4X5KA

Human naa50 complex with coenzyme a and an acetylated peptide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
GSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-alpha-acetyltransferase 50
publication title Human NAA50 with coenzymeA and a peptide
rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
total genus 39
structure length 153
sequence length 153
ec nomenclature ec 2.3.1.258: N-terminal methionine N(alpha)-acetyltransferase NatE.
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4x5kA00
4FD6A 1Q2YA 3JUWA 5C88A 4ORFA 4AB7A 1OZPA 3KKWA 2Z0ZA 2CY2A 3BJ8A 3CXPA 2I79A 1K4JA 2WPWA 4QVTA 1QSNA 4AG7A 2BL1A 4X5KA 4KOYA 2FXFA 4OLLA 1YK3A 3T90A 3W91A 2H5MA 2R98A 4MY3A 3N7ZA 4KZTA 3K9UA 1Q2CA 1Z9UA 3DDDA 4PK3A 2I00A 2O28A 1LRZA 1I1DA 3G8WA 2C27A 5EBVA 3TO6A 4II9A 2Z10A 3PP9A 2OZGA 2QMLA 1Y9WA 2ZW4A 4AVAA 3EXNA 4XNHC 2B3VA 3I3GA 4M85A 3GY9A 2REEA 4K30A 4XNHB 1P0HA 2NMTA 5JPHA 4NEXA 5DWMA 1XF8A 4JJXA 2PC1A 2ZW7A 1S7KA 1NMTA 4CRYB 3DR8A 2VI7A 4R57A 5HH1A 4YFJA 2P6EA 3H4QA 4KUBA 3TOBA 2P0WA 4YGOA 2ZXVA 4F6AA 2B5GB 2Q44A 1XEBA 3SHPA 5KTCA 3G3SA 2P6FA 3CXSA 2GE3A 5E96A 3GYAA 1BOBA 3W6SA 1ON0A 2VBQA 4KUAA 1MJ9A 1SQHA 3BLNA 2G3TA 2PSWA 5I0CA 1KZFA 2JDDA 2BSWA 2CNMA 4CRZB 3SXOA 2VZYA 2VXKA 1KUVA 2AE6A 2EVNA 1QSOA 3NE7A 2K5TA 1QSTA 2OH1A 1S3ZA 2ARHA 1U6MA 2OZHA 4R3LA 2FL4A 2JDCA 5FVJA 5F49A 1S7NA 2D4OA 3ZJ0A 3TFYA 3PGPA 3RYOA 4QBJA 4PSXA 1RXTA 3TO9A 4LUAA 1Z4RA 4E0AA 2R7HA 2Q7BA 4DNCA 3D2PA 5F46A 4KORA 2ZW5A 4FD7A 4NSQA 4R87A 3FXTA 5HMNA 3S6GA 2Q4VA 5H86A 2PR1A 4LX9A 1I12A 4QB9A 1TIQA 2Y0MA 2REFA 2JEVA 2Z11A 1IB1E 1PUAA 3R9FA 3D2MA 1S5KA 3S6KA 1I21A 2BUEA 3F8KA 4MHDA 4UWJA 1GHEA 3FIXA 4JD6A 1UFHA 2QECA 4UA3A 3TE4A 1M4DA 1IYLA 3FNCA 4CAVA 3LODA 4RS2A 1WWZA 1BO4A 4XPDC 1XE4A 2B5GA 3VWDA 4MBUA 4XPLA 1IYKA 5J8CA 5J8FA 1FY7A 4XPDB 2A4NA 1YLEA 1WK4A 2FE7A 4KOXA 3D8PA 3B8GA 3R96A 2Q04A 4JXRA 4L8AA 2HQYA 4HNXB 2FSRA 4MJ8A 1YVKA 3QAHA 3R1KA 4HNYB 2J8RA 3FBUA 2CNSA 2X7BA 4KOUA 4B5PB 5GCNA 4L89A 2F5IA 1NE9A 3TOAA 3UY5A 4YRHA 2G0BA 2VZZA 4H6ZA 4KOWA 3V8IA 1KUYA 4R9MA 4KOTA 2JLMA 1S7LA 1M4GA 2PR8A 2GANA 4AG9A 2VQYA 5C82A 2DXQA 4KVME 4QUSA 2FIWA 4ZBGA 5KTDA 2B4DB 2RC4A 1Z4EA 2R1IA 4OAEA 1YGHA 4PV6A 4NXYA 4E8OA 3S6FA 2D4PA 3FYNA 3F5BA 1CM0A 3W6XA 3JVNA 3OWCA 3F0AA 5IB0A 2FCKA 4KLVA 5ISVA 4KVOE 5IX3A 4U5YA 3C26A 1M1DA 3IGRA 4CAWA 1NSLA 4F0YA 4AVBA 3EO4A 1CJWA 3R9EA 2B4BA 2P6GA 2KCWA 2QIRA 2J8MA 2HUZA 3EC4A 3FB3A 4PK2A 4UWIA 4KLWA 2BEIA 4R3KA 4KOVA 3SXNA 1PU9A 5EC4A 3R95A 1Y7RA 3S6HA 4MY0A 1R57A 3EY5A 5F48A 1VHSA 5DWNA 4IUSA 1S60A 3VWEA 3EFAA 3BJ7A 3I9SA 5JQ4A 4FD4A 4QC6A 4B5PA 1IIDA 2WPXA 4JWPA 4I49A 3P2HA 5KTAA 1M4IA 1Y9KA 3DR6A 4CAXA 3DNSA 2Q4YA 3TT2A 4KOSA 3FRMA 5IV0A 4H6UA 1V0CA 5CNPA 1RO5A 1VKCA 2B58A 3WR7A 3LD2A 3IWGA 4RI1A 3CXQA 2OZUA 4B5OA 1MJBA 4NCZA 4HNWB 2FT0A 2B4DA 2IL4A 4CS0B 3GKRA 2PQ8A 3TCVA 2FS5A 2VEZA 2PDOA 1XIXA 2J8NA 4HKFA 1S7FA 2Q0YA 1YVOA 2OU2A 4FD5A 3DSBA 2GIVA 4GS4A 1B6BA 1J4JA 1KUXA 4OADA 2ATRA 2ZPAA 4U9ZA 3TTHA 4NF1A 3D3SA 4BMHA 4KVXA 1YREA 2R8VA 1B87A 1YX0A 1QSRA 5H84A 1XMTA 3R9GA 3TO7A 4Y49C 4MI4A 2PRBA 4JLYA 4JXQA 4IF5A 2AJ6A 4Y49B 5F47A 4M3SA 4H89A 1Q2DA 1P4NA 1M44A 4J3GA 4ONUA 2EUIA 3T9YA 3E0KA 1QSMA 1IICA 4UBRA 4AVCA 2CNTA 1MK4A 3ZZIA 1L0CA 3QB8A 2HV2A 4U9YA 3PZJA 2OB0A 2B3UA 3MGDA 2ZW6A 4E2AA 3P2FA 1N71A 2FIAA 4EVYA 4PSWA 1MJAA 1YR0A 2G3AA 4XPKA
chains in the Genus database with same CATH superfamily
4ZY2A 4FD6A 1Q2YA 3JUWA 5C88A 2QJ8A 4A32A 4ORFA 5K8OA 4AB7A 1OZPA 1DTDA 3KKWA 2Z0ZA 2CY2A 4DUKA 2Q51A 2PJ9A 4PXDA 3BJ8A 3CXPA 2I79A 1K4JA 1YW6A 2WPWA 1VIXA 4QVTA 2Z3MA 1QSNA 3DLJA 4A37A 4A2ZA 4AG7A 1PYTB 2BL1A 4OC3A 4X5KA 4KOYA 2FXFA 4OLLA 1YK3A 3T90A 3W91A 4FWUA 2H5MA 4KSIA 1ZG8A 4MCPA 2R98A 4MY3A 3N7ZA 2BO9A 4A31A 2ZEFA 2PJ7A 4KZTA 5LRGA 6CPAA 3K9UA 4A38A 4F8ZA 2RB7A 4BINA 1Q2CA 1Z9UA 2JBKA 1BPNA 2HC9A 2I00A 1IU8A 1LRZA 2O28A 3DDDA 4OIDA 4PK3A 3V38A 1I1DA 3G8WA 2C27A 2AFOA 5EBVA 2PJ8A 5AG5A 3TO6A 4EMEA 2GU2A 2GFQA 4Q36A 4II9A 2Z10A 3PP9A 3FECA 2OZGA 2QMLA 1Y9WA 2ZW4A 4AVAA 3EXNA 2ZEGA 1ZLHA 4XNHC 2B3VA 3I3GA 4M85A 3GY9A 4CAFA 1Y0YA 2REEA 4UCMA 3BXMA 2NYQA 4K30A 3CDXA 2AFWA 4XNHB 4NJQA 5G21A 1P0HA 2CF4A 3NH5A 4P4JA 5K8NA 2NMTA 5HXDA 5CPAA 5JPHA 1Y0RA 5LYFA 1CG2A 4NEXA 5DWMA 1XF8A 4JJXA 4Z65A 3HUVA 3PB9X 4ONWA 2PC1A 1CP6A 2ZW7A 4F0XA 2GLFA 4K3NA 1S7KA 1NMTA 4OP4A 4CRYB 3MRUA 5A28A 3DR8A 1LAPA 2VI7A 4R57A 5HH1A 3TC8A 3B2YA 2P6EA 3H4QA 4KUBA 4YFJA 2J9AA 3TOBA 2P0WA 4YGOA 2Z3LA 2Z3OA 2I3CA 2ZEOA 4IAVA 2ZXVA 4OMEA 4CAEA 4NGMA 2B5GB 4F6AA 3RAMA 3GLJA 2OR4A 3GB0A 3RO0A 2Q44A 3BHXA 1X12A 3D7HA 4CPAA 4MHNA 1XEBA 2ZELA 3IEHA 3NH4A 3SHPA 3FEDA 3GUXA 5KTCA 4PPZA 3G3SA 2P6FA 3PFOA 3CXSA 2GE3A 1F2OA 2V77A 2EBJA 5E96A 3GYAA 3K2KA 1BOBA 3W6SA 1ON0A 2VBQA 1ZLIA 3B3WA 3B3TA 3IIBA 4KUAA 2XEIA 4AXVA 1TKHA 1MJ9A 3PB8X 1SQHA 2JEWA 3QNVA 3BLNA 2G3TA 2PSWA 5I0CA 1QMUA 1KZFA 4B12A 2JDDA 1ELLP 4OC0A 4X2TA 4BD9A 2BSWA 2C6PA 2CNMA 2XEFA 4CRZB 3SXOA 2VZYA 2VXKA 3KQXA 3ISZA 1KUVA 4CYOA 1XMBA 2AE6A 2EVNA 2PIZA 5LYIA 5K8MA 1QSOA 2POKA 3NE7A 2K5TA 1QSTA 2OH1A 1S3ZA 2ARHA 1CPSA 4NJRA 1U6MA 3D7DA 2OZHA 4ZYQA 2ODFA 3VH9A 1ARLA 3S9NA 4R3LA 4TNUA 2C1CA 1LOKA 2FL4A 2ZEPA 1PCAA 2JDCA 5FVJA 3PEIA 5F49A 1S7NA 4C2XA 2Z3PA 4GXHA 4MFJA 3B7IA 5JM6A 2D4OA 4MCRA 2DPSA 2C6GA 3ZJ0A 3TFYA 4CGOA 4F9UA 2DEAA 2CXAA 5D8NA 3PGPA 2ABZA 3RYOA 4QBJA 2PVVA 2HB6A 4PSXA 1RXTA 3TO9A 2PJ4A 4LUAA 3IFEA 1Z4RA 1TF9A 1Y7EA 1HEEA 4E0AA 3RNZA 2R7HA 1FNOA 1JWQA 2DF5A 4O23A 2Q7BA 4UFWA 4DNCA 3D2PA 2O4HA 2AFZA 4C2YA 4NFRA 5F46A 4B6ZA 4UCPA 4KORA 3SJXA 2ZW5A 4FD7A 4NSQA 2DPTA 4R87A 3FXTA 5HMNA 1AMPA 3FMCA 3NFZA 3S6GA 2Q4VA 5H86A 2PR1A 4LX9A 3PBBA 1I12A 3N5FA 3FJUA 3KR4A 8CPAA 4QB9A 1TIQA 2Y0MA 4MHZA 2REFA 1X10A 4UCNA 2JEVA 2Z11A 1IB1E 1PUAA 3R9FA 1BLLE 2YNDA 3D2MA 3H8FA 4G1PA 4R7MA 3WC7A 2F7VA 1S5KA 4W9YA 3S6KA 2PIYA 5JH9A 3SJFA 4MXUA 5G20A 1I21A 2BUEA 2CIJA 1CBXA 3F8KA 4MHDA 4UWJA 1GHEA 3IWEA 3KGQA 3FIXA 4GM5A 4JYWA 3DGVA 4P4IA 5CBMA 4JD6A 3S9LA 1LAMA 1UFHA 2QECA 1Z8LA 1ZG7A 2RFHA 5AGEA 2EK9A 4UA3A 3TE4A 4C68A 2OOTA 1M4DA 3GIUA 1TF8A 1XFOA 3WABA 1IYLA 3FNCA 4B10A 4CAVA 3LODA 4RS2A 4P4DA 1WWZA 1BO4A 2G9DA 4XPDC 1A2ZA 1XE4A 3V7ZA 1BPMA 2B5GA 5BWAB 3KQZA 3VWDA 4MBUA 4XPLA 1IYKA 2Q4ZA 4A39A 4B13A 1FY7A 5A27A 5J8FA 5J8CA 4XPDB 4R76A 4P44A 2A4NA 1YLEA 3RBUA 3PFEA 4C7IA 1WK4A 1F2PA 2AFMA 1YW4A 2FE7A 3B3VA 3BI0A 4KOXA 3D8PA 3B8GA 3R96A 2Q04A 3I1UA 3JRUA 2ZEDA 3NA6A 4JXRA 4P45A 4ZY0A 2F8HA 1H8LA 1Z2LA 2PJAA 3RZAA 4A94A 4L8AA 2HQYA 3TX8A 4HNXB 4MMOA 2FSRA 4MJ8A 1YVKA 4CYQA 3QAHA 5HVHA 4OKOA 3R1KA 4HNYB 4B14A 2J8RA 4A33A 3FBUA 3SI0A 4KSFA 5F09A 2CNSA 2X7BA 3PB4X 4KOUA 4B5PB 2IJZA 1TXRA 2PJ5A 3H8GA 5GCNA 2ZENA 3CPXA 4L89A 4MHPA 5D29A 1VHEA 2F5IA 4NGSA 2PJ2A 1NE9A 3TOAA 4NGTA 3IJ3A 3UY5A 4YRHA 2V8GA 2EWBA 2G0BA 1M4LA 2VZZA 1CP7A 4MFLA 4UEZA 4H6ZA 4KOWA 3V8IA 1KUYA 2YNEA 2IQ6A 4R9MA 4KOTA 3CZXA 4NGNA 3KZWA 3ISXA 3D67A 3IU2A 2JLMA 1XRYA 5ELYA 4C7HA 1S7LA 1M4GA 2PR8A 3FVLA 3KR5A 2GANA 4AG9A 4MFZA 2VQYA 3VATA 5C82A 2DXQA 4KVME 4QUSA 2FIWA 3PBEA 4ZBGA 5KTDA 2B4DB 1XJOA 2NSMA 4CGLA 2RC4A 2WSAA 1Z4EA 3D4UA 2R1IA 1ARMA 4OAEA 1YGHA 3LWUA 4OIWA 4NXYA 4PV6A 4R6TA 4E8OA 1IOFA 1IOIA 3S6FA 2VL1A 4X8IA 1IY7A 4MFPA 4OC5A 2D4PA 3FYNA 3F5BA 4OC1A 5JGFA 2Z3NA 4UEEA 4PQAA 1CM0A 3W6XA 3JVNA 1FT7A 3OWCA 3F0AA 5IB0A 4DJLA 2FCKA 4KLVA 1XOVA 5ISVA 4KVOE 2AFSA 1ELMP 2PJ0A 1LANA 1YMEA 4KSAA 4WJBA 3FH4A 5IX3A 4U5YA 3C26A 1M1DA 3IGRA 5EMIA 2PJBA 1GYTA 3A9LA 1NSLA 4CAWA 4F0YA 4MCSA 4AVBA 4M6HA 5G22A 2GLJA 1Z5RA 2EO8A 3EO4A 1CJWA 1VGYA 2BOAA 3R9EA 2B4BA 2P6GA 2QVPA 2QYVA 2KCWA 2QIRA 2J8MA 3KL9A 2HUZA 4WWVA 4LQ6A 3EC4A 3FB3A 4PK2A 4UWIA 5I4MA 4ZI6A 5AG7A 3IO1A 4OC2A 1LCPA 4KLWA 1AYEA 2BEIA 3K9TA 2PRQA 4R3KA 4A30A 3CPAA 4KOVA 3NH8A 3SXNA 1PU9A 5EC4A 4UIAA 3IWWA 4KS9A 5LYLA 1F57A 2Q43A 3R95A 2ZEMA 1TKFA 1Y7RA 3D66A 4YWYA 3S6HA 4MFKA 2O53A 4UIBA 2IMOA 4MY0A 4TWEA 1R57A 3EY5A 5F48A 4P6YA 2ANPA 4PXEA 4ZX8A 5LRJA 1VHSA 2PJ6A 4HPSA 5DWNA 1LFWA 4IUSA 2V8DA 1S60A 2PE3A 3LACA 4R8FA 2XEGA 4FUUA 3KI9A 4CGNA 1QQ9A 1ZG9A 3VWEA 3FX6A 1JQGA 3EFAA 2Z3KA 3PRTA 3BJ7A 3I9SA 3D7GA 5JQ4A 2CTBA 1CX8A 2GREA 4FD4A 4QC6A 4B5PA 1IIDA 2WPXA 4JWPA 4I49A 3P2HA 5KTAA 1M4IA 5AG4A 1Y9KA 2YNCC 5DS0A 3DR6A 3SJGA 4H2KA 4CAXA 1HDUA 3DNSA 2Q4YA 3KHXA 3T8WA 4KOSA 3TT2A 3FRMA 2ZEEA 1NSAA 4P4FA 4UFXA 5IV0A 1Z8WA 1YSJA 4H6UA 1V0CA 2PJ1A 5CNPA 1RO5A 2WZNA 1VKCA 3L2NA 3FEEA 2B58A 3WR7A 2C6CA 2JBJA 3LD2A 2AFXA 3IWGA 4RI1A 3CXQA 2OZUA 1AUGA 2AFUA 2Q7SA 4B5OA 1MJBA 4P4BA 3B35A 3S9MA 3CT9A 4NCZA 4HNWB 3PB7X 4PXCA 5G1ZA 4ZY1A 4UEFA 4RN7A 4F9VA 2FT0A 4DYOA 3WC6A 2PJ3A 2B4DA 2IL4A 4BBHA 4PXBA 4P4EA 4CS0B 3GKRA 2EK8A 2ZOGA 2PJCA 4Q7AA 2PQ8A 3TCVA 2FS5A 2VEZA 2PDOA 1XIXA 3D7FA 4Q38A 3IC1A 5LYDA 5THWA 4UF4A 2J8NA 1Z8TA 3FF3A 4HKFA 1S7FA 1YLOA 4JZ0A 2PCUA 2Q0YA 1YVOA 3B3SA 4B11A 2OU2A 4FD5A 3DSBA 4OC4A 2V8HA 3KASA 2GIVA 4GS4A 4NGQA 1B6BA 3SJEA 5J1QA 2FVGA 1J4JA 1KUXA 4OADA 2ATRA 5AG6A 2ZPAA 4NGRA 2CTCA 4U9ZA 3TTHA 1VHOA 4NF1A 3D3SA 4BMHA 4KVXA 4EFDA 2WYRA 3HLPA 1DE4C 1YREA 4UFVA 2R8VA 1B87A 1OBRA 4CGPA 3SI1A 3NE8A 1CPXA 1YX0A 1QSRA 5H84A 1XMTA 1IGBA 3R9GA 4CYNA 3TO7A 4Y49C 4MI4A 2PRBA 4JLYA 2ZOFA 4JXQA 2WUUA 4ZGYB 3QAYA 1HDQA 4IF5A 1ZO0A 2AJ6A 3D68A 4M6IA 1YQEA 5IB9A 4Y49B 5F47A 4M3SA 1TKJA 4H89A 4ZX9A 1Q2DA 4MHYA 3PB6X 5HVFA 4FBEA 3SI2A 1P4NA 1R3NA 1M44A 4J3GA 1EE3P 4ONUA 2EUIA 4MCQA 3T9YA 3H8EA 4P10A 3E0KA 3KHZA 1QSMA 3VARA 2ZEHA 1IICA 2PVWA 4UBRA 4RUHA 4AVCA 3WT4A 1RTQA 2CNTA 4MFQA 2YGWA 1MK4A 3MN8A 3ZZIA 4FAIA 3BI1A 2XEJA 4MRIA 1L0CA 4CYPA 3QB8A 3B3CA 5HVGA 5K8PA 2HV2A 2BCOA 1XBUA 4U9YA 3PZJA 2OB0A 4C2ZA 4NGPA 5LRKA 2B3UA 4YU9A 3MGDA 2ZW6A 1R43A 3P2FA 4M6GA 1N71A 4A95A 4E2AA 1Q7LA 4LQGA 3JTKA 2FIAA 3IU1A 1UWYA 4EWTA 3LMSA 1KWMA 1Z8XA 4IK2A 4EVYA 4IHMA 4PSWA 2V8VA 1MJAA 4CGMA 1YR0A 2YNCA 3H5ZA 4X3RA 2G3AA 4XPKA 1BAVA 3WC5A 7CPAA
chains in the Genus database with same CATH topology
4FD6A 1Q2YA 3JUWA 5C88A 4A32A 4ORFA 4AB7A 1OZPA 3KKWA 2Z0ZA 2CY2A 3BJ8A 3CXPA 2I79A 1K4JA 2WPWA 4QVTA 2Z3MA 1QSNA 4A2ZA 4AG7A 2BL1A 4X5KA 4KOYA 2FXFA 4OLLA 1YK3A 3T90A 3W91A 2H5MA 2R98A 4MY3A 3N7ZA 4A31A 4KZTA 3K9UA 1Q2CA 1Z9UA 3DDDA 4PK3A 2I00A 2O28A 1LRZA 1I1DA 3G8WA 2C27A 5EBVA 5AG5A 3TO6A 4Q36A 4II9A 2Z10A 3PP9A 2OZGA 2QMLA 1Y9WA 2ZW4A 4AVAA 3EXNA 4XNHC 2B3VA 3I3GA 4M85A 3GY9A 4CAFA 2REEA 4UCMA 4K30A 4XNHB 5G21A 1P0HA 2NMTA 5JPHA 4NEXA 5DWMA 1XF8A 4JJXA 2PC1A 2ZW7A 4F0XA 1S7KA 1NMTA 4CRYB 5A28A 3DR8A 2VI7A 4R57A 5HH1A 4YFJA 2P6EA 3H4QA 4KUBA 3TOBA 2P0WA 4YGOA 2Z3LA 2Z3OA 2ZXVA 4CAEA 4F6AA 2B5GB 2Q44A 1XEBA 3SHPA 5KTCA 3G3SA 2P6FA 3CXSA 2GE3A 5E96A 3GYAA 1BOBA 3W6SA 1ON0A 2VBQA 4KUAA 1MJ9A 1SQHA 3BLNA 2G3TA 2PSWA 5I0CA 1KZFA 4B12A 2JDDA 2BSWA 2CNMA 4CRZB 3SXOA 2VZYA 2VXKA 4CYOA 1KUVA 2AE6A 2EVNA 1QSOA 3NE7A 2K5TA 1QSTA 2OH1A 1S3ZA 2ARHA 1U6MA 2OZHA 4R3LA 2FL4A 2JDCA 5FVJA 5F49A 4C2XA 1S7NA 2Z3PA 4MFJA 2D4OA 2DPSA 3ZJ0A 3TFYA 4CGOA 2CXAA 3PGPA 3RYOA 4QBJA 4PSXA 1RXTA 3TO9A 4LUAA 1Z4RA 4E0AA 2R7HA 2Q7BA 4UFWA 4DNCA 3D2PA 4C2YA 5F46A 4UCPA 4KORA 2ZW5A 4FD7A 4NSQA 2DPTA 4R87A 3FXTA 5HMNA 3S6GA 2Q4VA 5H86A 2PR1A 4LX9A 1I12A 4QB9A 1TIQA 2Y0MA 2REFA 4UCNA 2JEVA 2Z11A 1IB1E 1PUAA 3R9FA 3D2MA 2YNDA 1S5KA 3S6KA 5G20A 1I21A 2BUEA 3F8KA 4MHDA 4UWJA 1GHEA 3IWEA 3FIXA 4JD6A 1UFHA 2QECA 5AGEA 4UA3A 3TE4A 4C68A 1M4DA 1IYLA 3FNCA 4B10A 4CAVA 3LODA 4RS2A 1WWZA 1BO4A 4XPDC 1XE4A 5BWAB 2B5GA 3VWDA 4MBUA 4XPLA 1IYKA 5J8CA 4B13A 5J8FA 1FY7A 5A27A 4XPDB 2A4NA 1YLEA 4C7IA 1WK4A 2FE7A 4KOXA 3D8PA 3B8GA 3R96A 2Q04A 4JXRA 4L8AA 2HQYA 4HNXB 2FSRA 4MJ8A 1YVKA 4CYQA 3QAHA 3R1KA 4HNYB 4B14A 2J8RA 4A33A 3FBUA 4KSFA 2CNSA 2X7BA 4KOUA 4B5PB 5GCNA 4L89A 2F5IA 1NE9A 3TOAA 3UY5A 4YRHA 2G0BA 2VZZA 4MFLA 4H6ZA 4KOWA 3V8IA 1KUYA 2YNEA 4R9MA 4KOTA 3IU2A 2JLMA 4C7HA 1S7LA 1M4GA 2PR8A 2GANA 4AG9A 4MFZA 2VQYA 5C82A 2DXQA 4KVME 4QUSA 2FIWA 4ZBGA 5KTDA 2B4DB 4CGLA 2RC4A 2WSAA 1Z4EA 2R1IA 4OAEA 1YGHA 4PV6A 4NXYA 4E8OA 3S6FA 4MFPA 2D4PA 3FYNA 3F5BA 2Z3NA 1CM0A 3W6XA 3JVNA 3OWCA 3F0AA 5IB0A 2FCKA 4KLVA 5ISVA 4KVOE 4KSAA 5IX3A 4U5YA 3C26A 1M1DA 3IGRA 4CAWA 3A9LA 1NSLA 4F0YA 4AVBA 5G22A 3EO4A 1CJWA 3R9EA 2B4BA 2P6GA 2KCWA 2QIRA 2J8MA 2HUZA 3EC4A 3FB3A 4PK2A 4UWIA 5AG7A 4KLWA 2BEIA 4R3KA 4A30A 4KOVA 3SXNA 1PU9A 5EC4A 4KS9A 3R95A 1Y7RA 3S6HA 4MFKA 4MY0A 1R57A 3EY5A 5F48A 1VHSA 5DWNA 4IUSA 1S60A 4CGNA 3VWEA 3EFAA 2Z3KA 3BJ7A 3I9SA 5JQ4A 4FD4A 4QC6A 4B5PA 1IIDA 2WPXA 4JWPA 4I49A 3P2HA 5KTAA 1M4IA 5AG4A 1Y9KA 2YNCC 3DR6A 4CAXA 3DNSA 2Q4YA 3TT2A 4KOSA 3FRMA 4UFXA 5IV0A 4H6UA 1V0CA 5CNPA 1RO5A 1VKCA 2B58A 3WR7A 3LD2A 3IWGA 4RI1A 3CXQA 2OZUA 4B5OA 1MJBA 4NCZA 4HNWB 5G1ZA 2FT0A 2B4DA 2IL4A 4BBHA 4CS0B 3GKRA 2PQ8A 3TCVA 2FS5A 2VEZA 2PDOA 1XIXA 4Q38A 2J8NA 4HKFA 1S7FA 4B11A 2Q0YA 1YVOA 2OU2A 4FD5A 3DSBA 2GIVA 4GS4A 1B6BA 1J4JA 1KUXA 4OADA 2ATRA 5AG6A 2ZPAA 4U9ZA 3TTHA 4NF1A 3D3SA 4BMHA 4KVXA 4UFVA 1YREA 2R8VA 1B87A 4CGPA 1YX0A 1QSRA 5H84A 1XMTA 3R9GA 4CYNA 3TO7A 4Y49C 4MI4A 2PRBA 4JLYA 4JXQA 2WUUA 4ZGYB 4IF5A 1ZO0A 2AJ6A 4Y49B 5F47A 4M3SA 4H89A 1Q2DA 1P4NA 1M44A 4J3GA 4ONUA 2EUIA 3T9YA 3E0KA 1QSMA 1IICA 4UBRA 4AVCA 2CNTA 4MFQA 2YGWA 1MK4A 3ZZIA 1L0CA 4CYPA 3QB8A 2HV2A 4U9YA 3PZJA 2OB0A 4C2ZA 2B3UA 3MGDA 2ZW6A 4E2AA 3P2FA 4A95A 1N71A 3JTKA 2FIAA 3IU1A 4EVYA 4PSWA 1MJAA 4CGMA 1YR0A 2YNCA 3H5ZA 2G3AA 4XPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FD6 A;  1Q2Y A;  3JUW A;  5C88 A;  4ORF A;  4AB7 A;  1OZP A;  3KKW A;  2Z0Z A;  2CY2 A;  3BJ8 A;  3CXP A;  2I79 A;  1K4J A;  2WPW A;  4QVT A;  1QSN A;  4AG7 A;  2BL1 A;  4X5K A;  4KOY A;  2FXF A;  4OLL A;  1YK3 A;  3T90 A;  3W91 A;  2H5M A;  2R98 A;  4MY3 A;  3N7Z A;  4KZT A;  3K9U A;  1Q2C A;  1Z9U A;  3DDD A;  4PK3 A;  2I00 A;  2O28 A;  1LRZ A;  1I1D A;  3G8W A;  2C27 A;  5EBV A;  3TO6 A;  4II9 A;  2Z10 A;  3PP9 A;  2OZG A;  2QML A;  1Y9W A;  2ZW4 A;  4AVA A;  3EXN A;  4XNH C;  2B3V A;  3I3G A;  4M85 A;  3GY9 A;  2REE A;  4K30 A;  4XNH B;  1P0H A;  2NMT A;  5JPH A;  4NEX A;  5DWM A;  1XF8 A;  4JJX A;  2PC1 A;  2ZW7 A;  1S7K A;  1NMT A;  4CRY B;  3DR8 A;  2VI7 A;  4R57 A;  5HH1 A;  4YFJ A;  2P6E A;  3H4Q A;  4KUB A;  3TOB A;  2P0W A;  4YGO A;  2ZXV A;  4F6A A;  2B5G B;  2Q44 A;  1XEB A;  3SHP A;  5KTC A;  3G3S A;  2P6F A;  3CXS A;  2GE3 A;  5E96 A;  3GYA A;  1BOB A;  3W6S A;  1ON0 A;  2VBQ A;  4KUA A;  1MJ9 A;  1SQH A;  3BLN A;  2G3T A;  2PSW A;  5I0C A;  1KZF A;  2JDD A;  2BSW A;  2CNM A;  4CRZ B;  3SXO A;  2VZY A;  2VXK A;  1KUV A;  2AE6 A;  2EVN A;  1QSO A;  3NE7 A;  2K5T A;  1QST A;  2OH1 A;  1S3Z A;  2ARH A;  1U6M A;  2OZH A;  4R3L A;  2FL4 A;  2JDC A;  5FVJ A;  5F49 A;  1S7N A;  2D4O A;  3ZJ0 A;  3TFY A;  3PGP A;  3RYO A;  4QBJ A;  4PSX A;  1RXT A;  3TO9 A;  4LUA A;  1Z4R A;  4E0A A;  2R7H A;  2Q7B A;  4DNC A;  3D2P A;  5F46 A;  4KOR A;  2ZW5 A;  4FD7 A;  4NSQ A;  4R87 A;  3FXT A;  5HMN A;  3S6G A;  2Q4V A;  5H86 A;  2PR1 A;  4LX9 A;  1I12 A;  4QB9 A;  1TIQ A;  2Y0M A;  2REF A;  2JEV A;  2Z11 A;  1IB1 E;  1PUA A;  3R9F A;  3D2M A;  1S5K A;  3S6K A;  1I21 A;  2BUE A;  3F8K A;  4MHD A;  4UWJ A;  1GHE A;  3FIX A;  4JD6 A;  1UFH A;  2QEC A;  4UA3 A;  3TE4 A;  1M4D A;  1IYL A;  3FNC A;  4CAV A;  3LOD A;  4RS2 A;  1WWZ A;  1BO4 A;  4XPD C;  1XE4 A;  2B5G A;  3VWD A;  4MBU A;  4XPL A;  1IYK A;  5J8C A;  5J8F A;  1FY7 A;  4XPD B;  2A4N A;  1YLE A;  1WK4 A;  2FE7 A;  4KOX A;  3D8P A;  3B8G A;  3R96 A;  2Q04 A;  4JXR A;  4L8A A;  2HQY A;  4HNX B;  2FSR A;  4MJ8 A;  1YVK A;  3QAH A;  3R1K A;  4HNY B;  2J8R A;  3FBU A;  2CNS A;  2X7B A;  4KOU A;  4B5P B;  5GCN A;  4L89 A;  2F5I A;  1NE9 A;  3TOA A;  3UY5 A;  4YRH A;  2G0B A;  2VZZ A;  4H6Z A;  4KOW A;  3V8I A;  1KUY A;  4R9M A;  4KOT A;  2JLM A;  1S7L A;  1M4G A;  2PR8 A;  2GAN A;  4AG9 A;  2VQY A;  5C82 A;  2DXQ A;  4KVM E;  4QUS A;  2FIW A;  4ZBG A;  5KTD A;  2B4D B;  2RC4 A;  1Z4E A;  2R1I A;  4OAE A;  1YGH A;  4PV6 A;  4NXY A;  4E8O A;  3S6F A;  2D4P A;  3FYN A;  3F5B A;  1CM0 A;  3W6X A;  3JVN A;  3OWC A;  3F0A A;  5IB0 A;  2FCK A;  4KLV A;  5ISV A;  4KVO E;  5IX3 A;  4U5Y A;  3C26 A;  1M1D A;  3IGR A;  4CAW A;  1NSL A;  4F0Y A;  4AVB A;  3EO4 A;  1CJW A;  3R9E A;  2B4B A;  2P6G A;  2KCW A;  2QIR A;  2J8M A;  2HUZ A;  3EC4 A;  3FB3 A;  4PK2 A;  4UWI A;  4KLW A;  2BEI A;  4R3K A;  4KOV A;  3SXN A;  1PU9 A;  5EC4 A;  3R95 A;  1Y7R A;  3S6H A;  4MY0 A;  1R57 A;  3EY5 A;  5F48 A;  1VHS A;  5DWN A;  4IUS A;  1S60 A;  3VWE A;  3EFA A;  3BJ7 A;  3I9S A;  5JQ4 A;  4FD4 A;  4QC6 A;  4B5P A;  1IID A;  2WPX A;  4JWP A;  4I49 A;  3P2H A;  5KTA A;  1M4I A;  1Y9K A;  3DR6 A;  4CAX A;  3DNS A;  2Q4Y A;  3TT2 A;  4KOS A;  3FRM A;  5IV0 A;  4H6U A;  1V0C A;  5CNP A;  1RO5 A;  1VKC A;  2B58 A;  3WR7 A;  3LD2 A;  3IWG A;  4RI1 A;  3CXQ A;  2OZU A;  4B5O A;  1MJB A;  4NCZ A;  4HNW B;  2FT0 A;  2B4D A;  2IL4 A;  4CS0 B;  3GKR A;  2PQ8 A;  3TCV A;  2FS5 A;  2VEZ A;  2PDO A;  1XIX A;  2J8N A;  4HKF A;  1S7F A;  2Q0Y A;  1YVO A;  2OU2 A;  4FD5 A;  3DSB A;  2GIV A;  4GS4 A;  1B6B A;  1J4J A;  1KUX A;  4OAD A;  2ATR A;  2ZPA A;  4U9Z A;  3TTH A;  4NF1 A;  3D3S A;  4BMH A;  4KVX A;  1YRE A;  2R8V A;  1B87 A;  1YX0 A;  1QSR A;  5H84 A;  1XMT A;  3R9G A;  3TO7 A;  4Y49 C;  4MI4 A;  2PRB A;  4JLY A;  4JXQ A;  4IF5 A;  2AJ6 A;  4Y49 B;  5F47 A;  4M3S A;  4H89 A;  1Q2D A;  1P4N A;  1M44 A;  4J3G A;  4ONU A;  2EUI A;  3T9Y A;  3E0K A;  1QSM A;  1IIC A;  4UBR A;  4AVC A;  2CNT A;  1MK4 A;  3ZZI A;  1L0C A;  3QB8 A;  2HV2 A;  4U9Y A;  3PZJ A;  2OB0 A;  2B3U A;  3MGD A;  2ZW6 A;  4E2A A;  3P2F A;  1N71 A;  2FIA A;  4EVY A;  4PSW A;  1MJA A;  1YR0 A;  2G3A A;  4XPK A; 
#chains in the Genus database with same CATH topology
 4ZY2 A;  4FD6 A;  1Q2Y A;  3JUW A;  5C88 A;  2QJ8 A;  4A32 A;  4ORF A;  5K8O A;  4AB7 A;  1OZP A;  1DTD A;  3KKW A;  2Z0Z A;  2CY2 A;  4DUK A;  2Q51 A;  2PJ9 A;  4PXD A;  3BJ8 A;  3CXP A;  2I79 A;  1K4J A;  1YW6 A;  2WPW A;  1VIX A;  4QVT A;  2Z3M A;  1QSN A;  3DLJ A;  4A37 A;  4A2Z A;  4AG7 A;  1PYT B;  2BL1 A;  4OC3 A;  4X5K A;  4KOY A;  2FXF A;  4OLL A;  1YK3 A;  3T90 A;  3W91 A;  4FWU A;  2H5M A;  4KSI A;  1ZG8 A;  4MCP A;  2R98 A;  4MY3 A;  3N7Z A;  2BO9 A;  4A31 A;  2ZEF A;  2PJ7 A;  4KZT A;  5LRG A;  6CPA A;  3K9U A;  4A38 A;  4F8Z A;  2RB7 A;  4BIN A;  1Q2C A;  1Z9U A;  2JBK A;  1BPN A;  2HC9 A;  2I00 A;  1IU8 A;  1LRZ A;  2O28 A;  3DDD A;  4OID A;  4PK3 A;  3V38 A;  1I1D A;  3G8W A;  2C27 A;  2AFO A;  5EBV A;  2PJ8 A;  5AG5 A;  3TO6 A;  4EME A;  2GU2 A;  2GFQ A;  4Q36 A;  4II9 A;  2Z10 A;  3PP9 A;  3FEC A;  2OZG A;  2QML A;  1Y9W A;  2ZW4 A;  4AVA A;  3EXN A;  2ZEG A;  1ZLH A;  4XNH C;  2B3V A;  3I3G A;  4M85 A;  3GY9 A;  4CAF A;  1Y0Y A;  2REE A;  4UCM A;  3BXM A;  2NYQ A;  4K30 A;  3CDX A;  2AFW A;  4XNH B;  4NJQ A;  5G21 A;  1P0H A;  2CF4 A;  3NH5 A;  4P4J A;  5K8N A;  2NMT A;  5HXD A;  5CPA A;  5JPH A;  1Y0R A;  5LYF A;  1CG2 A;  4NEX A;  5DWM A;  1XF8 A;  4JJX A;  4Z65 A;  3HUV A;  3PB9 X;  4ONW A;  2PC1 A;  1CP6 A;  2ZW7 A;  4F0X A;  2GLF A;  4K3N A;  1S7K A;  1NMT A;  4OP4 A;  4CRY B;  3MRU A;  5A28 A;  3DR8 A;  1LAP A;  2VI7 A;  4R57 A;  5HH1 A;  3TC8 A;  3B2Y A;  2P6E A;  3H4Q A;  4KUB A;  4YFJ A;  2J9A A;  3TOB A;  2P0W A;  4YGO A;  2Z3L A;  2Z3O A;  2I3C A;  2ZEO A;  4IAV A;  2ZXV A;  4OME A;  4CAE A;  4NGM A;  2B5G B;  4F6A A;  3RAM A;  3GLJ A;  2OR4 A;  3GB0 A;  3RO0 A;  2Q44 A;  3BHX A;  1X12 A;  3D7H A;  4CPA A;  4MHN A;  1XEB A;  2ZEL A;  3IEH A;  3NH4 A;  3SHP A;  3FED A;  3GUX A;  5KTC A;  4PPZ A;  3G3S A;  2P6F A;  3PFO A;  3CXS A;  2GE3 A;  1F2O A;  2V77 A;  2EBJ A;  5E96 A;  3GYA A;  3K2K A;  1BOB A;  3W6S A;  1ON0 A;  2VBQ A;  1ZLI A;  3B3W A;  3B3T A;  3IIB A;  4KUA A;  2XEI A;  4AXV A;  1TKH A;  1MJ9 A;  3PB8 X;  1SQH A;  2JEW A;  3QNV A;  3BLN A;  2G3T A;  2PSW A;  5I0C A;  1QMU A;  1KZF A;  4B12 A;  2JDD A;  1ELL P;  4OC0 A;  4X2T A;  4BD9 A;  2BSW A;  2C6P A;  2CNM A;  2XEF A;  4CRZ B;  3SXO A;  2VZY A;  2VXK A;  3KQX A;  3ISZ A;  1KUV A;  4CYO A;  1XMB A;  2AE6 A;  2EVN A;  2PIZ A;  5LYI A;  5K8M A;  1QSO A;  2POK A;  3NE7 A;  2K5T A;  1QST A;  2OH1 A;  1S3Z A;  2ARH A;  1CPS A;  4NJR A;  1U6M A;  3D7D A;  2OZH A;  4ZYQ A;  2ODF A;  3VH9 A;  1ARL A;  3S9N A;  4R3L A;  4TNU A;  2C1C A;  1LOK A;  2FL4 A;  2ZEP A;  1PCA A;  2JDC A;  5FVJ A;  3PEI A;  5F49 A;  1S7N A;  4C2X A;  2Z3P A;  4GXH A;  4MFJ A;  3B7I A;  5JM6 A;  2D4O A;  4MCR A;  2DPS A;  2C6G A;  3ZJ0 A;  3TFY A;  4CGO A;  4F9U A;  2DEA A;  2CXA A;  5D8N A;  3PGP A;  2ABZ A;  3RYO A;  4QBJ A;  2PVV A;  2HB6 A;  4PSX A;  1RXT A;  3TO9 A;  2PJ4 A;  4LUA A;  3IFE A;  1Z4R A;  1TF9 A;  1Y7E A;  1HEE A;  4E0A A;  3RNZ A;  2R7H A;  1FNO A;  1JWQ A;  2DF5 A;  4O23 A;  2Q7B A;  4UFW A;  4DNC A;  3D2P A;  2O4H A;  2AFZ A;  4C2Y A;  4NFR A;  5F46 A;  4B6Z A;  4UCP A;  4KOR A;  3SJX A;  2ZW5 A;  4FD7 A;  4NSQ A;  2DPT A;  4R87 A;  3FXT A;  5HMN A;  1AMP A;  3FMC A;  3NFZ A;  3S6G A;  2Q4V A;  5H86 A;  2PR1 A;  4LX9 A;  3PBB A;  1I12 A;  3N5F A;  3FJU A;  3KR4 A;  8CPA A;  4QB9 A;  1TIQ A;  2Y0M A;  4MHZ A;  2REF A;  1X10 A;  4UCN A;  2JEV A;  2Z11 A;  1IB1 E;  1PUA A;  3R9F A;  1BLL E;  2YND A;  3D2M A;  3H8F A;  4G1P A;  4R7M A;  3WC7 A;  2F7V A;  1S5K A;  4W9Y A;  3S6K A;  2PIY A;  5JH9 A;  3SJF A;  4MXU A;  5G20 A;  1I21 A;  2BUE A;  2CIJ A;  1CBX A;  3F8K A;  4MHD A;  4UWJ A;  1GHE A;  3IWE A;  3KGQ A;  3FIX A;  4GM5 A;  4JYW A;  3DGV A;  4P4I A;  5CBM A;  4JD6 A;  3S9L A;  1LAM A;  1UFH A;  2QEC A;  1Z8L A;  1ZG7 A;  2RFH A;  5AGE A;  2EK9 A;  4UA3 A;  3TE4 A;  4C68 A;  2OOT A;  1M4D A;  3GIU A;  1TF8 A;  1XFO A;  3WAB A;  1IYL A;  3FNC A;  4B10 A;  4CAV A;  3LOD A;  4RS2 A;  4P4D A;  1WWZ A;  1BO4 A;  2G9D A;  4XPD C;  1A2Z A;  1XE4 A;  3V7Z A;  1BPM A;  2B5G A;  5BWA B;  3KQZ A;  3VWD A;  4MBU A;  4XPL A;  1IYK A;  2Q4Z A;  4A39 A;  4B13 A;  1FY7 A;  5A27 A;  5J8F A;  5J8C A;  4XPD B;  4R76 A;  4P44 A;  2A4N A;  1YLE A;  3RBU A;  3PFE A;  4C7I A;  1WK4 A;  1F2P A;  2AFM A;  1YW4 A;  2FE7 A;  3B3V A;  3BI0 A;  4KOX A;  3D8P A;  3B8G A;  3R96 A;  2Q04 A;  3I1U A;  3JRU A;  2ZED A;  3NA6 A;  4JXR A;  4P45 A;  4ZY0 A;  2F8H A;  1H8L A;  1Z2L A;  2PJA A;  3RZA A;  4A94 A;  4L8A A;  2HQY A;  3TX8 A;  4HNX B;  4MMO A;  2FSR A;  4MJ8 A;  1YVK A;  4CYQ A;  3QAH A;  5HVH A;  4OKO A;  3R1K A;  4HNY B;  4B14 A;  2J8R A;  4A33 A;  3FBU A;  3SI0 A;  4KSF A;  5F09 A;  2CNS A;  2X7B A;  3PB4 X;  4KOU A;  4B5P B;  2IJZ A;  1TXR A;  2PJ5 A;  3H8G A;  5GCN A;  2ZEN A;  3CPX A;  4L89 A;  4MHP A;  5D29 A;  1VHE A;  2F5I A;  4NGS A;  2PJ2 A;  1NE9 A;  3TOA A;  4NGT A;  3IJ3 A;  3UY5 A;  4YRH A;  2V8G A;  2EWB A;  2G0B A;  1M4L A;  2VZZ A;  1CP7 A;  4MFL A;  4UEZ A;  4H6Z A;  4KOW A;  3V8I A;  1KUY A;  2YNE A;  2IQ6 A;  4R9M A;  4KOT A;  3CZX A;  4NGN A;  3KZW A;  3ISX A;  3D67 A;  3IU2 A;  2JLM A;  1XRY A;  5ELY A;  4C7H A;  1S7L A;  1M4G A;  2PR8 A;  3FVL A;  3KR5 A;  2GAN A;  4AG9 A;  4MFZ A;  2VQY A;  3VAT A;  5C82 A;  2DXQ A;  4KVM E;  4QUS A;  2FIW A;  3PBE A;  4ZBG A;  5KTD A;  2B4D B;  1XJO A;  2NSM A;  4CGL A;  2RC4 A;  2WSA A;  1Z4E A;  3D4U A;  2R1I A;  1ARM A;  4OAE A;  1YGH A;  3LWU A;  4OIW A;  4NXY A;  4PV6 A;  4R6T A;  4E8O A;  1IOF A;  1IOI A;  3S6F A;  2VL1 A;  4X8I A;  1IY7 A;  4MFP A;  4OC5 A;  2D4P A;  3FYN A;  3F5B A;  4OC1 A;  5JGF A;  2Z3N A;  4UEE A;  4PQA A;  1CM0 A;  3W6X A;  3JVN A;  1FT7 A;  3OWC A;  3F0A A;  5IB0 A;  4DJL A;  2FCK A;  4KLV A;  1XOV A;  5ISV A;  4KVO E;  2AFS A;  1ELM P;  2PJ0 A;  1LAN A;  1YME A;  4KSA A;  4WJB A;  3FH4 A;  5IX3 A;  4U5Y A;  3C26 A;  1M1D A;  3IGR A;  5EMI A;  2PJB A;  1GYT A;  3A9L A;  1NSL A;  4CAW A;  4F0Y A;  4MCS A;  4AVB A;  4M6H A;  5G22 A;  2GLJ A;  1Z5R A;  2EO8 A;  3EO4 A;  1CJW A;  1VGY A;  2BOA A;  3R9E A;  2B4B A;  2P6G A;  2QVP A;  2QYV A;  2KCW A;  2QIR A;  2J8M A;  3KL9 A;  2HUZ A;  4WWV A;  4LQ6 A;  3EC4 A;  3FB3 A;  4PK2 A;  4UWI A;  5I4M A;  4ZI6 A;  5AG7 A;  3IO1 A;  4OC2 A;  1LCP A;  4KLW A;  1AYE A;  2BEI A;  3K9T A;  2PRQ A;  4R3K A;  4A30 A;  3CPA A;  4KOV A;  3NH8 A;  3SXN A;  1PU9 A;  5EC4 A;  4UIA A;  3IWW A;  4KS9 A;  5LYL A;  1F57 A;  2Q43 A;  3R95 A;  2ZEM A;  1TKF A;  1Y7R A;  3D66 A;  4YWY A;  3S6H A;  4MFK A;  2O53 A;  4UIB A;  2IMO A;  4MY0 A;  4TWE A;  1R57 A;  3EY5 A;  5F48 A;  4P6Y A;  2ANP A;  4PXE A;  4ZX8 A;  5LRJ A;  1VHS A;  2PJ6 A;  4HPS A;  5DWN A;  1LFW A;  4IUS A;  2V8D A;  1S60 A;  2PE3 A;  3LAC A;  4R8F A;  2XEG A;  4FUU A;  3KI9 A;  4CGN A;  1QQ9 A;  1ZG9 A;  3VWE A;  3FX6 A;  1JQG A;  3EFA A;  2Z3K A;  3PRT A;  3BJ7 A;  3I9S A;  3D7G A;  5JQ4 A;  2CTB A;  1CX8 A;  2GRE A;  4FD4 A;  4QC6 A;  4B5P A;  1IID A;  2WPX A;  4JWP A;  4I49 A;  3P2H A;  5KTA A;  1M4I A;  5AG4 A;  1Y9K A;  2YNC C;  5DS0 A;  3DR6 A;  3SJG A;  4H2K A;  4CAX A;  1HDU A;  3DNS A;  2Q4Y A;  3KHX A;  3T8W A;  4KOS A;  3TT2 A;  3FRM A;  2ZEE A;  1NSA A;  4P4F A;  4UFX A;  5IV0 A;  1Z8W A;  1YSJ A;  4H6U A;  1V0C A;  2PJ1 A;  5CNP A;  1RO5 A;  2WZN A;  1VKC A;  3L2N A;  3FEE A;  2B58 A;  3WR7 A;  2C6C A;  2JBJ A;  3LD2 A;  2AFX A;  3IWG A;  4RI1 A;  3CXQ A;  2OZU A;  1AUG A;  2AFU A;  2Q7S A;  4B5O A;  1MJB A;  4P4B A;  3B35 A;  3S9M A;  3CT9 A;  4NCZ A;  4HNW B;  3PB7 X;  4PXC A;  5G1Z A;  4ZY1 A;  4UEF A;  4RN7 A;  4F9V A;  2FT0 A;  4DYO A;  3WC6 A;  2PJ3 A;  2B4D A;  2IL4 A;  4BBH A;  4PXB A;  4P4E A;  4CS0 B;  3GKR A;  2EK8 A;  2ZOG A;  2PJC A;  4Q7A A;  2PQ8 A;  3TCV A;  2FS5 A;  2VEZ A;  2PDO A;  1XIX A;  3D7F A;  4Q38 A;  3IC1 A;  5LYD A;  5THW A;  4UF4 A;  2J8N A;  1Z8T A;  3FF3 A;  4HKF A;  1S7F A;  1YLO A;  4JZ0 A;  2PCU A;  2Q0Y A;  1YVO A;  3B3S A;  4B11 A;  2OU2 A;  4FD5 A;  3DSB A;  4OC4 A;  2V8H A;  3KAS A;  2GIV A;  4GS4 A;  4NGQ A;  1B6B A;  3SJE A;  5J1Q A;  2FVG A;  1J4J A;  1KUX A;  4OAD A;  2ATR A;  5AG6 A;  2ZPA A;  4NGR A;  2CTC A;  4U9Z A;  3TTH A;  1VHO A;  4NF1 A;  3D3S A;  4BMH A;  4KVX A;  4EFD A;  2WYR A;  3HLP A;  1DE4 C;  1YRE A;  4UFV A;  2R8V A;  1B87 A;  1OBR A;  4CGP A;  3SI1 A;  3NE8 A;  1CPX A;  1YX0 A;  1QSR A;  5H84 A;  1XMT A;  1IGB A;  3R9G A;  4CYN A;  3TO7 A;  4Y49 C;  4MI4 A;  2PRB A;  4JLY A;  2ZOF A;  4JXQ A;  2WUU A;  4ZGY B;  3QAY A;  1HDQ A;  4IF5 A;  1ZO0 A;  2AJ6 A;  3D68 A;  4M6I A;  1YQE A;  5IB9 A;  4Y49 B;  5F47 A;  4M3S A;  1TKJ A;  4H89 A;  4ZX9 A;  1Q2D A;  4MHY A;  3PB6 X;  5HVF A;  4FBE A;  3SI2 A;  1P4N A;  1R3N A;  1M44 A;  4J3G A;  1EE3 P;  4ONU A;  2EUI A;  4MCQ A;  3T9Y A;  3H8E A;  4P10 A;  3E0K A;  3KHZ A;  1QSM A;  3VAR A;  2ZEH A;  1IIC A;  2PVW A;  4UBR A;  4RUH A;  4AVC A;  3WT4 A;  1RTQ A;  2CNT A;  4MFQ A;  2YGW A;  1MK4 A;  3MN8 A;  3ZZI A;  4FAI A;  3BI1 A;  2XEJ A;  4MRI A;  1L0C A;  4CYP A;  3QB8 A;  3B3C A;  5HVG A;  5K8P A;  2HV2 A;  2BCO A;  1XBU A;  4U9Y A;  3PZJ A;  2OB0 A;  4C2Z A;  4NGP A;  5LRK A;  2B3U A;  4YU9 A;  3MGD A;  2ZW6 A;  1R43 A;  3P2F A;  4M6G A;  1N71 A;  4A95 A;  4E2A A;  1Q7L A;  4LQG A;  3JTK A;  2FIA A;  3IU1 A;  1UWY A;  4EWT A;  3LMS A;  1KWM A;  1Z8X A;  4IK2 A;  4EVY A;  4IHM A;  4PSW A;  2V8V A;  1MJA A;  4CGM A;  1YR0 A;  2YNC A;  3H5Z A;  4X3R A;  2G3A A;  4XPK A;  1BAV A;  3WC5 A;  7CPA A; 
#chains in the Genus database with same CATH homology
 4FD6 A;  1Q2Y A;  3JUW A;  5C88 A;  4A32 A;  4ORF A;  4AB7 A;  1OZP A;  3KKW A;  2Z0Z A;  2CY2 A;  3BJ8 A;  3CXP A;  2I79 A;  1K4J A;  2WPW A;  4QVT A;  2Z3M A;  1QSN A;  4A2Z A;  4AG7 A;  2BL1 A;  4X5K A;  4KOY A;  2FXF A;  4OLL A;  1YK3 A;  3T90 A;  3W91 A;  2H5M A;  2R98 A;  4MY3 A;  3N7Z A;  4A31 A;  4KZT A;  3K9U A;  1Q2C A;  1Z9U A;  3DDD A;  4PK3 A;  2I00 A;  2O28 A;  1LRZ A;  1I1D A;  3G8W A;  2C27 A;  5EBV A;  5AG5 A;  3TO6 A;  4Q36 A;  4II9 A;  2Z10 A;  3PP9 A;  2OZG A;  2QML A;  1Y9W A;  2ZW4 A;  4AVA A;  3EXN A;  4XNH C;  2B3V A;  3I3G A;  4M85 A;  3GY9 A;  4CAF A;  2REE A;  4UCM A;  4K30 A;  4XNH B;  5G21 A;  1P0H A;  2NMT A;  5JPH A;  4NEX A;  5DWM A;  1XF8 A;  4JJX A;  2PC1 A;  2ZW7 A;  4F0X A;  1S7K A;  1NMT A;  4CRY B;  5A28 A;  3DR8 A;  2VI7 A;  4R57 A;  5HH1 A;  4YFJ A;  2P6E A;  3H4Q A;  4KUB A;  3TOB A;  2P0W A;  4YGO A;  2Z3L A;  2Z3O A;  2ZXV A;  4CAE A;  4F6A A;  2B5G B;  2Q44 A;  1XEB A;  3SHP A;  5KTC A;  3G3S A;  2P6F A;  3CXS A;  2GE3 A;  5E96 A;  3GYA A;  1BOB A;  3W6S A;  1ON0 A;  2VBQ A;  4KUA A;  1MJ9 A;  1SQH A;  3BLN A;  2G3T A;  2PSW A;  5I0C A;  1KZF A;  4B12 A;  2JDD A;  2BSW A;  2CNM A;  4CRZ B;  3SXO A;  2VZY A;  2VXK A;  4CYO A;  1KUV A;  2AE6 A;  2EVN A;  1QSO A;  3NE7 A;  2K5T A;  1QST A;  2OH1 A;  1S3Z A;  2ARH A;  1U6M A;  2OZH A;  4R3L A;  2FL4 A;  2JDC A;  5FVJ A;  5F49 A;  4C2X A;  1S7N A;  2Z3P A;  4MFJ A;  2D4O A;  2DPS A;  3ZJ0 A;  3TFY A;  4CGO A;  2CXA A;  3PGP A;  3RYO A;  4QBJ A;  4PSX A;  1RXT A;  3TO9 A;  4LUA A;  1Z4R A;  4E0A A;  2R7H A;  2Q7B A;  4UFW A;  4DNC A;  3D2P A;  4C2Y A;  5F46 A;  4UCP A;  4KOR A;  2ZW5 A;  4FD7 A;  4NSQ A;  2DPT A;  4R87 A;  3FXT A;  5HMN A;  3S6G A;  2Q4V A;  5H86 A;  2PR1 A;  4LX9 A;  1I12 A;  4QB9 A;  1TIQ A;  2Y0M A;  2REF A;  4UCN A;  2JEV A;  2Z11 A;  1IB1 E;  1PUA A;  3R9F A;  3D2M A;  2YND A;  1S5K A;  3S6K A;  5G20 A;  1I21 A;  2BUE A;  3F8K A;  4MHD A;  4UWJ A;  1GHE A;  3IWE A;  3FIX A;  4JD6 A;  1UFH A;  2QEC A;  5AGE A;  4UA3 A;  3TE4 A;  4C68 A;  1M4D A;  1IYL A;  3FNC A;  4B10 A;  4CAV A;  3LOD A;  4RS2 A;  1WWZ A;  1BO4 A;  4XPD C;  1XE4 A;  5BWA B;  2B5G A;  3VWD A;  4MBU A;  4XPL A;  1IYK A;  5J8C A;  4B13 A;  5J8F A;  1FY7 A;  5A27 A;  4XPD B;  2A4N A;  1YLE A;  4C7I A;  1WK4 A;  2FE7 A;  4KOX A;  3D8P A;  3B8G A;  3R96 A;  2Q04 A;  4JXR A;  4L8A A;  2HQY A;  4HNX B;  2FSR A;  4MJ8 A;  1YVK A;  4CYQ A;  3QAH A;  3R1K A;  4HNY B;  4B14 A;  2J8R A;  4A33 A;  3FBU A;  4KSF A;  2CNS A;  2X7B A;  4KOU A;  4B5P B;  5GCN A;  4L89 A;  2F5I A;  1NE9 A;  3TOA A;  3UY5 A;  4YRH A;  2G0B A;  2VZZ A;  4MFL A;  4H6Z A;  4KOW A;  3V8I A;  1KUY A;  2YNE A;  4R9M A;  4KOT A;  3IU2 A;  2JLM A;  4C7H A;  1S7L A;  1M4G A;  2PR8 A;  2GAN A;  4AG9 A;  4MFZ A;  2VQY A;  5C82 A;  2DXQ A;  4KVM E;  4QUS A;  2FIW A;  4ZBG A;  5KTD A;  2B4D B;  4CGL A;  2RC4 A;  2WSA A;  1Z4E A;  2R1I A;  4OAE A;  1YGH A;  4PV6 A;  4NXY A;  4E8O A;  3S6F A;  4MFP A;  2D4P A;  3FYN A;  3F5B A;  2Z3N A;  1CM0 A;  3W6X A;  3JVN A;  3OWC A;  3F0A A;  5IB0 A;  2FCK A;  4KLV A;  5ISV A;  4KVO E;  4KSA A;  5IX3 A;  4U5Y A;  3C26 A;  1M1D A;  3IGR A;  4CAW A;  3A9L A;  1NSL A;  4F0Y A;  4AVB A;  5G22 A;  3EO4 A;  1CJW A;  3R9E A;  2B4B A;  2P6G A;  2KCW A;  2QIR A;  2J8M A;  2HUZ A;  3EC4 A;  3FB3 A;  4PK2 A;  4UWI A;  5AG7 A;  4KLW A;  2BEI A;  4R3K A;  4A30 A;  4KOV A;  3SXN A;  1PU9 A;  5EC4 A;  4KS9 A;  3R95 A;  1Y7R A;  3S6H A;  4MFK A;  4MY0 A;  1R57 A;  3EY5 A;  5F48 A;  1VHS A;  5DWN A;  4IUS A;  1S60 A;  4CGN A;  3VWE A;  3EFA A;  2Z3K A;  3BJ7 A;  3I9S A;  5JQ4 A;  4FD4 A;  4QC6 A;  4B5P A;  1IID A;  2WPX A;  4JWP A;  4I49 A;  3P2H A;  5KTA A;  1M4I A;  5AG4 A;  1Y9K A;  2YNC C;  3DR6 A;  4CAX A;  3DNS A;  2Q4Y A;  3TT2 A;  4KOS A;  3FRM A;  4UFX A;  5IV0 A;  4H6U A;  1V0C A;  5CNP A;  1RO5 A;  1VKC A;  2B58 A;  3WR7 A;  3LD2 A;  3IWG A;  4RI1 A;  3CXQ A;  2OZU A;  4B5O A;  1MJB A;  4NCZ A;  4HNW B;  5G1Z A;  2FT0 A;  2B4D A;  2IL4 A;  4BBH A;  4CS0 B;  3GKR A;  2PQ8 A;  3TCV A;  2FS5 A;  2VEZ A;  2PDO A;  1XIX A;  4Q38 A;  2J8N A;  4HKF A;  1S7F A;  4B11 A;  2Q0Y A;  1YVO A;  2OU2 A;  4FD5 A;  3DSB A;  2GIV A;  4GS4 A;  1B6B A;  1J4J A;  1KUX A;  4OAD A;  2ATR A;  5AG6 A;  2ZPA A;  4U9Z A;  3TTH A;  4NF1 A;  3D3S A;  4BMH A;  4KVX A;  4UFV A;  1YRE A;  2R8V A;  1B87 A;  4CGP A;  1YX0 A;  1QSR A;  5H84 A;  1XMT A;  3R9G A;  4CYN A;  3TO7 A;  4Y49 C;  4MI4 A;  2PRB A;  4JLY A;  4JXQ A;  2WUU A;  4ZGY B;  4IF5 A;  1ZO0 A;  2AJ6 A;  4Y49 B;  5F47 A;  4M3S A;  4H89 A;  1Q2D A;  1P4N A;  1M44 A;  4J3G A;  4ONU A;  2EUI A;  3T9Y A;  3E0K A;  1QSM A;  1IIC A;  4UBR A;  4AVC A;  2CNT A;  4MFQ A;  2YGW A;  1MK4 A;  3ZZI A;  1L0C A;  4CYP A;  3QB8 A;  2HV2 A;  4U9Y A;  3PZJ A;  2OB0 A;  4C2Z A;  2B3U A;  3MGD A;  2ZW6 A;  4E2A A;  3P2F A;  4A95 A;  1N71 A;  3JTK A;  2FIA A;  3IU1 A;  4EVY A;  4PSW A;  1MJA A;  4CGM A;  1YR0 A;  2YNC A;  3H5Z A;  2G3A A;  4XPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...