3B2YA

Crystal structure of a putative metallopeptidase (sden_2526) from shewanella denitrificans os217 at 1.74 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
273
structure length
262
Chain Sequence
MTSRSPFESFVWQSEIFNCQSNDIDAFYAQLAEEVNRLGLKKNTLGSVDSFAINLYQSASQRSDLPSLLISSGFHGEEAAGPWGMLHFLRGLQPALFERVNLSLLPLVNPTGFKAGHRFNRFGENPNRGFTLHTSLEGKLLLEHAQLLCAASRDGILTCHEDVLMNETYVYSFEPTQTPGRFSLGLRDALGQYFKLAKFIDECPVTDGVIFNHFDTSFEAFLVRSGAKLAACSETPGQEDFDRRVQANSAAMGQFIAHCAPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallopeptidase containing co-catalytic metalloactive site
publication title Crystal structure of metallopeptidase containing co-catalytic metalloactive site (YP_563529.1) from Shewanella denitrificans OS217 at 1.74 A resolution
rcsb
source organism Shewanella denitrificans os217
molecule tags Hydrolase
total genus 82
structure length 262
sequence length 273
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3b2yA00
5K8PA 3SI1A 2C6GA 1F2PA 2PJ3A 3B35A 1IGBA 1Y0RA 1YLOA 2VL1A 2XEIA 4OP4A 4YU9A 4OC1A 4P6YA 4R76A 2Q51A 3SI0A 2F8HA 1LOKA 3WC7A 2CIJA 4NGRA 4W9YA 4MHZA 3IC1A 3B7IA 4R6TA 1LAPA 1H8LA 3T8WA 1RTQA 4MCPA 1VIXA 4MXUA 1NSAA 1Z8LA 1CPXA 2J9AA 4P4BA 2V8GA 4MCRA 2AFZA 4CPAA 3FH4A 2PJ2A 4MCQA 4PXBA 3SJXA 1LCPA 3B3SA 1F57A 5K8NA 2PJBA 1IY7A 2AFXA 1Z5RA 1ELLP 2C6PA 4UEFA 2O53A 5LRJA 4X8IA 4JZ0A 1ARLA 4OMEA 5HVHA 2QYVA 2ZENA 4TWEA 3KR4A 4P4IA 4MMOA 1Y0YA 1QMUA 1XMBA 2GLJA 5JGFA 4K3NA 4X3RA 4MHNA 2NSMA 3DLJA 1BAVA 4EMEA 1AYEA 3RZAA 2CTCA 1CP7A 4OC3A 2PJ8A 4MRIA 2IMOA 3FJUA 3QNVA 2ANPA 2PIYA 4FBEA 5LYFA 2GLFA 4ZI6A 3PEIA 4FAIA 1TF9A 3SJFA 1FNOA 2O4HA 2IQ6A 3VH9A 5DS0A 3FVLA 3RBUA 3HLPA 2ZOGA 5I4MA 5ELYA 2XEGA 4Q7AA 4P4FA 2POKA 4P10A 2WYRA 2C6CA 4P45A 2ZEHA 3H8EA 5LRKA 1XBUA 5IB9A 2PVVA 1CBXA 3D68A 1VHEA 3VATA 2ZEOA 3SJGA 3FMCA 3I1UA 2EK9A 1DE4C 1HDUA 1EE3P 2JBJA 3NH4A 1JQGA 3PRTA 1Y7EA 3TC8A 4F9VA 4OC0A 4LQGA 4JYWA 5LYLA 1M4LA 2PCUA 2HB6A 2NYQA 1TKFA 3KQZA 2XEFA 3PBEA 3VARA 4A37A 3SJEA 3GUXA 4P4EA 1XJOA 1CX8A 3B3WA 2ZEDA 3PBBA 2PJ1A 1YW6A 2EWBA 3K9TA 2AFOA 3CT9A 4A38A 1VHOA 3D7DA 3KASA 4NGPA 4MHYA 3B3VA 1Q7LA 3GLJA 4FUUA 3WC5A 3KQXA 4PXCA 1ZLHA 2CTBA 2V77A 1XFOA 3JRUA 2PIZA 5K8OA 1QQ9A 4O23A 1R3NA 4GM5A 4NGQA 2AFMA 1BPMA 1LFWA 5HVGA 3H8GA 2FVGA 1CP6A 5CBMA 3NH5A 4P44A 2QJ8A 3PFOA 2RFHA 3CPAA 1R43A 1BLLE 4ZYQA 1OBRA 2QVPA 1ZG8A 5K8MA 4EWTA 4FWUA 3WT4A 3S9MA 4NGMA 1YSJA 3B3CA 3S9NA 2V8VA 3ISZA 2WZNA 1YMEA 4P4DA 2EK8A 3PFEA 1CG2A 4PXDA 1ZG9A 2CF4A 3DGVA 2GU2A 3HUVA 3KHZA 2PJ7A 2OOTA 3FX6A 3CPXA 4MCSA 4TNUA 3KL9A 1GYTA 1ARMA 1LANA 4OIWA 4P4JA 3TX8A 4UEZA 2C1CA 2PJAA 3RAMA 3B2YA 3N5FA 3L2NA 3FECA 2F7VA 4UF4A 3PB9X 3D7FA 3WC6A 2PJCA 4DUKA 1TKJA 3IWWA 1ZG7A 1PCAA 4PPZA 1UWYA 5HXDA 1FT7A 3FF3A 1KWMA 2AFWA 1VGYA 3FEEA 5J1QA 5LYIA 3D7GA 1BPNA 1AMPA 2ZEMA 3PB6X 2V8DA 4NJQA 3LWUA 4UIBA 3BI0A 2PJ0A 1CPSA 3K2KA 3SI2A 3WABA 2ZEPA 4H2KA 4NGTA 4OC4A 2ZEEA 3IJ3A 5D8NA 4IK2A 5CPAA 4PXEA 2IJZA 4ZX9A 3KHXA 4OIDA 4ZX8A 4F9UA 4IHMA 3IO1A 3MRUA 2GREA 2JEWA 4ZY1A 2OR4A 1TXRA 3PB8X 6CPAA 3LMSA 4BD9A 4RUHA 2PRQA 5F09A 2I3CA 3KI9A 2BO9A 5THWA 1F2OA 2ZEGA 3V38A 4NGNA 1HEEA 4PQAA 3IIBA 1LAMA 4NJRA 4R7MA 4G1PA 1HDQA 4DJLA 4F8ZA 1PYTB 5LRGA 3CDXA 3FEDA 5HVFA 2G9DA 4YWYA 5LYDA 3PB7X 2BCOA 4B6ZA 7CPAA 2DEAA 3D66A 5JM6A 1ZLIA 2PE3A 4OKOA 5JH9A 3PB4X 2Q43A 4ZY2A 2AFSA 5D29A 3S9LA 2BOAA 2ABZA 3H8FA 2Q4ZA 2ZOFA 3NA6A 4ZY0A 3KGQA 3D7HA 4OC2A 1Z2LA 1TF8A 4UIAA 4MHPA 3GB0A 4A94A 4Z65A 4X2TA 4UEEA 3V7ZA 3NFZA 4OC5A 4EFDA 3KR5A 3KZWA 3B3TA 4NFRA 4A39A 4IAVA 2PJ4A 3BI1A 3BXMA 4NGSA 4WJBA 1XRYA 2PJ6A 3MN8A 3IFEA 3D4UA 1TKHA 2ZELA 4R8FA 2AFUA 2PJ5A 1ELMP 8CPAA 1DTDA 4DYOA 4KSIA 2JBKA 1YW4A 3NH8A 3ISXA 2HC9A 2RB7A 2XEJA 2ZEFA 2V8HA 3IEHA 4AXVA 4ONWA 3BHXA 2PJ9A 4WWVA 2PVWA 3D67A
chains in the Genus database with same CATH superfamily
5K8PA 2OH1A 3FRMA 4Q36A 3SI1A 2DPSA 2C6GA 4UBRA 1F2PA 5DWNA 2PJ3A 3B35A 1IGBA 1Y0RA 1YLOA 2VL1A 1CM0A 4LX9A 2OZGA 3IWEA 4CYPA 2HV2A 2BL1A 2DPTA 5DWMA 1VHSA 2XEIA 4OP4A 2IL4A 5EBVA 3RYOA 4YU9A 2Q44A 4OC1A 4P6YA 4F0YA 3G3SA 3T9YA 4B12A 2FIWA 4R76A 2Q51A 2ZW4A 3SI0A 4B11A 2F8HA 1RO5A 1LOKA 3WC7A 1QSNA 5A27A 2CIJA 4C7HA 4NGRA 3CZXA 4U9ZA 4W9YA 4MHZA 3IC1A 3B7IA 4M6IA 4R6TA 1LAPA 1H8LA 3T8WA 4B5OA 1L0CA 4M6HA 5G21A 1RTQA 2B4DB 3GYAA 1ON0A 3FBUA 3F5BA 4MCPA 1Q2DA 1VIXA 4BMHA 2PSWA 2AJ6A 4QVTA 4MXUA 1NSAA 1S7KA 3DNSA 4MFPA 1Z8LA 1CPXA 1M4IA 2J9AA 4P4BA 4HKFA 1Z8XA 2B3UA 2V8GA 4MCRA 2AFZA 3NE8A 5F48A 3R9GA 4YRHA 4CPAA 2R7HA 2PJ2A 2WUUA 3FH4A 4MCQA 4QC6A 4PXBA 1NSLA 3SJXA 4AVBA 2B5GB 4BINA 1LCPA 3B3SA 4UWJA 1F57A 4B10A 5K8NA 3QAYA 2PJBA 1IY7A 2AFXA 2WSAA 1Z5RA 3QAHA 4IUSA 1ELLP 3E0KA 3D2PA 2C6PA 4UEFA 2O53A 2Q0YA 4H6UA 5LRJA 2GE3A 4X8IA 4JZ0A 1SQHA 3BJ7A 4HNWB 3K9UA 4CAXA 1ARLA 4OMEA 5HVHA 4MFZA 2QYVA 2ZENA 4JLYA 3R9EA 4TWEA 3KR4A 2VZZA 4P4IA 4MMOA 1Y0YA 1QMUA 1XMBA 2GLJA 3RNZA 5JGFA 4K3NA 4X3RA 1VKCA 2Q4VA 4MHNA 5F47A 1MJ9A 3A9LA 3TOBA 4ONUA 2NSMA 3JVNA 3DLJA 3PZJA 4UCMA 4XNHB 3V8IA 1N71A 1V0CA 1BAVA 1BOBA 4EMEA 2VXKA 3I9SA 4JD6A 4KOXA 1QSRA 4R3KA 1AYEA 3RZAA 2CTCA 4H6ZA 1CP7A 2RC4A 4PSWA 4XPDC 2PR1A 2PJ8A 3CXPA 4M85A 4OC3A 2D4OA 2BUEA 4MRIA 4MY3A 2IMOA 1Z8TA 1UFHA 1YREA 3FJUA 2OU2A 1Y9WA 2Y0MA 3QB8A 3QNVA 2ANPA 2PIYA 3D2MA 4JXRA 3TO6A 4FBEA 2YNEA 5LYFA 2GLFA 1Z8WA 3PEIA 4CGLA 4ZI6A 4FAIA 1TF9A 3DDDA 3SJFA 2B4BA 1FNOA 1B87A 5I0CA 4NXYA 2O4HA 4LUAA 2IQ6A 3VH9A 5DS0A 3FVLA 3RBUA 3HLPA 5HMNA 2ZOGA 2PQ8A 5I4MA 2CXAA 4DNCA 4XPLA 5ELYA 1MK4A 4KVME 2XEGA 1ZO0A 3TOAA 4B13A 2YNDA 4Q7AA 4P4FA 2POKA 1IIDA 2B58A 4P10A 2WYRA 2C6CA 3IU2A 3TT2A 4P45A 2ZEHA 5KTCA 3H8EA 3SHPA 4CAEA 5LRKA 1IYKA 1IICA 1XBUA 2PVVA 1CBXA 5H86A 5IB9A 3D68A 5AG7A 1VHEA 1WK4A 3VATA 3D3SA 2ZEOA 3SJGA 1IB1E 1P4NA 2CNMA 3FMCA 3I1UA 1I21A 2EK9A 4HNYB 2ZW7A 4F0XA 3P2FA 1TIQA 1DE4C 1HDUA 1QSTA 5E96A 3NE7A 3CXSA 1I12A 2Z3NA 4JXQA 1X12A 1EE3P 3S6KA 1YR0A 3R9FA 2JBJA 2Z3LA 3GY9A 1JQGA 3KKWA 3NH4A 3PRTA 1Y7EA 4PV6A 3TC8A 3CXQA 3TFYA 5AG6A 4F9VA 4OC0A 2GIVA 3H5ZA 2EUIA 4UFVA 4RN7A 3ZJ0A 3EC4A 4LQGA 4JYWA 2JLMA 1XEBA 4UCPA 4MFLA 5LYLA 2J8MA 1M4LA 2PCUA 2HB6A 2CNTA 5G22A 5IX3A 2NYQA 2FS5A 3FYNA 3LACA 1TKFA 2CNSA 4HPSA 4NF1A 1M1DA 5HH1A 3KQZA 2XEFA 1FY7A 3TTHA 4ZBGA 4KOUA 3S6FA 3PBEA 3VARA 3WR7A 4A37A 3SJEA 4MFJA 3GUXA 4MJ8A 4P4EA 1XJOA 2REEA 4ORFA 2I00A 1CX8A 2O28A 1K4JA 2PC1A 3B3WA 2ZEDA 3PBBA 2PJ1A 4CGPA 1YW6A 2AE6A 2D4PA 2EWBA 3K9TA 1IOFA 1YVOA 2AFOA 3CT9A 5JPHA 2P6FA 5J8FA 4A38A 4AG7A 2YNCC 2ZXVA 4UA3A 4Q38A 1VHOA 4QBJA 1KUXA 3D7DA 2X7BA 2Q04A 3EFAA 3KASA 4NGPA 4MHYA 4FD7A 3B3VA 1BO4A 3W91A 1Q7LA 4M6GA 2Z3PA 3GLJA 4FUUA 4QB9A 2Z11A 1S7FA 4MBUA 3WC5A 3KQXA 4OADA 3VWEA 2VQYA 4CAVA 4MI4A 4FD6A 4PXCA 5EC4A 4C68A 1M4DA 1ZLHA 2CTBA 2V77A 1XFOA 3JRUA 4AG9A 4C2ZA 3W6SA 2PIZA 4XPDB 1YQEA 1QQ9A 2EVNA 2OB0A 4O23A 1P0HA 5K8OA 1R3NA 3FB3A 4GM5A 1IOIA 4NGQA 4R57A 2AFMA 1BPMA 1LFWA 5HVGA 3H8GA 2ZPAA 2FVGA 1CP6A 4PK3A 5CBMA 3NH5A 4P44A 2VZYA 2H5MA 2QJ8A 3PFOA 2RFHA 3CPAA 4KSAA 2YNCA 1R43A 1BLLE 4ZYQA 1OBRA 2BEIA 3T90A 1R57A 2QVPA 4YFJA 3EXNA 3I3GA 1ZG8A 4KOVA 5K8MA 2Q4YA 4CYOA 4EWTA 3DSBA 4FWUA 4UCNA 3WT4A 2PRBA 4NGMA 1YSJA 1Z4EA 3S9MA 3B3CA 4CGNA 4KS9A 3S9NA 2V8VA 3ISZA 4AB7A 3LODA 3R1KA 2R1IA 2WZNA 1YMEA 2B3VA 5IV0A 4P4DA 2GANA 4R3LA 2REFA 2EK8A 3PFEA 3EY5A 1CG2A 4C2XA 4PXDA 4MFQA 2P6EA 3F8KA 1ZG9A 4K30A 2G3AA 4KLVA 2FE7A 2CF4A 3DGVA 1AUGA 2GU2A 3HUVA 1M44A 4F6AA 5J8CA 4KOYA 3KHZA 4CAWA 2PJ7A 4H89A 2OOTA 4A95A 3FX6A 5IB0A 1JWQA 2PDOA 3CPXA 2WPWA 4KUBA 2R8VA 3MGDA 4MCSA 4TNUA 4JWPA 1YGHA 2VI7A 2K5TA 1GHEA 3KL9A 3RO0A 1GYTA 1KUVA 4UFXA 2DXQA 2JEVA 1ARMA 1LANA 4OIWA 4P4JA 3TX8A 4A31A 1I1DA 3C26A 2C1CA 2PJAA 4IF5A 1IU8A 4UEZA 1YLEA 4UWIA 4Y49C 3RAMA 3B2YA 3N5FA 4U5YA 3L2NA 2VEZA 3FECA 4NSQA 2F7VA 2GFQA 5C82A 4UF4A 2CY2A 3PB9X 3VWDA 1QSMA 2EO8A 3D7FA 3WC6A 2PJCA 4B14A 4DUKA 2ODFA 4NEXA 1TKJA 3IWWA 5FVJA 4E2AA 1ZG7A 1PCAA 4PPZA 1UWYA 1OZPA 4A2ZA 1NMTA 4PK2A 5HXDA 5KTDA 2F5IA 4CAFA 1FT7A 3FF3A 3W6XA 4KZTA 1KWMA 3FNCA 2AFWA 1VGYA 3DR6A 1XF8A 3FEEA 3GIUA 4L8AA 5LYIA 4PSXA 3D7GA 5J1QA 4EVYA 1BPNA 2ZW5A 3LD2A 1AMPA 2ZEMA 2NMTA 3PB6X 4E0AA 1M4GA 1RXTA 4OLLA 4X5KA 5BWAB 2V8DA 4NJQA 3LWUA 4KORA 1XE4A 4UIBA 3TO7A 3BI0A 2BSWA 1S5KA 4YGOA 2PJ0A 1CPSA 2ZW6A 3K2KA 4GXHA 1X10A 3PP9A 2Z3OA 5AG5A 5CNPA 3SI2A 2ZEPA 2G3TA 3WABA 3R95A 2QIRA 4H2KA 4NGTA 5GCNA 4OC4A 3G8WA 4C2YA 2ZEEA 3IJ3A 4JJXA 5D8NA 2A4NA 2P0WA 4IK2A 4II9A 4A33A 3BLNA 5CPAA 4J3GA 4PXEA 3R96A 2IJZA 4ZX9A 5AG4A 3UY5A 1QSOA 3KHXA 3BJ8A 3DR8A 4OIDA 4ZX8A 2J8NA 4F9UA 1XIXA 3TCVA 4IHMA 3IO1A 2ATRA 3MRUA 4GS4A 2GREA 1Q2YA 2JEWA 2OR4A 4ZY1A 2PR8A 4E8OA 1S7NA 1WWZA 4L89A 1TXRA 3PB8X 6CPAA 5AGEA 1Z4RA 3LMSA 4BD9A 4RUHA 2PRQA 3JTKA 4CGMA 4CYQA 4HNXB 5G1ZA 5JQ4A 3EO4A 5F09A 5G20A 5KTAA 2I3CA 3KI9A 4KOSA 2BO9A 2FL4A 5THWA 5F49A 1F2OA 2ZEGA 3V38A 1U6MA 4NGNA 4C7IA 2VBQA 4CRZB 1HEEA 4PQAA 3IIBA 1LAMA 1J4JA 1Y9KA 4NJRA 4R7MA 1KUYA 1MJBA 1YX0A 3PGPA 2HQYA 2FXFA 3S6HA 3SXNA 3OWCA 1HDQA 4G1PA 4DJLA 4F8ZA 4AVCA 1CJWA 1PYTB 5A28A 5LRGA 2FIAA 1PUAA 1S7LA 3CDXA 2R98A 3FEDA 3FXTA 5HVFA 2G9DA 4YWYA 5LYDA 4ZGYB 3PB7X 2BCOA 4B6ZA 1Y7RA 7CPAA 2DEAA 3D66A 4CRYB 5JM6A 1ZLIA 2PE3A 4OKOA 5JH9A 3PB4X 2Q43A 4ZY2A 2AFSA 5D29A 3ZZIA 3S9LA 4CS0B 5F46A 4KLWA 3JUWA 3TO9A 2BOAA 4B5PA 3IGRA 2DF5A 2ABZA 1XOVA 2Q7SA 3H8FA 4Y49B 2Q4ZA 2ZOFA 4RI1A 5H84A 1S3ZA 3NA6A 4ZY0A 3TE4A 4U9YA 2P6GA 1Z9UA 3KGQA 1NE9A 3D7HA 3F0AA 4XPKA 5EMIA 2Q7BA 2WPXA 4OC2A 1Z2LA 1XMTA 1TF8A 2FCKA 4UIAA 3N7ZA 4MHPA 5ISVA 1MJAA 3GB0A 1YK3A 4A94A 4Z65A 2HUZA 3B8GA 4OAEA 2KCWA 4X2TA 4UEEA 3V7ZA 4QUSA 3NFZA 1IYLA 4KUAA 4OC5A 2Z3KA 2Z0ZA 4EFDA 2Z3MA 3KR5A 4NCZA 3SXOA 3S6GA 3KZWA 2C27A 3B3TA 4NFRA 1PU9A 2OZUA 4A39A 4MHDA 1B6BA 4KSFA 4AVAA 2OZHA 4BBHA 1Q2CA 4M3SA 4I49A 4KOTA 4RS2A 4IAVA 2G0BA 2PJ4A 2B4DA 3BI1A 4FD5A 4CGOA 4R9MA 3BXMA 3IU1A 4NGSA 3FIXA 4WJBA 1XRYA 2PJ6A 3MN8A 3IFEA 3D4UA 4FD4A 1TKHA 2ZELA 1YVKA 4R8FA 2FT0A 2JDCA 4KVOE 2AFUA 1LRZA 1ELMP 2PJ5A 4KOWA 4XNHC 1S60A 2B5GA 8CPAA 4UFWA 1DTDA 4A32A 4KVXA 4DYOA 2Z10A 4KSIA 4CYNA 2JBKA 3H4QA 2EBJA 1YW4A 3NH8A 3ISXA 4MY0A 2HC9A 3GKRA 4LQ6A 2RB7A 2FSRA 2XEJA 2ZEFA 2QMLA 3P2HA 2V8HA 3IEHA 4AXVA 2JDDA 2J8RA 4R87A 5C88A 2I79A 4MFKA 4ONWA 3BHXA 1KZFA 2PJ9A 3D8PA 2ARHA 3IWGA 4WWVA 2PVWA 2YGWA 3D67A 4B5PB 4A30A 1A2ZA 2QECA
chains in the Genus database with same CATH topology
5K8PA 3SI1A 2C6GA 1F2PA 2PJ3A 3B35A 1IGBA 1Y0RA 1YLOA 2VL1A 2XEIA 4OP4A 4YU9A 4OC1A 4P6YA 4R76A 2Q51A 3SI0A 2F8HA 1LOKA 3WC7A 2CIJA 4NGRA 4W9YA 4MHZA 3IC1A 3B7IA 4R6TA 1LAPA 1H8LA 3T8WA 1RTQA 4MCPA 1VIXA 4MXUA 1NSAA 1Z8LA 1CPXA 2J9AA 4P4BA 2V8GA 4MCRA 2AFZA 4CPAA 3FH4A 2PJ2A 4MCQA 4PXBA 3SJXA 1LCPA 3B3SA 1F57A 5K8NA 2PJBA 1IY7A 2AFXA 1Z5RA 1ELLP 2C6PA 4UEFA 2O53A 5LRJA 4X8IA 4JZ0A 1ARLA 4OMEA 5HVHA 2QYVA 2ZENA 4TWEA 3KR4A 4P4IA 4MMOA 1Y0YA 1QMUA 1XMBA 2GLJA 5JGFA 4K3NA 4X3RA 4MHNA 2NSMA 3DLJA 1BAVA 4EMEA 1AYEA 3RZAA 2CTCA 1CP7A 4OC3A 2PJ8A 4MRIA 2IMOA 3FJUA 3QNVA 2ANPA 2PIYA 4FBEA 5LYFA 2GLFA 4ZI6A 3PEIA 4FAIA 1TF9A 3SJFA 1FNOA 2O4HA 2IQ6A 3VH9A 5DS0A 3FVLA 3RBUA 3HLPA 2ZOGA 5I4MA 5ELYA 2XEGA 4Q7AA 4P4FA 2POKA 4P10A 2WYRA 2C6CA 4P45A 2ZEHA 3H8EA 5LRKA 1XBUA 5IB9A 2PVVA 1CBXA 3D68A 1VHEA 3VATA 2ZEOA 3SJGA 3FMCA 3I1UA 2EK9A 1DE4C 1HDUA 1EE3P 2JBJA 3NH4A 1JQGA 3PRTA 1Y7EA 3TC8A 4F9VA 4OC0A 4LQGA 4JYWA 5LYLA 1M4LA 2PCUA 2HB6A 2NYQA 1TKFA 3KQZA 2XEFA 3PBEA 3VARA 4A37A 3SJEA 3GUXA 4P4EA 1XJOA 1CX8A 3B3WA 2ZEDA 3PBBA 2PJ1A 1YW6A 2EWBA 3K9TA 2AFOA 3CT9A 4A38A 1VHOA 3D7DA 3KASA 4NGPA 4MHYA 3B3VA 1Q7LA 3GLJA 4FUUA 3WC5A 3KQXA 4PXCA 1ZLHA 2CTBA 2V77A 1XFOA 3JRUA 2PIZA 5K8OA 1QQ9A 4O23A 1R3NA 4GM5A 4NGQA 2AFMA 1BPMA 1LFWA 5HVGA 3H8GA 2FVGA 1CP6A 5CBMA 3NH5A 4P44A 2QJ8A 3PFOA 2RFHA 3CPAA 1R43A 1BLLE 4ZYQA 1OBRA 2QVPA 1ZG8A 5K8MA 4EWTA 4FWUA 3WT4A 3S9MA 4NGMA 1YSJA 3B3CA 3S9NA 2V8VA 3ISZA 2WZNA 1YMEA 4P4DA 2EK8A 3PFEA 1CG2A 4PXDA 1ZG9A 2CF4A 3DGVA 2GU2A 3HUVA 3KHZA 2PJ7A 2OOTA 3FX6A 3CPXA 4MCSA 4TNUA 3KL9A 1GYTA 1ARMA 1LANA 4OIWA 4P4JA 3TX8A 4UEZA 2C1CA 2PJAA 3RAMA 3B2YA 3N5FA 3L2NA 3FECA 2F7VA 4UF4A 3PB9X 3D7FA 3WC6A 2PJCA 4DUKA 1TKJA 3IWWA 1ZG7A 1PCAA 4PPZA 1UWYA 5HXDA 1FT7A 3FF3A 1KWMA 2AFWA 1VGYA 3FEEA 5J1QA 5LYIA 3D7GA 1BPNA 1AMPA 2ZEMA 3PB6X 2V8DA 4NJQA 3LWUA 4UIBA 3BI0A 2PJ0A 1CPSA 3K2KA 3SI2A 3WABA 2ZEPA 4H2KA 4NGTA 4OC4A 2ZEEA 3IJ3A 5D8NA 4IK2A 5CPAA 4PXEA 2IJZA 4ZX9A 3KHXA 4OIDA 4ZX8A 4F9UA 4IHMA 3IO1A 3MRUA 2GREA 2JEWA 4ZY1A 2OR4A 1TXRA 3PB8X 6CPAA 3LMSA 4BD9A 4RUHA 2PRQA 5F09A 2I3CA 3KI9A 2BO9A 5THWA 1F2OA 2ZEGA 3V38A 4NGNA 1HEEA 4PQAA 3IIBA 1LAMA 4NJRA 4R7MA 4G1PA 1HDQA 4DJLA 4F8ZA 1PYTB 5LRGA 3CDXA 3FEDA 5HVFA 2G9DA 4YWYA 5LYDA 3PB7X 2BCOA 4B6ZA 7CPAA 2DEAA 3D66A 5JM6A 1ZLIA 2PE3A 4OKOA 5JH9A 3PB4X 2Q43A 4ZY2A 2AFSA 5D29A 3S9LA 2BOAA 2ABZA 3H8FA 2Q4ZA 2ZOFA 3NA6A 4ZY0A 3KGQA 3D7HA 4OC2A 1Z2LA 1TF8A 4UIAA 4MHPA 3GB0A 4A94A 4Z65A 4X2TA 4UEEA 3V7ZA 3NFZA 4OC5A 4EFDA 3KR5A 3KZWA 3B3TA 4NFRA 4A39A 4IAVA 2PJ4A 3BI1A 3BXMA 4NGSA 4WJBA 1XRYA 2PJ6A 3MN8A 3IFEA 3D4UA 1TKHA 2ZELA 4R8FA 2AFUA 2PJ5A 1ELMP 8CPAA 1DTDA 4DYOA 4KSIA 2JBKA 1YW4A 3NH8A 3ISXA 2HC9A 2RB7A 2XEJA 2ZEFA 2V8HA 3IEHA 4AXVA 4ONWA 3BHXA 2PJ9A 4WWVA 2PVWA 3D67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K8P A;  3SI1 A;  2C6G A;  1F2P A;  2PJ3 A;  3B35 A;  1IGB A;  1Y0R A;  1YLO A;  2VL1 A;  2XEI A;  4OP4 A;  4YU9 A;  4OC1 A;  4P6Y A;  4R76 A;  2Q51 A;  3SI0 A;  2F8H A;  1LOK A;  3WC7 A;  2CIJ A;  4NGR A;  4W9Y A;  4MHZ A;  3IC1 A;  3B7I A;  4R6T A;  1LAP A;  1H8L A;  3T8W A;  1RTQ A;  4MCP A;  1VIX A;  4MXU A;  1NSA A;  1Z8L A;  1CPX A;  2J9A A;  4P4B A;  2V8G A;  4MCR A;  2AFZ A;  4CPA A;  3FH4 A;  2PJ2 A;  4MCQ A;  4PXB A;  3SJX A;  1LCP A;  3B3S A;  1F57 A;  5K8N A;  2PJB A;  1IY7 A;  2AFX A;  1Z5R A;  1ELL P;  2C6P A;  4UEF A;  2O53 A;  5LRJ A;  4X8I A;  4JZ0 A;  1ARL A;  4OME A;  5HVH A;  2QYV A;  2ZEN A;  4TWE A;  3KR4 A;  4P4I A;  4MMO A;  1Y0Y A;  1QMU A;  1XMB A;  2GLJ A;  5JGF A;  4K3N A;  4X3R A;  4MHN A;  2NSM A;  3DLJ A;  1BAV A;  4EME A;  1AYE A;  3RZA A;  2CTC A;  1CP7 A;  4OC3 A;  2PJ8 A;  4MRI A;  2IMO A;  3FJU A;  3QNV A;  2ANP A;  2PIY A;  4FBE A;  5LYF A;  2GLF A;  4ZI6 A;  3PEI A;  4FAI A;  1TF9 A;  3SJF A;  1FNO A;  2O4H A;  2IQ6 A;  3VH9 A;  5DS0 A;  3FVL A;  3RBU A;  3HLP A;  2ZOG A;  5I4M A;  5ELY A;  2XEG A;  4Q7A A;  4P4F A;  2POK A;  4P10 A;  2WYR A;  2C6C A;  4P45 A;  2ZEH A;  3H8E A;  5LRK A;  1XBU A;  5IB9 A;  2PVV A;  1CBX A;  3D68 A;  1VHE A;  3VAT A;  2ZEO A;  3SJG A;  3FMC A;  3I1U A;  2EK9 A;  1DE4 C;  1HDU A;  1EE3 P;  2JBJ A;  3NH4 A;  1JQG A;  3PRT A;  1Y7E A;  3TC8 A;  4F9V A;  4OC0 A;  4LQG A;  4JYW A;  5LYL A;  1M4L A;  2PCU A;  2HB6 A;  2NYQ A;  1TKF A;  3KQZ A;  2XEF A;  3PBE A;  3VAR A;  4A37 A;  3SJE A;  3GUX A;  4P4E A;  1XJO A;  1CX8 A;  3B3W A;  2ZED A;  3PBB A;  2PJ1 A;  1YW6 A;  2EWB A;  3K9T A;  2AFO A;  3CT9 A;  4A38 A;  1VHO A;  3D7D A;  3KAS A;  4NGP A;  4MHY A;  3B3V A;  1Q7L A;  3GLJ A;  4FUU A;  3WC5 A;  3KQX A;  4PXC A;  1ZLH A;  2CTB A;  2V77 A;  1XFO A;  3JRU A;  2PIZ A;  5K8O A;  1QQ9 A;  4O23 A;  1R3N A;  4GM5 A;  4NGQ A;  2AFM A;  1BPM A;  1LFW A;  5HVG A;  3H8G A;  2FVG A;  1CP6 A;  5CBM A;  3NH5 A;  4P44 A;  2QJ8 A;  3PFO A;  2RFH A;  3CPA A;  1R43 A;  1BLL E;  4ZYQ A;  1OBR A;  2QVP A;  1ZG8 A;  5K8M A;  4EWT A;  4FWU A;  3WT4 A;  3S9M A;  4NGM A;  1YSJ A;  3B3C A;  3S9N A;  2V8V A;  3ISZ A;  2WZN A;  1YME A;  4P4D A;  2EK8 A;  3PFE A;  1CG2 A;  4PXD A;  1ZG9 A;  2CF4 A;  3DGV A;  2GU2 A;  3HUV A;  3KHZ A;  2PJ7 A;  2OOT A;  3FX6 A;  3CPX A;  4MCS A;  4TNU A;  3KL9 A;  1GYT A;  1ARM A;  1LAN A;  4OIW A;  4P4J A;  3TX8 A;  4UEZ A;  2C1C A;  2PJA A;  3RAM A;  3B2Y A;  3N5F A;  3L2N A;  3FEC A;  2F7V A;  4UF4 A;  3PB9 X;  3D7F A;  3WC6 A;  2PJC A;  4DUK A;  1TKJ A;  3IWW A;  1ZG7 A;  1PCA A;  4PPZ A;  1UWY A;  5HXD A;  1FT7 A;  3FF3 A;  1KWM A;  2AFW A;  1VGY A;  3FEE A;  5J1Q A;  5LYI A;  3D7G A;  1BPN A;  1AMP A;  2ZEM A;  3PB6 X;  2V8D A;  4NJQ A;  3LWU A;  4UIB A;  3BI0 A;  2PJ0 A;  1CPS A;  3K2K A;  3SI2 A;  3WAB A;  2ZEP A;  4H2K A;  4NGT A;  4OC4 A;  2ZEE A;  3IJ3 A;  5D8N A;  4IK2 A;  5CPA A;  4PXE A;  2IJZ A;  4ZX9 A;  3KHX A;  4OID A;  4ZX8 A;  4F9U A;  4IHM A;  3IO1 A;  3MRU A;  2GRE A;  2JEW A;  4ZY1 A;  2OR4 A;  1TXR A;  3PB8 X;  6CPA A;  3LMS A;  4BD9 A;  4RUH A;  2PRQ A;  5F09 A;  2I3C A;  3KI9 A;  2BO9 A;  5THW A;  1F2O A;  2ZEG A;  3V38 A;  4NGN A;  1HEE A;  4PQA A;  3IIB A;  1LAM A;  4NJR A;  4R7M A;  4G1P A;  1HDQ A;  4DJL A;  4F8Z A;  1PYT B;  5LRG A;  3CDX A;  3FED A;  5HVF A;  2G9D A;  4YWY A;  5LYD A;  3PB7 X;  2BCO A;  4B6Z A;  7CPA A;  2DEA A;  3D66 A;  5JM6 A;  1ZLI A;  2PE3 A;  4OKO A;  5JH9 A;  3PB4 X;  2Q43 A;  4ZY2 A;  2AFS A;  5D29 A;  3S9L A;  2BOA A;  2ABZ A;  3H8F A;  2Q4Z A;  2ZOF A;  3NA6 A;  4ZY0 A;  3KGQ A;  3D7H A;  4OC2 A;  1Z2L A;  1TF8 A;  4UIA A;  4MHP A;  3GB0 A;  4A94 A;  4Z65 A;  4X2T A;  4UEE A;  3V7Z A;  3NFZ A;  4OC5 A;  4EFD A;  3KR5 A;  3KZW A;  3B3T A;  4NFR A;  4A39 A;  4IAV A;  2PJ4 A;  3BI1 A;  3BXM A;  4NGS A;  4WJB A;  1XRY A;  2PJ6 A;  3MN8 A;  3IFE A;  3D4U A;  1TKH A;  2ZEL A;  4R8F A;  2AFU A;  2PJ5 A;  1ELM P;  8CPA A;  1DTD A;  4DYO A;  4KSI A;  2JBK A;  1YW4 A;  3NH8 A;  3ISX A;  2HC9 A;  2RB7 A;  2XEJ A;  2ZEF A;  2V8H A;  3IEH A;  4AXV A;  4ONW A;  3BHX A;  2PJ9 A;  4WWV A;  2PVW A;  3D67 A; 
#chains in the Genus database with same CATH topology
 5K8P A;  2OH1 A;  3FRM A;  4Q36 A;  3SI1 A;  2DPS A;  2C6G A;  4UBR A;  1F2P A;  5DWN A;  2PJ3 A;  3B35 A;  1IGB A;  1Y0R A;  1YLO A;  2VL1 A;  1CM0 A;  4LX9 A;  2OZG A;  3IWE A;  4CYP A;  2HV2 A;  2BL1 A;  2DPT A;  5DWM A;  1VHS A;  2XEI A;  4OP4 A;  2IL4 A;  5EBV A;  3RYO A;  4YU9 A;  2Q44 A;  4OC1 A;  4P6Y A;  4F0Y A;  3G3S A;  3T9Y A;  4B12 A;  2FIW A;  4R76 A;  2Q51 A;  2ZW4 A;  3SI0 A;  4B11 A;  2F8H A;  1RO5 A;  1LOK A;  3WC7 A;  1QSN A;  5A27 A;  2CIJ A;  4C7H A;  4NGR A;  3CZX A;  4U9Z A;  4W9Y A;  4MHZ A;  3IC1 A;  3B7I A;  4M6I A;  4R6T A;  1LAP A;  1H8L A;  3T8W A;  4B5O A;  1L0C A;  4M6H A;  5G21 A;  1RTQ A;  2B4D B;  3GYA A;  1ON0 A;  3FBU A;  3F5B A;  4MCP A;  1Q2D A;  1VIX A;  4BMH A;  2PSW A;  2AJ6 A;  4QVT A;  4MXU A;  1NSA A;  1S7K A;  3DNS A;  4MFP A;  1Z8L A;  1CPX A;  1M4I A;  2J9A A;  4P4B A;  4HKF A;  1Z8X A;  2B3U A;  2V8G A;  4MCR A;  2AFZ A;  3NE8 A;  5F48 A;  3R9G A;  4YRH A;  4CPA A;  2R7H A;  2PJ2 A;  2WUU A;  3FH4 A;  4MCQ A;  4QC6 A;  4PXB A;  1NSL A;  3SJX A;  4AVB A;  2B5G B;  4BIN A;  1LCP A;  3B3S A;  4UWJ A;  1F57 A;  4B10 A;  5K8N A;  3QAY A;  2PJB A;  1IY7 A;  2AFX A;  2WSA A;  1Z5R A;  3QAH A;  4IUS A;  1ELL P;  3E0K A;  3D2P A;  2C6P A;  4UEF A;  2O53 A;  2Q0Y A;  4H6U A;  5LRJ A;  2GE3 A;  4X8I A;  4JZ0 A;  1SQH A;  3BJ7 A;  4HNW B;  3K9U A;  4CAX A;  1ARL A;  4OME A;  5HVH A;  4MFZ A;  2QYV A;  2ZEN A;  4JLY A;  3R9E A;  4TWE A;  3KR4 A;  2VZZ A;  4P4I A;  4MMO A;  1Y0Y A;  1QMU A;  1XMB A;  2GLJ A;  3RNZ A;  5JGF A;  4K3N A;  4X3R A;  1VKC A;  2Q4V A;  4MHN A;  5F47 A;  1MJ9 A;  3A9L A;  3TOB A;  4ONU A;  2NSM A;  3JVN A;  3DLJ A;  3PZJ A;  4UCM A;  4XNH B;  3V8I A;  1N71 A;  1V0C A;  1BAV A;  1BOB A;  4EME A;  2VXK A;  3I9S A;  4JD6 A;  4KOX A;  1QSR A;  4R3K A;  1AYE A;  3RZA A;  2CTC A;  4H6Z A;  1CP7 A;  2RC4 A;  4PSW A;  4XPD C;  2PR1 A;  2PJ8 A;  3CXP A;  4M85 A;  4OC3 A;  2D4O A;  2BUE A;  4MRI A;  4MY3 A;  2IMO A;  1Z8T A;  1UFH A;  1YRE A;  3FJU A;  2OU2 A;  1Y9W A;  2Y0M A;  3QB8 A;  3QNV A;  2ANP A;  2PIY A;  3D2M A;  4JXR A;  3TO6 A;  4FBE A;  2YNE A;  5LYF A;  2GLF A;  1Z8W A;  3PEI A;  4CGL A;  4ZI6 A;  4FAI A;  1TF9 A;  3DDD A;  3SJF A;  2B4B A;  1FNO A;  1B87 A;  5I0C A;  4NXY A;  2O4H A;  4LUA A;  2IQ6 A;  3VH9 A;  5DS0 A;  3FVL A;  3RBU A;  3HLP A;  5HMN A;  2ZOG A;  2PQ8 A;  5I4M A;  2CXA A;  4DNC A;  4XPL A;  5ELY A;  1MK4 A;  4KVM E;  2XEG A;  1ZO0 A;  3TOA A;  4B13 A;  2YND A;  4Q7A A;  4P4F A;  2POK A;  1IID A;  2B58 A;  4P10 A;  2WYR A;  2C6C A;  3IU2 A;  3TT2 A;  4P45 A;  2ZEH A;  5KTC A;  3H8E A;  3SHP A;  4CAE A;  5LRK A;  1IYK A;  1IIC A;  1XBU A;  2PVV A;  1CBX A;  5H86 A;  5IB9 A;  3D68 A;  5AG7 A;  1VHE A;  1WK4 A;  3VAT A;  3D3S A;  2ZEO A;  3SJG A;  1IB1 E;  1P4N A;  2CNM A;  3FMC A;  3I1U A;  1I21 A;  2EK9 A;  4HNY B;  2ZW7 A;  4F0X A;  3P2F A;  1TIQ A;  1DE4 C;  1HDU A;  1QST A;  5E96 A;  3NE7 A;  3CXS A;  1I12 A;  2Z3N A;  4JXQ A;  1X12 A;  1EE3 P;  3S6K A;  1YR0 A;  3R9F A;  2JBJ A;  2Z3L A;  3GY9 A;  1JQG A;  3KKW A;  3NH4 A;  3PRT A;  1Y7E A;  4PV6 A;  3TC8 A;  3CXQ A;  3TFY A;  5AG6 A;  4F9V A;  4OC0 A;  2GIV A;  3H5Z A;  2EUI A;  4UFV A;  4RN7 A;  3ZJ0 A;  3EC4 A;  4LQG A;  4JYW A;  2JLM A;  1XEB A;  4UCP A;  4MFL A;  5LYL A;  2J8M A;  1M4L A;  2PCU A;  2HB6 A;  2CNT A;  5G22 A;  5IX3 A;  2NYQ A;  2FS5 A;  3FYN A;  3LAC A;  1TKF A;  2CNS A;  4HPS A;  4NF1 A;  1M1D A;  5HH1 A;  3KQZ A;  2XEF A;  1FY7 A;  3TTH A;  4ZBG A;  4KOU A;  3S6F A;  3PBE A;  3VAR A;  3WR7 A;  4A37 A;  3SJE A;  4MFJ A;  3GUX A;  4MJ8 A;  4P4E A;  1XJO A;  2REE A;  4ORF A;  2I00 A;  1CX8 A;  2O28 A;  1K4J A;  2PC1 A;  3B3W A;  2ZED A;  3PBB A;  2PJ1 A;  4CGP A;  1YW6 A;  2AE6 A;  2D4P A;  2EWB A;  3K9T A;  1IOF A;  1YVO A;  2AFO A;  3CT9 A;  5JPH A;  2P6F A;  5J8F A;  4A38 A;  4AG7 A;  2YNC C;  2ZXV A;  4UA3 A;  4Q38 A;  1VHO A;  4QBJ A;  1KUX A;  3D7D A;  2X7B A;  2Q04 A;  3EFA A;  3KAS A;  4NGP A;  4MHY A;  4FD7 A;  3B3V A;  1BO4 A;  3W91 A;  1Q7L A;  4M6G A;  2Z3P A;  3GLJ A;  4FUU A;  4QB9 A;  2Z11 A;  1S7F A;  4MBU A;  3WC5 A;  3KQX A;  4OAD A;  3VWE A;  2VQY A;  4CAV A;  4MI4 A;  4FD6 A;  4PXC A;  5EC4 A;  4C68 A;  1M4D A;  1ZLH A;  2CTB A;  2V77 A;  1XFO A;  3JRU A;  4AG9 A;  4C2Z A;  3W6S A;  2PIZ A;  4XPD B;  1YQE A;  1QQ9 A;  2EVN A;  2OB0 A;  4O23 A;  1P0H A;  5K8O A;  1R3N A;  3FB3 A;  4GM5 A;  1IOI A;  4NGQ A;  4R57 A;  2AFM A;  1BPM A;  1LFW A;  5HVG A;  3H8G A;  2ZPA A;  2FVG A;  1CP6 A;  4PK3 A;  5CBM A;  3NH5 A;  4P44 A;  2VZY A;  2H5M A;  2QJ8 A;  3PFO A;  2RFH A;  3CPA A;  4KSA A;  2YNC A;  1R43 A;  1BLL E;  4ZYQ A;  1OBR A;  2BEI A;  3T90 A;  1R57 A;  2QVP A;  4YFJ A;  3EXN A;  3I3G A;  1ZG8 A;  4KOV A;  5K8M A;  2Q4Y A;  4CYO A;  4EWT A;  3DSB A;  4FWU A;  4UCN A;  3WT4 A;  2PRB A;  4NGM A;  1YSJ A;  1Z4E A;  3S9M A;  3B3C A;  4CGN A;  4KS9 A;  3S9N A;  2V8V A;  3ISZ A;  4AB7 A;  3LOD A;  3R1K A;  2R1I A;  2WZN A;  1YME A;  2B3V A;  5IV0 A;  4P4D A;  2GAN A;  4R3L A;  2REF A;  2EK8 A;  3PFE A;  3EY5 A;  1CG2 A;  4C2X A;  4PXD A;  4MFQ A;  2P6E A;  3F8K A;  1ZG9 A;  4K30 A;  2G3A A;  4KLV A;  2FE7 A;  2CF4 A;  3DGV A;  1AUG A;  2GU2 A;  3HUV A;  1M44 A;  4F6A A;  5J8C A;  4KOY A;  3KHZ A;  4CAW A;  2PJ7 A;  4H89 A;  2OOT A;  4A95 A;  3FX6 A;  5IB0 A;  1JWQ A;  2PDO A;  3CPX A;  2WPW A;  4KUB A;  2R8V A;  3MGD A;  4MCS A;  4TNU A;  4JWP A;  1YGH A;  2VI7 A;  2K5T A;  1GHE A;  3KL9 A;  3RO0 A;  1GYT A;  1KUV A;  4UFX A;  2DXQ A;  2JEV A;  1ARM A;  1LAN A;  4OIW A;  4P4J A;  3TX8 A;  4A31 A;  1I1D A;  3C26 A;  2C1C A;  2PJA A;  4IF5 A;  1IU8 A;  4UEZ A;  1YLE A;  4UWI A;  4Y49 C;  3RAM A;  3B2Y A;  3N5F A;  4U5Y A;  3L2N A;  2VEZ A;  3FEC A;  4NSQ A;  2F7V A;  2GFQ A;  5C82 A;  4UF4 A;  2CY2 A;  3PB9 X;  3VWD A;  1QSM A;  2EO8 A;  3D7F A;  3WC6 A;  2PJC A;  4B14 A;  4DUK A;  2ODF A;  4NEX A;  1TKJ A;  3IWW A;  5FVJ A;  4E2A A;  1ZG7 A;  1PCA A;  4PPZ A;  1UWY A;  1OZP A;  4A2Z A;  1NMT A;  4PK2 A;  5HXD A;  5KTD A;  2F5I A;  4CAF A;  1FT7 A;  3FF3 A;  3W6X A;  4KZT A;  1KWM A;  3FNC A;  2AFW A;  1VGY A;  3DR6 A;  1XF8 A;  3FEE A;  3GIU A;  4L8A A;  5LYI A;  4PSX A;  3D7G A;  5J1Q A;  4EVY A;  1BPN A;  2ZW5 A;  3LD2 A;  1AMP A;  2ZEM A;  2NMT A;  3PB6 X;  4E0A A;  1M4G A;  1RXT A;  4OLL A;  4X5K A;  5BWA B;  2V8D A;  4NJQ A;  3LWU A;  4KOR A;  1XE4 A;  4UIB A;  3TO7 A;  3BI0 A;  2BSW A;  1S5K A;  4YGO A;  2PJ0 A;  1CPS A;  2ZW6 A;  3K2K A;  4GXH A;  1X10 A;  3PP9 A;  2Z3O A;  5AG5 A;  5CNP A;  3SI2 A;  2ZEP A;  2G3T A;  3WAB A;  3R95 A;  2QIR A;  4H2K A;  4NGT A;  5GCN A;  4OC4 A;  3G8W A;  4C2Y A;  2ZEE A;  3IJ3 A;  4JJX A;  5D8N A;  2A4N A;  2P0W A;  4IK2 A;  4II9 A;  4A33 A;  3BLN A;  5CPA A;  4J3G A;  4PXE A;  3R96 A;  2IJZ A;  4ZX9 A;  5AG4 A;  3UY5 A;  1QSO A;  3KHX A;  3BJ8 A;  3DR8 A;  4OID A;  4ZX8 A;  2J8N A;  4F9U A;  1XIX A;  3TCV A;  4IHM A;  3IO1 A;  2ATR A;  3MRU A;  4GS4 A;  2GRE A;  1Q2Y A;  2JEW A;  2OR4 A;  4ZY1 A;  2PR8 A;  4E8O A;  1S7N A;  1WWZ A;  4L89 A;  1TXR A;  3PB8 X;  6CPA A;  5AGE A;  1Z4R A;  3LMS A;  4BD9 A;  4RUH A;  2PRQ A;  3JTK A;  4CGM A;  4CYQ A;  4HNX B;  5G1Z A;  5JQ4 A;  3EO4 A;  5F09 A;  5G20 A;  5KTA A;  2I3C A;  3KI9 A;  4KOS A;  2BO9 A;  2FL4 A;  5THW A;  5F49 A;  1F2O A;  2ZEG A;  3V38 A;  1U6M A;  4NGN A;  4C7I A;  2VBQ A;  4CRZ B;  1HEE A;  4PQA A;  3IIB A;  1LAM A;  1J4J A;  1Y9K A;  4NJR A;  4R7M A;  1KUY A;  1MJB A;  1YX0 A;  3PGP A;  2HQY A;  2FXF A;  3S6H A;  3SXN A;  3OWC A;  1HDQ A;  4G1P A;  4DJL A;  4F8Z A;  4AVC A;  1CJW A;  1PYT B;  5A28 A;  5LRG A;  2FIA A;  1PUA A;  1S7L A;  3CDX A;  2R98 A;  3FED A;  3FXT A;  5HVF A;  2G9D A;  4YWY A;  5LYD A;  4ZGY B;  3PB7 X;  2BCO A;  4B6Z A;  1Y7R A;  7CPA A;  2DEA A;  3D66 A;  4CRY B;  5JM6 A;  1ZLI A;  2PE3 A;  4OKO A;  5JH9 A;  3PB4 X;  2Q43 A;  4ZY2 A;  2AFS A;  5D29 A;  3ZZI A;  3S9L A;  4CS0 B;  5F46 A;  4KLW A;  3JUW A;  3TO9 A;  2BOA A;  4B5P A;  3IGR A;  2DF5 A;  2ABZ A;  1XOV A;  2Q7S A;  3H8F A;  4Y49 B;  2Q4Z A;  2ZOF A;  4RI1 A;  5H84 A;  1S3Z A;  3NA6 A;  4ZY0 A;  3TE4 A;  4U9Y A;  2P6G A;  1Z9U A;  3KGQ A;  1NE9 A;  3D7H A;  3F0A A;  4XPK A;  5EMI A;  2Q7B A;  2WPX A;  4OC2 A;  1Z2L A;  1XMT A;  1TF8 A;  2FCK A;  4UIA A;  3N7Z A;  4MHP A;  5ISV A;  1MJA A;  3GB0 A;  1YK3 A;  4A94 A;  4Z65 A;  2HUZ A;  3B8G A;  4OAE A;  2KCW A;  4X2T A;  4UEE A;  3V7Z A;  4QUS A;  3NFZ A;  1IYL A;  4KUA A;  4OC5 A;  2Z3K A;  2Z0Z A;  4EFD A;  2Z3M A;  3KR5 A;  4NCZ A;  3SXO A;  3S6G A;  3KZW A;  2C27 A;  3B3T A;  4NFR A;  1PU9 A;  2OZU A;  4A39 A;  4MHD A;  1B6B A;  4KSF A;  4AVA A;  2OZH A;  4BBH A;  1Q2C A;  4M3S A;  4I49 A;  4KOT A;  4RS2 A;  4IAV A;  2G0B A;  2PJ4 A;  2B4D A;  3BI1 A;  4FD5 A;  4CGO A;  4R9M A;  3BXM A;  3IU1 A;  4NGS A;  3FIX A;  4WJB A;  1XRY A;  2PJ6 A;  3MN8 A;  3IFE A;  3D4U A;  4FD4 A;  1TKH A;  2ZEL A;  1YVK A;  4R8F A;  2FT0 A;  2JDC A;  4KVO E;  2AFU A;  1LRZ A;  1ELM P;  2PJ5 A;  4KOW A;  4XNH C;  1S60 A;  2B5G A;  8CPA A;  4UFW A;  1DTD A;  4A32 A;  4KVX A;  4DYO A;  2Z10 A;  4KSI A;  4CYN A;  2JBK A;  3H4Q A;  2EBJ A;  1YW4 A;  3NH8 A;  3ISX A;  4MY0 A;  2HC9 A;  3GKR A;  4LQ6 A;  2RB7 A;  2FSR A;  2XEJ A;  2ZEF A;  2QML A;  3P2H A;  2V8H A;  3IEH A;  4AXV A;  2JDD A;  2J8R A;  4R87 A;  5C88 A;  2I79 A;  4MFK A;  4ONW A;  3BHX A;  1KZF A;  2PJ9 A;  3D8P A;  2ARH A;  3IWG A;  4WWV A;  2PVW A;  2YGW A;  3D67 A;  4B5P B;  4A30 A;  1A2Z A;  2QEC A; 
#chains in the Genus database with same CATH homology
 5K8P A;  3SI1 A;  2C6G A;  1F2P A;  2PJ3 A;  3B35 A;  1IGB A;  1Y0R A;  1YLO A;  2VL1 A;  2XEI A;  4OP4 A;  4YU9 A;  4OC1 A;  4P6Y A;  4R76 A;  2Q51 A;  3SI0 A;  2F8H A;  1LOK A;  3WC7 A;  2CIJ A;  4NGR A;  4W9Y A;  4MHZ A;  3IC1 A;  3B7I A;  4R6T A;  1LAP A;  1H8L A;  3T8W A;  1RTQ A;  4MCP A;  1VIX A;  4MXU A;  1NSA A;  1Z8L A;  1CPX A;  2J9A A;  4P4B A;  2V8G A;  4MCR A;  2AFZ A;  4CPA A;  3FH4 A;  2PJ2 A;  4MCQ A;  4PXB A;  3SJX A;  1LCP A;  3B3S A;  1F57 A;  5K8N A;  2PJB A;  1IY7 A;  2AFX A;  1Z5R A;  1ELL P;  2C6P A;  4UEF A;  2O53 A;  5LRJ A;  4X8I A;  4JZ0 A;  1ARL A;  4OME A;  5HVH A;  2QYV A;  2ZEN A;  4TWE A;  3KR4 A;  4P4I A;  4MMO A;  1Y0Y A;  1QMU A;  1XMB A;  2GLJ A;  5JGF A;  4K3N A;  4X3R A;  4MHN A;  2NSM A;  3DLJ A;  1BAV A;  4EME A;  1AYE A;  3RZA A;  2CTC A;  1CP7 A;  4OC3 A;  2PJ8 A;  4MRI A;  2IMO A;  3FJU A;  3QNV A;  2ANP A;  2PIY A;  4FBE A;  5LYF A;  2GLF A;  4ZI6 A;  3PEI A;  4FAI A;  1TF9 A;  3SJF A;  1FNO A;  2O4H A;  2IQ6 A;  3VH9 A;  5DS0 A;  3FVL A;  3RBU A;  3HLP A;  2ZOG A;  5I4M A;  5ELY A;  2XEG A;  4Q7A A;  4P4F A;  2POK A;  4P10 A;  2WYR A;  2C6C A;  4P45 A;  2ZEH A;  3H8E A;  5LRK A;  1XBU A;  5IB9 A;  2PVV A;  1CBX A;  3D68 A;  1VHE A;  3VAT A;  2ZEO A;  3SJG A;  3FMC A;  3I1U A;  2EK9 A;  1DE4 C;  1HDU A;  1EE3 P;  2JBJ A;  3NH4 A;  1JQG A;  3PRT A;  1Y7E A;  3TC8 A;  4F9V A;  4OC0 A;  4LQG A;  4JYW A;  5LYL A;  1M4L A;  2PCU A;  2HB6 A;  2NYQ A;  1TKF A;  3KQZ A;  2XEF A;  3PBE A;  3VAR A;  4A37 A;  3SJE A;  3GUX A;  4P4E A;  1XJO A;  1CX8 A;  3B3W A;  2ZED A;  3PBB A;  2PJ1 A;  1YW6 A;  2EWB A;  3K9T A;  2AFO A;  3CT9 A;  4A38 A;  1VHO A;  3D7D A;  3KAS A;  4NGP A;  4MHY A;  3B3V A;  1Q7L A;  3GLJ A;  4FUU A;  3WC5 A;  3KQX A;  4PXC A;  1ZLH A;  2CTB A;  2V77 A;  1XFO A;  3JRU A;  2PIZ A;  5K8O A;  1QQ9 A;  4O23 A;  1R3N A;  4GM5 A;  4NGQ A;  2AFM A;  1BPM A;  1LFW A;  5HVG A;  3H8G A;  2FVG A;  1CP6 A;  5CBM A;  3NH5 A;  4P44 A;  2QJ8 A;  3PFO A;  2RFH A;  3CPA A;  1R43 A;  1BLL E;  4ZYQ A;  1OBR A;  2QVP A;  1ZG8 A;  5K8M A;  4EWT A;  4FWU A;  3WT4 A;  3S9M A;  4NGM A;  1YSJ A;  3B3C A;  3S9N A;  2V8V A;  3ISZ A;  2WZN A;  1YME A;  4P4D A;  2EK8 A;  3PFE A;  1CG2 A;  4PXD A;  1ZG9 A;  2CF4 A;  3DGV A;  2GU2 A;  3HUV A;  3KHZ A;  2PJ7 A;  2OOT A;  3FX6 A;  3CPX A;  4MCS A;  4TNU A;  3KL9 A;  1GYT A;  1ARM A;  1LAN A;  4OIW A;  4P4J A;  3TX8 A;  4UEZ A;  2C1C A;  2PJA A;  3RAM A;  3B2Y A;  3N5F A;  3L2N A;  3FEC A;  2F7V A;  4UF4 A;  3PB9 X;  3D7F A;  3WC6 A;  2PJC A;  4DUK A;  1TKJ A;  3IWW A;  1ZG7 A;  1PCA A;  4PPZ A;  1UWY A;  5HXD A;  1FT7 A;  3FF3 A;  1KWM A;  2AFW A;  1VGY A;  3FEE A;  5J1Q A;  5LYI A;  3D7G A;  1BPN A;  1AMP A;  2ZEM A;  3PB6 X;  2V8D A;  4NJQ A;  3LWU A;  4UIB A;  3BI0 A;  2PJ0 A;  1CPS A;  3K2K A;  3SI2 A;  3WAB A;  2ZEP A;  4H2K A;  4NGT A;  4OC4 A;  2ZEE A;  3IJ3 A;  5D8N A;  4IK2 A;  5CPA A;  4PXE A;  2IJZ A;  4ZX9 A;  3KHX A;  4OID A;  4ZX8 A;  4F9U A;  4IHM A;  3IO1 A;  3MRU A;  2GRE A;  2JEW A;  4ZY1 A;  2OR4 A;  1TXR A;  3PB8 X;  6CPA A;  3LMS A;  4BD9 A;  4RUH A;  2PRQ A;  5F09 A;  2I3C A;  3KI9 A;  2BO9 A;  5THW A;  1F2O A;  2ZEG A;  3V38 A;  4NGN A;  1HEE A;  4PQA A;  3IIB A;  1LAM A;  4NJR A;  4R7M A;  4G1P A;  1HDQ A;  4DJL A;  4F8Z A;  1PYT B;  5LRG A;  3CDX A;  3FED A;  5HVF A;  2G9D A;  4YWY A;  5LYD A;  3PB7 X;  2BCO A;  4B6Z A;  7CPA A;  2DEA A;  3D66 A;  5JM6 A;  1ZLI A;  2PE3 A;  4OKO A;  5JH9 A;  3PB4 X;  2Q43 A;  4ZY2 A;  2AFS A;  5D29 A;  3S9L A;  2BOA A;  2ABZ A;  3H8F A;  2Q4Z A;  2ZOF A;  3NA6 A;  4ZY0 A;  3KGQ A;  3D7H A;  4OC2 A;  1Z2L A;  1TF8 A;  4UIA A;  4MHP A;  3GB0 A;  4A94 A;  4Z65 A;  4X2T A;  4UEE A;  3V7Z A;  3NFZ A;  4OC5 A;  4EFD A;  3KR5 A;  3KZW A;  3B3T A;  4NFR A;  4A39 A;  4IAV A;  2PJ4 A;  3BI1 A;  3BXM A;  4NGS A;  4WJB A;  1XRY A;  2PJ6 A;  3MN8 A;  3IFE A;  3D4U A;  1TKH A;  2ZEL A;  4R8F A;  2AFU A;  2PJ5 A;  1ELM P;  8CPA A;  1DTD A;  4DYO A;  4KSI A;  2JBK A;  1YW4 A;  3NH8 A;  3ISX A;  2HC9 A;  2RB7 A;  2XEJ A;  2ZEF A;  2V8H A;  3IEH A;  4AXV A;  4ONW A;  3BHX A;  2PJ9 A;  4WWV A;  2PVW A;  3D67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...