  2V77 A;  3G3S A;  5D8N A;  2BCO A;  3BXM A;  2IQ6 A;  2JEW A;  3B3T A;  4B5P B;  4PQA A;  3MRU A;  4C2Z A;  5KTA A;  3R95 A;  3HLP A;  1YW6 A;  2ZW4 A;  4PK2 A;  4PXD A;  1Z5R A;  3KI9 A;  5DWN A;  3DR8 A;  2C6G A;  2DF5 A;  1IOI A;  1KWM A;  4LX9 A;  2Q04 A;  1XBU A;  4NSQ A;  4PXE A;  1EE3 P;  1Y0Y A;  1S5K A;  2FS5 A;  1VHE A;  3PB6 X;  4PSW A;  5HVH A;  2XEI A;  4II9 A;  1MK4 A;  2Q4Y A;  2B4D B;  2G0B A;  2QJ8 A;  4OP4 A;  2AFO A;  3P2F A;  1LCP A;  1ZG8 A;  2DPT A;  4AVA A;  5G22 A;  1YR0 A;  2KCW A;  4PSX A;  3WR7 A;  3FEC A;  4XPD B;  2Z3L A;  1M4L A;  1S3Z A;  5J8C A;  4FD4 A;  4QBJ A;  1M4I A;  2AFU A;  2JBK A;  2R98 A;  3K2K A;  4IUS A;  4MHD A;  3B2Y A;  4CYQ A;  3FX6 A;  3BLN A;  1MJ9 A;  2D4P A;  4UEE A;  3KGQ A;  1YX0 A;  4X5K A;  4HNX B;  3NH4 A;  2DPS A;  1M4G A;  4KOT A;  2PJ6 A;  4C7H A;  2V8G A;  2AFZ A;  4DJL A;  2G3T A;  2IMO A;  4U9Z A;  1XOV A;  1OZP A;  2ZEH A;  3C26 A;  4Y49 B;  2I3C A;  1YVO A;  2PJ4 A;  2VI7 A;  4MY0 A;  4GS4 A;  1TKF A;  2PC1 A;  4OAD A;  2FCK A;  3S9L A;  1CPS A;  3L2N A;  1PUA A;  3DGV A;  4MJ8 A;  4L8A A;  5G21 A;  5K8O A;  5HVF A;  1KUY A;  2CXA A;  2PJA A;  1J4J A;  3K9U A;  5JGF A;  3TOB A;  4RS2 A;  3WAB A;  4MHP A;  2K5T A;  5IB9 A;  2DXQ A;  1Z2L A;  2F7V A;  3PBE A;  2CTC A;  2O4H A;  4TWE A;  3RBU A;  5F49 A;  2HV2 A;  4NF1 A;  5IX3 A;  4KS9 A;  3SI2 A;  2ZEE A;  2Z3P A;  2FVG A;  2PJ5 A;  4YU9 A;  3JRU A;  3QNV A;  3OWC A;  4IHM A;  1WWZ A;  3FED A;  3D3S A;  3I9S A;  3VWD A;  2Q7B A;  2ZEP A;  5EC4 A;  8CPA A;  4OC0 A;  3IU1 A;  1VIX A;  3NE7 A;  4UBR A;  1IID A;  1H8L A;  2YGW A;  4MFJ A;  4YFJ A;  1BPM A;  3FEE A;  2OOT A;  3K9T A;  3D67 A;  4GXH A;  4MFP A;  2VQY A;  5LYF A;  4H6U A;  4B14 A;  2DEA A;  3D2P A;  1VGY A;  1UFH A;  5F48 A;  4OKO A;  4UCN A;  4BIN A;  3RYO A;  2FIA A;  5ELY A;  4AVC A;  4F9V A;  3I3G A;  3SI0 A;  2ZEL A;  4XNH C;  2PIZ A;  5A27 A;  1M4D A;  3R1K A;  1Z9U A;  4CGN A;  3DLJ A;  3S6K A;  4RI1 A;  4M85 A;  4MCP A;  1IY7 A;  1LOK A;  1PU9 A;  1XMT A;  2NSM A;  2RC4 A;  1L0C A;  3NH8 A;  4KOY A;  4CAF A;  2J8R A;  2P6E A; 
#chains in the Genus database with same CATH homology
 3IWE A;  1KZF A;  3TTH A;  3TT2 A;  4CGL A;  2J8N A;  2Z3K A;  1CJW A;  5G20 A;  2CNM A;  1QSO A;  2YND A;  1S7N A;  4JXQ A;  2CNT A;  2ZW6 A;  3H4Q A;  4NEX A;  3JTK A;  4B13 A;  4CGM A;  1NSL A;  4KSA A;  2ZXV A;  1RXT A;  2AJ6 A;  4HNY B;  2CNS A;  4YRH A;  3TOA A;  2OZH A;  3A9L A;  4QVT A;  1MJB A;  3LOD A;  2PDO A;  2H5M A;  1VHS A;  2GAN A;  2Q4V A;  4NCZ A;  2HUZ A;  1N71 A;  3S6H A;  4B5P A;  3FBU A;  5ISV A;  2ARH A;  1Y7R A;  1YK3 A;  4CRY B;  2P6G A;  2QEC A;  4KVO E;  1P0H A;  2B4D A;  3DNS A;  4UFV A;  3UY5 A;  1NMT A;  4FD7 A;  2JLM A;  5AG5 A;  3CXQ A;  4MFL A;  2Z11 A;  4R87 A;  4Q38 A;  1Q2Y A;  4UA3 A;  5FVJ A;  1YVK A;  4E0A A;  3S6F A;  4A32 A;  4IF5 A;  5HMN A;  1S60 A;  3TE4 A;  3TFY A;  4OAE A;  4CAX A;  1LRZ A;  3FRM A;  1IIC A;  2YNE A;  3BJ8 A;  2FIW A;  1QST A;  1QSN A;  1B87 A;  1ZO0 A;  5AGE A;  2Z0Z A;  4R9M A;  2FT0 A;  4B11 A;  4BMH A;  3EC4 A;  2Z3O A;  4XPL A;  4CYO A;  5KTC A;  4FD5 A;  3QB8 A;  4B10 A;  4AG7 A;  3SHP A;  4MY3 A;  4XPK A;  4R3K A;  4KOW A;  5DWM A;  5C88 A;  4UFX A;  2I00 A;  3TO6 A;  3R9F A;  4JD6 A;  1BO4 A;  4CGP A;  1KUV A;  4PK3 A;  4K30 A;  1P4N A;  4R3L A;  4A33 A;  3F8K A;  3SXN A;  4CYP A;  4B12 A;  5JQ4 A;  3GY9 A;  4H6Z A;  4A2Z A;  4C2Y A;  2B5G B;  3IWG A;  2OB0 A;  3IGR A;  1S7F A;  4BBH A;  1IYL A;  3MGD A;  1S7L A;  4OLL A;  2ZPA A;  4KVX A;  3FNC A;  3BJ7 A;  2Y0M A;  2EVN A;  4FD6 A;  4HNW B;  5C82 A;  2VEZ A;  4MFQ A;  3G8W A;  5IV0 A;  1Q2C A;  1IB1 E;  3F5B A;  3W91 A;  2GE3 A;  1KUX A;  3DSB A;  2PRB A;  2R1I A;  4KOR A;  3EY5 A;  2JDD A;  5F46 A;  1XIX A;  4CYN A;  2X7B A;  4Q36 A;  1Y9W A;  2PQ8 A;  1U6M A;  1Q2D A;  3T90 A;  1K4J A;  2JEV A;  2IL4 A;  2PR8 A;  4XNH B;  1YLE A;  5AG6 A;  5F47 A;  4HKF A;  3TO7 A;  2R7H A;  3IU2 A;  1I21 A;  3W6S A;  3ZZI A;  2OH1 A;  4KLW A;  4KSF A;  4CS0 B;  4Y49 C;  3DDD A;  5KTD A;  4PV6 A;  4KLV A;  4CAV A;  5AG4 A;  4F0Y A;  4AVB A;  4B5O A;  3SXO A;  4MFZ A;  4A30 A;  1I1D A;  4MI4 A;  2Z3N A;  2GIV A;  1XEB A;  4E2A A;  4KOV A;  4MFK A;  3FXT A;  2ZW5 A;  4DNC A;  2WPX A;  2HQY A;  2BSW A;  4KZT A;  2C27 A;  2PSW A;  2G3A A;  1WK4 A;  2AE6 A;  3W6X A;  4QUS A;  4U5Y A;  4F0X A;  3R9G A;  4A31 A;  1R57 A;  4A95 A;  5J8F A;  5H86 A;  3FIX A;  5EBV A;  2R8V A;  1MJA A;  3F0A A;  4C7I A;  1RO5 A;  1Z4E A;  3PZJ A;  2B3U A;  3TCV A;  2WSA A;  4QB9 A;  4CAW A;  2EUI A;  4L89 A;  3D2M A;  4ORF A;  2OZG A;  3H5Z A;  3R96 A;  1M44 A;  3EFA A;  4KOX A;  4XPD C;  4KVM E;  1NE9 A;  3CXS A;  4KUA A;  2WPW A;  1XE4 A;  2REF A;  5IB0 A;  5I0C A;  3TO9 A;  2OU2 A;  2VBQ A;  4JWP A;  2A4N A;  4UCM A;  2B3V A;  2J8M A;  3GYA A;  3S6G A;  4ZBG A;  4F6A A;  2WUU A;  5BWA B;  4H89 A;  4QC6 A;  3B8G A;  3E0K A;  3LD2 A;  2VZZ A;  4UWI A;  1IYK A;  1VKC A;  5E96 A;  4KOS A;  1S7K A;  4AG9 A;  2JDC A;  2P0W A;  3FYN A;  3PP9 A;  1QSR A;  4CRZ B;  4I49 A;  3ZJ0 A;  3P2H A;  1ON0 A;  4LUA A;  3QAH A;  2D4O A;  4UFW A;  3DR6 A;  3VWE A;  2I79 A;  2Q44 A;  2FE7 A;  4C68 A;  2VZY A;  1M1D A;  2PR1 A;  4YGO A;  2B4B A;  3CXP A;  4AB7 A;  4KUB A;  4ONU A;  1CM0 A;  5CNP A;  3N7Z A;  5AG7 A;  1XF8 A;  3JVN A;  2Q0Y A;  2YNC A;  5GCN A;  2Z10 A;  4NXY A;  2FXF A;  3FB3 A;  1YGH A;  2O28 A;  4M3S A;  1V0C A;  1TIQ A;  5G1Z A;  5HH1 A;  4C2X A;  4KOU A;  2NMT A;  3PGP A;  4MBU A;  1Z4R A;  4CGO A;  2B5G A;  4U9Y A;  1GHE A;  4JLY A;  2CY2 A;  2ATR A;  4EVY A;  1YRE A;  4UCP A;  2FSR A;  4R57 A;  3V8I A;  1Y9K A;  2BL1 A;  2VXK A;  4UWJ A;  4JJX A;  4CAE A;  2P6F A;  3D8P A;  5A28 A;  5JPH A;  3EXN A;  2REE A;  4J3G A;  2OZU A;  2QML A;  3GKR A;  3JUW A;  1QSM A;  4JXR A;  1I12 A;  5H84 A;  2FL4 A;  1B6B A;  3T9Y A;  2YNC C;  4ZGY B;  4E8O A;  2B58 A;  2Z3M A;  2BUE A;  1BOB A;  2ZW7 A;  2BEI A;  1SQH A;  2QIR A;  3KKW A;  3EO4 A;  1FY7 A;  3R9E A;  3G3S A;  2F5I A;  4B5P B;  4C2Z A;  5KTA A;  3R95 A;  2ZW4 A;  4PK2 A;  5DWN A;  3DR8 A;  4LX9 A;  2Q04 A;  4NSQ A;  1S5K A;  2FS5 A;  4PSW A;  4II9 A;  1MK4 A;  2Q4Y A;  2B4D B;  2G0B A;  3P2F A;  4AVA A;  2DPT A;  5G22 A;  1YR0 A;  2KCW A;  4PSX A;  3WR7 A;  4XPD B;  2Z3L A;  1S3Z A;  5J8C A;  4FD4 A;  4QBJ A;  1M4I A;  2R98 A;  4IUS A;  4MHD A;  4CYQ A;  3BLN A;  1MJ9 A;  2D4P A;  1YX0 A;  4X5K A;  4HNX B;  2DPS A;  1M4G A;  4KOT A;  4C7H A;  2G3T A;  4U9Z A;  1OZP A;  3C26 A;  4Y49 B;  1YVO A;  2VI7 A;  4MY0 A;  4GS4 A;  2PC1 A;  4OAD A;  2FCK A;  1PUA A;  4MJ8 A;  4L8A A;  5G21 A;  1KUY A;  2CXA A;  1J4J A;  3K9U A;  3TOB A;  4RS2 A;  2K5T A;  2DXQ A;  5F49 A;  2HV2 A;  4NF1 A;  5IX3 A;  4KS9 A;  2Z3P A;  3OWC A;  1WWZ A;  3D3S A;  3I9S A;  3VWD A;  2Q7B A;  5EC4 A;  4UBR A;  3IU1 A;  3NE7 A;  1IID A;  4MFJ A;  2YGW A;  4YFJ A;  4MFP A;  2VQY A;  4H6U A;  4B14 A;  3D2P A;  1UFH A;  5F48 A;  4UCN A;  3RYO A;  2FIA A;  4AVC A;  3I3G A;  4XNH C;  5A27 A;  1M4D A;  3R1K A;  1Z9U A;  4CGN A;  3S6K A;  4RI1 A;  4M85 A;  1XMT A;  1PU9 A;  4CAF A;  2RC4 A;  1L0C A;  4KOY A;  2J8R A;  2P6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...