1I21A

Crystal structure of yeast gna1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
158
structure length
155
Chain Sequence
MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFCKLIKYWNEATVWNDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSNAGVEMQIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
publication title The crystal structures of Apo and complexed Saccharomyces cerevisiae GNA1 shed light on the catalytic mechanism of an amino-sugar N-acetyltransferase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 38
structure length 155
sequence length 158
chains with identical sequence B, M, N, X, Y
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2001-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1i21A00
2PC1A 2B4DA 3R9GA 4RS2A 4ONUA 2DXQA 3EXNA 3OWCA 1UFHA 4JLYA 4XPKA 4L8AA 2G3AA 2HQYA 3EC4A 2D4OA 3TOAA 4UA3A 3PP9A 1CM0A 4KOSA 3CXPA 2Q7BA 1YGHA 3H4QA 2QIRA 3EFAA 2B4DB 3W91A 2GIVA 4JWPA 5F48A 3ZZIA 1GHEA 2EVNA 3F8KA 3F5BA 1S7NA 1YK3A 1VKCA 4MJ8A 1KUXA 1MJ9A 3PGPA 2WPXA 1BO4A 2PR8A 5EBVA 1S3ZA 4KOTA 1ON0A 3VWEA 4HNYB 4QUSA 1V0CA 4U9YA 5IX3A 3F0AA 1KUVA 4KUBA 4CRYB 4NXYA 4XPDB 2OH1A 1YREA 2BEIA 2WPWA 2Z10A 2Z0ZA 3TT2A 4H6ZA 4JXRA 4LUAA 1S5KA 5I0CA 4BMHA 5EC4A 2FCKA 1XF8A 2QECA 4XNHB 1QSMA 2OZGA 4FD4A 2HUZA 4R3KA 4KOXA 2P6GA 2I00A 2ATRA 2JLMA 1M44A 5CNPA 5F46A 4OAEA 3TTHA 2P6EA 4Y49C 4PK3A 2O28A 3QB8A 4QVTA 5C88A 1YVKA 2QMLA 4KLVA 4AVAA 2KCWA 3R1KA 4AVBA 3LD2A 5IV0A 5DWNA 4IUSA 2IL4A 3D2MA 4HNWB 4L89A 5C82A 4MY0A 4R87A 3B8GA 4J3GA 4AG9A 1S7KA 3DR8A 3TO6A 4YFJA 3FIXA 2ZW4A 3I3GA 4JXQA 2Q44A 3P2FA 3D3SA 3LODA 1PUAA 4H89A 2BL1A 2R7HA 1IICA 1I12A 2G3TA 3DR6A 3FRMA 4II9A 4AVCA 4F6AA 3CXSA 2VXKA 2FIAA 4LX9A 2VI7A 2X7BA 4X5KA 4AG7A 2BUEA 5H86A 3IWGA 2AJ6A 4FD7A 3S6HA 3G8WA 1N71A 3TFYA 3TO7A 1MJAA 3FBUA 4R57A 5E96A 4CAVA 2J8RA 4HKFA 2G0BA 2Q4YA 4K30A 1OZPA 4OADA 3TO9A 1B6BA 4MI4A 2PDOA 3BLNA 1M4GA 3CXQA 3GY9A 2REFA 3S6FA 2FT0A 4FD6A 4M3SA 4GS4A 3K9UA 4QBJA 3SXNA 1S7FA 1R57A 4E0AA 3MGDA 5KTDA 2ZXVA 3R95A 4E8OA 4IF5A 1QSOA 2VZYA 4UBRA 1Q2DA 4NF1A 3SXOA 1QSTA 3TE4A 3DDDA 2H5MA 4M85A 1QSNA 1MJBA 2JDDA 2OZUA 1L0CA 4QC6A 3RYOA 1PU9A 2CNMA 4UWIA 1S7LA 4AB7A 5ISVA 3R9EA 3IGRA 1Z4EA 1YVOA 4NCZA 2FIWA 3JVNA 4PSWA 2R1IA 3S6KA 2Q0YA 1Y9WA 1Y7RA 3G3SA 2PSWA 4KOYA 1MK4A 4KZTA 3FNCA 4PV6A 4KVME 1XE4A 5JPHA 3C26A 3P2HA 4DNCA 1FY7A 1KZFA 3W6SA 1XEBA 5KTAA 4HNXB 2Z11A 4KOUA 2B58A 2NMTA 2B4BA 1S60A 2CY2A 1TIQA 2FL4A 3S6GA 1QSRA 4FD5A 2EUIA 2CNSA 2HV2A 2ZW6A 1Q2YA 5HH1A 3JUWA 1Z4RA 5F49A 1IB1E 1U6MA 1M4DA 1VHSA 2GANA 2Q4VA 3WR7A 1K4JA 2ZPAA 5HMNA 1IYLA 1YR0A 3SHPA 2VZZA 2OZHA 2OU2A 3R96A 2A4NA 3T90A 2FSRA 4JD6A 2AE6A 4H6UA 2J8NA 4F0YA 1Q2CA 1BOBA 2FS5A 3R9FA 1P0HA 4CAXA 3GKRA 2Y0MA 4KOVA 4NSQA 4ORFA 4PK2A 4YGOA 1WWZA 2JDCA 4B5PA 3UY5A 2PRBA 1XIXA 2R98A 3FB3A 1IYKA 3FYNA 4OLLA 1Y9KA 2PQ8A 1I21A 4MBUA 2FXFA 2D4PA 3TOBA 1RXTA 1YX0A 4B5PB 4EVYA 1WK4A 2P6FA 1B87A 4I49A 4KOWA 2P0WA 4B5OA 4RI1A 3VWDA 1P4NA 2K5TA 4PSXA 4E2AA 1M4IA 4XPDC 2VEZA 3DSBA 3KKWA 3BJ8A 3PZJA 5KTCA 2Q04A 4KUAA 4XNHC 3FXTA 3GYAA 5GCNA 2OB0A 2C27A 1YLEA 4ZBGA 2ARHA 4KVXA 4U9ZA 3W6XA 3BJ7A 5IB0A 3N7ZA 4QB9A 4NEXA 1J4JA 5H84A 1NSLA 2CNTA 4YRHA 5J8CA 2VQYA 4UWJA 5J8FA 3DNSA 4U5YA 3T9YA 4XPLA 1SQHA 3NE7A 4MY3A 3E0KA 1KUYA 3TCVA 3QAHA 1CJWA 3I9SA 4Y49B 4KORA 2PR1A 5JQ4A 4MHDA 2I79A 2B5GA 3V8IA 3D8PA 4KLWA 2B3UA 2REEA 3ZJ0A 5FVJA 2GE3A 1LRZA 4CRZB 4CS0B 5F47A 4KVOE 1XMTA 4R9MA 1NMTA 4CAWA 3EY5A 4JJXA 1RO5A 2ZW5A 2B5GB 2FE7A 3D2PA 2VBQA 2ZW7A 5DWMA 1NE9A 3EO4A 1M1DA 2F5IA 2JEVA 4R3LA 2RC4A 2J8MA 2R8VA 1I1DA 2B3VA 1IIDA 2BSWA 1Z9UA
chains in the Genus database with same CATH superfamily
1YW6A 2PC1A 3KQXA 4A95A 2C6GA 2B4DA 4UIAA 3R9GA 4RS2A 4NJQA 4CAFA 4ONUA 4DUKA 2DXQA 3EXNA 3OWCA 1UFHA 4P10A 4JLYA 4ONWA 4L8AA 2ZEHA 4XPKA 1TXRA 5LYIA 1HEEA 5AG5A 2G3AA 2DPTA 2HQYA 3EC4A 4W9YA 2D4OA 4DYOA 3D7HA 4R76A 4UA3A 2Q4ZA 3TOAA 3GIUA 4MFKA 2Q51A 3PP9A 4MCRA 1CM0A 2AFSA 4KOSA 4DJLA 2YNCA 2V8HA 3CXPA 2Q7BA 1YGHA 3H4QA 2QIRA 5IB9A 4NGQA 3EFAA 2B4DB 3W91A 2NYQA 3A9LA 2GIVA 2O4HA 4JWPA 5F48A 3ZZIA 4A33A 1GHEA 3H5ZA 1YLOA 4MHYA 4UIBA 4FAIA 1TKFA 1TF9A 2PJ3A 3NH5A 2EVNA 3F8KA 3PB9X 4ZYQA 3F5BA 1S7NA 3KQZA 4C68A 4CYPA 1YK3A 4R6TA 1VKCA 2G9DA 2ZEOA 3D4UA 1ELMP 1KUXA 1MJ9A 4MJ8A 1LAPA 3PGPA 1XFOA 3D67A 2WPXA 1BO4A 1OBRA 2PR8A 1GYTA 1S3ZA 2PIZA 4M6GA 4MFJA 5EBVA 4KOTA 3SJXA 1BLLE 4TNUA 5G20A 7CPAA 1DTDA 2PJBA 1ON0A 3VWEA 4P4FA 2OOTA 5AG6A 4HNYB 1IU8A 3FJUA 4QUSA 2AFUA 4UEFA 1V0CA 1VGYA 4U9YA 5IX3A 3QNVA 4WWVA 1Y0RA 2WUUA 2J9AA 4MFLA 5K8PA 2C1CA 3F0AA 1KUVA 3MN8A 4JYWA 3WT4A 3RO0A 3WC7A 1VHEA 2C6PA 3NFZA 4KUBA 4MHZA 4CRYB 2V77A 4QVTA 4NXYA 4MMOA 4XPDB 2IMOA 1YREA 2OH1A 2BEIA 2WPWA 4OC5A 4P4IA 4B14A 2Z10A 2PCUA 2Z0ZA 3TT2A 4H6ZA 4JXRA 4LUAA 2QVPA 1S5KA 4X8IA 5I0CA 4NGPA 2GFQA 2YNDA 3D7DA 4NGRA 4BMHA 5EC4A 2FCKA 1XF8A 2QECA 4UEEA 4XNHB 1QSMA 2OZGA 4FD4A 2HUZA 1Z5RA 2PJCA 4IHMA 4R3KA 4MCSA 1FNOA 2VL1A 4GM5A 5DS0A 4Q7AA 4KOXA 4C2ZA 3B3SA 2P6GA 1TF8A 2I00A 1IOIA 2ATRA 2JLMA 1M44A 3K9TA 5CNPA 4AXVA 4F8ZA 5F46A 4OAEA 1BPMA 2Z3NA 3TTHA 2P6EA 3FVLA 3PB4X 4Y49C 2BO9A 1VIXA 2O53A 4PK3A 2O28A 1IGBA 1ZO0A 1F57A 1ARMA 1YVKA 3QB8A 2QMLA 2V8VA 2PIYA 2PRQA 4KLVA 4AVAA 5K8OA 2PJ1A 2KCWA 3R1KA 4AVBA 3LD2A 5IV0A 1LCPA 3HLPA 5AGEA 2Z3KA 4IUSA 1M4LA 4KSFA 5DWNA 4RUHA 2IL4A 4B11A 5K8MA 3BHXA 2OR4A 2HC9A 1YQEA 3D2MA 3MRUA 2PE3A 4HNWB 4L89A 5C82A 4MY0A 3FEDA 5I4MA 4OC3A 4R87A 3B8GA 4UF4A 2CF4A 2PJ8A 4J3GA 4AG9A 1S7KA 3NH4A 3KHXA 3DR8A 3TO6A 5C88A 3KHZA 2GU2A 3FECA 2C6CA 4YFJA 1A2ZA 2GLFA 2ZW4A 3FIXA 3I3GA 4JXQA 2Q44A 2V8DA 1Y7EA 3P2FA 2ODFA 4C7IA 3D3SA 3LODA 1PUAA 2QJ8A 4H89A 2BL1A 2R7HA 1IICA 1I12A 2CTCA 1Z8LA 3NA6A 5AG7A 2G3TA 2PJ5A 3DR6A 3FRMA 2XEGA 4O23A 4II9A 5D8NA 4P4DA 4AVCA 4F6AA 5G1ZA 4FUUA 3CXSA 2VXKA 2RB7A 2FIAA 2XEIA 2ZENA 2DPSA 4LX9A 4PXBA 2VI7A 2X7BA 4BINA 4X5KA 4AG7A 2BUEA 4ZGYB 5H86A 2V8GA 3S9LA 1TKHA 3IWGA 3JRUA 4C7HA 2AJ6A 4FD7A 5F09A 3FX6A 3S6HA 4F9VA 1Z2LA 3G8WA 4MXUA 3CDXA 4EWTA 5HVGA 1HDQA 1N71A 5K8NA 1ELLP 1UWYA 1CX8A 3TFYA 1AYEA 3KR4A 3TO7A 1MJAA 3FBUA 4R57A 2FVGA 4WJBA 5G21A 1LAMA 5E96A 3DLJA 2PVWA 4CAVA 5BWAB 3PFOA 2J8RA 4HKFA 2G0BA 3IWWA 5LRGA 2NSMA 3JTKA 2Q4YA 2CXAA 4K30A 1OZPA 1QQ9A 4OADA 2BOAA 3TO9A 4P4JA 1B6BA 2XEFA 4MI4A 4UEZA 4M6HA 2PDOA 3BLNA 1M4GA 5A27A 3B3VA 3CXQA 4OC0A 3GY9A 2REFA 3CT9A 3PBEA 3S6FA 4OMEA 2FT0A 4FD6A 4M3SA 4ZY2A 1CP7A 1Z8XA 4OIDA 4GS4A 2BCOA 3K9UA 2PJ7A 2ZEFA 2ZELA 3SXNA 4QBJA 1S7FA 3L2NA 1R57A 1X12A 1XBUA 2EK9A 4MFPA 4E0AA 1ARLA 1Z8TA 3MGDA 2WYRA 3NH8A 2ZXVA 5KTDA 4A31A 5CPAA 3R95A 4FBEA 4ZY0A 4E8OA 2PVVA 4CGNA 4IF5A 3IFEA 4NGNA 1F2PA 4PPZA 1QSOA 2VZYA 3IU2A 4UCPA 2PJ2A 3LACA 4UBRA 3PRTA 1Q2DA 4NF1A 3SXOA 1QSTA 2AFZA 3TE4A 1LOKA 3PEIA 3DDDA 2H5MA 4M85A 1QSNA 1MJBA 2JDDA 3KR5A 4M6IA 2DEAA 4G1PA 3B3WA 2AFWA 1XRYA 2OZUA 4R7MA 1L0CA 4QC6A 3RYOA 1PU9A 2CNMA 4UWIA 1S7LA 1ZLIA 2AFMA 3SI0A 4B10A 2JBKA 4AB7A 5ISVA 1EE3P 5LRJA 3R9EA 3IGRA 1Z4EA 1YVOA 4NCZA 1Y0YA 2FIWA 3JVNA 4X3RA 4PSWA 2R1IA 3S6KA 2Q0YA 1Y9WA 2EO8A 1LFWA 1Y7RA 3G3SA 4UFWA 2PSWA 4KOYA 4UFXA 1MK4A 3ISXA 1R43A 3H8EA 3IEHA 3IU1A 2XEJA 3IJ3A 4KZTA 3FNCA 4PV6A 3IO1A 1CG2A 1XOVA 1Q7LA 2ABZA 3FMCA 4OC1A 3HUVA 4C2YA 5HXDA 1DE4C 4Q38A 1NSAA 1YW4A 3KGQA 4KVME 4TWEA 1XE4A 3NE8A 3GUXA 3D66A 1R3NA 5JPHA 4BBHA 3C26A 4ZY1A 2ZEDA 3P2HA 2ZEGA 3QAYA 4DNCA 1FY7A 2CTBA 5JGFA 1X10A 4KSAA 4MCPA 1KZFA 4OIWA 3W6SA 1XEBA 1YMEA 3VARA 4HNXB 5KTAA 2WSAA 2Z11A 4KOUA 2B58A 2NMTA 2B4BA 1S60A 2CY2A 4A39A 1TIQA 2FL4A 3FEEA 3S6GA 4IK2A 1QSRA 4FD5A 1FT7A 4CYNA 2EUIA 5AG4A 3H8GA 2CNSA 2HV2A 2ZW6A 1ZG9A 1Q2YA 2PJAA 1CPSA 2PJ4A 5HH1A 1YSJA 3FH4A 3JUWA 4PXDA 4ZX9A 4NFRA 1Z4RA 4OKOA 4Q36A 4YU9A 5F49A 1CBXA 5ELYA 3WABA 3WC5A 4CPAA 1IB1E 1U6MA 2ZEEA 2YGWA 1XMBA 4MHPA 1M4DA 1LANA 1VHSA 2GANA 2Q4VA 2ZEMA 4A2ZA 5G22A 3WR7A 5LYDA 1K4JA 4BD9A 2ZPAA 3D68A 2ZEPA 5HMNA 1IYLA 1PYTB 1YR0A 3IC1A 3SHPA 1ZG8A 4NGSA 2VZZA 2OZHA 2OU2A 4PXCA 4P44A 2A4NA 4OC4A 3R96A 2FSRA 4JD6A 3T90A 4Z65A 2PJ6A 2AE6A 4MFZA 4MCQA 4H6UA 2J8NA 3CPXA 4F0YA 2JEWA 3RZAA 1Q2CA 4B12A 3K2KA 1BOBA 2Z3LA 4UFVA 2RFHA 2FS5A 3R9FA 3D7GA 1P0HA 4JZ0A 4UCNA 3SJEA 4CAXA 3GKRA 5LRKA 2Y0MA 5THWA 3T8WA 4KOVA 4NSQA 2AFOA 4ORFA 4PK2A 4YGOA 3V38A 1WWZA 2JDCA 4B5PA 4K3NA 3CZXA 3KASA 3UY5A 3S9MA 4EFDA 2PRBA 1XIXA 2GREA 2R98A 3FB3A 3N5FA 3VH9A 2EBJA 6CPAA 1IYKA 3FYNA 4OLLA 1Y9KA 2PQ8A 1I21A 3ISZA 4MBUA 2QYVA 2ZOGA 2FXFA 3PB8X 4A32A 5JM6A 3GB0A 3TX8A 4YWYA 3IIBA 4C2XA 4ZX8A 2D4PA 1KWMA 3TOBA 3D7FA 1RXTA 2WZNA 5LYLA 1YX0A 4B5PB 4EVYA 3PBBA 2EWBA 3SI1A 3PB6X 3DGVA 1WK4A 2P6FA 4CYOA 1B87A 4KS9A 4F0XA 4I49A 3KI9A 2P0WA 2YNCC 4KOWA 4B5OA 3LWUA 2YNEA 3B7IA 4RI1A 3VWDA 2Z3MA 4ZI6A 3S9NA 1P4NA 1PCAA 4GXHA 4PXEA 2K5TA 3B3TA 3H8FA 2Q43A 3FF3A 4PSXA 4PQAA 5HVFA 3KL9A 2IQ6A 3B35A 2Z3OA 4E2AA 1CP6A 3RNZA 4X2TA 1M4IA 4B13A 3I1UA 4A37A 1BPNA 4XPDC 4R8FA 4OC2A 2VEZA 3DSBA 4H2KA 4B6ZA 5JH9A 3KKWA 3BJ8A 4CAEA 3PZJA 5A28A 5LYFA 5KTCA 8CPAA 2Q04A 4KUAA 2POKA 3BXMA 4XNHC 3FXTA 3SJGA 3GYAA 3SJFA 1F2OA 5D29A 5GCNA 2ZOFA 4LQ6A 4P4EA 1CPXA 2OB0A 3SI2A 1VHOA 1AMPA 4NJRA 2C27A 2F7VA 1YLEA 2F8HA 4ZBGA 3VATA 2ARHA 4KVXA 4U9ZA 3W6XA 3BJ7A 5HVHA 5IB0A 3N7ZA 5EMIA 2GLJA 4QB9A 3BI0A 4OP4A 3PFEA 1TKJA 4NEXA 2PJ0A 1J4JA 5H84A 1NSLA 2CNTA 4YRHA 1ZG7A 5J8CA 4A38A 2VQYA 4MHNA 4UWJA 4A30A 5J8FA 3DNSA 4U5YA 3T9YA 3WC6A 1HDUA 5J1QA 4RN7A 1ZLHA 4XPLA 2Q7SA 4NGTA 4CGOA 4NGMA 1SQHA 3BI1A 4MFQA 3NE7A 4MY3A 1JWQA 3E0KA 1KUYA 1IOFA 3TCVA 3QAHA 4CGMA 4UCMA 1CJWA 3I9SA 4Y49B 4KORA 5CBMA 4LQGA 1Z8WA 2PR1A 2Z3PA 4HPSA 5JQ4A 4MHDA 1IY7A 3RBUA 3V7ZA 3GLJA 2I79A 2AFXA 3CPAA 3TC8A 3KZWA 2B5GA 2JBJA 4FWUA 3PB7X 3V8IA 1BAVA 3D8PA 4KSIA 4KLWA 1JQGA 2B3UA 2REEA 3ZJ0A 4A94A 2DF5A 5FVJA 2GE3A 4CGLA 1H8LA 1LRZA 4P6YA 4MRIA 4CRZB 4CS0B 5F47A 2I3CA 4KVOE 2IJZA 1XMTA 4IAVA 4R9MA 1NMTA 3LMSA 4P45A 4CAWA 2PJ9A 3EY5A 4JJXA 4CYQA 2HB6A 1RO5A 1QMUA 2ZW5A 2ANPA 2FE7A 2B5GB 3D2PA 2VBQA 2ZW7A 1XJOA 5DWMA 2EK8A 1NE9A 2CIJA 3EO4A 1M1DA 4F9UA 4EMEA 1AUGA 3B2YA 2F5IA 4P4BA 2JEVA 3IWEA 4R3LA 2RC4A 4CGPA 2J8MA 2R8VA 3RAMA 3B3CA 1I1DA 2B3VA 1RTQA 1IIDA 2BSWA 1Z9UA
chains in the Genus database with same CATH topology
2PC1A 4A95A 2B4DA 4CAFA 3R9GA 4RS2A 4ONUA 2DXQA 3EXNA 3OWCA 1UFHA 4JLYA 4XPKA 4L8AA 5AG5A 2G3AA 2DPTA 2HQYA 3EC4A 2D4OA 3TOAA 4UA3A 4MFKA 3PP9A 1CM0A 4KOSA 2YNCA 3CXPA 2Q7BA 1YGHA 3H4QA 2QIRA 3EFAA 2B4DB 3W91A 3A9LA 2GIVA 4JWPA 5F48A 3ZZIA 4A33A 1GHEA 3H5ZA 2EVNA 3F8KA 3F5BA 1S7NA 4C68A 4CYPA 1YK3A 1VKCA 4MJ8A 1KUXA 1MJ9A 3PGPA 4MFJA 2WPXA 1BO4A 2PR8A 5EBVA 1S3ZA 4KOTA 5G20A 1ON0A 3VWEA 5AG6A 4HNYB 4QUSA 1V0CA 4U9YA 5IX3A 2WUUA 4MFLA 3F0AA 1KUVA 4KUBA 4CRYB 4NXYA 4XPDB 2OH1A 1YREA 2BEIA 2WPWA 4B14A 2Z10A 2Z0ZA 3TT2A 4H6ZA 4JXRA 4LUAA 1S5KA 5I0CA 4BMHA 2YNDA 5EC4A 2FCKA 1XF8A 2QECA 4XNHB 1QSMA 2OZGA 4FD4A 2HUZA 4R3KA 4KOXA 4C2ZA 2P6GA 2I00A 2ATRA 2JLMA 1M44A 5CNPA 5F46A 4OAEA 2Z3NA 3TTHA 2P6EA 4Y49C 4PK3A 1ZO0A 2O28A 3QB8A 4QVTA 1YVKA 5C88A 2QMLA 4KLVA 4AVAA 2KCWA 3R1KA 4AVBA 3LD2A 5IV0A 5AGEA 5DWNA 2Z3KA 4IUSA 4KSFA 2IL4A 4B11A 3D2MA 4HNWB 4L89A 5C82A 4MY0A 4R87A 3B8GA 4J3GA 4AG9A 1S7KA 3DR8A 3TO6A 4YFJA 3FIXA 2ZW4A 3I3GA 4JXQA 2Q44A 3P2FA 4C7IA 3D3SA 3LODA 1PUAA 4H89A 2BL1A 2R7HA 1IICA 1I12A 5AG7A 2G3TA 3DR6A 3FRMA 4II9A 4AVCA 4F6AA 5G1ZA 3CXSA 2VXKA 2FIAA 2DPSA 4LX9A 2VI7A 2X7BA 4X5KA 4AG7A 2BUEA 4ZGYB 5H86A 3IWGA 4C7HA 2AJ6A 4FD7A 3S6HA 3G8WA 1N71A 3TFYA 3TO7A 1MJAA 3FBUA 4R57A 5G21A 5E96A 4CAVA 5BWAB 2J8RA 4HKFA 2G0BA 3JTKA 2Q4YA 2CXAA 4K30A 1OZPA 4OADA 3TO9A 1B6BA 4MI4A 2PDOA 3BLNA 1M4GA 5A27A 3CXQA 3GY9A 2REFA 3S6FA 2FT0A 4FD6A 4M3SA 4GS4A 3K9UA 4QBJA 3SXNA 1S7FA 4MFPA 1R57A 4E0AA 3MGDA 5KTDA 2ZXVA 4A31A 3R95A 4E8OA 4CGNA 4IF5A 1QSOA 2VZYA 3IU2A 4UCPA 4UBRA 1Q2DA 4NF1A 3SXOA 1QSTA 3TE4A 3DDDA 2H5MA 4M85A 1QSNA 1MJBA 2JDDA 2OZUA 1L0CA 4QC6A 3RYOA 1PU9A 2CNMA 4UWIA 1S7LA 4B10A 4AB7A 5ISVA 3R9EA 3IGRA 1Z4EA 1YVOA 4NCZA 2FIWA 3JVNA 4PSWA 2R1IA 3S6KA 2Q0YA 1Y9WA 1Y7RA 3G3SA 4UFWA 2PSWA 4KOYA 4UFXA 1MK4A 3IU1A 4KZTA 3FNCA 4PV6A 4C2YA 4Q38A 4KVME 1XE4A 5JPHA 4BBHA 3C26A 3P2HA 4DNCA 1FY7A 4KSAA 1KZFA 3W6SA 1XEBA 5KTAA 4HNXB 2WSAA 2Z11A 4KOUA 2B58A 2NMTA 2B4BA 1S60A 2CY2A 1TIQA 2FL4A 3S6GA 1QSRA 4FD5A 4CYNA 2EUIA 5AG4A 2CNSA 2HV2A 2ZW6A 1Q2YA 5HH1A 3JUWA 1Z4RA 4Q36A 5F49A 1IB1E 1U6MA 2YGWA 1M4DA 1VHSA 2GANA 2Q4VA 4A2ZA 5G22A 3WR7A 1K4JA 2ZPAA 5HMNA 1IYLA 1YR0A 3SHPA 2VZZA 2OZHA 2OU2A 3R96A 2A4NA 3T90A 2FSRA 4JD6A 2AE6A 4MFZA 4H6UA 2J8NA 4F0YA 1Q2CA 4B12A 1BOBA 2Z3LA 4UFVA 2FS5A 3R9FA 1P0HA 4UCNA 4CAXA 3GKRA 2Y0MA 4KOVA 4NSQA 4ORFA 4PK2A 4YGOA 1WWZA 2JDCA 4B5PA 3UY5A 2PRBA 1XIXA 2R98A 3FB3A 1IYKA 3FYNA 4OLLA 1Y9KA 2PQ8A 1I21A 4MBUA 2FXFA 4A32A 4C2XA 2D4PA 3TOBA 1RXTA 1YX0A 4B5PB 4EVYA 1WK4A 2P6FA 4CYOA 1B87A 4KS9A 4F0XA 4I49A 4KOWA 2P0WA 2YNCC 4B5OA 2YNEA 4RI1A 3VWDA 2Z3MA 1P4NA 2K5TA 4PSXA 4E2AA 2Z3OA 1M4IA 4B13A 4XPDC 2VEZA 3DSBA 3KKWA 3BJ8A 4CAEA 3PZJA 5A28A 5KTCA 2Q04A 4KUAA 4XNHC 3FXTA 3GYAA 5GCNA 2OB0A 2C27A 1YLEA 4ZBGA 2ARHA 4KVXA 4U9ZA 3W6XA 3BJ7A 5IB0A 3N7ZA 4QB9A 4NEXA 1J4JA 5H84A 1NSLA 2CNTA 4YRHA 5J8CA 2VQYA 4A30A 4UWJA 5J8FA 3DNSA 4U5YA 3T9YA 4XPLA 4CGOA 1SQHA 4MFQA 3NE7A 4MY3A 3E0KA 1KUYA 3TCVA 3QAHA 4CGMA 4UCMA 1CJWA 3I9SA 4Y49B 4KORA 2Z3PA 2PR1A 5JQ4A 4MHDA 2I79A 2B5GA 3V8IA 3D8PA 4KLWA 2B3UA 2REEA 3ZJ0A 5FVJA 4CGLA 2GE3A 1LRZA 4CRZB 4CS0B 5F47A 4KVOE 1XMTA 4R9MA 1NMTA 4CAWA 3EY5A 4JJXA 4CYQA 1RO5A 2ZW5A 2B5GB 2FE7A 3D2PA 2VBQA 2ZW7A 5DWMA 1NE9A 3EO4A 1M1DA 2F5IA 2JEVA 3IWEA 4R3LA 2RC4A 4CGPA 2J8MA 2R8VA 1I1DA 2B3VA 1IIDA 2BSWA 1Z9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PC1 A;  2B4D A;  3R9G A;  4RS2 A;  4ONU A;  2DXQ A;  3EXN A;  3OWC A;  1UFH A;  4JLY A;  4XPK A;  4L8A A;  2G3A A;  2HQY A;  3EC4 A;  2D4O A;  3TOA A;  4UA3 A;  3PP9 A;  1CM0 A;  4KOS A;  3CXP A;  2Q7B A;  1YGH A;  3H4Q A;  2QIR A;  3EFA A;  2B4D B;  3W91 A;  2GIV A;  4JWP A;  5F48 A;  3ZZI A;  1GHE A;  2EVN A;  3F8K A;  3F5B A;  1S7N A;  1YK3 A;  1VKC A;  4MJ8 A;  1KUX A;  1MJ9 A;  3PGP A;  2WPX A;  1BO4 A;  2PR8 A;  5EBV A;  1S3Z A;  4KOT A;  1ON0 A;  3VWE A;  4HNY B;  4QUS A;  1V0C A;  4U9Y A;  5IX3 A;  3F0A A;  1KUV A;  4KUB A;  4CRY B;  4NXY A;  4XPD B;  2OH1 A;  1YRE A;  2BEI A;  2WPW A;  2Z10 A;  2Z0Z A;  3TT2 A;  4H6Z A;  4JXR A;  4LUA A;  1S5K A;  5I0C A;  4BMH A;  5EC4 A;  2FCK A;  1XF8 A;  2QEC A;  4XNH B;  1QSM A;  2OZG A;  4FD4 A;  2HUZ A;  4R3K A;  4KOX A;  2P6G A;  2I00 A;  2ATR A;  2JLM A;  1M44 A;  5CNP A;  5F46 A;  4OAE A;  3TTH A;  2P6E A;  4Y49 C;  4PK3 A;  2O28 A;  3QB8 A;  4QVT A;  5C88 A;  1YVK A;  2QML A;  4KLV A;  4AVA A;  2KCW A;  3R1K A;  4AVB A;  3LD2 A;  5IV0 A;  5DWN A;  4IUS A;  2IL4 A;  3D2M A;  4HNW B;  4L89 A;  5C82 A;  4MY0 A;  4R87 A;  3B8G A;  4J3G A;  4AG9 A;  1S7K A;  3DR8 A;  3TO6 A;  4YFJ A;  3FIX A;  2ZW4 A;  3I3G A;  4JXQ A;  2Q44 A;  3P2F A;  3D3S A;  3LOD A;  1PUA A;  4H89 A;  2BL1 A;  2R7H A;  1IIC A;  1I12 A;  2G3T A;  3DR6 A;  3FRM A;  4II9 A;  4AVC A;  4F6A A;  3CXS A;  2VXK A;  2FIA A;  4LX9 A;  2VI7 A;  2X7B A;  4X5K A;  4AG7 A;  2BUE A;  5H86 A;  3IWG A;  2AJ6 A;  4FD7 A;  3S6H A;  3G8W A;  1N71 A;  3TFY A;  3TO7 A;  1MJA A;  3FBU A;  4R57 A;  5E96 A;  4CAV A;  2J8R A;  4HKF A;  2G0B A;  2Q4Y A;  4K30 A;  1OZP A;  4OAD A;  3TO9 A;  1B6B A;  4MI4 A;  2PDO A;  3BLN A;  1M4G A;  3CXQ A;  3GY9 A;  2REF A;  3S6F A;  2FT0 A;  4FD6 A;  4M3S A;  4GS4 A;  3K9U A;  4QBJ A;  3SXN A;  1S7F A;  1R57 A;  4E0A A;  3MGD A;  5KTD A;  2ZXV A;  3R95 A;  4E8O A;  4IF5 A;  1QSO A;  2VZY A;  4UBR A;  1Q2D A;  4NF1 A;  3SXO A;  1QST A;  3TE4 A;  3DDD A;  2H5M A;  4M85 A;  1QSN A;  1MJB A;  2JDD A;  2OZU A;  1L0C A;  4QC6 A;  3RYO A;  1PU9 A;  2CNM A;  4UWI A;  1S7L A;  4AB7 A;  5ISV A;  3R9E A;  3IGR A;  1Z4E A;  1YVO A;  4NCZ A;  2FIW A;  3JVN A;  4PSW A;  2R1I A;  3S6K A;  2Q0Y A;  1Y9W A;  1Y7R A;  3G3S A;  2PSW A;  4KOY A;  1MK4 A;  4KZT A;  3FNC A;  4PV6 A;  4KVM E;  1XE4 A;  5JPH A;  3C26 A;  3P2H A;  4DNC A;  1FY7 A;  1KZF A;  3W6S A;  1XEB A;  5KTA A;  4HNX B;  2Z11 A;  4KOU A;  2B58 A;  2NMT A;  2B4B A;  1S60 A;  2CY2 A;  1TIQ A;  2FL4 A;  3S6G A;  1QSR A;  4FD5 A;  2EUI A;  2CNS A;  2HV2 A;  2ZW6 A;  1Q2Y A;  5HH1 A;  3JUW A;  1Z4R A;  5F49 A;  1IB1 E;  1U6M A;  1M4D A;  1VHS A;  2GAN A;  2Q4V A;  3WR7 A;  1K4J A;  2ZPA A;  5HMN A;  1IYL A;  1YR0 A;  3SHP A;  2VZZ A;  2OZH A;  2OU2 A;  3R96 A;  2A4N A;  3T90 A;  2FSR A;  4JD6 A;  2AE6 A;  4H6U A;  2J8N A;  4F0Y A;  1Q2C A;  1BOB A;  2FS5 A;  3R9F A;  1P0H A;  4CAX A;  3GKR A;  2Y0M A;  4KOV A;  4NSQ A;  4ORF A;  4PK2 A;  4YGO A;  1WWZ A;  2JDC A;  4B5P A;  3UY5 A;  2PRB A;  1XIX A;  2R98 A;  3FB3 A;  1IYK A;  3FYN A;  4OLL A;  1Y9K A;  2PQ8 A;  1I21 A;  4MBU A;  2FXF A;  2D4P A;  3TOB A;  1RXT A;  1YX0 A;  4B5P B;  4EVY A;  1WK4 A;  2P6F A;  1B87 A;  4I49 A;  4KOW A;  2P0W A;  4B5O A;  4RI1 A;  3VWD A;  1P4N A;  2K5T A;  4PSX A;  4E2A A;  1M4I A;  4XPD C;  2VEZ A;  3DSB A;  3KKW A;  3BJ8 A;  3PZJ A;  5KTC A;  2Q04 A;  4KUA A;  4XNH C;  3FXT A;  3GYA A;  5GCN A;  2OB0 A;  2C27 A;  1YLE A;  4ZBG A;  2ARH A;  4KVX A;  4U9Z A;  3W6X A;  3BJ7 A;  5IB0 A;  3N7Z A;  4QB9 A;  4NEX A;  1J4J A;  5H84 A;  1NSL A;  2CNT A;  4YRH A;  5J8C A;  2VQY A;  4UWJ A;  5J8F A;  3DNS A;  4U5Y A;  3T9Y A;  4XPL A;  1SQH A;  3NE7 A;  4MY3 A;  3E0K A;  1KUY A;  3TCV A;  3QAH A;  1CJW A;  3I9S A;  4Y49 B;  4KOR A;  2PR1 A;  5JQ4 A;  4MHD A;  2I79 A;  2B5G A;  3V8I A;  3D8P A;  4KLW A;  2B3U A;  2REE A;  3ZJ0 A;  5FVJ A;  2GE3 A;  1LRZ A;  4CRZ B;  4CS0 B;  5F47 A;  4KVO E;  1XMT A;  4R9M A;  1NMT A;  4CAW A;  3EY5 A;  4JJX A;  1RO5 A;  2ZW5 A;  2B5G B;  2FE7 A;  3D2P A;  2VBQ A;  2ZW7 A;  5DWM A;  1NE9 A;  3EO4 A;  1M1D A;  2F5I A;  2JEV A;  4R3L A;  2RC4 A;  2J8M A;  2R8V A;  1I1D A;  2B3V A;  1IID A;  2BSW A;  1Z9U A; 
#chains in the Genus database with same CATH topology
 1YW6 A;  2PC1 A;  3KQX A;  4A95 A;  2C6G A;  2B4D A;  4UIA A;  3R9G A;  4RS2 A;  4NJQ A;  4CAF A;  4ONU A;  4DUK A;  2DXQ A;  3EXN A;  3OWC A;  1UFH A;  4P10 A;  4JLY A;  4ONW A;  4L8A A;  2ZEH A;  4XPK A;  1TXR A;  5LYI A;  1HEE A;  5AG5 A;  2G3A A;  2DPT A;  2HQY A;  3EC4 A;  4W9Y A;  2D4O A;  4DYO A;  3D7H A;  4R76 A;  4UA3 A;  2Q4Z A;  3TOA A;  3GIU A;  4MFK A;  2Q51 A;  3PP9 A;  4MCR A;  1CM0 A;  2AFS A;  4KOS A;  4DJL A;  2YNC A;  2V8H A;  3CXP A;  2Q7B A;  1YGH A;  3H4Q A;  2QIR A;  5IB9 A;  4NGQ A;  3EFA A;  2B4D B;  3W91 A;  2NYQ A;  3A9L A;  2GIV A;  2O4H A;  4JWP A;  5F48 A;  3ZZI A;  4A33 A;  1GHE A;  3H5Z A;  1YLO A;  4MHY A;  4UIB A;  4FAI A;  1TKF A;  1TF9 A;  2PJ3 A;  3NH5 A;  2EVN A;  3F8K A;  3PB9 X;  4ZYQ A;  3F5B A;  1S7N A;  3KQZ A;  4C68 A;  4CYP A;  1YK3 A;  4R6T A;  1VKC A;  2G9D A;  2ZEO A;  3D4U A;  1ELM P;  1KUX A;  1MJ9 A;  4MJ8 A;  1LAP A;  3PGP A;  1XFO A;  3D67 A;  2WPX A;  1BO4 A;  1OBR A;  2PR8 A;  1GYT A;  1S3Z A;  2PIZ A;  4M6G A;  4MFJ A;  5EBV A;  4KOT A;  3SJX A;  1BLL E;  4TNU A;  5G20 A;  7CPA A;  1DTD A;  2PJB A;  1ON0 A;  3VWE A;  4P4F A;  2OOT A;  5AG6 A;  4HNY B;  1IU8 A;  3FJU A;  4QUS A;  2AFU A;  4UEF A;  1V0C A;  1VGY A;  4U9Y A;  5IX3 A;  3QNV A;  4WWV A;  1Y0R A;  2WUU A;  2J9A A;  4MFL A;  5K8P A;  2C1C A;  3F0A A;  1KUV A;  3MN8 A;  4JYW A;  3WT4 A;  3RO0 A;  3WC7 A;  1VHE A;  2C6P A;  3NFZ A;  4KUB A;  4MHZ A;  4CRY B;  2V77 A;  4QVT A;  4NXY A;  4MMO A;  4XPD B;  2IMO A;  1YRE A;  2OH1 A;  2BEI A;  2WPW A;  4OC5 A;  4P4I A;  4B14 A;  2Z10 A;  2PCU A;  2Z0Z A;  3TT2 A;  4H6Z A;  4JXR A;  4LUA A;  2QVP A;  1S5K A;  4X8I A;  5I0C A;  4NGP A;  2GFQ A;  2YND A;  3D7D A;  4NGR A;  4BMH A;  5EC4 A;  2FCK A;  1XF8 A;  2QEC A;  4UEE A;  4XNH B;  1QSM A;  2OZG A;  4FD4 A;  2HUZ A;  1Z5R A;  2PJC A;  4IHM A;  4R3K A;  4MCS A;  1FNO A;  2VL1 A;  4GM5 A;  5DS0 A;  4Q7A A;  4KOX A;  4C2Z A;  3B3S A;  2P6G A;  1TF8 A;  2I00 A;  1IOI A;  2ATR A;  2JLM A;  1M44 A;  3K9T A;  5CNP A;  4AXV A;  4F8Z A;  5F46 A;  4OAE A;  1BPM A;  2Z3N A;  3TTH A;  2P6E A;  3FVL A;  3PB4 X;  4Y49 C;  2BO9 A;  1VIX A;  2O53 A;  4PK3 A;  2O28 A;  1IGB A;  1ZO0 A;  1F57 A;  1ARM A;  1YVK A;  3QB8 A;  2QML A;  2V8V A;  2PIY A;  2PRQ A;  4KLV A;  4AVA A;  5K8O A;  2PJ1 A;  2KCW A;  3R1K A;  4AVB A;  3LD2 A;  5IV0 A;  1LCP A;  3HLP A;  5AGE A;  2Z3K A;  4IUS A;  1M4L A;  4KSF A;  5DWN A;  4RUH A;  2IL4 A;  4B11 A;  5K8M A;  3BHX A;  2OR4 A;  2HC9 A;  1YQE A;  3D2M A;  3MRU A;  2PE3 A;  4HNW B;  4L89 A;  5C82 A;  4MY0 A;  3FED A;  5I4M A;  4OC3 A;  4R87 A;  3B8G A;  4UF4 A;  2CF4 A;  2PJ8 A;  4J3G A;  4AG9 A;  1S7K A;  3NH4 A;  3KHX A;  3DR8 A;  3TO6 A;  5C88 A;  3KHZ A;  2GU2 A;  3FEC A;  2C6C A;  4YFJ A;  1A2Z A;  2GLF A;  2ZW4 A;  3FIX A;  3I3G A;  4JXQ A;  2Q44 A;  2V8D A;  1Y7E A;  3P2F A;  2ODF A;  4C7I A;  3D3S A;  3LOD A;  1PUA A;  2QJ8 A;  4H89 A;  2BL1 A;  2R7H A;  1IIC A;  1I12 A;  2CTC A;  1Z8L A;  3NA6 A;  5AG7 A;  2G3T A;  2PJ5 A;  3DR6 A;  3FRM A;  2XEG A;  4O23 A;  4II9 A;  5D8N A;  4P4D A;  4AVC A;  4F6A A;  5G1Z A;  4FUU A;  3CXS A;  2VXK A;  2RB7 A;  2FIA A;  2XEI A;  2ZEN A;  2DPS A;  4LX9 A;  4PXB A;  2VI7 A;  2X7B A;  4BIN A;  4X5K A;  4AG7 A;  2BUE A;  4ZGY B;  5H86 A;  2V8G A;  3S9L A;  1TKH A;  3IWG A;  3JRU A;  4C7H A;  2AJ6 A;  4FD7 A;  5F09 A;  3FX6 A;  3S6H A;  4F9V A;  1Z2L A;  3G8W A;  4MXU A;  3CDX A;  4EWT A;  5HVG A;  1HDQ A;  1N71 A;  5K8N A;  1ELL P;  1UWY A;  1CX8 A;  3TFY A;  1AYE A;  3KR4 A;  3TO7 A;  1MJA A;  3FBU A;  4R57 A;  2FVG A;  4WJB A;  5G21 A;  1LAM A;  5E96 A;  3DLJ A;  2PVW A;  4CAV A;  5BWA B;  3PFO A;  2J8R A;  4HKF A;  2G0B A;  3IWW A;  5LRG A;  2NSM A;  3JTK A;  2Q4Y A;  2CXA A;  4K30 A;  1OZP A;  1QQ9 A;  4OAD A;  2BOA A;  3TO9 A;  4P4J A;  1B6B A;  2XEF A;  4MI4 A;  4UEZ A;  4M6H A;  2PDO A;  3BLN A;  1M4G A;  5A27 A;  3B3V A;  3CXQ A;  4OC0 A;  3GY9 A;  2REF A;  3CT9 A;  3PBE A;  3S6F A;  4OME A;  2FT0 A;  4FD6 A;  4M3S A;  4ZY2 A;  1CP7 A;  1Z8X A;  4OID A;  4GS4 A;  2BCO A;  3K9U A;  2PJ7 A;  2ZEF A;  2ZEL A;  3SXN A;  4QBJ A;  1S7F A;  3L2N A;  1R57 A;  1X12 A;  1XBU A;  2EK9 A;  4MFP A;  4E0A A;  1ARL A;  1Z8T A;  3MGD A;  2WYR A;  3NH8 A;  2ZXV A;  5KTD A;  4A31 A;  5CPA A;  3R95 A;  4FBE A;  4ZY0 A;  4E8O A;  2PVV A;  4CGN A;  4IF5 A;  3IFE A;  4NGN A;  1F2P A;  4PPZ A;  1QSO A;  2VZY A;  3IU2 A;  4UCP A;  2PJ2 A;  3LAC A;  4UBR A;  3PRT A;  1Q2D A;  4NF1 A;  3SXO A;  1QST A;  2AFZ A;  3TE4 A;  1LOK A;  3PEI A;  3DDD A;  2H5M A;  4M85 A;  1QSN A;  1MJB A;  2JDD A;  3KR5 A;  4M6I A;  2DEA A;  4G1P A;  3B3W A;  2AFW A;  1XRY A;  2OZU A;  4R7M A;  1L0C A;  4QC6 A;  3RYO A;  1PU9 A;  2CNM A;  4UWI A;  1S7L A;  1ZLI A;  2AFM A;  3SI0 A;  4B10 A;  2JBK A;  4AB7 A;  5ISV A;  1EE3 P;  5LRJ A;  3R9E A;  3IGR A;  1Z4E A;  1YVO A;  4NCZ A;  1Y0Y A;  2FIW A;  3JVN A;  4X3R A;  4PSW A;  2R1I A;  3S6K A;  2Q0Y A;  1Y9W A;  2EO8 A;  1LFW A;  1Y7R A;  3G3S A;  4UFW A;  2PSW A;  4KOY A;  4UFX A;  1MK4 A;  3ISX A;  1R43 A;  3H8E A;  3IEH A;  3IU1 A;  2XEJ A;  3IJ3 A;  4KZT A;  3FNC A;  4PV6 A;  3IO1 A;  1CG2 A;  1XOV A;  1Q7L A;  2ABZ A;  3FMC A;  4OC1 A;  3HUV A;  4C2Y A;  5HXD A;  1DE4 C;  4Q38 A;  1NSA A;  1YW4 A;  3KGQ A;  4KVM E;  4TWE A;  1XE4 A;  3NE8 A;  3GUX A;  3D66 A;  1R3N A;  5JPH A;  4BBH A;  3C26 A;  4ZY1 A;  2ZED A;  3P2H A;  2ZEG A;  3QAY A;  4DNC A;  1FY7 A;  2CTB A;  5JGF A;  1X10 A;  4KSA A;  4MCP A;  1KZF A;  4OIW A;  3W6S A;  1XEB A;  1YME A;  3VAR A;  4HNX B;  5KTA A;  2WSA A;  2Z11 A;  4KOU A;  2B58 A;  2NMT A;  2B4B A;  1S60 A;  2CY2 A;  4A39 A;  1TIQ A;  2FL4 A;  3FEE A;  3S6G A;  4IK2 A;  1QSR A;  4FD5 A;  1FT7 A;  4CYN A;  2EUI A;  5AG4 A;  3H8G A;  2CNS A;  2HV2 A;  2ZW6 A;  1ZG9 A;  1Q2Y A;  2PJA A;  1CPS A;  2PJ4 A;  5HH1 A;  1YSJ A;  3FH4 A;  3JUW A;  4PXD A;  4ZX9 A;  4NFR A;  1Z4R A;  4OKO A;  4Q36 A;  4YU9 A;  5F49 A;  1CBX A;  5ELY A;  3WAB A;  3WC5 A;  4CPA A;  1IB1 E;  1U6M A;  2ZEE A;  2YGW A;  1XMB A;  4MHP A;  1M4D A;  1LAN A;  1VHS A;  2GAN A;  2Q4V A;  2ZEM A;  4A2Z A;  5G22 A;  3WR7 A;  5LYD A;  1K4J A;  4BD9 A;  2ZPA A;  3D68 A;  2ZEP A;  5HMN A;  1IYL A;  1PYT B;  1YR0 A;  3IC1 A;  3SHP A;  1ZG8 A;  4NGS A;  2VZZ A;  2OZH A;  2OU2 A;  4PXC A;  4P44 A;  2A4N A;  4OC4 A;  3R96 A;  2FSR A;  4JD6 A;  3T90 A;  4Z65 A;  2PJ6 A;  2AE6 A;  4MFZ A;  4MCQ A;  4H6U A;  2J8N A;  3CPX A;  4F0Y A;  2JEW A;  3RZA A;  1Q2C A;  4B12 A;  3K2K A;  1BOB A;  2Z3L A;  4UFV A;  2RFH A;  2FS5 A;  3R9F A;  3D7G A;  1P0H A;  4JZ0 A;  4UCN A;  3SJE A;  4CAX A;  3GKR A;  5LRK A;  2Y0M A;  5THW A;  3T8W A;  4KOV A;  4NSQ A;  2AFO A;  4ORF A;  4PK2 A;  4YGO A;  3V38 A;  1WWZ A;  2JDC A;  4B5P A;  4K3N A;  3CZX A;  3KAS A;  3UY5 A;  3S9M A;  4EFD A;  2PRB A;  1XIX A;  2GRE A;  2R98 A;  3FB3 A;  3N5F A;  3VH9 A;  2EBJ A;  6CPA A;  1IYK A;  3FYN A;  4OLL A;  1Y9K A;  2PQ8 A;  1I21 A;  3ISZ A;  4MBU A;  2QYV A;  2ZOG A;  2FXF A;  3PB8 X;  4A32 A;  5JM6 A;  3GB0 A;  3TX8 A;  4YWY A;  3IIB A;  4C2X A;  4ZX8 A;  2D4P A;  1KWM A;  3TOB A;  3D7F A;  1RXT A;  2WZN A;  5LYL A;  1YX0 A;  4B5P B;  4EVY A;  3PBB A;  2EWB A;  3SI1 A;  3PB6 X;  3DGV A;  1WK4 A;  2P6F A;  4CYO A;  1B87 A;  4KS9 A;  4F0X A;  4I49 A;  3KI9 A;  2P0W A;  2YNC C;  4KOW A;  4B5O A;  3LWU A;  2YNE A;  3B7I A;  4RI1 A;  3VWD A;  2Z3M A;  4ZI6 A;  3S9N A;  1P4N A;  1PCA A;  4GXH A;  4PXE A;  2K5T A;  3B3T A;  3H8F A;  2Q43 A;  3FF3 A;  4PSX A;  4PQA A;  5HVF A;  3KL9 A;  2IQ6 A;  3B35 A;  2Z3O A;  4E2A A;  1CP6 A;  3RNZ A;  4X2T A;  1M4I A;  4B13 A;  3I1U A;  4A37 A;  1BPN A;  4XPD C;  4R8F A;  4OC2 A;  2VEZ A;  3DSB A;  4H2K A;  4B6Z A;  5JH9 A;  3KKW A;  3BJ8 A;  4CAE A;  3PZJ A;  5A28 A;  5LYF A;  5KTC A;  8CPA A;  2Q04 A;  4KUA A;  2POK A;  3BXM A;  4XNH C;  3FXT A;  3SJG A;  3GYA A;  3SJF A;  1F2O A;  5D29 A;  5GCN A;  2ZOF A;  4LQ6 A;  4P4E A;  1CPX A;  2OB0 A;  3SI2 A;  1VHO A;  1AMP A;  4NJR A;  2C27 A;  2F7V A;  1YLE A;  2F8H A;  4ZBG A;  3VAT A;  2ARH A;  4KVX A;  4U9Z A;  3W6X A;  3BJ7 A;  5HVH A;  5IB0 A;  3N7Z A;  5EMI A;  2GLJ A;  4QB9 A;  3BI0 A;  4OP4 A;  3PFE A;  1TKJ A;  4NEX A;  2PJ0 A;  1J4J A;  5H84 A;  1NSL A;  2CNT A;  4YRH A;  1ZG7 A;  5J8C A;  4A38 A;  2VQY A;  4MHN A;  4UWJ A;  4A30 A;  5J8F A;  3DNS A;  4U5Y A;  3T9Y A;  3WC6 A;  1HDU A;  5J1Q A;  4RN7 A;  1ZLH A;  4XPL A;  2Q7S A;  4NGT A;  4CGO A;  4NGM A;  1SQH A;  3BI1 A;  4MFQ A;  3NE7 A;  4MY3 A;  1JWQ A;  3E0K A;  1KUY A;  1IOF A;  3TCV A;  3QAH A;  4CGM A;  4UCM A;  1CJW A;  3I9S A;  4Y49 B;  4KOR A;  5CBM A;  4LQG A;  1Z8W A;  2PR1 A;  2Z3P A;  4HPS A;  5JQ4 A;  4MHD A;  1IY7 A;  3RBU A;  3V7Z A;  3GLJ A;  2I79 A;  2AFX A;  3CPA A;  3TC8 A;  3KZW A;  2B5G A;  2JBJ A;  4FWU A;  3PB7 X;  3V8I A;  1BAV A;  3D8P A;  4KSI A;  4KLW A;  1JQG A;  2B3U A;  2REE A;  3ZJ0 A;  4A94 A;  2DF5 A;  5FVJ A;  2GE3 A;  4CGL A;  1H8L A;  1LRZ A;  4P6Y A;  4MRI A;  4CRZ B;  4CS0 B;  5F47 A;  2I3C A;  4KVO E;  2IJZ A;  1XMT A;  4IAV A;  4R9M A;  1NMT A;  3LMS A;  4P45 A;  4CAW A;  2PJ9 A;  3EY5 A;  4JJX A;  4CYQ A;  2HB6 A;  1RO5 A;  1QMU A;  2ZW5 A;  2ANP A;  2FE7 A;  2B5G B;  3D2P A;  2VBQ A;  2ZW7 A;  1XJO A;  5DWM A;  2EK8 A;  1NE9 A;  2CIJ A;  3EO4 A;  1M1D A;  4F9U A;  4EME A;  1AUG A;  3B2Y A;  2F5I A;  4P4B A;  2JEV A;  3IWE A;  4R3L A;  2RC4 A;  4CGP A;  2J8M A;  2R8V A;  3RAM A;  3B3C A;  1I1D A;  2B3V A;  1RTQ A;  1IID A;  2BSW A;  1Z9U A; 
#chains in the Genus database with same CATH homology
 2PC1 A;  4A95 A;  2B4D A;  4CAF A;  3R9G A;  4RS2 A;  4ONU A;  2DXQ A;  3EXN A;  3OWC A;  1UFH A;  4JLY A;  4XPK A;  4L8A A;  5AG5 A;  2G3A A;  2DPT A;  2HQY A;  3EC4 A;  2D4O A;  3TOA A;  4UA3 A;  4MFK A;  3PP9 A;  1CM0 A;  4KOS A;  2YNC A;  3CXP A;  2Q7B A;  1YGH A;  3H4Q A;  2QIR A;  3EFA A;  2B4D B;  3W91 A;  3A9L A;  2GIV A;  4JWP A;  5F48 A;  3ZZI A;  4A33 A;  1GHE A;  3H5Z A;  2EVN A;  3F8K A;  3F5B A;  1S7N A;  4C68 A;  4CYP A;  1YK3 A;  1VKC A;  4MJ8 A;  1KUX A;  1MJ9 A;  3PGP A;  4MFJ A;  2WPX A;  1BO4 A;  2PR8 A;  5EBV A;  1S3Z A;  4KOT A;  5G20 A;  1ON0 A;  3VWE A;  5AG6 A;  4HNY B;  4QUS A;  1V0C A;  4U9Y A;  5IX3 A;  2WUU A;  4MFL A;  3F0A A;  1KUV A;  4KUB A;  4CRY B;  4NXY A;  4XPD B;  2OH1 A;  1YRE A;  2BEI A;  2WPW A;  4B14 A;  2Z10 A;  2Z0Z A;  3TT2 A;  4H6Z A;  4JXR A;  4LUA A;  1S5K A;  5I0C A;  4BMH A;  2YND A;  5EC4 A;  2FCK A;  1XF8 A;  2QEC A;  4XNH B;  1QSM A;  2OZG A;  4FD4 A;  2HUZ A;  4R3K A;  4KOX A;  4C2Z A;  2P6G A;  2I00 A;  2ATR A;  2JLM A;  1M44 A;  5CNP A;  5F46 A;  4OAE A;  2Z3N A;  3TTH A;  2P6E A;  4Y49 C;  4PK3 A;  1ZO0 A;  2O28 A;  3QB8 A;  4QVT A;  1YVK A;  5C88 A;  2QML A;  4KLV A;  4AVA A;  2KCW A;  3R1K A;  4AVB A;  3LD2 A;  5IV0 A;  5AGE A;  5DWN A;  2Z3K A;  4IUS A;  4KSF A;  2IL4 A;  4B11 A;  3D2M A;  4HNW B;  4L89 A;  5C82 A;  4MY0 A;  4R87 A;  3B8G A;  4J3G A;  4AG9 A;  1S7K A;  3DR8 A;  3TO6 A;  4YFJ A;  3FIX A;  2ZW4 A;  3I3G A;  4JXQ A;  2Q44 A;  3P2F A;  4C7I A;  3D3S A;  3LOD A;  1PUA A;  4H89 A;  2BL1 A;  2R7H A;  1IIC A;  1I12 A;  5AG7 A;  2G3T A;  3DR6 A;  3FRM A;  4II9 A;  4AVC A;  4F6A A;  5G1Z A;  3CXS A;  2VXK A;  2FIA A;  2DPS A;  4LX9 A;  2VI7 A;  2X7B A;  4X5K A;  4AG7 A;  2BUE A;  4ZGY B;  5H86 A;  3IWG A;  4C7H A;  2AJ6 A;  4FD7 A;  3S6H A;  3G8W A;  1N71 A;  3TFY A;  3TO7 A;  1MJA A;  3FBU A;  4R57 A;  5G21 A;  5E96 A;  4CAV A;  5BWA B;  2J8R A;  4HKF A;  2G0B A;  3JTK A;  2Q4Y A;  2CXA A;  4K30 A;  1OZP A;  4OAD A;  3TO9 A;  1B6B A;  4MI4 A;  2PDO A;  3BLN A;  1M4G A;  5A27 A;  3CXQ A;  3GY9 A;  2REF A;  3S6F A;  2FT0 A;  4FD6 A;  4M3S A;  4GS4 A;  3K9U A;  4QBJ A;  3SXN A;  1S7F A;  4MFP A;  1R57 A;  4E0A A;  3MGD A;  5KTD A;  2ZXV A;  4A31 A;  3R95 A;  4E8O A;  4CGN A;  4IF5 A;  1QSO A;  2VZY A;  3IU2 A;  4UCP A;  4UBR A;  1Q2D A;  4NF1 A;  3SXO A;  1QST A;  3TE4 A;  3DDD A;  2H5M A;  4M85 A;  1QSN A;  1MJB A;  2JDD A;  2OZU A;  1L0C A;  4QC6 A;  3RYO A;  1PU9 A;  2CNM A;  4UWI A;  1S7L A;  4B10 A;  4AB7 A;  5ISV A;  3R9E A;  3IGR A;  1Z4E A;  1YVO A;  4NCZ A;  2FIW A;  3JVN A;  4PSW A;  2R1I A;  3S6K A;  2Q0Y A;  1Y9W A;  1Y7R A;  3G3S A;  4UFW A;  2PSW A;  4KOY A;  4UFX A;  1MK4 A;  3IU1 A;  4KZT A;  3FNC A;  4PV6 A;  4C2Y A;  4Q38 A;  4KVM E;  1XE4 A;  5JPH A;  4BBH A;  3C26 A;  3P2H A;  4DNC A;  1FY7 A;  4KSA A;  1KZF A;  3W6S A;  1XEB A;  5KTA A;  4HNX B;  2WSA A;  2Z11 A;  4KOU A;  2B58 A;  2NMT A;  2B4B A;  1S60 A;  2CY2 A;  1TIQ A;  2FL4 A;  3S6G A;  1QSR A;  4FD5 A;  4CYN A;  2EUI A;  5AG4 A;  2CNS A;  2HV2 A;  2ZW6 A;  1Q2Y A;  5HH1 A;  3JUW A;  1Z4R A;  4Q36 A;  5F49 A;  1IB1 E;  1U6M A;  2YGW A;  1M4D A;  1VHS A;  2GAN A;  2Q4V A;  4A2Z A;  5G22 A;  3WR7 A;  1K4J A;  2ZPA A;  5HMN A;  1IYL A;  1YR0 A;  3SHP A;  2VZZ A;  2OZH A;  2OU2 A;  3R96 A;  2A4N A;  3T90 A;  2FSR A;  4JD6 A;  2AE6 A;  4MFZ A;  4H6U A;  2J8N A;  4F0Y A;  1Q2C A;  4B12 A;  1BOB A;  2Z3L A;  4UFV A;  2FS5 A;  3R9F A;  1P0H A;  4UCN A;  4CAX A;  3GKR A;  2Y0M A;  4KOV A;  4NSQ A;  4ORF A;  4PK2 A;  4YGO A;  1WWZ A;  2JDC A;  4B5P A;  3UY5 A;  2PRB A;  1XIX A;  2R98 A;  3FB3 A;  1IYK A;  3FYN A;  4OLL A;  1Y9K A;  2PQ8 A;  1I21 A;  4MBU A;  2FXF A;  4A32 A;  4C2X A;  2D4P A;  3TOB A;  1RXT A;  1YX0 A;  4B5P B;  4EVY A;  1WK4 A;  2P6F A;  4CYO A;  1B87 A;  4KS9 A;  4F0X A;  4I49 A;  4KOW A;  2P0W A;  2YNC C;  4B5O A;  2YNE A;  4RI1 A;  3VWD A;  2Z3M A;  1P4N A;  2K5T A;  4PSX A;  4E2A A;  2Z3O A;  1M4I A;  4B13 A;  4XPD C;  2VEZ A;  3DSB A;  3KKW A;  3BJ8 A;  4CAE A;  3PZJ A;  5A28 A;  5KTC A;  2Q04 A;  4KUA A;  4XNH C;  3FXT A;  3GYA A;  5GCN A;  2OB0 A;  2C27 A;  1YLE A;  4ZBG A;  2ARH A;  4KVX A;  4U9Z A;  3W6X A;  3BJ7 A;  5IB0 A;  3N7Z A;  4QB9 A;  4NEX A;  1J4J A;  5H84 A;  1NSL A;  2CNT A;  4YRH A;  5J8C A;  2VQY A;  4A30 A;  4UWJ A;  5J8F A;  3DNS A;  4U5Y A;  3T9Y A;  4XPL A;  4CGO A;  1SQH A;  4MFQ A;  3NE7 A;  4MY3 A;  3E0K A;  1KUY A;  3TCV A;  3QAH A;  4CGM A;  4UCM A;  1CJW A;  3I9S A;  4Y49 B;  4KOR A;  2Z3P A;  2PR1 A;  5JQ4 A;  4MHD A;  2I79 A;  2B5G A;  3V8I A;  3D8P A;  4KLW A;  2B3U A;  2REE A;  3ZJ0 A;  5FVJ A;  4CGL A;  2GE3 A;  1LRZ A;  4CRZ B;  4CS0 B;  5F47 A;  4KVO E;  1XMT A;  4R9M A;  1NMT A;  4CAW A;  3EY5 A;  4JJX A;  4CYQ A;  1RO5 A;  2ZW5 A;  2B5G B;  2FE7 A;  3D2P A;  2VBQ A;  2ZW7 A;  5DWM A;  1NE9 A;  3EO4 A;  1M1D A;  2F5I A;  2JEV A;  3IWE A;  4R3L A;  2RC4 A;  4CGP A;  2J8M A;  2R8V A;  1I1D A;  2B3V A;  1IID A;  2BSW A;  1Z9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...