2B58A

Ssat with coa_sp, spermine disordered, k26r mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
167
structure length
167
Chain Sequence
FVIRPATAADCSDILRLIKELARYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 1
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 36
structure length 167
sequence length 167
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b58A00
2PSWA 2BL1A 3D8PA 4H89A 4KVME 4QUSA 1I21A 4II9A 1U6MA 2PQ8A 3TOBA 5F47A 1KZFA 1CJWA 2CNTA 2HQYA 4H6ZA 1M1DA 2B58A 5C88A 5J8CA 2GE3A 3FXTA 2B5GA 2P6EA 2PR1A 2JLMA 1KUVA 3JVNA 2ZXVA 2B4BA 4MY0A 4OADA 2J8RA 4OLLA 1R57A 3F8KA 3QAHA 4R9MA 4UWJA 3R1KA 2O28A 5CNPA 2G0BA 4Y49C 3IGRA 5KTCA 4GS4A 4KOYA 1QSRA 3W6SA 2FIAA 1TIQA 2ZW5A 4JWPA 4KLWA 1N71A 2VI7A 4QC6A 4CAVA 4KUBA 1Y9WA 4Y49B 5C82A 2FSRA 1J4JA 2Z11A 3TCVA 2X7BA 5F48A 2RC4A 3B8GA 4UBRA 1UFHA 3EFAA 4L8AA 2WPWA 1S60A 1RXTA 3R9GA 4KOTA 3TO7A 2OZUA 3S6FA 1MJ9A 4PV6A 3PZJA 1XIXA 3JUWA 5HH1A 5GCNA 2R98A 4KVXA 3DSBA 5F49A 3WR7A 2AE6A 3FNCA 3PGPA 4RI1A 4E0AA 3S6HA 1ON0A 4U9ZA 2KCWA 2R7HA 2REFA 2CY2A 3EXNA 1L0CA 3V8IA 4EVYA 5IB0A 4R87A 1S7LA 1VHSA 1IIDA 3BLNA 4F6AA 3FBUA 4DNCA 2GIVA 2FE7A 5H86A 3TO6A 4MI4A 3N7ZA 2Q4VA 1Q2DA 1QSMA 1Z9UA 3OWCA 3DDDA 3SHPA 4U9YA 5FVJA 4FD5A 4AG7A 1M4IA 4B5OA 2G3AA 4NF1A 4KOUA 3CXSA 2Q7BA 2HV2A 5ISVA 2B4DB 2DXQA 3TFYA 2VBQA 3F5BA 3FIXA 4ZBGA 2JEVA 1BOBA 4HNXB 3QB8A 3T90A 1B6BA 4XPDC 3TE4A 4HKFA 1YX0A 2F5IA 2C27A 1S3ZA 1Z4RA 4MHDA 2PR8A 1OZPA 1SQHA 3S6KA 1XEBA 4K30A 2R1IA 1YK3A 4YFJA 4HNWB 1QSTA 3P2HA 5HMNA 4RS2A 3R95A 1M44A 3CXPA 1K4JA 5F46A 2B4DA 2CNMA 4NEXA 4XPDB 3SXNA 1WK4A 2P6FA 2FIWA 3R9FA 3PP9A 1YREA 5E96A 1IYLA 3GYAA 1MJAA 3TO9A 5EBVA 3BJ8A 5KTAA 4KOXA 2EVNA 2QMLA 4J3GA 2IL4A 2ZW6A 4R57A 4AB7A 1Y9KA 3G8WA 3IWGA 5JQ4A 4AVAA 2NMTA 1IYKA 1YVOA 2REEA 4QBJA 5H84A 4XNHB 4M85A 4IUSA 2Z0ZA 2OU2A 4MBUA 3KKWA 4R3KA 1WWZA 1Q2CA 1I12A 2FXFA 3TOAA 4FD6A 3D2PA 2PRBA 4JXQA 3DR8A 2PC1A 3RYOA 5J8FA 1M4GA 4ONUA 1Y7RA 3VWDA 3I3GA 3FYNA 2BEIA 3GY9A 2VEZA 1YVKA 4B5PB 3T9YA 4U5YA 1BO4A 4F0YA 2WPXA 3I9SA 2QECA 2K5TA 2Q4YA 4PK2A 4YGOA 4LX9A 1LRZA 2Z10A 1P0HA 1S7KA 2OB0A 3R9EA 2FL4A 1YLEA 3D3SA 4UWIA 2H5MA 1M4DA 4KZTA 3P2FA 1QSOA 2VXKA 4FD4A 4CS0B 2GANA 1XE4A 3W91A 1IB1E 2P0WA 3LD2A 1S7FA 2Y0MA 1Q2YA 4B5PA 4CAXA 2I79A 4AVBA 2BSWA 5JPHA 1PU9A 4QB9A 1MJBA 4NCZA 5DWMA 4CRYB 3EO4A 4XPLA 2JDCA 3W6XA 1YGHA 1QSNA 4L89A 3MGDA 4E2AA 2ARHA 2ZPAA 5I0CA 3H4QA 1B87A 4ORFA 4KOSA 4QVTA 2VQYA 2B3VA 4JJXA 3LODA 4MJ8A 4OAEA 4R3LA 4YRHA 4E8OA 3D2MA 2FS5A 2ZW4A 2JDDA 2A4NA 4XNHC 4AG9A 2PDOA 5IV0A 3ZZIA 4KUAA 4HNYB 2J8NA 2ZW7A 2B3UA 4KLVA 3FB3A 2Q0YA 3S6GA 3EC4A 4LUAA 2G3TA 1KUXA 2AJ6A 4KVOE 2VZYA 1RO5A 3TT2A 1Z4EA 2J8MA 3FRMA 1MK4A 4PSXA 3ZJ0A 1XF8A 1VKCA 3SXOA 1IICA 4IF5A 4BMHA 2FT0A 3G3SA 5IX3A 4X5KA 2ATRA 5KTDA 3R96A 4UA3A 2OZHA 1XMTA 4CRZB 4NXYA 2BUEA 1YR0A 4CAWA 2VZZA 4NSQA 1GHEA 1I1DA 2I00A 3TTHA 1NMTA 3C26A 1P4NA 1NSLA 4XPKA 4H6UA 4PK3A 1KUYA 2OH1A 2EUIA 3BJ7A 2D4OA 4FD7A 2D4PA 1PUAA 5EC4A 2HUZA 1NE9A 3EY5A 1FY7A 5DWNA 3UY5A 4KOWA 2QIRA 3NE7A 3CXQA 3F0AA 3DNSA 4KORA 4JLYA 4PSWA 4I49A 4AVCA 2Q44A 3VWEA 3K9UA 1CM0A 3E0KA 4M3SA 4MY3A 1V0CA 4JD6A 2OZGA 2B5GB 4KOVA 1S5KA 2P6GA 2CNSA 1S7NA 2R8VA 2Q04A 2FCKA 4JXRA 3DR6A 3GKRA
chains in the Genus database with same CATH superfamily
4M6GA 2PSWA 2ZELA 1ZG7A 2BL1A 5G22A 3CPAA 5CBMA 3D8PA 4H89A 2JBJA 4KVME 3V38A 3NH4A 4QUSA 1I21A 1BPMA 5LRGA 5K8PA 1U6MA 3PBEA 2PQ8A 3KHXA 4NGPA 4II9A 4ZY1A 3TOBA 5F47A 1KZFA 5HXDA 1CJWA 2CNTA 2C6GA 2Z3MA 2HQYA 5I4MA 4H6ZA 1M1DA 4PXEA 2B58A 5C88A 5J8CA 2GE3A 3FXTA 3MN8A 2B5GA 2P6EA 4UEEA 2PR1A 1UWYA 3WC5A 4WWVA 4BBHA 1IU8A 2YNDA 1KWMA 2JLMA 4UEFA 1KUVA 2PJ7A 3JVNA 2ZXVA 2B4BA 3GIUA 2PJBA 4MY0A 1IOFA 2J8RA 2PVWA 2QVPA 4OADA 1R57A 3F8KA 3QAHA 4OLLA 4R9MA 4UWJA 3R1KA 5JGFA 2XEFA 2O28A 1XOVA 3B3CA 4OP4A 5CNPA 2G0BA 5F09A 3KHZA 4CYNA 2AFXA 2PJ2A 1RTQA 3BXMA 3WC6A 4Y49C 4ZGYB 3SI2A 4CGNA 3IGRA 5KTCA 4GS4A 1CPXA 1QSRA 4KOYA 4OIWA 2V77A 3W6SA 2IJZA 2FIAA 2PCUA 1TIQA 2OOTA 2ZW5A 4P10A 2YNCA 4IAVA 4CGMA 2CIJA 3LACA 4JWPA 4KLWA 1N71A 1PCAA 3KR4A 2VI7A 4QC6A 4NFRA 4CAVA 2O4HA 2ZOFA 4KUBA 2ZOGA 1Y9WA 4M6IA 4Y49B 4UIAA 5C82A 3CT9A 3K2KA 6CPAA 2GREA 2FSRA 1J4JA 2Z11A 3PFEA 3TCVA 1QMUA 5G1ZA 2X7BA 4DYOA 5F48A 3I1UA 2RC4A 3B8GA 3FF3A 4UBRA 3FJUA 1UFHA 3EFAA 4L8AA 4UFWA 2PJ0A 1R43A 3TX8A 1IGBA 1OBRA 2WPWA 3ISXA 4MHPA 4P4JA 1JWQA 1S60A 2C1CA 3KI9A 1RXTA 4UFVA 3R9GA 1AUGA 4KOTA 3B35A 3TO7A 4F9UA 2OZUA 2Q7SA 1YSJA 3S6FA 1MJ9A 5EMIA 4PV6A 3PZJA 1XIXA 3JUWA 5HH1A 5GCNA 2R98A 4KVXA 1X12A 3DSBA 3QNVA 2PJAA 5F49A 5HVFA 3WR7A 4A33A 2AE6A 4IHMA 2PJ8A 1AMPA 4OC5A 1TF8A 4H2KA 1Z2LA 3FNCA 3PGPA 4RI1A 3H8GA 4E0AA 4OC1A 3S6HA 1ON0A 4DUKA 4U9ZA 2POKA 3FEEA 2ZEHA 2KCWA 2R7HA 1XRYA 2REFA 1F57A 2CY2A 1F2PA 3EXNA 1L0CA 3V8IA 2IMOA 4EVYA 2AFOA 2V8DA 4F0XA 4R87A 4X2TA 1S7LA 5IB0A 2PE3A 1VHSA 3D7DA 1IIDA 1TKJA 3BLNA 1ELMP 4KS9A 4F6AA 2Q43A 3FBUA 4OKOA 4MFLA 2GIVA 1BAVA 4CYPA 2FE7A 4DNCA 1ARLA 5H86A 4MFPA 3TO6A 3D68A 4BINA 2DPSA 3H5ZA 3N7ZA 4MI4A 2Q4VA 1Y7EA 1Q2DA 1QSMA 1Y0YA 1Z9UA 2PJ4A 3OWCA 2AFMA 3DDDA 3SHPA 3PB4X 4R6TA 4U9YA 4TNUA 5FVJA 2RB7A 4FD5A 4AG7A 1M4IA 1EE3P 2G3AA 3FECA 4O23A 4NF1A 4B5OA 3SJXA 5HVGA 4KOUA 3IC1A 4P4DA 3CXSA 2Q7BA 3IFEA 2EO8A 2HV2A 5ISVA 2B4DB 3IWWA 1VHOA 2DXQA 3KL9A 4P4FA 3TFYA 3PB9X 2VBQA 5BWAB 3F5BA 3FIXA 3KR5A 4LQ6A 4ZBGA 2XEJA 3IO1A 3IU1A 4GXHA 2JEVA 1ZO0A 1BOBA 1H8LA 3KQXA 4HNXB 4NGNA 3QB8A 4Q36A 3T90A 1Z8TA 1B6BA 4XPDC 3TE4A 3NH5A 4HKFA 1YX0A 4JXRA 2F5IA 2ABZA 2C27A 1S3ZA 3GKRA 2Z3LA 3T8WA 1Z4RA 4MHDA 5LYIA 2PR8A 1OZPA 1YMEA 1SQHA 3JRUA 3S6KA 1XEBA 4K30A 2R1IA 1YK3A 4YFJA 4HNWB 4M6HA 4UEZA 4UIBA 1QSTA 2C6PA 3P2HA 5HMNA 1Z5RA 5JH9A 4RS2A 3R95A 1ZLHA 3PB7X 3A9LA 1M44A 3CXPA 1K4JA 5F46A 2B4DA 4CAEA 2CNMA 2I3CA 4NEXA 4XPDB 3SXNA 3TC8A 5IB9A 5J1QA 1DE4C 4B11A 4OIDA 3IIBA 3FMCA 1WK4A 2P6FA 3MRUA 3WABA 5K8OA 2PJ6A 4PPZA 4AXVA 2FIWA 3R9FA 3PP9A 4C2YA 1YREA 2BCOA 2O53A 2GU2A 2PJ9A 5E96A 1IYLA 3GYAA 1MJAA 3TO9A 2GFQA 4CAFA 4ONWA 3VH9A 4MHZA 5EBVA 3BJ8A 1IOIA 4B13A 5KTAA 4KOXA 2EVNA 2DEAA 4UF4A 2F7VA 1XBUA 2QMLA 2C6CA 1R3NA 4PXBA 5K8NA 3NFZA 4A38A 4J3GA 2IL4A 2ZW6A 3GUXA 3KGQA 3PRTA 5HVHA 4Q7AA 4R57A 4AB7A 3IJ3A 1Y9KA 4CGLA 3G8WA 3IWGA 2AFWA 5JQ4A 4AVAA 2NMTA 2CTBA 2ZEMA 1IYKA 1YVOA 2REEA 4QBJA 2PJCA 2V8GA 2ZEDA 5AG4A 1VGYA 5H84A 4G1PA 3LMSA 4XNHB 1CP7A 3SJFA 3KASA 3FVLA 4M85A 4IUSA 2Z0ZA 2PIZA 2OU2A 4FAIA 4A32A 2Q51A 4RN7A 4C2ZA 3RZAA 4R8FA 1Z8WA 3LWUA 4MBUA 1ZG9A 3KKWA 3HUVA 1CP6A 4R3KA 4NJQA 3D7GA 2F8HA 1WWZA 1Q2CA 4A39A 1I12A 4KSFA 2FXFA 2HB6A 1TXRA 3TOAA 4CPAA 4OC2A 4W9YA 2AFSA 2WSAA 4FD6A 3D2PA 3B3WA 2BO9A 1YQEA 1XMBA 4B6ZA 2PRBA 4JXQA 2HC9A 3IEHA 4NGTA 3DR8A 2PC1A 3RYOA 5J8FA 1M4GA 4ONUA 1Y7RA 3BI1A 5LRJA 2ZENA 3VWDA 3I3GA 3FYNA 2BEIA 3GY9A 2VEZA 4UCMA 1FT7A 1Y0RA 1YVKA 3NH8A 3VARA 4B5PB 1HDUA 3D4UA 5AG7A 4EFDA 3ISZA 3T9YA 4U5YA 3D7HA 4TWEA 4P4IA 4IK2A 1BO4A 1TKHA 4F0YA 2NYQA 3S9NA 1GYTA 2WPXA 2QECA 3I9SA 4FWUA 2K5TA 2Q4YA 3PFOA 2CF4A 4PK2A 4YGOA 1QQ9A 4LX9A 1LRZA 4NGRA 3SI0A 2Z10A 1P0HA 3CPXA 3PB8X 1S7KA 2OB0A 3KQZA 4WJBA 3R9EA 2FL4A 1YLEA 3D3SA 4UWIA 2H5MA 2JEWA 1M4DA 2Z3OA 4KZTA 4P6YA 4P45A 3P2FA 4CYOA 3SJGA 1QSOA 5G21A 2VXKA 4FD4A 4NJRA 7CPAA 1XJOA 2PJ1A 4CS0B 1FNOA 4NGSA 5THWA 2GANA 5A27A 1XE4A 4UFXA 3S9LA 4MMOA 3W91A 4EMEA 1IB1E 2P0WA 3LD2A 5D29A 4ZYQA 1S7FA 4MHYA 2Y0MA 1Q2YA 4MCRA 4B5PA 4CAXA 2I79A 2RFHA 3BI0A 4MFQA 4AVBA 1ZG8A 1HEEA 5LYFA 2BSWA 5JPHA 2XEIA 1YW6A 2BOAA 1PU9A 4R7MA 1X10A 1TF9A 4QB9A 2G9DA 4UCPA 1MJBA 4KSIA 4NGMA 2YNEA 2DPTA 3B3SA 4ZX8A 4NCZA 4YU9A 4X3RA 5DWMA 4CRYB 3EO4A 3CZXA 2JDCA 4XPLA 3H8EA 3W6XA 4C7HA 1YGHA 1QSNA 4GM5A 4L89A 3MGDA 5AG5A 4E2AA 4C7IA 4K3NA 5LYLA 4HPSA 5D8NA 2ARHA 4B12A 2ZPAA 4B14A 4PXCA 5I0CA 3H4QA 4OC3A 1B87A 4KSAA 2NSMA 4ORFA 4ZI6A 2XEGA 1F2OA 4KOSA 4QVTA 2DF5A 3IU2A 1LOKA 2VQYA 4B10A 3RNZA 5JM6A 4CGPA 2B3VA 1LAMA 2EBJA 4Z65A 4JJXA 3LODA 4MJ8A 4OAEA 2ZEEA 4LQGA 4R3LA 3RBUA 4YRHA 4E8OA 3FX6A 3D2MA 4OMEA 2FS5A 2ZW4A 2JDDA 1BPNA 3HLPA 1LAPA 2A4NA 4XNHC 1YLOA 4AG9A 4OC4A 2PDOA 4CYQA 4PQAA 5IV0A 1LANA 3SJEA 5ELYA 3ZZIA 2ANPA 1ELLP 1Q7LA 2JBKA 4KUAA 4HNYB 2V8VA 1IY7A 4PXDA 3B3VA 4MXUA 3B3TA 8CPAA 2J8NA 1CG2A 4A94A 4C68A 2ZW7A 2B3UA 4KLVA 2ZEFA 3FB3A 3FH4A 2Q0YA 5AG6A 3DGVA 3JTKA 4ZY2A 1M4LA 2Z3KA 3EC4A 4LUAA 5G20A 3S6GA 2G3TA 2PIYA 1KUXA 2AJ6A 3VATA 1VHEA 2ZEGA 4KVOE 3S9MA 2QJ8A 4MCSA 2VZYA 4MCPA 2ZEPA 1RO5A 3TT2A 3RO0A 4DJLA 2GLJA 2EK9A 3WT4A 1Z4EA 4MFZA 2J8MA 3FRMA 3GLJA 1MK4A 2WYRA 2CTCA 4PSXA 2WUUA 3ZJ0A 1A2ZA 4EWTA 3SI1A 1XF8A 1VKCA 2ZEOA 4R76A 1JQGA 4YWYA 3SXOA 4OC0A 2AFZA 3FEDA 4Q38A 1IICA 2OR4A 4IF5A 1XFOA 3RAMA 4BMHA 4FBEA 2FT0A 2IQ6A 3GB0A 1YW4A 3G3SA 4RUHA 5IX3A 4X5KA 2ATRA 5KTDA 2AFUA 4ZY0A 3R96A 1BLLE 2EK8A 4P44A 1VIXA 2OZHA 4UA3A 2WZNA 4C2XA 4ZX9A 4A31A 3L2NA 3V7ZA 1XMTA 4A37A 4CRZB 4NXYA 2BUEA 1YR0A 4CAWA 2VZZA 4NSQA 4F9VA 2PVVA 5LRKA 3D67A 5AGEA 1GHEA 1I1DA 1NSAA 3BHXA 1Z8LA 1HDQA 2I00A 1ARMA 2CXAA 4A30A 3PBBA 4X8IA 4CGOA 3TTHA 1NMTA 3C26A 2V8HA 1Z8XA 1DTDA 1P4NA 4JZ0A 4XPKA 4H6UA 1NSLA 2Z3NA 2YGWA 4A2ZA 4PK3A 3WC7A 1KUYA 2OH1A 2EUIA 3BJ7A 2D4OA 4FD7A 1AYEA 5DS0A 2D4PA 1PUAA 5EC4A 1LCPA 2HUZA 1NE9A 1ZLIA 3CDXA 3N5FA 5CPAA 3H8FA 1CPSA 3EY5A 2VL1A 1FY7A 5DWNA 3UY5A 3D66A 4FUUA 1CBXA 3DR6A 4JYWA 4KOWA 4NGQA 2QIRA 3NE7A 3CXQA 3F0AA 3DNSA 4P4BA 1CX8A 4MFJA 5A28A 4KORA 2EWBA 4JLYA 4PSWA 2ODFA 4UCNA 4I49A 4AVCA 3B7IA 5LYDA 2Q44A 3NE8A 3VWEA 3K9UA 4MCQA 1CM0A 3E0KA 4M3SA 4MY3A 1V0CA 3D7FA 3K9TA 2Z3PA 4JD6A 2PJ5A 2OZGA 2Q4ZA 1TKFA 2J9AA 1PYTB 3NA6A 1LFWA 4A95A 3B2YA 3PB6X 2B5GB 4MHNA 4P4EA 3QAYA 4BD9A 3DLJA 4KOVA 4MRIA 2PRQA 1S5KA 2P6GA 2PJ3A 5K8MA 3PEIA 4MFKA 2YNCC 2CNSA 1S7NA 2R8VA 3KZWA 3IWEA 2Q04A 2FCKA 2GLFA 2FVGA 2QYVA 4F8ZA
chains in the Genus database with same CATH topology
2PSWA 2BL1A 5G22A 3D8PA 4H89A 4KVME 4QUSA 1I21A 4II9A 1U6MA 2PQ8A 3TOBA 5F47A 1KZFA 1CJWA 2CNTA 2Z3MA 2HQYA 4H6ZA 1M1DA 2B58A 5C88A 5J8CA 2GE3A 3FXTA 2B5GA 2P6EA 2PR1A 4BBHA 2YNDA 2JLMA 1KUVA 3JVNA 2ZXVA 2B4BA 4MY0A 4OADA 2J8RA 4OLLA 1R57A 3F8KA 3QAHA 4R9MA 4UWJA 3R1KA 2O28A 5CNPA 2G0BA 4CYNA 4Y49C 4ZGYB 4CGNA 3IGRA 5KTCA 4GS4A 4KOYA 1QSRA 3W6SA 2FIAA 1TIQA 2ZW5A 2YNCA 4CGMA 4JWPA 4KLWA 1N71A 2VI7A 4QC6A 4CAVA 4KUBA 1Y9WA 4Y49B 5C82A 2FSRA 1J4JA 2Z11A 3TCVA 5G1ZA 2X7BA 5F48A 2RC4A 3B8GA 4UBRA 1UFHA 3EFAA 4L8AA 4UFWA 2WPWA 1S60A 1RXTA 4UFVA 3R9GA 4KOTA 3TO7A 2OZUA 3S6FA 1MJ9A 4PV6A 3PZJA 1XIXA 3JUWA 5HH1A 5GCNA 2R98A 4KVXA 3DSBA 5F49A 4A33A 3WR7A 2AE6A 3FNCA 3PGPA 4RI1A 4E0AA 3S6HA 1ON0A 4U9ZA 2KCWA 2R7HA 2REFA 2CY2A 3EXNA 1L0CA 3V8IA 4EVYA 4F0XA 5IB0A 4R87A 1S7LA 1VHSA 1IIDA 3BLNA 4KS9A 4F6AA 3FBUA 4CYPA 4MFLA 2GIVA 4DNCA 2FE7A 5H86A 4MFPA 3TO6A 2DPSA 3H5ZA 3N7ZA 4MI4A 2Q4VA 1Q2DA 1QSMA 1Z9UA 3OWCA 3DDDA 3SHPA 4U9YA 5FVJA 4FD5A 4AG7A 1M4IA 4B5OA 2G3AA 4NF1A 4KOUA 3CXSA 2Q7BA 2HV2A 5ISVA 2B4DB 2DXQA 3TFYA 2VBQA 5BWAB 3F5BA 3FIXA 4ZBGA 3IU1A 2JEVA 1ZO0A 1BOBA 4HNXB 3QB8A 4Q36A 3T90A 1B6BA 4XPDC 3TE4A 4HKFA 1YX0A 2F5IA 2C27A 1S3ZA 2Z3LA 1Z4RA 4MHDA 2PR8A 1OZPA 1SQHA 3S6KA 1XEBA 4K30A 2R1IA 1YK3A 4YFJA 4HNWB 1QSTA 3P2HA 5HMNA 4RS2A 3R95A 3A9LA 1M44A 3CXPA 1K4JA 5F46A 2B4DA 4CAEA 2CNMA 4NEXA 4XPDB 3SXNA 4B11A 1WK4A 2P6FA 2FIWA 3R9FA 3PP9A 4C2YA 1YREA 5E96A 1IYLA 3GYAA 1MJAA 3TO9A 4CAFA 5EBVA 3BJ8A 4B13A 5KTAA 4KOXA 2EVNA 2QMLA 4J3GA 2IL4A 2ZW6A 4R57A 4AB7A 1Y9KA 4CGLA 3G8WA 3IWGA 5JQ4A 4AVAA 2NMTA 1IYKA 1YVOA 2REEA 4QBJA 5AG4A 5H84A 4XNHB 4M85A 4IUSA 2Z0ZA 2OU2A 4A32A 4C2ZA 4MBUA 3KKWA 4R3KA 1WWZA 1Q2CA 1I12A 4KSFA 2FXFA 3TOAA 2WSAA 4FD6A 3D2PA 2PRBA 4JXQA 3DR8A 2PC1A 3RYOA 5J8FA 1M4GA 4ONUA 1Y7RA 3VWDA 3I3GA 3FYNA 2BEIA 3GY9A 2VEZA 4UCMA 1YVKA 4B5PB 5AG7A 3T9YA 4U5YA 1BO4A 4F0YA 2WPXA 3I9SA 2QECA 2K5TA 2Q4YA 4PK2A 4YGOA 4LX9A 1LRZA 2Z10A 1P0HA 1S7KA 2OB0A 3R9EA 2FL4A 1YLEA 3D3SA 4UWIA 2H5MA 1M4DA 2Z3OA 4KZTA 3P2FA 4CYOA 1QSOA 5G21A 2VXKA 4FD4A 4CS0B 2GANA 5A27A 1XE4A 4UFXA 3W91A 1IB1E 2P0WA 3LD2A 1S7FA 2Y0MA 1Q2YA 4B5PA 4CAXA 2I79A 4MFQA 4AVBA 2BSWA 5JPHA 1PU9A 4QB9A 4UCPA 1MJBA 2YNEA 2DPTA 4NCZA 5DWMA 4CRYB 3EO4A 4XPLA 2JDCA 3W6XA 4C7HA 1YGHA 1QSNA 4L89A 3MGDA 5AG5A 4E2AA 4C7IA 4B12A 2ARHA 4B14A 2ZPAA 5I0CA 3H4QA 1B87A 4KSAA 4ORFA 4KOSA 4QVTA 3IU2A 2VQYA 4B10A 4CGPA 2B3VA 4JJXA 3LODA 4MJ8A 4OAEA 4R3LA 4YRHA 4E8OA 3D2MA 2FS5A 2ZW4A 2JDDA 2A4NA 4XNHC 4AG9A 2PDOA 4CYQA 5IV0A 3ZZIA 4KUAA 4HNYB 2J8NA 4C68A 2ZW7A 2B3UA 4KLVA 3FB3A 2Q0YA 5AG6A 3JTKA 3S6GA 2Z3KA 3EC4A 4LUAA 5G20A 2G3TA 1KUXA 2AJ6A 4KVOE 2VZYA 1RO5A 3TT2A 1Z4EA 4MFZA 2J8MA 3FRMA 1MK4A 4PSXA 2WUUA 3ZJ0A 1XF8A 1VKCA 3SXOA 4Q38A 1IICA 4IF5A 4BMHA 2FT0A 3G3SA 5IX3A 4X5KA 2ATRA 5KTDA 3R96A 4UA3A 2OZHA 4C2XA 4A31A 1XMTA 4CRZB 4NXYA 2BUEA 1YR0A 4CAWA 2VZZA 4NSQA 5AGEA 1GHEA 1I1DA 2I00A 2CXAA 4A30A 4CGOA 3TTHA 1NMTA 3C26A 1P4NA 1NSLA 4XPKA 4H6UA 2Z3NA 2YGWA 4A2ZA 4PK3A 1KUYA 2OH1A 2EUIA 3BJ7A 2D4OA 4FD7A 2D4PA 1PUAA 5EC4A 2HUZA 1NE9A 3EY5A 1FY7A 5DWNA 3UY5A 4KOWA 2QIRA 3NE7A 3CXQA 3F0AA 3DNSA 4MFJA 5A28A 4KORA 4JLYA 4PSWA 4UCNA 4I49A 4AVCA 2Q44A 3VWEA 3K9UA 1CM0A 3E0KA 4M3SA 4MY3A 1V0CA 4JD6A 2Z3PA 2OZGA 4A95A 2B5GB 4KOVA 1S5KA 2P6GA 4MFKA 2YNCC 2CNSA 1S7NA 2R8VA 3IWEA 2Q04A 2FCKA 4JXRA 3DR6A 3GKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PSW A;  2BL1 A;  3D8P A;  4H89 A;  4KVM E;  4QUS A;  1I21 A;  4II9 A;  1U6M A;  2PQ8 A;  3TOB A;  5F47 A;  1KZF A;  1CJW A;  2CNT A;  2HQY A;  4H6Z A;  1M1D A;  2B58 A;  5C88 A;  5J8C A;  2GE3 A;  3FXT A;  2B5G A;  2P6E A;  2PR1 A;  2JLM A;  1KUV A;  3JVN A;  2ZXV A;  2B4B A;  4MY0 A;  4OAD A;  2J8R A;  4OLL A;  1R57 A;  3F8K A;  3QAH A;  4R9M A;  4UWJ A;  3R1K A;  2O28 A;  5CNP A;  2G0B A;  4Y49 C;  3IGR A;  5KTC A;  4GS4 A;  4KOY A;  1QSR A;  3W6S A;  2FIA A;  1TIQ A;  2ZW5 A;  4JWP A;  4KLW A;  1N71 A;  2VI7 A;  4QC6 A;  4CAV A;  4KUB A;  1Y9W A;  4Y49 B;  5C82 A;  2FSR A;  1J4J A;  2Z11 A;  3TCV A;  2X7B A;  5F48 A;  2RC4 A;  3B8G A;  4UBR A;  1UFH A;  3EFA A;  4L8A A;  2WPW A;  1S60 A;  1RXT A;  3R9G A;  4KOT A;  3TO7 A;  2OZU A;  3S6F A;  1MJ9 A;  4PV6 A;  3PZJ A;  1XIX A;  3JUW A;  5HH1 A;  5GCN A;  2R98 A;  4KVX A;  3DSB A;  5F49 A;  3WR7 A;  2AE6 A;  3FNC A;  3PGP A;  4RI1 A;  4E0A A;  3S6H A;  1ON0 A;  4U9Z A;  2KCW A;  2R7H A;  2REF A;  2CY2 A;  3EXN A;  1L0C A;  3V8I A;  4EVY A;  5IB0 A;  4R87 A;  1S7L A;  1VHS A;  1IID A;  3BLN A;  4F6A A;  3FBU A;  4DNC A;  2GIV A;  2FE7 A;  5H86 A;  3TO6 A;  4MI4 A;  3N7Z A;  2Q4V A;  1Q2D A;  1QSM A;  1Z9U A;  3OWC A;  3DDD A;  3SHP A;  4U9Y A;  5FVJ A;  4FD5 A;  4AG7 A;  1M4I A;  4B5O A;  2G3A A;  4NF1 A;  4KOU A;  3CXS A;  2Q7B A;  2HV2 A;  5ISV A;  2B4D B;  2DXQ A;  3TFY A;  2VBQ A;  3F5B A;  3FIX A;  4ZBG A;  2JEV A;  1BOB A;  4HNX B;  3QB8 A;  3T90 A;  1B6B A;  4XPD C;  3TE4 A;  4HKF A;  1YX0 A;  2F5I A;  2C27 A;  1S3Z A;  1Z4R A;  4MHD A;  2PR8 A;  1OZP A;  1SQH A;  3S6K A;  1XEB A;  4K30 A;  2R1I A;  1YK3 A;  4YFJ A;  4HNW B;  1QST A;  3P2H A;  5HMN A;  4RS2 A;  3R95 A;  1M44 A;  3CXP A;  1K4J A;  5F46 A;  2B4D A;  2CNM A;  4NEX A;  4XPD B;  3SXN A;  1WK4 A;  2P6F A;  2FIW A;  3R9F A;  3PP9 A;  1YRE A;  5E96 A;  1IYL A;  3GYA A;  1MJA A;  3TO9 A;  5EBV A;  3BJ8 A;  5KTA A;  4KOX A;  2EVN A;  2QML A;  4J3G A;  2IL4 A;  2ZW6 A;  4R57 A;  4AB7 A;  1Y9K A;  3G8W A;  3IWG A;  5JQ4 A;  4AVA A;  2NMT A;  1IYK A;  1YVO A;  2REE A;  4QBJ A;  5H84 A;  4XNH B;  4M85 A;  4IUS A;  2Z0Z A;  2OU2 A;  4MBU A;  3KKW A;  4R3K A;  1WWZ A;  1Q2C A;  1I12 A;  2FXF A;  3TOA A;  4FD6 A;  3D2P A;  2PRB A;  4JXQ A;  3DR8 A;  2PC1 A;  3RYO A;  5J8F A;  1M4G A;  4ONU A;  1Y7R A;  3VWD A;  3I3G A;  3FYN A;  2BEI A;  3GY9 A;  2VEZ A;  1YVK A;  4B5P B;  3T9Y A;  4U5Y A;  1BO4 A;  4F0Y A;  2WPX A;  3I9S A;  2QEC A;  2K5T A;  2Q4Y A;  4PK2 A;  4YGO A;  4LX9 A;  1LRZ A;  2Z10 A;  1P0H A;  1S7K A;  2OB0 A;  3R9E A;  2FL4 A;  1YLE A;  3D3S A;  4UWI A;  2H5M A;  1M4D A;  4KZT A;  3P2F A;  1QSO A;  2VXK A;  4FD4 A;  4CS0 B;  2GAN A;  1XE4 A;  3W91 A;  1IB1 E;  2P0W A;  3LD2 A;  1S7F A;  2Y0M A;  1Q2Y A;  4B5P A;  4CAX A;  2I79 A;  4AVB A;  2BSW A;  5JPH A;  1PU9 A;  4QB9 A;  1MJB A;  4NCZ A;  5DWM A;  4CRY B;  3EO4 A;  4XPL A;  2JDC A;  3W6X A;  1YGH A;  1QSN A;  4L89 A;  3MGD A;  4E2A A;  2ARH A;  2ZPA A;  5I0C A;  3H4Q A;  1B87 A;  4ORF A;  4KOS A;  4QVT A;  2VQY A;  2B3V A;  4JJX A;  3LOD A;  4MJ8 A;  4OAE A;  4R3L A;  4YRH A;  4E8O A;  3D2M A;  2FS5 A;  2ZW4 A;  2JDD A;  2A4N A;  4XNH C;  4AG9 A;  2PDO A;  5IV0 A;  3ZZI A;  4KUA A;  4HNY B;  2J8N A;  2ZW7 A;  2B3U A;  4KLV A;  3FB3 A;  2Q0Y A;  3S6G A;  3EC4 A;  4LUA A;  2G3T A;  1KUX A;  2AJ6 A;  4KVO E;  2VZY A;  1RO5 A;  3TT2 A;  1Z4E A;  2J8M A;  3FRM A;  1MK4 A;  4PSX A;  3ZJ0 A;  1XF8 A;  1VKC A;  3SXO A;  1IIC A;  4IF5 A;  4BMH A;  2FT0 A;  3G3S A;  5IX3 A;  4X5K A;  2ATR A;  5KTD A;  3R96 A;  4UA3 A;  2OZH A;  1XMT A;  4CRZ B;  4NXY A;  2BUE A;  1YR0 A;  4CAW A;  2VZZ A;  4NSQ A;  1GHE A;  1I1D A;  2I00 A;  3TTH A;  1NMT A;  3C26 A;  1P4N A;  1NSL A;  4XPK A;  4H6U A;  4PK3 A;  1KUY A;  2OH1 A;  2EUI A;  3BJ7 A;  2D4O A;  4FD7 A;  2D4P A;  1PUA A;  5EC4 A;  2HUZ A;  1NE9 A;  3EY5 A;  1FY7 A;  5DWN A;  3UY5 A;  4KOW A;  2QIR A;  3NE7 A;  3CXQ A;  3F0A A;  3DNS A;  4KOR A;  4JLY A;  4PSW A;  4I49 A;  4AVC A;  2Q44 A;  3VWE A;  3K9U A;  1CM0 A;  3E0K A;  4M3S A;  4MY3 A;  1V0C A;  4JD6 A;  2OZG A;  2B5G B;  4KOV A;  1S5K A;  2P6G A;  2CNS A;  1S7N A;  2R8V A;  2Q04 A;  2FCK A;  4JXR A;  3DR6 A;  3GKR A; 
#chains in the Genus database with same CATH topology
 4M6G A;  2PSW A;  2ZEL A;  1ZG7 A;  2BL1 A;  5G22 A;  3CPA A;  5CBM A;  3D8P A;  4H89 A;  2JBJ A;  4KVM E;  3V38 A;  3NH4 A;  4QUS A;  1I21 A;  1BPM A;  5LRG A;  5K8P A;  1U6M A;  3PBE A;  2PQ8 A;  3KHX A;  4NGP A;  4II9 A;  4ZY1 A;  3TOB A;  5F47 A;  1KZF A;  5HXD A;  1CJW A;  2CNT A;  2C6G A;  2Z3M A;  2HQY A;  5I4M A;  4H6Z A;  1M1D A;  4PXE A;  2B58 A;  5C88 A;  5J8C A;  2GE3 A;  3FXT A;  3MN8 A;  2B5G A;  2P6E A;  4UEE A;  2PR1 A;  1UWY A;  3WC5 A;  4WWV A;  4BBH A;  1IU8 A;  2YND A;  1KWM A;  2JLM A;  4UEF A;  1KUV A;  2PJ7 A;  3JVN A;  2ZXV A;  2B4B A;  3GIU A;  2PJB A;  4MY0 A;  1IOF A;  2J8R A;  2PVW A;  2QVP A;  4OAD A;  1R57 A;  3F8K A;  3QAH A;  4OLL A;  4R9M A;  4UWJ A;  3R1K A;  5JGF A;  2XEF A;  2O28 A;  1XOV A;  3B3C A;  4OP4 A;  5CNP A;  2G0B A;  5F09 A;  3KHZ A;  4CYN A;  2AFX A;  2PJ2 A;  1RTQ A;  3BXM A;  3WC6 A;  4Y49 C;  4ZGY B;  3SI2 A;  4CGN A;  3IGR A;  5KTC A;  4GS4 A;  1CPX A;  1QSR A;  4KOY A;  4OIW A;  2V77 A;  3W6S A;  2IJZ A;  2FIA A;  2PCU A;  1TIQ A;  2OOT A;  2ZW5 A;  4P10 A;  2YNC A;  4IAV A;  4CGM A;  2CIJ A;  3LAC A;  4JWP A;  4KLW A;  1N71 A;  1PCA A;  3KR4 A;  2VI7 A;  4QC6 A;  4NFR A;  4CAV A;  2O4H A;  2ZOF A;  4KUB A;  2ZOG A;  1Y9W A;  4M6I A;  4Y49 B;  4UIA A;  5C82 A;  3CT9 A;  3K2K A;  6CPA A;  2GRE A;  2FSR A;  1J4J A;  2Z11 A;  3PFE A;  3TCV A;  1QMU A;  5G1Z A;  2X7B A;  4DYO A;  5F48 A;  3I1U A;  2RC4 A;  3B8G A;  3FF3 A;  4UBR A;  3FJU A;  1UFH A;  3EFA A;  4L8A A;  4UFW A;  2PJ0 A;  1R43 A;  3TX8 A;  1IGB A;  1OBR A;  2WPW A;  3ISX A;  4MHP A;  4P4J A;  1JWQ A;  1S60 A;  2C1C A;  3KI9 A;  1RXT A;  4UFV A;  3R9G A;  1AUG A;  4KOT A;  3B35 A;  3TO7 A;  4F9U A;  2OZU A;  2Q7S A;  1YSJ A;  3S6F A;  1MJ9 A;  5EMI A;  4PV6 A;  3PZJ A;  1XIX A;  3JUW A;  5HH1 A;  5GCN A;  2R98 A;  4KVX A;  1X12 A;  3DSB A;  3QNV A;  2PJA A;  5F49 A;  5HVF A;  3WR7 A;  4A33 A;  2AE6 A;  4IHM A;  2PJ8 A;  1AMP A;  4OC5 A;  1TF8 A;  4H2K A;  1Z2L A;  3FNC A;  3PGP A;  4RI1 A;  3H8G A;  4E0A A;  4OC1 A;  3S6H A;  1ON0 A;  4DUK A;  4U9Z A;  2POK A;  3FEE A;  2ZEH A;  2KCW A;  2R7H A;  1XRY A;  2REF A;  1F57 A;  2CY2 A;  1F2P A;  3EXN A;  1L0C A;  3V8I A;  2IMO A;  4EVY A;  2AFO A;  2V8D A;  4F0X A;  4R87 A;  4X2T A;  1S7L A;  5IB0 A;  2PE3 A;  1VHS A;  3D7D A;  1IID A;  1TKJ A;  3BLN A;  1ELM P;  4KS9 A;  4F6A A;  2Q43 A;  3FBU A;  4OKO A;  4MFL A;  2GIV A;  1BAV A;  4CYP A;  2FE7 A;  4DNC A;  1ARL A;  5H86 A;  4MFP A;  3TO6 A;  3D68 A;  4BIN A;  2DPS A;  3H5Z A;  3N7Z A;  4MI4 A;  2Q4V A;  1Y7E A;  1Q2D A;  1QSM A;  1Y0Y A;  1Z9U A;  2PJ4 A;  3OWC A;  2AFM A;  3DDD A;  3SHP A;  3PB4 X;  4R6T A;  4U9Y A;  4TNU A;  5FVJ A;  2RB7 A;  4FD5 A;  4AG7 A;  1M4I A;  1EE3 P;  2G3A A;  3FEC A;  4O23 A;  4NF1 A;  4B5O A;  3SJX A;  5HVG A;  4KOU A;  3IC1 A;  4P4D A;  3CXS A;  2Q7B A;  3IFE A;  2EO8 A;  2HV2 A;  5ISV A;  2B4D B;  3IWW A;  1VHO A;  2DXQ A;  3KL9 A;  4P4F A;  3TFY A;  3PB9 X;  2VBQ A;  5BWA B;  3F5B A;  3FIX A;  3KR5 A;  4LQ6 A;  4ZBG A;  2XEJ A;  3IO1 A;  3IU1 A;  4GXH A;  2JEV A;  1ZO0 A;  1BOB A;  1H8L A;  3KQX A;  4HNX B;  4NGN A;  3QB8 A;  4Q36 A;  3T90 A;  1Z8T A;  1B6B A;  4XPD C;  3TE4 A;  3NH5 A;  4HKF A;  1YX0 A;  4JXR A;  2F5I A;  2ABZ A;  2C27 A;  1S3Z A;  3GKR A;  2Z3L A;  3T8W A;  1Z4R A;  4MHD A;  5LYI A;  2PR8 A;  1OZP A;  1YME A;  1SQH A;  3JRU A;  3S6K A;  1XEB A;  4K30 A;  2R1I A;  1YK3 A;  4YFJ A;  4HNW B;  4M6H A;  4UEZ A;  4UIB A;  1QST A;  2C6P A;  3P2H A;  5HMN A;  1Z5R A;  5JH9 A;  4RS2 A;  3R95 A;  1ZLH A;  3PB7 X;  3A9L A;  1M44 A;  3CXP A;  1K4J A;  5F46 A;  2B4D A;  4CAE A;  2CNM A;  2I3C A;  4NEX A;  4XPD B;  3SXN A;  3TC8 A;  5IB9 A;  5J1Q A;  1DE4 C;  4B11 A;  4OID A;  3IIB A;  3FMC A;  1WK4 A;  2P6F A;  3MRU A;  3WAB A;  5K8O A;  2PJ6 A;  4PPZ A;  4AXV A;  2FIW A;  3R9F A;  3PP9 A;  4C2Y A;  1YRE A;  2BCO A;  2O53 A;  2GU2 A;  2PJ9 A;  5E96 A;  1IYL A;  3GYA A;  1MJA A;  3TO9 A;  2GFQ A;  4CAF A;  4ONW A;  3VH9 A;  4MHZ A;  5EBV A;  3BJ8 A;  1IOI A;  4B13 A;  5KTA A;  4KOX A;  2EVN A;  2DEA A;  4UF4 A;  2F7V A;  1XBU A;  2QML A;  2C6C A;  1R3N A;  4PXB A;  5K8N A;  3NFZ A;  4A38 A;  4J3G A;  2IL4 A;  2ZW6 A;  3GUX A;  3KGQ A;  3PRT A;  5HVH A;  4Q7A A;  4R57 A;  4AB7 A;  3IJ3 A;  1Y9K A;  4CGL A;  3G8W A;  3IWG A;  2AFW A;  5JQ4 A;  4AVA A;  2NMT A;  2CTB A;  2ZEM A;  1IYK A;  1YVO A;  2REE A;  4QBJ A;  2PJC A;  2V8G A;  2ZED A;  5AG4 A;  1VGY A;  5H84 A;  4G1P A;  3LMS A;  4XNH B;  1CP7 A;  3SJF A;  3KAS A;  3FVL A;  4M85 A;  4IUS A;  2Z0Z A;  2PIZ A;  2OU2 A;  4FAI A;  4A32 A;  2Q51 A;  4RN7 A;  4C2Z A;  3RZA A;  4R8F A;  1Z8W A;  3LWU A;  4MBU A;  1ZG9 A;  3KKW A;  3HUV A;  1CP6 A;  4R3K A;  4NJQ A;  3D7G A;  2F8H A;  1WWZ A;  1Q2C A;  4A39 A;  1I12 A;  4KSF A;  2FXF A;  2HB6 A;  1TXR A;  3TOA A;  4CPA A;  4OC2 A;  4W9Y A;  2AFS A;  2WSA A;  4FD6 A;  3D2P A;  3B3W A;  2BO9 A;  1YQE A;  1XMB A;  4B6Z A;  2PRB A;  4JXQ A;  2HC9 A;  3IEH A;  4NGT A;  3DR8 A;  2PC1 A;  3RYO A;  5J8F A;  1M4G A;  4ONU A;  1Y7R A;  3BI1 A;  5LRJ A;  2ZEN A;  3VWD A;  3I3G A;  3FYN A;  2BEI A;  3GY9 A;  2VEZ A;  4UCM A;  1FT7 A;  1Y0R A;  1YVK A;  3NH8 A;  3VAR A;  4B5P B;  1HDU A;  3D4U A;  5AG7 A;  4EFD A;  3ISZ A;  3T9Y A;  4U5Y A;  3D7H A;  4TWE A;  4P4I A;  4IK2 A;  1BO4 A;  1TKH A;  4F0Y A;  2NYQ A;  3S9N A;  1GYT A;  2WPX A;  2QEC A;  3I9S A;  4FWU A;  2K5T A;  2Q4Y A;  3PFO A;  2CF4 A;  4PK2 A;  4YGO A;  1QQ9 A;  4LX9 A;  1LRZ A;  4NGR A;  3SI0 A;  2Z10 A;  1P0H A;  3CPX A;  3PB8 X;  1S7K A;  2OB0 A;  3KQZ A;  4WJB A;  3R9E A;  2FL4 A;  1YLE A;  3D3S A;  4UWI A;  2H5M A;  2JEW A;  1M4D A;  2Z3O A;  4KZT A;  4P6Y A;  4P45 A;  3P2F A;  4CYO A;  3SJG A;  1QSO A;  5G21 A;  2VXK A;  4FD4 A;  4NJR A;  7CPA A;  1XJO A;  2PJ1 A;  4CS0 B;  1FNO A;  4NGS A;  5THW A;  2GAN A;  5A27 A;  1XE4 A;  4UFX A;  3S9L A;  4MMO A;  3W91 A;  4EME A;  1IB1 E;  2P0W A;  3LD2 A;  5D29 A;  4ZYQ A;  1S7F A;  4MHY A;  2Y0M A;  1Q2Y A;  4MCR A;  4B5P A;  4CAX A;  2I79 A;  2RFH A;  3BI0 A;  4MFQ A;  4AVB A;  1ZG8 A;  1HEE A;  5LYF A;  2BSW A;  5JPH A;  2XEI A;  1YW6 A;  2BOA A;  1PU9 A;  4R7M A;  1X10 A;  1TF9 A;  4QB9 A;  2G9D A;  4UCP A;  1MJB A;  4KSI A;  4NGM A;  2YNE A;  2DPT A;  3B3S A;  4ZX8 A;  4NCZ A;  4YU9 A;  4X3R A;  5DWM A;  4CRY B;  3EO4 A;  3CZX A;  2JDC A;  4XPL A;  3H8E A;  3W6X A;  4C7H A;  1YGH A;  1QSN A;  4GM5 A;  4L89 A;  3MGD A;  5AG5 A;  4E2A A;  4C7I A;  4K3N A;  5LYL A;  4HPS A;  5D8N A;  2ARH A;  4B12 A;  2ZPA A;  4B14 A;  4PXC A;  5I0C A;  3H4Q A;  4OC3 A;  1B87 A;  4KSA A;  2NSM A;  4ORF A;  4ZI6 A;  2XEG A;  1F2O A;  4KOS A;  4QVT A;  2DF5 A;  3IU2 A;  1LOK A;  2VQY A;  4B10 A;  3RNZ A;  5JM6 A;  4CGP A;  2B3V A;  1LAM A;  2EBJ A;  4Z65 A;  4JJX A;  3LOD A;  4MJ8 A;  4OAE A;  2ZEE A;  4LQG A;  4R3L A;  3RBU A;  4YRH A;  4E8O A;  3FX6 A;  3D2M A;  4OME A;  2FS5 A;  2ZW4 A;  2JDD A;  1BPN A;  3HLP A;  1LAP A;  2A4N A;  4XNH C;  1YLO A;  4AG9 A;  4OC4 A;  2PDO A;  4CYQ A;  4PQA A;  5IV0 A;  1LAN A;  3SJE A;  5ELY A;  3ZZI A;  2ANP A;  1ELL P;  1Q7L A;  2JBK A;  4KUA A;  4HNY B;  2V8V A;  1IY7 A;  4PXD A;  3B3V A;  4MXU A;  3B3T A;  8CPA A;  2J8N A;  1CG2 A;  4A94 A;  4C68 A;  2ZW7 A;  2B3U A;  4KLV A;  2ZEF A;  3FB3 A;  3FH4 A;  2Q0Y A;  5AG6 A;  3DGV A;  3JTK A;  4ZY2 A;  1M4L A;  2Z3K A;  3EC4 A;  4LUA A;  5G20 A;  3S6G A;  2G3T A;  2PIY A;  1KUX A;  2AJ6 A;  3VAT A;  1VHE A;  2ZEG A;  4KVO E;  3S9M A;  2QJ8 A;  4MCS A;  2VZY A;  4MCP A;  2ZEP A;  1RO5 A;  3TT2 A;  3RO0 A;  4DJL A;  2GLJ A;  2EK9 A;  3WT4 A;  1Z4E A;  4MFZ A;  2J8M A;  3FRM A;  3GLJ A;  1MK4 A;  2WYR A;  2CTC A;  4PSX A;  2WUU A;  3ZJ0 A;  1A2Z A;  4EWT A;  3SI1 A;  1XF8 A;  1VKC A;  2ZEO A;  4R76 A;  1JQG A;  4YWY A;  3SXO A;  4OC0 A;  2AFZ A;  3FED A;  4Q38 A;  1IIC A;  2OR4 A;  4IF5 A;  1XFO A;  3RAM A;  4BMH A;  4FBE A;  2FT0 A;  2IQ6 A;  3GB0 A;  1YW4 A;  3G3S A;  4RUH A;  5IX3 A;  4X5K A;  2ATR A;  5KTD A;  2AFU A;  4ZY0 A;  3R96 A;  1BLL E;  2EK8 A;  4P44 A;  1VIX A;  2OZH A;  4UA3 A;  2WZN A;  4C2X A;  4ZX9 A;  4A31 A;  3L2N A;  3V7Z A;  1XMT A;  4A37 A;  4CRZ B;  4NXY A;  2BUE A;  1YR0 A;  4CAW A;  2VZZ A;  4NSQ A;  4F9V A;  2PVV A;  5LRK A;  3D67 A;  5AGE A;  1GHE A;  1I1D A;  1NSA A;  3BHX A;  1Z8L A;  1HDQ A;  2I00 A;  1ARM A;  2CXA A;  4A30 A;  3PBB A;  4X8I A;  4CGO A;  3TTH A;  1NMT A;  3C26 A;  2V8H A;  1Z8X A;  1DTD A;  1P4N A;  4JZ0 A;  4XPK A;  4H6U A;  1NSL A;  2Z3N A;  2YGW A;  4A2Z A;  4PK3 A;  3WC7 A;  1KUY A;  2OH1 A;  2EUI A;  3BJ7 A;  2D4O A;  4FD7 A;  1AYE A;  5DS0 A;  2D4P A;  1PUA A;  5EC4 A;  1LCP A;  2HUZ A;  1NE9 A;  1ZLI A;  3CDX A;  3N5F A;  5CPA A;  3H8F A;  1CPS A;  3EY5 A;  2VL1 A;  1FY7 A;  5DWN A;  3UY5 A;  3D66 A;  4FUU A;  1CBX A;  3DR6 A;  4JYW A;  4KOW A;  4NGQ A;  2QIR A;  3NE7 A;  3CXQ A;  3F0A A;  3DNS A;  4P4B A;  1CX8 A;  4MFJ A;  5A28 A;  4KOR A;  2EWB A;  4JLY A;  4PSW A;  2ODF A;  4UCN A;  4I49 A;  4AVC A;  3B7I A;  5LYD A;  2Q44 A;  3NE8 A;  3VWE A;  3K9U A;  4MCQ A;  1CM0 A;  3E0K A;  4M3S A;  4MY3 A;  1V0C A;  3D7F A;  3K9T A;  2Z3P A;  4JD6 A;  2PJ5 A;  2OZG A;  2Q4Z A;  1TKF A;  2J9A A;  1PYT B;  3NA6 A;  1LFW A;  4A95 A;  3B2Y A;  3PB6 X;  2B5G B;  4MHN A;  4P4E A;  3QAY A;  4BD9 A;  3DLJ A;  4KOV A;  4MRI A;  2PRQ A;  1S5K A;  2P6G A;  2PJ3 A;  5K8M A;  3PEI A;  4MFK A;  2YNC C;  2CNS A;  1S7N A;  2R8V A;  3KZW A;  3IWE A;  2Q04 A;  2FCK A;  2GLF A;  2FVG A;  2QYV A;  4F8Z A; 
#chains in the Genus database with same CATH homology
 2PSW A;  2BL1 A;  5G22 A;  3D8P A;  4H89 A;  4KVM E;  4QUS A;  1I21 A;  4II9 A;  1U6M A;  2PQ8 A;  3TOB A;  5F47 A;  1KZF A;  1CJW A;  2CNT A;  2Z3M A;  2HQY A;  4H6Z A;  1M1D A;  2B58 A;  5C88 A;  5J8C A;  2GE3 A;  3FXT A;  2B5G A;  2P6E A;  2PR1 A;  4BBH A;  2YND A;  2JLM A;  1KUV A;  3JVN A;  2ZXV A;  2B4B A;  4MY0 A;  4OAD A;  2J8R A;  4OLL A;  1R57 A;  3F8K A;  3QAH A;  4R9M A;  4UWJ A;  3R1K A;  2O28 A;  5CNP A;  2G0B A;  4CYN A;  4Y49 C;  4ZGY B;  4CGN A;  3IGR A;  5KTC A;  4GS4 A;  4KOY A;  1QSR A;  3W6S A;  2FIA A;  1TIQ A;  2ZW5 A;  2YNC A;  4CGM A;  4JWP A;  4KLW A;  1N71 A;  2VI7 A;  4QC6 A;  4CAV A;  4KUB A;  1Y9W A;  4Y49 B;  5C82 A;  2FSR A;  1J4J A;  2Z11 A;  3TCV A;  5G1Z A;  2X7B A;  5F48 A;  2RC4 A;  3B8G A;  4UBR A;  1UFH A;  3EFA A;  4L8A A;  4UFW A;  2WPW A;  1S60 A;  1RXT A;  4UFV A;  3R9G A;  4KOT A;  3TO7 A;  2OZU A;  3S6F A;  1MJ9 A;  4PV6 A;  3PZJ A;  1XIX A;  3JUW A;  5HH1 A;  5GCN A;  2R98 A;  4KVX A;  3DSB A;  5F49 A;  4A33 A;  3WR7 A;  2AE6 A;  3FNC A;  3PGP A;  4RI1 A;  4E0A A;  3S6H A;  1ON0 A;  4U9Z A;  2KCW A;  2R7H A;  2REF A;  2CY2 A;  3EXN A;  1L0C A;  3V8I A;  4EVY A;  4F0X A;  5IB0 A;  4R87 A;  1S7L A;  1VHS A;  1IID A;  3BLN A;  4KS9 A;  4F6A A;  3FBU A;  4CYP A;  4MFL A;  2GIV A;  4DNC A;  2FE7 A;  5H86 A;  4MFP A;  3TO6 A;  2DPS A;  3H5Z A;  3N7Z A;  4MI4 A;  2Q4V A;  1Q2D A;  1QSM A;  1Z9U A;  3OWC A;  3DDD A;  3SHP A;  4U9Y A;  5FVJ A;  4FD5 A;  4AG7 A;  1M4I A;  4B5O A;  2G3A A;  4NF1 A;  4KOU A;  3CXS A;  2Q7B A;  2HV2 A;  5ISV A;  2B4D B;  2DXQ A;  3TFY A;  2VBQ A;  5BWA B;  3F5B A;  3FIX A;  4ZBG A;  3IU1 A;  2JEV A;  1ZO0 A;  1BOB A;  4HNX B;  3QB8 A;  4Q36 A;  3T90 A;  1B6B A;  4XPD C;  3TE4 A;  4HKF A;  1YX0 A;  2F5I A;  2C27 A;  1S3Z A;  2Z3L A;  1Z4R A;  4MHD A;  2PR8 A;  1OZP A;  1SQH A;  3S6K A;  1XEB A;  4K30 A;  2R1I A;  1YK3 A;  4YFJ A;  4HNW B;  1QST A;  3P2H A;  5HMN A;  4RS2 A;  3R95 A;  3A9L A;  1M44 A;  3CXP A;  1K4J A;  5F46 A;  2B4D A;  4CAE A;  2CNM A;  4NEX A;  4XPD B;  3SXN A;  4B11 A;  1WK4 A;  2P6F A;  2FIW A;  3R9F A;  3PP9 A;  4C2Y A;  1YRE A;  5E96 A;  1IYL A;  3GYA A;  1MJA A;  3TO9 A;  4CAF A;  5EBV A;  3BJ8 A;  4B13 A;  5KTA A;  4KOX A;  2EVN A;  2QML A;  4J3G A;  2IL4 A;  2ZW6 A;  4R57 A;  4AB7 A;  1Y9K A;  4CGL A;  3G8W A;  3IWG A;  5JQ4 A;  4AVA A;  2NMT A;  1IYK A;  1YVO A;  2REE A;  4QBJ A;  5AG4 A;  5H84 A;  4XNH B;  4M85 A;  4IUS A;  2Z0Z A;  2OU2 A;  4A32 A;  4C2Z A;  4MBU A;  3KKW A;  4R3K A;  1WWZ A;  1Q2C A;  1I12 A;  4KSF A;  2FXF A;  3TOA A;  2WSA A;  4FD6 A;  3D2P A;  2PRB A;  4JXQ A;  3DR8 A;  2PC1 A;  3RYO A;  5J8F A;  1M4G A;  4ONU A;  1Y7R A;  3VWD A;  3I3G A;  3FYN A;  2BEI A;  3GY9 A;  2VEZ A;  4UCM A;  1YVK A;  4B5P B;  5AG7 A;  3T9Y A;  4U5Y A;  1BO4 A;  4F0Y A;  2WPX A;  3I9S A;  2QEC A;  2K5T A;  2Q4Y A;  4PK2 A;  4YGO A;  4LX9 A;  1LRZ A;  2Z10 A;  1P0H A;  1S7K A;  2OB0 A;  3R9E A;  2FL4 A;  1YLE A;  3D3S A;  4UWI A;  2H5M A;  1M4D A;  2Z3O A;  4KZT A;  3P2F A;  4CYO A;  1QSO A;  5G21 A;  2VXK A;  4FD4 A;  4CS0 B;  2GAN A;  5A27 A;  1XE4 A;  4UFX A;  3W91 A;  1IB1 E;  2P0W A;  3LD2 A;  1S7F A;  2Y0M A;  1Q2Y A;  4B5P A;  4CAX A;  2I79 A;  4MFQ A;  4AVB A;  2BSW A;  5JPH A;  1PU9 A;  4QB9 A;  4UCP A;  1MJB A;  2YNE A;  2DPT A;  4NCZ A;  5DWM A;  4CRY B;  3EO4 A;  4XPL A;  2JDC A;  3W6X A;  4C7H A;  1YGH A;  1QSN A;  4L89 A;  3MGD A;  5AG5 A;  4E2A A;  4C7I A;  4B12 A;  2ARH A;  4B14 A;  2ZPA A;  5I0C A;  3H4Q A;  1B87 A;  4KSA A;  4ORF A;  4KOS A;  4QVT A;  3IU2 A;  2VQY A;  4B10 A;  4CGP A;  2B3V A;  4JJX A;  3LOD A;  4MJ8 A;  4OAE A;  4R3L A;  4YRH A;  4E8O A;  3D2M A;  2FS5 A;  2ZW4 A;  2JDD A;  2A4N A;  4XNH C;  4AG9 A;  2PDO A;  4CYQ A;  5IV0 A;  3ZZI A;  4KUA A;  4HNY B;  2J8N A;  4C68 A;  2ZW7 A;  2B3U A;  4KLV A;  3FB3 A;  2Q0Y A;  5AG6 A;  3JTK A;  3S6G A;  2Z3K A;  3EC4 A;  4LUA A;  5G20 A;  2G3T A;  1KUX A;  2AJ6 A;  4KVO E;  2VZY A;  1RO5 A;  3TT2 A;  1Z4E A;  4MFZ A;  2J8M A;  3FRM A;  1MK4 A;  4PSX A;  2WUU A;  3ZJ0 A;  1XF8 A;  1VKC A;  3SXO A;  4Q38 A;  1IIC A;  4IF5 A;  4BMH A;  2FT0 A;  3G3S A;  5IX3 A;  4X5K A;  2ATR A;  5KTD A;  3R96 A;  4UA3 A;  2OZH A;  4C2X A;  4A31 A;  1XMT A;  4CRZ B;  4NXY A;  2BUE A;  1YR0 A;  4CAW A;  2VZZ A;  4NSQ A;  5AGE A;  1GHE A;  1I1D A;  2I00 A;  2CXA A;  4A30 A;  4CGO A;  3TTH A;  1NMT A;  3C26 A;  1P4N A;  1NSL A;  4XPK A;  4H6U A;  2Z3N A;  2YGW A;  4A2Z A;  4PK3 A;  1KUY A;  2OH1 A;  2EUI A;  3BJ7 A;  2D4O A;  4FD7 A;  2D4P A;  1PUA A;  5EC4 A;  2HUZ A;  1NE9 A;  3EY5 A;  1FY7 A;  5DWN A;  3UY5 A;  4KOW A;  2QIR A;  3NE7 A;  3CXQ A;  3F0A A;  3DNS A;  4MFJ A;  5A28 A;  4KOR A;  4JLY A;  4PSW A;  4UCN A;  4I49 A;  4AVC A;  2Q44 A;  3VWE A;  3K9U A;  1CM0 A;  3E0K A;  4M3S A;  4MY3 A;  1V0C A;  4JD6 A;  2Z3P A;  2OZG A;  4A95 A;  2B5G B;  4KOV A;  1S5K A;  2P6G A;  4MFK A;  2YNC C;  2CNS A;  1S7N A;  2R8V A;  3IWE A;  2Q04 A;  2FCK A;  4JXR A;  3DR6 A;  3GKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...