4X5KA

Human naa50 complex with coenzyme a and an acetylated peptide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
b'GSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-alpha-acetyltransferase 50
publication title Human NAA50 with coenzymeA and a peptide
rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
total genus 39
structure length 153
sequence length 153
ec nomenclature ec 2.3.1.258: N-terminal methionine N(alpha)-acetyltransferase NatE.
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4x5kA00
1KUVA 2CY2A 1M4DA 2CNSA 3KKWA 4BMHA 5IB0A 1Y9WA 4U9YA 4M85A 1VHSA 3P2FA 4YGOA 1QSRA 1M4IA 1VKCA 3T90A 1Z4RA 4JJXA 2DXQA 3FIXA 4ORFA 2P0WA 4NXYA 4JWPA 3EFAA 4Y49C 2J8MA 2FIWA 3ZZIA 4R3LA 5J8FA 4FD7A 4DNCA 4UWJA 2CNTA 3PP9A 4NSQA 4KOWA 2ZPAA 2AJ6A 5E96A 3I9SA 4KOTA 4XPKA 2QECA 2HQYA 4YRHA 4UA3A 2K5TA 2G3TA 1NSLA 1QSMA 5DWNA 1S7LA 1S7NA 3EC4A 4KOXA 4JD6A 5I0CA 1GHEA 1S5KA 2FXFA 1IYKA 3GKRA 4LUAA 5JQ4A 2JLMA 3DR8A 2FCKA 5F49A 4FD4A 3DSBA 2GANA 3H4QA 3W6XA 2Z0ZA 3TE4A 1KUXA 4PSXA 1FY7A 2BEIA 3GY9A 4B5OA 3D2PA 2ZW7A 2REEA 1U6MA 4OAEA 3GYAA 1Q2YA 4FD6A 1SQHA 1CJWA 5H86A 2Z10A 2REFA 4PK3A 3LODA 1KZFA 3MGDA 1S60A 2QIRA 3W91A 5H84A 1PU9A 2PDOA 4KOUA 2EVNA 3IGRA 3CXSA 3TO9A 5C88A 4ZBGA 2ZW4A 4MJ8A 2Q4VA 4X5KA 4JLYA 1RXTA 1I21A 1V0CA 3JVNA 1NE9A 4HKFA 2JEVA 1UFHA 4JXRA 3V8IA 2AE6A 3LD2A 3G3SA 4K30A 1S3ZA 4I49A 4KZTA 1OZPA 1PUAA 4NCZA 2VEZA 4R9MA 1S7KA 2CNMA 4FD5A 4KORA 2VBQA 2NMTA 2FIAA 4ONUA 2PR1A 2D4OA 1KUYA 5GCNA 4KUAA 3WR7A 3QAHA 2IL4A 4EVYA 4IUSA 3PZJA 1BOBA 2PRBA 4E0AA 2FS5A 2P6GA 1B87A 5F48A 3W6SA 3BJ7A 4PK2A 4M3SA 3SHPA 5CNPA 2BL1A 2VI7A 3S6KA 1XMTA 1XF8A 5HH1A 3G8WA 2FE7A 4H89A 1P0HA 1XIXA 1YVKA 2ZW5A 3CXPA 4AVCA 2D4PA 4XPDB 2ARHA 2VZYA 4KOYA 1QSOA 4OLLA 3S6FA 4AG9A 1YR0A 4HNXB 2FSRA 4RS2A 2G0BA 4U9ZA 1M44A 2OB0A 1LRZA 4MY0A 2PC1A 3SXNA 4MI4A 4CAWA 1I1DA 2JDDA 2OZHA 4HNWB 1N71A 3R9GA 3EY5A 3C26A 3B8GA 1L0CA 2I00A 4KLVA 2B5GA 2J8RA 4AVAA 5IX3A 5FVJA 4YFJA 2Q04A 3RYOA 4NF1A 4R87A 4B5PB 3TO6A 2Z11A 3IWGA 3UY5A 1WWZA 2JDCA 3VWEA 3TT2A 4B5PA 4QVTA 4R57A 3OWCA 2J8NA 2GE3A 1QSNA 3FXTA 2ZXVA 3TOBA 1R57A 2HV2A 4F6AA 3BLNA 2VQYA 3FRMA 3R95A 3NE7A 1YVOA 4XPDC 4QUSA 1M4GA 5JPHA 3FNCA 3DR6A 4KLWA 2RC4A 3EO4A 4PV6A 3F8KA 3DDDA 2ZW6A 4KOSA 2C27A 1Q2CA 2FL4A 4PSWA 3D2MA 4L89A 3SXOA 1P4NA 1Y9KA 3TOAA 4MY3A 2G3AA 4JXQA 4AVBA 2X7BA 4HNYB 1Q2DA 2Y0MA 2WPWA 3CXQA 4L8AA 2KCWA 3PGPA 3S6GA 4NEXA 2WPXA 3TCVA 2BSWA 1IICA 3FYNA 2BUEA 2ATRA 2VXKA 4LX9A 3DNSA 4KOVA 3ZJ0A 2P6FA 2PR8A 2Q4YA 4XNHB 3BJ8A 3R1KA 2B3VA 5J8CA 1ON0A 2HUZA 1J4JA 3R96A 3D8PA 3N7ZA 3EXNA 3F5BA 1YREA 4UWIA 4CAXA 4U5YA 1K4JA 5KTCA 2O28A 5DWMA 1XE4A 2PQ8A 4GS4A 4KVME 4E8OA 1RO5A 3FB3A 1YGHA 2A4NA 2PSWA 2EUIA 3TTHA 2OU2A 2B5GB 2B4DB 1TIQA 1Z9UA 4CRZB 1I12A 1Y7RA 3T9YA 5KTAA 2FT0A 4UBRA 4KUBA 1BO4A 3E0KA 1YLEA 2B4DA 3JUWA 1NMTA 3K9UA 2Q7BA 5ISVA 2GIVA 3R9FA 2R8VA 5F47A 4QBJA 1CM0A 4MBUA 1MJBA 4IF5A 3F0AA 4XPLA 4H6ZA 2B4BA 3D3SA 4F0YA 4KVOE 3I3GA 2R7HA 2P6EA 4Y49B 2Q0YA 1MK4A 2I79A 4AG7A 5EC4A 2B58A 4QC6A 3R9EA 2F5IA 5KTDA 5F46A 1IB1E 3TO7A 1IYLA 4XNHC 4E2AA 4KVXA 2OH1A 2H5MA 3VWDA 4R3KA 5C82A 3FBUA 4RI1A 1S7FA 1YX0A 3QB8A 1M1DA 4OADA 4II9A 2QMLA 4CS0B 1B6BA 1XEBA 4MHDA 1QSTA 2OZUA 2VZZA 1YK3A 5IV0A 4AB7A 4CAVA 4H6UA 1Z4EA 2Q44A 1WK4A 2OZGA 2R98A 3P2HA 2B3UA 4J3GA 5HMNA 2R1IA 3TFYA 1IIDA 3S6HA 1MJAA 5EBVA 1MJ9A 4CRYB 4QB9A
chains in the Genus database with same CATH superfamily
3B3SA 1KUVA 2G9DA 2CY2A 1M4DA 3KI9A 2CNSA 3SI2A 2C6CA 3KKWA 2O53A 3NH5A 4AXVA 4BMHA 3SJGA 1DTDA 4CGLA 5IB0A 2YNDA 2ZEEA 1Y9WA 4U9YA 4M85A 1VHSA 2Q4ZA 2XEGA 1ELMP 3P2FA 4YGOA 1QSRA 4KSFA 4P4EA 1M4IA 1VKCA 2Z3KA 3T90A 1Z4RA 4JJXA 2DXQA 5HVFA 3FIXA 2GLJA 3QAYA 4MCQA 4ORFA 4NGRA 2P0WA 4NXYA 4JWPA 3EFAA 4Y49C 2J8MA 3PB8X 5I4MA 4ZY0A 3PBEA 2FIWA 4MFKA 3ZZIA 4R3LA 2ZEDA 3PFOA 5J8FA 4GXHA 2WYRA 4FWUA 4W9YA 4A95A 4FD7A 4DNCA 4UWJA 4B6ZA 2BCOA 2CNTA 3PP9A 1Z8LA 4NSQA 2BOAA 1HDQA 1VGYA 4KOWA 2CF4A 3FECA 2JBKA 2ZPAA 2AJ6A 5E96A 4CGOA 3I9SA 4KOTA 2Z3PA 4XPKA 2QECA 2HQYA 4YRHA 4LQ6A 1ZG9A 2K5TA 4UA3A 2G3TA 1NSLA 1QSMA 5DWNA 1F2OA 1S7LA 4TWEA 4IHMA 4OKOA 1S7NA 3EC4A 4MCPA 2GLFA 4KOXA 3RNZA 1EE3P 1TKFA 4JD6A 4P4IA 1TF9A 4B13A 5I0CA 4UCNA 2WSAA 1GHEA 1S5KA 2FXFA 1IYKA 3GKRA 4ZY2A 2EK9A 4CYPA 4LUAA 4BBHA 5F09A 2JLMA 5ELYA 1BPNA 5JQ4A 3IIBA 4UF4A 3DR8A 4C7IA 2FCKA 2GU2A 3B3CA 4UFXA 2XEJA 4A39A 2PJ5A 1LAMA 5F49A 2HC9A 1FT7A 3KZWA 4FD4A 4P4BA 4X2TA 5IB9A 3DSBA 2GANA 3H4QA 3PB6X 2Z0ZA 3W6XA 2BO9A 3TE4A 1KUXA 4PSXA 1FY7A 2BEIA 2CIJA 3GY9A 4ONWA 3JRUA 4B5OA 1XFOA 2ZW7A 3D2PA 3KQXA 3FF3A 4FBEA 3HUVA 2REEA 1DE4C 2PRQA 4UIAA 1U6MA 4OAEA 3GYAA 1Q2YA 2V8VA 2AFXA 4FD6A 1SQHA 1CJWA 5H86A 2Z10A 4IK2A 2XEIA 4M6HA 1YW6A 3IC1A 4NGNA 2ZELA 3D4UA 3PEIA 3SJFA 4P10A 2REFA 3PB7X 1VIXA 4PK3A 1TKJA 1VHOA 3LODA 4PXBA 4R76A 1ELLP 2FVGA 1IOFA 1KZFA 3MGDA 1S60A 2QIRA 3W91A 4OIDA 3FMCA 5H84A 1PU9A 2PDOA 4KOUA 2EVNA 3IGRA 3CXSA 4KSIA 3TO9A 1YSJA 3VH9A 5C88A 2IMOA 4ZBGA 3KASA 2ZW4A 4MFQA 4MJ8A 4PXEA 1X12A 2Q4VA 4A37A 4X5KA 4LQGA 5K8NA 1TXRA 1ZLIA 4DUKA 4JLYA 4F9UA 4PPZA 1RXTA 1I21A 1V0CA 4A30A 3JVNA 1NE9A 4HKFA 4UCMA 4UFVA 4C68A 4DJLA 2QJ8A 2JEVA 1UFHA 2I3CA 4JXRA 3V8IA 4Q36A 3FVLA 2AE6A 4NGPA 3LD2A 4UEEA 3NH4A 2PVVA 3G3SA 4A32A 1OBRA 1Z8TA 1JWQA 4K30A 3NH8A 1S3ZA 5DS0A 3V7ZA 4I49A 4KZTA 1OZPA 3H5ZA 1GYTA 1PUAA 2YNEA 3B35A 4Q38A 4NCZA 2HB6A 3WT4A 2VEZA 4CAEA 1ZG8A 1S7KA 4R9MA 2QYVA 2CNMA 4FD5A 4KORA 2VBQA 1X10A 2ZEMA 2PJ4A 3KR5A 2PJBA 4R7MA 2NMTA 2FIAA 3N5FA 3D67A 4GM5A 4ONUA 4MRIA 1R3NA 2PR1A 4OMEA 3WC6A 2D4OA 3RZAA 1KUYA 3NA6A 4NJRA 5GCNA 2Z3OA 4KUAA 4OC4A 3WR7A 3QAHA 5A27A 2IL4A 4EVYA 4IUSA 3D7DA 3HLPA 4EMEA 4H2KA 5HVGA 4OC3A 3PZJA 1BOBA 2PRBA 4CGPA 4F0XA 3JTKA 1RTQA 4R8FA 3RO0A 4ZX9A 3SJEA 1KWMA 4E0AA 2FS5A 2P6GA 3KL9A 1IU8A 1B87A 5F48A 3W6SA 4UIBA 3BJ7A 4PK2A 1QQ9A 4M3SA 3V38A 4UCPA 5K8MA 3SHPA 5CNPA 4OP4A 1LFWA 2Q7SA 2V8HA 2POKA 2BL1A 3WABA 2VI7A 2EK8A 3FX6A 4ZX8A 3S6KA 1XMTA 1XF8A 3K2KA 3BI1A 4CRYB 4ZGYB 5HH1A 3G8WA 3KHZA 2FE7A 4H89A 1P0HA 2XEFA 1XIXA 2PJ0A 3BXMA 2YNCA 5LRJA 3S9LA 1YVKA 1F2PA 4X8IA 1F57A 2ZW5A 5J1QA 3CXPA 1LCPA 2F8HA 1YMEA 4YU9A 2ABZA 2PJ7A 4AVCA 5HXDA 3IFEA 1YLOA 3L2NA 2D4PA 4XPDB 2AFUA 1XOVA 2ARHA 2VZYA 3CT9A 4MHPA 1LOKA 4KOYA 1QSOA 1IOIA 4OLLA 1HDUA 3S6FA 4AG9A 5JH9A 1YR0A 6CPAA 4HNXB 1Z8XA 2FSRA 5LYIA 2IQ6A 4RS2A 4MFZA 2G0BA 4EFDA 2AFOA 4C2XA 1LAPA 2PJ9A 1ARMA 4U9ZA 1IGBA 3B2YA 1M44A 2OB0A 1LRZA 4C2YA 4Z65A 5A28A 4MY0A 2PC1A 5LYDA 3SXNA 4MFPA 4MI4A 4CAWA 1I1DA 3CPXA 2ZEPA 3LMSA 1AYEA 4A31A 4EWTA 3WC5A 2JDDA 2OZHA 4A38A 4HNWB 1N71A 4NGSA 4YWYA 2Z3LA 3D7FA 4MCRA 3R9GA 1CG2A 3EY5A 4B12A 3C26A 3BI0A 3B8GA 1L0CA 2I00A 2GREA 4KLVA 1VHEA 5LYFA 2EWBA 2QVPA 2B5GA 2J8RA 1Z2LA 4AVAA 2O4HA 5IX3A 5FVJA 4YFJA 4FUUA 5G1ZA 1H8LA 4OC1A 2JEWA 1AMPA 2Q04A 1R43A 5AGEA 2DPSA 3GIUA 4M6IA 2V8DA 4NF1A 3RYOA 4JZ0A 1CP6A 2RB7A 3IWEA 4NJQA 4R87A 4B5PB 3TO6A 2Z11A 7CPAA 4RN7A 3PB9X 2CXAA 2V77A 4NFRA 4O23A 4OIWA 4WJBA 3IWGA 3UY5A 1WWZA 2JDCA 3VWEA 4B10A 5HVHA 3TT2A 4NGQA 1BLLE 3H8FA 5K8PA 4B5PA 2DEAA 1JQGA 3VARA 4QVTA 4R57A 4UEFA 2YNCC 3OWCA 2JBJA 3KHXA 2J8NA 2GE3A 1QSNA 3FXTA 2ZXVA 3TOBA 3FH4A 3DGVA 4B14A 1R57A 2HV2A 5AG6A 3RAMA 4F6AA 3GLJA 3BLNA 1HEEA 2VQYA 3FRMA 2OR4A 4F8ZA 4A2ZA 2CTBA 3R95A 2V8GA 3NE7A 1Z5RA 2PJAA 1XJOA 1YVOA 4XPDC 4CYQA 4ZY1A 4QUSA 1M4GA 2NYQA 3LWUA 5JPHA 3FNCA 4IAVA 1Y0RA 3KQZA 3DR6A 4OC5A 4CYNA 2ANPA 4KLWA 2RC4A 2PJ3A 3S9NA 3EO4A 4PV6A 4CPAA 3F8KA 3B3TA 3DDDA 2ZW6A 4KOSA 1CX8A 3IWWA 4NGMA 1Y0YA 2C27A 3CDXA 3KR4A 1Q2CA 2FL4A 3PB4X 4PSWA 3D2MA 4L89A 3SXOA 4A33A 2PVWA 1ZO0A 1P4NA 1Y9KA 3TOAA 2ZEGA 3D68A 2VL1A 2G3AA 3A9LA 4MY3A 3I1UA 3GUXA 4JXQA 3H8GA 3RBUA 1FNOA 2X7BA 4AVBA 2EO8A 4HNYB 1Q2DA 4P4FA 2Y0MA 2WPWA 5JGFA 3CXQA 4L8AA 2AFSA 4R6TA 2KCWA 3PGPA 3NE8A 3S9MA 3S6GA 5LYLA 4MHZA 4NEXA 4X3RA 5LRGA 2WPXA 3TCVA 2BSWA 2ZEHA 3B3VA 1IICA 5K8OA 3MN8A 3FYNA 2BUEA 2ATRA 4BINA 2VXKA 2ZENA 4LX9A 2PIYA 3DNSA 2PJ6A 4KOVA 4MCSA 4P4DA 1IY7A 3ZJ0A 4CGNA 3D7HA 3D66A 2P6FA 3BHXA 2PR8A 1CBXA 4ZYQA 2NSMA 3SI0A 2Q4YA 2AFZA 2PJ2A 4XNHB 3PBBA 3BJ8A 2ZOFA 3R1KA 2B3VA 2J9AA 4MHNA 4MFJA 5D29A 5J8CA 3FEDA 1ON0A 2HUZA 3GB0A 1J4JA 2ZOGA 2RFHA 1XMBA 2Z3MA 3D8PA 3EXNA 2ZEFA 1YREA 2CTCA 3F5BA 3IU1A 3LACA 3N7ZA 4PXCA 4UWIA 4CAXA 4U5YA 1K4JA 3CZXA 1CPSA 3ISXA 5KTCA 2ODFA 3DLJA 2O28A 4P4JA 5DWMA 2DF5A 2Z3NA 1XE4A 2EBJA 2PQ8A 4GS4A 4JYWA 4KVME 4TNUA 1RO5A 4E8OA 3FB3A 1YGHA 2A4NA 4B11A 2PSWA 4UFWA 2EUIA 1XBUA 3TTHA 2OU2A 4UEZA 2B5GB 4OC0A 3ISZA 2B4DB 4C2ZA 4FAIA 2YGWA 1TIQA 1Z9UA 3B3WA 4CRZB 1I12A 5EMIA 1A2ZA 2PIZA 1Y7RA 3T9YA 5KTAA 2FT0A 4Q7AA 3PRTA 3MRUA 4UBRA 4KUBA 1BO4A 3E0KA 3SI1A 4A94A 2AFWA 1YLEA 2F7VA 5D8NA 2PJ1A 2AFMA 3SJXA 2B4DA 3JUWA 1NMTA 2C6PA 3IU2A 3K9UA 4KSAA 2Q7BA 5AG4A 5ISVA 2GIVA 2PJCA 4P44A 1UWYA 2C1CA 3R9FA 5LRKA 2R8VA 4P6YA 5F47A 4DYOA 3FEEA 2Q43A 3TC8A 1AUGA 3WC7A 4QBJA 4CGMA 2C6GA 3D7GA 1CM0A 4KS9A 5G21A 4MBUA 4CAFA 1MJBA 1CPXA 1PCAA 4IF5A 3K9TA 2WZNA 5THWA 3F0AA 4XPLA 4H6ZA 1YW4A 5G22A 2DPTA 2B4BA 3D3SA 2GFQA 4C7HA 1M4LA 4KVOE 4F0YA 3I3GA 1ZG7A 2R7HA 2P6EA 4Y49B 1PYTB 2PJ8A 2Q0YA 1QMUA 3B7IA 4CYOA 4PQAA 1MK4A 2I79A 3H8EA 4P45A 4AG7A 5EC4A 5BWAB 1LANA 2Q51A 2B58A 3CPAA 4NGTA 4QC6A 3R9EA 2PCUA 2F5IA 5KTDA 3T8WA 3TX8A 5F46A 1IB1E 2PE3A 4RUHA 3TO7A 1IYLA 1CP7A 5CBMA 4XNHC 4E2AA 4KVXA 2OH1A 2H5MA 4ZI6A 3VWDA 4R3KA 1BPMA 4HPSA 1TKHA 5C82A 3FBUA 3NFZA 4RI1A 4PXDA 1S7FA 3PFEA 1YX0A 1YQEA 3QB8A 4M6GA 1BAVA 4MXUA 1M1DA 4OADA 1ARLA 4II9A 2QMLA 4CS0B 1B6BA 1XEBA 4G1PA 3QNVA 4MHDA 1Z8WA 1TF8A 4F9VA 1QSTA 1Y7EA 1XRYA 2OZUA 2VZZA 1YK3A 5IV0A 3IJ3A 4AB7A 4H6UA 4CAVA 8CPAA 1Z4EA 1ZLHA 2Q44A 1WK4A 2OZGA 2R98A 5AG7A 3P2HA 1NSAA 1Q7LA 2OOTA 2B3UA 5AG5A 4J3GA 5CPAA 4MHYA 4BD9A 5HMNA 2R1IA 5JM6A 3TFYA 2IJZA 4MMOA 1IIDA 3IO1A 4WWVA 3S6HA 4MFLA 5G20A 3FJUA 4K3NA 3IEHA 2ZEOA 3KGQA 4OC2A 1MJAA 5EBVA 1MJ9A 3R96A 3VATA 4QB9A 2WUUA
chains in the Genus database with same CATH topology
1KUVA 2CY2A 1M4DA 2CNSA 3KKWA 4BMHA 4CGLA 5IB0A 2YNDA 1Y9WA 4U9YA 4M85A 1VHSA 3P2FA 4YGOA 1QSRA 4KSFA 1M4IA 1VKCA 2Z3KA 3T90A 1Z4RA 4JJXA 2DXQA 3FIXA 4ORFA 2P0WA 4NXYA 4JWPA 3EFAA 4Y49C 2J8MA 2FIWA 4MFKA 3ZZIA 4R3LA 5J8FA 4A95A 4FD7A 4DNCA 4UWJA 2CNTA 3PP9A 4NSQA 4KOWA 2ZPAA 2AJ6A 5E96A 4CGOA 3I9SA 4KOTA 2Z3PA 4XPKA 2QECA 2HQYA 4YRHA 4UA3A 2K5TA 2G3TA 1NSLA 1QSMA 5DWNA 1S7LA 1S7NA 3EC4A 4KOXA 4JD6A 4B13A 5I0CA 4UCNA 2WSAA 1GHEA 1S5KA 2FXFA 1IYKA 3GKRA 4CYPA 4LUAA 4BBHA 5JQ4A 2JLMA 3DR8A 4C7IA 2FCKA 4UFXA 5F49A 4FD4A 3DSBA 2GANA 3H4QA 3W6XA 2Z0ZA 3TE4A 1KUXA 4PSXA 1FY7A 2BEIA 3GY9A 4B5OA 3D2PA 2ZW7A 2REEA 1U6MA 4OAEA 3GYAA 1Q2YA 4FD6A 1SQHA 1CJWA 5H86A 2Z10A 2REFA 4PK3A 3LODA 1KZFA 3MGDA 1S60A 2QIRA 3W91A 5H84A 1PU9A 2PDOA 4KOUA 2EVNA 3IGRA 3CXSA 3TO9A 5C88A 4ZBGA 2ZW4A 4MFQA 4MJ8A 2Q4VA 4X5KA 4JLYA 1RXTA 1I21A 1V0CA 4A30A 3JVNA 1NE9A 4HKFA 4UCMA 4UFVA 4C68A 2JEVA 1UFHA 4JXRA 3V8IA 4Q36A 2AE6A 3LD2A 3G3SA 4A32A 4K30A 1S3ZA 4I49A 4KZTA 1OZPA 3H5ZA 1PUAA 2YNEA 4CAEA 4Q38A 4NCZA 2VEZA 4R9MA 1S7KA 2CNMA 4FD5A 4KORA 2VBQA 2NMTA 2FIAA 4ONUA 2PR1A 2D4OA 1KUYA 5GCNA 2Z3OA 4KUAA 3WR7A 3QAHA 5A27A 2IL4A 4EVYA 4IUSA 3PZJA 1BOBA 2PRBA 4CGPA 4F0XA 3JTKA 4E0AA 2FS5A 2P6GA 1B87A 5F48A 3W6SA 3BJ7A 4PK2A 4M3SA 4UCPA 3SHPA 5CNPA 2BL1A 2VI7A 3S6KA 1XMTA 1XF8A 4ZGYB 5HH1A 3G8WA 2FE7A 4H89A 1P0HA 1XIXA 2YNCA 1YVKA 2ZW5A 3CXPA 4AVCA 2D4PA 4XPDB 2ARHA 2VZYA 4KOYA 1QSOA 4OLLA 3S6FA 4AG9A 1YR0A 4HNXB 2FSRA 4RS2A 4MFZA 2G0BA 4C2XA 4U9ZA 1M44A 2OB0A 1LRZA 4C2YA 5A28A 4MY0A 2PC1A 3SXNA 4MFPA 4MI4A 4CAWA 1I1DA 4A31A 2JDDA 2OZHA 4HNWB 1N71A 2Z3LA 3R9GA 3EY5A 4B12A 3C26A 3B8GA 1L0CA 2I00A 4KLVA 2B5GA 2J8RA 4AVAA 5IX3A 5FVJA 4YFJA 5G1ZA 2Q04A 5AGEA 2DPSA 3RYOA 4NF1A 4R87A 3IWEA 4B5PB 3TO6A 2Z11A 2CXAA 3IWGA 3UY5A 1WWZA 2JDCA 3VWEA 4B10A 3TT2A 4B5PA 4QVTA 4R57A 2YNCC 3OWCA 2J8NA 2GE3A 1QSNA 3FXTA 2ZXVA 3TOBA 4B14A 1R57A 2HV2A 5AG6A 4F6AA 3BLNA 2VQYA 3FRMA 4A2ZA 3R95A 3NE7A 1YVOA 4CYQA 4XPDC 4QUSA 1M4GA 5JPHA 3FNCA 4CYNA 3DR6A 4KLWA 2RC4A 3EO4A 4PV6A 3F8KA 3DDDA 2ZW6A 4KOSA 2C27A 1Q2CA 2FL4A 4PSWA 3D2MA 4L89A 3SXOA 4A33A 1ZO0A 1P4NA 1Y9KA 3TOAA 4MY3A 2G3AA 3A9LA 4JXQA 4AVBA 2X7BA 4HNYB 1Q2DA 2Y0MA 2WPWA 3CXQA 4L8AA 2KCWA 3PGPA 3S6GA 4NEXA 2WPXA 3TCVA 2BSWA 1IICA 3FYNA 2BUEA 2ATRA 2VXKA 4LX9A 3DNSA 4KOVA 3ZJ0A 4CGNA 2P6FA 2PR8A 2Q4YA 4XNHB 3BJ8A 3R1KA 2B3VA 4MFJA 5J8CA 1ON0A 2HUZA 1J4JA 2Z3MA 3R96A 3D8PA 3N7ZA 3EXNA 3F5BA 1YREA 3IU1A 4UWIA 4CAXA 4U5YA 1K4JA 5KTCA 2O28A 5DWMA 2Z3NA 1XE4A 2PQ8A 4GS4A 4KVME 4E8OA 1RO5A 3FB3A 1YGHA 2A4NA 4B11A 2PSWA 4UFWA 2EUIA 3TTHA 2OU2A 2B5GB 2B4DB 4C2ZA 2YGWA 1TIQA 1Z9UA 4CRZB 1I12A 1Y7RA 3T9YA 5KTAA 2FT0A 4UBRA 4KUBA 1BO4A 3E0KA 1YLEA 2B4DA 3JUWA 1NMTA 3IU2A 3K9UA 4KSAA 2Q7BA 5AG4A 5ISVA 2GIVA 3R9FA 2R8VA 5F47A 4QBJA 4CGMA 1CM0A 4KS9A 5G21A 4MBUA 4CAFA 1MJBA 4IF5A 3F0AA 4XPLA 4H6ZA 5G22A 2DPTA 2B4BA 3D3SA 4C7HA 4F0YA 4KVOE 3I3GA 2R7HA 2P6EA 4Y49B 2Q0YA 4CYOA 1MK4A 2I79A 4AG7A 5EC4A 5BWAB 2B58A 4QC6A 3R9EA 2F5IA 5KTDA 5F46A 1IB1E 3TO7A 1IYLA 4XNHC 4E2AA 4KVXA 2OH1A 2H5MA 3VWDA 4R3KA 5C82A 3FBUA 4RI1A 1S7FA 1YX0A 3QB8A 1M1DA 4OADA 4II9A 2QMLA 4CS0B 1B6BA 1XEBA 4MHDA 1QSTA 2OZUA 2VZZA 1YK3A 5IV0A 4AB7A 4CAVA 4H6UA 1Z4EA 2Q44A 1WK4A 2OZGA 2R98A 5AG7A 3P2HA 2B3UA 5AG5A 4J3GA 5HMNA 2R1IA 3TFYA 1IIDA 3S6HA 4MFLA 5G20A 1MJAA 5EBVA 1MJ9A 4CRYB 4QB9A 2WUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KUV A;  2CY2 A;  1M4D A;  2CNS A;  3KKW A;  4BMH A;  5IB0 A;  1Y9W A;  4U9Y A;  4M85 A;  1VHS A;  3P2F A;  4YGO A;  1QSR A;  1M4I A;  1VKC A;  3T90 A;  1Z4R A;  4JJX A;  2DXQ A;  3FIX A;  4ORF A;  2P0W A;  4NXY A;  4JWP A;  3EFA A;  4Y49 C;  2J8M A;  2FIW A;  3ZZI A;  4R3L A;  5J8F A;  4FD7 A;  4DNC A;  4UWJ A;  2CNT A;  3PP9 A;  4NSQ A;  4KOW A;  2ZPA A;  2AJ6 A;  5E96 A;  3I9S A;  4KOT A;  4XPK A;  2QEC A;  2HQY A;  4YRH A;  4UA3 A;  2K5T A;  2G3T A;  1NSL A;  1QSM A;  5DWN A;  1S7L A;  1S7N A;  3EC4 A;  4KOX A;  4JD6 A;  5I0C A;  1GHE A;  1S5K A;  2FXF A;  1IYK A;  3GKR A;  4LUA A;  5JQ4 A;  2JLM A;  3DR8 A;  2FCK A;  5F49 A;  4FD4 A;  3DSB A;  2GAN A;  3H4Q A;  3W6X A;  2Z0Z A;  3TE4 A;  1KUX A;  4PSX A;  1FY7 A;  2BEI A;  3GY9 A;  4B5O A;  3D2P A;  2ZW7 A;  2REE A;  1U6M A;  4OAE A;  3GYA A;  1Q2Y A;  4FD6 A;  1SQH A;  1CJW A;  5H86 A;  2Z10 A;  2REF A;  4PK3 A;  3LOD A;  1KZF A;  3MGD A;  1S60 A;  2QIR A;  3W91 A;  5H84 A;  1PU9 A;  2PDO A;  4KOU A;  2EVN A;  3IGR A;  3CXS A;  3TO9 A;  5C88 A;  4ZBG A;  2ZW4 A;  4MJ8 A;  2Q4V A;  4X5K A;  4JLY A;  1RXT A;  1I21 A;  1V0C A;  3JVN A;  1NE9 A;  4HKF A;  2JEV A;  1UFH A;  4JXR A;  3V8I A;  2AE6 A;  3LD2 A;  3G3S A;  4K30 A;  1S3Z A;  4I49 A;  4KZT A;  1OZP A;  1PUA A;  4NCZ A;  2VEZ A;  4R9M A;  1S7K A;  2CNM A;  4FD5 A;  4KOR A;  2VBQ A;  2NMT A;  2FIA A;  4ONU A;  2PR1 A;  2D4O A;  1KUY A;  5GCN A;  4KUA A;  3WR7 A;  3QAH A;  2IL4 A;  4EVY A;  4IUS A;  3PZJ A;  1BOB A;  2PRB A;  4E0A A;  2FS5 A;  2P6G A;  1B87 A;  5F48 A;  3W6S A;  3BJ7 A;  4PK2 A;  4M3S A;  3SHP A;  5CNP A;  2BL1 A;  2VI7 A;  3S6K A;  1XMT A;  1XF8 A;  5HH1 A;  3G8W A;  2FE7 A;  4H89 A;  1P0H A;  1XIX A;  1YVK A;  2ZW5 A;  3CXP A;  4AVC A;  2D4P A;  4XPD B;  2ARH A;  2VZY A;  4KOY A;  1QSO A;  4OLL A;  3S6F A;  4AG9 A;  1YR0 A;  4HNX B;  2FSR A;  4RS2 A;  2G0B A;  4U9Z A;  1M44 A;  2OB0 A;  1LRZ A;  4MY0 A;  2PC1 A;  3SXN A;  4MI4 A;  4CAW A;  1I1D A;  2JDD A;  2OZH A;  4HNW B;  1N71 A;  3R9G A;  3EY5 A;  3C26 A;  3B8G A;  1L0C A;  2I00 A;  4KLV A;  2B5G A;  2J8R A;  4AVA A;  5IX3 A;  5FVJ A;  4YFJ A;  2Q04 A;  3RYO A;  4NF1 A;  4R87 A;  4B5P B;  3TO6 A;  2Z11 A;  3IWG A;  3UY5 A;  1WWZ A;  2JDC A;  3VWE A;  3TT2 A;  4B5P A;  4QVT A;  4R57 A;  3OWC A;  2J8N A;  2GE3 A;  1QSN A;  3FXT A;  2ZXV A;  3TOB A;  1R57 A;  2HV2 A;  4F6A A;  3BLN A;  2VQY A;  3FRM A;  3R95 A;  3NE7 A;  1YVO A;  4XPD C;  4QUS A;  1M4G A;  5JPH A;  3FNC A;  3DR6 A;  4KLW A;  2RC4 A;  3EO4 A;  4PV6 A;  3F8K A;  3DDD A;  2ZW6 A;  4KOS A;  2C27 A;  1Q2C A;  2FL4 A;  4PSW A;  3D2M A;  4L89 A;  3SXO A;  1P4N A;  1Y9K A;  3TOA A;  4MY3 A;  2G3A A;  4JXQ A;  4AVB A;  2X7B A;  4HNY B;  1Q2D A;  2Y0M A;  2WPW A;  3CXQ A;  4L8A A;  2KCW A;  3PGP A;  3S6G A;  4NEX A;  2WPX A;  3TCV A;  2BSW A;  1IIC A;  3FYN A;  2BUE A;  2ATR A;  2VXK A;  4LX9 A;  3DNS A;  4KOV A;  3ZJ0 A;  2P6F A;  2PR8 A;  2Q4Y A;  4XNH B;  3BJ8 A;  3R1K A;  2B3V A;  5J8C A;  1ON0 A;  2HUZ A;  1J4J A;  3R96 A;  3D8P A;  3N7Z A;  3EXN A;  3F5B A;  1YRE A;  4UWI A;  4CAX A;  4U5Y A;  1K4J A;  5KTC A;  2O28 A;  5DWM A;  1XE4 A;  2PQ8 A;  4GS4 A;  4KVM E;  4E8O A;  1RO5 A;  3FB3 A;  1YGH A;  2A4N A;  2PSW A;  2EUI A;  3TTH A;  2OU2 A;  2B5G B;  2B4D B;  1TIQ A;  1Z9U A;  4CRZ B;  1I12 A;  1Y7R A;  3T9Y A;  5KTA A;  2FT0 A;  4UBR A;  4KUB A;  1BO4 A;  3E0K A;  1YLE A;  2B4D A;  3JUW A;  1NMT A;  3K9U A;  2Q7B A;  5ISV A;  2GIV A;  3R9F A;  2R8V A;  5F47 A;  4QBJ A;  1CM0 A;  4MBU A;  1MJB A;  4IF5 A;  3F0A A;  4XPL A;  4H6Z A;  2B4B A;  3D3S A;  4F0Y A;  4KVO E;  3I3G A;  2R7H A;  2P6E A;  4Y49 B;  2Q0Y A;  1MK4 A;  2I79 A;  4AG7 A;  5EC4 A;  2B58 A;  4QC6 A;  3R9E A;  2F5I A;  5KTD A;  5F46 A;  1IB1 E;  3TO7 A;  1IYL A;  4XNH C;  4E2A A;  4KVX A;  2OH1 A;  2H5M A;  3VWD A;  4R3K A;  5C82 A;  3FBU A;  4RI1 A;  1S7F A;  1YX0 A;  3QB8 A;  1M1D A;  4OAD A;  4II9 A;  2QML A;  4CS0 B;  1B6B A;  1XEB A;  4MHD A;  1QST A;  2OZU A;  2VZZ A;  1YK3 A;  5IV0 A;  4AB7 A;  4CAV A;  4H6U A;  1Z4E A;  2Q44 A;  1WK4 A;  2OZG A;  2R98 A;  3P2H A;  2B3U A;  4J3G A;  5HMN A;  2R1I A;  3TFY A;  1IID A;  3S6H A;  1MJA A;  5EBV A;  1MJ9 A;  4CRY B;  4QB9 A; 
#chains in the Genus database with same CATH topology
 3B3S A;  1KUV A;  2G9D A;  2CY2 A;  1M4D A;  3KI9 A;  2CNS A;  3SI2 A;  2C6C A;  3KKW A;  2O53 A;  3NH5 A;  4AXV A;  4BMH A;  3SJG A;  1DTD A;  4CGL A;  5IB0 A;  2YND A;  2ZEE A;  1Y9W A;  4U9Y A;  4M85 A;  1VHS A;  2Q4Z A;  2XEG A;  1ELM P;  3P2F A;  4YGO A;  1QSR A;  4KSF A;  4P4E A;  1M4I A;  1VKC A;  2Z3K A;  3T90 A;  1Z4R A;  4JJX A;  2DXQ A;  5HVF A;  3FIX A;  2GLJ A;  3QAY A;  4MCQ A;  4ORF A;  4NGR A;  2P0W A;  4NXY A;  4JWP A;  3EFA A;  4Y49 C;  2J8M A;  3PB8 X;  5I4M A;  4ZY0 A;  3PBE A;  2FIW A;  4MFK A;  3ZZI A;  4R3L A;  2ZED A;  3PFO A;  5J8F A;  4GXH A;  2WYR A;  4FWU A;  4W9Y A;  4A95 A;  4FD7 A;  4DNC A;  4UWJ A;  4B6Z A;  2BCO A;  2CNT A;  3PP9 A;  1Z8L A;  4NSQ A;  2BOA A;  1HDQ A;  1VGY A;  4KOW A;  2CF4 A;  3FEC A;  2JBK A;  2ZPA A;  2AJ6 A;  5E96 A;  4CGO A;  3I9S A;  4KOT A;  2Z3P A;  4XPK A;  2QEC A;  2HQY A;  4YRH A;  4LQ6 A;  1ZG9 A;  2K5T A;  4UA3 A;  2G3T A;  1NSL A;  1QSM A;  5DWN A;  1F2O A;  1S7L A;  4TWE A;  4IHM A;  4OKO A;  1S7N A;  3EC4 A;  4MCP A;  2GLF A;  4KOX A;  3RNZ A;  1EE3 P;  1TKF A;  4JD6 A;  4P4I A;  1TF9 A;  4B13 A;  5I0C A;  4UCN A;  2WSA A;  1GHE A;  1S5K A;  2FXF A;  1IYK A;  3GKR A;  4ZY2 A;  2EK9 A;  4CYP A;  4LUA A;  4BBH A;  5F09 A;  2JLM A;  5ELY A;  1BPN A;  5JQ4 A;  3IIB A;  4UF4 A;  3DR8 A;  4C7I A;  2FCK A;  2GU2 A;  3B3C A;  4UFX A;  2XEJ A;  4A39 A;  2PJ5 A;  1LAM A;  5F49 A;  2HC9 A;  1FT7 A;  3KZW A;  4FD4 A;  4P4B A;  4X2T A;  5IB9 A;  3DSB A;  2GAN A;  3H4Q A;  3PB6 X;  2Z0Z A;  3W6X A;  2BO9 A;  3TE4 A;  1KUX A;  4PSX A;  1FY7 A;  2BEI A;  2CIJ A;  3GY9 A;  4ONW A;  3JRU A;  4B5O A;  1XFO A;  2ZW7 A;  3D2P A;  3KQX A;  3FF3 A;  4FBE A;  3HUV A;  2REE A;  1DE4 C;  2PRQ A;  4UIA A;  1U6M A;  4OAE A;  3GYA A;  1Q2Y A;  2V8V A;  2AFX A;  4FD6 A;  1SQH A;  1CJW A;  5H86 A;  2Z10 A;  4IK2 A;  2XEI A;  4M6H A;  1YW6 A;  3IC1 A;  4NGN A;  2ZEL A;  3D4U A;  3PEI A;  3SJF A;  4P10 A;  2REF A;  3PB7 X;  1VIX A;  4PK3 A;  1TKJ A;  1VHO A;  3LOD A;  4PXB A;  4R76 A;  1ELL P;  2FVG A;  1IOF A;  1KZF A;  3MGD A;  1S60 A;  2QIR A;  3W91 A;  4OID A;  3FMC A;  5H84 A;  1PU9 A;  2PDO A;  4KOU A;  2EVN A;  3IGR A;  3CXS A;  4KSI A;  3TO9 A;  1YSJ A;  3VH9 A;  5C88 A;  2IMO A;  4ZBG A;  3KAS A;  2ZW4 A;  4MFQ A;  4MJ8 A;  4PXE A;  1X12 A;  2Q4V A;  4A37 A;  4X5K A;  4LQG A;  5K8N A;  1TXR A;  1ZLI A;  4DUK A;  4JLY A;  4F9U A;  4PPZ A;  1RXT A;  1I21 A;  1V0C A;  4A30 A;  3JVN A;  1NE9 A;  4HKF A;  4UCM A;  4UFV A;  4C68 A;  4DJL A;  2QJ8 A;  2JEV A;  1UFH A;  2I3C A;  4JXR A;  3V8I A;  4Q36 A;  3FVL A;  2AE6 A;  4NGP A;  3LD2 A;  4UEE A;  3NH4 A;  2PVV A;  3G3S A;  4A32 A;  1OBR A;  1Z8T A;  1JWQ A;  4K30 A;  3NH8 A;  1S3Z A;  5DS0 A;  3V7Z A;  4I49 A;  4KZT A;  1OZP A;  3H5Z A;  1GYT A;  1PUA A;  2YNE A;  3B35 A;  4Q38 A;  4NCZ A;  2HB6 A;  3WT4 A;  2VEZ A;  4CAE A;  1ZG8 A;  1S7K A;  4R9M A;  2QYV A;  2CNM A;  4FD5 A;  4KOR A;  2VBQ A;  1X10 A;  2ZEM A;  2PJ4 A;  3KR5 A;  2PJB A;  4R7M A;  2NMT A;  2FIA A;  3N5F A;  3D67 A;  4GM5 A;  4ONU A;  4MRI A;  1R3N A;  2PR1 A;  4OME A;  3WC6 A;  2D4O A;  3RZA A;  1KUY A;  3NA6 A;  4NJR A;  5GCN A;  2Z3O A;  4KUA A;  4OC4 A;  3WR7 A;  3QAH A;  5A27 A;  2IL4 A;  4EVY A;  4IUS A;  3D7D A;  3HLP A;  4EME A;  4H2K A;  5HVG A;  4OC3 A;  3PZJ A;  1BOB A;  2PRB A;  4CGP A;  4F0X A;  3JTK A;  1RTQ A;  4R8F A;  3RO0 A;  4ZX9 A;  3SJE A;  1KWM A;  4E0A A;  2FS5 A;  2P6G A;  3KL9 A;  1IU8 A;  1B87 A;  5F48 A;  3W6S A;  4UIB A;  3BJ7 A;  4PK2 A;  1QQ9 A;  4M3S A;  3V38 A;  4UCP A;  5K8M A;  3SHP A;  5CNP A;  4OP4 A;  1LFW A;  2Q7S A;  2V8H A;  2POK A;  2BL1 A;  3WAB A;  2VI7 A;  2EK8 A;  3FX6 A;  4ZX8 A;  3S6K A;  1XMT A;  1XF8 A;  3K2K A;  3BI1 A;  4CRY B;  4ZGY B;  5HH1 A;  3G8W A;  3KHZ A;  2FE7 A;  4H89 A;  1P0H A;  2XEF A;  1XIX A;  2PJ0 A;  3BXM A;  2YNC A;  5LRJ A;  3S9L A;  1YVK A;  1F2P A;  4X8I A;  1F57 A;  2ZW5 A;  5J1Q A;  3CXP A;  1LCP A;  2F8H A;  1YME A;  4YU9 A;  2ABZ A;  2PJ7 A;  4AVC A;  5HXD A;  3IFE A;  1YLO A;  3L2N A;  2D4P A;  4XPD B;  2AFU A;  1XOV A;  2ARH A;  2VZY A;  3CT9 A;  4MHP A;  1LOK A;  4KOY A;  1QSO A;  1IOI A;  4OLL A;  1HDU A;  3S6F A;  4AG9 A;  5JH9 A;  1YR0 A;  6CPA A;  4HNX B;  1Z8X A;  2FSR A;  5LYI A;  2IQ6 A;  4RS2 A;  4MFZ A;  2G0B A;  4EFD A;  2AFO A;  4C2X A;  1LAP A;  2PJ9 A;  1ARM A;  4U9Z A;  1IGB A;  3B2Y A;  1M44 A;  2OB0 A;  1LRZ A;  4C2Y A;  4Z65 A;  5A28 A;  4MY0 A;  2PC1 A;  5LYD A;  3SXN A;  4MFP A;  4MI4 A;  4CAW A;  1I1D A;  3CPX A;  2ZEP A;  3LMS A;  1AYE A;  4A31 A;  4EWT A;  3WC5 A;  2JDD A;  2OZH A;  4A38 A;  4HNW B;  1N71 A;  4NGS A;  4YWY A;  2Z3L A;  3D7F A;  4MCR A;  3R9G A;  1CG2 A;  3EY5 A;  4B12 A;  3C26 A;  3BI0 A;  3B8G A;  1L0C A;  2I00 A;  2GRE A;  4KLV A;  1VHE A;  5LYF A;  2EWB A;  2QVP A;  2B5G A;  2J8R A;  1Z2L A;  4AVA A;  2O4H A;  5IX3 A;  5FVJ A;  4YFJ A;  4FUU A;  5G1Z A;  1H8L A;  4OC1 A;  2JEW A;  1AMP A;  2Q04 A;  1R43 A;  5AGE A;  2DPS A;  3GIU A;  4M6I A;  2V8D A;  4NF1 A;  3RYO A;  4JZ0 A;  1CP6 A;  2RB7 A;  3IWE A;  4NJQ A;  4R87 A;  4B5P B;  3TO6 A;  2Z11 A;  7CPA A;  4RN7 A;  3PB9 X;  2CXA A;  2V77 A;  4NFR A;  4O23 A;  4OIW A;  4WJB A;  3IWG A;  3UY5 A;  1WWZ A;  2JDC A;  3VWE A;  4B10 A;  5HVH A;  3TT2 A;  4NGQ A;  1BLL E;  3H8F A;  5K8P A;  4B5P A;  2DEA A;  1JQG A;  3VAR A;  4QVT A;  4R57 A;  4UEF A;  2YNC C;  3OWC A;  2JBJ A;  3KHX A;  2J8N A;  2GE3 A;  1QSN A;  3FXT A;  2ZXV A;  3TOB A;  3FH4 A;  3DGV A;  4B14 A;  1R57 A;  2HV2 A;  5AG6 A;  3RAM A;  4F6A A;  3GLJ A;  3BLN A;  1HEE A;  2VQY A;  3FRM A;  2OR4 A;  4F8Z A;  4A2Z A;  2CTB A;  3R95 A;  2V8G A;  3NE7 A;  1Z5R A;  2PJA A;  1XJO A;  1YVO A;  4XPD C;  4CYQ A;  4ZY1 A;  4QUS A;  1M4G A;  2NYQ A;  3LWU A;  5JPH A;  3FNC A;  4IAV A;  1Y0R A;  3KQZ A;  3DR6 A;  4OC5 A;  4CYN A;  2ANP A;  4KLW A;  2RC4 A;  2PJ3 A;  3S9N A;  3EO4 A;  4PV6 A;  4CPA A;  3F8K A;  3B3T A;  3DDD A;  2ZW6 A;  4KOS A;  1CX8 A;  3IWW A;  4NGM A;  1Y0Y A;  2C27 A;  3CDX A;  3KR4 A;  1Q2C A;  2FL4 A;  3PB4 X;  4PSW A;  3D2M A;  4L89 A;  3SXO A;  4A33 A;  2PVW A;  1ZO0 A;  1P4N A;  1Y9K A;  3TOA A;  2ZEG A;  3D68 A;  2VL1 A;  2G3A A;  3A9L A;  4MY3 A;  3I1U A;  3GUX A;  4JXQ A;  3H8G A;  3RBU A;  1FNO A;  2X7B A;  4AVB A;  2EO8 A;  4HNY B;  1Q2D A;  4P4F A;  2Y0M A;  2WPW A;  5JGF A;  3CXQ A;  4L8A A;  2AFS A;  4R6T A;  2KCW A;  3PGP A;  3NE8 A;  3S9M A;  3S6G A;  5LYL A;  4MHZ A;  4NEX A;  4X3R A;  5LRG A;  2WPX A;  3TCV A;  2BSW A;  2ZEH A;  3B3V A;  1IIC A;  5K8O A;  3MN8 A;  3FYN A;  2BUE A;  2ATR A;  4BIN A;  2VXK A;  2ZEN A;  4LX9 A;  2PIY A;  3DNS A;  2PJ6 A;  4KOV A;  4MCS A;  4P4D A;  1IY7 A;  3ZJ0 A;  4CGN A;  3D7H A;  3D66 A;  2P6F A;  3BHX A;  2PR8 A;  1CBX A;  4ZYQ A;  2NSM A;  3SI0 A;  2Q4Y A;  2AFZ A;  2PJ2 A;  4XNH B;  3PBB A;  3BJ8 A;  2ZOF A;  3R1K A;  2B3V A;  2J9A A;  4MHN A;  4MFJ A;  5D29 A;  5J8C A;  3FED A;  1ON0 A;  2HUZ A;  3GB0 A;  1J4J A;  2ZOG A;  2RFH A;  1XMB A;  2Z3M A;  3D8P A;  3EXN A;  2ZEF A;  1YRE A;  2CTC A;  3F5B A;  3IU1 A;  3LAC A;  3N7Z A;  4PXC A;  4UWI A;  4CAX A;  4U5Y A;  1K4J A;  3CZX A;  1CPS A;  3ISX A;  5KTC A;  2ODF A;  3DLJ A;  2O28 A;  4P4J A;  5DWM A;  2DF5 A;  2Z3N A;  1XE4 A;  2EBJ A;  2PQ8 A;  4GS4 A;  4JYW A;  4KVM E;  4TNU A;  1RO5 A;  4E8O A;  3FB3 A;  1YGH A;  2A4N A;  4B11 A;  2PSW A;  4UFW A;  2EUI A;  1XBU A;  3TTH A;  2OU2 A;  4UEZ A;  2B5G B;  4OC0 A;  3ISZ A;  2B4D B;  4C2Z A;  4FAI A;  2YGW A;  1TIQ A;  1Z9U A;  3B3W A;  4CRZ B;  1I12 A;  5EMI A;  1A2Z A;  2PIZ A;  1Y7R A;  3T9Y A;  5KTA A;  2FT0 A;  4Q7A A;  3PRT A;  3MRU A;  4UBR A;  4KUB A;  1BO4 A;  3E0K A;  3SI1 A;  4A94 A;  2AFW A;  1YLE A;  2F7V A;  5D8N A;  2PJ1 A;  2AFM A;  3SJX A;  2B4D A;  3JUW A;  1NMT A;  2C6P A;  3IU2 A;  3K9U A;  4KSA A;  2Q7B A;  5AG4 A;  5ISV A;  2GIV A;  2PJC A;  4P44 A;  1UWY A;  2C1C A;  3R9F A;  5LRK A;  2R8V A;  4P6Y A;  5F47 A;  4DYO A;  3FEE A;  2Q43 A;  3TC8 A;  1AUG A;  3WC7 A;  4QBJ A;  4CGM A;  2C6G A;  3D7G A;  1CM0 A;  4KS9 A;  5G21 A;  4MBU A;  4CAF A;  1MJB A;  1CPX A;  1PCA A;  4IF5 A;  3K9T A;  2WZN A;  5THW A;  3F0A A;  4XPL A;  4H6Z A;  1YW4 A;  5G22 A;  2DPT A;  2B4B A;  3D3S A;  2GFQ A;  4C7H A;  1M4L A;  4KVO E;  4F0Y A;  3I3G A;  1ZG7 A;  2R7H A;  2P6E A;  4Y49 B;  1PYT B;  2PJ8 A;  2Q0Y A;  1QMU A;  3B7I A;  4CYO A;  4PQA A;  1MK4 A;  2I79 A;  3H8E A;  4P45 A;  4AG7 A;  5EC4 A;  5BWA B;  1LAN A;  2Q51 A;  2B58 A;  3CPA A;  4NGT A;  4QC6 A;  3R9E A;  2PCU A;  2F5I A;  5KTD A;  3T8W A;  3TX8 A;  5F46 A;  1IB1 E;  2PE3 A;  4RUH A;  3TO7 A;  1IYL A;  1CP7 A;  5CBM A;  4XNH C;  4E2A A;  4KVX A;  2OH1 A;  2H5M A;  4ZI6 A;  3VWD A;  4R3K A;  1BPM A;  4HPS A;  1TKH A;  5C82 A;  3FBU A;  3NFZ A;  4RI1 A;  4PXD A;  1S7F A;  3PFE A;  1YX0 A;  1YQE A;  3QB8 A;  4M6G A;  1BAV A;  4MXU A;  1M1D A;  4OAD A;  1ARL A;  4II9 A;  2QML A;  4CS0 B;  1B6B A;  1XEB A;  4G1P A;  3QNV A;  4MHD A;  1Z8W A;  1TF8 A;  4F9V A;  1QST A;  1Y7E A;  1XRY A;  2OZU A;  2VZZ A;  1YK3 A;  5IV0 A;  3IJ3 A;  4AB7 A;  4H6U A;  4CAV A;  8CPA A;  1Z4E A;  1ZLH A;  2Q44 A;  1WK4 A;  2OZG A;  2R98 A;  5AG7 A;  3P2H A;  1NSA A;  1Q7L A;  2OOT A;  2B3U A;  5AG5 A;  4J3G A;  5CPA A;  4MHY A;  4BD9 A;  5HMN A;  2R1I A;  5JM6 A;  3TFY A;  2IJZ A;  4MMO A;  1IID A;  3IO1 A;  4WWV A;  3S6H A;  4MFL A;  5G20 A;  3FJU A;  4K3N A;  3IEH A;  2ZEO A;  3KGQ A;  4OC2 A;  1MJA A;  5EBV A;  1MJ9 A;  3R96 A;  3VAT A;  4QB9 A;  2WUU A; 
#chains in the Genus database with same CATH homology
 1KUV A;  2CY2 A;  1M4D A;  2CNS A;  3KKW A;  4BMH A;  4CGL A;  5IB0 A;  2YND A;  1Y9W A;  4U9Y A;  4M85 A;  1VHS A;  3P2F A;  4YGO A;  1QSR A;  4KSF A;  1M4I A;  1VKC A;  2Z3K A;  3T90 A;  1Z4R A;  4JJX A;  2DXQ A;  3FIX A;  4ORF A;  2P0W A;  4NXY A;  4JWP A;  3EFA A;  4Y49 C;  2J8M A;  2FIW A;  4MFK A;  3ZZI A;  4R3L A;  5J8F A;  4A95 A;  4FD7 A;  4DNC A;  4UWJ A;  2CNT A;  3PP9 A;  4NSQ A;  4KOW A;  2ZPA A;  2AJ6 A;  5E96 A;  4CGO A;  3I9S A;  4KOT A;  2Z3P A;  4XPK A;  2QEC A;  2HQY A;  4YRH A;  4UA3 A;  2K5T A;  2G3T A;  1NSL A;  1QSM A;  5DWN A;  1S7L A;  1S7N A;  3EC4 A;  4KOX A;  4JD6 A;  4B13 A;  5I0C A;  4UCN A;  2WSA A;  1GHE A;  1S5K A;  2FXF A;  1IYK A;  3GKR A;  4CYP A;  4LUA A;  4BBH A;  5JQ4 A;  2JLM A;  3DR8 A;  4C7I A;  2FCK A;  4UFX A;  5F49 A;  4FD4 A;  3DSB A;  2GAN A;  3H4Q A;  3W6X A;  2Z0Z A;  3TE4 A;  1KUX A;  4PSX A;  1FY7 A;  2BEI A;  3GY9 A;  4B5O A;  3D2P A;  2ZW7 A;  2REE A;  1U6M A;  4OAE A;  3GYA A;  1Q2Y A;  4FD6 A;  1SQH A;  1CJW A;  5H86 A;  2Z10 A;  2REF A;  4PK3 A;  3LOD A;  1KZF A;  3MGD A;  1S60 A;  2QIR A;  3W91 A;  5H84 A;  1PU9 A;  2PDO A;  4KOU A;  2EVN A;  3IGR A;  3CXS A;  3TO9 A;  5C88 A;  4ZBG A;  2ZW4 A;  4MFQ A;  4MJ8 A;  2Q4V A;  4X5K A;  4JLY A;  1RXT A;  1I21 A;  1V0C A;  4A30 A;  3JVN A;  1NE9 A;  4HKF A;  4UCM A;  4UFV A;  4C68 A;  2JEV A;  1UFH A;  4JXR A;  3V8I A;  4Q36 A;  2AE6 A;  3LD2 A;  3G3S A;  4A32 A;  4K30 A;  1S3Z A;  4I49 A;  4KZT A;  1OZP A;  3H5Z A;  1PUA A;  2YNE A;  4CAE A;  4Q38 A;  4NCZ A;  2VEZ A;  4R9M A;  1S7K A;  2CNM A;  4FD5 A;  4KOR A;  2VBQ A;  2NMT A;  2FIA A;  4ONU A;  2PR1 A;  2D4O A;  1KUY A;  5GCN A;  2Z3O A;  4KUA A;  3WR7 A;  3QAH A;  5A27 A;  2IL4 A;  4EVY A;  4IUS A;  3PZJ A;  1BOB A;  2PRB A;  4CGP A;  4F0X A;  3JTK A;  4E0A A;  2FS5 A;  2P6G A;  1B87 A;  5F48 A;  3W6S A;  3BJ7 A;  4PK2 A;  4M3S A;  4UCP A;  3SHP A;  5CNP A;  2BL1 A;  2VI7 A;  3S6K A;  1XMT A;  1XF8 A;  4ZGY B;  5HH1 A;  3G8W A;  2FE7 A;  4H89 A;  1P0H A;  1XIX A;  2YNC A;  1YVK A;  2ZW5 A;  3CXP A;  4AVC A;  2D4P A;  4XPD B;  2ARH A;  2VZY A;  4KOY A;  1QSO A;  4OLL A;  3S6F A;  4AG9 A;  1YR0 A;  4HNX B;  2FSR A;  4RS2 A;  4MFZ A;  2G0B A;  4C2X A;  4U9Z A;  1M44 A;  2OB0 A;  1LRZ A;  4C2Y A;  5A28 A;  4MY0 A;  2PC1 A;  3SXN A;  4MFP A;  4MI4 A;  4CAW A;  1I1D A;  4A31 A;  2JDD A;  2OZH A;  4HNW B;  1N71 A;  2Z3L A;  3R9G A;  3EY5 A;  4B12 A;  3C26 A;  3B8G A;  1L0C A;  2I00 A;  4KLV A;  2B5G A;  2J8R A;  4AVA A;  5IX3 A;  5FVJ A;  4YFJ A;  5G1Z A;  2Q04 A;  5AGE A;  2DPS A;  3RYO A;  4NF1 A;  4R87 A;  3IWE A;  4B5P B;  3TO6 A;  2Z11 A;  2CXA A;  3IWG A;  3UY5 A;  1WWZ A;  2JDC A;  3VWE A;  4B10 A;  3TT2 A;  4B5P A;  4QVT A;  4R57 A;  2YNC C;  3OWC A;  2J8N A;  2GE3 A;  1QSN A;  3FXT A;  2ZXV A;  3TOB A;  4B14 A;  1R57 A;  2HV2 A;  5AG6 A;  4F6A A;  3BLN A;  2VQY A;  3FRM A;  4A2Z A;  3R95 A;  3NE7 A;  1YVO A;  4CYQ A;  4XPD C;  4QUS A;  1M4G A;  5JPH A;  3FNC A;  4CYN A;  3DR6 A;  4KLW A;  2RC4 A;  3EO4 A;  4PV6 A;  3F8K A;  3DDD A;  2ZW6 A;  4KOS A;  2C27 A;  1Q2C A;  2FL4 A;  4PSW A;  3D2M A;  4L89 A;  3SXO A;  4A33 A;  1ZO0 A;  1P4N A;  1Y9K A;  3TOA A;  4MY3 A;  2G3A A;  3A9L A;  4JXQ A;  4AVB A;  2X7B A;  4HNY B;  1Q2D A;  2Y0M A;  2WPW A;  3CXQ A;  4L8A A;  2KCW A;  3PGP A;  3S6G A;  4NEX A;  2WPX A;  3TCV A;  2BSW A;  1IIC A;  3FYN A;  2BUE A;  2ATR A;  2VXK A;  4LX9 A;  3DNS A;  4KOV A;  3ZJ0 A;  4CGN A;  2P6F A;  2PR8 A;  2Q4Y A;  4XNH B;  3BJ8 A;  3R1K A;  2B3V A;  4MFJ A;  5J8C A;  1ON0 A;  2HUZ A;  1J4J A;  2Z3M A;  3R96 A;  3D8P A;  3N7Z A;  3EXN A;  3F5B A;  1YRE A;  3IU1 A;  4UWI A;  4CAX A;  4U5Y A;  1K4J A;  5KTC A;  2O28 A;  5DWM A;  2Z3N A;  1XE4 A;  2PQ8 A;  4GS4 A;  4KVM E;  4E8O A;  1RO5 A;  3FB3 A;  1YGH A;  2A4N A;  4B11 A;  2PSW A;  4UFW A;  2EUI A;  3TTH A;  2OU2 A;  2B5G B;  2B4D B;  4C2Z A;  2YGW A;  1TIQ A;  1Z9U A;  4CRZ B;  1I12 A;  1Y7R A;  3T9Y A;  5KTA A;  2FT0 A;  4UBR A;  4KUB A;  1BO4 A;  3E0K A;  1YLE A;  2B4D A;  3JUW A;  1NMT A;  3IU2 A;  3K9U A;  4KSA A;  2Q7B A;  5AG4 A;  5ISV A;  2GIV A;  3R9F A;  2R8V A;  5F47 A;  4QBJ A;  4CGM A;  1CM0 A;  4KS9 A;  5G21 A;  4MBU A;  4CAF A;  1MJB A;  4IF5 A;  3F0A A;  4XPL A;  4H6Z A;  5G22 A;  2DPT A;  2B4B A;  3D3S A;  4C7H A;  4F0Y A;  4KVO E;  3I3G A;  2R7H A;  2P6E A;  4Y49 B;  2Q0Y A;  4CYO A;  1MK4 A;  2I79 A;  4AG7 A;  5EC4 A;  5BWA B;  2B58 A;  4QC6 A;  3R9E A;  2F5I A;  5KTD A;  5F46 A;  1IB1 E;  3TO7 A;  1IYL A;  4XNH C;  4E2A A;  4KVX A;  2OH1 A;  2H5M A;  3VWD A;  4R3K A;  5C82 A;  3FBU A;  4RI1 A;  1S7F A;  1YX0 A;  3QB8 A;  1M1D A;  4OAD A;  4II9 A;  2QML A;  4CS0 B;  1B6B A;  1XEB A;  4MHD A;  1QST A;  2OZU A;  2VZZ A;  1YK3 A;  5IV0 A;  4AB7 A;  4CAV A;  4H6U A;  1Z4E A;  2Q44 A;  1WK4 A;  2OZG A;  2R98 A;  5AG7 A;  3P2H A;  2B3U A;  5AG5 A;  4J3G A;  5HMN A;  2R1I A;  3TFY A;  1IID A;  3S6H A;  4MFL A;  5G20 A;  1MJA A;  5EBV A;  1MJ9 A;  4CRY B;  4QB9 A;  2WUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...