1I21A

Crystal structure of yeast gna1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
158
structure length
155
Chain Sequence
MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFCKLIKYWNEATVWNDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSNAGVEMQIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structures of Apo and complexed Saccharomyces cerevisiae GNA1 shed light on the catalytic mechanism of an amino-sugar N-acetyltransferase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
total genus 38
structure length 155
sequence length 158
chains with identical sequence B, M, N, X, Y
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2001-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1i21A00
1QSMA 1U6MA 1XEBA 4CRZB 1QSOA 1P0HA 1S7NA 4HKFA 2CNTA 1IICA 2FL4A 3DR6A 2DXQA 2VQYA 5F46A 2BL1A 4JLYA 4H89A 2HQYA 2B3UA 3R9EA 4ZBGA 1M44A 4MBUA 3R95A 3EY5A 1MJAA 4KVOE 1I21A 5F48A 1TIQA 4L8AA 4MY3A 5J8CA 3F8KA 3F0AA 2PR8A 4L89A 2Q4YA 2OB0A 4MI4A 3F5BA 3QB8A 4KVXA 2BEIA 2Q4VA 4J3GA 4OAEA 2R98A 3GKRA 1B6BA 4AVAA 2PQ8A 1PUAA 4DNCA 5IX3A 3TOBA 5EBVA 4KOUA 2VZYA 3TFYA 2CNSA 4OLLA 3B8GA 2Y0MA 4QBJA 1Q2DA 3NE7A 4U5YA 4R57A 5GCNA 1MK4A 5H84A 5HMNA 2I79A 1NMTA 4KUBA 3W6SA 4NEXA 2R1IA 2F5IA 3FNCA 4KOYA 2C27A 2HUZA 1YVOA 2VZZA 3CXPA 4Y49B 3OWCA 2O28A 1LRZA 5EC4A 1CJWA 2P6FA 3R9GA 2PC1A 3W6XA 2REFA 3TO7A 4II9A 1M1DA 4NF1A 1Y9WA 4IUSA 3MGDA 1VHSA 1NSLA 1RXTA 4IF5A 4H6ZA 3I9SA 1Q2YA 3RYOA 5KTAA 1R57A 3S6GA 3VWDA 1OZPA 2GE3A 3LODA 2P6EA 1ON0A 4CRYB 1Z4EA 3TO9A 1S7LA 5FVJA 2BUEA 3TT2A 4EVYA 4UBRA 2VEZA 4KLWA 1YREA 2ZW5A 2OZHA 2OZGA 5DWNA 1J4JA 3N7ZA 2CY2A 2PRBA 2WPXA 4KLVA 4UWIA 2X7BA 3SXOA 1M4IA 3D8PA 1B87A 2B58A 3S6KA 3EXNA 3FIXA 3FBUA 2R7HA 3T9YA 3EFAA 3JVNA 4KZTA 2ZW6A 3E0KA 3H4QA 4R9MA 5JQ4A 4KOSA 4I49A 4E2AA 1YLEA 2P6GA 2FE7A 4PV6A 1MJBA 3FXTA 3ZJ0A 1S7FA 1QSRA 1KZFA 2QECA 4MHDA 2FSRA 1WK4A 1S5KA 4KOVA 4Y49C 2JDDA 3G3SA 1I1DA 2D4OA 4NXYA 3PGPA 2JLMA 3V8IA 4AG9A 2J8RA 2RC4A 4HNYB 3D2MA 4HNXB 1Z4RA 4MJ8A 4QVTA 2Z0ZA 2GIVA 2JEVA 3KKWA 2A4NA 3W91A 1KUXA 4LX9A 3G8WA 5J8FA 3DSBA 4KOTA 1M4DA 2KCWA 4MY0A 2IL4A 1V0CA 2G0BA 1S3ZA 1YR0A 2B4BA 3DR8A 4FD4A 3R96A 1XF8A 1BOBA 4XPDC 2HV2A 2PSWA 2B5GA 3S6HA 5IB0A 2B3VA 5JPHA 3LD2A 4PK3A 4H6UA 1YVKA 2R8VA 4PSXA 4XPLA 1MJ9A 2AJ6A 4XNHC 2FIWA 4RS2A 3BJ7A 4NSQA 4AB7A 3UY5A 3TOAA 5C82A 3TE4A 2H5MA 3BJ8A 2Q0YA 4K30A 1Z9UA 2J8NA 3TCVA 5KTDA 4U9ZA 5ISVA 3FYNA 4FD7A 1CM0A 2FXFA 2J8MA 2JDCA 3SXNA 3DNSA 2PDOA 4XPKA 2PR1A 4ONUA 3R9FA 2Q04A 4PSWA 4XNHB 1Y9KA 4KOWA 1UFHA 2OU2A 1IYLA 2ZXVA 3PP9A 2Q7BA 2EUIA 2VI7A 2Q44A 4F0YA 4NCZA 4QB9A 4PK2A 4U9YA 3FB3A 2ZPAA 1K4JA 1S7KA 4OADA 1IB1E 1YGHA 2FCKA 3GY9A 3IWGA 4XPDB 4KORA 3SHPA 5I0CA 2WPWA 4CAXA 4X5KA 3EC4A 3C26A 1WWZA 4B5OA 1N71A 2Z10A 1YK3A 4KUAA 3I3GA 2NMTA 4B5PB 1Y7RA 2ARHA 4ORFA 4JXQA 3CXQA 1KUVA 3VWEA 2K5TA 1PU9A 1IYKA 2B4DA 4HNWB 5IV0A 5E96A 2BSWA 4AG7A 4BMHA 1I12A 3P2HA 2B5GB 2REEA 2VXKA 3BLNA 3TO6A 4JWPA 3S6FA 5H86A 4M85A 4R87A 2VBQA 1IIDA 2G3AA 5C88A 3DDDA 3D2PA 2QMLA 3TTHA 3PZJA 3T90A 2ZW4A 1Q2CA 2ZW7A 2P0WA 4FD6A 4YGOA 4KOXA 1XIXA 2OZUA 4RI1A 1XE4A 1QSTA 4QC6A 4CS0B 1YX0A 1XMTA 3WR7A 1SQHA 4JXRA 4F6AA 1RO5A 4JD6A 4B5PA 2GANA 2FT0A 2FS5A 3JUWA 1VKCA 3ZZIA 1BO4A 1QSNA 1P4NA 2EVNA 3EO4A 2FIAA 2Z11A 2CNMA 5F49A 1FY7A 1KUYA 3IGRA 2I00A 5DWMA 4M3SA 4AVCA 4UA3A 3K9UA 2B4DB 4KVME 5F47A 1M4GA 4AVBA 3CXSA 2AE6A 4R3KA 3GYAA 2OH1A 3QAHA 3D3SA 3R1KA 5HH1A 5KTCA 2D4PA 4CAWA 2ATRA 1L0CA 4FD5A 2QIRA 4QUSA 4LUAA 4E0AA 1S60A 4YFJA 4R3LA 4GS4A 4E8OA 4CAVA 4JJXA 1GHEA 1NE9A 4UWJA 5CNPA 4YRHA 3FRMA 2G3TA 3P2FA
chains in the Genus database with same CATH superfamily
1QSMA 1U6MA 1X10A 1XEBA 4CRZB 1QSOA 5HVGA 2V8DA 5I4MA 3D7FA 1P0HA 3CT9A 2POKA 1S7NA 4HKFA 2CNTA 1IICA 2FL4A 3DR6A 2DXQA 2VQYA 5F46A 2BL1A 2DEAA 1ELLP 1PCAA 4MFPA 2Q7SA 3B3WA 4JLYA 3QAYA 2HQYA 4H89A 2B3UA 3R9EA 1BPNA 3TX8A 4ZBGA 1M44A 3WABA 4MBUA 3R95A 3LACA 4MFKA 2PIYA 3EY5A 4MCPA 4KS9A 1CPSA 2ZEOA 2DF5A 3SJXA 1Z8XA 1A2ZA 1MJAA 4KVOE 1I21A 1Z2LA 4OP4A 4BBHA 1TKFA 3FECA 2V8VA 3GUXA 2QVPA 5F48A 4OC5A 1TIQA 4L8AA 4EWTA 4MMOA 3IEHA 2J9AA 4MY3A 1XOVA 5J8CA 5LYIA 3F8KA 3F0AA 2PR8A 2WYRA 2Q4YA 2OB0A 4L89A 3L2NA 4MI4A 2RB7A 3F5BA 1FNOA 3RAMA 3QB8A 4KVXA 1F57A 3FF3A 4TWEA 3S9MA 4MCSA 2PJAA 2BEIA 2Q4VA 3RO0A 2PJ2A 2HB6A 2OR4A 4ONWA 4J3GA 4OAEA 2GREA 4MCRA 2R98A 3NFZA 3GKRA 4BINA 1B6BA 3IWEA 1DE4C 5LYLA 4A94A 4AVAA 2PQ8A 3IU2A 1PUAA 2F8HA 4DNCA 5IX3A 3SI0A 1KWMA 5EBVA 3TOBA 3IIBA 4KOUA 2VZYA 4ZX9A 4CGMA 3GIUA 2CNSA 5HVHA 3TFYA 4OLLA 3B8GA 4ZX8A 2BO9A 3H8FA 2Y0MA 3FX6A 4QBJA 1Q2DA 3NE7A 3KR4A 4UFWA 1TF8A 4U5YA 2QYVA 1CPXA 4R57A 5GCNA 1MK4A 5H84A 2PIZA 5G22A 5HMNA 4CYOA 2I79A 1NMTA 4KUBA 1ZLIA 4A38A 4Q7AA 3W6SA 5CPAA 4NEXA 2R1IA 1HEEA 2F5IA 3FNCA 4KOYA 2PJ0A 3NH4A 4M6GA 2C27A 2HUZA 1HDUA 1YVOA 5HVFA 4A95A 2VZZA 2EK9A 3CXPA 4Z65A 2NSMA 4Y49B 3OWCA 2O28A 2V77A 4OKOA 1LRZA 3KR5A 2G9DA 4ZY2A 4C7HA 4DUKA 5EC4A 1CJWA 2P6FA 3R9GA 2PC1A 3PB6X 3D7HA 1LAPA 3W6XA 3D66A 2REFA 3TO7A 3VH9A 1X12A 4II9A 1M1DA 2JEWA 5K8NA 4NF1A 4P45A 1Y9WA 2PJ3A 3WT4A 4AXVA 4IUSA 3SJGA 3DGVA 1VHOA 3MGDA 1VHSA 3KQZA 1VIXA 4OIWA 3B3VA 1NSLA 4B11A 2GLFA 2AFSA 1RXTA 4IF5A 4IHMA 5K8PA 3PEIA 4NGNA 3IC1A 3DLJA 4M6HA 4H6ZA 5EMIA 2AFOA 5A27A 2RFHA 3I9SA 2PJ4A 4OC1A 1Q2YA 4OC2A 3MRUA 2GFQA 3RYOA 1R57A 3S6GA 5HXDA 5KTAA 1JWQA 3D4UA 3KL9A 3VWDA 1OZPA 2GE3A 4NJRA 1ZG7A 3LODA 2P6EA 1ELMP 1ON0A 4B6ZA 4CRYB 1Z4EA 3TO9A 4DYOA 5AGEA 1S7LA 4Q38A 2BUEA 5FVJA 3TT2A 4EVYA 2GLJA 1TXRA 4UBRA 2VEZA 3LMSA 4KLWA 1YREA 2Z3MA 4M6IA 2ZW5A 3B3SA 2OZHA 4NJQA 4X8IA 2OZGA 4OMEA 1PYTB 2QJ8A 4X2TA 5DWNA 1J4JA 3N7ZA 4MFJA 3ISZA 2CY2A 2PJ9A 4C68A 2XEIA 2PRBA 2WPXA 2AFWA 4NGSA 1QMUA 1YW6A 4KLVA 4UWIA 4DJLA 4OIDA 2X7BA 4B13A 2YNEA 3SXOA 1YMEA 1M4IA 3FEEA 4TNUA 3D8PA 4NGMA 2IQ6A 1B87A 4R6TA 1Z8LA 2CTCA 2B58A 3I1UA 4PXCA 4P44A 3S6KA 3EXNA 3PFOA 5D8NA 1XRYA 2JBJA 3B7IA 3FIXA 4YWYA 1XMBA 2C1CA 4CYNA 3HLPA 2JBKA 3FBUA 2R7HA 4F9VA 2ZEPA 3T9YA 1BLLE 3VARA 3EFAA 1M4LA 4C2YA 4CPAA 2DPTA 4CGNA 5DS0A 3SI1A 3FMCA 1ZLHA 4B14A 1XJOA 3K2KA 3D67A 3JRUA 3JVNA 4KZTA 2ZW6A 2YNCA 3E0KA 3H4QA 4H2KA 4P4DA 2IMOA 3FVLA 4P4JA 4R9MA 2WZNA 3D7GA 3LWUA 2F7VA 5JQ4A 3KZWA 3NE8A 4R8FA 5JGFA 1LAMA 4KOSA 2XEJA 1LCPA 4PXEA 1H8LA 1Y0YA 4C2ZA 2PJ1A 7CPAA 4I49A 4E2AA 4C7IA 4K3NA 3SJEA 1YLEA 1Y0RA 2P6GA 2FE7A 4PV6A 1FT7A 2Q4ZA 4A37A 4ZYQA 1MJBA 3FXTA 3ZJ0A 5G21A 1S7FA 5A28A 1QSRA 1UWYA 1KZFA 2QECA 2EO8A 1CX8A 2ZOGA 2FSRA 4HPSA 1WK4A 1S5KA 4KOVA 4MHDA 4Y49C 2JDDA 3G3SA 5AG7A 1I1DA 2D4OA 4CGOA 1IOIA 2EWBA 4F8ZA 1IGBA 3PGPA 4NXYA 4R76A 3BI1A 2JLMA 3CPAA 3V8IA 4B12A 4AG9A 3KHZA 2J8RA 2Z3PA 2RC4A 4HNYB 2Q51A 3D2MA 4HNXB 1Z4RA 4W9YA 4MHZA 4MJ8A 4QVTA 1JQGA 2PJ8A 2Z0ZA 4UF4A 2GIVA 3B35A 3KHXA 2JEVA 3KKWA 5AG6A 1NSAA 2A4NA 2ZEGA 3W91A 1KUXA 4LX9A 3N5FA 4RN7A 3S9NA 4NGRA 3G8WA 5J8FA 1TKJA 4OC3A 3SJFA 2HC9A 2FVGA 3DSBA 1M4DA 2KCWA 4KOTA 4UEEA 4MY0A 2C6GA 2IL4A 1V0CA 4F9UA 2G0BA 1S3ZA 1YR0A 4JYWA 2B4BA 2ABZA 1ZO0A 4FAIA 5JM6A 1CP7A 1VHEA 2C6PA 3DR8A 3MN8A 4FD4A 4WWVA 3R96A 1XF8A 1LANA 2PJ7A 1BOBA 3BI0A 4NGQA 4XPDC 3IU1A 2HV2A 1ZG8A 1VGYA 2B5GA 2PSWA 3IWWA 1F2PA 3BHXA 3S6HA 2YNCC 3D7DA 4MHNA 5IB0A 2B3VA 5JPHA 2I3CA 2CIJA 3LD2A 4FUUA 1TKHA 4OC4A 4PK3A 4H6UA 1ARMA 3RZAA 4P6YA 1YVKA 2R8VA 4EFDA 4PSXA 4UFXA 4XPLA 4KSIA 1MJ9A 2AFZA 2EK8A 3PB4X 4UIAA 4IAVA 8CPAA 2AJ6A 2PJ6A 5ELYA 4XNHC 2FIWA 4RS2A 3BJ7A 4NSQA 4AB7A 3UY5A 4R7MA 2C6CA 3QNVA 2AFMA 4KSFA 3TOAA 2PJCA 5C82A 3TE4A 2H5MA 4P4IA 3BJ8A 2Q0YA 1HDQA 4K30A 1Z9UA 2J8NA 1TF9A 3TCVA 5KTDA 3NH5A 4U9ZA 5ISVA 3FYNA 4NFRA 4FD7A 4MXUA 4LQ6A 1CM0A 4Q36A 2FXFA 2J8MA 4A31A 2JDCA 2PVVA 2ZEHA 3SXNA 3DNSA 2PDOA 4MFQA 2PE3A 4XPKA 2PR1A 4ONUA 3R9FA 2Q04A 4PSWA 4XNHB 1Y9KA 4KOWA 3CZXA 4B10A 2BCOA 3GB0A 1UFHA 2YGWA 3B3TA 4ZI6A 4ZY1A 2WSAA 2OU2A 4PPZA 1IYLA 4NGPA 1ARLA 2ZXVA 2ZENA 3PP9A 2Q7BA 3PB9X 5F09A 2EUIA 2VI7A 3SI2A 3WC7A 2Q44A 4OC0A 4F0YA 3FH4A 4NCZA 1BPMA 4PK2A 4G1PA 4QB9A 4UCPA 4U9YA 3FB3A 4IK2A 2WUUA 2ZPAA 4MRIA 4MHYA 1IY7A 5JH9A 1K4JA 1S7KA 1XBUA 3PB7X 4P10A 4GXHA 4OADA 2O4HA 1IB1E 1YGHA 2FCKA 4WJBA 3GY9A 4CYPA 1Y7EA 1GYTA 1LOKA 2ZEDA 3IWGA 4KORA 3NA6A 4XPDB 5AG5A 3VATA 3SHPA 5I0CA 2WPWA 1RTQA 2OOTA 1Z8TA 4X5KA 4CAXA 3EC4A 4FBEA 1OBRA 3C26A 3HUVA 4CGPA 1WWZA 3PBBA 4B5OA 4O23A 1N71A 2Z10A 2XEFA 1YK3A 4KUAA 2AFXA 1YSJA 5LRKA 3I3GA 2NMTA 2BOAA 2NYQA 3WC5A 4A33A 4B5PB 1Y7RA 5LRGA 2ARHA 4ORFA 4JXQA 5BWAB 3CXQA 1KUVA 3VWEA 2K5TA 2ZELA 1PU9A 5CBMA 1IYKA 2B4DA 3KASA 4HNWB 3ISXA 5IV0A 1R43A 4ZGYB 4JZ0A 5E96A 2XEGA 4PQAA 4GM5A 2BSWA 4AG7A 2VL1A 3FEDA 4BMHA 3KQXA 6CPAA 1LFWA 1EE3P 4UEFA 1YQEA 2Z3NA 4UIBA 4LQGA 1I12A 3P2HA 4MFZA 2ZEFA 1IOFA 2B5GB 3V38A 5LYDA 4CGLA 1AMPA 4RUHA 3IJ3A 3KI9A 3NH8A 3PBEA 2REEA 4ZY0A 5IB9A 2VXKA 3BLNA 3CDXA 3TO6A 4JWPA 1IU8A 2Z3KA 1CG2A 3S6FA 4MHPA 5H86A 4M85A 4R87A 1Z8WA 2VBQA 1XFOA 3BXMA 1IIDA 3FRMA 2G3AA 4UCMA 3B2YA 2CXAA 1F2OA 2ZOFA 4BD9A 5C88A 3DDDA 5G20A 4YU9A 4PXBA 3D2PA 2QMLA 3PFEA 3TTHA 3PZJA 1DTDA 3T90A 2ZW4A 2ANPA 1Q2CA 4NGTA 2ZW7A 5J1QA 4CAEA 1YW4A 2P0WA 1Q7LA 4FD6A 4YGOA 4MCQA 4KOXA 1XIXA 2OZUA 4RI1A 4UCNA 1XE4A 3H8GA 4A39A 1QSTA 2Z3LA 4QC6A 3PB8X 4CS0B 2PCUA 1YX0A 1Z5RA 3JTKA 1XMTA 4P4EA 1CP6A 2ZEEA 3H8EA 3WR7A 1SQHA 4JXRA 4F6AA 1RO5A 4JD6A 3T8WA 4UEZA 1AYEA 2Q43A 1CBXA 4B5PA 2PVWA 2YNDA 4EMEA 2CF4A 3WC6A 4C2XA 5AG4A 2Z3OA 2GANA 2PRQA 5D29A 2FT0A 1BAVA 2V8GA 2FS5A 3JUWA 4X3RA 1VKCA 4CYQA 2PJBA 3ZZIA 1BO4A 1QSNA 1P4NA 2EVNA 4P4FA 3EO4A 2FIAA 3KGQA 2Z11A 4PXDA 3RBUA 2CNMA 5F49A 3RNZA 3IFEA 4CAFA 1FY7A 5G1ZA 1KUYA 5LYFA 3S9LA 3IGRA 5LRJA 2ZEMA 2I00A 4MFLA 4P4BA 5DWMA 3A9LA 4M3SA 4AVCA 2ODFA 4UA3A 3K9UA 2PJ5A 2B4DB 4KVME 5F47A 1M4GA 3H5ZA 3K9TA 4AVBA 3CXSA 1QQ9A 2AE6A 4R3KA 3GYAA 2AFUA 2CTBA 2OH1A 3QAHA 1YLOA 3D3SA 3GLJA 3PRTA 3R1KA 3FJUA 5HH1A 2IJZA 5KTCA 4FWUA 1ZG9A 4A32A 4A2ZA 2D4PA 4UFVA 4CAWA 2ATRA 1L0CA 4FD5A 2QIRA 4LUAA 4QUSA 5K8OA 1AUGA 4E0AA 3IO1A 3V7ZA 2O53A 4A30A 1R3NA 1S60A 5K8MA 2EBJA 2DPSA 4YFJA 4R3LA 4GS4A 3CPXA 4E8OA 3D68A 5THWA 4JJXA 4CAVA 1GHEA 1NE9A 4UWJA 5CNPA 4YRHA 2GU2A 4KSAA 3B3CA 3TC8A 4F0XA 2V8HA 2G3TA 3P2FA
chains in the Genus database with same CATH topology
1QSMA 1U6MA 1XEBA 4CRZB 1QSOA 1P0HA 1S7NA 4HKFA 2CNTA 1IICA 2FL4A 3DR6A 2DXQA 2VQYA 5F46A 2BL1A 4MFPA 4JLYA 4H89A 2HQYA 2B3UA 3R9EA 4ZBGA 1M44A 4MBUA 3R95A 4MFKA 3EY5A 4KS9A 1MJAA 4KVOE 1I21A 4BBHA 5F48A 1TIQA 4L8AA 4MY3A 5J8CA 3F8KA 3F0AA 2PR8A 4L89A 2Q4YA 2OB0A 4MI4A 3F5BA 3QB8A 4KVXA 2BEIA 2Q4VA 4J3GA 4OAEA 2R98A 3GKRA 1B6BA 3IWEA 4AVAA 2PQ8A 3IU2A 1PUAA 4DNCA 5IX3A 3TOBA 5EBVA 4CGMA 4KOUA 2VZYA 3TFYA 2CNSA 4OLLA 3B8GA 2Y0MA 4QBJA 1Q2DA 3NE7A 4UFWA 4U5YA 4R57A 5GCNA 1MK4A 5H84A 5G22A 5HMNA 4CYOA 2I79A 1NMTA 4KUBA 3W6SA 4NEXA 2R1IA 2F5IA 3FNCA 4KOYA 2C27A 2HUZA 1YVOA 4A95A 2VZZA 3CXPA 4Y49B 3OWCA 2O28A 1LRZA 4C7HA 5EC4A 1CJWA 2P6FA 3R9GA 2PC1A 3W6XA 2REFA 3TO7A 4II9A 1M1DA 4NF1A 1Y9WA 4IUSA 3MGDA 1VHSA 1NSLA 4B11A 1RXTA 4IF5A 4H6ZA 5A27A 3I9SA 1Q2YA 3RYOA 5KTAA 1R57A 3S6GA 3VWDA 1OZPA 2GE3A 3LODA 2P6EA 1ON0A 4CRYB 1Z4EA 3TO9A 5AGEA 1S7LA 4Q38A 2BUEA 5FVJA 3TT2A 4EVYA 4UBRA 2VEZA 4KLWA 1YREA 2Z3MA 2ZW5A 2OZHA 2OZGA 5DWNA 1J4JA 3N7ZA 4MFJA 2CY2A 4C68A 2PRBA 2WPXA 4KLVA 4UWIA 2X7BA 4B13A 2YNEA 3SXOA 1M4IA 3D8PA 1B87A 2B58A 3S6KA 3EXNA 3FIXA 4CYNA 3FBUA 2R7HA 3T9YA 3EFAA 4C2YA 2DPTA 4CGNA 4B14A 3JVNA 4KZTA 3H4QA 2YNCA 2ZW6A 3E0KA 4R9MA 5JQ4A 4KOSA 4C2ZA 4I49A 4E2AA 4C7IA 1YLEA 2P6GA 2FE7A 4PV6A 1MJBA 3FXTA 3ZJ0A 5G21A 1S7FA 5A28A 1QSRA 1KZFA 2QECA 4MHDA 2FSRA 1WK4A 1S5KA 4KOVA 4Y49C 2JDDA 3G3SA 5AG7A 1I1DA 2D4OA 4CGOA 4NXYA 3PGPA 2JLMA 3V8IA 4B12A 4AG9A 2J8RA 2Z3PA 2RC4A 4HNYB 3D2MA 4HNXB 1Z4RA 4MJ8A 4QVTA 2Z0ZA 2GIVA 5AG6A 2JEVA 3KKWA 2A4NA 3W91A 1KUXA 4LX9A 3G8WA 5J8FA 3DSBA 4KOTA 1M4DA 2KCWA 4MY0A 2IL4A 1V0CA 2G0BA 1S3ZA 1YR0A 2B4BA 1ZO0A 3DR8A 4FD4A 3R96A 1XF8A 1BOBA 4XPDC 3IU1A 2HV2A 2PSWA 2B5GA 3S6HA 2YNCC 5IB0A 2B3VA 5JPHA 3LD2A 4PK3A 4H6UA 1YVKA 2R8VA 4PSXA 4UFXA 4XPLA 1MJ9A 2AJ6A 4XNHC 2FIWA 4RS2A 3BJ7A 4NSQA 4AB7A 3UY5A 4KSFA 3TOAA 5C82A 3TE4A 2H5MA 3BJ8A 2Q0YA 4K30A 1Z9UA 2J8NA 3TCVA 5KTDA 4U9ZA 5ISVA 3FYNA 4FD7A 1CM0A 4Q36A 2FXFA 2J8MA 4A31A 2JDCA 3SXNA 3DNSA 2PDOA 4MFQA 4XPKA 2PR1A 4ONUA 3R9FA 2Q04A 4PSWA 4XNHB 1Y9KA 4KOWA 4B10A 1UFHA 2YGWA 2WSAA 2OU2A 1IYLA 2ZXVA 3PP9A 2Q7BA 2EUIA 2VI7A 2Q44A 4F0YA 4NCZA 4QB9A 4PK2A 4UCPA 4U9YA 3FB3A 2WUUA 2ZPAA 1K4JA 1S7KA 4OADA 1IB1E 1YGHA 2FCKA 4CYPA 3GY9A 3IWGA 4XPDB 4KORA 5AG5A 3SHPA 5I0CA 2WPWA 4CAXA 4X5KA 3EC4A 3C26A 4CGPA 1WWZA 4B5OA 1N71A 2Z10A 1YK3A 4KUAA 3I3GA 2NMTA 4A33A 4B5PB 1Y7RA 2ARHA 4ORFA 4JXQA 5BWAB 3CXQA 1KUVA 3VWEA 2K5TA 1PU9A 1IYKA 2B4DA 4HNWB 5IV0A 4ZGYB 5E96A 2BSWA 4AG7A 4BMHA 2Z3NA 1I12A 3P2HA 4MFZA 2B5GB 4CGLA 2REEA 2VXKA 3BLNA 3TO6A 4JWPA 2Z3KA 3S6FA 5H86A 4M85A 4R87A 2VBQA 1IIDA 4UCMA 2G3AA 2CXAA 5C88A 3DDDA 5G20A 3D2PA 2QMLA 3TTHA 3PZJA 3T90A 2ZW4A 1Q2CA 2ZW7A 4CAEA 2P0WA 4FD6A 4YGOA 4KOXA 1XIXA 2OZUA 4RI1A 4UCNA 1XE4A 1QSTA 2Z3LA 4QC6A 4CS0B 3JTKA 1YX0A 1XMTA 3WR7A 1SQHA 4JXRA 4F6AA 1RO5A 4JD6A 4B5PA 2YNDA 4C2XA 5AG4A 2Z3OA 2GANA 2FT0A 2FS5A 3JUWA 1VKCA 4CYQA 3ZZIA 1BO4A 1QSNA 1P4NA 2EVNA 3EO4A 2FIAA 2Z11A 2CNMA 5F49A 4CAFA 1FY7A 5G1ZA 1KUYA 3IGRA 2I00A 4MFLA 5DWMA 3A9LA 4M3SA 4AVCA 4UA3A 3K9UA 2B4DB 4KVME 5F47A 1M4GA 3H5ZA 4AVBA 3CXSA 2AE6A 4R3KA 3GYAA 2OH1A 3QAHA 3D3SA 3R1KA 5HH1A 5KTCA 4A32A 4A2ZA 2D4PA 4UFVA 4CAWA 2ATRA 1L0CA 4FD5A 2QIRA 4LUAA 4QUSA 4E0AA 4A30A 1S60A 2DPSA 4YFJA 4R3LA 4GS4A 4E8OA 4CAVA 4JJXA 1GHEA 1NE9A 4UWJA 5CNPA 4YRHA 4KSAA 4F0XA 3FRMA 2G3TA 3P2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QSM A;  1U6M A;  1XEB A;  4CRZ B;  1QSO A;  1P0H A;  1S7N A;  4HKF A;  2CNT A;  1IIC A;  2FL4 A;  3DR6 A;  2DXQ A;  2VQY A;  5F46 A;  2BL1 A;  4JLY A;  4H89 A;  2HQY A;  2B3U A;  3R9E A;  4ZBG A;  1M44 A;  4MBU A;  3R95 A;  3EY5 A;  1MJA A;  4KVO E;  1I21 A;  5F48 A;  1TIQ A;  4L8A A;  4MY3 A;  5J8C A;  3F8K A;  3F0A A;  2PR8 A;  4L89 A;  2Q4Y A;  2OB0 A;  4MI4 A;  3F5B A;  3QB8 A;  4KVX A;  2BEI A;  2Q4V A;  4J3G A;  4OAE A;  2R98 A;  3GKR A;  1B6B A;  4AVA A;  2PQ8 A;  1PUA A;  4DNC A;  5IX3 A;  3TOB A;  5EBV A;  4KOU A;  2VZY A;  3TFY A;  2CNS A;  4OLL A;  3B8G A;  2Y0M A;  4QBJ A;  1Q2D A;  3NE7 A;  4U5Y A;  4R57 A;  5GCN A;  1MK4 A;  5H84 A;  5HMN A;  2I79 A;  1NMT A;  4KUB A;  3W6S A;  4NEX A;  2R1I A;  2F5I A;  3FNC A;  4KOY A;  2C27 A;  2HUZ A;  1YVO A;  2VZZ A;  3CXP A;  4Y49 B;  3OWC A;  2O28 A;  1LRZ A;  5EC4 A;  1CJW A;  2P6F A;  3R9G A;  2PC1 A;  3W6X A;  2REF A;  3TO7 A;  4II9 A;  1M1D A;  4NF1 A;  1Y9W A;  4IUS A;  3MGD A;  1VHS A;  1NSL A;  1RXT A;  4IF5 A;  4H6Z A;  3I9S A;  1Q2Y A;  3RYO A;  5KTA A;  1R57 A;  3S6G A;  3VWD A;  1OZP A;  2GE3 A;  3LOD A;  2P6E A;  1ON0 A;  4CRY B;  1Z4E A;  3TO9 A;  1S7L A;  5FVJ A;  2BUE A;  3TT2 A;  4EVY A;  4UBR A;  2VEZ A;  4KLW A;  1YRE A;  2ZW5 A;  2OZH A;  2OZG A;  5DWN A;  1J4J A;  3N7Z A;  2CY2 A;  2PRB A;  2WPX A;  4KLV A;  4UWI A;  2X7B A;  3SXO A;  1M4I A;  3D8P A;  1B87 A;  2B58 A;  3S6K A;  3EXN A;  3FIX A;  3FBU A;  2R7H A;  3T9Y A;  3EFA A;  3JVN A;  4KZT A;  2ZW6 A;  3E0K A;  3H4Q A;  4R9M A;  5JQ4 A;  4KOS A;  4I49 A;  4E2A A;  1YLE A;  2P6G A;  2FE7 A;  4PV6 A;  1MJB A;  3FXT A;  3ZJ0 A;  1S7F A;  1QSR A;  1KZF A;  2QEC A;  4MHD A;  2FSR A;  1WK4 A;  1S5K A;  4KOV A;  4Y49 C;  2JDD A;  3G3S A;  1I1D A;  2D4O A;  4NXY A;  3PGP A;  2JLM A;  3V8I A;  4AG9 A;  2J8R A;  2RC4 A;  4HNY B;  3D2M A;  4HNX B;  1Z4R A;  4MJ8 A;  4QVT A;  2Z0Z A;  2GIV A;  2JEV A;  3KKW A;  2A4N A;  3W91 A;  1KUX A;  4LX9 A;  3G8W A;  5J8F A;  3DSB A;  4KOT A;  1M4D A;  2KCW A;  4MY0 A;  2IL4 A;  1V0C A;  2G0B A;  1S3Z A;  1YR0 A;  2B4B A;  3DR8 A;  4FD4 A;  3R96 A;  1XF8 A;  1BOB A;  4XPD C;  2HV2 A;  2PSW A;  2B5G A;  3S6H A;  5IB0 A;  2B3V A;  5JPH A;  3LD2 A;  4PK3 A;  4H6U A;  1YVK A;  2R8V A;  4PSX A;  4XPL A;  1MJ9 A;  2AJ6 A;  4XNH C;  2FIW A;  4RS2 A;  3BJ7 A;  4NSQ A;  4AB7 A;  3UY5 A;  3TOA A;  5C82 A;  3TE4 A;  2H5M A;  3BJ8 A;  2Q0Y A;  4K30 A;  1Z9U A;  2J8N A;  3TCV A;  5KTD A;  4U9Z A;  5ISV A;  3FYN A;  4FD7 A;  1CM0 A;  2FXF A;  2J8M A;  2JDC A;  3SXN A;  3DNS A;  2PDO A;  4XPK A;  2PR1 A;  4ONU A;  3R9F A;  2Q04 A;  4PSW A;  4XNH B;  1Y9K A;  4KOW A;  1UFH A;  2OU2 A;  1IYL A;  2ZXV A;  3PP9 A;  2Q7B A;  2EUI A;  2VI7 A;  2Q44 A;  4F0Y A;  4NCZ A;  4QB9 A;  4PK2 A;  4U9Y A;  3FB3 A;  2ZPA A;  1K4J A;  1S7K A;  4OAD A;  1IB1 E;  1YGH A;  2FCK A;  3GY9 A;  3IWG A;  4XPD B;  4KOR A;  3SHP A;  5I0C A;  2WPW A;  4CAX A;  4X5K A;  3EC4 A;  3C26 A;  1WWZ A;  4B5O A;  1N71 A;  2Z10 A;  1YK3 A;  4KUA A;  3I3G A;  2NMT A;  4B5P B;  1Y7R A;  2ARH A;  4ORF A;  4JXQ A;  3CXQ A;  1KUV A;  3VWE A;  2K5T A;  1PU9 A;  1IYK A;  2B4D A;  4HNW B;  5IV0 A;  5E96 A;  2BSW A;  4AG7 A;  4BMH A;  1I12 A;  3P2H A;  2B5G B;  2REE A;  2VXK A;  3BLN A;  3TO6 A;  4JWP A;  3S6F A;  5H86 A;  4M85 A;  4R87 A;  2VBQ A;  1IID A;  2G3A A;  5C88 A;  3DDD A;  3D2P A;  2QML A;  3TTH A;  3PZJ A;  3T90 A;  2ZW4 A;  1Q2C A;  2ZW7 A;  2P0W A;  4FD6 A;  4YGO A;  4KOX A;  1XIX A;  2OZU A;  4RI1 A;  1XE4 A;  1QST A;  4QC6 A;  4CS0 B;  1YX0 A;  1XMT A;  3WR7 A;  1SQH A;  4JXR A;  4F6A A;  1RO5 A;  4JD6 A;  4B5P A;  2GAN A;  2FT0 A;  2FS5 A;  3JUW A;  1VKC A;  3ZZI A;  1BO4 A;  1QSN A;  1P4N A;  2EVN A;  3EO4 A;  2FIA A;  2Z11 A;  2CNM A;  5F49 A;  1FY7 A;  1KUY A;  3IGR A;  2I00 A;  5DWM A;  4M3S A;  4AVC A;  4UA3 A;  3K9U A;  2B4D B;  4KVM E;  5F47 A;  1M4G A;  4AVB A;  3CXS A;  2AE6 A;  4R3K A;  3GYA A;  2OH1 A;  3QAH A;  3D3S A;  3R1K A;  5HH1 A;  5KTC A;  2D4P A;  4CAW A;  2ATR A;  1L0C A;  4FD5 A;  2QIR A;  4QUS A;  4LUA A;  4E0A A;  1S60 A;  4YFJ A;  4R3L A;  4GS4 A;  4E8O A;  4CAV A;  4JJX A;  1GHE A;  1NE9 A;  4UWJ A;  5CNP A;  4YRH A;  3FRM A;  2G3T A;  3P2F A; 
#chains in the Genus database with same CATH topology
 1QSM A;  1U6M A;  1X10 A;  1XEB A;  4CRZ B;  1QSO A;  5HVG A;  2V8D A;  5I4M A;  3D7F A;  1P0H A;  3CT9 A;  2POK A;  1S7N A;  4HKF A;  2CNT A;  1IIC A;  2FL4 A;  3DR6 A;  2DXQ A;  2VQY A;  5F46 A;  2BL1 A;  2DEA A;  1ELL P;  1PCA A;  4MFP A;  2Q7S A;  3B3W A;  4JLY A;  3QAY A;  2HQY A;  4H89 A;  2B3U A;  3R9E A;  1BPN A;  3TX8 A;  4ZBG A;  1M44 A;  3WAB A;  4MBU A;  3R95 A;  3LAC A;  4MFK A;  2PIY A;  3EY5 A;  4MCP A;  4KS9 A;  1CPS A;  2ZEO A;  2DF5 A;  3SJX A;  1Z8X A;  1A2Z A;  1MJA A;  4KVO E;  1I21 A;  1Z2L A;  4OP4 A;  4BBH A;  1TKF A;  3FEC A;  2V8V A;  3GUX A;  2QVP A;  5F48 A;  4OC5 A;  1TIQ A;  4L8A A;  4EWT A;  4MMO A;  3IEH A;  2J9A A;  4MY3 A;  1XOV A;  5J8C A;  5LYI A;  3F8K A;  3F0A A;  2PR8 A;  2WYR A;  2Q4Y A;  2OB0 A;  4L89 A;  3L2N A;  4MI4 A;  2RB7 A;  3F5B A;  1FNO A;  3RAM A;  3QB8 A;  4KVX A;  1F57 A;  3FF3 A;  4TWE A;  3S9M A;  4MCS A;  2PJA A;  2BEI A;  2Q4V A;  3RO0 A;  2PJ2 A;  2HB6 A;  2OR4 A;  4ONW A;  4J3G A;  4OAE A;  2GRE A;  4MCR A;  2R98 A;  3NFZ A;  3GKR A;  4BIN A;  1B6B A;  3IWE A;  1DE4 C;  5LYL A;  4A94 A;  4AVA A;  2PQ8 A;  3IU2 A;  1PUA A;  2F8H A;  4DNC A;  5IX3 A;  3SI0 A;  1KWM A;  5EBV A;  3TOB A;  3IIB A;  4KOU A;  2VZY A;  4ZX9 A;  4CGM A;  3GIU A;  2CNS A;  5HVH A;  3TFY A;  4OLL A;  3B8G A;  4ZX8 A;  2BO9 A;  3H8F A;  2Y0M A;  3FX6 A;  4QBJ A;  1Q2D A;  3NE7 A;  3KR4 A;  4UFW A;  1TF8 A;  4U5Y A;  2QYV A;  1CPX A;  4R57 A;  5GCN A;  1MK4 A;  5H84 A;  2PIZ A;  5G22 A;  5HMN A;  4CYO A;  2I79 A;  1NMT A;  4KUB A;  1ZLI A;  4A38 A;  4Q7A A;  3W6S A;  5CPA A;  4NEX A;  2R1I A;  1HEE A;  2F5I A;  3FNC A;  4KOY A;  2PJ0 A;  3NH4 A;  4M6G A;  2C27 A;  2HUZ A;  1HDU A;  1YVO A;  5HVF A;  4A95 A;  2VZZ A;  2EK9 A;  3CXP A;  4Z65 A;  2NSM A;  4Y49 B;  3OWC A;  2O28 A;  2V77 A;  4OKO A;  1LRZ A;  3KR5 A;  2G9D A;  4ZY2 A;  4C7H A;  4DUK A;  5EC4 A;  1CJW A;  2P6F A;  3R9G A;  2PC1 A;  3PB6 X;  3D7H A;  1LAP A;  3W6X A;  3D66 A;  2REF A;  3TO7 A;  3VH9 A;  1X12 A;  4II9 A;  1M1D A;  2JEW A;  5K8N A;  4NF1 A;  4P45 A;  1Y9W A;  2PJ3 A;  3WT4 A;  4AXV A;  4IUS A;  3SJG A;  3DGV A;  1VHO A;  3MGD A;  1VHS A;  3KQZ A;  1VIX A;  4OIW A;  3B3V A;  1NSL A;  4B11 A;  2GLF A;  2AFS A;  1RXT A;  4IF5 A;  4IHM A;  5K8P A;  3PEI A;  4NGN A;  3IC1 A;  3DLJ A;  4M6H A;  4H6Z A;  5EMI A;  2AFO A;  5A27 A;  2RFH A;  3I9S A;  2PJ4 A;  4OC1 A;  1Q2Y A;  4OC2 A;  3MRU A;  2GFQ A;  3RYO A;  1R57 A;  3S6G A;  5HXD A;  5KTA A;  1JWQ A;  3D4U A;  3KL9 A;  3VWD A;  1OZP A;  2GE3 A;  4NJR A;  1ZG7 A;  3LOD A;  2P6E A;  1ELM P;  1ON0 A;  4B6Z A;  4CRY B;  1Z4E A;  3TO9 A;  4DYO A;  5AGE A;  1S7L A;  4Q38 A;  2BUE A;  5FVJ A;  3TT2 A;  4EVY A;  2GLJ A;  1TXR A;  4UBR A;  2VEZ A;  3LMS A;  4KLW A;  1YRE A;  2Z3M A;  4M6I A;  2ZW5 A;  3B3S A;  2OZH A;  4NJQ A;  4X8I A;  2OZG A;  4OME A;  1PYT B;  2QJ8 A;  4X2T A;  5DWN A;  1J4J A;  3N7Z A;  4MFJ A;  3ISZ A;  2CY2 A;  2PJ9 A;  4C68 A;  2XEI A;  2PRB A;  2WPX A;  2AFW A;  4NGS A;  1QMU A;  1YW6 A;  4KLV A;  4UWI A;  4DJL A;  4OID A;  2X7B A;  4B13 A;  2YNE A;  3SXO A;  1YME A;  1M4I A;  3FEE A;  4TNU A;  3D8P A;  4NGM A;  2IQ6 A;  1B87 A;  4R6T A;  1Z8L A;  2CTC A;  2B58 A;  3I1U A;  4PXC A;  4P44 A;  3S6K A;  3EXN A;  3PFO A;  5D8N A;  1XRY A;  2JBJ A;  3B7I A;  3FIX A;  4YWY A;  1XMB A;  2C1C A;  4CYN A;  3HLP A;  2JBK A;  3FBU A;  2R7H A;  4F9V A;  2ZEP A;  3T9Y A;  1BLL E;  3VAR A;  3EFA A;  1M4L A;  4C2Y A;  4CPA A;  2DPT A;  4CGN A;  5DS0 A;  3SI1 A;  3FMC A;  1ZLH A;  4B14 A;  1XJO A;  3K2K A;  3D67 A;  3JRU A;  3JVN A;  4KZT A;  2ZW6 A;  2YNC A;  3E0K A;  3H4Q A;  4H2K A;  4P4D A;  2IMO A;  3FVL A;  4P4J A;  4R9M A;  2WZN A;  3D7G A;  3LWU A;  2F7V A;  5JQ4 A;  3KZW A;  3NE8 A;  4R8F A;  5JGF A;  1LAM A;  4KOS A;  2XEJ A;  1LCP A;  4PXE A;  1H8L A;  1Y0Y A;  4C2Z A;  2PJ1 A;  7CPA A;  4I49 A;  4E2A A;  4C7I A;  4K3N A;  3SJE A;  1YLE A;  1Y0R A;  2P6G A;  2FE7 A;  4PV6 A;  1FT7 A;  2Q4Z A;  4A37 A;  4ZYQ A;  1MJB A;  3FXT A;  3ZJ0 A;  5G21 A;  1S7F A;  5A28 A;  1QSR A;  1UWY A;  1KZF A;  2QEC A;  2EO8 A;  1CX8 A;  2ZOG A;  2FSR A;  4HPS A;  1WK4 A;  1S5K A;  4KOV A;  4MHD A;  4Y49 C;  2JDD A;  3G3S A;  5AG7 A;  1I1D A;  2D4O A;  4CGO A;  1IOI A;  2EWB A;  4F8Z A;  1IGB A;  3PGP A;  4NXY A;  4R76 A;  3BI1 A;  2JLM A;  3CPA A;  3V8I A;  4B12 A;  4AG9 A;  3KHZ A;  2J8R A;  2Z3P A;  2RC4 A;  4HNY B;  2Q51 A;  3D2M A;  4HNX B;  1Z4R A;  4W9Y A;  4MHZ A;  4MJ8 A;  4QVT A;  1JQG A;  2PJ8 A;  2Z0Z A;  4UF4 A;  2GIV A;  3B35 A;  3KHX A;  2JEV A;  3KKW A;  5AG6 A;  1NSA A;  2A4N A;  2ZEG A;  3W91 A;  1KUX A;  4LX9 A;  3N5F A;  4RN7 A;  3S9N A;  4NGR A;  3G8W A;  5J8F A;  1TKJ A;  4OC3 A;  3SJF A;  2HC9 A;  2FVG A;  3DSB A;  1M4D A;  2KCW A;  4KOT A;  4UEE A;  4MY0 A;  2C6G A;  2IL4 A;  1V0C A;  4F9U A;  2G0B A;  1S3Z A;  1YR0 A;  4JYW A;  2B4B A;  2ABZ A;  1ZO0 A;  4FAI A;  5JM6 A;  1CP7 A;  1VHE A;  2C6P A;  3DR8 A;  3MN8 A;  4FD4 A;  4WWV A;  3R96 A;  1XF8 A;  1LAN A;  2PJ7 A;  1BOB A;  3BI0 A;  4NGQ A;  4XPD C;  3IU1 A;  2HV2 A;  1ZG8 A;  1VGY A;  2B5G A;  2PSW A;  3IWW A;  1F2P A;  3BHX A;  3S6H A;  2YNC C;  3D7D A;  4MHN A;  5IB0 A;  2B3V A;  5JPH A;  2I3C A;  2CIJ A;  3LD2 A;  4FUU A;  1TKH A;  4OC4 A;  4PK3 A;  4H6U A;  1ARM A;  3RZA A;  4P6Y A;  1YVK A;  2R8V A;  4EFD A;  4PSX A;  4UFX A;  4XPL A;  4KSI A;  1MJ9 A;  2AFZ A;  2EK8 A;  3PB4 X;  4UIA A;  4IAV A;  8CPA A;  2AJ6 A;  2PJ6 A;  5ELY A;  4XNH C;  2FIW A;  4RS2 A;  3BJ7 A;  4NSQ A;  4AB7 A;  3UY5 A;  4R7M A;  2C6C A;  3QNV A;  2AFM A;  4KSF A;  3TOA A;  2PJC A;  5C82 A;  3TE4 A;  2H5M A;  4P4I A;  3BJ8 A;  2Q0Y A;  1HDQ A;  4K30 A;  1Z9U A;  2J8N A;  1TF9 A;  3TCV A;  5KTD A;  3NH5 A;  4U9Z A;  5ISV A;  3FYN A;  4NFR A;  4FD7 A;  4MXU A;  4LQ6 A;  1CM0 A;  4Q36 A;  2FXF A;  2J8M A;  4A31 A;  2JDC A;  2PVV A;  2ZEH A;  3SXN A;  3DNS A;  2PDO A;  4MFQ A;  2PE3 A;  4XPK A;  2PR1 A;  4ONU A;  3R9F A;  2Q04 A;  4PSW A;  4XNH B;  1Y9K A;  4KOW A;  3CZX A;  4B10 A;  2BCO A;  3GB0 A;  1UFH A;  2YGW A;  3B3T A;  4ZI6 A;  4ZY1 A;  2WSA A;  2OU2 A;  4PPZ A;  1IYL A;  4NGP A;  1ARL A;  2ZXV A;  2ZEN A;  3PP9 A;  2Q7B A;  3PB9 X;  5F09 A;  2EUI A;  2VI7 A;  3SI2 A;  3WC7 A;  2Q44 A;  4OC0 A;  4F0Y A;  3FH4 A;  4NCZ A;  1BPM A;  4PK2 A;  4G1P A;  4QB9 A;  4UCP A;  4U9Y A;  3FB3 A;  4IK2 A;  2WUU A;  2ZPA A;  4MRI A;  4MHY A;  1IY7 A;  5JH9 A;  1K4J A;  1S7K A;  1XBU A;  3PB7 X;  4P10 A;  4GXH A;  4OAD A;  2O4H A;  1IB1 E;  1YGH A;  2FCK A;  4WJB A;  3GY9 A;  4CYP A;  1Y7E A;  1GYT A;  1LOK A;  2ZED A;  3IWG A;  4KOR A;  3NA6 A;  4XPD B;  5AG5 A;  3VAT A;  3SHP A;  5I0C A;  2WPW A;  1RTQ A;  2OOT A;  1Z8T A;  4X5K A;  4CAX A;  3EC4 A;  4FBE A;  1OBR A;  3C26 A;  3HUV A;  4CGP A;  1WWZ A;  3PBB A;  4B5O A;  4O23 A;  1N71 A;  2Z10 A;  2XEF A;  1YK3 A;  4KUA A;  2AFX A;  1YSJ A;  5LRK A;  3I3G A;  2NMT A;  2BOA A;  2NYQ A;  3WC5 A;  4A33 A;  4B5P B;  1Y7R A;  5LRG A;  2ARH A;  4ORF A;  4JXQ A;  5BWA B;  3CXQ A;  1KUV A;  3VWE A;  2K5T A;  2ZEL A;  1PU9 A;  5CBM A;  1IYK A;  2B4D A;  3KAS A;  4HNW B;  3ISX A;  5IV0 A;  1R43 A;  4ZGY B;  4JZ0 A;  5E96 A;  2XEG A;  4PQA A;  4GM5 A;  2BSW A;  4AG7 A;  2VL1 A;  3FED A;  4BMH A;  3KQX A;  6CPA A;  1LFW A;  1EE3 P;  4UEF A;  1YQE A;  2Z3N A;  4UIB A;  4LQG A;  1I12 A;  3P2H A;  4MFZ A;  2ZEF A;  1IOF A;  2B5G B;  3V38 A;  5LYD A;  4CGL A;  1AMP A;  4RUH A;  3IJ3 A;  3KI9 A;  3NH8 A;  3PBE A;  2REE A;  4ZY0 A;  5IB9 A;  2VXK A;  3BLN A;  3CDX A;  3TO6 A;  4JWP A;  1IU8 A;  2Z3K A;  1CG2 A;  3S6F A;  4MHP A;  5H86 A;  4M85 A;  4R87 A;  1Z8W A;  2VBQ A;  1XFO A;  3BXM A;  1IID A;  3FRM A;  2G3A A;  4UCM A;  3B2Y A;  2CXA A;  1F2O A;  2ZOF A;  4BD9 A;  5C88 A;  3DDD A;  5G20 A;  4YU9 A;  4PXB A;  3D2P A;  2QML A;  3PFE A;  3TTH A;  3PZJ A;  1DTD A;  3T90 A;  2ZW4 A;  2ANP A;  1Q2C A;  4NGT A;  2ZW7 A;  5J1Q A;  4CAE A;  1YW4 A;  2P0W A;  1Q7L A;  4FD6 A;  4YGO A;  4MCQ A;  4KOX A;  1XIX A;  2OZU A;  4RI1 A;  4UCN A;  1XE4 A;  3H8G A;  4A39 A;  1QST A;  2Z3L A;  4QC6 A;  3PB8 X;  4CS0 B;  2PCU A;  1YX0 A;  1Z5R A;  3JTK A;  1XMT A;  4P4E A;  1CP6 A;  2ZEE A;  3H8E A;  3WR7 A;  1SQH A;  4JXR A;  4F6A A;  1RO5 A;  4JD6 A;  3T8W A;  4UEZ A;  1AYE A;  2Q43 A;  1CBX A;  4B5P A;  2PVW A;  2YND A;  4EME A;  2CF4 A;  3WC6 A;  4C2X A;  5AG4 A;  2Z3O A;  2GAN A;  2PRQ A;  5D29 A;  2FT0 A;  1BAV A;  2V8G A;  2FS5 A;  3JUW A;  4X3R A;  1VKC A;  4CYQ A;  2PJB A;  3ZZI A;  1BO4 A;  1QSN A;  1P4N A;  2EVN A;  4P4F A;  3EO4 A;  2FIA A;  3KGQ A;  2Z11 A;  4PXD A;  3RBU A;  2CNM A;  5F49 A;  3RNZ A;  3IFE A;  4CAF A;  1FY7 A;  5G1Z A;  1KUY A;  5LYF A;  3S9L A;  3IGR A;  5LRJ A;  2ZEM A;  2I00 A;  4MFL A;  4P4B A;  5DWM A;  3A9L A;  4M3S A;  4AVC A;  2ODF A;  4UA3 A;  3K9U A;  2PJ5 A;  2B4D B;  4KVM E;  5F47 A;  1M4G A;  3H5Z A;  3K9T A;  4AVB A;  3CXS A;  1QQ9 A;  2AE6 A;  4R3K A;  3GYA A;  2AFU A;  2CTB A;  2OH1 A;  3QAH A;  1YLO A;  3D3S A;  3GLJ A;  3PRT A;  3R1K A;  3FJU A;  5HH1 A;  2IJZ A;  5KTC A;  4FWU A;  1ZG9 A;  4A32 A;  4A2Z A;  2D4P A;  4UFV A;  4CAW A;  2ATR A;  1L0C A;  4FD5 A;  2QIR A;  4LUA A;  4QUS A;  5K8O A;  1AUG A;  4E0A A;  3IO1 A;  3V7Z A;  2O53 A;  4A30 A;  1R3N A;  1S60 A;  5K8M A;  2EBJ A;  2DPS A;  4YFJ A;  4R3L A;  4GS4 A;  3CPX A;  4E8O A;  3D68 A;  5THW A;  4JJX A;  4CAV A;  1GHE A;  1NE9 A;  4UWJ A;  5CNP A;  4YRH A;  2GU2 A;  4KSA A;  3B3C A;  3TC8 A;  4F0X A;  2V8H A;  2G3T A;  3P2F A; 
#chains in the Genus database with same CATH homology
 1QSM A;  1U6M A;  1XEB A;  4CRZ B;  1QSO A;  1P0H A;  1S7N A;  4HKF A;  2CNT A;  1IIC A;  2FL4 A;  3DR6 A;  2DXQ A;  2VQY A;  5F46 A;  2BL1 A;  4MFP A;  4JLY A;  4H89 A;  2HQY A;  2B3U A;  3R9E A;  4ZBG A;  1M44 A;  4MBU A;  3R95 A;  4MFK A;  3EY5 A;  4KS9 A;  1MJA A;  4KVO E;  1I21 A;  4BBH A;  5F48 A;  1TIQ A;  4L8A A;  4MY3 A;  5J8C A;  3F8K A;  3F0A A;  2PR8 A;  4L89 A;  2Q4Y A;  2OB0 A;  4MI4 A;  3F5B A;  3QB8 A;  4KVX A;  2BEI A;  2Q4V A;  4J3G A;  4OAE A;  2R98 A;  3GKR A;  1B6B A;  3IWE A;  4AVA A;  2PQ8 A;  3IU2 A;  1PUA A;  4DNC A;  5IX3 A;  3TOB A;  5EBV A;  4CGM A;  4KOU A;  2VZY A;  3TFY A;  2CNS A;  4OLL A;  3B8G A;  2Y0M A;  4QBJ A;  1Q2D A;  3NE7 A;  4UFW A;  4U5Y A;  4R57 A;  5GCN A;  1MK4 A;  5H84 A;  5G22 A;  5HMN A;  4CYO A;  2I79 A;  1NMT A;  4KUB A;  3W6S A;  4NEX A;  2R1I A;  2F5I A;  3FNC A;  4KOY A;  2C27 A;  2HUZ A;  1YVO A;  4A95 A;  2VZZ A;  3CXP A;  4Y49 B;  3OWC A;  2O28 A;  1LRZ A;  4C7H A;  5EC4 A;  1CJW A;  2P6F A;  3R9G A;  2PC1 A;  3W6X A;  2REF A;  3TO7 A;  4II9 A;  1M1D A;  4NF1 A;  1Y9W A;  4IUS A;  3MGD A;  1VHS A;  1NSL A;  4B11 A;  1RXT A;  4IF5 A;  4H6Z A;  5A27 A;  3I9S A;  1Q2Y A;  3RYO A;  5KTA A;  1R57 A;  3S6G A;  3VWD A;  1OZP A;  2GE3 A;  3LOD A;  2P6E A;  1ON0 A;  4CRY B;  1Z4E A;  3TO9 A;  5AGE A;  1S7L A;  4Q38 A;  2BUE A;  5FVJ A;  3TT2 A;  4EVY A;  4UBR A;  2VEZ A;  4KLW A;  1YRE A;  2Z3M A;  2ZW5 A;  2OZH A;  2OZG A;  5DWN A;  1J4J A;  3N7Z A;  4MFJ A;  2CY2 A;  4C68 A;  2PRB A;  2WPX A;  4KLV A;  4UWI A;  2X7B A;  4B13 A;  2YNE A;  3SXO A;  1M4I A;  3D8P A;  1B87 A;  2B58 A;  3S6K A;  3EXN A;  3FIX A;  4CYN A;  3FBU A;  2R7H A;  3T9Y A;  3EFA A;  4C2Y A;  2DPT A;  4CGN A;  4B14 A;  3JVN A;  4KZT A;  3H4Q A;  2YNC A;  2ZW6 A;  3E0K A;  4R9M A;  5JQ4 A;  4KOS A;  4C2Z A;  4I49 A;  4E2A A;  4C7I A;  1YLE A;  2P6G A;  2FE7 A;  4PV6 A;  1MJB A;  3FXT A;  3ZJ0 A;  5G21 A;  1S7F A;  5A28 A;  1QSR A;  1KZF A;  2QEC A;  4MHD A;  2FSR A;  1WK4 A;  1S5K A;  4KOV A;  4Y49 C;  2JDD A;  3G3S A;  5AG7 A;  1I1D A;  2D4O A;  4CGO A;  4NXY A;  3PGP A;  2JLM A;  3V8I A;  4B12 A;  4AG9 A;  2J8R A;  2Z3P A;  2RC4 A;  4HNY B;  3D2M A;  4HNX B;  1Z4R A;  4MJ8 A;  4QVT A;  2Z0Z A;  2GIV A;  5AG6 A;  2JEV A;  3KKW A;  2A4N A;  3W91 A;  1KUX A;  4LX9 A;  3G8W A;  5J8F A;  3DSB A;  4KOT A;  1M4D A;  2KCW A;  4MY0 A;  2IL4 A;  1V0C A;  2G0B A;  1S3Z A;  1YR0 A;  2B4B A;  1ZO0 A;  3DR8 A;  4FD4 A;  3R96 A;  1XF8 A;  1BOB A;  4XPD C;  3IU1 A;  2HV2 A;  2PSW A;  2B5G A;  3S6H A;  2YNC C;  5IB0 A;  2B3V A;  5JPH A;  3LD2 A;  4PK3 A;  4H6U A;  1YVK A;  2R8V A;  4PSX A;  4UFX A;  4XPL A;  1MJ9 A;  2AJ6 A;  4XNH C;  2FIW A;  4RS2 A;  3BJ7 A;  4NSQ A;  4AB7 A;  3UY5 A;  4KSF A;  3TOA A;  5C82 A;  3TE4 A;  2H5M A;  3BJ8 A;  2Q0Y A;  4K30 A;  1Z9U A;  2J8N A;  3TCV A;  5KTD A;  4U9Z A;  5ISV A;  3FYN A;  4FD7 A;  1CM0 A;  4Q36 A;  2FXF A;  2J8M A;  4A31 A;  2JDC A;  3SXN A;  3DNS A;  2PDO A;  4MFQ A;  4XPK A;  2PR1 A;  4ONU A;  3R9F A;  2Q04 A;  4PSW A;  4XNH B;  1Y9K A;  4KOW A;  4B10 A;  1UFH A;  2YGW A;  2WSA A;  2OU2 A;  1IYL A;  2ZXV A;  3PP9 A;  2Q7B A;  2EUI A;  2VI7 A;  2Q44 A;  4F0Y A;  4NCZ A;  4QB9 A;  4PK2 A;  4UCP A;  4U9Y A;  3FB3 A;  2WUU A;  2ZPA A;  1K4J A;  1S7K A;  4OAD A;  1IB1 E;  1YGH A;  2FCK A;  4CYP A;  3GY9 A;  3IWG A;  4XPD B;  4KOR A;  5AG5 A;  3SHP A;  5I0C A;  2WPW A;  4CAX A;  4X5K A;  3EC4 A;  3C26 A;  4CGP A;  1WWZ A;  4B5O A;  1N71 A;  2Z10 A;  1YK3 A;  4KUA A;  3I3G A;  2NMT A;  4A33 A;  4B5P B;  1Y7R A;  2ARH A;  4ORF A;  4JXQ A;  5BWA B;  3CXQ A;  1KUV A;  3VWE A;  2K5T A;  1PU9 A;  1IYK A;  2B4D A;  4HNW B;  5IV0 A;  4ZGY B;  5E96 A;  2BSW A;  4AG7 A;  4BMH A;  2Z3N A;  1I12 A;  3P2H A;  4MFZ A;  2B5G B;  4CGL A;  2REE A;  2VXK A;  3BLN A;  3TO6 A;  4JWP A;  2Z3K A;  3S6F A;  5H86 A;  4M85 A;  4R87 A;  2VBQ A;  1IID A;  4UCM A;  2G3A A;  2CXA A;  5C88 A;  3DDD A;  5G20 A;  3D2P A;  2QML A;  3TTH A;  3PZJ A;  3T90 A;  2ZW4 A;  1Q2C A;  2ZW7 A;  4CAE A;  2P0W A;  4FD6 A;  4YGO A;  4KOX A;  1XIX A;  2OZU A;  4RI1 A;  4UCN A;  1XE4 A;  1QST A;  2Z3L A;  4QC6 A;  4CS0 B;  3JTK A;  1YX0 A;  1XMT A;  3WR7 A;  1SQH A;  4JXR A;  4F6A A;  1RO5 A;  4JD6 A;  4B5P A;  2YND A;  4C2X A;  5AG4 A;  2Z3O A;  2GAN A;  2FT0 A;  2FS5 A;  3JUW A;  1VKC A;  4CYQ A;  3ZZI A;  1BO4 A;  1QSN A;  1P4N A;  2EVN A;  3EO4 A;  2FIA A;  2Z11 A;  2CNM A;  5F49 A;  4CAF A;  1FY7 A;  5G1Z A;  1KUY A;  3IGR A;  2I00 A;  4MFL A;  5DWM A;  3A9L A;  4M3S A;  4AVC A;  4UA3 A;  3K9U A;  2B4D B;  4KVM E;  5F47 A;  1M4G A;  3H5Z A;  4AVB A;  3CXS A;  2AE6 A;  4R3K A;  3GYA A;  2OH1 A;  3QAH A;  3D3S A;  3R1K A;  5HH1 A;  5KTC A;  4A32 A;  4A2Z A;  2D4P A;  4UFV A;  4CAW A;  2ATR A;  1L0C A;  4FD5 A;  2QIR A;  4LUA A;  4QUS A;  4E0A A;  4A30 A;  1S60 A;  2DPS A;  4YFJ A;  4R3L A;  4GS4 A;  4E8O A;  4CAV A;  4JJX A;  1GHE A;  1NE9 A;  4UWJ A;  5CNP A;  4YRH A;  4KSA A;  4F0X A;  3FRM A;  2G3T A;  3P2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...