3B2YA

Crystal structure of a putative metallopeptidase (sden_2526) from shewanella denitrificans os217 at 1.74 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
273
structure length
262
Chain Sequence
MTSRSPFESFVWQSEIFNCQSNDIDAFYAQLAEEVNRLGLKKNTLGSVDSFAINLYQSASQRSDLPSLLISSGFHGEEAAGPWGMLHFLRGLQPALFERVNLSLLPLVNPTGFKAGHRFNRFGENPNRGFTLHTSLEGKLLLEHAQLLCAASRDGILTCHEDVLMNETYVYSFEPTQTPGRFSLGLRDALGQYFKLAKFIDECPVTDGVIFNHFDTSFEAFLVRSGAKLAACSETPGQEDFDRRVQANSAAMGQFIAHCAPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Metallopeptidase containing co-catalytic metalloactive site
publication title Crystal structure of metallopeptidase containing co-catalytic metalloactive site (YP_563529.1) from Shewanella denitrificans OS217 at 1.74 A resolution
rcsb
source organism Shewanella denitrificans os217
total genus 82
structure length 262
sequence length 273
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3b2yA00
4DYOA 1YSJA 3IO1A 5K8PA 1XRYA 3FECA 5D8NA 4PXEA 1NSAA 3I1UA 4DUKA 4R7MA 4ZX8A 1VHEA 3RBUA 1YW6A 2XEIA 4F8ZA 3D7HA 4OC4A 3WC6A 1Z2LA 1EE3P 1F2OA 4P45A 3PBBA 1Y0RA 3KQXA 4NFRA 1UWYA 3H8FA 1TXRA 3V7ZA 2CF4A 2AFZA 3B3SA 3K2KA 3IEHA 2EK9A 3HUVA 3B3VA 1LAMA 3GLJA 3PB9X 3PB4X 5CBMA 1Y7EA 2PJAA 3PB8X 1JQGA 5JM6A 3NFZA 4OIWA 4F9UA 4KSIA 3KHXA 2CTBA 1AYEA 4PPZA 2XEJA 3JRUA 3KQZA 1ZG8A 1M4LA 4NGPA 4W9YA 3N5FA 3WC7A 3KL9A 4P4IA 3FH4A 2XEGA 2CIJA 4UEFA 4X3RA 3SJEA 4A38A 1IY7A 5J1QA 3B7IA 2F8HA 1XFOA 4IAVA 1TF8A 2G9DA 4OC0A 1BPMA 4YWYA 4MHYA 3KHZA 3B3TA 3PFOA 2PJ1A 2AFSA 4ONWA 4ZYQA 2PJCA 3D7FA 2BOAA 2ANPA 4B6ZA 3MN8A 5HVGA 1LCPA 1YMEA 5K8OA 2IMOA 3CPXA 2OOTA 3L2NA 1ZG7A 7CPAA 3FJUA 4PXCA 2PJ2A 1TKFA 2QVPA 1AMPA 2ABZA 1Q7LA 1ARLA 2O53A 1CP7A 4K3NA 5HXDA 1FNOA 1Y0YA 4YU9A 4FWUA 3S9MA 2AFWA 2PJ0A 1GYTA 2J9AA 3S9NA 4IK2A 3PRTA 4R8FA 1XJOA 3K9TA 3FEDA 4P10A 4WJBA 4ZX9A 4NGMA 3CPAA 1ZG9A 3FVLA 1F57A 5LRJA 4NGSA 4EWTA 4R6TA 4UF4A 3PB6X 2ZOFA 1LOKA 5DS0A 2RB7A 3WC5A 4ZY0A 1CP6A 4R76A 3B3WA 2ZEHA 2WZNA 1DE4C 2IJZA 2AFOA 4P44A 4BD9A 2PJ9A 3HLPA 1F2PA 2C6CA 2XEFA 3KR5A 1CPXA 4MCRA 3DGVA 3PBEA 2ZEEA 1Z8LA 3RZAA 3FMCA 4PXDA 3D66A 5JH9A 5LYFA 3CT9A 4UEZA 4AXVA 2Q51A 2ZEMA 4OC1A 4WWVA 1ZLIA 4UIAA 4FBEA 2PJ7A 5LYLA 5F09A 3VH9A 4NGQA 2V8GA 4X8IA 4ZY2A 1PCAA 1QMUA 2PRQA 2EWBA 2ZENA 1TKHA 2ZEFA 5HVFA 2PJ5A 3SI0A 5K8MA 2PJ6A 2AFMA 4ZY1A 3GUXA 3H8GA 2QJ8A 2QYVA 3VARA 3NH8A 3FX6A 2I3CA 3D67A 1DTDA 5ELYA 4OC2A 2ZEPA 2PE3A 4FUUA 4OIDA 3FF3A 3SI1A 2GLFA 4OC5A 5LRGA 1HEEA 4OP4A 2PJ4A 4NGTA 1BLLE 4MHZA 2V77A 5CPAA 2V8HA 4NGNA 2HB6A 2ZEDA 3PFEA 3KI9A 3CDXA 1CPSA 2V8VA 4P4JA 1HDQA 5D29A 3LWUA 1PYTB 4MRIA 2BCOA 3GB0A 3NH5A 1VIXA 4MHNA 3RAMA 3TC8A 5LRKA 1XMBA 3NH4A 2POKA 1ARMA 2VL1A 1CBXA 6CPAA 1R3NA 1VHOA 2V8DA 1LAPA 4Z65A 1XBUA 2C6PA 3SJXA 3D68A 8CPAA 4OKOA 4P6YA 2DEAA 2AFXA 2Q4ZA 4MMOA 3ISZA 3IFEA 3PB7X 2JBKA 4JYWA 2F7VA 3T8WA 4RUHA 4MCSA 5I4MA 1Z5RA 1QQ9A 4DJLA 1ELLP 4H2KA 4ZI6A 2OR4A 5K8NA 4P4FA 3KGQA 2ZOGA 2EK8A 1BAVA 1KWMA 1OBRA 1LANA 1H8LA 3IIBA 2PVWA 2JEWA 4PXBA 4TWEA 2ZELA 2Q43A 3WT4A 1RTQA 3KZWA 3D7GA 2HC9A 4UEEA 1R43A 1YW4A 4TNUA 1HDUA 2AFUA 4O23A 2NSMA 2C6GA 3BHXA 4P4BA 3KASA 4LQGA 4UIBA 2FVGA 1ZLHA 3WABA 4EFDA 3LMSA 4Q7AA 4MXUA 1FT7A 3ISXA 1YLOA 2JBJA 3BI0A 3SJFA 2GREA 3S9LA 4A37A 2PCUA 1CG2A 2PJBA 3TX8A 3PEIA 5JGFA 1VGYA 3QNVA 4MCQA 1ELMP 3IWWA 4NJQA 3B3CA 3D7DA 2O4HA 2PJ8A 3KR4A 4IHMA 4EMEA 4OMEA 5LYIA 1TKJA 2C1CA 2PVVA 4JZ0A 4NGRA 1BPNA 2NYQA 4MCPA 3MRUA 3B35A 4NJRA 3V38A 2IQ6A 1LFWA 4P4EA 2RFHA 1CX8A 4FAIA 3NA6A 4CPAA 4OC3A 2PJ3A 3SI2A 3BI1A 5LYDA 4P4DA 2BO9A 3IJ3A 4G1PA 4X2TA 2CTCA 5HVHA 2ZEOA 1IGBA 3D4UA 5THWA 5IB9A 3VATA 2WYRA 2PIYA 2PIZA 4PQAA 3BXMA 2GLJA 4F9VA 4A39A 2ZEGA 4A94A 2GU2A 3IC1A 1TF9A 3H8EA 3DLJA 4MHPA 3FEEA 3SJGA 3B2YA 4GM5A
chains in the Genus database with same CATH superfamily
4DYOA 1X12A 1YSJA 3IO1A 5K8PA 2G0BA 1KZFA 1XRYA 3NE8A 3FECA 5D8NA 4PXEA 1NSAA 3I1UA 4DUKA 4R7MA 2BUEA 4ZX8A 1VHEA 2FIWA 4MFJA 3QAHA 3RBUA 3FYNA 1YW6A 1JWQA 4U9YA 2XEIA 3EO4A 4F8ZA 3D7HA 4OC4A 3WC6A 4B14A 1Z2LA 1EE3P 4F6AA 1F2OA 4P45A 3PBBA 1Y0RA 1NSLA 3KQXA 3EFAA 4KOYA 4UCMA 4AVCA 4DNCA 2PC1A 5EBVA 4NFRA 3IU2A 1UWYA 3D8PA 1N71A 4LX9A 3LACA 4HKFA 5AG4A 2FCKA 4MJ8A 3H8FA 3R9EA 1TXRA 3V7ZA 4AG7A 2PQ8A 2CF4A 2AFZA 3B3SA 4HNXB 1S5KA 3K2KA 1U6MA 3IEHA 3H4QA 4IF5A 2DPTA 4HPSA 3ZZIA 4M6HA 3V8IA 2EK9A 1IIDA 3HUVA 4MFZA 1XMTA 2VQYA 4KOWA 3B3VA 1LAMA 3GLJA 3PB9X 2I00A 3PB4X 3R96A 2FSRA 5CBMA 1Y7EA 2PJAA 3PB8X 4Y49B 1JQGA 4KSFA 5JM6A 1Y9KA 3NFZA 4OIWA 4UA3A 5FVJA 4F9UA 2Q4VA 4KSIA 3FNCA 5CNPA 3KHXA 2FXFA 2PR8A 3CXSA 2CTBA 4XPLA 1AYEA 2G3AA 2PDOA 1PUAA 4PPZA 3MGDA 1S7KA 2XEJA 3JRUA 4HNYB 3KQZA 4JLYA 2AE6A 1YX0A 1M4LA 1ZG8A 5HMNA 4M6GA 2D4OA 3DR8A 3G8WA 4NGPA 4W9YA 3R95A 3N5FA 3WC7A 4PSXA 2EUIA 3KL9A 4FD6A 1KUYA 3FH4A 2XEGA 4P4IA 1M4IA 2CIJA 1XEBA 4UEFA 4KVME 4MY3A 4H6ZA 4C7HA 4KVOE 4M3SA 1CJWA 4X3RA 2Z3KA 3SJEA 4A38A 3F8KA 1IY7A 2QIRA 4U5YA 5J1QA 2RC4A 2H5MA 2YNEA 3B7IA 2F8HA 1XFOA 2GIVA 4IAVA 1TF8A 4JD6A 2A4NA 2FL4A 2G9DA 2B4DA 4OC0A 1BPMA 3LD2A 4YWYA 4MHYA 1R57A 3KHZA 1Z8WA 1K4JA 1S7NA 2YNDA 3BLNA 2OU2A 4OAEA 5F49A 1Z8TA 2PR1A 5A27A 3B3TA 2JLMA 3QAYA 3OWCA 3PFOA 2PJ1A 2AFSA 4ONWA 4UCNA 4ZYQA 3W6XA 4I49A 2PSWA 2PJCA 3D7FA 3S6FA 3IGRA 1I1DA 2BOAA 2OH1A 4Y49C 5EC4A 1KUVA 4MFKA 2ANPA 3CZXA 3MN8A 4B6ZA 1LCPA 4NXYA 4CAVA 1YMEA 5HVGA 5K8OA 4AVBA 4B12A 3FXTA 2BSWA 3RO0A 4ZBGA 4KOVA 5GCNA 1RXTA 2IMOA 4R9MA 2Z3PA 3CPXA 3PP9A 3L2NA 2OOTA 1Q2CA 2JDCA 4FD5A 1ZG7A 4CAEA 7CPAA 2QECA 2DF5A 1S60A 3FJUA 4PXCA 2QMLA 2PJ2A 3S6HA 2B5GB 1TKFA 2QVPA 1AMPA 2ABZA 1BO4A 1Q7LA 2KCWA 1ARLA 2O53A 1CP7A 4H89A 4K3NA 5HXDA 1TIQA 1FNOA 1Y0YA 4YU9A 5H86A 4FWUA 3S9MA 2AFWA 2PJ0A 1GYTA 2J9AA 4PK2A 3S9NA 2R1IA 2B3UA 4IK2A 3TE4A 3PRTA 1QSTA 4R8FA 1S3ZA 1XJOA 1M44A 3K9TA 3G3SA 3FEDA 2ATRA 4P10A 4WJBA 4FD7A 1IB1E 2REEA 4ZX9A 4BMHA 4J3GA 4NGMA 4B10A 3CPAA 3CXPA 1Z9UA 1ZG9A 3FVLA 2Q04A 4BINA 1F57A 2OZHA 5LRJA 3EXNA 1YGHA 4NGSA 2Q44A 4EWTA 4CRYB 4R6TA 4UF4A 3PB6X 4M6IA 2ZOFA 4KVXA 1LOKA 1S7LA 4F0XA 1MJ9A 5DS0A 5IX3A 5KTAA 4II9A 4B5PA 2B4BA 4CGNA 4AG9A 2RB7A 4X5KA 3N7ZA 3WC5A 4ZY0A 4GS4A 1CP6A 2REFA 2YNCC 5AG5A 3P2FA 4R76A 3B3WA 2F5IA 3DDDA 2ZEHA 2WZNA 1DE4C 1VHSA 2IJZA 2AFOA 4P44A 2Q0YA 4BD9A 3BJ7A 2FE7A 2PJ9A 1IOFA 4PK3A 2Z10A 3HLPA 2VZZA 2JDDA 1F2PA 2C6CA 2XEFA 3KR5A 3TO6A 4LUAA 1CPXA 4MCRA 2D4PA 3DGVA 4XPKA 3PBEA 3FIXA 4NSQA 4BBHA 4RN7A 4A31A 4L89A 1B87A 1S7FA 2P6FA 1QSRA 2ZEEA 5AG7A 1P0HA 5F47A 1Z8LA 1J4JA 3RZAA 5IB0A 3FMCA 2DPSA 1YVOA 4PXDA 4C68A 3D66A 5JH9A 3TOBA 2R8VA 5LYFA 3CT9A 4YFJA 4UEZA 1GHEA 4AXVA 1QSNA 2CXAA 2Q51A 2ZEMA 3GKRA 5AG6A 2CNMA 2B58A 3I3GA 4OC1A 4CS0B 4WWVA 4CYQA 1ZLIA 4UIAA 3GIUA 4B13A 4FBEA 2PJ7A 5LYLA 4FD4A 1IYKA 3VH9A 5F09A 1YREA 4NGQA 2OZUA 2V8GA 4X8IA 4ZY2A 2ZW6A 1PCAA 1QMUA 2PRQA 2EWBA 2ZENA 4LQ6A 1MJAA 1TKHA 5HH1A 2ZEFA 4PSWA 3TT2A 1WK4A 1KUXA 1I12A 5HVFA 4KLVA 2PJ5A 3SI0A 5K8MA 2ARHA 3JUWA 2PJ6A 2CY2A 2J8NA 2WPWA 2AFMA 4ZY1A 4KORA 3GUXA 3RNZA 1YR0A 4KOSA 2Q7SA 3H8GA 2QJ8A 2QYVA 3SXOA 3VARA 3NH8A 3FX6A 4MFLA 2I3CA 4JWPA 1B6BA 1DTDA 3D67A 4CGMA 5ELYA 4OC2A 1XE4A 2FIAA 1L0CA 2PE3A 2ZEPA 4R3KA 4FUUA 4OIDA 3S6KA 4C2YA 3FF3A 3SI1A 2GLFA 5KTDA 3B8GA 2CNSA 2I79A 4OC5A 5LRGA 1YVKA 2Z3LA 1Z4EA 4E2AA 1HEEA 2WUUA 1IICA 2PJ4A 4KUAA 4OP4A 2B4DB 3SXNA 3A9LA 1QSMA 4NGTA 1BLLE 5G20A 4JJXA 4MHZA 2V77A 2R98A 2IL4A 2YGWA 5CPAA 3LODA 5IV0A 2V8HA 4NGNA 3E0KA 5G21A 2HB6A 2ZEDA 5ISVA 3P2HA 3PFEA 2VZYA 3KKWA 1IU8A 4CRZB 5J8CA 3GYAA 4CAXA 2FS5A 2Q4YA 3KI9A 4CGLA 4RS2A 3CDXA 1Y7RA 1CPSA 4ZGYB 2V8VA 2AJ6A 5F48A 3D2PA 4ORFA 4P4JA 1HDQA 4KOTA 3IWEA 4NF1A 2Q7BA 4IUSA 3LWUA 1SQHA 5D29A 1M1DA 1XF8A 1PYTB 3EC4A 2JEVA 2WSAA 4EVYA 4MRIA 2BCOA 3GB0A 3NH5A 2P6GA 1VIXA 2VEZA 4MHNA 4UBRA 3F0AA 3RAMA 1UFHA 3TC8A 4U9ZA 5C88A 5LRKA 3JVNA 1XMBA 3NH4A 2POKA 2DXQA 1IYLA 1ARMA 2VL1A 1CBXA 6CPAA 1R3NA 1X10A 1VHOA 2V8DA 4AB7A 2NMTA 4QUSA 1LAPA 3UY5A 4B5OA 4Z65A 4A2ZA 1XBUA 2C6PA 3SJXA 1YLEA 3D68A 1WWZA 1MK4A 4OKOA 4P6YA 8CPAA 4MHDA 4CYNA 3DNSA 4F0YA 2DEAA 2AFXA 4L8AA 2EO8A 3T9YA 4NCZA 1Y9WA 4NEXA 2Q4ZA 1XIXA 1AUGA 4MMOA 3IU1A 3ISZA 4JXQA 4QBJA 4E0AA 3IFEA 2GANA 3TCVA 4KOUA 3PB7X 4KZTA 2P6EA 4QC6A 2JBKA 4UCPA 5E96A 2ZW5A 2F7VA 4JYWA 3IWGA 1P4NA 4R3LA 3T8WA 5J8FA 4RUHA 4MCSA 4B5PB 1Z5RA 4KUBA 4OLLA 5I4MA 1QSOA 3WR7A 4CGOA 4QVTA 4UFWA 1QQ9A 4DJLA 1ELLP 2Z3NA 4H2KA 4ZI6A 3I9SA 4Q38A 4UFVA 2Z3MA 2OR4A 3R9FA 5K8NA 4P4FA 3KGQA 4MI4A 3PZJA 5DWMA 2ZOGA 1YK3A 1PU9A 2EK8A 5C82A 2GFQA 2EBJA 1BAVA 1KWMA 1OBRA 1LANA 4HNWB 1H8LA 3IIBA 4M85A 2PVWA 2JEWA 4PXBA 4TWEA 2ZELA 2BL1A 2Q43A 4YGOA 1I21A 3W91A 3WT4A 1NMTA 1RTQA 3KZWA 4JXRA 3D7GA 3TO7A 2HC9A 4A95A 3S6GA 4UEEA 4A33A 1R43A 4CYOA 1YW4A 4TNUA 1HDUA 4R57A 4XNHC 1LRZA 4KOXA 2VI7A 2AFUA 1V0CA 4O23A 2Z11A 4AVAA 1ON0A 4B11A 2NSMA 1IOIA 2C6GA 2P0WA 3BHXA 4P4BA 3KASA 4LQGA 4XPDC 5F46A 1FY7A 2OB0A 4UIBA 2FVGA 3R1KA 1YQEA 1ZLHA 1BOBA 3WABA 2HV2A 3K9UA 4ONUA 1Z8XA 3LMSA 4EFDA 1Q2DA 2PRBA 4Q7AA 3VWEA 4MXUA 1FT7A 5DWNA 3ISXA 4MBUA 1M4DA 1YLOA 4KSAA 2JBJA 2X7BA 3BI0A 2ODFA 1M4GA 3NE7A 2GREA 3SJFA 3ZJ0A 3S9LA 4A37A 3D2MA 2PCUA 1VKCA 4YRHA 3TO9A 2GE3A 1CG2A 2PJBA 3TX8A 3PEIA 3T90A 5JGFA 2EVNA 1VGYA 4K30A 3QNVA 4MCQA 1ELMP 1MJBA 3IWWA 4NJQA 3R9GA 4A30A 4H6UA 1CM0A 2BEIA 3B3CA 3D7DA 2FT0A 3DSBA 2O4HA 2PJ8A 3KR4A 4IHMA 4OADA 4EMEA 4OMEA 4C7IA 5LYIA 3FB3A 1TKJA 2C1CA 2PVVA 4JZ0A 2YNCA 2K5TA 2Z3OA 4R87A 4NGRA 3CXQA 1BPNA 5G22A 4CAWA 2NYQA 1A2ZA 2CNTA 2HQYA 1Z4RA 3B35A 3MRUA 4MCPA 1Q2YA 4NJRA 2IQ6A 1LFWA 2Z0ZA 3V38A 4P4EA 3VWDA 5JQ4A 2RFHA 2WPXA 5KTCA 3QB8A 5I0CA 4PV6A 4QB9A 1CX8A 4FAIA 2VBQA 3NA6A 3F5BA 2ZW4A 2ZXVA 3FRMA 4MY0A 3PGPA 3BJ8A 4CPAA 2VXKA 2J8MA 4OC3A 2PJ3A 4KS9A 3SI2A 2B5GA 3BI1A 4CYPA 5LYDA 2HUZA 1XOVA 2BO9A 4P4DA 3IJ3A 4MFQA 4UFXA 4G1PA 5EMIA 3FBUA 4X2TA 2CTCA 5HVHA 4UWJA 3EY5A 2ZEOA 1ZO0A 3SHPA 4CAFA 2R7HA 2Y0MA 1IGBA 1OZPA 4UWIA 3D4UA 5THWA 4C2ZA 2OZGA 2J8RA 3C26A 4C2XA 5IB9A 2G3TA 3VATA 1NE9A 2WYRA 2PIYA 5AGEA 2PIZA 2ZW7A 5JPHA 5H84A 3RYOA 4PQAA 3BXMA 5BWAB 2GLJA 4F9VA 4KLWA 4XNHB 3TTHA 2O28A 3W6SA 1RO5A 3D3SA 4RI1A 3TOAA 2ZEGA 4A39A 4E8OA 3H5ZA 2ZPAA 4A94A 2GU2A 5G1ZA 2C27A 3IC1A 1TF9A 4CGPA 3H8EA 3JTKA 3DLJA 3DR6A 4MFPA 4MHPA 5A28A 3FEEA 4GXHA 4XPDB 3SJGA 3B2YA 3TFYA 4Q36A 3GY9A 4A32A 4GM5A 2B3VA
chains in the Genus database with same CATH topology
4DYOA 1YSJA 3IO1A 5K8PA 1XRYA 3FECA 5D8NA 4PXEA 1NSAA 3I1UA 4DUKA 4R7MA 4ZX8A 1VHEA 3RBUA 1YW6A 2XEIA 4F8ZA 3D7HA 4OC4A 3WC6A 1Z2LA 1EE3P 1F2OA 4P45A 3PBBA 1Y0RA 3KQXA 4NFRA 1UWYA 3H8FA 1TXRA 3V7ZA 2CF4A 2AFZA 3B3SA 3K2KA 3IEHA 2EK9A 3HUVA 3B3VA 1LAMA 3GLJA 3PB9X 3PB4X 5CBMA 1Y7EA 2PJAA 3PB8X 1JQGA 5JM6A 3NFZA 4OIWA 4F9UA 4KSIA 3KHXA 2CTBA 1AYEA 4PPZA 2XEJA 3JRUA 3KQZA 1ZG8A 1M4LA 4NGPA 4W9YA 3N5FA 3WC7A 3KL9A 4P4IA 3FH4A 2XEGA 2CIJA 4UEFA 4X3RA 3SJEA 4A38A 1IY7A 5J1QA 3B7IA 2F8HA 1XFOA 4IAVA 1TF8A 2G9DA 4OC0A 1BPMA 4YWYA 4MHYA 3KHZA 3B3TA 3PFOA 2PJ1A 2AFSA 4ONWA 4ZYQA 2PJCA 3D7FA 2BOAA 2ANPA 4B6ZA 3MN8A 5HVGA 1LCPA 1YMEA 5K8OA 2IMOA 3CPXA 2OOTA 3L2NA 1ZG7A 7CPAA 3FJUA 4PXCA 2PJ2A 1TKFA 2QVPA 1AMPA 2ABZA 1Q7LA 1ARLA 2O53A 1CP7A 4K3NA 5HXDA 1FNOA 1Y0YA 4YU9A 4FWUA 3S9MA 2AFWA 2PJ0A 1GYTA 2J9AA 3S9NA 4IK2A 3PRTA 4R8FA 1XJOA 3K9TA 3FEDA 4P10A 4WJBA 4ZX9A 4NGMA 3CPAA 1ZG9A 3FVLA 1F57A 5LRJA 4NGSA 4EWTA 4R6TA 4UF4A 3PB6X 2ZOFA 1LOKA 5DS0A 2RB7A 3WC5A 4ZY0A 1CP6A 4R76A 3B3WA 2ZEHA 2WZNA 1DE4C 2IJZA 2AFOA 4P44A 4BD9A 2PJ9A 3HLPA 1F2PA 2C6CA 2XEFA 3KR5A 1CPXA 4MCRA 3DGVA 3PBEA 2ZEEA 1Z8LA 3RZAA 3FMCA 4PXDA 3D66A 5JH9A 5LYFA 3CT9A 4UEZA 4AXVA 2Q51A 2ZEMA 4OC1A 4WWVA 1ZLIA 4UIAA 4FBEA 2PJ7A 5LYLA 5F09A 3VH9A 4NGQA 2V8GA 4X8IA 4ZY2A 1PCAA 1QMUA 2PRQA 2EWBA 2ZENA 1TKHA 2ZEFA 5HVFA 2PJ5A 3SI0A 5K8MA 2PJ6A 2AFMA 4ZY1A 3GUXA 3H8GA 2QJ8A 2QYVA 3VARA 3NH8A 3FX6A 2I3CA 3D67A 1DTDA 5ELYA 4OC2A 2ZEPA 2PE3A 4FUUA 4OIDA 3FF3A 3SI1A 2GLFA 4OC5A 5LRGA 1HEEA 4OP4A 2PJ4A 4NGTA 1BLLE 4MHZA 2V77A 5CPAA 2V8HA 4NGNA 2HB6A 2ZEDA 3PFEA 3KI9A 3CDXA 1CPSA 2V8VA 4P4JA 1HDQA 5D29A 3LWUA 1PYTB 4MRIA 2BCOA 3GB0A 3NH5A 1VIXA 4MHNA 3RAMA 3TC8A 5LRKA 1XMBA 3NH4A 2POKA 1ARMA 2VL1A 1CBXA 6CPAA 1R3NA 1VHOA 2V8DA 1LAPA 4Z65A 1XBUA 2C6PA 3SJXA 3D68A 8CPAA 4OKOA 4P6YA 2DEAA 2AFXA 2Q4ZA 4MMOA 3ISZA 3IFEA 3PB7X 2JBKA 4JYWA 2F7VA 3T8WA 4RUHA 4MCSA 5I4MA 1Z5RA 1QQ9A 4DJLA 1ELLP 4H2KA 4ZI6A 2OR4A 5K8NA 4P4FA 3KGQA 2ZOGA 2EK8A 1BAVA 1KWMA 1OBRA 1LANA 1H8LA 3IIBA 2PVWA 2JEWA 4PXBA 4TWEA 2ZELA 2Q43A 3WT4A 1RTQA 3KZWA 3D7GA 2HC9A 4UEEA 1R43A 1YW4A 4TNUA 1HDUA 2AFUA 4O23A 2NSMA 2C6GA 3BHXA 4P4BA 3KASA 4LQGA 4UIBA 2FVGA 1ZLHA 3WABA 4EFDA 3LMSA 4Q7AA 4MXUA 1FT7A 3ISXA 1YLOA 2JBJA 3BI0A 3SJFA 2GREA 3S9LA 4A37A 2PCUA 1CG2A 2PJBA 3TX8A 3PEIA 5JGFA 1VGYA 3QNVA 4MCQA 1ELMP 3IWWA 4NJQA 3B3CA 3D7DA 2O4HA 2PJ8A 3KR4A 4IHMA 4EMEA 4OMEA 5LYIA 1TKJA 2C1CA 2PVVA 4JZ0A 4NGRA 1BPNA 2NYQA 4MCPA 3MRUA 3B35A 4NJRA 3V38A 2IQ6A 1LFWA 4P4EA 2RFHA 1CX8A 4FAIA 3NA6A 4CPAA 4OC3A 2PJ3A 3SI2A 3BI1A 5LYDA 4P4DA 2BO9A 3IJ3A 4G1PA 4X2TA 2CTCA 5HVHA 2ZEOA 1IGBA 3D4UA 5THWA 5IB9A 3VATA 2WYRA 2PIYA 2PIZA 4PQAA 3BXMA 2GLJA 4F9VA 4A39A 2ZEGA 4A94A 2GU2A 3IC1A 1TF9A 3H8EA 3DLJA 4MHPA 3FEEA 3SJGA 3B2YA 4GM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DYO A;  1YSJ A;  3IO1 A;  5K8P A;  1XRY A;  3FEC A;  5D8N A;  4PXE A;  1NSA A;  3I1U A;  4DUK A;  4R7M A;  4ZX8 A;  1VHE A;  3RBU A;  1YW6 A;  2XEI A;  4F8Z A;  3D7H A;  4OC4 A;  3WC6 A;  1Z2L A;  1EE3 P;  1F2O A;  4P45 A;  3PBB A;  1Y0R A;  3KQX A;  4NFR A;  1UWY A;  3H8F A;  1TXR A;  3V7Z A;  2CF4 A;  2AFZ A;  3B3S A;  3K2K A;  3IEH A;  2EK9 A;  3HUV A;  3B3V A;  1LAM A;  3GLJ A;  3PB9 X;  3PB4 X;  5CBM A;  1Y7E A;  2PJA A;  3PB8 X;  1JQG A;  5JM6 A;  3NFZ A;  4OIW A;  4F9U A;  4KSI A;  3KHX A;  2CTB A;  1AYE A;  4PPZ A;  2XEJ A;  3JRU A;  3KQZ A;  1ZG8 A;  1M4L A;  4NGP A;  4W9Y A;  3N5F A;  3WC7 A;  3KL9 A;  4P4I A;  3FH4 A;  2XEG A;  2CIJ A;  4UEF A;  4X3R A;  3SJE A;  4A38 A;  1IY7 A;  5J1Q A;  3B7I A;  2F8H A;  1XFO A;  4IAV A;  1TF8 A;  2G9D A;  4OC0 A;  1BPM A;  4YWY A;  4MHY A;  3KHZ A;  3B3T A;  3PFO A;  2PJ1 A;  2AFS A;  4ONW A;  4ZYQ A;  2PJC A;  3D7F A;  2BOA A;  2ANP A;  4B6Z A;  3MN8 A;  5HVG A;  1LCP A;  1YME A;  5K8O A;  2IMO A;  3CPX A;  2OOT A;  3L2N A;  1ZG7 A;  7CPA A;  3FJU A;  4PXC A;  2PJ2 A;  1TKF A;  2QVP A;  1AMP A;  2ABZ A;  1Q7L A;  1ARL A;  2O53 A;  1CP7 A;  4K3N A;  5HXD A;  1FNO A;  1Y0Y A;  4YU9 A;  4FWU A;  3S9M A;  2AFW A;  2PJ0 A;  1GYT A;  2J9A A;  3S9N A;  4IK2 A;  3PRT A;  4R8F A;  1XJO A;  3K9T A;  3FED A;  4P10 A;  4WJB A;  4ZX9 A;  4NGM A;  3CPA A;  1ZG9 A;  3FVL A;  1F57 A;  5LRJ A;  4NGS A;  4EWT A;  4R6T A;  4UF4 A;  3PB6 X;  2ZOF A;  1LOK A;  5DS0 A;  2RB7 A;  3WC5 A;  4ZY0 A;  1CP6 A;  4R76 A;  3B3W A;  2ZEH A;  2WZN A;  1DE4 C;  2IJZ A;  2AFO A;  4P44 A;  4BD9 A;  2PJ9 A;  3HLP A;  1F2P A;  2C6C A;  2XEF A;  3KR5 A;  1CPX A;  4MCR A;  3DGV A;  3PBE A;  2ZEE A;  1Z8L A;  3RZA A;  3FMC A;  4PXD A;  3D66 A;  5JH9 A;  5LYF A;  3CT9 A;  4UEZ A;  4AXV A;  2Q51 A;  2ZEM A;  4OC1 A;  4WWV A;  1ZLI A;  4UIA A;  4FBE A;  2PJ7 A;  5LYL A;  5F09 A;  3VH9 A;  4NGQ A;  2V8G A;  4X8I A;  4ZY2 A;  1PCA A;  1QMU A;  2PRQ A;  2EWB A;  2ZEN A;  1TKH A;  2ZEF A;  5HVF A;  2PJ5 A;  3SI0 A;  5K8M A;  2PJ6 A;  2AFM A;  4ZY1 A;  3GUX A;  3H8G A;  2QJ8 A;  2QYV A;  3VAR A;  3NH8 A;  3FX6 A;  2I3C A;  3D67 A;  1DTD A;  5ELY A;  4OC2 A;  2ZEP A;  2PE3 A;  4FUU A;  4OID A;  3FF3 A;  3SI1 A;  2GLF A;  4OC5 A;  5LRG A;  1HEE A;  4OP4 A;  2PJ4 A;  4NGT A;  1BLL E;  4MHZ A;  2V77 A;  5CPA A;  2V8H A;  4NGN A;  2HB6 A;  2ZED A;  3PFE A;  3KI9 A;  3CDX A;  1CPS A;  2V8V A;  4P4J A;  1HDQ A;  5D29 A;  3LWU A;  1PYT B;  4MRI A;  2BCO A;  3GB0 A;  3NH5 A;  1VIX A;  4MHN A;  3RAM A;  3TC8 A;  5LRK A;  1XMB A;  3NH4 A;  2POK A;  1ARM A;  2VL1 A;  1CBX A;  6CPA A;  1R3N A;  1VHO A;  2V8D A;  1LAP A;  4Z65 A;  1XBU A;  2C6P A;  3SJX A;  3D68 A;  8CPA A;  4OKO A;  4P6Y A;  2DEA A;  2AFX A;  2Q4Z A;  4MMO A;  3ISZ A;  3IFE A;  3PB7 X;  2JBK A;  4JYW A;  2F7V A;  3T8W A;  4RUH A;  4MCS A;  5I4M A;  1Z5R A;  1QQ9 A;  4DJL A;  1ELL P;  4H2K A;  4ZI6 A;  2OR4 A;  5K8N A;  4P4F A;  3KGQ A;  2ZOG A;  2EK8 A;  1BAV A;  1KWM A;  1OBR A;  1LAN A;  1H8L A;  3IIB A;  2PVW A;  2JEW A;  4PXB A;  4TWE A;  2ZEL A;  2Q43 A;  3WT4 A;  1RTQ A;  3KZW A;  3D7G A;  2HC9 A;  4UEE A;  1R43 A;  1YW4 A;  4TNU A;  1HDU A;  2AFU A;  4O23 A;  2NSM A;  2C6G A;  3BHX A;  4P4B A;  3KAS A;  4LQG A;  4UIB A;  2FVG A;  1ZLH A;  3WAB A;  4EFD A;  3LMS A;  4Q7A A;  4MXU A;  1FT7 A;  3ISX A;  1YLO A;  2JBJ A;  3BI0 A;  3SJF A;  2GRE A;  3S9L A;  4A37 A;  2PCU A;  1CG2 A;  2PJB A;  3TX8 A;  3PEI A;  5JGF A;  1VGY A;  3QNV A;  4MCQ A;  1ELM P;  3IWW A;  4NJQ A;  3B3C A;  3D7D A;  2O4H A;  2PJ8 A;  3KR4 A;  4IHM A;  4EME A;  4OME A;  5LYI A;  1TKJ A;  2C1C A;  2PVV A;  4JZ0 A;  4NGR A;  1BPN A;  2NYQ A;  4MCP A;  3MRU A;  3B35 A;  4NJR A;  3V38 A;  2IQ6 A;  1LFW A;  4P4E A;  2RFH A;  1CX8 A;  4FAI A;  3NA6 A;  4CPA A;  4OC3 A;  2PJ3 A;  3SI2 A;  3BI1 A;  5LYD A;  4P4D A;  2BO9 A;  3IJ3 A;  4G1P A;  4X2T A;  2CTC A;  5HVH A;  2ZEO A;  1IGB A;  3D4U A;  5THW A;  5IB9 A;  3VAT A;  2WYR A;  2PIY A;  2PIZ A;  4PQA A;  3BXM A;  2GLJ A;  4F9V A;  4A39 A;  2ZEG A;  4A94 A;  2GU2 A;  3IC1 A;  1TF9 A;  3H8E A;  3DLJ A;  4MHP A;  3FEE A;  3SJG A;  3B2Y A;  4GM5 A; 
#chains in the Genus database with same CATH topology
 4DYO A;  1X12 A;  1YSJ A;  3IO1 A;  5K8P A;  2G0B A;  1KZF A;  1XRY A;  3NE8 A;  3FEC A;  5D8N A;  4PXE A;  1NSA A;  3I1U A;  4DUK A;  4R7M A;  2BUE A;  4ZX8 A;  1VHE A;  2FIW A;  4MFJ A;  3QAH A;  3RBU A;  3FYN A;  1YW6 A;  1JWQ A;  4U9Y A;  2XEI A;  3EO4 A;  4F8Z A;  3D7H A;  4OC4 A;  3WC6 A;  4B14 A;  1Z2L A;  1EE3 P;  4F6A A;  1F2O A;  4P45 A;  3PBB A;  1Y0R A;  1NSL A;  3KQX A;  3EFA A;  4KOY A;  4UCM A;  4AVC A;  4DNC A;  2PC1 A;  5EBV A;  4NFR A;  3IU2 A;  1UWY A;  3D8P A;  1N71 A;  4LX9 A;  3LAC A;  4HKF A;  5AG4 A;  2FCK A;  4MJ8 A;  3H8F A;  3R9E A;  1TXR A;  3V7Z A;  4AG7 A;  2PQ8 A;  2CF4 A;  2AFZ A;  3B3S A;  4HNX B;  1S5K A;  3K2K A;  1U6M A;  3IEH A;  3H4Q A;  4IF5 A;  2DPT A;  4HPS A;  3ZZI A;  4M6H A;  3V8I A;  2EK9 A;  1IID A;  3HUV A;  4MFZ A;  1XMT A;  2VQY A;  4KOW A;  3B3V A;  1LAM A;  3GLJ A;  3PB9 X;  2I00 A;  3PB4 X;  3R96 A;  2FSR A;  5CBM A;  1Y7E A;  2PJA A;  3PB8 X;  4Y49 B;  1JQG A;  4KSF A;  5JM6 A;  1Y9K A;  3NFZ A;  4OIW A;  4UA3 A;  5FVJ A;  4F9U A;  2Q4V A;  4KSI A;  3FNC A;  5CNP A;  3KHX A;  2FXF A;  2PR8 A;  3CXS A;  2CTB A;  4XPL A;  1AYE A;  2G3A A;  2PDO A;  1PUA A;  4PPZ A;  3MGD A;  1S7K A;  2XEJ A;  3JRU A;  4HNY B;  3KQZ A;  4JLY A;  2AE6 A;  1YX0 A;  1M4L A;  1ZG8 A;  5HMN A;  4M6G A;  2D4O A;  3DR8 A;  3G8W A;  4NGP A;  4W9Y A;  3R95 A;  3N5F A;  3WC7 A;  4PSX A;  2EUI A;  3KL9 A;  4FD6 A;  1KUY A;  3FH4 A;  2XEG A;  4P4I A;  1M4I A;  2CIJ A;  1XEB A;  4UEF A;  4KVM E;  4MY3 A;  4H6Z A;  4C7H A;  4KVO E;  4M3S A;  1CJW A;  4X3R A;  2Z3K A;  3SJE A;  4A38 A;  3F8K A;  1IY7 A;  2QIR A;  4U5Y A;  5J1Q A;  2RC4 A;  2H5M A;  2YNE A;  3B7I A;  2F8H A;  1XFO A;  2GIV A;  4IAV A;  1TF8 A;  4JD6 A;  2A4N A;  2FL4 A;  2G9D A;  2B4D A;  4OC0 A;  1BPM A;  3LD2 A;  4YWY A;  4MHY A;  1R57 A;  3KHZ A;  1Z8W A;  1K4J A;  1S7N A;  2YND A;  3BLN A;  2OU2 A;  4OAE A;  5F49 A;  1Z8T A;  2PR1 A;  5A27 A;  3B3T A;  2JLM A;  3QAY A;  3OWC A;  3PFO A;  2PJ1 A;  2AFS A;  4ONW A;  4UCN A;  4ZYQ A;  3W6X A;  4I49 A;  2PSW A;  2PJC A;  3D7F A;  3S6F A;  3IGR A;  1I1D A;  2BOA A;  2OH1 A;  4Y49 C;  5EC4 A;  1KUV A;  4MFK A;  2ANP A;  3CZX A;  3MN8 A;  4B6Z A;  1LCP A;  4NXY A;  4CAV A;  1YME A;  5HVG A;  5K8O A;  4AVB A;  4B12 A;  3FXT A;  2BSW A;  3RO0 A;  4ZBG A;  4KOV A;  5GCN A;  1RXT A;  2IMO A;  4R9M A;  2Z3P A;  3CPX A;  3PP9 A;  3L2N A;  2OOT A;  1Q2C A;  2JDC A;  4FD5 A;  1ZG7 A;  4CAE A;  7CPA A;  2QEC A;  2DF5 A;  1S60 A;  3FJU A;  4PXC A;  2QML A;  2PJ2 A;  3S6H A;  2B5G B;  1TKF A;  2QVP A;  1AMP A;  2ABZ A;  1BO4 A;  1Q7L A;  2KCW A;  1ARL A;  2O53 A;  1CP7 A;  4H89 A;  4K3N A;  5HXD A;  1TIQ A;  1FNO A;  1Y0Y A;  4YU9 A;  5H86 A;  4FWU A;  3S9M A;  2AFW A;  2PJ0 A;  1GYT A;  2J9A A;  4PK2 A;  3S9N A;  2R1I A;  2B3U A;  4IK2 A;  3TE4 A;  3PRT A;  1QST A;  4R8F A;  1S3Z A;  1XJO A;  1M44 A;  3K9T A;  3G3S A;  3FED A;  2ATR A;  4P10 A;  4WJB A;  4FD7 A;  1IB1 E;  2REE A;  4ZX9 A;  4BMH A;  4J3G A;  4NGM A;  4B10 A;  3CPA A;  3CXP A;  1Z9U A;  1ZG9 A;  3FVL A;  2Q04 A;  4BIN A;  1F57 A;  2OZH A;  5LRJ A;  3EXN A;  1YGH A;  4NGS A;  2Q44 A;  4EWT A;  4CRY B;  4R6T A;  4UF4 A;  3PB6 X;  4M6I A;  2ZOF A;  4KVX A;  1LOK A;  1S7L A;  4F0X A;  1MJ9 A;  5DS0 A;  5IX3 A;  5KTA A;  4II9 A;  4B5P A;  2B4B A;  4CGN A;  4AG9 A;  2RB7 A;  4X5K A;  3N7Z A;  3WC5 A;  4ZY0 A;  4GS4 A;  1CP6 A;  2REF A;  2YNC C;  5AG5 A;  3P2F A;  4R76 A;  3B3W A;  2F5I A;  3DDD A;  2ZEH A;  2WZN A;  1DE4 C;  1VHS A;  2IJZ A;  2AFO A;  4P44 A;  2Q0Y A;  4BD9 A;  3BJ7 A;  2FE7 A;  2PJ9 A;  1IOF A;  4PK3 A;  2Z10 A;  3HLP A;  2VZZ A;  2JDD A;  1F2P A;  2C6C A;  2XEF A;  3KR5 A;  3TO6 A;  4LUA A;  1CPX A;  4MCR A;  2D4P A;  3DGV A;  4XPK A;  3PBE A;  3FIX A;  4NSQ A;  4BBH A;  4RN7 A;  4A31 A;  4L89 A;  1B87 A;  1S7F A;  2P6F A;  1QSR A;  2ZEE A;  5AG7 A;  1P0H A;  5F47 A;  1Z8L A;  1J4J A;  3RZA A;  5IB0 A;  3FMC A;  2DPS A;  1YVO A;  4PXD A;  4C68 A;  3D66 A;  5JH9 A;  3TOB A;  2R8V A;  5LYF A;  3CT9 A;  4YFJ A;  4UEZ A;  1GHE A;  4AXV A;  1QSN A;  2CXA A;  2Q51 A;  2ZEM A;  3GKR A;  5AG6 A;  2CNM A;  2B58 A;  3I3G A;  4OC1 A;  4CS0 B;  4WWV A;  4CYQ A;  1ZLI A;  4UIA A;  3GIU A;  4B13 A;  4FBE A;  2PJ7 A;  5LYL A;  4FD4 A;  1IYK A;  3VH9 A;  5F09 A;  1YRE A;  4NGQ A;  2OZU A;  2V8G A;  4X8I A;  4ZY2 A;  2ZW6 A;  1PCA A;  1QMU A;  2PRQ A;  2EWB A;  2ZEN A;  4LQ6 A;  1MJA A;  1TKH A;  5HH1 A;  2ZEF A;  4PSW A;  3TT2 A;  1WK4 A;  1KUX A;  1I12 A;  5HVF A;  4KLV A;  2PJ5 A;  3SI0 A;  5K8M A;  2ARH A;  3JUW A;  2PJ6 A;  2CY2 A;  2J8N A;  2WPW A;  2AFM A;  4ZY1 A;  4KOR A;  3GUX A;  3RNZ A;  1YR0 A;  4KOS A;  2Q7S A;  3H8G A;  2QJ8 A;  2QYV A;  3SXO A;  3VAR A;  3NH8 A;  3FX6 A;  4MFL A;  2I3C A;  4JWP A;  1B6B A;  1DTD A;  3D67 A;  4CGM A;  5ELY A;  4OC2 A;  1XE4 A;  2FIA A;  1L0C A;  2PE3 A;  2ZEP A;  4R3K A;  4FUU A;  4OID A;  3S6K A;  4C2Y A;  3FF3 A;  3SI1 A;  2GLF A;  5KTD A;  3B8G A;  2CNS A;  2I79 A;  4OC5 A;  5LRG A;  1YVK A;  2Z3L A;  1Z4E A;  4E2A A;  1HEE A;  2WUU A;  1IIC A;  2PJ4 A;  4KUA A;  4OP4 A;  2B4D B;  3SXN A;  3A9L A;  1QSM A;  4NGT A;  1BLL E;  5G20 A;  4JJX A;  4MHZ A;  2V77 A;  2R98 A;  2IL4 A;  2YGW A;  5CPA A;  3LOD A;  5IV0 A;  2V8H A;  4NGN A;  3E0K A;  5G21 A;  2HB6 A;  2ZED A;  5ISV A;  3P2H A;  3PFE A;  2VZY A;  3KKW A;  1IU8 A;  4CRZ B;  5J8C A;  3GYA A;  4CAX A;  2FS5 A;  2Q4Y A;  3KI9 A;  4CGL A;  4RS2 A;  3CDX A;  1Y7R A;  1CPS A;  4ZGY B;  2V8V A;  2AJ6 A;  5F48 A;  3D2P A;  4ORF A;  4P4J A;  1HDQ A;  4KOT A;  3IWE A;  4NF1 A;  2Q7B A;  4IUS A;  3LWU A;  1SQH A;  5D29 A;  1M1D A;  1XF8 A;  1PYT B;  3EC4 A;  2JEV A;  2WSA A;  4EVY A;  4MRI A;  2BCO A;  3GB0 A;  3NH5 A;  2P6G A;  1VIX A;  2VEZ A;  4MHN A;  4UBR A;  3F0A A;  3RAM A;  1UFH A;  3TC8 A;  4U9Z A;  5C88 A;  5LRK A;  3JVN A;  1XMB A;  3NH4 A;  2POK A;  2DXQ A;  1IYL A;  1ARM A;  2VL1 A;  1CBX A;  6CPA A;  1R3N A;  1X10 A;  1VHO A;  2V8D A;  4AB7 A;  2NMT A;  4QUS A;  1LAP A;  3UY5 A;  4B5O A;  4Z65 A;  4A2Z A;  1XBU A;  2C6P A;  3SJX A;  1YLE A;  3D68 A;  1WWZ A;  1MK4 A;  4OKO A;  4P6Y A;  8CPA A;  4MHD A;  4CYN A;  3DNS A;  4F0Y A;  2DEA A;  2AFX A;  4L8A A;  2EO8 A;  3T9Y A;  4NCZ A;  1Y9W A;  4NEX A;  2Q4Z A;  1XIX A;  1AUG A;  4MMO A;  3IU1 A;  3ISZ A;  4JXQ A;  4QBJ A;  4E0A A;  3IFE A;  2GAN A;  3TCV A;  4KOU A;  3PB7 X;  4KZT A;  2P6E A;  4QC6 A;  2JBK A;  4UCP A;  5E96 A;  2ZW5 A;  2F7V A;  4JYW A;  3IWG A;  1P4N A;  4R3L A;  3T8W A;  5J8F A;  4RUH A;  4MCS A;  4B5P B;  1Z5R A;  4KUB A;  4OLL A;  5I4M A;  1QSO A;  3WR7 A;  4CGO A;  4QVT A;  4UFW A;  1QQ9 A;  4DJL A;  1ELL P;  2Z3N A;  4H2K A;  4ZI6 A;  3I9S A;  4Q38 A;  4UFV A;  2Z3M A;  2OR4 A;  3R9F A;  5K8N A;  4P4F A;  3KGQ A;  4MI4 A;  3PZJ A;  5DWM A;  2ZOG A;  1YK3 A;  1PU9 A;  2EK8 A;  5C82 A;  2GFQ A;  2EBJ A;  1BAV A;  1KWM A;  1OBR A;  1LAN A;  4HNW B;  1H8L A;  3IIB A;  4M85 A;  2PVW A;  2JEW A;  4PXB A;  4TWE A;  2ZEL A;  2BL1 A;  2Q43 A;  4YGO A;  1I21 A;  3W91 A;  3WT4 A;  1NMT A;  1RTQ A;  3KZW A;  4JXR A;  3D7G A;  3TO7 A;  2HC9 A;  4A95 A;  3S6G A;  4UEE A;  4A33 A;  1R43 A;  4CYO A;  1YW4 A;  4TNU A;  1HDU A;  4R57 A;  4XNH C;  1LRZ A;  4KOX A;  2VI7 A;  2AFU A;  1V0C A;  4O23 A;  2Z11 A;  4AVA A;  1ON0 A;  4B11 A;  2NSM A;  1IOI A;  2C6G A;  2P0W A;  3BHX A;  4P4B A;  3KAS A;  4LQG A;  4XPD C;  5F46 A;  1FY7 A;  2OB0 A;  4UIB A;  2FVG A;  3R1K A;  1YQE A;  1ZLH A;  1BOB A;  3WAB A;  2HV2 A;  3K9U A;  4ONU A;  1Z8X A;  3LMS A;  4EFD A;  1Q2D A;  2PRB A;  4Q7A A;  3VWE A;  4MXU A;  1FT7 A;  5DWN A;  3ISX A;  4MBU A;  1M4D A;  1YLO A;  4KSA A;  2JBJ A;  2X7B A;  3BI0 A;  2ODF A;  1M4G A;  3NE7 A;  2GRE A;  3SJF A;  3ZJ0 A;  3S9L A;  4A37 A;  3D2M A;  2PCU A;  1VKC A;  4YRH A;  3TO9 A;  2GE3 A;  1CG2 A;  2PJB A;  3TX8 A;  3PEI A;  3T90 A;  5JGF A;  2EVN A;  1VGY A;  4K30 A;  3QNV A;  4MCQ A;  1ELM P;  1MJB A;  3IWW A;  4NJQ A;  3R9G A;  4A30 A;  4H6U A;  1CM0 A;  2BEI A;  3B3C A;  3D7D A;  2FT0 A;  3DSB A;  2O4H A;  2PJ8 A;  3KR4 A;  4IHM A;  4OAD A;  4EME A;  4OME A;  4C7I A;  5LYI A;  3FB3 A;  1TKJ A;  2C1C A;  2PVV A;  4JZ0 A;  2YNC A;  2K5T A;  2Z3O A;  4R87 A;  4NGR A;  3CXQ A;  1BPN A;  5G22 A;  4CAW A;  2NYQ A;  1A2Z A;  2CNT A;  2HQY A;  1Z4R A;  3B35 A;  3MRU A;  4MCP A;  1Q2Y A;  4NJR A;  2IQ6 A;  1LFW A;  2Z0Z A;  3V38 A;  4P4E A;  3VWD A;  5JQ4 A;  2RFH A;  2WPX A;  5KTC A;  3QB8 A;  5I0C A;  4PV6 A;  4QB9 A;  1CX8 A;  4FAI A;  2VBQ A;  3NA6 A;  3F5B A;  2ZW4 A;  2ZXV A;  3FRM A;  4MY0 A;  3PGP A;  3BJ8 A;  4CPA A;  2VXK A;  2J8M A;  4OC3 A;  2PJ3 A;  4KS9 A;  3SI2 A;  2B5G A;  3BI1 A;  4CYP A;  5LYD A;  2HUZ A;  1XOV A;  2BO9 A;  4P4D A;  3IJ3 A;  4MFQ A;  4UFX A;  4G1P A;  5EMI A;  3FBU A;  4X2T A;  2CTC A;  5HVH A;  4UWJ A;  3EY5 A;  2ZEO A;  1ZO0 A;  3SHP A;  4CAF A;  2R7H A;  2Y0M A;  1IGB A;  1OZP A;  4UWI A;  3D4U A;  5THW A;  4C2Z A;  2OZG A;  2J8R A;  3C26 A;  4C2X A;  5IB9 A;  2G3T A;  3VAT A;  1NE9 A;  2WYR A;  2PIY A;  5AGE A;  2PIZ A;  2ZW7 A;  5JPH A;  5H84 A;  3RYO A;  4PQA A;  3BXM A;  5BWA B;  2GLJ A;  4F9V A;  4KLW A;  4XNH B;  3TTH A;  2O28 A;  3W6S A;  1RO5 A;  3D3S A;  4RI1 A;  3TOA A;  2ZEG A;  4A39 A;  4E8O A;  3H5Z A;  2ZPA A;  4A94 A;  2GU2 A;  5G1Z A;  2C27 A;  3IC1 A;  1TF9 A;  4CGP A;  3H8E A;  3JTK A;  3DLJ A;  3DR6 A;  4MFP A;  4MHP A;  5A28 A;  3FEE A;  4GXH A;  4XPD B;  3SJG A;  3B2Y A;  3TFY A;  4Q36 A;  3GY9 A;  4A32 A;  4GM5 A;  2B3V A; 
#chains in the Genus database with same CATH homology
 4DYO A;  1YSJ A;  3IO1 A;  5K8P A;  1XRY A;  3FEC A;  5D8N A;  4PXE A;  1NSA A;  3I1U A;  4DUK A;  4R7M A;  4ZX8 A;  1VHE A;  3RBU A;  1YW6 A;  2XEI A;  4F8Z A;  3D7H A;  4OC4 A;  3WC6 A;  1Z2L A;  1EE3 P;  1F2O A;  4P45 A;  3PBB A;  1Y0R A;  3KQX A;  4NFR A;  1UWY A;  3H8F A;  1TXR A;  3V7Z A;  2CF4 A;  2AFZ A;  3B3S A;  3K2K A;  3IEH A;  2EK9 A;  3HUV A;  3B3V A;  1LAM A;  3GLJ A;  3PB9 X;  3PB4 X;  5CBM A;  1Y7E A;  2PJA A;  3PB8 X;  1JQG A;  5JM6 A;  3NFZ A;  4OIW A;  4F9U A;  4KSI A;  3KHX A;  2CTB A;  1AYE A;  4PPZ A;  2XEJ A;  3JRU A;  3KQZ A;  1ZG8 A;  1M4L A;  4NGP A;  4W9Y A;  3N5F A;  3WC7 A;  3KL9 A;  4P4I A;  3FH4 A;  2XEG A;  2CIJ A;  4UEF A;  4X3R A;  3SJE A;  4A38 A;  1IY7 A;  5J1Q A;  3B7I A;  2F8H A;  1XFO A;  4IAV A;  1TF8 A;  2G9D A;  4OC0 A;  1BPM A;  4YWY A;  4MHY A;  3KHZ A;  3B3T A;  3PFO A;  2PJ1 A;  2AFS A;  4ONW A;  4ZYQ A;  2PJC A;  3D7F A;  2BOA A;  2ANP A;  4B6Z A;  3MN8 A;  5HVG A;  1LCP A;  1YME A;  5K8O A;  2IMO A;  3CPX A;  2OOT A;  3L2N A;  1ZG7 A;  7CPA A;  3FJU A;  4PXC A;  2PJ2 A;  1TKF A;  2QVP A;  1AMP A;  2ABZ A;  1Q7L A;  1ARL A;  2O53 A;  1CP7 A;  4K3N A;  5HXD A;  1FNO A;  1Y0Y A;  4YU9 A;  4FWU A;  3S9M A;  2AFW A;  2PJ0 A;  1GYT A;  2J9A A;  3S9N A;  4IK2 A;  3PRT A;  4R8F A;  1XJO A;  3K9T A;  3FED A;  4P10 A;  4WJB A;  4ZX9 A;  4NGM A;  3CPA A;  1ZG9 A;  3FVL A;  1F57 A;  5LRJ A;  4NGS A;  4EWT A;  4R6T A;  4UF4 A;  3PB6 X;  2ZOF A;  1LOK A;  5DS0 A;  2RB7 A;  3WC5 A;  4ZY0 A;  1CP6 A;  4R76 A;  3B3W A;  2ZEH A;  2WZN A;  1DE4 C;  2IJZ A;  2AFO A;  4P44 A;  4BD9 A;  2PJ9 A;  3HLP A;  1F2P A;  2C6C A;  2XEF A;  3KR5 A;  1CPX A;  4MCR A;  3DGV A;  3PBE A;  2ZEE A;  1Z8L A;  3RZA A;  3FMC A;  4PXD A;  3D66 A;  5JH9 A;  5LYF A;  3CT9 A;  4UEZ A;  4AXV A;  2Q51 A;  2ZEM A;  4OC1 A;  4WWV A;  1ZLI A;  4UIA A;  4FBE A;  2PJ7 A;  5LYL A;  5F09 A;  3VH9 A;  4NGQ A;  2V8G A;  4X8I A;  4ZY2 A;  1PCA A;  1QMU A;  2PRQ A;  2EWB A;  2ZEN A;  1TKH A;  2ZEF A;  5HVF A;  2PJ5 A;  3SI0 A;  5K8M A;  2PJ6 A;  2AFM A;  4ZY1 A;  3GUX A;  3H8G A;  2QJ8 A;  2QYV A;  3VAR A;  3NH8 A;  3FX6 A;  2I3C A;  3D67 A;  1DTD A;  5ELY A;  4OC2 A;  2ZEP A;  2PE3 A;  4FUU A;  4OID A;  3FF3 A;  3SI1 A;  2GLF A;  4OC5 A;  5LRG A;  1HEE A;  4OP4 A;  2PJ4 A;  4NGT A;  1BLL E;  4MHZ A;  2V77 A;  5CPA A;  2V8H A;  4NGN A;  2HB6 A;  2ZED A;  3PFE A;  3KI9 A;  3CDX A;  1CPS A;  2V8V A;  4P4J A;  1HDQ A;  5D29 A;  3LWU A;  1PYT B;  4MRI A;  2BCO A;  3GB0 A;  3NH5 A;  1VIX A;  4MHN A;  3RAM A;  3TC8 A;  5LRK A;  1XMB A;  3NH4 A;  2POK A;  1ARM A;  2VL1 A;  1CBX A;  6CPA A;  1R3N A;  1VHO A;  2V8D A;  1LAP A;  4Z65 A;  1XBU A;  2C6P A;  3SJX A;  3D68 A;  8CPA A;  4OKO A;  4P6Y A;  2DEA A;  2AFX A;  2Q4Z A;  4MMO A;  3ISZ A;  3IFE A;  3PB7 X;  2JBK A;  4JYW A;  2F7V A;  3T8W A;  4RUH A;  4MCS A;  5I4M A;  1Z5R A;  1QQ9 A;  4DJL A;  1ELL P;  4H2K A;  4ZI6 A;  2OR4 A;  5K8N A;  4P4F A;  3KGQ A;  2ZOG A;  2EK8 A;  1BAV A;  1KWM A;  1OBR A;  1LAN A;  1H8L A;  3IIB A;  2PVW A;  2JEW A;  4PXB A;  4TWE A;  2ZEL A;  2Q43 A;  3WT4 A;  1RTQ A;  3KZW A;  3D7G A;  2HC9 A;  4UEE A;  1R43 A;  1YW4 A;  4TNU A;  1HDU A;  2AFU A;  4O23 A;  2NSM A;  2C6G A;  3BHX A;  4P4B A;  3KAS A;  4LQG A;  4UIB A;  2FVG A;  1ZLH A;  3WAB A;  4EFD A;  3LMS A;  4Q7A A;  4MXU A;  1FT7 A;  3ISX A;  1YLO A;  2JBJ A;  3BI0 A;  3SJF A;  2GRE A;  3S9L A;  4A37 A;  2PCU A;  1CG2 A;  2PJB A;  3TX8 A;  3PEI A;  5JGF A;  1VGY A;  3QNV A;  4MCQ A;  1ELM P;  3IWW A;  4NJQ A;  3B3C A;  3D7D A;  2O4H A;  2PJ8 A;  3KR4 A;  4IHM A;  4EME A;  4OME A;  5LYI A;  1TKJ A;  2C1C A;  2PVV A;  4JZ0 A;  4NGR A;  1BPN A;  2NYQ A;  4MCP A;  3MRU A;  3B35 A;  4NJR A;  3V38 A;  2IQ6 A;  1LFW A;  4P4E A;  2RFH A;  1CX8 A;  4FAI A;  3NA6 A;  4CPA A;  4OC3 A;  2PJ3 A;  3SI2 A;  3BI1 A;  5LYD A;  4P4D A;  2BO9 A;  3IJ3 A;  4G1P A;  4X2T A;  2CTC A;  5HVH A;  2ZEO A;  1IGB A;  3D4U A;  5THW A;  5IB9 A;  3VAT A;  2WYR A;  2PIY A;  2PIZ A;  4PQA A;  3BXM A;  2GLJ A;  4F9V A;  4A39 A;  2ZEG A;  4A94 A;  2GU2 A;  3IC1 A;  1TF9 A;  3H8E A;  3DLJ A;  4MHP A;  3FEE A;  3SJG A;  3B2Y A;  4GM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...