4X5KA

Human naa50 complex with coenzyme a and an acetylated peptide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
GSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/peptide
molecule keywords N-alpha-acetyltransferase 50
publication title Human NAA50 with coenzymeA and a peptide
rcsb
source organism Homo sapiens
total genus 39
structure length 153
sequence length 153
ec nomenclature ec 2.3.1.258: N-terminal methionine N(alpha)-acetyltransferase NatE.
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4x5kA00
1MJ9A 4Y49C 1K4JA 2AE6A 2OB0A 4IUSA 4DNCA 1U6MA 2OH1A 4RI1A 3DDDA 3N7ZA 1KUXA 3VWDA 3D2PA 3D8PA 2B4DA 2C27A 2QIRA 3NE7A 2D4OA 4GS4A 4U9ZA 4KLWA 4AG9A 2X7BA 2PQ8A 1J4JA 4YFJA 2VEZA 4I49A 2PSWA 1KUVA 3E0KA 4H6UA 4R3KA 1M4GA 1QSRA 2BEIA 3WR7A 3MGDA 3I9SA 4LUAA 3GKRA 4M3SA 4QUSA 1KUYA 5JPHA 1S60A 2Z11A 4AVAA 4M85A 4IF5A 2J8MA 1S7NA 2RC4A 5E96A 3FIXA 4NEXA 4NXYA 1Y9KA 1YLEA 2ZW4A 2FXFA 3W91A 2Z0ZA 1S7LA 2ZXVA 1RXTA 3TOAA 5IX3A 2ZW6A 5F48A 4JLYA 3SHPA 2PRBA 2OZGA 4R9MA 3R9FA 4JXQA 4NSQA 3JVNA 3DNSA 1BO4A 5EBVA 4E0AA 1VHSA 3S6FA 5F46A 2REFA 2Y0MA 2VZYA 2B4BA 2IL4A 1Z9UA 3IWGA 4BMHA 1IICA 2CY2A 1Y9WA 2D4PA 4FD7A 4HNYB 2I79A 2ARHA 3R9EA 1KZFA 2CNTA 2GANA 2P6GA 5F49A 4PSXA 4CAVA 4L89A 1NSLA 4FD4A 2AJ6A 3TFYA 3FNCA 3D2MA 4PK2A 1ON0A 4JJXA 3FRMA 3UY5A 4AVCA 1CJWA 3BJ8A 1QSTA 4QB9A 4U9YA 3DR6A 2HQYA 4OAEA 3BJ7A 2FIWA 1BOBA 1XIXA 1PUAA 1XEBA 2Z10A 5CNPA 3ZJ0A 2VI7A 4PK3A 4U5YA 1QSOA 3F5BA 4UBRA 3PZJA 3RYOA 2B5GB 2Q4YA 4PV6A 4XPLA 1YVOA 3S6HA 4MHDA 2R1IA 3G8WA 2K5TA 1XMTA 2FT0A 4JXRA 2JDDA 3DR8A 1N71A 2VQYA 5H84A 2P6EA 4KZTA 1B87A 3IGRA 3TE4A 1I1DA 4UWIA 1S3ZA 2B5GA 4ZBGA 3JUWA 3EC4A 1IB1E 3OWCA 1S7KA 1Q2CA 3BLNA 4ONUA 1Y7RA 2FS5A 2BSWA 4YRHA 3C26A 4K30A 3G3SA 3PGPA 3LD2A 4MBUA 4XNHB 3W6XA 1Q2YA 4KUAA 1YGHA 2B3UA 3S6KA 3EFAA 2A4NA 1S5KA 1IIDA 4Y49B 1NMTA 2GIVA 4R3LA 4R87A 4MY3A 2Q7BA 2R98A 2FSRA 2Q44A 3TTHA 1YVKA 2ZW7A 2DXQA 4X5KA 5GCNA 3PP9A 4MI4A 1M4DA 1M44A 1Z4RA 4AB7A 2G3TA 4OADA 5IV0A 4R57A 2J8NA 5JQ4A 4XPDC 2BUEA 4AG7A 4CAXA 4KVXA 3FYNA 4KOWA 5H86A 1Q2DA 5C88A 4JWPA 5I0CA 5KTDA 2H5MA 4F0YA 4YGOA 2JLMA 1CM0A 2HV2A 5IB0A 4KOXA 5J8CA 3SXNA 3F0AA 4L8AA 4QVTA 2VZZA 3EY5A 2G3AA 3R1KA 5HH1A 3VWEA 1SQHA 2JEVA 4OLLA 4KVME 5KTCA 2FIAA 4KOYA 3D3SA 3T90A 5EC4A 2EVNA 2GE3A 2PDOA 3FXTA 1MK4A 2FL4A 4QBJA 4KVOE 4CRYB 1Z4EA 2JDCA 3V8IA 2PR1A 3T9YA 1XF8A 2KCWA 2FE7A 2EUIA 1TIQA 4KLVA 1WWZA 3CXSA 1MJAA 1RO5A 4AVBA 2PC1A 5FVJA 3TO6A 3TCVA 1MJBA 3QB8A 3TO7A 3DSBA 4CRZB 4KOVA 1S7FA 1L0CA 1I12A 3H4QA 1IYLA 1IYKA 4LX9A 1VKCA 3EXNA 3ZZIA 2OZUA 3I3GA 1UFHA 4NCZA 3LODA 2WPXA 4MY0A 4EVYA 1YREA 4UA3A 4MJ8A 5F47A 3K9UA 3P2FA 2WPWA 4CS0B 4HKFA 2F5IA 1QSMA 1QSNA 1I21A 4J3GA 1YR0A 4FD5A 4B5PB 3EO4A 5DWMA 2ZPAA 4PSWA 3TO9A 3W6SA 4RS2A 4KOSA 4KORA 2CNSA 2B3VA 4JD6A 4KUBA 5DWNA 5KTAA 1NE9A 1OZPA 2ZW5A 2Q04A 4B5PA 3KKWA 1PU9A 2OZHA 2FCKA 2R8VA 2OU2A 3FB3A 4CAWA 2ATRA 4II9A 3FBUA 4NF1A 3CXPA 1GHEA 2G0BA 2QMLA 4H89A 2QECA 3TOBA 4KOUA 1FY7A 3GY9A 4XPKA 2CNMA 1V0CA 1XE4A 2P6FA 2VXKA 5J8FA 1LRZA 3GYAA 4UWJA 4QC6A 1YX0A 3TT2A 4XPDB 4E2AA 2NMTA 1M1DA 2J8RA 1B6BA 4HNXB 3R9GA 2VBQA 1P0HA 4FD6A 5HMNA 4HNWB 2BL1A 3F8KA 4B5OA 4KOTA 3R96A 4F6AA 1R57A 3S6GA 3R95A 2REEA 1M4IA 1YK3A 5C82A 2I00A 4H6ZA 3SXOA 5ISVA 2P0WA 2Q4VA 2HUZA 2B4DB 2B58A 4XNHC 1WK4A 3CXQA 2Q0YA 1P4NA 2PR8A 2R7HA 4E8OA 2O28A 3B8GA 3P2HA 4ORFA 3QAHA
chains in the Genus database with same CATH superfamily
1MJ9A 4Y49C 1VIXA 1K4JA 2AE6A 2OB0A 4IUSA 3BXMA 1U6MA 2OH1A 3D4UA 3A9LA 3DDDA 3N7ZA 4RI1A 4BD9A 1KUXA 3CZXA 3VWDA 3D2PA 2PJ6A 3D8PA 1KWMA 3DLJA 1YLOA 4MFPA 2B4DA 2C27A 2QIRA 3NE7A 2D4OA 4GS4A 4UEEA 4U9ZA 1ZLIA 3FVLA 1ZG7A 4KLWA 4A2ZA 4AG9A 5JH9A 2X7BA 2PQ8A 1J4JA 4JZ0A 4YFJA 2VEZA 4I49A 2IJZA 3FX6A 2PSWA 3GB0A 4MFQA 4B11A 1KUVA 3E0KA 3IU1A 2C6PA 4B6ZA 4H6UA 4R3KA 2I3CA 4NGSA 1M4GA 1QSRA 2BEIA 5K8MA 3B3CA 3WR7A 1XJOA 3MGDA 1H8LA 2Q51A 4OC1A 3IU2A 4C2ZA 3I9SA 4LUAA 4P4FA 3PB4X 3GKRA 4M3SA 3BI1A 1KUYA 4OIWA 4QUSA 3K2KA 4NJRA 4NGRA 5JPHA 1S60A 2V77A 5CBMA 2Z11A 4AVAA 4A95A 4M85A 3QAYA 1FT7A 4IF5A 3D68A 2CTCA 4CYPA 2J8MA 3SJEA 1S7NA 2RC4A 3VARA 5LRGA 1FNOA 2BO9A 3DGVA 4OMEA 2ZELA 4UEFA 5E96A 5BWAB 3FIXA 4NEXA 4NXYA 3CT9A 4CYQA 4UFXA 2V8VA 1Y9KA 1XMBA 1YLEA 5HVFA 2ZW4A 2FXFA 3W91A 2JBKA 2Z0ZA 1S7LA 2Q4ZA 2ZXVA 5G1ZA 4F0XA 2ODFA 1RXTA 1Y7EA 3FJUA 3TOAA 1AMPA 5IX3A 2ZW6A 2PVVA 5F48A 2OOTA 4JLYA 1F2OA 3H5ZA 3SHPA 4UIAA 2PRBA 4A94A 2OZGA 2AFZA 3KR5A 4R9MA 3R9FA 4JXQA 2XEGA 4Z65A 1TF8A 2PJ5A 3PB8X 4NSQA 4ZY2A 3JVNA 5LRKA 3DNSA 1BO4A 2C1CA 5CPAA 3CPAA 3S9LA 4CGMA 5EBVA 3GIUA 4NGQA 2AFMA 4E0AA 1VHSA 4X3RA 3S6FA 4PXCA 5A28A 3D7HA 1F57A 5AG7A 3LWUA 3SI0A 1TF9A 5F46A 2REFA 2Y0MA 2WYRA 4M6HA 2VZYA 2B4BA 2IL4A 1Z9UA 2PIYA 3IWGA 4BMHA 3WT4A 1IICA 1VHOA 2CY2A 2YNCC 4BBHA 1LANA 3RAMA 1Y9WA 2D4PA 2DPTA 3PEIA 3HLPA 4FD7A 4ZY0A 4HNYB 2I79A 2ARHA 3NH8A 3R9EA 1KZFA 2CNTA 2GANA 2DPSA 2P6GA 1Y0RA 5F49A 1LOKA 4IAVA 2QVPA 4OC2A 4PSXA 4CAVA 4L89A 3IO1A 4UIBA 3TC8A 1NSLA 4FD4A 2PJ4A 2AJ6A 3TFYA 3FNCA 1YSJA 2WSAA 3D2MA 1Z5RA 4PK2A 1ON0A 3D7DA 3RO0A 3SI2A 2YGWA 3FRMA 1HEEA 4JJXA 4CAEA 1QQ9A 2PJ8A 1ARLA 3UY5A 4DJLA 4RUHA 4FWUA 4P4BA 4AVCA 4GM5A 4UFVA 2GFQA 1CJWA 3BJ8A 3D7GA 1QSTA 5D8NA 3WC5A 4QB9A 4U9YA 2DF5A 2QYVA 3DR6A 2HQYA 4OAEA 4C2XA 4KS9A 3BJ7A 1XOVA 2FIWA 1BOBA 1XIXA 3WC6A 4P4EA 1PUAA 2AFXA 2CXAA 4PPZA 1XEBA 3B35A 3B3SA 1ELMP 3D67A 4FAIA 1UWYA 4O23A 3IWWA 2Z10A 4W9YA 5CNPA 3ZJ0A 2VI7A 4PK3A 1ZO0A 4U5YA 1ELLP 2Z3NA 4P6YA 5EMIA 1QSOA 5HVGA 3F5BA 4R6TA 4UBRA 3PZJA 3FF3A 3RYOA 2B5GB 2Q4YA 1BPNA 1BLLE 3FEEA 4PV6A 1ZG9A 1XFOA 1YVOA 1ZLHA 4XPLA 5K8NA 3S6HA 4MHDA 2IQ6A 2R1IA 4LQGA 3G8WA 2K5TA 4MFLA 5HVHA 1XMTA 2FT0A 4B10A 4JXRA 2JDDA 1CBXA 4DNCA 1VHEA 3DR8A 4EMEA 1N71A 2VQYA 3KL9A 4H2KA 5H84A 2XEFA 4MCSA 5J1QA 4A33A 2P6EA 4KZTA 4KSAA 1B87A 4A38A 3IGRA 3TE4A 1I1DA 4UWIA 3PRTA 1S3ZA 2B5GA 4OC4A 4ZBGA 1IGBA 4YU9A 5AG4A 1R3NA 2PJ1A 3JUWA 3EC4A 1IB1E 3OWCA 2EWBA 2PIZA 2PVWA 1S7KA 1Q2CA 3BI0A 3BLNA 2EBJA 4KSIA 4ONUA 6CPAA 4A30A 2ZOGA 1Y7RA 2FS5A 3H8GA 2BSWA 4NJQA 4RN7A 4YRHA 4MCPA 3C26A 4OC3A 4OP4A 3KHZA 4NGMA 3PBEA 3RBUA 4K30A 3G3SA 3PGPA 4A31A 3LD2A 4MBUA 4R76A 4XNHB 4ZYQA 3W6XA 1X10A 1Q2YA 3B3WA 3FECA 4YWYA 4EFDA 4KUAA 1YGHA 2B3UA 3S6KA 3EFAA 2O53A 1PCAA 2YNEA 3T8WA 2A4NA 4B13A 5HXDA 1S5KA 2WUUA 2JBJA 1IIDA 2CF4A 4P10A 4Y49B 1NMTA 2GIVA 3IC1A 4R3LA 4R87A 1F2PA 4MY3A 2Q7BA 2R98A 4X8IA 3ISXA 2FSRA 2Q44A 3TTHA 1PYTB 1YVKA 3I1UA 4UCPA 2AFOA 2PJ0A 2ZW7A 2DXQA 4X5KA 2CIJA 5GCNA 3PP9A 1GYTA 4ZX9A 4MI4A 1ARMA 3JRUA 1M4DA 1M44A 1Z4RA 1EE3P 1LAMA 1X12A 4AB7A 2G3TA 1YMEA 4OADA 5IV0A 4UF4A 2WZNA 4R57A 4B14A 2J8NA 3B3TA 2GLJA 5JQ4A 1HDUA 1Z2LA 2C6CA 4OIDA 4XPDC 1AYEA 2BUEA 3S9MA 4AG7A 4Q36A 1IY7A 1IU8A 2ZOFA 2VL1A 5AG5A 4CAXA 1M4LA 4KVXA 3FYNA 4KOWA 4A32A 5H86A 2ZEOA 1Q2DA 3SJFA 4P4IA 2Z3LA 1VGYA 3B2YA 5C88A 3KZWA 2OR4A 3NH4A 4UCMA 1NSAA 4JWPA 2HC9A 1LCPA 3VATA 5I0CA 1QMUA 5KTDA 4X2TA 4MCQA 2H5MA 1YQEA 4F0YA 4F9VA 4B12A 3FEDA 2ZEDA 2AFWA 4PXBA 4YGOA 1BAVA 3PBBA 2PJ7A 1TXRA 5AG6A 4MFKA 7CPAA 4MCRA 1LAPA 2G9DA 2JLMA 3IIBA 3D66A 1CM0A 2HV2A 5IB0A 2QJ8A 3ISZA 5IB9A 4KOXA 4G1PA 5J8CA 1JWQA 3NA6A 2PJ9A 2PJCA 4KSFA 4Q7AA 3SXNA 5JM6A 3F0AA 1BPMA 4L8AA 4TNUA 2ZEGA 4QVTA 2VZZA 3EY5A 1TKJA 2G3AA 3R1KA 5HH1A 4CGPA 3VWEA 1SQHA 2JEVA 3D7FA 2EK8A 4OLLA 5D29A 4KVME 4MFJA 3MN8A 3CPXA 5KTCA 2FIAA 3KQZA 4KOYA 3D3SA 4R7MA 3T90A 4P4JA 5EC4A 1AUGA 2EVNA 2GE3A 2PDOA 3FXTA 1MK4A 2FL4A 4QBJA 3IEHA 4KVOE 1TKHA 4CRYB 4NGPA 2V8GA 5LYFA 3L2NA 1OBRA 1Z4EA 2AFUA 2JDCA 3V8IA 4PQAA 4UEZA 4MRIA 2PR1A 3T9YA 3H8EA 1XF8A 2KCWA 2FE7A 1CG2A 2RFHA 2EUIA 3BHXA 4P45A 3NH5A 1Z8TA 1TIQA 4KLVA 1WWZA 2XEJA 3B3VA 3CXSA 5LYLA 2DEAA 4F8ZA 1Z8XA 1MJAA 1RO5A 4AVBA 2Q7SA 4TWEA 4M6IA 2PC1A 3VH9A 5FVJA 3IWEA 3TO6A 4HPSA 3SJGA 3PB9X 4ZI6A 3TCVA 1MJBA 4JYWA 4MFZA 3QB8A 2YNCA 1YW6A 3TO7A 3DSBA 2AFSA 4CYOA 2ZEHA 4UFWA 5LRJA 4CRZB 3SJXA 3TX8A 3KGQA 4KOVA 1S7FA 1L0CA 4IHMA 1I12A 4M6GA 4DUKA 3H4QA 4EWTA 4GXHA 2BOAA 1IYLA 1IYKA 4LX9A 4WJBA 1VKCA 2PJ2A 3EXNA 3ZZIA 4CPAA 4CAFA 2OZUA 3PFEA 3I3GA 1CPXA 1UFHA 4NCZA 3LODA 2WPXA 4MY0A 3WABA 4EVYA 1YREA 4UA3A 3WC7A 2NYQA 5F09A 1DE4C 4MJ8A 2PRQA 5DS0A 2C6GA 3FMCA 3GLJA 3KQXA 5F47A 2RB7A 1Y0YA 3K9UA 3P2FA 2CTBA 2F7VA 2WPWA 3RZAA 4A37A 2EK9A 4CS0B 2GLFA 2F5IA 4HKFA 3S9NA 1QSMA 1QSNA 3RNZA 1IOIA 1I21A 3SI1A 1Z8WA 4J3GA 4CGLA 2J9AA 4ZY1A 1YR0A 2Z3MA 4FD5A 5JGFA 4MXUA 4NFRA 4B5PB 3EO4A 5DWMA 2ZEPA 4CYNA 3PB6X 4DYOA 3QNVA 2FVGA 3GUXA 3KASA 2ZPAA 3H8FA 2ZENA 4OC5A 2Z3OA 4PSWA 3TO9A 3W6SA 4UCNA 4RS2A 4KOSA 4KORA 2CNSA 2POKA 2B3VA 2JEWA 4C7IA 1Z8LA 4JD6A 2PE3A 4KUBA 3V38A 5DWNA 2Q43A 5KTAA 2IMOA 4ZGYB 2XEIA 1NE9A 2PJ3A 1OZPA 1XRYA 2ZW5A 4IK2A 2Q04A 5G22A 4B5PA 3KI9A 4NGTA 1CP7A 3KKWA 4WWVA 3N5FA 1PU9A 2OZHA 1LFWA 4Q38A 2ANPA 8CPAA 3IJ3A 2FCKA 2R8VA 2OU2A 2EO8A 2ABZA 3FB3A 1XBUA 4CAWA 2ATRA 4II9A 2O4HA 2PJBA 3FBUA 3B7IA 3NFZA 3PFOA 2ZEFA 4PXEA 2YNDA 3LACA 4NF1A 1RTQA 3CXPA 1IOFA 3LMSA 2V8HA 1A2ZA 1GHEA 3HUVA 3KR4A 2G0BA 2QMLA 4H89A 4CGNA 2QECA 2PJAA 5AGEA 3TOBA 1CX8A 4KOUA 2BCOA 4CGOA 1FY7A 1DTDA 2Z3KA 3GY9A 3NE8A 2CNMA 4MHNA 4XPKA 1V0CA 5A27A 1XE4A 2P6FA 2ZEMA 4ONWA 2VXKA 5J8FA 1LRZA 4ZX8A 5LYIA 3KHXA 4P44A 5LYDA 3GYAA 4UWJA 4QC6A 1YX0A 1CP6A 1TKFA 4XPDB 3TT2A 4C68A 5I4MA 4E2AA 4FBEA 2NMTA 1M1DA 3JTKA 2J8RA 1B6BA 4NGNA 4HNXB 4LQ6A 4R8FA 2NSMA 2VBQA 3FH4A 3R9GA 2F8HA 4K3NA 1P0HA 3K9TA 4FD6A 4MHPA 3CDXA 1CPSA 5HMNA 4HNWB 3V7ZA 2BL1A 3F8KA 4B5OA 2ZEEA 1Q7LA 4KOTA 3R96A 4C7HA 4F6AA 4MHYA 1R57A 4P4DA 5THWA 3S6GA 2GU2A 3R95A 4FUUA 1ZG8A 2REEA 5G20A 2Z3PA 1M4IA 1YK3A 5K8OA 4OC0A 3MRUA 5ELYA 5C82A 2I00A 4C2YA 4H6ZA 3SXOA 1HDQA 5ISVA 2P0WA 1YW4A 4MHZA 4PXDA 4A39A 1JQGA 3IFEA 4F9UA 2Q4VA 2HUZA 2PCUA 2B4DB 2V8DA 2B58A 4OKOA 4XNHC 4AXVA 1WK4A 3CXQA 2GREA 2Q0YA 1P4NA 2PR8A 2R7HA 3PB7X 4E8OA 2HB6A 2O28A 3B8GA 4MMOA 3P2HA 4ORFA 5G21A 5K8PA 3QAHA 4BINA 1R43A
chains in the Genus database with same CATH topology
1MJ9A 4Y49C 1K4JA 2AE6A 2OB0A 4IUSA 4DNCA 1U6MA 2OH1A 4RI1A 3A9LA 3DDDA 3N7ZA 1KUXA 3VWDA 3D2PA 3D8PA 4MFPA 2B4DA 2C27A 2QIRA 3NE7A 2D4OA 4GS4A 4U9ZA 4KLWA 4A2ZA 4AG9A 2X7BA 2PQ8A 1J4JA 4YFJA 2VEZA 4I49A 4B11A 2PSWA 4MFQA 1KUVA 3E0KA 3IU1A 4H6UA 4R3KA 1M4GA 1QSRA 2BEIA 3WR7A 3MGDA 3IU2A 4C2ZA 3I9SA 4LUAA 3GKRA 4M3SA 4QUSA 1KUYA 5JPHA 1S60A 2Z11A 4AVAA 4A95A 4M85A 4CYPA 4IF5A 2J8MA 1S7NA 2RC4A 5BWAB 5E96A 3FIXA 4NEXA 4NXYA 4CYQA 4UFXA 1Y9KA 1YLEA 2ZW4A 2FXFA 3W91A 2Z0ZA 1S7LA 5G1ZA 2ZXVA 4F0XA 1RXTA 3TOAA 5IX3A 2ZW6A 5F48A 4JLYA 3H5ZA 3SHPA 2PRBA 2OZGA 4R9MA 3R9FA 4JXQA 4NSQA 3JVNA 3DNSA 1BO4A 4CGMA 5EBVA 4E0AA 5A28A 1VHSA 3S6FA 5AG7A 5F46A 2REFA 2Y0MA 2VZYA 2B4BA 2IL4A 1Z9UA 3IWGA 4BMHA 1IICA 2CY2A 2YNCC 4BBHA 1Y9WA 2D4PA 2DPTA 4FD7A 4HNYB 2I79A 2ARHA 3R9EA 1KZFA 2CNTA 2DPSA 2GANA 2P6GA 5F49A 4PSXA 4CAVA 4L89A 1NSLA 4FD4A 2AJ6A 3TFYA 3FNCA 2WSAA 3D2MA 4PK2A 1ON0A 2YGWA 3FRMA 4JJXA 4CAEA 3UY5A 4AVCA 4UFVA 1CJWA 3BJ8A 1QSTA 4QB9A 4U9YA 3DR6A 2HQYA 4OAEA 4C2XA 4KS9A 3BJ7A 2FIWA 1BOBA 1XIXA 1PUAA 2CXAA 1XEBA 2Z10A 5CNPA 3ZJ0A 2VI7A 4PK3A 1ZO0A 4U5YA 2Z3NA 1QSOA 3F5BA 4UBRA 3PZJA 3RYOA 2B5GB 2Q4YA 4PV6A 4XPLA 1YVOA 3S6HA 4MHDA 2R1IA 3G8WA 2K5TA 4MFLA 1XMTA 2FT0A 4B10A 4JXRA 2JDDA 3DR8A 1N71A 2VQYA 5H84A 4A33A 2P6EA 4KZTA 4KSAA 1B87A 3IGRA 3TE4A 1I1DA 4UWIA 1S3ZA 2B5GA 4ZBGA 5AG4A 3JUWA 3EC4A 1IB1E 3OWCA 1S7KA 1Q2CA 3BLNA 4ONUA 4A30A 1Y7RA 2FS5A 2BSWA 4YRHA 3C26A 4K30A 3G3SA 3PGPA 4A31A 3LD2A 4MBUA 4XNHB 3W6XA 1Q2YA 4KUAA 1YGHA 2B3UA 3S6KA 3EFAA 2YNEA 2A4NA 4B13A 1S5KA 2WUUA 1IIDA 4Y49B 1NMTA 2GIVA 4R3LA 4R87A 4MY3A 2Q7BA 2R98A 2FSRA 2Q44A 3TTHA 1YVKA 4UCPA 2ZW7A 2DXQA 4X5KA 5GCNA 3PP9A 4MI4A 1M4DA 1M44A 1Z4RA 4AB7A 2G3TA 4OADA 5IV0A 4R57A 4B14A 2J8NA 5JQ4A 4XPDC 2BUEA 4AG7A 4Q36A 5AG5A 4CAXA 4KVXA 3FYNA 4KOWA 4A32A 5H86A 1Q2DA 2Z3LA 5C88A 4UCMA 4JWPA 5I0CA 5KTDA 2H5MA 4F0YA 4B12A 4YGOA 5AG6A 4MFKA 2JLMA 1CM0A 2HV2A 5IB0A 4KOXA 5J8CA 3SXNA 4KSFA 3F0AA 4L8AA 4QVTA 2VZZA 3EY5A 2G3AA 3R1KA 5HH1A 4CGPA 3VWEA 1SQHA 2JEVA 4OLLA 4KVME 4MFJA 5KTCA 2FIAA 4KOYA 3D3SA 3T90A 5EC4A 2EVNA 2GE3A 2PDOA 3FXTA 1MK4A 2FL4A 4QBJA 4KVOE 4CRYB 1Z4EA 2JDCA 3V8IA 2PR1A 3T9YA 1XF8A 2KCWA 2FE7A 2EUIA 1TIQA 4KLVA 1WWZA 3CXSA 1MJAA 1RO5A 4AVBA 2PC1A 5FVJA 3IWEA 3TO6A 3TCVA 1MJBA 4MFZA 3QB8A 2YNCA 3TO7A 3DSBA 4CYOA 4UFWA 4CRZB 4KOVA 1S7FA 1L0CA 1I12A 3H4QA 1IYLA 1IYKA 4LX9A 1VKCA 3EXNA 3ZZIA 4CAFA 2OZUA 3I3GA 1UFHA 4NCZA 3LODA 2WPXA 4MY0A 4EVYA 1YREA 4UA3A 4MJ8A 5F47A 3K9UA 3P2FA 2WPWA 4CS0B 4HKFA 2F5IA 1QSMA 1QSNA 1I21A 4J3GA 4CGLA 1YR0A 2Z3MA 4FD5A 4B5PB 3EO4A 5DWMA 4CYNA 2ZPAA 2Z3OA 4PSWA 3TO9A 3W6SA 4UCNA 4RS2A 4KOSA 4KORA 2CNSA 2B3VA 4C7IA 4JD6A 4KUBA 5DWNA 5KTAA 4ZGYB 1NE9A 1OZPA 2ZW5A 2Q04A 5G22A 4B5PA 3KKWA 1PU9A 2OZHA 4Q38A 2FCKA 2R8VA 2OU2A 3FB3A 4CAWA 2ATRA 4II9A 3FBUA 2YNDA 4NF1A 3CXPA 1GHEA 2G0BA 2QMLA 4H89A 4CGNA 2QECA 5AGEA 3TOBA 4KOUA 4CGOA 1FY7A 2Z3KA 3GY9A 4XPKA 2CNMA 1V0CA 5A27A 1XE4A 2P6FA 2VXKA 5J8FA 1LRZA 3GYAA 4UWJA 4QC6A 1YX0A 3TT2A 4XPDB 4C68A 4E2AA 2NMTA 1M1DA 3JTKA 2J8RA 1B6BA 4HNXB 3R9GA 2VBQA 1P0HA 4FD6A 5HMNA 4HNWB 2BL1A 3F8KA 4B5OA 4KOTA 3R96A 4C7HA 4F6AA 1R57A 3S6GA 3R95A 2REEA 5G20A 2Z3PA 1M4IA 1YK3A 5C82A 2I00A 4C2YA 4H6ZA 3SXOA 5ISVA 2P0WA 2Q4VA 2HUZA 2B4DB 2B58A 4XNHC 1WK4A 3CXQA 2Q0YA 1P4NA 2PR8A 2R7HA 4E8OA 2O28A 3B8GA 3P2HA 4ORFA 5G21A 3QAHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MJ9 A;  4Y49 C;  1K4J A;  2AE6 A;  2OB0 A;  4IUS A;  4DNC A;  1U6M A;  2OH1 A;  4RI1 A;  3DDD A;  3N7Z A;  1KUX A;  3VWD A;  3D2P A;  3D8P A;  2B4D A;  2C27 A;  2QIR A;  3NE7 A;  2D4O A;  4GS4 A;  4U9Z A;  4KLW A;  4AG9 A;  2X7B A;  2PQ8 A;  1J4J A;  4YFJ A;  2VEZ A;  4I49 A;  2PSW A;  1KUV A;  3E0K A;  4H6U A;  4R3K A;  1M4G A;  1QSR A;  2BEI A;  3WR7 A;  3MGD A;  3I9S A;  4LUA A;  3GKR A;  4M3S A;  4QUS A;  1KUY A;  5JPH A;  1S60 A;  2Z11 A;  4AVA A;  4M85 A;  4IF5 A;  2J8M A;  1S7N A;  2RC4 A;  5E96 A;  3FIX A;  4NEX A;  4NXY A;  1Y9K A;  1YLE A;  2ZW4 A;  2FXF A;  3W91 A;  2Z0Z A;  1S7L A;  2ZXV A;  1RXT A;  3TOA A;  5IX3 A;  2ZW6 A;  5F48 A;  4JLY A;  3SHP A;  2PRB A;  2OZG A;  4R9M A;  3R9F A;  4JXQ A;  4NSQ A;  3JVN A;  3DNS A;  1BO4 A;  5EBV A;  4E0A A;  1VHS A;  3S6F A;  5F46 A;  2REF A;  2Y0M A;  2VZY A;  2B4B A;  2IL4 A;  1Z9U A;  3IWG A;  4BMH A;  1IIC A;  2CY2 A;  1Y9W A;  2D4P A;  4FD7 A;  4HNY B;  2I79 A;  2ARH A;  3R9E A;  1KZF A;  2CNT A;  2GAN A;  2P6G A;  5F49 A;  4PSX A;  4CAV A;  4L89 A;  1NSL A;  4FD4 A;  2AJ6 A;  3TFY A;  3FNC A;  3D2M A;  4PK2 A;  1ON0 A;  4JJX A;  3FRM A;  3UY5 A;  4AVC A;  1CJW A;  3BJ8 A;  1QST A;  4QB9 A;  4U9Y A;  3DR6 A;  2HQY A;  4OAE A;  3BJ7 A;  2FIW A;  1BOB A;  1XIX A;  1PUA A;  1XEB A;  2Z10 A;  5CNP A;  3ZJ0 A;  2VI7 A;  4PK3 A;  4U5Y A;  1QSO A;  3F5B A;  4UBR A;  3PZJ A;  3RYO A;  2B5G B;  2Q4Y A;  4PV6 A;  4XPL A;  1YVO A;  3S6H A;  4MHD A;  2R1I A;  3G8W A;  2K5T A;  1XMT A;  2FT0 A;  4JXR A;  2JDD A;  3DR8 A;  1N71 A;  2VQY A;  5H84 A;  2P6E A;  4KZT A;  1B87 A;  3IGR A;  3TE4 A;  1I1D A;  4UWI A;  1S3Z A;  2B5G A;  4ZBG A;  3JUW A;  3EC4 A;  1IB1 E;  3OWC A;  1S7K A;  1Q2C A;  3BLN A;  4ONU A;  1Y7R A;  2FS5 A;  2BSW A;  4YRH A;  3C26 A;  4K30 A;  3G3S A;  3PGP A;  3LD2 A;  4MBU A;  4XNH B;  3W6X A;  1Q2Y A;  4KUA A;  1YGH A;  2B3U A;  3S6K A;  3EFA A;  2A4N A;  1S5K A;  1IID A;  4Y49 B;  1NMT A;  2GIV A;  4R3L A;  4R87 A;  4MY3 A;  2Q7B A;  2R98 A;  2FSR A;  2Q44 A;  3TTH A;  1YVK A;  2ZW7 A;  2DXQ A;  4X5K A;  5GCN A;  3PP9 A;  4MI4 A;  1M4D A;  1M44 A;  1Z4R A;  4AB7 A;  2G3T A;  4OAD A;  5IV0 A;  4R57 A;  2J8N A;  5JQ4 A;  4XPD C;  2BUE A;  4AG7 A;  4CAX A;  4KVX A;  3FYN A;  4KOW A;  5H86 A;  1Q2D A;  5C88 A;  4JWP A;  5I0C A;  5KTD A;  2H5M A;  4F0Y A;  4YGO A;  2JLM A;  1CM0 A;  2HV2 A;  5IB0 A;  4KOX A;  5J8C A;  3SXN A;  3F0A A;  4L8A A;  4QVT A;  2VZZ A;  3EY5 A;  2G3A A;  3R1K A;  5HH1 A;  3VWE A;  1SQH A;  2JEV A;  4OLL A;  4KVM E;  5KTC A;  2FIA A;  4KOY A;  3D3S A;  3T90 A;  5EC4 A;  2EVN A;  2GE3 A;  2PDO A;  3FXT A;  1MK4 A;  2FL4 A;  4QBJ A;  4KVO E;  4CRY B;  1Z4E A;  2JDC A;  3V8I A;  2PR1 A;  3T9Y A;  1XF8 A;  2KCW A;  2FE7 A;  2EUI A;  1TIQ A;  4KLV A;  1WWZ A;  3CXS A;  1MJA A;  1RO5 A;  4AVB A;  2PC1 A;  5FVJ A;  3TO6 A;  3TCV A;  1MJB A;  3QB8 A;  3TO7 A;  3DSB A;  4CRZ B;  4KOV A;  1S7F A;  1L0C A;  1I12 A;  3H4Q A;  1IYL A;  1IYK A;  4LX9 A;  1VKC A;  3EXN A;  3ZZI A;  2OZU A;  3I3G A;  1UFH A;  4NCZ A;  3LOD A;  2WPX A;  4MY0 A;  4EVY A;  1YRE A;  4UA3 A;  4MJ8 A;  5F47 A;  3K9U A;  3P2F A;  2WPW A;  4CS0 B;  4HKF A;  2F5I A;  1QSM A;  1QSN A;  1I21 A;  4J3G A;  1YR0 A;  4FD5 A;  4B5P B;  3EO4 A;  5DWM A;  2ZPA A;  4PSW A;  3TO9 A;  3W6S A;  4RS2 A;  4KOS A;  4KOR A;  2CNS A;  2B3V A;  4JD6 A;  4KUB A;  5DWN A;  5KTA A;  1NE9 A;  1OZP A;  2ZW5 A;  2Q04 A;  4B5P A;  3KKW A;  1PU9 A;  2OZH A;  2FCK A;  2R8V A;  2OU2 A;  3FB3 A;  4CAW A;  2ATR A;  4II9 A;  3FBU A;  4NF1 A;  3CXP A;  1GHE A;  2G0B A;  2QML A;  4H89 A;  2QEC A;  3TOB A;  4KOU A;  1FY7 A;  3GY9 A;  4XPK A;  2CNM A;  1V0C A;  1XE4 A;  2P6F A;  2VXK A;  5J8F A;  1LRZ A;  3GYA A;  4UWJ A;  4QC6 A;  1YX0 A;  3TT2 A;  4XPD B;  4E2A A;  2NMT A;  1M1D A;  2J8R A;  1B6B A;  4HNX B;  3R9G A;  2VBQ A;  1P0H A;  4FD6 A;  5HMN A;  4HNW B;  2BL1 A;  3F8K A;  4B5O A;  4KOT A;  3R96 A;  4F6A A;  1R57 A;  3S6G A;  3R95 A;  2REE A;  1M4I A;  1YK3 A;  5C82 A;  2I00 A;  4H6Z A;  3SXO A;  5ISV A;  2P0W A;  2Q4V A;  2HUZ A;  2B4D B;  2B58 A;  4XNH C;  1WK4 A;  3CXQ A;  2Q0Y A;  1P4N A;  2PR8 A;  2R7H A;  4E8O A;  2O28 A;  3B8G A;  3P2H A;  4ORF A;  3QAH A; 
#chains in the Genus database with same CATH topology
 1MJ9 A;  4Y49 C;  1VIX A;  1K4J A;  2AE6 A;  2OB0 A;  4IUS A;  3BXM A;  1U6M A;  2OH1 A;  3D4U A;  3A9L A;  3DDD A;  3N7Z A;  4RI1 A;  4BD9 A;  1KUX A;  3CZX A;  3VWD A;  3D2P A;  2PJ6 A;  3D8P A;  1KWM A;  3DLJ A;  1YLO A;  4MFP A;  2B4D A;  2C27 A;  2QIR A;  3NE7 A;  2D4O A;  4GS4 A;  4UEE A;  4U9Z A;  1ZLI A;  3FVL A;  1ZG7 A;  4KLW A;  4A2Z A;  4AG9 A;  5JH9 A;  2X7B A;  2PQ8 A;  1J4J A;  4JZ0 A;  4YFJ A;  2VEZ A;  4I49 A;  2IJZ A;  3FX6 A;  2PSW A;  3GB0 A;  4MFQ A;  4B11 A;  1KUV A;  3E0K A;  3IU1 A;  2C6P A;  4B6Z A;  4H6U A;  4R3K A;  2I3C A;  4NGS A;  1M4G A;  1QSR A;  2BEI A;  5K8M A;  3B3C A;  3WR7 A;  1XJO A;  3MGD A;  1H8L A;  2Q51 A;  4OC1 A;  3IU2 A;  4C2Z A;  3I9S A;  4LUA A;  4P4F A;  3PB4 X;  3GKR A;  4M3S A;  3BI1 A;  1KUY A;  4OIW A;  4QUS A;  3K2K A;  4NJR A;  4NGR A;  5JPH A;  1S60 A;  2V77 A;  5CBM A;  2Z11 A;  4AVA A;  4A95 A;  4M85 A;  3QAY A;  1FT7 A;  4IF5 A;  3D68 A;  2CTC A;  4CYP A;  2J8M A;  3SJE A;  1S7N A;  2RC4 A;  3VAR A;  5LRG A;  1FNO A;  2BO9 A;  3DGV A;  4OME A;  2ZEL A;  4UEF A;  5E96 A;  5BWA B;  3FIX A;  4NEX A;  4NXY A;  3CT9 A;  4CYQ A;  4UFX A;  2V8V A;  1Y9K A;  1XMB A;  1YLE A;  5HVF A;  2ZW4 A;  2FXF A;  3W91 A;  2JBK A;  2Z0Z A;  1S7L A;  2Q4Z A;  2ZXV A;  5G1Z A;  4F0X A;  2ODF A;  1RXT A;  1Y7E A;  3FJU A;  3TOA A;  1AMP A;  5IX3 A;  2ZW6 A;  2PVV A;  5F48 A;  2OOT A;  4JLY A;  1F2O A;  3H5Z A;  3SHP A;  4UIA A;  2PRB A;  4A94 A;  2OZG A;  2AFZ A;  3KR5 A;  4R9M A;  3R9F A;  4JXQ A;  2XEG A;  4Z65 A;  1TF8 A;  2PJ5 A;  3PB8 X;  4NSQ A;  4ZY2 A;  3JVN A;  5LRK A;  3DNS A;  1BO4 A;  2C1C A;  5CPA A;  3CPA A;  3S9L A;  4CGM A;  5EBV A;  3GIU A;  4NGQ A;  2AFM A;  4E0A A;  1VHS A;  4X3R A;  3S6F A;  4PXC A;  5A28 A;  3D7H A;  1F57 A;  5AG7 A;  3LWU A;  3SI0 A;  1TF9 A;  5F46 A;  2REF A;  2Y0M A;  2WYR A;  4M6H A;  2VZY A;  2B4B A;  2IL4 A;  1Z9U A;  2PIY A;  3IWG A;  4BMH A;  3WT4 A;  1IIC A;  1VHO A;  2CY2 A;  2YNC C;  4BBH A;  1LAN A;  3RAM A;  1Y9W A;  2D4P A;  2DPT A;  3PEI A;  3HLP A;  4FD7 A;  4ZY0 A;  4HNY B;  2I79 A;  2ARH A;  3NH8 A;  3R9E A;  1KZF A;  2CNT A;  2GAN A;  2DPS A;  2P6G A;  1Y0R A;  5F49 A;  1LOK A;  4IAV A;  2QVP A;  4OC2 A;  4PSX A;  4CAV A;  4L89 A;  3IO1 A;  4UIB A;  3TC8 A;  1NSL A;  4FD4 A;  2PJ4 A;  2AJ6 A;  3TFY A;  3FNC A;  1YSJ A;  2WSA A;  3D2M A;  1Z5R A;  4PK2 A;  1ON0 A;  3D7D A;  3RO0 A;  3SI2 A;  2YGW A;  3FRM A;  1HEE A;  4JJX A;  4CAE A;  1QQ9 A;  2PJ8 A;  1ARL A;  3UY5 A;  4DJL A;  4RUH A;  4FWU A;  4P4B A;  4AVC A;  4GM5 A;  4UFV A;  2GFQ A;  1CJW A;  3BJ8 A;  3D7G A;  1QST A;  5D8N A;  3WC5 A;  4QB9 A;  4U9Y A;  2DF5 A;  2QYV A;  3DR6 A;  2HQY A;  4OAE A;  4C2X A;  4KS9 A;  3BJ7 A;  1XOV A;  2FIW A;  1BOB A;  1XIX A;  3WC6 A;  4P4E A;  1PUA A;  2AFX A;  2CXA A;  4PPZ A;  1XEB A;  3B35 A;  3B3S A;  1ELM P;  3D67 A;  4FAI A;  1UWY A;  4O23 A;  3IWW A;  2Z10 A;  4W9Y A;  5CNP A;  3ZJ0 A;  2VI7 A;  4PK3 A;  1ZO0 A;  4U5Y A;  1ELL P;  2Z3N A;  4P6Y A;  5EMI A;  1QSO A;  5HVG A;  3F5B A;  4R6T A;  4UBR A;  3PZJ A;  3FF3 A;  3RYO A;  2B5G B;  2Q4Y A;  1BPN A;  1BLL E;  3FEE A;  4PV6 A;  1ZG9 A;  1XFO A;  1YVO A;  1ZLH A;  4XPL A;  5K8N A;  3S6H A;  4MHD A;  2IQ6 A;  2R1I A;  4LQG A;  3G8W A;  2K5T A;  4MFL A;  5HVH A;  1XMT A;  2FT0 A;  4B10 A;  4JXR A;  2JDD A;  1CBX A;  4DNC A;  1VHE A;  3DR8 A;  4EME A;  1N71 A;  2VQY A;  3KL9 A;  4H2K A;  5H84 A;  2XEF A;  4MCS A;  5J1Q A;  4A33 A;  2P6E A;  4KZT A;  4KSA A;  1B87 A;  4A38 A;  3IGR A;  3TE4 A;  1I1D A;  4UWI A;  3PRT A;  1S3Z A;  2B5G A;  4OC4 A;  4ZBG A;  1IGB A;  4YU9 A;  5AG4 A;  1R3N A;  2PJ1 A;  3JUW A;  3EC4 A;  1IB1 E;  3OWC A;  2EWB A;  2PIZ A;  2PVW A;  1S7K A;  1Q2C A;  3BI0 A;  3BLN A;  2EBJ A;  4KSI A;  4ONU A;  6CPA A;  4A30 A;  2ZOG A;  1Y7R A;  2FS5 A;  3H8G A;  2BSW A;  4NJQ A;  4RN7 A;  4YRH A;  4MCP A;  3C26 A;  4OC3 A;  4OP4 A;  3KHZ A;  4NGM A;  3PBE A;  3RBU A;  4K30 A;  3G3S A;  3PGP A;  4A31 A;  3LD2 A;  4MBU A;  4R76 A;  4XNH B;  4ZYQ A;  3W6X A;  1X10 A;  1Q2Y A;  3B3W A;  3FEC A;  4YWY A;  4EFD A;  4KUA A;  1YGH A;  2B3U A;  3S6K A;  3EFA A;  2O53 A;  1PCA A;  2YNE A;  3T8W A;  2A4N A;  4B13 A;  5HXD A;  1S5K A;  2WUU A;  2JBJ A;  1IID A;  2CF4 A;  4P10 A;  4Y49 B;  1NMT A;  2GIV A;  3IC1 A;  4R3L A;  4R87 A;  1F2P A;  4MY3 A;  2Q7B A;  2R98 A;  4X8I A;  3ISX A;  2FSR A;  2Q44 A;  3TTH A;  1PYT B;  1YVK A;  3I1U A;  4UCP A;  2AFO A;  2PJ0 A;  2ZW7 A;  2DXQ A;  4X5K A;  2CIJ A;  5GCN A;  3PP9 A;  1GYT A;  4ZX9 A;  4MI4 A;  1ARM A;  3JRU A;  1M4D A;  1M44 A;  1Z4R A;  1EE3 P;  1LAM A;  1X12 A;  4AB7 A;  2G3T A;  1YME A;  4OAD A;  5IV0 A;  4UF4 A;  2WZN A;  4R57 A;  4B14 A;  2J8N A;  3B3T A;  2GLJ A;  5JQ4 A;  1HDU A;  1Z2L A;  2C6C A;  4OID A;  4XPD C;  1AYE A;  2BUE A;  3S9M A;  4AG7 A;  4Q36 A;  1IY7 A;  1IU8 A;  2ZOF A;  2VL1 A;  5AG5 A;  4CAX A;  1M4L A;  4KVX A;  3FYN A;  4KOW A;  4A32 A;  5H86 A;  2ZEO A;  1Q2D A;  3SJF A;  4P4I A;  2Z3L A;  1VGY A;  3B2Y A;  5C88 A;  3KZW A;  2OR4 A;  3NH4 A;  4UCM A;  1NSA A;  4JWP A;  2HC9 A;  1LCP A;  3VAT A;  5I0C A;  1QMU A;  5KTD A;  4X2T A;  4MCQ A;  2H5M A;  1YQE A;  4F0Y A;  4F9V A;  4B12 A;  3FED A;  2ZED A;  2AFW A;  4PXB A;  4YGO A;  1BAV A;  3PBB A;  2PJ7 A;  1TXR A;  5AG6 A;  4MFK A;  7CPA A;  4MCR A;  1LAP A;  2G9D A;  2JLM A;  3IIB A;  3D66 A;  1CM0 A;  2HV2 A;  5IB0 A;  2QJ8 A;  3ISZ A;  5IB9 A;  4KOX A;  4G1P A;  5J8C A;  1JWQ A;  3NA6 A;  2PJ9 A;  2PJC A;  4KSF A;  4Q7A A;  3SXN A;  5JM6 A;  3F0A A;  1BPM A;  4L8A A;  4TNU A;  2ZEG A;  4QVT A;  2VZZ A;  3EY5 A;  1TKJ A;  2G3A A;  3R1K A;  5HH1 A;  4CGP A;  3VWE A;  1SQH A;  2JEV A;  3D7F A;  2EK8 A;  4OLL A;  5D29 A;  4KVM E;  4MFJ A;  3MN8 A;  3CPX A;  5KTC A;  2FIA A;  3KQZ A;  4KOY A;  3D3S A;  4R7M A;  3T90 A;  4P4J A;  5EC4 A;  1AUG A;  2EVN A;  2GE3 A;  2PDO A;  3FXT A;  1MK4 A;  2FL4 A;  4QBJ A;  3IEH A;  4KVO E;  1TKH A;  4CRY B;  4NGP A;  2V8G A;  5LYF A;  3L2N A;  1OBR A;  1Z4E A;  2AFU A;  2JDC A;  3V8I A;  4PQA A;  4UEZ A;  4MRI A;  2PR1 A;  3T9Y A;  3H8E A;  1XF8 A;  2KCW A;  2FE7 A;  1CG2 A;  2RFH A;  2EUI A;  3BHX A;  4P45 A;  3NH5 A;  1Z8T A;  1TIQ A;  4KLV A;  1WWZ A;  2XEJ A;  3B3V A;  3CXS A;  5LYL A;  2DEA A;  4F8Z A;  1Z8X A;  1MJA A;  1RO5 A;  4AVB A;  2Q7S A;  4TWE A;  4M6I A;  2PC1 A;  3VH9 A;  5FVJ A;  3IWE A;  3TO6 A;  4HPS A;  3SJG A;  3PB9 X;  4ZI6 A;  3TCV A;  1MJB A;  4JYW A;  4MFZ A;  3QB8 A;  2YNC A;  1YW6 A;  3TO7 A;  3DSB A;  2AFS A;  4CYO A;  2ZEH A;  4UFW A;  5LRJ A;  4CRZ B;  3SJX A;  3TX8 A;  3KGQ A;  4KOV A;  1S7F A;  1L0C A;  4IHM A;  1I12 A;  4M6G A;  4DUK A;  3H4Q A;  4EWT A;  4GXH A;  2BOA A;  1IYL A;  1IYK A;  4LX9 A;  4WJB A;  1VKC A;  2PJ2 A;  3EXN A;  3ZZI A;  4CPA A;  4CAF A;  2OZU A;  3PFE A;  3I3G A;  1CPX A;  1UFH A;  4NCZ A;  3LOD A;  2WPX A;  4MY0 A;  3WAB A;  4EVY A;  1YRE A;  4UA3 A;  3WC7 A;  2NYQ A;  5F09 A;  1DE4 C;  4MJ8 A;  2PRQ A;  5DS0 A;  2C6G A;  3FMC A;  3GLJ A;  3KQX A;  5F47 A;  2RB7 A;  1Y0Y A;  3K9U A;  3P2F A;  2CTB A;  2F7V A;  2WPW A;  3RZA A;  4A37 A;  2EK9 A;  4CS0 B;  2GLF A;  2F5I A;  4HKF A;  3S9N A;  1QSM A;  1QSN A;  3RNZ A;  1IOI A;  1I21 A;  3SI1 A;  1Z8W A;  4J3G A;  4CGL A;  2J9A A;  4ZY1 A;  1YR0 A;  2Z3M A;  4FD5 A;  5JGF A;  4MXU A;  4NFR A;  4B5P B;  3EO4 A;  5DWM A;  2ZEP A;  4CYN A;  3PB6 X;  4DYO A;  3QNV A;  2FVG A;  3GUX A;  3KAS A;  2ZPA A;  3H8F A;  2ZEN A;  4OC5 A;  2Z3O A;  4PSW A;  3TO9 A;  3W6S A;  4UCN A;  4RS2 A;  4KOS A;  4KOR A;  2CNS A;  2POK A;  2B3V A;  2JEW A;  4C7I A;  1Z8L A;  4JD6 A;  2PE3 A;  4KUB A;  3V38 A;  5DWN A;  2Q43 A;  5KTA A;  2IMO A;  4ZGY B;  2XEI A;  1NE9 A;  2PJ3 A;  1OZP A;  1XRY A;  2ZW5 A;  4IK2 A;  2Q04 A;  5G22 A;  4B5P A;  3KI9 A;  4NGT A;  1CP7 A;  3KKW A;  4WWV A;  3N5F A;  1PU9 A;  2OZH A;  1LFW A;  4Q38 A;  2ANP A;  8CPA A;  3IJ3 A;  2FCK A;  2R8V A;  2OU2 A;  2EO8 A;  2ABZ A;  3FB3 A;  1XBU A;  4CAW A;  2ATR A;  4II9 A;  2O4H A;  2PJB A;  3FBU A;  3B7I A;  3NFZ A;  3PFO A;  2ZEF A;  4PXE A;  2YND A;  3LAC A;  4NF1 A;  1RTQ A;  3CXP A;  1IOF A;  3LMS A;  2V8H A;  1A2Z A;  1GHE A;  3HUV A;  3KR4 A;  2G0B A;  2QML A;  4H89 A;  4CGN A;  2QEC A;  2PJA A;  5AGE A;  3TOB A;  1CX8 A;  4KOU A;  2BCO A;  4CGO A;  1FY7 A;  1DTD A;  2Z3K A;  3GY9 A;  3NE8 A;  2CNM A;  4MHN A;  4XPK A;  1V0C A;  5A27 A;  1XE4 A;  2P6F A;  2ZEM A;  4ONW A;  2VXK A;  5J8F A;  1LRZ A;  4ZX8 A;  5LYI A;  3KHX A;  4P44 A;  5LYD A;  3GYA A;  4UWJ A;  4QC6 A;  1YX0 A;  1CP6 A;  1TKF A;  4XPD B;  3TT2 A;  4C68 A;  5I4M A;  4E2A A;  4FBE A;  2NMT A;  1M1D A;  3JTK A;  2J8R A;  1B6B A;  4NGN A;  4HNX B;  4LQ6 A;  4R8F A;  2NSM A;  2VBQ A;  3FH4 A;  3R9G A;  2F8H A;  4K3N A;  1P0H A;  3K9T A;  4FD6 A;  4MHP A;  3CDX A;  1CPS A;  5HMN A;  4HNW B;  3V7Z A;  2BL1 A;  3F8K A;  4B5O A;  2ZEE A;  1Q7L A;  4KOT A;  3R96 A;  4C7H A;  4F6A A;  4MHY A;  1R57 A;  4P4D A;  5THW A;  3S6G A;  2GU2 A;  3R95 A;  4FUU A;  1ZG8 A;  2REE A;  5G20 A;  2Z3P A;  1M4I A;  1YK3 A;  5K8O A;  4OC0 A;  3MRU A;  5ELY A;  5C82 A;  2I00 A;  4C2Y A;  4H6Z A;  3SXO A;  1HDQ A;  5ISV A;  2P0W A;  1YW4 A;  4MHZ A;  4PXD A;  4A39 A;  1JQG A;  3IFE A;  4F9U A;  2Q4V A;  2HUZ A;  2PCU A;  2B4D B;  2V8D A;  2B58 A;  4OKO A;  4XNH C;  4AXV A;  1WK4 A;  3CXQ A;  2GRE A;  2Q0Y A;  1P4N A;  2PR8 A;  2R7H A;  3PB7 X;  4E8O A;  2HB6 A;  2O28 A;  3B8G A;  4MMO A;  3P2H A;  4ORF A;  5G21 A;  5K8P A;  3QAH A;  4BIN A;  1R43 A; 
#chains in the Genus database with same CATH homology
 1MJ9 A;  4Y49 C;  1K4J A;  2AE6 A;  2OB0 A;  4IUS A;  4DNC A;  1U6M A;  2OH1 A;  4RI1 A;  3A9L A;  3DDD A;  3N7Z A;  1KUX A;  3VWD A;  3D2P A;  3D8P A;  4MFP A;  2B4D A;  2C27 A;  2QIR A;  3NE7 A;  2D4O A;  4GS4 A;  4U9Z A;  4KLW A;  4A2Z A;  4AG9 A;  2X7B A;  2PQ8 A;  1J4J A;  4YFJ A;  2VEZ A;  4I49 A;  4B11 A;  2PSW A;  4MFQ A;  1KUV A;  3E0K A;  3IU1 A;  4H6U A;  4R3K A;  1M4G A;  1QSR A;  2BEI A;  3WR7 A;  3MGD A;  3IU2 A;  4C2Z A;  3I9S A;  4LUA A;  3GKR A;  4M3S A;  4QUS A;  1KUY A;  5JPH A;  1S60 A;  2Z11 A;  4AVA A;  4A95 A;  4M85 A;  4CYP A;  4IF5 A;  2J8M A;  1S7N A;  2RC4 A;  5BWA B;  5E96 A;  3FIX A;  4NEX A;  4NXY A;  4CYQ A;  4UFX A;  1Y9K A;  1YLE A;  2ZW4 A;  2FXF A;  3W91 A;  2Z0Z A;  1S7L A;  5G1Z A;  2ZXV A;  4F0X A;  1RXT A;  3TOA A;  5IX3 A;  2ZW6 A;  5F48 A;  4JLY A;  3H5Z A;  3SHP A;  2PRB A;  2OZG A;  4R9M A;  3R9F A;  4JXQ A;  4NSQ A;  3JVN A;  3DNS A;  1BO4 A;  4CGM A;  5EBV A;  4E0A A;  5A28 A;  1VHS A;  3S6F A;  5AG7 A;  5F46 A;  2REF A;  2Y0M A;  2VZY A;  2B4B A;  2IL4 A;  1Z9U A;  3IWG A;  4BMH A;  1IIC A;  2CY2 A;  2YNC C;  4BBH A;  1Y9W A;  2D4P A;  2DPT A;  4FD7 A;  4HNY B;  2I79 A;  2ARH A;  3R9E A;  1KZF A;  2CNT A;  2DPS A;  2GAN A;  2P6G A;  5F49 A;  4PSX A;  4CAV A;  4L89 A;  1NSL A;  4FD4 A;  2AJ6 A;  3TFY A;  3FNC A;  2WSA A;  3D2M A;  4PK2 A;  1ON0 A;  2YGW A;  3FRM A;  4JJX A;  4CAE A;  3UY5 A;  4AVC A;  4UFV A;  1CJW A;  3BJ8 A;  1QST A;  4QB9 A;  4U9Y A;  3DR6 A;  2HQY A;  4OAE A;  4C2X A;  4KS9 A;  3BJ7 A;  2FIW A;  1BOB A;  1XIX A;  1PUA A;  2CXA A;  1XEB A;  2Z10 A;  5CNP A;  3ZJ0 A;  2VI7 A;  4PK3 A;  1ZO0 A;  4U5Y A;  2Z3N A;  1QSO A;  3F5B A;  4UBR A;  3PZJ A;  3RYO A;  2B5G B;  2Q4Y A;  4PV6 A;  4XPL A;  1YVO A;  3S6H A;  4MHD A;  2R1I A;  3G8W A;  2K5T A;  4MFL A;  1XMT A;  2FT0 A;  4B10 A;  4JXR A;  2JDD A;  3DR8 A;  1N71 A;  2VQY A;  5H84 A;  4A33 A;  2P6E A;  4KZT A;  4KSA A;  1B87 A;  3IGR A;  3TE4 A;  1I1D A;  4UWI A;  1S3Z A;  2B5G A;  4ZBG A;  5AG4 A;  3JUW A;  3EC4 A;  1IB1 E;  3OWC A;  1S7K A;  1Q2C A;  3BLN A;  4ONU A;  4A30 A;  1Y7R A;  2FS5 A;  2BSW A;  4YRH A;  3C26 A;  4K30 A;  3G3S A;  3PGP A;  4A31 A;  3LD2 A;  4MBU A;  4XNH B;  3W6X A;  1Q2Y A;  4KUA A;  1YGH A;  2B3U A;  3S6K A;  3EFA A;  2YNE A;  2A4N A;  4B13 A;  1S5K A;  2WUU A;  1IID A;  4Y49 B;  1NMT A;  2GIV A;  4R3L A;  4R87 A;  4MY3 A;  2Q7B A;  2R98 A;  2FSR A;  2Q44 A;  3TTH A;  1YVK A;  4UCP A;  2ZW7 A;  2DXQ A;  4X5K A;  5GCN A;  3PP9 A;  4MI4 A;  1M4D A;  1M44 A;  1Z4R A;  4AB7 A;  2G3T A;  4OAD A;  5IV0 A;  4R57 A;  4B14 A;  2J8N A;  5JQ4 A;  4XPD C;  2BUE A;  4AG7 A;  4Q36 A;  5AG5 A;  4CAX A;  4KVX A;  3FYN A;  4KOW A;  4A32 A;  5H86 A;  1Q2D A;  2Z3L A;  5C88 A;  4UCM A;  4JWP A;  5I0C A;  5KTD A;  2H5M A;  4F0Y A;  4B12 A;  4YGO A;  5AG6 A;  4MFK A;  2JLM A;  1CM0 A;  2HV2 A;  5IB0 A;  4KOX A;  5J8C A;  3SXN A;  4KSF A;  3F0A A;  4L8A A;  4QVT A;  2VZZ A;  3EY5 A;  2G3A A;  3R1K A;  5HH1 A;  4CGP A;  3VWE A;  1SQH A;  2JEV A;  4OLL A;  4KVM E;  4MFJ A;  5KTC A;  2FIA A;  4KOY A;  3D3S A;  3T90 A;  5EC4 A;  2EVN A;  2GE3 A;  2PDO A;  3FXT A;  1MK4 A;  2FL4 A;  4QBJ A;  4KVO E;  4CRY B;  1Z4E A;  2JDC A;  3V8I A;  2PR1 A;  3T9Y A;  1XF8 A;  2KCW A;  2FE7 A;  2EUI A;  1TIQ A;  4KLV A;  1WWZ A;  3CXS A;  1MJA A;  1RO5 A;  4AVB A;  2PC1 A;  5FVJ A;  3IWE A;  3TO6 A;  3TCV A;  1MJB A;  4MFZ A;  3QB8 A;  2YNC A;  3TO7 A;  3DSB A;  4CYO A;  4UFW A;  4CRZ B;  4KOV A;  1S7F A;  1L0C A;  1I12 A;  3H4Q A;  1IYL A;  1IYK A;  4LX9 A;  1VKC A;  3EXN A;  3ZZI A;  4CAF A;  2OZU A;  3I3G A;  1UFH A;  4NCZ A;  3LOD A;  2WPX A;  4MY0 A;  4EVY A;  1YRE A;  4UA3 A;  4MJ8 A;  5F47 A;  3K9U A;  3P2F A;  2WPW A;  4CS0 B;  4HKF A;  2F5I A;  1QSM A;  1QSN A;  1I21 A;  4J3G A;  4CGL A;  1YR0 A;  2Z3M A;  4FD5 A;  4B5P B;  3EO4 A;  5DWM A;  4CYN A;  2ZPA A;  2Z3O A;  4PSW A;  3TO9 A;  3W6S A;  4UCN A;  4RS2 A;  4KOS A;  4KOR A;  2CNS A;  2B3V A;  4C7I A;  4JD6 A;  4KUB A;  5DWN A;  5KTA A;  4ZGY B;  1NE9 A;  1OZP A;  2ZW5 A;  2Q04 A;  5G22 A;  4B5P A;  3KKW A;  1PU9 A;  2OZH A;  4Q38 A;  2FCK A;  2R8V A;  2OU2 A;  3FB3 A;  4CAW A;  2ATR A;  4II9 A;  3FBU A;  2YND A;  4NF1 A;  3CXP A;  1GHE A;  2G0B A;  2QML A;  4H89 A;  4CGN A;  2QEC A;  5AGE A;  3TOB A;  4KOU A;  4CGO A;  1FY7 A;  2Z3K A;  3GY9 A;  4XPK A;  2CNM A;  1V0C A;  5A27 A;  1XE4 A;  2P6F A;  2VXK A;  5J8F A;  1LRZ A;  3GYA A;  4UWJ A;  4QC6 A;  1YX0 A;  3TT2 A;  4XPD B;  4C68 A;  4E2A A;  2NMT A;  1M1D A;  3JTK A;  2J8R A;  1B6B A;  4HNX B;  3R9G A;  2VBQ A;  1P0H A;  4FD6 A;  5HMN A;  4HNW B;  2BL1 A;  3F8K A;  4B5O A;  4KOT A;  3R96 A;  4C7H A;  4F6A A;  1R57 A;  3S6G A;  3R95 A;  2REE A;  5G20 A;  2Z3P A;  1M4I A;  1YK3 A;  5C82 A;  2I00 A;  4C2Y A;  4H6Z A;  3SXO A;  5ISV A;  2P0W A;  2Q4V A;  2HUZ A;  2B4D B;  2B58 A;  4XNH C;  1WK4 A;  3CXQ A;  2Q0Y A;  1P4N A;  2PR8 A;  2R7H A;  4E8O A;  2O28 A;  3B8G A;  3P2H A;  4ORF A;  5G21 A;  3QAH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...