4X5KA

Human naa50 complex with coenzyme a and an acetylated peptide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
GSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human NAA50 with coenzymeA and a peptide
rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
molecule keywords N-alpha-acetyltransferase 50
total genus 39
structure length 153
sequence length 153
ec nomenclature ec 2.3.1.258: N-terminal methionine N(alpha)-acetyltransferase NatE.
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4x5kA00
1IIDA 3FRMA 2Q0YA 2VQYA 4MI4A 2B4DB 1WWZA 1FY7A 2FL4A 5KTDA 4E0AA 4M3SA 2OH1A 4ONUA 1M4DA 4E8OA 1ON0A 2FE7A 2RC4A 1Q2DA 4CAWA 2EUIA 2I79A 3FXTA 3GYAA 4UA3A 1YVOA 4H6UA 4XPLA 3P2FA 4U9ZA 3R9EA 4PSXA 2R7HA 3D2PA 4KVOE 3VWEA 3CXQA 2B58A 1XMTA 5IX3A 1S60A 3EO4A 4NXYA 3GY9A 4MY0A 2HV2A 3EC4A 1Q2CA 2PDOA 3EFAA 2EVNA 5DWMA 2R1IA 3PGPA 4NF1A 4MHDA 3K9UA 1V0CA 4K30A 3R1KA 2FS5A 3JVNA 3R9FA 2CNSA 3I3GA 1MJBA 2B5GA 2J8NA 4ZBGA 1QSOA 2R8VA 4KVME 1I21A 4OADA 5KTCA 4KOSA 1MJ9A 2REFA 3TFYA 1M1DA 2BEIA 1S7KA 2F5IA 4YFJA 2G3AA 3N7ZA 4UBRA 3I9SA 2R98A 5H86A 1Z4RA 2BUEA 3W6SA 5GCNA 4II9A 1IB1E 4JXQA 3QAHA 2CNMA 4L89A 5IV0A 4FD6A 4JLYA 1NSLA 1KUXA 1S5KA 4F0YA 3W6XA 3BLNA 4QC6A 2JEVA 3FYNA 4H89A 5EC4A 1Y7RA 3LODA 4XPKA 1RXTA 1YK3A 4Y49C 2OZHA 4NSQA 1XF8A 3FNCA 4R3KA 1Q2YA 3RYOA 1IYLA 2B4BA 4HNYB 1KUYA 2ATRA 4AVAA 4QBJA 1R57A 5JQ4A 2B5GB 3MGDA 2K5TA 1MK4A 1M4GA 2Z0ZA 5F49A 4GS4A 1YVKA 1P0HA 4JXRA 4L8AA 2KCWA 4R9MA 4J3GA 1N71A 2ZW6A 3S6GA 1RO5A 2Z11A 2ZW5A 3G3SA 3DR8A 3NE7A 1PU9A 1XEBA 2OZGA 3S6FA 3EXNA 4XPDB 3TOBA 3WR7A 1IICA 1I1DA 2Y0MA 1Y9WA 4KOXA 4LUAA 1PUAA 2JLMA 1YR0A 3E0KA 4KUBA 3P2HA 4R3LA 5J8FA 1Z9UA 5C82A 1IYKA 4IF5A 2HUZA 3T90A 5JPHA 3R9GA 2P0WA 3C26A 4JJXA 1KUVA 1S3ZA 1YLEA 1S7LA 3TTHA 2B3UA 3S6HA 3VWDA 2JDDA 1NE9A 1QSRA 2WPWA 2P6FA 4B5PB 3B8GA 3G8WA 4AVCA 2PQ8A 2WPXA 4HNWB 2VEZA 1P4NA 2QECA 2FIAA 3EY5A 1L0CA 4UWIA 3TCVA 2CY2A 4KOYA 3IWGA 2Q7BA 1YX0A 1I12A 1Z4EA 3BJ8A 3TO9A 2PRBA 2D4PA 1GHEA 1MJAA 4U9YA 4AG7A 4MY3A 5I0CA 4KOUA 5FVJA 4DNCA 1CM0A 4HNXB 3OWCA 2B4DA 2J8RA 2GIVA 2ARHA 4I49A 4FD7A 2DXQA 5DWNA 4PK3A 2BSWA 4B5OA 1KZFA 4FD5A 2VZYA 2X7BA 1S7FA 5CNPA 3W91A 1SQHA 3SXOA 2Q44A 1U6MA 2BL1A 4NCZA 1TIQA 2AE6A 2ZPAA 5ISVA 3DSBA 2G3TA 4QUSA 4RI1A 3ZJ0A 2H5MA 3KKWA 2P6EA 2Q4VA 5EBVA 3TO7A 2A4NA 4MJ8A 3S6KA 4QB9A 4CS0B 2G0BA 1Y9KA 4XNHB 4MBUA 2IL4A 1OZPA 4AB7A 3D2MA 3UY5A 3DNSA 3TO6A 3DDDA 1WK4A 1YGHA 3TOAA 3JUWA 1QSTA 4AVBA 2VZZA 3PZJA 3GKRA 4EVYA 5C88A 3F0AA 4OLLA 3BJ7A 3D3SA 4KORA 1VKCA 2CNTA 2OZUA 3F5BA 3LD2A 2VBQA 2PC1A 2B3VA 3TE4A 3H4QA 4CRYB 2FIWA 2O28A 5F46A 3SXNA 4RS2A 2FSRA 4AG9A 1J4JA 3TT2A 3ZZIA 5IB0A 4KVXA 2Z10A 1B6BA 3F8KA 4UWJA 4H6ZA 4PSWA 4BMHA 4R87A 5H84A 1BOBA 3T9YA 4NEXA 2QIRA 2JDCA 1M4IA 4JWPA 4XPDC 2GE3A 2GANA 4KZTA 1NMTA 1LRZA 4KLVA 3R96A 3CXPA 2PR1A 4JD6A 1CJWA 4PV6A 2Q4YA 4M85A 3D8PA 4FD4A 5HH1A 1K4JA 2OB0A 1XE4A 4KUAA 1VHSA 3V8IA 4CRZB 2NMTA 2Q04A 2VXKA 3FBUA 2PR8A 3FB3A 2ZW4A 3DR6A 1M44A 3PP9A 4YGOA 2D4OA 5E96A 2PSWA 4PK2A 1BO4A 4IUSA 4YRHA 4E2AA 4CAXA 4QVTA 2ZW7A 2C27A 5F47A 4ORFA 3QB8A 4KOWA 4XNHC 1S7NA 4KOVA 2FT0A 1YREA 2P6GA 1QSNA 2REEA 1XIXA 5KTAA 4R57A 4LX9A 3R95A 2HQYA 2AJ6A 5HMNA 5J8CA 2I00A 1B87A 4HKFA 2ZXVA 4KLWA 3SHPA 3FIXA 2J8MA 4F6AA 2FCKA 1QSMA 4X5KA 4KOTA 4B5PA 2OU2A 4Y49B 2QMLA 3IGRA 1UFHA 5F48A 2FXFA 3CXSA 4OAEA 4U5YA 2VI7A 4CAVA
chains in the Genus database with same CATH superfamily
1IIDA 3FRMA 3LWUA 2Q0YA 3B3WA 2VQYA 1XRYA 4MI4A 1RTQA 2B4DB 1WWZA 4FBEA 1FY7A 2FL4A 5KTDA 3K2KA 3HUVA 5G1ZA 3ISZA 2PVWA 4E0AA 4OP4A 4M3SA 4KSIA 2OH1A 1YLOA 2PJ2A 4ONUA 1M4DA 4CGMA 5I4MA 3PRTA 4EFDA 4E8OA 3NA6A 5CPAA 1ARLA 1ON0A 4KSFA 1F57A 2FE7A 2PJ7A 2RC4A 1Q2DA 3CDXA 2EUIA 1FNOA 3TC8A 2I79A 3FXTA 4CAWA 2BO9A 3GYAA 4P4FA 4P10A 4P4DA 4OKOA 4UA3A 1ZG8A 4C7IA 4ZYQA 3RZAA 3WC5A 1PYTB 1YVOA 2QJ8A 4H6UA 3VARA 2PJBA 4XPLA 4A38A 3P2FA 3H8EA 2GLJA 4PSXA 2R7HA 3D2PA 4U9ZA 4KVOE 3R9EA 3VATA 4CGOA 3VWEA 3CXQA 4CYOA 2ZEGA 2JBKA 5HXDA 1Z8TA 4R8FA 2B58A 2XEJA 4A32A 4BINA 3D7FA 4MFJA 2YNCC 4R6TA 4O23A 1XMTA 5IX3A 1S60A 3EO4A 4NXYA 2ZEOA 2GLFA 3GY9A 4MY0A 4FWUA 4MFLA 4WJBA 4PXBA 2HV2A 3EC4A 3KHXA 2WZNA 1Q2CA 2PDOA 3EFAA 2EVNA 3NFZA 5DWMA 3KQXA 3JTKA 3WC6A 1PCAA 5CBMA 8CPAA 2R1IA 1FT7A 3BI0A 3PGPA 4MHDA 4NF1A 3K9UA 1V0CA 4K30A 3R1KA 2FS5A 3JVNA 4IK2A 4NGRA 3R9FA 3S9MA 2BCOA 2CNSA 3I3GA 4G1PA 4PXCA 1MJBA 2B5GA 1HDQA 4ZX8A 3NH4A 3B3TA 2J8NA 5G20A 4ZBGA 2AFMA 2PJ0A 1TKFA 4MCSA 2NSMA 1QSOA 2Q51A 2EK8A 2R8VA 3FJUA 1CPSA 4OIDA 4KVME 1I21A 4OADA 5KTCA 3IU2A 4MCRA 4HPSA 1MJ9A 2REFA 4KOSA 4OC3A 4OC4A 3TFYA 1M1DA 3FH4A 2BEIA 1JQGA 1S7KA 3LMSA 4DYOA 3D7GA 3H8GA 2F5IA 4YFJA 2G3AA 3N7ZA 4UBRA 3I9SA 2R98A 1IOIA 4X3RA 5H86A 1Z4RA 2BUEA 3W6SA 4FAIA 5GCNA 3A9LA 2PJ3A 4PPZA 4CYPA 1Y0YA 3D7DA 1IB1E 1F2OA 2DF5A 2ZEMA 3FMCA 4MMOA 4II9A 4JXQA 1CP7A 1BPNA 3QAHA 2CNMA 4L89A 5IV0A 3NH8A 4FD6A 4JLYA 2PRQA 3WT4A 4B10A 3KHZA 1NSLA 1KUXA 1S5KA 4UFVA 3S9NA 4F0YA 3W6XA 4B14A 3BLNA 2PJCA 2Z3MA 4QC6A 1F2PA 4CGNA 2JEVA 2PE3A 3FYNA 1CX8A 3IC1A 4ONWA 4H2KA 4H89A 5THWA 3RBUA 1VIXA 2BOAA 2V8GA 4F8ZA 4B6ZA 5EC4A 3MRUA 4ZY1A 1XMBA 2F7VA 1Y7RA 3LODA 2CF4A 4BD9A 4XPKA 4GM5A 1YK3A 1RXTA 4UCMA 4Y49C 2OZHA 4NSQA 1XF8A 2IJZA 3FNCA 4R3KA 1TKHA 1Q2YA 2JBJA 2ZEFA 3RYOA 1IYLA 2B4BA 3D4UA 4OC0A 3QNVA 1BAVA 3PB7X 3PBBA 4HNYB 1Z5RA 4Q36A 4A37A 3D66A 2HC9A 4C68A 1X12A 2Z3LA 2Z3KA 3DGVA 3KASA 1KUYA 2ATRA 4AVAA 4QBJA 1ELMP 5J1QA 1R57A 3PBEA 5JQ4A 2AFOA 3PFOA 4NGSA 4OIWA 2B5GB 3MGDA 5JM6A 1BPMA 2K5TA 1MK4A 1M4GA 2Z3PA 3CZXA 4IAVA 4UEEA 3PB8X 1Q7LA 3JRUA 3CPAA 3NH5A 2QYVA 2C6PA 2IMOA 4B11A 2AFSA 2Z0ZA 5F49A 4EMEA 4MFZA 4GS4A 1YVKA 2YNCA 4R7MA 4P6YA 4MHNA 1HEEA 4B12A 1P0HA 4JXRA 2POKA 4A39A 4L8AA 2KCWA 1IOFA 2Q43A 4R9MA 4J3GA 1N71A 1X10A 2PJ9A 2ZW6A 4UIBA 4TWEA 4ZY2A 3S6GA 1ZLHA 1RO5A 2Z11A 2ZW5A 3GUXA 1ELLP 2VL1A 3D67A 3G3SA 3DR8A 3NE7A 1UWYA 2YGWA 4F9UA 3FX6A 1PU9A 1XEBA 1ZG7A 2OZGA 3S6FA 3EXNA 4C2XA 4MCQA 4XPDB 1IU8A 3TOBA 3WR7A 4C2ZA 1IICA 1I1DA 2Y0MA 1Y9WA 2ZEDA 4YWYA 4KOXA 3FVLA 3IU1A 4LUAA 1PUAA 2JLMA 4CGPA 1YR0A 3WC7A 1AMPA 3E0KA 4KUBA 3P2HA 4R3LA 5DS0A 5J8FA 2PCUA 1Z9UA 5C82A 2ZOFA 4RUHA 2ZELA 1IYKA 4ZX9A 4IF5A 2HUZA 2WSAA 3T90A 5JPHA 1XJOA 4GXHA 4C7HA 2XEGA 3R9GA 2P0WA 2DPSA 3C26A 4JJXA 1CG2A 2PJ1A 1KUVA 1S3ZA 4UFXA 3PB9X 1YLEA 1S7LA 4A2ZA 1Z2LA 3TTHA 2B3UA 4P44A 2EWBA 4NGMA 3S6HA 3VWDA 4CYQA 2DEAA 2JDDA 4NJRA 1NE9A 4P4EA 3PB6X 2AFZA 1QSRA 2WPWA 4P4JA 5EMIA 2YNDA 2CTBA 3KL9A 3TX8A 5LYIA 2P6FA 4B5PB 3B8GA 4MFPA 1M4LA 1ZLIA 1YW6A 3G8WA 4CPAA 4ZI6A 2PJ6A 3IFEA 4AVCA 2PQ8A 2WPXA 4HNWB 4K3NA 3KI9A 2VEZA 1CP6A 1P4NA 2QECA 3SI1A 1QQ9A 2DPTA 2FIAA 3EY5A 1L0CA 2F8HA 4KSAA 4MCPA 4P4BA 2CY2A 4UWIA 3TCVA 4KOYA 3IWGA 2Q7BA 4A31A 5LRKA 2XEIA 2AFXA 1YX0A 4UCPA 1I12A 3HLPA 5IB9A 3PFEA 1Z4EA 3V7ZA 3BJ8A 1OBRA 4NFRA 5AGEA 3TO9A 2PRBA 4W9YA 2D4PA 3IWEA 5K8NA 4Q7AA 1GHEA 1MJAA 4U9YA 4AG7A 4MY3A 5I0CA 4KOUA 4OC5A 5FVJA 4DNCA 4A95A 3IO1A 1CM0A 4HNXB 3OWCA 3SI0A 2O4HA 3KR5A 1R3NA 2B4DA 1LAMA 2GIVA 2J8RA 4CGLA 3H5ZA 2Q4ZA 4MHPA 2ARHA 3N5FA 4I49A 4M6HA 4FD7A 2C1CA 2DXQA 1Z8WA 3V38A 1BLLE 5DWNA 4PK3A 1Z8LA 1ZO0A 2BSWA 3GIUA 4P45A 3RAMA 4B5OA 4MRIA 1KZFA 2GREA 4FD5A 3CPXA 3IEHA 2VZYA 2X7BA 2GFQA 1S7FA 5CNPA 2HB6A 2V8HA 3W91A 1SQHA 3FECA 3SI2A 3SXOA 2Q44A 5K8MA 2V77A 1U6MA 2AFWA 2ZEEA 2BL1A 3D7HA 4NCZA 5D8NA 4B13A 2G9DA 4Z65A 3FF3A 2ABZA 4M6GA 3FEEA 4A94A 1TIQA 2AE6A 2ZPAA 5ISVA 4UEFA 3DSBA 2G3TA 4QUSA 4RI1A 3ZJ0A 4UEZA 2H5MA 3KKWA 2P6EA 2Q4VA 5EBVA 5JH9A 3H8FA 3TO7A 1H8LA 3NE8A 5LRJA 2A4NA 3D68A 4MJ8A 3GLJA 1TF8A 2C6GA 4QB9A 3S6KA 4MXUA 4CAFA 2G0BA 1QMUA 5LYDA 1Y9KA 4CS0B 3B3SA 4XNHB 4FUUA 2IL4A 4MBUA 1CPXA 1VHEA 1OZPA 1YMEA 4AB7A 3D2MA 3UY5A 5LYLA 3DNSA 3TO6A 2ZOGA 4MHZA 2CXAA 3DDDA 1WK4A 3T8WA 1YGHA 1NSAA 1XFOA 3K9TA 3B35A 3JUWA 1XOVA 3TOAA 1QSTA 4CAVA 4AVBA 1TKJA 2PJ4A 5AG6A 3RNZA 2VZZA 5BWAB 1XBUA 3PZJA 1ARMA 3GKRA 3PB4X 1TXRA 4R76A 2PIZA 4EVYA 5C88A 3F0AA 4OLLA 3BJ7A 3KR4A 3D3SA 3WABA 4KORA 3S9LA 3BI1A 1VKCA 2CNTA 2OZUA 3F5BA 4JYWA 3LACA 1TF9A 3LD2A 2PIYA 1EE3P 2VBQA 4NGQA 2PC1A 2B3VA 3L2NA 2O53A 3TE4A 2EO8A 2YNEA 2V8VA 4IHMA 1Y0RA 1IGBA 3H4QA 1GYTA 1YW4A 2OOTA 4CRYB 1CBXA 2XEFA 4X2TA 2FIWA 2O28A 3BXMA 3B7IA 5F46A 3SXNA 2ZENA 3IWWA 2FSRA 4RS2A 4UFWA 4AG9A 1VHOA 2GU2A 1J4JA 1Z8XA 3TT2A 3ZZIA 1A2ZA 4F9VA 5IB0A 1R43A 3DLJA 4JZ0A 2WYRA 4NGNA 4KVXA 4PXEA 7CPAA 4MHYA 5JGFA 4NGPA 2Z10A 1B6BA 3F8KA 4UWJA 2J9AA 2NYQA 4Q38A 4H6ZA 4YU9A 2PVVA 2V8DA 4P4IA 3SJEA 4PSWA 4LQ6A 3SJGA 4BMHA 2CTCA 4R87A 1LANA 1BOBA 1LOKA 5H84A 3T9YA 2PJAA 4NEXA 3IIBA 2QIRA 3KQZA 4C2YA 5D29A 4A33A 4LQGA 5A28A 2JDCA 1M4IA 1YQEA 4JWPA 4XPDC 2ZEHA 3VH9A 5HVGA 1HDUA 5K8OA 4UIAA 2GE3A 2GANA 4OC2A 3BHXA 4MFKA 4KZTA 1AUGA 1LRZA 1NMTA 3MN8A 4KLVA 3R96A 2OR4A 3CXPA 1Y7EA 2PR1A 4JD6A 1CJWA 4PV6A 4TNUA 5A27A 3B2YA 2Q4YA 4M85A 3D8PA 2Q7SA 4FD4A 5HH1A 2FVGA 2ODFA 1K4JA 4CAEA 2OB0A 1XE4A 5HVFA 4KUAA 2I3CA 3FEDA 1VHSA 3V8IA 4CRZB 2AFUA 2NMTA 3B3VA 4A30A 2Q04A 2VXKA 3FBUA 2PR8A 3FB3A 5F09A 4RN7A 2ZW4A 3SJXA 3DR6A 1M44A 3PP9A 2CIJA 4AXVA 5HVHA 4YGOA 2D4OA 4X8IA 5E96A 2PSWA 2Z3OA 4NJQA 1JWQA 3QAYA 4PQAA 4KS9A 3KGQA 3IJ3A 1BO4A 4IUSA 4PK2A 4BBHA 4DJLA 4YRHA 4ZGYB 2EK9A 4E2AA 4MFQA 4CAXA 5LYFA 4QVTA 5ELYA 2ZW7A 2C27A 5F47A 4ORFA 2IQ6A 3PEIA 3QB8A 2PJ5A 3GB0A 1YSJA 4KOWA 4XNHC 5LRGA 1LCPA 1S7NA 4NGTA 4KOVA 3B3CA 2FT0A 2RB7A 1YREA 4F0XA 1LAPA 2P6GA 1QSNA 2REEA 5AG5A 6CPAA 1LFWA 1XIXA 2Z3NA 5KTAA 4R57A 5G22A 4LX9A 4UF4A 3R95A 3SJFA 2QVPA 2HQYA 2AJ6A 5AG4A 5HMNA 1IY7A 2PJ8A 1AYEA 1ZG9A 4UCNA 4EWTA 4M6IA 1KWMA 5J8CA 1DE4C 2I00A 1VGYA 1B87A 3I1UA 5G21A 4OMEA 4HKFA 4OC1A 2ZEPA 2ZXVA 3CT9A 4KLWA 3SHPA 3FIXA 2J8MA 5AG7A 4F6AA 2FCKA 4PXDA 1QSMA 2RFHA 4X5KA 2JEWA 3KZWA 4KOTA 2ANPA 3RO0A 4B5PA 2OU2A 4ZY0A 1DTDA 4Y49B 3ISXA 2QMLA 3IGRA 1UFHA 5F48A 2FXFA 2WUUA 3CXSA 5K8PA 4OAEA 4CYNA 4DUKA 4U5YA 2VI7A 2C6CA 2EBJA 4WWVA
chains in the Genus database with same CATH topology
1IIDA 3FRMA 2Q0YA 2VQYA 4MI4A 2B4DB 1WWZA 1FY7A 2FL4A 5KTDA 5G1ZA 4E0AA 4M3SA 2OH1A 4ONUA 1M4DA 4CGMA 4E8OA 1ON0A 4KSFA 2FE7A 2RC4A 1Q2DA 4CAWA 2EUIA 2I79A 3FXTA 3GYAA 4C7IA 4UA3A 1YVOA 4H6UA 4XPLA 3P2FA 4U9ZA 3R9EA 4PSXA 2R7HA 3D2PA 4KVOE 4CGOA 3VWEA 3CXQA 4CYOA 2B58A 4A32A 4MFJA 2YNCC 1XMTA 5IX3A 1S60A 3EO4A 4NXYA 3GY9A 4MY0A 4MFLA 2HV2A 3EC4A 1Q2CA 2PDOA 3EFAA 2EVNA 5DWMA 3JTKA 2R1IA 3PGPA 4NF1A 4MHDA 3K9UA 1V0CA 4K30A 3R1KA 2FS5A 3JVNA 3R9FA 2CNSA 3I3GA 1MJBA 2B5GA 2J8NA 5G20A 4ZBGA 1QSOA 2R8VA 4KVME 1I21A 4OADA 5KTCA 3IU2A 4KOSA 1MJ9A 2REFA 3TFYA 1M1DA 2BEIA 1S7KA 2F5IA 4YFJA 2G3AA 3N7ZA 4UBRA 3I9SA 2R98A 5H86A 1Z4RA 2BUEA 3W6SA 5GCNA 3A9LA 4CYPA 4II9A 1IB1E 4JXQA 3QAHA 2CNMA 4L89A 5IV0A 4FD6A 4JLYA 4B10A 1NSLA 1KUXA 1S5KA 4F0YA 3W6XA 4B14A 3BLNA 2Z3MA 4QC6A 4CGNA 2JEVA 3FYNA 4H89A 5EC4A 1Y7RA 3LODA 4XPKA 1RXTA 1YK3A 4UCMA 4Y49C 2OZHA 4NSQA 1XF8A 3FNCA 4R3KA 1Q2YA 3RYOA 1IYLA 2B4BA 4HNYB 4Q36A 4C68A 2Z3LA 2Z3KA 1KUYA 2ATRA 4AVAA 4QBJA 1R57A 5JQ4A 2B5GB 3MGDA 2K5TA 1MK4A 1M4GA 2Z3PA 4B11A 2Z0ZA 5F49A 4MFZA 4GS4A 1YVKA 2YNCA 4B12A 1P0HA 4JXRA 4L8AA 2KCWA 4R9MA 4J3GA 1N71A 2ZW6A 3S6GA 1RO5A 2Z11A 2ZW5A 3G3SA 3DR8A 3NE7A 2YGWA 1PU9A 1XEBA 2OZGA 3S6FA 3EXNA 4C2XA 4XPDB 3TOBA 3WR7A 4C2ZA 1IICA 1I1DA 2Y0MA 1Y9WA 4KOXA 3IU1A 4LUAA 1PUAA 2JLMA 4CGPA 1YR0A 3E0KA 4KUBA 3P2HA 4R3LA 5J8FA 1Z9UA 5C82A 1IYKA 4IF5A 2HUZA 2WSAA 3T90A 5JPHA 4C7HA 3R9GA 2P0WA 2DPSA 3C26A 4JJXA 1KUVA 1S3ZA 4UFXA 4A2ZA 1YLEA 1S7LA 3TTHA 2B3UA 3S6HA 4CYQA 3VWDA 2JDDA 1NE9A 1QSRA 2WPWA 2YNDA 2P6FA 4B5PB 3B8GA 4MFPA 3G8WA 4AVCA 2PQ8A 2WPXA 4HNWB 2VEZA 1P4NA 2QECA 2DPTA 2FIAA 3EY5A 1L0CA 4KSAA 4UWIA 3TCVA 2CY2A 4KOYA 3IWGA 2Q7BA 4A31A 1YX0A 4UCPA 1I12A 1Z4EA 3BJ8A 5AGEA 3TO9A 2PRBA 2D4PA 3IWEA 1GHEA 1MJAA 4U9YA 4AG7A 4MY3A 5I0CA 4KOUA 5FVJA 4DNCA 4A95A 1CM0A 4HNXB 3OWCA 2B4DA 2J8RA 2GIVA 4CGLA 3H5ZA 2ARHA 4I49A 4FD7A 2DXQA 5DWNA 4PK3A 1ZO0A 2BSWA 4B5OA 1KZFA 4FD5A 2VZYA 2X7BA 1S7FA 5CNPA 3W91A 1SQHA 3SXOA 2Q44A 1U6MA 4B13A 2BL1A 4NCZA 1TIQA 2AE6A 2ZPAA 5ISVA 3DSBA 2G3TA 4QUSA 4RI1A 3ZJ0A 2H5MA 3KKWA 2P6EA 2Q4VA 5EBVA 3TO7A 2A4NA 4MJ8A 3S6KA 4QB9A 4CAFA 4CS0B 2G0BA 1Y9KA 4XNHB 4MBUA 2IL4A 1OZPA 4AB7A 3D2MA 3UY5A 3DNSA 3TO6A 2CXAA 3DDDA 1WK4A 1YGHA 3TOAA 3JUWA 1QSTA 4AVBA 5AG6A 2VZZA 5BWAB 3PZJA 3GKRA 4EVYA 5C88A 3F0AA 4OLLA 3BJ7A 3D3SA 4KORA 1VKCA 2CNTA 2OZUA 3F5BA 3LD2A 2VBQA 2PC1A 2B3VA 3TE4A 2YNEA 3H4QA 4CRYB 2FIWA 2O28A 5F46A 3SXNA 4RS2A 2FSRA 4UFWA 4AG9A 1J4JA 3TT2A 3ZZIA 5IB0A 4KVXA 2Z10A 1B6BA 3F8KA 4UWJA 4Q38A 4H6ZA 4PSWA 4BMHA 4R87A 5H84A 1BOBA 3T9YA 4NEXA 2QIRA 4C2YA 4A33A 5A28A 2JDCA 1M4IA 4JWPA 4XPDC 2GE3A 2GANA 4MFKA 4KZTA 1NMTA 1LRZA 4KLVA 3R96A 3CXPA 2PR1A 4JD6A 1CJWA 4PV6A 5A27A 2Q4YA 4M85A 3D8PA 4FD4A 5HH1A 1K4JA 4CAEA 2OB0A 1XE4A 4KUAA 1VHSA 3V8IA 4CRZB 2NMTA 4A30A 2Q04A 2VXKA 3FBUA 2PR8A 3FB3A 2ZW4A 3DR6A 1M44A 3PP9A 4YGOA 2D4OA 5E96A 2PSWA 2Z3OA 4KS9A 4PK2A 4BBHA 1BO4A 4IUSA 4ZGYB 4YRHA 4E2AA 4MFQA 4CAXA 4QVTA 2ZW7A 2C27A 5F47A 4ORFA 3QB8A 4KOWA 4XNHC 1S7NA 4KOVA 2FT0A 1YREA 4F0XA 2P6GA 1QSNA 2REEA 5AG5A 2Z3NA 1XIXA 5KTAA 4R57A 5G22A 4LX9A 3R95A 2HQYA 2AJ6A 5AG4A 5HMNA 4UCNA 5J8CA 2I00A 1B87A 5G21A 4HKFA 2ZXVA 4KLWA 3SHPA 3FIXA 2J8MA 5AG7A 4F6AA 2FCKA 1QSMA 4X5KA 4KOTA 4B5PA 2OU2A 4Y49B 2QMLA 3IGRA 1UFHA 5F48A 2FXFA 2WUUA 3CXSA 4OAEA 4CYNA 4U5YA 2VI7A 4UFVA 4CAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IID A;  3FRM A;  2Q0Y A;  2VQY A;  4MI4 A;  2B4D B;  1WWZ A;  1FY7 A;  2FL4 A;  5KTD A;  4E0A A;  4M3S A;  2OH1 A;  4ONU A;  1M4D A;  4E8O A;  1ON0 A;  2FE7 A;  2RC4 A;  1Q2D A;  4CAW A;  2EUI A;  2I79 A;  3FXT A;  3GYA A;  4UA3 A;  1YVO A;  4H6U A;  4XPL A;  3P2F A;  4U9Z A;  3R9E A;  4PSX A;  2R7H A;  3D2P A;  4KVO E;  3VWE A;  3CXQ A;  2B58 A;  1XMT A;  5IX3 A;  1S60 A;  3EO4 A;  4NXY A;  3GY9 A;  4MY0 A;  2HV2 A;  3EC4 A;  1Q2C A;  2PDO A;  3EFA A;  2EVN A;  5DWM A;  2R1I A;  3PGP A;  4NF1 A;  4MHD A;  3K9U A;  1V0C A;  4K30 A;  3R1K A;  2FS5 A;  3JVN A;  3R9F A;  2CNS A;  3I3G A;  1MJB A;  2B5G A;  2J8N A;  4ZBG A;  1QSO A;  2R8V A;  4KVM E;  1I21 A;  4OAD A;  5KTC A;  4KOS A;  1MJ9 A;  2REF A;  3TFY A;  1M1D A;  2BEI A;  1S7K A;  2F5I A;  4YFJ A;  2G3A A;  3N7Z A;  4UBR A;  3I9S A;  2R98 A;  5H86 A;  1Z4R A;  2BUE A;  3W6S A;  5GCN A;  4II9 A;  1IB1 E;  4JXQ A;  3QAH A;  2CNM A;  4L89 A;  5IV0 A;  4FD6 A;  4JLY A;  1NSL A;  1KUX A;  1S5K A;  4F0Y A;  3W6X A;  3BLN A;  4QC6 A;  2JEV A;  3FYN A;  4H89 A;  5EC4 A;  1Y7R A;  3LOD A;  4XPK A;  1RXT A;  1YK3 A;  4Y49 C;  2OZH A;  4NSQ A;  1XF8 A;  3FNC A;  4R3K A;  1Q2Y A;  3RYO A;  1IYL A;  2B4B A;  4HNY B;  1KUY A;  2ATR A;  4AVA A;  4QBJ A;  1R57 A;  5JQ4 A;  2B5G B;  3MGD A;  2K5T A;  1MK4 A;  1M4G A;  2Z0Z A;  5F49 A;  4GS4 A;  1YVK A;  1P0H A;  4JXR A;  4L8A A;  2KCW A;  4R9M A;  4J3G A;  1N71 A;  2ZW6 A;  3S6G A;  1RO5 A;  2Z11 A;  2ZW5 A;  3G3S A;  3DR8 A;  3NE7 A;  1PU9 A;  1XEB A;  2OZG A;  3S6F A;  3EXN A;  4XPD B;  3TOB A;  3WR7 A;  1IIC A;  1I1D A;  2Y0M A;  1Y9W A;  4KOX A;  4LUA A;  1PUA A;  2JLM A;  1YR0 A;  3E0K A;  4KUB A;  3P2H A;  4R3L A;  5J8F A;  1Z9U A;  5C82 A;  1IYK A;  4IF5 A;  2HUZ A;  3T90 A;  5JPH A;  3R9G A;  2P0W A;  3C26 A;  4JJX A;  1KUV A;  1S3Z A;  1YLE A;  1S7L A;  3TTH A;  2B3U A;  3S6H A;  3VWD A;  2JDD A;  1NE9 A;  1QSR A;  2WPW A;  2P6F A;  4B5P B;  3B8G A;  3G8W A;  4AVC A;  2PQ8 A;  2WPX A;  4HNW B;  2VEZ A;  1P4N A;  2QEC A;  2FIA A;  3EY5 A;  1L0C A;  4UWI A;  3TCV A;  2CY2 A;  4KOY A;  3IWG A;  2Q7B A;  1YX0 A;  1I12 A;  1Z4E A;  3BJ8 A;  3TO9 A;  2PRB A;  2D4P A;  1GHE A;  1MJA A;  4U9Y A;  4AG7 A;  4MY3 A;  5I0C A;  4KOU A;  5FVJ A;  4DNC A;  1CM0 A;  4HNX B;  3OWC A;  2B4D A;  2J8R A;  2GIV A;  2ARH A;  4I49 A;  4FD7 A;  2DXQ A;  5DWN A;  4PK3 A;  2BSW A;  4B5O A;  1KZF A;  4FD5 A;  2VZY A;  2X7B A;  1S7F A;  5CNP A;  3W91 A;  1SQH A;  3SXO A;  2Q44 A;  1U6M A;  2BL1 A;  4NCZ A;  1TIQ A;  2AE6 A;  2ZPA A;  5ISV A;  3DSB A;  2G3T A;  4QUS A;  4RI1 A;  3ZJ0 A;  2H5M A;  3KKW A;  2P6E A;  2Q4V A;  5EBV A;  3TO7 A;  2A4N A;  4MJ8 A;  3S6K A;  4QB9 A;  4CS0 B;  2G0B A;  1Y9K A;  4XNH B;  4MBU A;  2IL4 A;  1OZP A;  4AB7 A;  3D2M A;  3UY5 A;  3DNS A;  3TO6 A;  3DDD A;  1WK4 A;  1YGH A;  3TOA A;  3JUW A;  1QST A;  4AVB A;  2VZZ A;  3PZJ A;  3GKR A;  4EVY A;  5C88 A;  3F0A A;  4OLL A;  3BJ7 A;  3D3S A;  4KOR A;  1VKC A;  2CNT A;  2OZU A;  3F5B A;  3LD2 A;  2VBQ A;  2PC1 A;  2B3V A;  3TE4 A;  3H4Q A;  4CRY B;  2FIW A;  2O28 A;  5F46 A;  3SXN A;  4RS2 A;  2FSR A;  4AG9 A;  1J4J A;  3TT2 A;  3ZZI A;  5IB0 A;  4KVX A;  2Z10 A;  1B6B A;  3F8K A;  4UWJ A;  4H6Z A;  4PSW A;  4BMH A;  4R87 A;  5H84 A;  1BOB A;  3T9Y A;  4NEX A;  2QIR A;  2JDC A;  1M4I A;  4JWP A;  4XPD C;  2GE3 A;  2GAN A;  4KZT A;  1NMT A;  1LRZ A;  4KLV A;  3R96 A;  3CXP A;  2PR1 A;  4JD6 A;  1CJW A;  4PV6 A;  2Q4Y A;  4M85 A;  3D8P A;  4FD4 A;  5HH1 A;  1K4J A;  2OB0 A;  1XE4 A;  4KUA A;  1VHS A;  3V8I A;  4CRZ B;  2NMT A;  2Q04 A;  2VXK A;  3FBU A;  2PR8 A;  3FB3 A;  2ZW4 A;  3DR6 A;  1M44 A;  3PP9 A;  4YGO A;  2D4O A;  5E96 A;  2PSW A;  4PK2 A;  1BO4 A;  4IUS A;  4YRH A;  4E2A A;  4CAX A;  4QVT A;  2ZW7 A;  2C27 A;  5F47 A;  4ORF A;  3QB8 A;  4KOW A;  4XNH C;  1S7N A;  4KOV A;  2FT0 A;  1YRE A;  2P6G A;  1QSN A;  2REE A;  1XIX A;  5KTA A;  4R57 A;  4LX9 A;  3R95 A;  2HQY A;  2AJ6 A;  5HMN A;  5J8C A;  2I00 A;  1B87 A;  4HKF A;  2ZXV A;  4KLW A;  3SHP A;  3FIX A;  2J8M A;  4F6A A;  2FCK A;  1QSM A;  4X5K A;  4KOT A;  4B5P A;  2OU2 A;  4Y49 B;  2QML A;  3IGR A;  1UFH A;  5F48 A;  2FXF A;  3CXS A;  4OAE A;  4U5Y A;  2VI7 A;  4CAV A; 
#chains in the Genus database with same CATH topology
 1IID A;  3FRM A;  3LWU A;  2Q0Y A;  3B3W A;  2VQY A;  1XRY A;  4MI4 A;  1RTQ A;  2B4D B;  1WWZ A;  4FBE A;  1FY7 A;  2FL4 A;  5KTD A;  3K2K A;  3HUV A;  5G1Z A;  3ISZ A;  2PVW A;  4E0A A;  4OP4 A;  4M3S A;  4KSI A;  2OH1 A;  1YLO A;  2PJ2 A;  4ONU A;  1M4D A;  4CGM A;  5I4M A;  3PRT A;  4EFD A;  4E8O A;  3NA6 A;  5CPA A;  1ARL A;  1ON0 A;  4KSF A;  1F57 A;  2FE7 A;  2PJ7 A;  2RC4 A;  1Q2D A;  3CDX A;  2EUI A;  1FNO A;  3TC8 A;  2I79 A;  3FXT A;  4CAW A;  2BO9 A;  3GYA A;  4P4F A;  4P10 A;  4P4D A;  4OKO A;  4UA3 A;  1ZG8 A;  4C7I A;  4ZYQ A;  3RZA A;  3WC5 A;  1PYT B;  1YVO A;  2QJ8 A;  4H6U A;  3VAR A;  2PJB A;  4XPL A;  4A38 A;  3P2F A;  3H8E A;  2GLJ A;  4PSX A;  2R7H A;  3D2P A;  4U9Z A;  4KVO E;  3R9E A;  3VAT A;  4CGO A;  3VWE A;  3CXQ A;  4CYO A;  2ZEG A;  2JBK A;  5HXD A;  1Z8T A;  4R8F A;  2B58 A;  2XEJ A;  4A32 A;  4BIN A;  3D7F A;  4MFJ A;  2YNC C;  4R6T A;  4O23 A;  1XMT A;  5IX3 A;  1S60 A;  3EO4 A;  4NXY A;  2ZEO A;  2GLF A;  3GY9 A;  4MY0 A;  4FWU A;  4MFL A;  4WJB A;  4PXB A;  2HV2 A;  3EC4 A;  3KHX A;  2WZN A;  1Q2C A;  2PDO A;  3EFA A;  2EVN A;  3NFZ A;  5DWM A;  3KQX A;  3JTK A;  3WC6 A;  1PCA A;  5CBM A;  8CPA A;  2R1I A;  1FT7 A;  3BI0 A;  3PGP A;  4MHD A;  4NF1 A;  3K9U A;  1V0C A;  4K30 A;  3R1K A;  2FS5 A;  3JVN A;  4IK2 A;  4NGR A;  3R9F A;  3S9M A;  2BCO A;  2CNS A;  3I3G A;  4G1P A;  4PXC A;  1MJB A;  2B5G A;  1HDQ A;  4ZX8 A;  3NH4 A;  3B3T A;  2J8N A;  5G20 A;  4ZBG A;  2AFM A;  2PJ0 A;  1TKF A;  4MCS A;  2NSM A;  1QSO A;  2Q51 A;  2EK8 A;  2R8V A;  3FJU A;  1CPS A;  4OID A;  4KVM E;  1I21 A;  4OAD A;  5KTC A;  3IU2 A;  4MCR A;  4HPS A;  1MJ9 A;  2REF A;  4KOS A;  4OC3 A;  4OC4 A;  3TFY A;  1M1D A;  3FH4 A;  2BEI A;  1JQG A;  1S7K A;  3LMS A;  4DYO A;  3D7G A;  3H8G A;  2F5I A;  4YFJ A;  2G3A A;  3N7Z A;  4UBR A;  3I9S A;  2R98 A;  1IOI A;  4X3R A;  5H86 A;  1Z4R A;  2BUE A;  3W6S A;  4FAI A;  5GCN A;  3A9L A;  2PJ3 A;  4PPZ A;  4CYP A;  1Y0Y A;  3D7D A;  1IB1 E;  1F2O A;  2DF5 A;  2ZEM A;  3FMC A;  4MMO A;  4II9 A;  4JXQ A;  1CP7 A;  1BPN A;  3QAH A;  2CNM A;  4L89 A;  5IV0 A;  3NH8 A;  4FD6 A;  4JLY A;  2PRQ A;  3WT4 A;  4B10 A;  3KHZ A;  1NSL A;  1KUX A;  1S5K A;  4UFV A;  3S9N A;  4F0Y A;  3W6X A;  4B14 A;  3BLN A;  2PJC A;  2Z3M A;  4QC6 A;  1F2P A;  4CGN A;  2JEV A;  2PE3 A;  3FYN A;  1CX8 A;  3IC1 A;  4ONW A;  4H2K A;  4H89 A;  5THW A;  3RBU A;  1VIX A;  2BOA A;  2V8G A;  4F8Z A;  4B6Z A;  5EC4 A;  3MRU A;  4ZY1 A;  1XMB A;  2F7V A;  1Y7R A;  3LOD A;  2CF4 A;  4BD9 A;  4XPK A;  4GM5 A;  1YK3 A;  1RXT A;  4UCM A;  4Y49 C;  2OZH A;  4NSQ A;  1XF8 A;  2IJZ A;  3FNC A;  4R3K A;  1TKH A;  1Q2Y A;  2JBJ A;  2ZEF A;  3RYO A;  1IYL A;  2B4B A;  3D4U A;  4OC0 A;  3QNV A;  1BAV A;  3PB7 X;  3PBB A;  4HNY B;  1Z5R A;  4Q36 A;  4A37 A;  3D66 A;  2HC9 A;  4C68 A;  1X12 A;  2Z3L A;  2Z3K A;  3DGV A;  3KAS A;  1KUY A;  2ATR A;  4AVA A;  4QBJ A;  1ELM P;  5J1Q A;  1R57 A;  3PBE A;  5JQ4 A;  2AFO A;  3PFO A;  4NGS A;  4OIW A;  2B5G B;  3MGD A;  5JM6 A;  1BPM A;  2K5T A;  1MK4 A;  1M4G A;  2Z3P A;  3CZX A;  4IAV A;  4UEE A;  3PB8 X;  1Q7L A;  3JRU A;  3CPA A;  3NH5 A;  2QYV A;  2C6P A;  2IMO A;  4B11 A;  2AFS A;  2Z0Z A;  5F49 A;  4EME A;  4MFZ A;  4GS4 A;  1YVK A;  2YNC A;  4R7M A;  4P6Y A;  4MHN A;  1HEE A;  4B12 A;  1P0H A;  4JXR A;  2POK A;  4A39 A;  4L8A A;  2KCW A;  1IOF A;  2Q43 A;  4R9M A;  4J3G A;  1N71 A;  1X10 A;  2PJ9 A;  2ZW6 A;  4UIB A;  4TWE A;  4ZY2 A;  3S6G A;  1ZLH A;  1RO5 A;  2Z11 A;  2ZW5 A;  3GUX A;  1ELL P;  2VL1 A;  3D67 A;  3G3S A;  3DR8 A;  3NE7 A;  1UWY A;  2YGW A;  4F9U A;  3FX6 A;  1PU9 A;  1XEB A;  1ZG7 A;  2OZG A;  3S6F A;  3EXN A;  4C2X A;  4MCQ A;  4XPD B;  1IU8 A;  3TOB A;  3WR7 A;  4C2Z A;  1IIC A;  1I1D A;  2Y0M A;  1Y9W A;  2ZED A;  4YWY A;  4KOX A;  3FVL A;  3IU1 A;  4LUA A;  1PUA A;  2JLM A;  4CGP A;  1YR0 A;  3WC7 A;  1AMP A;  3E0K A;  4KUB A;  3P2H A;  4R3L A;  5DS0 A;  5J8F A;  2PCU A;  1Z9U A;  5C82 A;  2ZOF A;  4RUH A;  2ZEL A;  1IYK A;  4ZX9 A;  4IF5 A;  2HUZ A;  2WSA A;  3T90 A;  5JPH A;  1XJO A;  4GXH A;  4C7H A;  2XEG A;  3R9G A;  2P0W A;  2DPS A;  3C26 A;  4JJX A;  1CG2 A;  2PJ1 A;  1KUV A;  1S3Z A;  4UFX A;  3PB9 X;  1YLE A;  1S7L A;  4A2Z A;  1Z2L A;  3TTH A;  2B3U A;  4P44 A;  2EWB A;  4NGM A;  3S6H A;  3VWD A;  4CYQ A;  2DEA A;  2JDD A;  4NJR A;  1NE9 A;  4P4E A;  3PB6 X;  2AFZ A;  1QSR A;  2WPW A;  4P4J A;  5EMI A;  2YND A;  2CTB A;  3KL9 A;  3TX8 A;  5LYI A;  2P6F A;  4B5P B;  3B8G A;  4MFP A;  1M4L A;  1ZLI A;  1YW6 A;  3G8W A;  4CPA A;  4ZI6 A;  2PJ6 A;  3IFE A;  4AVC A;  2PQ8 A;  2WPX A;  4HNW B;  4K3N A;  3KI9 A;  2VEZ A;  1CP6 A;  1P4N A;  2QEC A;  3SI1 A;  1QQ9 A;  2DPT A;  2FIA A;  3EY5 A;  1L0C A;  2F8H A;  4KSA A;  4MCP A;  4P4B A;  2CY2 A;  4UWI A;  3TCV A;  4KOY A;  3IWG A;  2Q7B A;  4A31 A;  5LRK A;  2XEI A;  2AFX A;  1YX0 A;  4UCP A;  1I12 A;  3HLP A;  5IB9 A;  3PFE A;  1Z4E A;  3V7Z A;  3BJ8 A;  1OBR A;  4NFR A;  5AGE A;  3TO9 A;  2PRB A;  4W9Y A;  2D4P A;  3IWE A;  5K8N A;  4Q7A A;  1GHE A;  1MJA A;  4U9Y A;  4AG7 A;  4MY3 A;  5I0C A;  4KOU A;  4OC5 A;  5FVJ A;  4DNC A;  4A95 A;  3IO1 A;  1CM0 A;  4HNX B;  3OWC A;  3SI0 A;  2O4H A;  3KR5 A;  1R3N A;  2B4D A;  1LAM A;  2GIV A;  2J8R A;  4CGL A;  3H5Z A;  2Q4Z A;  4MHP A;  2ARH A;  3N5F A;  4I49 A;  4M6H A;  4FD7 A;  2C1C A;  2DXQ A;  1Z8W A;  3V38 A;  1BLL E;  5DWN A;  4PK3 A;  1Z8L A;  1ZO0 A;  2BSW A;  3GIU A;  4P45 A;  3RAM A;  4B5O A;  4MRI A;  1KZF A;  2GRE A;  4FD5 A;  3CPX A;  3IEH A;  2VZY A;  2X7B A;  2GFQ A;  1S7F A;  5CNP A;  2HB6 A;  2V8H A;  3W91 A;  1SQH A;  3FEC A;  3SI2 A;  3SXO A;  2Q44 A;  5K8M A;  2V77 A;  1U6M A;  2AFW A;  2ZEE A;  2BL1 A;  3D7H A;  4NCZ A;  5D8N A;  4B13 A;  2G9D A;  4Z65 A;  3FF3 A;  2ABZ A;  4M6G A;  3FEE A;  4A94 A;  1TIQ A;  2AE6 A;  2ZPA A;  5ISV A;  4UEF A;  3DSB A;  2G3T A;  4QUS A;  4RI1 A;  3ZJ0 A;  4UEZ A;  2H5M A;  3KKW A;  2P6E A;  2Q4V A;  5EBV A;  5JH9 A;  3H8F A;  3TO7 A;  1H8L A;  3NE8 A;  5LRJ A;  2A4N A;  3D68 A;  4MJ8 A;  3GLJ A;  1TF8 A;  2C6G A;  4QB9 A;  3S6K A;  4MXU A;  4CAF A;  2G0B A;  1QMU A;  5LYD A;  1Y9K A;  4CS0 B;  3B3S A;  4XNH B;  4FUU A;  2IL4 A;  4MBU A;  1CPX A;  1VHE A;  1OZP A;  1YME A;  4AB7 A;  3D2M A;  3UY5 A;  5LYL A;  3DNS A;  3TO6 A;  2ZOG A;  4MHZ A;  2CXA A;  3DDD A;  1WK4 A;  3T8W A;  1YGH A;  1NSA A;  1XFO A;  3K9T A;  3B35 A;  3JUW A;  1XOV A;  3TOA A;  1QST A;  4CAV A;  4AVB A;  1TKJ A;  2PJ4 A;  5AG6 A;  3RNZ A;  2VZZ A;  5BWA B;  1XBU A;  3PZJ A;  1ARM A;  3GKR A;  3PB4 X;  1TXR A;  4R76 A;  2PIZ A;  4EVY A;  5C88 A;  3F0A A;  4OLL A;  3BJ7 A;  3KR4 A;  3D3S A;  3WAB A;  4KOR A;  3S9L A;  3BI1 A;  1VKC A;  2CNT A;  2OZU A;  3F5B A;  4JYW A;  3LAC A;  1TF9 A;  3LD2 A;  2PIY A;  1EE3 P;  2VBQ A;  4NGQ A;  2PC1 A;  2B3V A;  3L2N A;  2O53 A;  3TE4 A;  2EO8 A;  2YNE A;  2V8V A;  4IHM A;  1Y0R A;  1IGB A;  3H4Q A;  1GYT A;  1YW4 A;  2OOT A;  4CRY B;  1CBX A;  2XEF A;  4X2T A;  2FIW A;  2O28 A;  3BXM A;  3B7I A;  5F46 A;  3SXN A;  2ZEN A;  3IWW A;  2FSR A;  4RS2 A;  4UFW A;  4AG9 A;  1VHO A;  2GU2 A;  1J4J A;  1Z8X A;  3TT2 A;  3ZZI A;  1A2Z A;  4F9V A;  5IB0 A;  1R43 A;  3DLJ A;  4JZ0 A;  2WYR A;  4NGN A;  4KVX A;  4PXE A;  7CPA A;  4MHY A;  5JGF A;  4NGP A;  2Z10 A;  1B6B A;  3F8K A;  4UWJ A;  2J9A A;  2NYQ A;  4Q38 A;  4H6Z A;  4YU9 A;  2PVV A;  2V8D A;  4P4I A;  3SJE A;  4PSW A;  4LQ6 A;  3SJG A;  4BMH A;  2CTC A;  4R87 A;  1LAN A;  1BOB A;  1LOK A;  5H84 A;  3T9Y A;  2PJA A;  4NEX A;  3IIB A;  2QIR A;  3KQZ A;  4C2Y A;  5D29 A;  4A33 A;  4LQG A;  5A28 A;  2JDC A;  1M4I A;  1YQE A;  4JWP A;  4XPD C;  2ZEH A;  3VH9 A;  5HVG A;  1HDU A;  5K8O A;  4UIA A;  2GE3 A;  2GAN A;  4OC2 A;  3BHX A;  4MFK A;  4KZT A;  1AUG A;  1LRZ A;  1NMT A;  3MN8 A;  4KLV A;  3R96 A;  2OR4 A;  3CXP A;  1Y7E A;  2PR1 A;  4JD6 A;  1CJW A;  4PV6 A;  4TNU A;  5A27 A;  3B2Y A;  2Q4Y A;  4M85 A;  3D8P A;  2Q7S A;  4FD4 A;  5HH1 A;  2FVG A;  2ODF A;  1K4J A;  4CAE A;  2OB0 A;  1XE4 A;  5HVF A;  4KUA A;  2I3C A;  3FED A;  1VHS A;  3V8I A;  4CRZ B;  2AFU A;  2NMT A;  3B3V A;  4A30 A;  2Q04 A;  2VXK A;  3FBU A;  2PR8 A;  3FB3 A;  5F09 A;  4RN7 A;  2ZW4 A;  3SJX A;  3DR6 A;  1M44 A;  3PP9 A;  2CIJ A;  4AXV A;  5HVH A;  4YGO A;  2D4O A;  4X8I A;  5E96 A;  2PSW A;  2Z3O A;  4NJQ A;  1JWQ A;  3QAY A;  4PQA A;  4KS9 A;  3KGQ A;  3IJ3 A;  1BO4 A;  4IUS A;  4PK2 A;  4BBH A;  4DJL A;  4YRH A;  4ZGY B;  2EK9 A;  4E2A A;  4MFQ A;  4CAX A;  5LYF A;  4QVT A;  5ELY A;  2ZW7 A;  2C27 A;  5F47 A;  4ORF A;  2IQ6 A;  3PEI A;  3QB8 A;  2PJ5 A;  3GB0 A;  1YSJ A;  4KOW A;  4XNH C;  5LRG A;  1LCP A;  1S7N A;  4NGT A;  4KOV A;  3B3C A;  2FT0 A;  2RB7 A;  1YRE A;  4F0X A;  1LAP A;  2P6G A;  1QSN A;  2REE A;  5AG5 A;  6CPA A;  1LFW A;  1XIX A;  2Z3N A;  5KTA A;  4R57 A;  5G22 A;  4LX9 A;  4UF4 A;  3R95 A;  3SJF A;  2QVP A;  2HQY A;  2AJ6 A;  5AG4 A;  5HMN A;  1IY7 A;  2PJ8 A;  1AYE A;  1ZG9 A;  4UCN A;  4EWT A;  4M6I A;  1KWM A;  5J8C A;  1DE4 C;  2I00 A;  1VGY A;  1B87 A;  3I1U A;  5G21 A;  4OME A;  4HKF A;  4OC1 A;  2ZEP A;  2ZXV A;  3CT9 A;  4KLW A;  3SHP A;  3FIX A;  2J8M A;  5AG7 A;  4F6A A;  2FCK A;  4PXD A;  1QSM A;  2RFH A;  4X5K A;  2JEW A;  3KZW A;  4KOT A;  2ANP A;  3RO0 A;  4B5P A;  2OU2 A;  4ZY0 A;  1DTD A;  4Y49 B;  3ISX A;  2QML A;  3IGR A;  1UFH A;  5F48 A;  2FXF A;  2WUU A;  3CXS A;  5K8P A;  4OAE A;  4CYN A;  4DUK A;  4U5Y A;  2VI7 A;  2C6C A;  2EBJ A;  4WWV A; 
#chains in the Genus database with same CATH homology
 1IID A;  3FRM A;  2Q0Y A;  2VQY A;  4MI4 A;  2B4D B;  1WWZ A;  1FY7 A;  2FL4 A;  5KTD A;  5G1Z A;  4E0A A;  4M3S A;  2OH1 A;  4ONU A;  1M4D A;  4CGM A;  4E8O A;  1ON0 A;  4KSF A;  2FE7 A;  2RC4 A;  1Q2D A;  4CAW A;  2EUI A;  2I79 A;  3FXT A;  3GYA A;  4C7I A;  4UA3 A;  1YVO A;  4H6U A;  4XPL A;  3P2F A;  4U9Z A;  3R9E A;  4PSX A;  2R7H A;  3D2P A;  4KVO E;  4CGO A;  3VWE A;  3CXQ A;  4CYO A;  2B58 A;  4A32 A;  4MFJ A;  2YNC C;  1XMT A;  5IX3 A;  1S60 A;  3EO4 A;  4NXY A;  3GY9 A;  4MY0 A;  4MFL A;  2HV2 A;  3EC4 A;  1Q2C A;  2PDO A;  3EFA A;  2EVN A;  5DWM A;  3JTK A;  2R1I A;  3PGP A;  4NF1 A;  4MHD A;  3K9U A;  1V0C A;  4K30 A;  3R1K A;  2FS5 A;  3JVN A;  3R9F A;  2CNS A;  3I3G A;  1MJB A;  2B5G A;  2J8N A;  5G20 A;  4ZBG A;  1QSO A;  2R8V A;  4KVM E;  1I21 A;  4OAD A;  5KTC A;  3IU2 A;  4KOS A;  1MJ9 A;  2REF A;  3TFY A;  1M1D A;  2BEI A;  1S7K A;  2F5I A;  4YFJ A;  2G3A A;  3N7Z A;  4UBR A;  3I9S A;  2R98 A;  5H86 A;  1Z4R A;  2BUE A;  3W6S A;  5GCN A;  3A9L A;  4CYP A;  4II9 A;  1IB1 E;  4JXQ A;  3QAH A;  2CNM A;  4L89 A;  5IV0 A;  4FD6 A;  4JLY A;  4B10 A;  1NSL A;  1KUX A;  1S5K A;  4F0Y A;  3W6X A;  4B14 A;  3BLN A;  2Z3M A;  4QC6 A;  4CGN A;  2JEV A;  3FYN A;  4H89 A;  5EC4 A;  1Y7R A;  3LOD A;  4XPK A;  1RXT A;  1YK3 A;  4UCM A;  4Y49 C;  2OZH A;  4NSQ A;  1XF8 A;  3FNC A;  4R3K A;  1Q2Y A;  3RYO A;  1IYL A;  2B4B A;  4HNY B;  4Q36 A;  4C68 A;  2Z3L A;  2Z3K A;  1KUY A;  2ATR A;  4AVA A;  4QBJ A;  1R57 A;  5JQ4 A;  2B5G B;  3MGD A;  2K5T A;  1MK4 A;  1M4G A;  2Z3P A;  4B11 A;  2Z0Z A;  5F49 A;  4MFZ A;  4GS4 A;  1YVK A;  2YNC A;  4B12 A;  1P0H A;  4JXR A;  4L8A A;  2KCW A;  4R9M A;  4J3G A;  1N71 A;  2ZW6 A;  3S6G A;  1RO5 A;  2Z11 A;  2ZW5 A;  3G3S A;  3DR8 A;  3NE7 A;  2YGW A;  1PU9 A;  1XEB A;  2OZG A;  3S6F A;  3EXN A;  4C2X A;  4XPD B;  3TOB A;  3WR7 A;  4C2Z A;  1IIC A;  1I1D A;  2Y0M A;  1Y9W A;  4KOX A;  3IU1 A;  4LUA A;  1PUA A;  2JLM A;  4CGP A;  1YR0 A;  3E0K A;  4KUB A;  3P2H A;  4R3L A;  5J8F A;  1Z9U A;  5C82 A;  1IYK A;  4IF5 A;  2HUZ A;  2WSA A;  3T90 A;  5JPH A;  4C7H A;  3R9G A;  2P0W A;  2DPS A;  3C26 A;  4JJX A;  1KUV A;  1S3Z A;  4UFX A;  4A2Z A;  1YLE A;  1S7L A;  3TTH A;  2B3U A;  3S6H A;  4CYQ A;  3VWD A;  2JDD A;  1NE9 A;  1QSR A;  2WPW A;  2YND A;  2P6F A;  4B5P B;  3B8G A;  4MFP A;  3G8W A;  4AVC A;  2PQ8 A;  2WPX A;  4HNW B;  2VEZ A;  1P4N A;  2QEC A;  2DPT A;  2FIA A;  3EY5 A;  1L0C A;  4KSA A;  4UWI A;  3TCV A;  2CY2 A;  4KOY A;  3IWG A;  2Q7B A;  4A31 A;  1YX0 A;  4UCP A;  1I12 A;  1Z4E A;  3BJ8 A;  5AGE A;  3TO9 A;  2PRB A;  2D4P A;  3IWE A;  1GHE A;  1MJA A;  4U9Y A;  4AG7 A;  4MY3 A;  5I0C A;  4KOU A;  5FVJ A;  4DNC A;  4A95 A;  1CM0 A;  4HNX B;  3OWC A;  2B4D A;  2J8R A;  2GIV A;  4CGL A;  3H5Z A;  2ARH A;  4I49 A;  4FD7 A;  2DXQ A;  5DWN A;  4PK3 A;  1ZO0 A;  2BSW A;  4B5O A;  1KZF A;  4FD5 A;  2VZY A;  2X7B A;  1S7F A;  5CNP A;  3W91 A;  1SQH A;  3SXO A;  2Q44 A;  1U6M A;  4B13 A;  2BL1 A;  4NCZ A;  1TIQ A;  2AE6 A;  2ZPA A;  5ISV A;  3DSB A;  2G3T A;  4QUS A;  4RI1 A;  3ZJ0 A;  2H5M A;  3KKW A;  2P6E A;  2Q4V A;  5EBV A;  3TO7 A;  2A4N A;  4MJ8 A;  3S6K A;  4QB9 A;  4CAF A;  4CS0 B;  2G0B A;  1Y9K A;  4XNH B;  4MBU A;  2IL4 A;  1OZP A;  4AB7 A;  3D2M A;  3UY5 A;  3DNS A;  3TO6 A;  2CXA A;  3DDD A;  1WK4 A;  1YGH A;  3TOA A;  3JUW A;  1QST A;  4AVB A;  5AG6 A;  2VZZ A;  5BWA B;  3PZJ A;  3GKR A;  4EVY A;  5C88 A;  3F0A A;  4OLL A;  3BJ7 A;  3D3S A;  4KOR A;  1VKC A;  2CNT A;  2OZU A;  3F5B A;  3LD2 A;  2VBQ A;  2PC1 A;  2B3V A;  3TE4 A;  2YNE A;  3H4Q A;  4CRY B;  2FIW A;  2O28 A;  5F46 A;  3SXN A;  4RS2 A;  2FSR A;  4UFW A;  4AG9 A;  1J4J A;  3TT2 A;  3ZZI A;  5IB0 A;  4KVX A;  2Z10 A;  1B6B A;  3F8K A;  4UWJ A;  4Q38 A;  4H6Z A;  4PSW A;  4BMH A;  4R87 A;  5H84 A;  1BOB A;  3T9Y A;  4NEX A;  2QIR A;  4C2Y A;  4A33 A;  5A28 A;  2JDC A;  1M4I A;  4JWP A;  4XPD C;  2GE3 A;  2GAN A;  4MFK A;  4KZT A;  1NMT A;  1LRZ A;  4KLV A;  3R96 A;  3CXP A;  2PR1 A;  4JD6 A;  1CJW A;  4PV6 A;  5A27 A;  2Q4Y A;  4M85 A;  3D8P A;  4FD4 A;  5HH1 A;  1K4J A;  4CAE A;  2OB0 A;  1XE4 A;  4KUA A;  1VHS A;  3V8I A;  4CRZ B;  2NMT A;  4A30 A;  2Q04 A;  2VXK A;  3FBU A;  2PR8 A;  3FB3 A;  2ZW4 A;  3DR6 A;  1M44 A;  3PP9 A;  4YGO A;  2D4O A;  5E96 A;  2PSW A;  2Z3O A;  4KS9 A;  4PK2 A;  4BBH A;  1BO4 A;  4IUS A;  4ZGY B;  4YRH A;  4E2A A;  4MFQ A;  4CAX A;  4QVT A;  2ZW7 A;  2C27 A;  5F47 A;  4ORF A;  3QB8 A;  4KOW A;  4XNH C;  1S7N A;  4KOV A;  2FT0 A;  1YRE A;  4F0X A;  2P6G A;  1QSN A;  2REE A;  5AG5 A;  2Z3N A;  1XIX A;  5KTA A;  4R57 A;  5G22 A;  4LX9 A;  3R95 A;  2HQY A;  2AJ6 A;  5AG4 A;  5HMN A;  4UCN A;  5J8C A;  2I00 A;  1B87 A;  5G21 A;  4HKF A;  2ZXV A;  4KLW A;  3SHP A;  3FIX A;  2J8M A;  5AG7 A;  4F6A A;  2FCK A;  1QSM A;  4X5K A;  4KOT A;  4B5P A;  2OU2 A;  4Y49 B;  2QML A;  3IGR A;  1UFH A;  5F48 A;  2FXF A;  2WUU A;  3CXS A;  4OAE A;  4CYN A;  4U5Y A;  2VI7 A;  4UFV A;  4CAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...