1I21A

Crystal structure of yeast gna1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
158
structure length
155
Chain Sequence
MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFCKLIKYWNEATVWNDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSNAGVEMQIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
publication title The crystal structures of Apo and complexed Saccharomyces cerevisiae GNA1 shed light on the catalytic mechanism of an amino-sugar N-acetyltransferase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 38
structure length 155
sequence length 158
chains with identical sequence B, M, N, X, Y
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2001-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1i21A00
1RXTA 2EVNA 3I9SA 2VZZA 4HNXB 4RI1A 2VI7A 1IYLA 4KOYA 4H6UA 2G0BA 2B3UA 2CNMA 3T9YA 4AVCA 3TE4A 5F49A 4CRYB 4AB7A 4X5KA 1I21A 3W6SA 2PC1A 2O28A 2CY2A 1S7FA 3P2FA 4II9A 4AG7A 4K30A 1GHEA 4MJ8A 4KOXA 3TO9A 1MK4A 1KUXA 4IF5A 3EFAA 4NXYA 1J4JA 1YLEA 1RO5A 3CXSA 2H5MA 1TIQA 3DR8A 3SHPA 3V8IA 2R1IA 1SQHA 2A4NA 2ZW7A 4R3LA 2VBQA 4IUSA 1Q2YA 1CJWA 5DWNA 3W91A 2J8RA 2QIRA 2R98A 4NEXA 4B5OA 1YR0A 2P6FA 3TO7A 3RYOA 1B6BA 5JQ4A 1QSNA 4XPDB 1Y9WA 3KKWA 2I79A 2DXQA 3R96A 4KVXA 2REEA 3FRMA 4MI4A 3JVNA 1YVOA 4R3KA 2HUZA 5I0CA 1KUVA 1XE4A 1M4GA 1PU9A 4DNCA 3IGRA 2ARHA 2ZW4A 3FBUA 4XPDC 4NCZA 5J8CA 1YREA 4ZBGA 4ORFA 1Y9KA 5KTAA 2VZYA 4KVOE 3R1KA 3TO6A 2BEIA 3ZJ0A 3D2PA 1XMTA 4EVYA 2Y0MA 3S6KA 2BL1A 1KZFA 5EC4A 4MY3A 4LUAA 4XPKA 1V0CA 5C88A 2FCKA 2P6EA 2Q4VA 3FIXA 3FXTA 2OB0A 2GANA 3GYAA 3N7ZA 1FY7A 3PP9A 4I49A 2ZW6A 3BJ8A 2QMLA 4R87A 5EBVA 4PSWA 4L89A 2F5IA 3C26A 1MJBA 4B5PB 4FD7A 3GY9A 2B3VA 4MY0A 2FT0A 5HMNA 1R57A 4H6ZA 3ZZIA 4YGOA 4OLLA 2B4BA 4OAEA 1NMTA 3R95A 4KZTA 1LRZA 2PRBA 2Q44A 4HNWB 5DWMA 2VXKA 4UA3A 3QAHA 2ZPAA 3TTHA 5HH1A 5C82A 3GKRA 2BSWA 3F5BA 5IV0A 4J3GA 1S3ZA 2CNTA 3B8GA 1PUAA 4LX9A 5E96A 5J8FA 3EO4A 2JLMA 2FE7A 2PQ8A 1BO4A 4KOVA 3TFYA 4GS4A 3UY5A 3CXPA 5JPHA 3BJ7A 4HNYB 4PV6A 1Q2CA 4L8AA 1XF8A 2OU2A 2HV2A 5F48A 1L0CA 2R8VA 1VHSA 1K4JA 1M1DA 2B4DA 3W6XA 1S7NA 2WPWA 4H89A 3TCVA 1M44A 3D8PA 1S60A 1CM0A 3FNCA 3CXQA 3LODA 4JJXA 1QSTA 2ATRA 2C27A 2GE3A 4R9MA 4CRZB 3MGDA 4AVBA 2PSWA 4NSQA 1IIDA 2OZHA 5IB0A 4YFJA 4U9ZA 4RS2A 5FVJA 2G3TA 4MHDA 3D2MA 1YVKA 1Z9UA 1S7LA 2B58A 1UFHA 3G8WA 5H84A 4QUSA 2B4DB 2J8NA 5GCNA 2P0WA 2EUIA 3R9EA 2QECA 4U9YA 4E8OA 2JDDA 2Q0YA 4M85A 4PK2A 4QBJA 4JD6A 2D4PA 2IL4A 2J8MA 3DNSA 3F0AA 2REFA 4BMHA 3FYNA 1M4IA 3S6HA 4CS0B 4F0YA 2BUEA 2Z10A 4KVME 3G3SA 3VWEA 3QB8A 2OZUA 3WR7A 5KTCA 4QB9A 3SXOA 2CNSA 4FD5A 1KUYA 4KUAA 2FXFA 2AJ6A 4E0AA 4KLWA 4Y49C 1NSLA 4KOTA 2FSRA 4JWPA 2R7HA 1Z4RA 2Z0ZA 2Z11A 2B5GA 1QSMA 4CAWA 4F6AA 1WK4A 4QC6A 3S6GA 3EC4A 3S6FA 5KTDA 4PK3A 4KORA 4OADA 1BOBA 1M4DA 3DSBA 2Q7BA 2I00A 4KOSA 4CAVA 1IB1E 4XNHC 4E2AA 2JEVA 4AG9A 1Z4EA 5IX3A 2HQYA 3PGPA 1P0HA 4YRHA 3EY5A 2VQYA 2B5GB 2OZGA 5ISVA 1XEBA 4JXQA 2FS5A 3SXNA 5F47A 2P6GA 3I3GA 2Q04A 4KOUA 2VEZA 1U6MA 2PR1A 2PR8A 1YK3A 1P4NA 2PDOA 3VWDA 4ONUA 2FIWA 1VKCA 3TOBA 1OZPA 2FL4A 3H4QA 1WWZA 2Q4YA 4JXRA 2GIVA 1ON0A 4KLVA 4MBUA 1NE9A 1QSOA 2AE6A 1N71A 3IWGA 3DDDA 2X7BA 2ZW5A 5H86A 2ZXVA 2K5TA 1Q2DA 3R9FA 4QVTA 3JUWA 2KCWA 1Y7RA 4U5YA 3TT2A 3NE7A 1I12A 3D3SA 5CNPA 4FD6A 3PZJA 1MJAA 4PSXA 2JDCA 3TOAA 3K9UA 4M3SA 2FIAA 1I1DA 4Y49B 4KOWA 1YX0A 3LD2A 4FD4A 4CAXA 1MJ9A 4XPLA 4AVAA 1S5KA 1YGHA 4NF1A 1IICA 3EXNA 4B5PA 4UWJA 2G3AA 4HKFA 3FB3A 4KUBA 4R57A 2D4OA 2OH1A 1S7KA 4UBRA 4JLYA 1XIXA 3BLNA 2RC4A 1B87A 1IYKA 3T90A 3R9GA 3OWCA 4XNHB 4UWIA 5F46A 2NMTA 3DR6A 3F8KA 1QSRA 3P2HA 2WPXA 3E0KA
chains in the Genus database with same CATH superfamily
1RXTA 1RTQA 2EVNA 2IQ6A 2VZZA 3I9SA 4HNXB 4RI1A 2VI7A 1IYLA 4KOYA 4H6UA 2G0BA 2YGWA 2B3UA 2CNMA 3T9YA 4AVCA 2BOAA 2AFOA 3WABA 3TE4A 2PCUA 2AFMA 4P44A 5F49A 4CRYB 4FBEA 4AB7A 4X5KA 1I21A 4A30A 3W6SA 2PC1A 4ZYQA 4ZI6A 2O28A 3KZWA 4GM5A 2CY2A 1ZG7A 3WC7A 1IU8A 4OP4A 1R3NA 4Q7AA 1S7FA 5G1ZA 3P2FA 1XBUA 4II9A 4AG7A 3D67A 1LOKA 4K30A 2PJCA 1GHEA 4MHNA 4KOXA 4MJ8A 3D7DA 3TO9A 4OIWA 1MK4A 1KUXA 3PB9X 4MCPA 4IF5A 3EFAA 3PBBA 4NXYA 4NGSA 4IHMA 1J4JA 1YLEA 2PJ2A 1RO5A 3CXSA 1XMBA 2PJ6A 2GU2A 1H8LA 2H5MA 2I3CA 4P4JA 3VATA 4F8ZA 4FUUA 4F9UA 2PIYA 3PFEA 1TIQA 1IOFA 1AUGA 4LQ6A 3DR8A 1TKFA 3SHPA 3V8IA 2R1IA 1SQHA 2A4NA 2ZW7A 4R3LA 2PJBA 2VBQA 4DJLA 4IUSA 3SI0A 2V77A 3CT9A 4NGRA 5LYDA 5JGFA 1Q2YA 2BCOA 1BLLE 4FWUA 2OR4A 1CJWA 5DWNA 3W91A 4NJRA 2J8RA 2QIRA 3SJFA 4ZGYB 2R98A 4NEXA 4UFXA 2Q51A 4B5OA 2POKA 1YR0A 4NGTA 2P6FA 4PXCA 1Z2LA 3TO7A 3RYOA 1B6BA 5JQ4A 2DEAA 4RUHA 4F9VA 2WZNA 5LYIA 1QSNA 4XPDB 1JWQA 1Y9WA 2CF4A 1Z8XA 3KKWA 2I79A 4ONWA 4CGPA 2DXQA 4NJQA 3D7HA 5AG4A 3PEIA 3R96A 4KVXA 2QYVA 2REEA 3FRMA 5JM6A 2AFZA 4MI4A 1Z5RA 3KL9A 3JVNA 1YVOA 4R3KA 4PXDA 4C7IA 2HUZA 3HUVA 3CZXA 5I0CA 3H5ZA 1LAPA 1KUVA 5HVFA 3FEEA 3T8WA 4WWVA 1XE4A 2YNCA 4P4DA 4A33A 2AFSA 1CPXA 1M4GA 1PU9A 4M6HA 4OC5A 4DNCA 3IGRA 2ARHA 1A2ZA 2ZW4A 3H8EA 1Z8TA 3FBUA 4XPDC 2V8VA 2PJ9A 3IU1A 4NCZA 2C6GA 5J8CA 5K8PA 4A32A 2Q4ZA 1Z8WA 4MFKA 2PJ0A 1YREA 4ZBGA 4ORFA 1Y9KA 3RNZA 3BXMA 5KTAA 2Z3NA 2VZYA 4KVOE 3R1KA 1BPNA 3TO6A 1IGBA 3SI1A 2BEIA 3ZJ0A 3D2PA 2PJAA 4MMOA 2NSMA 4OMEA 1XMTA 4EVYA 2Y0MA 2GFQA 1XRYA 3S6KA 4MHYA 2BL1A 1KZFA 5EC4A 4A95A 3FF3A 2ZELA 4MY3A 4LUAA 4XPKA 2ZEHA 1V0CA 3ISXA 5C88A 4Z65A 2FCKA 2P6EA 2Q4VA 2GLFA 3FIXA 3FXTA 2F7VA 2OB0A 5HVGA 3I1UA 2DPSA 4UF4A 2GANA 3GYAA 4NGNA 4OC4A 3N7ZA 1FY7A 2EK8A 4ZX9A 4C7HA 3CDXA 3PP9A 1CG2A 4I49A 5AGEA 2ZW6A 3HLPA 5I4MA 3BJ8A 3FECA 4BINA 2QMLA 4P4BA 2XEIA 4R87A 5EBVA 4OC2A 4PSWA 1X10A 1BAVA 2G9DA 4L89A 4B13A 2F5IA 4ZX8A 1ZG8A 4P4IA 3PFOA 3FH4A 3C26A 2PIZA 4IK2A 1DTDA 1YMEA 1MJBA 3B35A 4B5PB 4FD7A 2YNCC 3S9LA 4MRIA 3RBUA 3NFZA 3GY9A 2B3VA 2EO8A 3GB0A 4MY0A 2JBKA 2FT0A 5HMNA 1R57A 5D8NA 3IO1A 4PQAA 4H6ZA 3A9LA 4UEZA 3ZZIA 3IFEA 4YGOA 4JZ0A 2EBJA 4OLLA 2B4BA 4OAEA 1NMTA 3R95A 4CGLA 2PJ8A 5G20A 4KZTA 4G1PA 1LRZA 2PRBA 2Q44A 4HNWB 3KGQA 2VXKA 4UA3A 4MFQA 5DWMA 3QAHA 2ZPAA 5F09A 3TTHA 5HH1A 2ZEFA 2EWBA 5C82A 3GKRA 3KQZA 2BSWA 3F5BA 4YU9A 4J3GA 4K3NA 1S3ZA 3D4UA 2CNTA 3B8GA 3TC8A 4CGNA 1PUAA 4LX9A 5E96A 5J8FA 3EO4A 4EMEA 1TF9A 2JLMA 2FE7A 2ANPA 1BO4A 2PQ8A 3D66A 3CPAA 4KOVA 1M4LA 4GS4A 5EMIA 3UY5A 3CXPA 3TFYA 4B12A 5JPHA 3RAMA 1OBRA 4CGOA 3BJ7A 1QMUA 3KI9A 4HNYB 4PV6A 3GIUA 2IMOA 4UCNA 1Q2CA 3PB8X 4R7MA 4L8AA 3GUXA 4ZY0A 5BWAB 1XF8A 2F8HA 5CPAA 2OU2A 2HV2A 3DLJA 5F48A 4C2XA 1L0CA 2R8VA 3PB6X 1VHSA 3D68A 1K4JA 5IB9A 4UIAA 1M1DA 2RFHA 2B4DA 3W6XA 4ZY2A 1S7NA 2WPWA 4H89A 5DS0A 3TCVA 2YNDA 2WUUA 2CTBA 1M44A 3VH9A 4MFJA 3S9NA 3D8PA 1VHEA 1Z8LA 1NSAA 1S60A 1CM0A 5ELYA 4MFPA 2HC9A 2NYQA 3CXQA 3FNCA 3KHXA 3LODA 4JJXA 3IC1A 1HDQA 1QSTA 2ATRA 2C27A 1CX8A 2C6PA 2GE3A 4M6GA 3FEDA 4R9MA 4CRZB 3E0KA 3MGDA 1FT7A 4AVBA 2PSWA 2AFXA 4NSQA 1PCAA 1TKJA 1IIDA 2OZHA 5IB0A 4YFJA 4U9ZA 2VL1A 4NGPA 4RS2A 5FVJA 2G3TA 4P4EA 4MHDA 1QQ9A 1YQEA 3B3VA 3D2MA 3WC5A 3MRUA 1YVKA 3B3SA 5CBMA 3DGVA 1Z9UA 4GXHA 5LYFA 1S7LA 2B58A 4OC1A 1UFHA 3G8WA 2RB7A 5H84A 3MN8A 2B4DB 4QUSA 2J8NA 5GCNA 4TNUA 1AYEA 2P0WA 5G21A 2EUIA 3R9EA 4OIDA 2QECA 4U9YA 3NH8A 1YW6A 5LRGA 4X8IA 2JDDA 4B14A 2Q0YA 3JRUA 4E8OA 4M85A 4CYOA 1VGYA 2XEFA 3IJ3A 1TF8A 3IIBA 4PK2A 3D7FA 4QBJA 4JD6A 4MHZA 4P4FA 5G22A 3KR5A 3SJXA 2D4PA 2IL4A 3BI0A 7CPAA 2J8MA 3DNSA 3F0AA 2REFA 4BMHA 2JEWA 3FYNA 3ISZA 1M4IA 3IWWA 4KSFA 4BBHA 2XEGA 3B7IA 3NE8A 4DUKA 3S6HA 4CS0B 4F0YA 4F0XA 2ZOFA 4FAIA 2BUEA 2Z10A 4MHPA 6CPAA 1Y0RA 4KVME 4PPZA 3G3SA 3VWEA 3QB8A 1CP6A 4WJBA 2OZUA 4UFWA 3WR7A 2V8GA 3PB7X 4UCMA 5KTCA 4QB9A 1KWMA 5THWA 3SXOA 2CNSA 2ZEDA 3S9MA 3IWEA 4FD5A 4X2TA 4R8FA 3KR4A 1KUYA 3RZAA 4KUAA 2FXFA 4CPAA 4B11A 3PB4X 2AJ6A 2C1CA 5K8MA 4HPSA 1IOIA 4E0AA 1ELMP 2QJ8A 1R43A 1TKHA 1ZG9A 4KLWA 5A28A 4EFDA 4KSIA 4Y49C 1NSLA 3LWUA 4UFVA 2PVWA 4KOTA 3D7GA 3K2KA 4KSAA 3N5FA 5AG5A 4P45A 2ZEMA 2ZEGA 4A94A 4A31A 2V8DA 4W9YA 2FSRA 4R76A 4JWPA 2R7HA 1YLOA 4NFRA 1Z4RA 2Z0ZA 2Z11A 2B5GA 1QSMA 4B6ZA 4MFZA 4CAWA 1WK4A 4QC6A 3S6GA 4F6AA 1DE4C 4UIBA 2ZOGA 3KASA 3EC4A 3S6FA 2AFWA 5KTDA 3CPXA 1EE3P 2O53A 4PK3A 4KORA 2J9AA 3V7ZA 3KQXA 2ZEOA 3B3TA 4OADA 1BOBA 1M4DA 4IAVA 4TWEA 1VIXA 3DSBA 2Q7BA 2FVGA 2I00A 4KOSA 3BHXA 4CAVA 5JH9A 1IB1E 2AFUA 4XNHC 1LANA 3WT4A 3V38A 4E2AA 2JEVA 2PRQA 2BO9A 4A39A 5K8OA 4MCRA 2IJZA 4M6IA 4AG9A 3B3CA 4CAEA 3KHZA 5K8NA 2GLJA 1Z4EA 5J1QA 5IX3A 2HQYA 2ABZA 1P0HA 3PGPA 4YRHA 3EY5A 2VQYA 5A27A 4DYOA 2Z3PA 2CIJA 2B5GB 1BPMA 2OZGA 3IU2A 5ISVA 1XEBA 4B10A 3WC6A 4JXQA 4MCSA 2FS5A 3SXNA 3VARA 4ZY1A 5D29A 5F47A 2P6GA 4A2ZA 3I3GA 2Q04A 3NH4A 4KOUA 4CYPA 2VEZA 4PXEA 1U6MA 2HB6A 2PR1A 3RO0A 3LMSA 2Z3LA 4EWTA 2PR8A 1YK3A 2O4HA 1P4NA 3JTKA 1ZO0A 4MXUA 2PDOA 3FX6A 1YW4A 3VWDA 4ONUA 4RN7A 2FIWA 1VKCA 4C2ZA 2CXAA 4NGMA 3H8GA 4H2KA 1F2OA 3TOBA 1OZPA 2FL4A 3H4QA 4UCPA 1ARMA 3B2YA 4X3RA 1WWZA 2Q4YA 4JXRA 1ZLHA 2GIVA 1Y0YA 3PBEA 4A38A 1ON0A 5LYLA 1LFWA 4KLVA 4MBUA 1NE9A 1Y7EA 1LAMA 1QSOA 1GYTA 4P6YA 1CP7A 2AE6A 3LACA 1CBXA 1N71A 4R6TA 5IV0A 4A37A 3IWGA 2PVVA 4CAFA 3DDDA 4Q36A 3IEHA 4OKOA 2WSAA 2X7BA 2ZW5A 3FMCA 4MCQA 4OC3A 3K9TA 4AXVA 5H86A 2ZXVA 4C2YA 2Q43A 2K5TA 3QAYA 1Q2DA 1YSJA 1JQGA 3R9FA 4QVTA 3JUWA 4CYNA 2KCWA 1Y7RA 3NA6A 2C6CA 4U5YA 3NE7A 1I12A 2WYRA 3D3SA 4UEFA 3TT2A 5CNPA 2EK9A 2OOTA 2PJ5A 1LCPA 3TX8A 1PYTB 2PE3A 4FD6A 1X12A 5LRJA 3H8FA 2ZENA 3PZJA 1HDUA 1MJAA 4C68A 3SI2A 4CGMA 4PSXA 4PXBA 2JDCA 2Q7SA 3TOAA 3K9UA 1TXRA 3BI1A 4M3SA 1XJOA 2FIAA 3GLJA 2QVPA 1I1DA 2ZEEA 8CPAA 4YWYA 2ZEPA 3SJGA 4Y49B 4KOWA 1YX0A 5AG6A 3NH5A 2PJ4A 4P10A 3LD2A 4NGQA 5LRKA 2DF5A 4FD4A 2DPTA 1ARLA 3FVLA 3L2NA 1FNOA 4CAXA 1MJ9A 4XPLA 3SJEA 4AVAA 1S5KA 2Z3OA 1YGHA 5HXDA 4NF1A 1IICA 3EXNA 4B5PA 4UWJA 2G3AA 2PJ7A 2Z3KA 4LQGA 4HKFA 3FB3A 4KUBA 2Z3MA 1ZLIA 4O23A 2D4OA 4OC0A 4R57A 2OH1A 1Q7LA 1S7KA 2GREA 2V8HA 4UEEA 5HVHA 4UBRA 1F2PA 1XOVA 4JLYA 4JYWA 2PJ1A 1XIXA 2ODFA 3BLNA 2JBJA 4BD9A 4CYQA 2YNEA 2RC4A 1B87A 4KS9A 1IYKA 2CTCA 3T90A 3R9GA 3OWCA 4XNHB 2PJ3A 1AMPA 1IY7A 5AG7A 2XEJA 4UWIA 1F57A 3FJUA 5F46A 2NMTA 1CPSA 1UWYA 3B3WA 3DR6A 4MFLA 1HEEA 3PRTA 1XFOA 3F8KA 3QNVA 4Q38A 1QSRA 1VHOA 3P2HA 2WPXA 1ELLP
chains in the Genus database with same CATH topology
1RXTA 2EVNA 3I9SA 2VZZA 4HNXB 4RI1A 2VI7A 1IYLA 4KOYA 4H6UA 2G0BA 2YGWA 2B3UA 2CNMA 3T9YA 4AVCA 3TE4A 5F49A 4CRYB 4AB7A 4X5KA 1I21A 4A30A 3W6SA 2PC1A 2O28A 2CY2A 5G1ZA 1S7FA 3P2FA 4II9A 4AG7A 4K30A 1GHEA 4MJ8A 4KOXA 3TO9A 1MK4A 1KUXA 4IF5A 3EFAA 4NXYA 1J4JA 1YLEA 1RO5A 3CXSA 2H5MA 1TIQA 3DR8A 3SHPA 3V8IA 2R1IA 1SQHA 2A4NA 2ZW7A 4R3LA 2VBQA 4IUSA 1Q2YA 1CJWA 5DWNA 3W91A 2J8RA 2QIRA 4ZGYB 2R98A 4NEXA 4UFXA 4B5OA 1YR0A 2P6FA 3TO7A 3RYOA 1B6BA 5JQ4A 1QSNA 4XPDB 1Y9WA 3KKWA 2I79A 5AG4A 4CGPA 2DXQA 3R96A 4KVXA 2REEA 3FRMA 4MI4A 3JVNA 1YVOA 4R3KA 4C7IA 2HUZA 5I0CA 3H5ZA 1KUVA 1XE4A 2YNCA 4A33A 1M4GA 1PU9A 4DNCA 3IGRA 2ARHA 2ZW4A 3FBUA 4XPDC 4NCZA 3IU1A 5J8CA 4A32A 4MFKA 1YREA 4ZBGA 4ORFA 1Y9KA 5KTAA 2Z3NA 2VZYA 4KVOE 3R1KA 3TO6A 2BEIA 3ZJ0A 3D2PA 1XMTA 4EVYA 2Y0MA 3S6KA 2BL1A 1KZFA 5EC4A 4A95A 4MY3A 4LUAA 4XPKA 1V0CA 5C88A 2FCKA 2P6EA 2Q4VA 3FIXA 3FXTA 2OB0A 2DPSA 2GANA 3GYAA 3N7ZA 1FY7A 4C7HA 3PP9A 4I49A 5AGEA 2ZW6A 3BJ8A 2QMLA 4R87A 5EBVA 4PSWA 4L89A 2F5IA 3C26A 1MJBA 4B5PB 4FD7A 2YNCC 3GY9A 2B3VA 4MY0A 2FT0A 5HMNA 1R57A 4H6ZA 3A9LA 3ZZIA 4YGOA 4OLLA 2B4BA 4OAEA 1NMTA 3R95A 4CGLA 5G20A 4KZTA 1LRZA 2PRBA 2Q44A 4HNWB 5DWMA 2VXKA 4UA3A 4MFQA 3QAHA 2ZPAA 3TTHA 5HH1A 5C82A 3GKRA 2BSWA 3F5BA 5IV0A 4J3GA 4CGNA 1S3ZA 2CNTA 3B8GA 1PUAA 4LX9A 5E96A 5J8FA 3EO4A 2JLMA 2FE7A 2PQ8A 1BO4A 4KOVA 3TFYA 4GS4A 3UY5A 3CXPA 4B12A 5JPHA 4CGOA 3BJ7A 4HNYB 4PV6A 4UCNA 1Q2CA 4L8AA 5BWAB 1XF8A 2OU2A 2HV2A 5F48A 4C2XA 1L0CA 2R8VA 1VHSA 1K4JA 1M1DA 2B4DA 3W6XA 1S7NA 2WPWA 4H89A 3TCVA 2YNDA 2WUUA 1M44A 4MFJA 3D8PA 1S60A 1CM0A 4MFPA 3FNCA 3CXQA 3LODA 4JJXA 1QSTA 2ATRA 2C27A 2GE3A 4R9MA 4CRZB 3MGDA 4AVBA 2PSWA 4NSQA 1IIDA 2OZHA 5IB0A 4YFJA 4U9ZA 4RS2A 5FVJA 2G3TA 4MHDA 3D2MA 1YVKA 1Z9UA 1S7LA 2B58A 1UFHA 3G8WA 5H84A 4QUSA 2B4DB 2J8NA 5GCNA 2P0WA 5G21A 2EUIA 3R9EA 2QECA 4U9YA 4E8OA 2JDDA 4B14A 2Q0YA 4M85A 4CYOA 4PK2A 4QBJA 4JD6A 5G22A 2D4PA 2IL4A 2J8MA 3DNSA 3F0AA 2REFA 4BMHA 3FYNA 1M4IA 4BBHA 4KSFA 3S6HA 4CS0B 4F0YA 4F0XA 2BUEA 2Z10A 4KVME 3G3SA 3VWEA 3QB8A 2OZUA 4UFWA 3WR7A 4UCMA 5KTCA 4QB9A 3SXOA 2CNSA 3IWEA 4FD5A 1KUYA 4KUAA 2FXFA 4B11A 2AJ6A 4E0AA 5A28A 4KLWA 4Y49C 1NSLA 4UFVA 4KOTA 4KSAA 5AG5A 4A31A 2FSRA 4JWPA 2R7HA 1Z4RA 2Z0ZA 2Z11A 2B5GA 1QSMA 4MFZA 4CAWA 1WK4A 4QC6A 3S6GA 4F6AA 3EC4A 3S6FA 5KTDA 4PK3A 4KORA 4OADA 1BOBA 1M4DA 3DSBA 2Q7BA 2I00A 4KOSA 4CAVA 1IB1E 4XNHC 4E2AA 2JEVA 4AG9A 4CAEA 1Z4EA 5IX3A 2HQYA 3PGPA 1P0HA 4YRHA 3EY5A 2VQYA 5A27A 2Z3PA 2B5GB 2OZGA 3IU2A 5ISVA 1XEBA 4B10A 4JXQA 2FS5A 3SXNA 5F47A 2P6GA 4A2ZA 3I3GA 2Q04A 4CYPA 4KOUA 2VEZA 1U6MA 2PR1A 2Z3LA 2PR8A 1YK3A 3JTKA 1P4NA 1ZO0A 2PDOA 3VWDA 4ONUA 2FIWA 1VKCA 4C2ZA 2CXAA 3TOBA 1OZPA 2FL4A 3H4QA 4UCPA 1WWZA 2Q4YA 4JXRA 2GIVA 1ON0A 4KLVA 4MBUA 1NE9A 1QSOA 2AE6A 1N71A 3IWGA 4CAFA 3DDDA 4Q36A 4B13A 2WSAA 2X7BA 2ZW5A 5H86A 2ZXVA 4C2YA 2K5TA 1Q2DA 3R9FA 4QVTA 3JUWA 4CYNA 2KCWA 1Y7RA 4U5YA 3TT2A 3NE7A 1I12A 3D3SA 5CNPA 4FD6A 4C68A 3PZJA 1MJAA 4CGMA 4PSXA 2JDCA 3TOAA 3K9UA 4M3SA 2FIAA 1I1DA 4Y49B 4KOWA 1YX0A 5AG6A 3LD2A 4FD4A 2DPTA 4CAXA 1MJ9A 4XPLA 4AVAA 1S5KA 2Z3OA 1YGHA 4NF1A 1IICA 3EXNA 4B5PA 4UWJA 2G3AA 2Z3KA 4HKFA 3FB3A 4KUBA 2Z3MA 4R57A 2D4OA 2OH1A 1S7KA 4UBRA 4JLYA 1XIXA 3BLNA 4CYQA 2YNEA 2RC4A 1B87A 4KS9A 1IYKA 3T90A 3R9GA 3OWCA 4XNHB 5AG7A 4UWIA 5F46A 2NMTA 3DR6A 4MFLA 3F8KA 4Q38A 1QSRA 3P2HA 2WPXA 3E0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RXT A;  2EVN A;  3I9S A;  2VZZ A;  4HNX B;  4RI1 A;  2VI7 A;  1IYL A;  4KOY A;  4H6U A;  2G0B A;  2B3U A;  2CNM A;  3T9Y A;  4AVC A;  3TE4 A;  5F49 A;  4CRY B;  4AB7 A;  4X5K A;  1I21 A;  3W6S A;  2PC1 A;  2O28 A;  2CY2 A;  1S7F A;  3P2F A;  4II9 A;  4AG7 A;  4K30 A;  1GHE A;  4MJ8 A;  4KOX A;  3TO9 A;  1MK4 A;  1KUX A;  4IF5 A;  3EFA A;  4NXY A;  1J4J A;  1YLE A;  1RO5 A;  3CXS A;  2H5M A;  1TIQ A;  3DR8 A;  3SHP A;  3V8I A;  2R1I A;  1SQH A;  2A4N A;  2ZW7 A;  4R3L A;  2VBQ A;  4IUS A;  1Q2Y A;  1CJW A;  5DWN A;  3W91 A;  2J8R A;  2QIR A;  2R98 A;  4NEX A;  4B5O A;  1YR0 A;  2P6F A;  3TO7 A;  3RYO A;  1B6B A;  5JQ4 A;  1QSN A;  4XPD B;  1Y9W A;  3KKW A;  2I79 A;  2DXQ A;  3R96 A;  4KVX A;  2REE A;  3FRM A;  4MI4 A;  3JVN A;  1YVO A;  4R3K A;  2HUZ A;  5I0C A;  1KUV A;  1XE4 A;  1M4G A;  1PU9 A;  4DNC A;  3IGR A;  2ARH A;  2ZW4 A;  3FBU A;  4XPD C;  4NCZ A;  5J8C A;  1YRE A;  4ZBG A;  4ORF A;  1Y9K A;  5KTA A;  2VZY A;  4KVO E;  3R1K A;  3TO6 A;  2BEI A;  3ZJ0 A;  3D2P A;  1XMT A;  4EVY A;  2Y0M A;  3S6K A;  2BL1 A;  1KZF A;  5EC4 A;  4MY3 A;  4LUA A;  4XPK A;  1V0C A;  5C88 A;  2FCK A;  2P6E A;  2Q4V A;  3FIX A;  3FXT A;  2OB0 A;  2GAN A;  3GYA A;  3N7Z A;  1FY7 A;  3PP9 A;  4I49 A;  2ZW6 A;  3BJ8 A;  2QML A;  4R87 A;  5EBV A;  4PSW A;  4L89 A;  2F5I A;  3C26 A;  1MJB A;  4B5P B;  4FD7 A;  3GY9 A;  2B3V A;  4MY0 A;  2FT0 A;  5HMN A;  1R57 A;  4H6Z A;  3ZZI A;  4YGO A;  4OLL A;  2B4B A;  4OAE A;  1NMT A;  3R95 A;  4KZT A;  1LRZ A;  2PRB A;  2Q44 A;  4HNW B;  5DWM A;  2VXK A;  4UA3 A;  3QAH A;  2ZPA A;  3TTH A;  5HH1 A;  5C82 A;  3GKR A;  2BSW A;  3F5B A;  5IV0 A;  4J3G A;  1S3Z A;  2CNT A;  3B8G A;  1PUA A;  4LX9 A;  5E96 A;  5J8F A;  3EO4 A;  2JLM A;  2FE7 A;  2PQ8 A;  1BO4 A;  4KOV A;  3TFY A;  4GS4 A;  3UY5 A;  3CXP A;  5JPH A;  3BJ7 A;  4HNY B;  4PV6 A;  1Q2C A;  4L8A A;  1XF8 A;  2OU2 A;  2HV2 A;  5F48 A;  1L0C A;  2R8V A;  1VHS A;  1K4J A;  1M1D A;  2B4D A;  3W6X A;  1S7N A;  2WPW A;  4H89 A;  3TCV A;  1M44 A;  3D8P A;  1S60 A;  1CM0 A;  3FNC A;  3CXQ A;  3LOD A;  4JJX A;  1QST A;  2ATR A;  2C27 A;  2GE3 A;  4R9M A;  4CRZ B;  3MGD A;  4AVB A;  2PSW A;  4NSQ A;  1IID A;  2OZH A;  5IB0 A;  4YFJ A;  4U9Z A;  4RS2 A;  5FVJ A;  2G3T A;  4MHD A;  3D2M A;  1YVK A;  1Z9U A;  1S7L A;  2B58 A;  1UFH A;  3G8W A;  5H84 A;  4QUS A;  2B4D B;  2J8N A;  5GCN A;  2P0W A;  2EUI A;  3R9E A;  2QEC A;  4U9Y A;  4E8O A;  2JDD A;  2Q0Y A;  4M85 A;  4PK2 A;  4QBJ A;  4JD6 A;  2D4P A;  2IL4 A;  2J8M A;  3DNS A;  3F0A A;  2REF A;  4BMH A;  3FYN A;  1M4I A;  3S6H A;  4CS0 B;  4F0Y A;  2BUE A;  2Z10 A;  4KVM E;  3G3S A;  3VWE A;  3QB8 A;  2OZU A;  3WR7 A;  5KTC A;  4QB9 A;  3SXO A;  2CNS A;  4FD5 A;  1KUY A;  4KUA A;  2FXF A;  2AJ6 A;  4E0A A;  4KLW A;  4Y49 C;  1NSL A;  4KOT A;  2FSR A;  4JWP A;  2R7H A;  1Z4R A;  2Z0Z A;  2Z11 A;  2B5G A;  1QSM A;  4CAW A;  4F6A A;  1WK4 A;  4QC6 A;  3S6G A;  3EC4 A;  3S6F A;  5KTD A;  4PK3 A;  4KOR A;  4OAD A;  1BOB A;  1M4D A;  3DSB A;  2Q7B A;  2I00 A;  4KOS A;  4CAV A;  1IB1 E;  4XNH C;  4E2A A;  2JEV A;  4AG9 A;  1Z4E A;  5IX3 A;  2HQY A;  3PGP A;  1P0H A;  4YRH A;  3EY5 A;  2VQY A;  2B5G B;  2OZG A;  5ISV A;  1XEB A;  4JXQ A;  2FS5 A;  3SXN A;  5F47 A;  2P6G A;  3I3G A;  2Q04 A;  4KOU A;  2VEZ A;  1U6M A;  2PR1 A;  2PR8 A;  1YK3 A;  1P4N A;  2PDO A;  3VWD A;  4ONU A;  2FIW A;  1VKC A;  3TOB A;  1OZP A;  2FL4 A;  3H4Q A;  1WWZ A;  2Q4Y A;  4JXR A;  2GIV A;  1ON0 A;  4KLV A;  4MBU A;  1NE9 A;  1QSO A;  2AE6 A;  1N71 A;  3IWG A;  3DDD A;  2X7B A;  2ZW5 A;  5H86 A;  2ZXV A;  2K5T A;  1Q2D A;  3R9F A;  4QVT A;  3JUW A;  2KCW A;  1Y7R A;  4U5Y A;  3TT2 A;  3NE7 A;  1I12 A;  3D3S A;  5CNP A;  4FD6 A;  3PZJ A;  1MJA A;  4PSX A;  2JDC A;  3TOA A;  3K9U A;  4M3S A;  2FIA A;  1I1D A;  4Y49 B;  4KOW A;  1YX0 A;  3LD2 A;  4FD4 A;  4CAX A;  1MJ9 A;  4XPL A;  4AVA A;  1S5K A;  1YGH A;  4NF1 A;  1IIC A;  3EXN A;  4B5P A;  4UWJ A;  2G3A A;  4HKF A;  3FB3 A;  4KUB A;  4R57 A;  2D4O A;  2OH1 A;  1S7K A;  4UBR A;  4JLY A;  1XIX A;  3BLN A;  2RC4 A;  1B87 A;  1IYK A;  3T90 A;  3R9G A;  3OWC A;  4XNH B;  4UWI A;  5F46 A;  2NMT A;  3DR6 A;  3F8K A;  1QSR A;  3P2H A;  2WPX A;  3E0K A; 
#chains in the Genus database with same CATH topology
 1RXT A;  1RTQ A;  2EVN A;  2IQ6 A;  2VZZ A;  3I9S A;  4HNX B;  4RI1 A;  2VI7 A;  1IYL A;  4KOY A;  4H6U A;  2G0B A;  2YGW A;  2B3U A;  2CNM A;  3T9Y A;  4AVC A;  2BOA A;  2AFO A;  3WAB A;  3TE4 A;  2PCU A;  2AFM A;  4P44 A;  5F49 A;  4CRY B;  4FBE A;  4AB7 A;  4X5K A;  1I21 A;  4A30 A;  3W6S A;  2PC1 A;  4ZYQ A;  4ZI6 A;  2O28 A;  3KZW A;  4GM5 A;  2CY2 A;  1ZG7 A;  3WC7 A;  1IU8 A;  4OP4 A;  1R3N A;  4Q7A A;  1S7F A;  5G1Z A;  3P2F A;  1XBU A;  4II9 A;  4AG7 A;  3D67 A;  1LOK A;  4K30 A;  2PJC A;  1GHE A;  4MHN A;  4KOX A;  4MJ8 A;  3D7D A;  3TO9 A;  4OIW A;  1MK4 A;  1KUX A;  3PB9 X;  4MCP A;  4IF5 A;  3EFA A;  3PBB A;  4NXY A;  4NGS A;  4IHM A;  1J4J A;  1YLE A;  2PJ2 A;  1RO5 A;  3CXS A;  1XMB A;  2PJ6 A;  2GU2 A;  1H8L A;  2H5M A;  2I3C A;  4P4J A;  3VAT A;  4F8Z A;  4FUU A;  4F9U A;  2PIY A;  3PFE A;  1TIQ A;  1IOF A;  1AUG A;  4LQ6 A;  3DR8 A;  1TKF A;  3SHP A;  3V8I A;  2R1I A;  1SQH A;  2A4N A;  2ZW7 A;  4R3L A;  2PJB A;  2VBQ A;  4DJL A;  4IUS A;  3SI0 A;  2V77 A;  3CT9 A;  4NGR A;  5LYD A;  5JGF A;  1Q2Y A;  2BCO A;  1BLL E;  4FWU A;  2OR4 A;  1CJW A;  5DWN A;  3W91 A;  4NJR A;  2J8R A;  2QIR A;  3SJF A;  4ZGY B;  2R98 A;  4NEX A;  4UFX A;  2Q51 A;  4B5O A;  2POK A;  1YR0 A;  4NGT A;  2P6F A;  4PXC A;  1Z2L A;  3TO7 A;  3RYO A;  1B6B A;  5JQ4 A;  2DEA A;  4RUH A;  4F9V A;  2WZN A;  5LYI A;  1QSN A;  4XPD B;  1JWQ A;  1Y9W A;  2CF4 A;  1Z8X A;  3KKW A;  2I79 A;  4ONW A;  4CGP A;  2DXQ A;  4NJQ A;  3D7H A;  5AG4 A;  3PEI A;  3R96 A;  4KVX A;  2QYV A;  2REE A;  3FRM A;  5JM6 A;  2AFZ A;  4MI4 A;  1Z5R A;  3KL9 A;  3JVN A;  1YVO A;  4R3K A;  4PXD A;  4C7I A;  2HUZ A;  3HUV A;  3CZX A;  5I0C A;  3H5Z A;  1LAP A;  1KUV A;  5HVF A;  3FEE A;  3T8W A;  4WWV A;  1XE4 A;  2YNC A;  4P4D A;  4A33 A;  2AFS A;  1CPX A;  1M4G A;  1PU9 A;  4M6H A;  4OC5 A;  4DNC A;  3IGR A;  2ARH A;  1A2Z A;  2ZW4 A;  3H8E A;  1Z8T A;  3FBU A;  4XPD C;  2V8V A;  2PJ9 A;  3IU1 A;  4NCZ A;  2C6G A;  5J8C A;  5K8P A;  4A32 A;  2Q4Z A;  1Z8W A;  4MFK A;  2PJ0 A;  1YRE A;  4ZBG A;  4ORF A;  1Y9K A;  3RNZ A;  3BXM A;  5KTA A;  2Z3N A;  2VZY A;  4KVO E;  3R1K A;  1BPN A;  3TO6 A;  1IGB A;  3SI1 A;  2BEI A;  3ZJ0 A;  3D2P A;  2PJA A;  4MMO A;  2NSM A;  4OME A;  1XMT A;  4EVY A;  2Y0M A;  2GFQ A;  1XRY A;  3S6K A;  4MHY A;  2BL1 A;  1KZF A;  5EC4 A;  4A95 A;  3FF3 A;  2ZEL A;  4MY3 A;  4LUA A;  4XPK A;  2ZEH A;  1V0C A;  3ISX A;  5C88 A;  4Z65 A;  2FCK A;  2P6E A;  2Q4V A;  2GLF A;  3FIX A;  3FXT A;  2F7V A;  2OB0 A;  5HVG A;  3I1U A;  2DPS A;  4UF4 A;  2GAN A;  3GYA A;  4NGN A;  4OC4 A;  3N7Z A;  1FY7 A;  2EK8 A;  4ZX9 A;  4C7H A;  3CDX A;  3PP9 A;  1CG2 A;  4I49 A;  5AGE A;  2ZW6 A;  3HLP A;  5I4M A;  3BJ8 A;  3FEC A;  4BIN A;  2QML A;  4P4B A;  2XEI A;  4R87 A;  5EBV A;  4OC2 A;  4PSW A;  1X10 A;  1BAV A;  2G9D A;  4L89 A;  4B13 A;  2F5I A;  4ZX8 A;  1ZG8 A;  4P4I A;  3PFO A;  3FH4 A;  3C26 A;  2PIZ A;  4IK2 A;  1DTD A;  1YME A;  1MJB A;  3B35 A;  4B5P B;  4FD7 A;  2YNC C;  3S9L A;  4MRI A;  3RBU A;  3NFZ A;  3GY9 A;  2B3V A;  2EO8 A;  3GB0 A;  4MY0 A;  2JBK A;  2FT0 A;  5HMN A;  1R57 A;  5D8N A;  3IO1 A;  4PQA A;  4H6Z A;  3A9L A;  4UEZ A;  3ZZI A;  3IFE A;  4YGO A;  4JZ0 A;  2EBJ A;  4OLL A;  2B4B A;  4OAE A;  1NMT A;  3R95 A;  4CGL A;  2PJ8 A;  5G20 A;  4KZT A;  4G1P A;  1LRZ A;  2PRB A;  2Q44 A;  4HNW B;  3KGQ A;  2VXK A;  4UA3 A;  4MFQ A;  5DWM A;  3QAH A;  2ZPA A;  5F09 A;  3TTH A;  5HH1 A;  2ZEF A;  2EWB A;  5C82 A;  3GKR A;  3KQZ A;  2BSW A;  3F5B A;  4YU9 A;  4J3G A;  4K3N A;  1S3Z A;  3D4U A;  2CNT A;  3B8G A;  3TC8 A;  4CGN A;  1PUA A;  4LX9 A;  5E96 A;  5J8F A;  3EO4 A;  4EME A;  1TF9 A;  2JLM A;  2FE7 A;  2ANP A;  1BO4 A;  2PQ8 A;  3D66 A;  3CPA A;  4KOV A;  1M4L A;  4GS4 A;  5EMI A;  3UY5 A;  3CXP A;  3TFY A;  4B12 A;  5JPH A;  3RAM A;  1OBR A;  4CGO A;  3BJ7 A;  1QMU A;  3KI9 A;  4HNY B;  4PV6 A;  3GIU A;  2IMO A;  4UCN A;  1Q2C A;  3PB8 X;  4R7M A;  4L8A A;  3GUX A;  4ZY0 A;  5BWA B;  1XF8 A;  2F8H A;  5CPA A;  2OU2 A;  2HV2 A;  3DLJ A;  5F48 A;  4C2X A;  1L0C A;  2R8V A;  3PB6 X;  1VHS A;  3D68 A;  1K4J A;  5IB9 A;  4UIA A;  1M1D A;  2RFH A;  2B4D A;  3W6X A;  4ZY2 A;  1S7N A;  2WPW A;  4H89 A;  5DS0 A;  3TCV A;  2YND A;  2WUU A;  2CTB A;  1M44 A;  3VH9 A;  4MFJ A;  3S9N A;  3D8P A;  1VHE A;  1Z8L A;  1NSA A;  1S60 A;  1CM0 A;  5ELY A;  4MFP A;  2HC9 A;  2NYQ A;  3CXQ A;  3FNC A;  3KHX A;  3LOD A;  4JJX A;  3IC1 A;  1HDQ A;  1QST A;  2ATR A;  2C27 A;  1CX8 A;  2C6P A;  2GE3 A;  4M6G A;  3FED A;  4R9M A;  4CRZ B;  3E0K A;  3MGD A;  1FT7 A;  4AVB A;  2PSW A;  2AFX A;  4NSQ A;  1PCA A;  1TKJ A;  1IID A;  2OZH A;  5IB0 A;  4YFJ A;  4U9Z A;  2VL1 A;  4NGP A;  4RS2 A;  5FVJ A;  2G3T A;  4P4E A;  4MHD A;  1QQ9 A;  1YQE A;  3B3V A;  3D2M A;  3WC5 A;  3MRU A;  1YVK A;  3B3S A;  5CBM A;  3DGV A;  1Z9U A;  4GXH A;  5LYF A;  1S7L A;  2B58 A;  4OC1 A;  1UFH A;  3G8W A;  2RB7 A;  5H84 A;  3MN8 A;  2B4D B;  4QUS A;  2J8N A;  5GCN A;  4TNU A;  1AYE A;  2P0W A;  5G21 A;  2EUI A;  3R9E A;  4OID A;  2QEC A;  4U9Y A;  3NH8 A;  1YW6 A;  5LRG A;  4X8I A;  2JDD A;  4B14 A;  2Q0Y A;  3JRU A;  4E8O A;  4M85 A;  4CYO A;  1VGY A;  2XEF A;  3IJ3 A;  1TF8 A;  3IIB A;  4PK2 A;  3D7F A;  4QBJ A;  4JD6 A;  4MHZ A;  4P4F A;  5G22 A;  3KR5 A;  3SJX A;  2D4P A;  2IL4 A;  3BI0 A;  7CPA A;  2J8M A;  3DNS A;  3F0A A;  2REF A;  4BMH A;  2JEW A;  3FYN A;  3ISZ A;  1M4I A;  3IWW A;  4KSF A;  4BBH A;  2XEG A;  3B7I A;  3NE8 A;  4DUK A;  3S6H A;  4CS0 B;  4F0Y A;  4F0X A;  2ZOF A;  4FAI A;  2BUE A;  2Z10 A;  4MHP A;  6CPA A;  1Y0R A;  4KVM E;  4PPZ A;  3G3S A;  3VWE A;  3QB8 A;  1CP6 A;  4WJB A;  2OZU A;  4UFW A;  3WR7 A;  2V8G A;  3PB7 X;  4UCM A;  5KTC A;  4QB9 A;  1KWM A;  5THW A;  3SXO A;  2CNS A;  2ZED A;  3S9M A;  3IWE A;  4FD5 A;  4X2T A;  4R8F A;  3KR4 A;  1KUY A;  3RZA A;  4KUA A;  2FXF A;  4CPA A;  4B11 A;  3PB4 X;  2AJ6 A;  2C1C A;  5K8M A;  4HPS A;  1IOI A;  4E0A A;  1ELM P;  2QJ8 A;  1R43 A;  1TKH A;  1ZG9 A;  4KLW A;  5A28 A;  4EFD A;  4KSI A;  4Y49 C;  1NSL A;  3LWU A;  4UFV A;  2PVW A;  4KOT A;  3D7G A;  3K2K A;  4KSA A;  3N5F A;  5AG5 A;  4P45 A;  2ZEM A;  2ZEG A;  4A94 A;  4A31 A;  2V8D A;  4W9Y A;  2FSR A;  4R76 A;  4JWP A;  2R7H A;  1YLO A;  4NFR A;  1Z4R A;  2Z0Z A;  2Z11 A;  2B5G A;  1QSM A;  4B6Z A;  4MFZ A;  4CAW A;  1WK4 A;  4QC6 A;  3S6G A;  4F6A A;  1DE4 C;  4UIB A;  2ZOG A;  3KAS A;  3EC4 A;  3S6F A;  2AFW A;  5KTD A;  3CPX A;  1EE3 P;  2O53 A;  4PK3 A;  4KOR A;  2J9A A;  3V7Z A;  3KQX A;  2ZEO A;  3B3T A;  4OAD A;  1BOB A;  1M4D A;  4IAV A;  4TWE A;  1VIX A;  3DSB A;  2Q7B A;  2FVG A;  2I00 A;  4KOS A;  3BHX A;  4CAV A;  5JH9 A;  1IB1 E;  2AFU A;  4XNH C;  1LAN A;  3WT4 A;  3V38 A;  4E2A A;  2JEV A;  2PRQ A;  2BO9 A;  4A39 A;  5K8O A;  4MCR A;  2IJZ A;  4M6I A;  4AG9 A;  3B3C A;  4CAE A;  3KHZ A;  5K8N A;  2GLJ A;  1Z4E A;  5J1Q A;  5IX3 A;  2HQY A;  2ABZ A;  1P0H A;  3PGP A;  4YRH A;  3EY5 A;  2VQY A;  5A27 A;  4DYO A;  2Z3P A;  2CIJ A;  2B5G B;  1BPM A;  2OZG A;  3IU2 A;  5ISV A;  1XEB A;  4B10 A;  3WC6 A;  4JXQ A;  4MCS A;  2FS5 A;  3SXN A;  3VAR A;  4ZY1 A;  5D29 A;  5F47 A;  2P6G A;  4A2Z A;  3I3G A;  2Q04 A;  3NH4 A;  4KOU A;  4CYP A;  2VEZ A;  4PXE A;  1U6M A;  2HB6 A;  2PR1 A;  3RO0 A;  3LMS A;  2Z3L A;  4EWT A;  2PR8 A;  1YK3 A;  2O4H A;  1P4N A;  3JTK A;  1ZO0 A;  4MXU A;  2PDO A;  3FX6 A;  1YW4 A;  3VWD A;  4ONU A;  4RN7 A;  2FIW A;  1VKC A;  4C2Z A;  2CXA A;  4NGM A;  3H8G A;  4H2K A;  1F2O A;  3TOB A;  1OZP A;  2FL4 A;  3H4Q A;  4UCP A;  1ARM A;  3B2Y A;  4X3R A;  1WWZ A;  2Q4Y A;  4JXR A;  1ZLH A;  2GIV A;  1Y0Y A;  3PBE A;  4A38 A;  1ON0 A;  5LYL A;  1LFW A;  4KLV A;  4MBU A;  1NE9 A;  1Y7E A;  1LAM A;  1QSO A;  1GYT A;  4P6Y A;  1CP7 A;  2AE6 A;  3LAC A;  1CBX A;  1N71 A;  4R6T A;  5IV0 A;  4A37 A;  3IWG A;  2PVV A;  4CAF A;  3DDD A;  4Q36 A;  3IEH A;  4OKO A;  2WSA A;  2X7B A;  2ZW5 A;  3FMC A;  4MCQ A;  4OC3 A;  3K9T A;  4AXV A;  5H86 A;  2ZXV A;  4C2Y A;  2Q43 A;  2K5T A;  3QAY A;  1Q2D A;  1YSJ A;  1JQG A;  3R9F A;  4QVT A;  3JUW A;  4CYN A;  2KCW A;  1Y7R A;  3NA6 A;  2C6C A;  4U5Y A;  3NE7 A;  1I12 A;  2WYR A;  3D3S A;  4UEF A;  3TT2 A;  5CNP A;  2EK9 A;  2OOT A;  2PJ5 A;  1LCP A;  3TX8 A;  1PYT B;  2PE3 A;  4FD6 A;  1X12 A;  5LRJ A;  3H8F A;  2ZEN A;  3PZJ A;  1HDU A;  1MJA A;  4C68 A;  3SI2 A;  4CGM A;  4PSX A;  4PXB A;  2JDC A;  2Q7S A;  3TOA A;  3K9U A;  1TXR A;  3BI1 A;  4M3S A;  1XJO A;  2FIA A;  3GLJ A;  2QVP A;  1I1D A;  2ZEE A;  8CPA A;  4YWY A;  2ZEP A;  3SJG A;  4Y49 B;  4KOW A;  1YX0 A;  5AG6 A;  3NH5 A;  2PJ4 A;  4P10 A;  3LD2 A;  4NGQ A;  5LRK A;  2DF5 A;  4FD4 A;  2DPT A;  1ARL A;  3FVL A;  3L2N A;  1FNO A;  4CAX A;  1MJ9 A;  4XPL A;  3SJE A;  4AVA A;  1S5K A;  2Z3O A;  1YGH A;  5HXD A;  4NF1 A;  1IIC A;  3EXN A;  4B5P A;  4UWJ A;  2G3A A;  2PJ7 A;  2Z3K A;  4LQG A;  4HKF A;  3FB3 A;  4KUB A;  2Z3M A;  1ZLI A;  4O23 A;  2D4O A;  4OC0 A;  4R57 A;  2OH1 A;  1Q7L A;  1S7K A;  2GRE A;  2V8H A;  4UEE A;  5HVH A;  4UBR A;  1F2P A;  1XOV A;  4JLY A;  4JYW A;  2PJ1 A;  1XIX A;  2ODF A;  3BLN A;  2JBJ A;  4BD9 A;  4CYQ A;  2YNE A;  2RC4 A;  1B87 A;  4KS9 A;  1IYK A;  2CTC A;  3T90 A;  3R9G A;  3OWC A;  4XNH B;  2PJ3 A;  1AMP A;  1IY7 A;  5AG7 A;  2XEJ A;  4UWI A;  1F57 A;  3FJU A;  5F46 A;  2NMT A;  1CPS A;  1UWY A;  3B3W A;  3DR6 A;  4MFL A;  1HEE A;  3PRT A;  1XFO A;  3F8K A;  3QNV A;  4Q38 A;  1QSR A;  1VHO A;  3P2H A;  2WPX A;  1ELL P; 
#chains in the Genus database with same CATH homology
 1RXT A;  2EVN A;  3I9S A;  2VZZ A;  4HNX B;  4RI1 A;  2VI7 A;  1IYL A;  4KOY A;  4H6U A;  2G0B A;  2YGW A;  2B3U A;  2CNM A;  3T9Y A;  4AVC A;  3TE4 A;  5F49 A;  4CRY B;  4AB7 A;  4X5K A;  1I21 A;  4A30 A;  3W6S A;  2PC1 A;  2O28 A;  2CY2 A;  5G1Z A;  1S7F A;  3P2F A;  4II9 A;  4AG7 A;  4K30 A;  1GHE A;  4MJ8 A;  4KOX A;  3TO9 A;  1MK4 A;  1KUX A;  4IF5 A;  3EFA A;  4NXY A;  1J4J A;  1YLE A;  1RO5 A;  3CXS A;  2H5M A;  1TIQ A;  3DR8 A;  3SHP A;  3V8I A;  2R1I A;  1SQH A;  2A4N A;  2ZW7 A;  4R3L A;  2VBQ A;  4IUS A;  1Q2Y A;  1CJW A;  5DWN A;  3W91 A;  2J8R A;  2QIR A;  4ZGY B;  2R98 A;  4NEX A;  4UFX A;  4B5O A;  1YR0 A;  2P6F A;  3TO7 A;  3RYO A;  1B6B A;  5JQ4 A;  1QSN A;  4XPD B;  1Y9W A;  3KKW A;  2I79 A;  5AG4 A;  4CGP A;  2DXQ A;  3R96 A;  4KVX A;  2REE A;  3FRM A;  4MI4 A;  3JVN A;  1YVO A;  4R3K A;  4C7I A;  2HUZ A;  5I0C A;  3H5Z A;  1KUV A;  1XE4 A;  2YNC A;  4A33 A;  1M4G A;  1PU9 A;  4DNC A;  3IGR A;  2ARH A;  2ZW4 A;  3FBU A;  4XPD C;  4NCZ A;  3IU1 A;  5J8C A;  4A32 A;  4MFK A;  1YRE A;  4ZBG A;  4ORF A;  1Y9K A;  5KTA A;  2Z3N A;  2VZY A;  4KVO E;  3R1K A;  3TO6 A;  2BEI A;  3ZJ0 A;  3D2P A;  1XMT A;  4EVY A;  2Y0M A;  3S6K A;  2BL1 A;  1KZF A;  5EC4 A;  4A95 A;  4MY3 A;  4LUA A;  4XPK A;  1V0C A;  5C88 A;  2FCK A;  2P6E A;  2Q4V A;  3FIX A;  3FXT A;  2OB0 A;  2DPS A;  2GAN A;  3GYA A;  3N7Z A;  1FY7 A;  4C7H A;  3PP9 A;  4I49 A;  5AGE A;  2ZW6 A;  3BJ8 A;  2QML A;  4R87 A;  5EBV A;  4PSW A;  4L89 A;  2F5I A;  3C26 A;  1MJB A;  4B5P B;  4FD7 A;  2YNC C;  3GY9 A;  2B3V A;  4MY0 A;  2FT0 A;  5HMN A;  1R57 A;  4H6Z A;  3A9L A;  3ZZI A;  4YGO A;  4OLL A;  2B4B A;  4OAE A;  1NMT A;  3R95 A;  4CGL A;  5G20 A;  4KZT A;  1LRZ A;  2PRB A;  2Q44 A;  4HNW B;  5DWM A;  2VXK A;  4UA3 A;  4MFQ A;  3QAH A;  2ZPA A;  3TTH A;  5HH1 A;  5C82 A;  3GKR A;  2BSW A;  3F5B A;  5IV0 A;  4J3G A;  4CGN A;  1S3Z A;  2CNT A;  3B8G A;  1PUA A;  4LX9 A;  5E96 A;  5J8F A;  3EO4 A;  2JLM A;  2FE7 A;  2PQ8 A;  1BO4 A;  4KOV A;  3TFY A;  4GS4 A;  3UY5 A;  3CXP A;  4B12 A;  5JPH A;  4CGO A;  3BJ7 A;  4HNY B;  4PV6 A;  4UCN A;  1Q2C A;  4L8A A;  5BWA B;  1XF8 A;  2OU2 A;  2HV2 A;  5F48 A;  4C2X A;  1L0C A;  2R8V A;  1VHS A;  1K4J A;  1M1D A;  2B4D A;  3W6X A;  1S7N A;  2WPW A;  4H89 A;  3TCV A;  2YND A;  2WUU A;  1M44 A;  4MFJ A;  3D8P A;  1S60 A;  1CM0 A;  4MFP A;  3FNC A;  3CXQ A;  3LOD A;  4JJX A;  1QST A;  2ATR A;  2C27 A;  2GE3 A;  4R9M A;  4CRZ B;  3MGD A;  4AVB A;  2PSW A;  4NSQ A;  1IID A;  2OZH A;  5IB0 A;  4YFJ A;  4U9Z A;  4RS2 A;  5FVJ A;  2G3T A;  4MHD A;  3D2M A;  1YVK A;  1Z9U A;  1S7L A;  2B58 A;  1UFH A;  3G8W A;  5H84 A;  4QUS A;  2B4D B;  2J8N A;  5GCN A;  2P0W A;  5G21 A;  2EUI A;  3R9E A;  2QEC A;  4U9Y A;  4E8O A;  2JDD A;  4B14 A;  2Q0Y A;  4M85 A;  4CYO A;  4PK2 A;  4QBJ A;  4JD6 A;  5G22 A;  2D4P A;  2IL4 A;  2J8M A;  3DNS A;  3F0A A;  2REF A;  4BMH A;  3FYN A;  1M4I A;  4BBH A;  4KSF A;  3S6H A;  4CS0 B;  4F0Y A;  4F0X A;  2BUE A;  2Z10 A;  4KVM E;  3G3S A;  3VWE A;  3QB8 A;  2OZU A;  4UFW A;  3WR7 A;  4UCM A;  5KTC A;  4QB9 A;  3SXO A;  2CNS A;  3IWE A;  4FD5 A;  1KUY A;  4KUA A;  2FXF A;  4B11 A;  2AJ6 A;  4E0A A;  5A28 A;  4KLW A;  4Y49 C;  1NSL A;  4UFV A;  4KOT A;  4KSA A;  5AG5 A;  4A31 A;  2FSR A;  4JWP A;  2R7H A;  1Z4R A;  2Z0Z A;  2Z11 A;  2B5G A;  1QSM A;  4MFZ A;  4CAW A;  1WK4 A;  4QC6 A;  3S6G A;  4F6A A;  3EC4 A;  3S6F A;  5KTD A;  4PK3 A;  4KOR A;  4OAD A;  1BOB A;  1M4D A;  3DSB A;  2Q7B A;  2I00 A;  4KOS A;  4CAV A;  1IB1 E;  4XNH C;  4E2A A;  2JEV A;  4AG9 A;  4CAE A;  1Z4E A;  5IX3 A;  2HQY A;  3PGP A;  1P0H A;  4YRH A;  3EY5 A;  2VQY A;  5A27 A;  2Z3P A;  2B5G B;  2OZG A;  3IU2 A;  5ISV A;  1XEB A;  4B10 A;  4JXQ A;  2FS5 A;  3SXN A;  5F47 A;  2P6G A;  4A2Z A;  3I3G A;  2Q04 A;  4CYP A;  4KOU A;  2VEZ A;  1U6M A;  2PR1 A;  2Z3L A;  2PR8 A;  1YK3 A;  3JTK A;  1P4N A;  1ZO0 A;  2PDO A;  3VWD A;  4ONU A;  2FIW A;  1VKC A;  4C2Z A;  2CXA A;  3TOB A;  1OZP A;  2FL4 A;  3H4Q A;  4UCP A;  1WWZ A;  2Q4Y A;  4JXR A;  2GIV A;  1ON0 A;  4KLV A;  4MBU A;  1NE9 A;  1QSO A;  2AE6 A;  1N71 A;  3IWG A;  4CAF A;  3DDD A;  4Q36 A;  4B13 A;  2WSA A;  2X7B A;  2ZW5 A;  5H86 A;  2ZXV A;  4C2Y A;  2K5T A;  1Q2D A;  3R9F A;  4QVT A;  3JUW A;  4CYN A;  2KCW A;  1Y7R A;  4U5Y A;  3TT2 A;  3NE7 A;  1I12 A;  3D3S A;  5CNP A;  4FD6 A;  4C68 A;  3PZJ A;  1MJA A;  4CGM A;  4PSX A;  2JDC A;  3TOA A;  3K9U A;  4M3S A;  2FIA A;  1I1D A;  4Y49 B;  4KOW A;  1YX0 A;  5AG6 A;  3LD2 A;  4FD4 A;  2DPT A;  4CAX A;  1MJ9 A;  4XPL A;  4AVA A;  1S5K A;  2Z3O A;  1YGH A;  4NF1 A;  1IIC A;  3EXN A;  4B5P A;  4UWJ A;  2G3A A;  2Z3K A;  4HKF A;  3FB3 A;  4KUB A;  2Z3M A;  4R57 A;  2D4O A;  2OH1 A;  1S7K A;  4UBR A;  4JLY A;  1XIX A;  3BLN A;  4CYQ A;  2YNE A;  2RC4 A;  1B87 A;  4KS9 A;  1IYK A;  3T90 A;  3R9G A;  3OWC A;  4XNH B;  5AG7 A;  4UWI A;  5F46 A;  2NMT A;  3DR6 A;  4MFL A;  3F8K A;  4Q38 A;  1QSR A;  3P2H A;  2WPX A;  3E0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...