2B58A

Ssat with coa_sp, spermine disordered, k26r mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
167
structure length
167
Chain Sequence
b'FVIRPATAADCSDILRLIKELARYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 1
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 36
structure length 167
sequence length 167
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b58A00
2QIRA 3GKRA 3TCVA 4MHDA 2QECA 2Q7BA 2EVNA 1M44A 5IB0A 3LODA 1N71A 4U5YA 1YGHA 4ZBGA 2P6EA 1XIXA 1S7NA 2FL4A 3TE4A 4LUAA 2G3TA 2Q4VA 4H6UA 2GIVA 3DR8A 4QVTA 2AJ6A 2WPWA 1NMTA 5F48A 4UA3A 4H89A 4KOSA 4X5KA 1MJAA 3DDDA 4JLYA 4MY0A 4KOUA 4JJXA 4M3SA 3IWGA 3OWCA 3ZZIA 4KOTA 4B5OA 2DXQA 2Q44A 3R96A 4CAVA 1WWZA 3C26A 4JD6A 3UY5A 5FVJA 4XNHB 1K4JA 2WPXA 4KLWA 4E2AA 2G0BA 3G8WA 1S60A 4L89A 2Z10A 1YX0A 3F8KA 5EC4A 4ONUA 3BLNA 1ON0A 1S5KA 2JLMA 5GCNA 1UFHA 1YVOA 4KOYA 2VZZA 4B5PA 4MI4A 1QSTA 2ARHA 2K5TA 3TO6A 3TOAA 2NMTA 2C27A 2JDCA 3N7ZA 2VXKA 5F46A 1GHEA 1NSLA 2R8VA 5F49A 2PQ8A 2P6GA 4YGOA 3I9SA 3TFYA 4U9YA 2BSWA 1XEBA 4HNWB 3EO4A 4KVXA 5JPHA 4PK3A 2FS5A 4ORFA 1S7LA 4QBJA 2VEZA 4FD6A 4E8OA 1QSMA 4YFJA 3TT2A 3GY9A 3R9EA 2CNTA 4AVAA 4MBUA 4UWJA 1RXTA 2D4PA 1Z4RA 2ZW7A 2OZUA 3CXQA 3K9UA 2HQYA 4KVME 4OAEA 4J3GA 2ZPAA 4QUSA 1YVKA 3GYAA 1IYKA 3D2MA 1P0HA 3MGDA 2P0WA 3IGRA 1Q2DA 4FD7A 1IIDA 1Y7RA 3H4QA 2FSRA 4KUBA 1U6MA 3QAHA 1LRZA 3FYNA 1M4DA 1IB1E 4Y49C 3WR7A 3R95A 1Z4EA 2F5IA 3SXNA 2A4NA 3W6XA 3E0KA 2ZW6A 3TOBA 4R57A 1I21A 4FD5A 1NE9A 2R7HA 4DNCA 4M85A 5HH1A 2QMLA 2EUIA 2RC4A 1KZFA 2OZGA 4KUAA 1XE4A 1WK4A 3CXSA 4IF5A 2X7BA 5EBVA 4JXQA 4KOWA 2PSWA 3F0AA 1M1DA 1SQHA 3PGPA 2O28A 4EVYA 1CJWA 1M4IA 2JEVA 3TTHA 4GS4A 2J8NA 5C82A 4OLLA 5H86A 4IUSA 2FXFA 2D4OA 4KLVA 2REFA 1Q2CA 4CAWA 1R57A 3FIXA 1XMTA 3RYOA 1V0CA 4Y49B 1BO4A 4NSQA 3EC4A 3NE7A 4U9ZA 4CAXA 4YRHA 1S7KA 3EXNA 5KTAA 2PRBA 3V8IA 4R9MA 2IL4A 2FIAA 4CS0B 3P2HA 2J8MA 2B5GB 5F47A 2OB0A 2R98A 3D8PA 3SXOA 4KOVA 1PUAA 2B4DA 3QB8A 3SHPA 2I00A 3EY5A 4AG9A 1VKCA 2Z11A 2OZHA 4AB7A 3F5BA 3T9YA 1CM0A 2B4BA 1QSRA 4R3LA 5IV0A 4KVOE 2CY2A 4BMHA 3BJ8A 4KZTA 1TIQA 3DSBA 4PV6A 4QB9A 2FCKA 2VZYA 2ATRA 4CRZB 2FE7A 3W91A 4HKFA 5I0CA 1Y9KA 2REEA 4JWPA 3FNCA 3EFAA 3S6HA 3VWEA 4H6ZA 4OADA 2B3VA 2Q04A 1L0CA 4AVBA 2VQYA 3P2FA 1YK3A 1B6BA 1S3ZA 3FRMA 3I3GA 4XPDC 1I12A 1KUVA 4KORA 2HV2A 2I79A 4F0YA 1BOBA 2R1IA 4MJ8A 5KTDA 4L8AA 4KOXA 2ZW5A 5IX3A 3W6SA 1VHSA 2Y0MA 4FD4A 4XPKA 2P6FA 4R3KA 2FIWA 3BJ7A 1IICA 4F6AA 2PR1A 2J8RA 4RI1A 1YLEA 4NEXA 2Q4YA 2VI7A 4II9A 1S7FA 1RO5A 1MK4A 4NCZA 2KCWA 4UWIA 3S6GA 4CRYB 3D2PA 4AVCA 3TO7A 3B8GA 1KUYA 4MY3A 4PK2A 1QSNA 2CNSA 3JUWA 2PR8A 2B58A 3FB3A 2PC1A 2B3UA 2VBQA 4K30A 3ZJ0A 4QC6A 2ZXVA 1I1DA 2Q0YA 4XPDB 1XF8A 1QSOA 2JDDA 4NXYA 2BEIA 1M4GA 3DNSA 1YREA 5J8CA 2HUZA 3JVNA 4LX9A 4RS2A 4UBRA 4HNXB 4R87A 5DWNA 2PDOA 3G3SA 1P4NA 4AG7A 4B5PB 4HNYB 3FBUA 5J8FA 2B5GA 4NF1A 2ZW4A 3R9GA 2OH1A 4I49A 4PSXA 3LD2A 3R9FA 1Z9UA 3KKWA 2AE6A 5E96A 5JQ4A 1MJ9A 1IYLA 1J4JA 1YR0A 4JXRA 3DR6A 2B4DB 2GANA 3CXPA 5HMNA 2FT0A 1Q2YA 2OU2A 3TO9A 2BUEA 3S6KA 4E0AA 5CNPA 4XPLA 3FXTA 3R1KA 3VWDA 5H84A 5C88A 2CNMA 2GE3A 1B87A 2H5MA 4PSWA 1Y9WA 5ISVA 3PP9A 2Z0ZA 1KUXA 1PU9A 5KTCA 3T90A 3PZJA 1OZPA 2G3AA 5DWMA 1MJBA 3D3SA 2BL1A 4XNHC 3S6FA 1FY7A
chains in the Genus database with same CATH superfamily
2QIRA 3GKRA 3TCVA 4MHDA 2QECA 2Q7BA 3NH8A 4OKOA 2EVNA 1M44A 2HB6A 3BXMA 4CAFA 3H8EA 4CPAA 5IB0A 3LODA 1N71A 4U5YA 2EWBA 3SI1A 1AYEA 1GYTA 1YGHA 4ZBGA 1ZO0A 2PIZA 4G1PA 2P6EA 1UWYA 5ELYA 5LRKA 1XIXA 4MCPA 4FAIA 1AUGA 1S7NA 1VHOA 2FL4A 4NGTA 3TE4A 2ZEHA 4LUAA 2G3TA 3D7GA 4UIAA 2I3CA 2Q4VA 4H6UA 2GIVA 3DR8A 1QMUA 4QVTA 2ZOFA 3KL9A 3S9MA 4MFQA 4A37A 3NH5A 1YW4A 2AJ6A 2WPWA 4KSIA 1NMTA 4Q7AA 5F48A 2PCUA 2QVPA 4UA3A 1R43A 3QAYA 4H89A 1EE3P 1LOKA 3D67A 3FMCA 4KOSA 4X5KA 4OC2A 4UCNA 5EMIA 2AFZA 1MJAA 2DPTA 3DDDA 3N5FA 4JLYA 4MMOA 4MY0A 4KOUA 4DUKA 1HDUA 3PBEA 3H8FA 4JJXA 4M3SA 3IWGA 1LFWA 3OWCA 7CPAA 3LMSA 3D66A 3WC7A 1X10A 4ZY0A 1OBRA 3FVLA 3ZZIA 4OC3A 4KOTA 2NYQA 2DXQA 2Q44A 3CDXA 4LQ6A 2YNCA 3KHXA 3R96A 2ZEPA 4B5OA 4CAVA 1WWZA 3C26A 4F9VA 2DF5A 2C6CA 4JD6A 4PXBA 2G9DA 3UY5A 1ZG8A 5FVJA 1YSJA 4CGMA 2FVGA 4XNHB 3GB0A 1K4JA 2AFMA 4CYQA 2YNDA 2Z3OA 2PE3A 2WPXA 4KLWA 4E2AA 2G0BA 3G8WA 1S60A 3IO1A 4FBEA 3SJXA 4L89A 4C7IA 1Z8LA 2Z10A 5JH9A 2CIJA 3GUXA 1YX0A 2JBKA 4R8FA 3F8KA 4A30A 4WWVA 4F0XA 2AFXA 4ONUA 5EC4A 3BLNA 1M4LA 1ON0A 1S5KA 1AMPA 2JLMA 2PVWA 5GCNA 3RO0A 3PB7X 1UFHA 1YW6A 1YVOA 4KOYA 2PJ4A 2VZZA 1H8LA 2Z3MA 5A27A 4M6HA 3B3VA 4EFDA 2YGWA 3T8WA 4B5PA 2BOAA 3D7DA 2C6PA 4MI4A 4NJRA 4C2XA 1QSTA 2ARHA 2K5TA 3IIBA 3TO6A 4A94A 3KHZA 3TOAA 5AG5A 2NMTA 3FECA 2C27A 4Z65A 4OC0A 1F57A 3V7ZA 2JDCA 2OOTA 3JRUA 2PJ2A 3PB4X 3N7ZA 4OC1A 3PB6X 4NGRA 2VXKA 5F46A 1LANA 3D7FA 4IHMA 2J9AA 3A9LA 2PJ5A 1GHEA 4K3NA 2ANPA 2DPSA 1NSLA 2R8VA 4MCQA 5F49A 4CGNA 2XEJA 1Z8TA 1ELLP 5LRJA 2PQ8A 2P6GA 4YGOA 2RFHA 3I9SA 2PJBA 5LYIA 1IGBA 4U9YA 3TFYA 6CPAA 2BSWA 1XEBA 1DTDA 4HNWB 3EO4A 4MFPA 4KVXA 4OMEA 1ELMP 5JPHA 1FT7A 4PK3A 2Q7SA 2FS5A 4ORFA 4CYOA 1S7LA 3H8GA 4QBJA 1XOVA 2VEZA 4FD6A 4E8OA 1QSMA 4YFJA 3TC8A 3CPAA 2QYVA 4UEZA 3TT2A 3GY9A 2PJ8A 2CNTA 3R9EA 2C6GA 4OIDA 4AVAA 2AFUA 4MBUA 4UWJA 1RXTA 2D4PA 1Z4RA 2Q51A 2OZUA 2ZW7A 3CXQA 3K9UA 4CYPA 3S9LA 4PXCA 5AG7A 2HQYA 4UFWA 4F9UA 4KVME 3PFOA 4OAEA 3B3CA 1RTQA 3D68A 4OC5A 4P6YA 3BI1A 4J3GA 4A32A 5LYDA 2ZPAA 4QUSA 3LACA 4PXDA 1YVKA 3GYAA 1IYKA 2YNEA 3D2MA 1P0HA 3MGDA 2P0WA 3PFEA 4ZY2A 4B13A 3HUVA 4ZY1A 3IGRA 1Q2DA 4FD7A 2BCOA 1YMEA 2GLJA 1BPMA 1IIDA 1Y7RA 2PJ3A 3CT9A 2C1CA 2XEIA 3H4QA 2ZEGA 3IJ3A 3PB9X 2FSRA 4KUBA 4UEEA 1U6MA 3QAHA 4R76A 3S9NA 1CG2A 4UCMA 1IY7A 2Z3NA 2WZNA 5DS0A 1LRZA 4W9YA 3FYNA 3D7HA 1M4DA 1IB1E 4PPZA 4Y49C 3WR7A 3NA6A 1ZG9A 2CXAA 1Z4EA 3DGVA 3PBBA 3R95A 2F5IA 4B6ZA 3SXNA 2ODFA 2A4NA 3W6XA 4IAVA 3E0KA 2V77A 2ZW6A 3TOBA 4R57A 1I21A 3B2YA 4FD5A 1NE9A 4A39A 4NGSA 2R7HA 8CPAA 3B35A 3B7IA 4DNCA 3TX8A 1CP7A 4M85A 1DE4C 3FEEA 5HH1A 4FWUA 3SI0A 2QMLA 2EUIA 2RC4A 3RBUA 5HXDA 2NSMA 4GM5A 5AG6A 1LCPA 1KZFA 2OZGA 5D29A 1HEEA 4KUAA 1XE4A 3KQXA 1WK4A 3CXSA 4IF5A 2X7BA 2IQ6A 4JZ0A 2V8HA 5EBVA 1TKFA 4JXQA 4KOWA 2Z3LA 2ZEOA 2PSWA 3F0AA 1M1DA 1SQHA 5JM6A 3LWUA 3PGPA 2O28A 4EVYA 4MHNA 5A28A 3RZAA 1CJWA 1M4IA 1ARLA 2JEVA 2AFWA 3TTHA 4C68A 4GS4A 4PQAA 4MXUA 4F8ZA 3IU2A 2J8NA 2IJZA 4KS9A 4MHYA 5C82A 3IU1A 3NFZA 1A2ZA 4OLLA 4UF4A 5H86A 4IUSA 2FXFA 3ISZA 3VATA 3VH9A 2D4OA 4KLVA 2REFA 2ZELA 5G1ZA 3VARA 1Q2CA 2V8VA 4CAWA 1CPSA 5CPAA 3WT4A 1R57A 4R7MA 3FIXA 1XMTA 1HDQA 3RYOA 1V0CA 4Y49B 5K8MA 1CBXA 1BO4A 4NSQA 1ZLHA 3EC4A 2QJ8A 3NE7A 4MHZA 3FX6A 2EO8A 1TF8A 5LYFA 2PJAA 4Q38A 4U9ZA 4ZX9A 1PCAA 4CAXA 3MRUA 2CTBA 4YRHA 1Z5RA 3H5ZA 2ZEEA 1S7KA 1TKJA 4GXHA 3FH4A 3EXNA 5KTAA 3KGQA 2F7VA 2PRBA 5G20A 5AG4A 5G21A 1NSAA 4A95A 4IK2A 3V8IA 1JWQA 4R9MA 1Z8WA 2IL4A 2FIAA 4MFJA 2WSAA 2EK8A 4C2YA 4CS0B 3P2HA 4TWEA 4TNUA 2J8MA 2B5GB 2Z3PA 5F47A 1CP6A 1JQGA 2OB0A 2R98A 1F2PA 3GLJA 1IOFA 3D8PA 3SXOA 4KOVA 2CF4A 1PUAA 2B4DA 3GIUA 3QB8A 2ZEFA 3K9TA 3SHPA 2DEAA 2I00A 4MCSA 5HVFA 3EY5A 4X2TA 4AG9A 4P4DA 5D8NA 2F8HA 1VKCA 3WC5A 2Z11A 4P4EA 2OZHA 4AB7A 2O53A 3F5BA 3T9YA 4B12A 1CM0A 2B4BA 1QSRA 2ZENA 4M6GA 4R3LA 5IV0A 4R6TA 4KVOE 2CY2A 4MHPA 4BMHA 1BAVA 3BJ8A 4KZTA 4RUHA 3KR5A 1TIQA 3DSBA 4PV6A 1QQ9A 4NFRA 3BI0A 3FF3A 4UIBA 4QB9A 2WUUA 1R3NA 2FCKA 2PJ6A 2VZYA 2ATRA 3I1UA 4CRZB 5HVHA 2GREA 3SI2A 2FE7A 3PEIA 3PB8X 3W91A 4HKFA 1Q7LA 5K8PA 3BHXA 2Q43A 5I0CA 1Y9KA 4MFZA 4BBHA 2YNCC 1XJOA 4ZI6A 2REEA 4JWPA 3FNCA 4OP4A 3EFAA 5AGEA 3S6HA 3VWEA 4H6ZA 4CGPA 4ZX8A 4OADA 3HLPA 2B3VA 2EK9A 2Q04A 1L0CA 4AVBA 3K2KA 2PJ1A 1Y7EA 2VQYA 3P2FA 4NGQA 1Z8XA 4PXEA 3FJUA 3IEHA 1YK3A 1B6BA 1S3ZA 3FRMA 3I3GA 4XPDC 1I12A 1XMBA 1KUVA 4KORA 3RNZA 2HV2A 2OR4A 2I79A 4F0YA 2PJ9A 3KQZA 4UFXA 1BOBA 2R1IA 2BO9A 2ZEMA 3KASA 3SJEA 5JGFA 5LYLA 3ISXA 4MJ8A 5KTDA 4L8AA 2PRQA 2Q4ZA 2ZEDA 1VHEA 4KOXA 4KSFA 4P45A 4DYOA 1TKHA 4YU9A 2PVVA 3V38A 2ZW5A 5IX3A 4BD9A 2O4HA 3W6SA 1VHSA 4X8IA 4P4BA 4X3RA 5THWA 1F2OA 2Y0MA 3PRTA 4P4FA 4FD4A 4XPKA 4MFKA 2P6FA 4R3KA 4NGNA 2FIWA 3BJ7A 2PJ0A 5HVGA 1YLOA 1IICA 2WYRA 1Y0RA 4F6AA 3IFEA 2PR1A 4AXVA 2ABZA 2J8RA 4RI1A 4CGOA 1YLEA 4MFLA 4A33A 4UCPA 1LAPA 4NEXA 2Q4YA 2V8GA 2VI7A 4B14A 4II9A 4EWTA 4OIWA 1S7FA 1CPXA 1RO5A 4YWYA 5K8NA 2GLFA 4ZYQA 5K8OA 1MK4A 1VIXA 4NCZA 2KCWA 3DLJA 4UWIA 3KR4A 3S6GA 4CGLA 3KI9A 1IU8A 4CRYB 3D2PA 4AVCA 3TO7A 2EBJA 4CYNA 3B8GA 1KUYA 4MY3A 4PK2A 1QSNA 2CNSA 3JUWA 4KSAA 5IB9A 2PR8A 4A2ZA 2B58A 3FB3A 2PC1A 5I4MA 2B3UA 2Z3KA 1CX8A 2VBQA 4HPSA 4K30A 3ZJ0A 4FUUA 1Z2LA 4QC6A 2ZXVA 4P4IA 4UEFA 3CPXA 2JBJA 3FEDA 1I1DA 2HC9A 2Q0YA 1XF8A 4Q36A 1LAMA 4XPDB 3JTKA 4MRIA 1QSOA 1X12A 2JDDA 3NE8A 4A38A 4BINA 4NXYA 4EMEA 2XEFA 2BEIA 1M4GA 4P10A 1XRYA 2CTCA 2PJ7A 3B3TA 3DNSA 1YREA 5G22A 4NGMA 5J8CA 4P44A 5CBMA 2GU2A 5LRGA 5F09A 2HUZA 3NH4A 2PJCA 3JVNA 4LX9A 2VL1A 4RS2A 4O23A 4UBRA 4HNXB 4P4JA 4R87A 3D4UA 5DWNA 1BLLE 1TF9A 1XFOA 4WJBA 2PDOA 2JEWA 3G3SA 1P4NA 1Y0YA 4RN7A 4AG7A 3MN8A 4HNYB 4OC4A 4B5PB 3FBUA 5J8FA 2B5GA 4NF1A 4A31A 2ZW4A 3R9GA 3SJGA 2OH1A 1XBUA 2POKA 3KZWA 5J1QA 4I49A 4M6IA 4PSXA 3LD2A 1TXRA 3R9FA 1ARMA 1VGYA 1Z9UA 3WC6A 3IWEA 3KKWA 2XEGA 2PIYA 2AE6A 5E96A 3B3SA 1IOIA 5JQ4A 3RAMA 3B3WA 1MJ9A 1IYLA 1J4JA 1YR0A 3CZXA 4H2KA 4JXRA 4ZGYB 3DR6A 5BWAB 1YQEA 3IWWA 2B4DB 2GANA 1PYTB 3CXPA 4DJLA 5HMNA 1ZLIA 2FT0A 1Q2YA 3QNVA 4B11A 2OU2A 3TO9A 2BUEA 2AFSA 4CAEA 4LQGA 3S6KA 4E0AA 2ZOGA 1KWMA 4XPLA 3L2NA 4MCRA 5CNPA 3SJFA 4C2ZA 2AFOA 3FXTA 4NGPA 3R1KA 3VWDA 4UFVA 5H84A 5C88A 2CNMA 3WABA 4ONWA 2GE3A 2V8DA 2IMOA 1B87A 2H5MA 4PSWA 1Y9WA 5ISVA 2GFQA 1FNOA 3PP9A 2Z0ZA 1KUXA 4JYWA 1PU9A 5KTCA 3T90A 3PZJA 1OZPA 2RB7A 2G3AA 4C7HA 5DWMA 1MJBA 3D3SA 2BL1A 4XNHC 4NJQA 1BPNA 4B10A 3S6FA 1ZG7A 1FY7A 3IC1A
chains in the Genus database with same CATH topology
2QIRA 3GKRA 3TCVA 4MHDA 2QECA 2Q7BA 2EVNA 1M44A 4CAFA 5IB0A 3LODA 1N71A 4U5YA 1YGHA 4ZBGA 1ZO0A 2P6EA 1XIXA 1S7NA 2FL4A 3TE4A 4LUAA 2G3TA 2Q4VA 4H6UA 2GIVA 3DR8A 4QVTA 4MFQA 2AJ6A 2WPWA 1NMTA 5F48A 4UA3A 4H89A 4KOSA 4X5KA 4UCNA 4JLYA 1MJAA 2DPTA 3DDDA 4MY0A 4KOUA 4JJXA 4M3SA 3IWGA 3OWCA 3ZZIA 4KOTA 4B5OA 2DXQA 2Q44A 3R96A 2YNCA 4CAVA 1WWZA 3C26A 4JD6A 3UY5A 5FVJA 4CGMA 4XNHB 1K4JA 4CYQA 2YNDA 2Z3OA 2WPXA 4KLWA 4E2AA 2G0BA 3G8WA 1S60A 4L89A 4C7IA 2Z10A 4A30A 1YX0A 3F8KA 4F0XA 5EC4A 4ONUA 3BLNA 1ON0A 1S5KA 2JLMA 5GCNA 1UFHA 1YVOA 4KOYA 2VZZA 2Z3MA 5A27A 2YGWA 4C2XA 4B5PA 4MI4A 1QSTA 2ARHA 2K5TA 3TO6A 3TOAA 5AG5A 2NMTA 2C27A 2JDCA 3N7ZA 2VXKA 5F46A 3A9LA 1GHEA 2DPSA 1NSLA 2R8VA 5F49A 4CGNA 2PQ8A 2P6GA 4YGOA 3I9SA 3TFYA 4U9YA 2BSWA 1XEBA 4HNWB 3EO4A 4MFPA 4KVXA 5JPHA 4PK3A 2FS5A 4ORFA 4CYOA 1S7LA 4QBJA 2VEZA 4FD6A 4E8OA 1QSMA 4YFJA 3TT2A 3GY9A 3R9EA 2CNTA 4AVAA 4MBUA 4UWJA 1RXTA 2D4PA 1Z4RA 2ZW7A 2OZUA 3CXQA 3K9UA 4CYPA 5AG7A 2HQYA 4UFWA 4KVME 4OAEA 4J3GA 4A32A 2ZPAA 4QUSA 1YVKA 3GYAA 1IYKA 2YNEA 3D2MA 1P0HA 3MGDA 2P0WA 4B13A 3IGRA 1Q2DA 4FD7A 1IIDA 1Y7RA 3H4QA 2FSRA 4KUBA 1U6MA 3QAHA 4UCMA 2Z3NA 1LRZA 3FYNA 1M4DA 1IB1E 4Y49C 3WR7A 2CXAA 3R95A 1Z4EA 2F5IA 3SXNA 2A4NA 3W6XA 3E0KA 2ZW6A 3TOBA 4R57A 1I21A 4FD5A 1NE9A 2R7HA 4DNCA 4M85A 5HH1A 2QMLA 2EUIA 2RC4A 5AG6A 1KZFA 2OZGA 4KUAA 1XE4A 1WK4A 3CXSA 4IF5A 2X7BA 5EBVA 4JXQA 4KOWA 2Z3LA 2PSWA 3F0AA 1M1DA 1SQHA 3PGPA 2O28A 4EVYA 5A28A 1CJWA 1M4IA 2JEVA 3TTHA 4C68A 4GS4A 3IU2A 2J8NA 4KS9A 5C82A 3IU1A 4OLLA 5H86A 4IUSA 2FXFA 2D4OA 4KLVA 2REFA 5G1ZA 1Q2CA 4CAWA 1R57A 3FIXA 1XMTA 3RYOA 1V0CA 4Y49B 1BO4A 4NSQA 3EC4A 3NE7A 4Q38A 4U9ZA 4CAXA 4YRHA 3H5ZA 1S7KA 3EXNA 5KTAA 2PRBA 5G20A 5AG4A 5G21A 4A95A 3V8IA 4R9MA 2IL4A 2FIAA 4MFJA 2WSAA 4C2YA 4CS0B 3P2HA 2J8MA 2B5GB 2Z3PA 5F47A 2OB0A 2R98A 3D8PA 3SXOA 4KOVA 1PUAA 2B4DA 3QB8A 3SHPA 2I00A 3EY5A 4AG9A 1VKCA 2Z11A 2OZHA 4AB7A 3F5BA 3T9YA 4B12A 1CM0A 2B4BA 1QSRA 4R3LA 5IV0A 4KVOE 2CY2A 4BMHA 3BJ8A 4KZTA 1TIQA 3DSBA 4PV6A 4QB9A 2WUUA 2FCKA 2VZYA 2ATRA 4CRZB 2FE7A 3W91A 4HKFA 5I0CA 1Y9KA 4MFZA 4BBHA 2YNCC 2REEA 4JWPA 3FNCA 3EFAA 5AGEA 3S6HA 3VWEA 4H6ZA 4CGPA 4OADA 2B3VA 2Q04A 1L0CA 4AVBA 2VQYA 3P2FA 1YK3A 1B6BA 1S3ZA 3FRMA 3I3GA 4XPDC 1I12A 1KUVA 4KORA 2HV2A 2I79A 4F0YA 4UFXA 1BOBA 2R1IA 4MJ8A 5KTDA 4L8AA 4KOXA 4KSFA 2ZW5A 5IX3A 3W6SA 1VHSA 2Y0MA 4FD4A 4XPKA 4MFKA 2P6FA 4R3KA 2FIWA 3BJ7A 1IICA 4F6AA 2PR1A 2J8RA 4RI1A 4CGOA 1YLEA 4MFLA 4A33A 4UCPA 4NEXA 2Q4YA 2VI7A 4B14A 4II9A 1S7FA 1RO5A 1MK4A 4NCZA 2KCWA 4UWIA 3S6GA 4CGLA 4CRYB 3D2PA 4AVCA 3TO7A 4CYNA 3B8GA 1KUYA 4MY3A 4PK2A 1QSNA 2CNSA 3JUWA 4KSAA 2PR8A 4A2ZA 2B58A 3FB3A 2PC1A 2B3UA 2Z3KA 2VBQA 4K30A 3ZJ0A 4QC6A 2ZXVA 1I1DA 2Q0YA 4Q36A 1XF8A 4XPDB 3JTKA 1QSOA 2JDDA 4NXYA 2BEIA 1M4GA 5G22A 3DNSA 1YREA 5J8CA 2HUZA 3JVNA 4LX9A 4RS2A 4UBRA 4HNXB 4R87A 5DWNA 2PDOA 3G3SA 1P4NA 4AG7A 4B5PB 4HNYB 3FBUA 5J8FA 2B5GA 4NF1A 4A31A 2ZW4A 3R9GA 2OH1A 4I49A 4PSXA 3LD2A 3R9FA 1Z9UA 3IWEA 3KKWA 2AE6A 5E96A 5JQ4A 1MJ9A 1IYLA 1J4JA 1YR0A 4JXRA 4ZGYB 3DR6A 5BWAB 2B4DB 2GANA 3CXPA 5HMNA 2FT0A 1Q2YA 4B11A 2OU2A 3TO9A 2BUEA 4CAEA 3S6KA 4E0AA 5CNPA 4XPLA 4C2ZA 3FXTA 3R1KA 3VWDA 4UFVA 5H84A 5C88A 2CNMA 2GE3A 1B87A 2H5MA 4PSWA 1Y9WA 5ISVA 3PP9A 2Z0ZA 1KUXA 1PU9A 5KTCA 3T90A 3PZJA 1OZPA 4C7HA 2G3AA 5DWMA 1MJBA 3D3SA 2BL1A 4XNHC 4B10A 3S6FA 1FY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIR A;  3GKR A;  3TCV A;  4MHD A;  2QEC A;  2Q7B A;  2EVN A;  1M44 A;  5IB0 A;  3LOD A;  1N71 A;  4U5Y A;  1YGH A;  4ZBG A;  2P6E A;  1XIX A;  1S7N A;  2FL4 A;  3TE4 A;  4LUA A;  2G3T A;  2Q4V A;  4H6U A;  2GIV A;  3DR8 A;  4QVT A;  2AJ6 A;  2WPW A;  1NMT A;  5F48 A;  4UA3 A;  4H89 A;  4KOS A;  4X5K A;  1MJA A;  3DDD A;  4JLY A;  4MY0 A;  4KOU A;  4JJX A;  4M3S A;  3IWG A;  3OWC A;  3ZZI A;  4KOT A;  4B5O A;  2DXQ A;  2Q44 A;  3R96 A;  4CAV A;  1WWZ A;  3C26 A;  4JD6 A;  3UY5 A;  5FVJ A;  4XNH B;  1K4J A;  2WPX A;  4KLW A;  4E2A A;  2G0B A;  3G8W A;  1S60 A;  4L89 A;  2Z10 A;  1YX0 A;  3F8K A;  5EC4 A;  4ONU A;  3BLN A;  1ON0 A;  1S5K A;  2JLM A;  5GCN A;  1UFH A;  1YVO A;  4KOY A;  2VZZ A;  4B5P A;  4MI4 A;  1QST A;  2ARH A;  2K5T A;  3TO6 A;  3TOA A;  2NMT A;  2C27 A;  2JDC A;  3N7Z A;  2VXK A;  5F46 A;  1GHE A;  1NSL A;  2R8V A;  5F49 A;  2PQ8 A;  2P6G A;  4YGO A;  3I9S A;  3TFY A;  4U9Y A;  2BSW A;  1XEB A;  4HNW B;  3EO4 A;  4KVX A;  5JPH A;  4PK3 A;  2FS5 A;  4ORF A;  1S7L A;  4QBJ A;  2VEZ A;  4FD6 A;  4E8O A;  1QSM A;  4YFJ A;  3TT2 A;  3GY9 A;  3R9E A;  2CNT A;  4AVA A;  4MBU A;  4UWJ A;  1RXT A;  2D4P A;  1Z4R A;  2ZW7 A;  2OZU A;  3CXQ A;  3K9U A;  2HQY A;  4KVM E;  4OAE A;  4J3G A;  2ZPA A;  4QUS A;  1YVK A;  3GYA A;  1IYK A;  3D2M A;  1P0H A;  3MGD A;  2P0W A;  3IGR A;  1Q2D A;  4FD7 A;  1IID A;  1Y7R A;  3H4Q A;  2FSR A;  4KUB A;  1U6M A;  3QAH A;  1LRZ A;  3FYN A;  1M4D A;  1IB1 E;  4Y49 C;  3WR7 A;  3R95 A;  1Z4E A;  2F5I A;  3SXN A;  2A4N A;  3W6X A;  3E0K A;  2ZW6 A;  3TOB A;  4R57 A;  1I21 A;  4FD5 A;  1NE9 A;  2R7H A;  4DNC A;  4M85 A;  5HH1 A;  2QML A;  2EUI A;  2RC4 A;  1KZF A;  2OZG A;  4KUA A;  1XE4 A;  1WK4 A;  3CXS A;  4IF5 A;  2X7B A;  5EBV A;  4JXQ A;  4KOW A;  2PSW A;  3F0A A;  1M1D A;  1SQH A;  3PGP A;  2O28 A;  4EVY A;  1CJW A;  1M4I A;  2JEV A;  3TTH A;  4GS4 A;  2J8N A;  5C82 A;  4OLL A;  5H86 A;  4IUS A;  2FXF A;  2D4O A;  4KLV A;  2REF A;  1Q2C A;  4CAW A;  1R57 A;  3FIX A;  1XMT A;  3RYO A;  1V0C A;  4Y49 B;  1BO4 A;  4NSQ A;  3EC4 A;  3NE7 A;  4U9Z A;  4CAX A;  4YRH A;  1S7K A;  3EXN A;  5KTA A;  2PRB A;  3V8I A;  4R9M A;  2IL4 A;  2FIA A;  4CS0 B;  3P2H A;  2J8M A;  2B5G B;  5F47 A;  2OB0 A;  2R98 A;  3D8P A;  3SXO A;  4KOV A;  1PUA A;  2B4D A;  3QB8 A;  3SHP A;  2I00 A;  3EY5 A;  4AG9 A;  1VKC A;  2Z11 A;  2OZH A;  4AB7 A;  3F5B A;  3T9Y A;  1CM0 A;  2B4B A;  1QSR A;  4R3L A;  5IV0 A;  4KVO E;  2CY2 A;  4BMH A;  3BJ8 A;  4KZT A;  1TIQ A;  3DSB A;  4PV6 A;  4QB9 A;  2FCK A;  2VZY A;  2ATR A;  4CRZ B;  2FE7 A;  3W91 A;  4HKF A;  5I0C A;  1Y9K A;  2REE A;  4JWP A;  3FNC A;  3EFA A;  3S6H A;  3VWE A;  4H6Z A;  4OAD A;  2B3V A;  2Q04 A;  1L0C A;  4AVB A;  2VQY A;  3P2F A;  1YK3 A;  1B6B A;  1S3Z A;  3FRM A;  3I3G A;  4XPD C;  1I12 A;  1KUV A;  4KOR A;  2HV2 A;  2I79 A;  4F0Y A;  1BOB A;  2R1I A;  4MJ8 A;  5KTD A;  4L8A A;  4KOX A;  2ZW5 A;  5IX3 A;  3W6S A;  1VHS A;  2Y0M A;  4FD4 A;  4XPK A;  2P6F A;  4R3K A;  2FIW A;  3BJ7 A;  1IIC A;  4F6A A;  2PR1 A;  2J8R A;  4RI1 A;  1YLE A;  4NEX A;  2Q4Y A;  2VI7 A;  4II9 A;  1S7F A;  1RO5 A;  1MK4 A;  4NCZ A;  2KCW A;  4UWI A;  3S6G A;  4CRY B;  3D2P A;  4AVC A;  3TO7 A;  3B8G A;  1KUY A;  4MY3 A;  4PK2 A;  1QSN A;  2CNS A;  3JUW A;  2PR8 A;  2B58 A;  3FB3 A;  2PC1 A;  2B3U A;  2VBQ A;  4K30 A;  3ZJ0 A;  4QC6 A;  2ZXV A;  1I1D A;  2Q0Y A;  4XPD B;  1XF8 A;  1QSO A;  2JDD A;  4NXY A;  2BEI A;  1M4G A;  3DNS A;  1YRE A;  5J8C A;  2HUZ A;  3JVN A;  4LX9 A;  4RS2 A;  4UBR A;  4HNX B;  4R87 A;  5DWN A;  2PDO A;  3G3S A;  1P4N A;  4AG7 A;  4B5P B;  4HNY B;  3FBU A;  5J8F A;  2B5G A;  4NF1 A;  2ZW4 A;  3R9G A;  2OH1 A;  4I49 A;  4PSX A;  3LD2 A;  3R9F A;  1Z9U A;  3KKW A;  2AE6 A;  5E96 A;  5JQ4 A;  1MJ9 A;  1IYL A;  1J4J A;  1YR0 A;  4JXR A;  3DR6 A;  2B4D B;  2GAN A;  3CXP A;  5HMN A;  2FT0 A;  1Q2Y A;  2OU2 A;  3TO9 A;  2BUE A;  3S6K A;  4E0A A;  5CNP A;  4XPL A;  3FXT A;  3R1K A;  3VWD A;  5H84 A;  5C88 A;  2CNM A;  2GE3 A;  1B87 A;  2H5M A;  4PSW A;  1Y9W A;  5ISV A;  3PP9 A;  2Z0Z A;  1KUX A;  1PU9 A;  5KTC A;  3T90 A;  3PZJ A;  1OZP A;  2G3A A;  5DWM A;  1MJB A;  3D3S A;  2BL1 A;  4XNH C;  3S6F A;  1FY7 A; 
#chains in the Genus database with same CATH topology
 2QIR A;  3GKR A;  3TCV A;  4MHD A;  2QEC A;  2Q7B A;  3NH8 A;  4OKO A;  2EVN A;  1M44 A;  2HB6 A;  3BXM A;  4CAF A;  3H8E A;  4CPA A;  5IB0 A;  3LOD A;  1N71 A;  4U5Y A;  2EWB A;  3SI1 A;  1AYE A;  1GYT A;  1YGH A;  4ZBG A;  1ZO0 A;  2PIZ A;  4G1P A;  2P6E A;  1UWY A;  5ELY A;  5LRK A;  1XIX A;  4MCP A;  4FAI A;  1AUG A;  1S7N A;  1VHO A;  2FL4 A;  4NGT A;  3TE4 A;  2ZEH A;  4LUA A;  2G3T A;  3D7G A;  4UIA A;  2I3C A;  2Q4V A;  4H6U A;  2GIV A;  3DR8 A;  1QMU A;  4QVT A;  2ZOF A;  3KL9 A;  3S9M A;  4MFQ A;  4A37 A;  3NH5 A;  1YW4 A;  2AJ6 A;  2WPW A;  4KSI A;  1NMT A;  4Q7A A;  5F48 A;  2PCU A;  2QVP A;  4UA3 A;  1R43 A;  3QAY A;  4H89 A;  1EE3 P;  1LOK A;  3D67 A;  3FMC A;  4KOS A;  4X5K A;  4OC2 A;  4UCN A;  5EMI A;  2AFZ A;  1MJA A;  2DPT A;  3DDD A;  3N5F A;  4JLY A;  4MMO A;  4MY0 A;  4KOU A;  4DUK A;  1HDU A;  3PBE A;  3H8F A;  4JJX A;  4M3S A;  3IWG A;  1LFW A;  3OWC A;  7CPA A;  3LMS A;  3D66 A;  3WC7 A;  1X10 A;  4ZY0 A;  1OBR A;  3FVL A;  3ZZI A;  4OC3 A;  4KOT A;  2NYQ A;  2DXQ A;  2Q44 A;  3CDX A;  4LQ6 A;  2YNC A;  3KHX A;  3R96 A;  2ZEP A;  4B5O A;  4CAV A;  1WWZ A;  3C26 A;  4F9V A;  2DF5 A;  2C6C A;  4JD6 A;  4PXB A;  2G9D A;  3UY5 A;  1ZG8 A;  5FVJ A;  1YSJ A;  4CGM A;  2FVG A;  4XNH B;  3GB0 A;  1K4J A;  2AFM A;  4CYQ A;  2YND A;  2Z3O A;  2PE3 A;  2WPX A;  4KLW A;  4E2A A;  2G0B A;  3G8W A;  1S60 A;  3IO1 A;  4FBE A;  3SJX A;  4L89 A;  4C7I A;  1Z8L A;  2Z10 A;  5JH9 A;  2CIJ A;  3GUX A;  1YX0 A;  2JBK A;  4R8F A;  3F8K A;  4A30 A;  4WWV A;  4F0X A;  2AFX A;  4ONU A;  5EC4 A;  3BLN A;  1M4L A;  1ON0 A;  1S5K A;  1AMP A;  2JLM A;  2PVW A;  5GCN A;  3RO0 A;  3PB7 X;  1UFH A;  1YW6 A;  1YVO A;  4KOY A;  2PJ4 A;  2VZZ A;  1H8L A;  2Z3M A;  5A27 A;  4M6H A;  3B3V A;  4EFD A;  2YGW A;  3T8W A;  4B5P A;  2BOA A;  3D7D A;  2C6P A;  4MI4 A;  4NJR A;  4C2X A;  1QST A;  2ARH A;  2K5T A;  3IIB A;  3TO6 A;  4A94 A;  3KHZ A;  3TOA A;  5AG5 A;  2NMT A;  3FEC A;  2C27 A;  4Z65 A;  4OC0 A;  1F57 A;  3V7Z A;  2JDC A;  2OOT A;  3JRU A;  2PJ2 A;  3PB4 X;  3N7Z A;  4OC1 A;  3PB6 X;  4NGR A;  2VXK A;  5F46 A;  1LAN A;  3D7F A;  4IHM A;  2J9A A;  3A9L A;  2PJ5 A;  1GHE A;  4K3N A;  2ANP A;  2DPS A;  1NSL A;  2R8V A;  4MCQ A;  5F49 A;  4CGN A;  2XEJ A;  1Z8T A;  1ELL P;  5LRJ A;  2PQ8 A;  2P6G A;  4YGO A;  2RFH A;  3I9S A;  2PJB A;  5LYI A;  1IGB A;  4U9Y A;  3TFY A;  6CPA A;  2BSW A;  1XEB A;  1DTD A;  4HNW B;  3EO4 A;  4MFP A;  4KVX A;  4OME A;  1ELM P;  5JPH A;  1FT7 A;  4PK3 A;  2Q7S A;  2FS5 A;  4ORF A;  4CYO A;  1S7L A;  3H8G A;  4QBJ A;  1XOV A;  2VEZ A;  4FD6 A;  4E8O A;  1QSM A;  4YFJ A;  3TC8 A;  3CPA A;  2QYV A;  4UEZ A;  3TT2 A;  3GY9 A;  2PJ8 A;  2CNT A;  3R9E A;  2C6G A;  4OID A;  4AVA A;  2AFU A;  4MBU A;  4UWJ A;  1RXT A;  2D4P A;  1Z4R A;  2Q51 A;  2OZU A;  2ZW7 A;  3CXQ A;  3K9U A;  4CYP A;  3S9L A;  4PXC A;  5AG7 A;  2HQY A;  4UFW A;  4F9U A;  4KVM E;  3PFO A;  4OAE A;  3B3C A;  1RTQ A;  3D68 A;  4OC5 A;  4P6Y A;  3BI1 A;  4J3G A;  4A32 A;  5LYD A;  2ZPA A;  4QUS A;  3LAC A;  4PXD A;  1YVK A;  3GYA A;  1IYK A;  2YNE A;  3D2M A;  1P0H A;  3MGD A;  2P0W A;  3PFE A;  4ZY2 A;  4B13 A;  3HUV A;  4ZY1 A;  3IGR A;  1Q2D A;  4FD7 A;  2BCO A;  1YME A;  2GLJ A;  1BPM A;  1IID A;  1Y7R A;  2PJ3 A;  3CT9 A;  2C1C A;  2XEI A;  3H4Q A;  2ZEG A;  3IJ3 A;  3PB9 X;  2FSR A;  4KUB A;  4UEE A;  1U6M A;  3QAH A;  4R76 A;  3S9N A;  1CG2 A;  4UCM A;  1IY7 A;  2Z3N A;  2WZN A;  5DS0 A;  1LRZ A;  4W9Y A;  3FYN A;  3D7H A;  1M4D A;  1IB1 E;  4PPZ A;  4Y49 C;  3WR7 A;  3NA6 A;  1ZG9 A;  2CXA A;  1Z4E A;  3DGV A;  3PBB A;  3R95 A;  2F5I A;  4B6Z A;  3SXN A;  2ODF A;  2A4N A;  3W6X A;  4IAV A;  3E0K A;  2V77 A;  2ZW6 A;  3TOB A;  4R57 A;  1I21 A;  3B2Y A;  4FD5 A;  1NE9 A;  4A39 A;  4NGS A;  2R7H A;  8CPA A;  3B35 A;  3B7I A;  4DNC A;  3TX8 A;  1CP7 A;  4M85 A;  1DE4 C;  3FEE A;  5HH1 A;  4FWU A;  3SI0 A;  2QML A;  2EUI A;  2RC4 A;  3RBU A;  5HXD A;  2NSM A;  4GM5 A;  5AG6 A;  1LCP A;  1KZF A;  2OZG A;  5D29 A;  1HEE A;  4KUA A;  1XE4 A;  3KQX A;  1WK4 A;  3CXS A;  4IF5 A;  2X7B A;  2IQ6 A;  4JZ0 A;  2V8H A;  5EBV A;  1TKF A;  4JXQ A;  4KOW A;  2Z3L A;  2ZEO A;  2PSW A;  3F0A A;  1M1D A;  1SQH A;  5JM6 A;  3LWU A;  3PGP A;  2O28 A;  4EVY A;  4MHN A;  5A28 A;  3RZA A;  1CJW A;  1M4I A;  1ARL A;  2JEV A;  2AFW A;  3TTH A;  4C68 A;  4GS4 A;  4PQA A;  4MXU A;  4F8Z A;  3IU2 A;  2J8N A;  2IJZ A;  4KS9 A;  4MHY A;  5C82 A;  3IU1 A;  3NFZ A;  1A2Z A;  4OLL A;  4UF4 A;  5H86 A;  4IUS A;  2FXF A;  3ISZ A;  3VAT A;  3VH9 A;  2D4O A;  4KLV A;  2REF A;  2ZEL A;  5G1Z A;  3VAR A;  1Q2C A;  2V8V A;  4CAW A;  1CPS A;  5CPA A;  3WT4 A;  1R57 A;  4R7M A;  3FIX A;  1XMT A;  1HDQ A;  3RYO A;  1V0C A;  4Y49 B;  5K8M A;  1CBX A;  1BO4 A;  4NSQ A;  1ZLH A;  3EC4 A;  2QJ8 A;  3NE7 A;  4MHZ A;  3FX6 A;  2EO8 A;  1TF8 A;  5LYF A;  2PJA A;  4Q38 A;  4U9Z A;  4ZX9 A;  1PCA A;  4CAX A;  3MRU A;  2CTB A;  4YRH A;  1Z5R A;  3H5Z A;  2ZEE A;  1S7K A;  1TKJ A;  4GXH A;  3FH4 A;  3EXN A;  5KTA A;  3KGQ A;  2F7V A;  2PRB A;  5G20 A;  5AG4 A;  5G21 A;  1NSA A;  4A95 A;  4IK2 A;  3V8I A;  1JWQ A;  4R9M A;  1Z8W A;  2IL4 A;  2FIA A;  4MFJ A;  2WSA A;  2EK8 A;  4C2Y A;  4CS0 B;  3P2H A;  4TWE A;  4TNU A;  2J8M A;  2B5G B;  2Z3P A;  5F47 A;  1CP6 A;  1JQG A;  2OB0 A;  2R98 A;  1F2P A;  3GLJ A;  1IOF A;  3D8P A;  3SXO A;  4KOV A;  2CF4 A;  1PUA A;  2B4D A;  3GIU A;  3QB8 A;  2ZEF A;  3K9T A;  3SHP A;  2DEA A;  2I00 A;  4MCS A;  5HVF A;  3EY5 A;  4X2T A;  4AG9 A;  4P4D A;  5D8N A;  2F8H A;  1VKC A;  3WC5 A;  2Z11 A;  4P4E A;  2OZH A;  4AB7 A;  2O53 A;  3F5B A;  3T9Y A;  4B12 A;  1CM0 A;  2B4B A;  1QSR A;  2ZEN A;  4M6G A;  4R3L A;  5IV0 A;  4R6T A;  4KVO E;  2CY2 A;  4MHP A;  4BMH A;  1BAV A;  3BJ8 A;  4KZT A;  4RUH A;  3KR5 A;  1TIQ A;  3DSB A;  4PV6 A;  1QQ9 A;  4NFR A;  3BI0 A;  3FF3 A;  4UIB A;  4QB9 A;  2WUU A;  1R3N A;  2FCK A;  2PJ6 A;  2VZY A;  2ATR A;  3I1U A;  4CRZ B;  5HVH A;  2GRE A;  3SI2 A;  2FE7 A;  3PEI A;  3PB8 X;  3W91 A;  4HKF A;  1Q7L A;  5K8P A;  3BHX A;  2Q43 A;  5I0C A;  1Y9K A;  4MFZ A;  4BBH A;  2YNC C;  1XJO A;  4ZI6 A;  2REE A;  4JWP A;  3FNC A;  4OP4 A;  3EFA A;  5AGE A;  3S6H A;  3VWE A;  4H6Z A;  4CGP A;  4ZX8 A;  4OAD A;  3HLP A;  2B3V A;  2EK9 A;  2Q04 A;  1L0C A;  4AVB A;  3K2K A;  2PJ1 A;  1Y7E A;  2VQY A;  3P2F A;  4NGQ A;  1Z8X A;  4PXE A;  3FJU A;  3IEH A;  1YK3 A;  1B6B A;  1S3Z A;  3FRM A;  3I3G A;  4XPD C;  1I12 A;  1XMB A;  1KUV A;  4KOR A;  3RNZ A;  2HV2 A;  2OR4 A;  2I79 A;  4F0Y A;  2PJ9 A;  3KQZ A;  4UFX A;  1BOB A;  2R1I A;  2BO9 A;  2ZEM A;  3KAS A;  3SJE A;  5JGF A;  5LYL A;  3ISX A;  4MJ8 A;  5KTD A;  4L8A A;  2PRQ A;  2Q4Z A;  2ZED A;  1VHE A;  4KOX A;  4KSF A;  4P45 A;  4DYO A;  1TKH A;  4YU9 A;  2PVV A;  3V38 A;  2ZW5 A;  5IX3 A;  4BD9 A;  2O4H A;  3W6S A;  1VHS A;  4X8I A;  4P4B A;  4X3R A;  5THW A;  1F2O A;  2Y0M A;  3PRT A;  4P4F A;  4FD4 A;  4XPK A;  4MFK A;  2P6F A;  4R3K A;  4NGN A;  2FIW A;  3BJ7 A;  2PJ0 A;  5HVG A;  1YLO A;  1IIC A;  2WYR A;  1Y0R A;  4F6A A;  3IFE A;  2PR1 A;  4AXV A;  2ABZ A;  2J8R A;  4RI1 A;  4CGO A;  1YLE A;  4MFL A;  4A33 A;  4UCP A;  1LAP A;  4NEX A;  2Q4Y A;  2V8G A;  2VI7 A;  4B14 A;  4II9 A;  4EWT A;  4OIW A;  1S7F A;  1CPX A;  1RO5 A;  4YWY A;  5K8N A;  2GLF A;  4ZYQ A;  5K8O A;  1MK4 A;  1VIX A;  4NCZ A;  2KCW A;  3DLJ A;  4UWI A;  3KR4 A;  3S6G A;  4CGL A;  3KI9 A;  1IU8 A;  4CRY B;  3D2P A;  4AVC A;  3TO7 A;  2EBJ A;  4CYN A;  3B8G A;  1KUY A;  4MY3 A;  4PK2 A;  1QSN A;  2CNS A;  3JUW A;  4KSA A;  5IB9 A;  2PR8 A;  4A2Z A;  2B58 A;  3FB3 A;  2PC1 A;  5I4M A;  2B3U A;  2Z3K A;  1CX8 A;  2VBQ A;  4HPS A;  4K30 A;  3ZJ0 A;  4FUU A;  1Z2L A;  4QC6 A;  2ZXV A;  4P4I A;  4UEF A;  3CPX A;  2JBJ A;  3FED A;  1I1D A;  2HC9 A;  2Q0Y A;  1XF8 A;  4Q36 A;  1LAM A;  4XPD B;  3JTK A;  4MRI A;  1QSO A;  1X12 A;  2JDD A;  3NE8 A;  4A38 A;  4BIN A;  4NXY A;  4EME A;  2XEF A;  2BEI A;  1M4G A;  4P10 A;  1XRY A;  2CTC A;  2PJ7 A;  3B3T A;  3DNS A;  1YRE A;  5G22 A;  4NGM A;  5J8C A;  4P44 A;  5CBM A;  2GU2 A;  5LRG A;  5F09 A;  2HUZ A;  3NH4 A;  2PJC A;  3JVN A;  4LX9 A;  2VL1 A;  4RS2 A;  4O23 A;  4UBR A;  4HNX B;  4P4J A;  4R87 A;  3D4U A;  5DWN A;  1BLL E;  1TF9 A;  1XFO A;  4WJB A;  2PDO A;  2JEW A;  3G3S A;  1P4N A;  1Y0Y A;  4RN7 A;  4AG7 A;  3MN8 A;  4HNY B;  4OC4 A;  4B5P B;  3FBU A;  5J8F A;  2B5G A;  4NF1 A;  4A31 A;  2ZW4 A;  3R9G A;  3SJG A;  2OH1 A;  1XBU A;  2POK A;  3KZW A;  5J1Q A;  4I49 A;  4M6I A;  4PSX A;  3LD2 A;  1TXR A;  3R9F A;  1ARM A;  1VGY A;  1Z9U A;  3WC6 A;  3IWE A;  3KKW A;  2XEG A;  2PIY A;  2AE6 A;  5E96 A;  3B3S A;  1IOI A;  5JQ4 A;  3RAM A;  3B3W A;  1MJ9 A;  1IYL A;  1J4J A;  1YR0 A;  3CZX A;  4H2K A;  4JXR A;  4ZGY B;  3DR6 A;  5BWA B;  1YQE A;  3IWW A;  2B4D B;  2GAN A;  1PYT B;  3CXP A;  4DJL A;  5HMN A;  1ZLI A;  2FT0 A;  1Q2Y A;  3QNV A;  4B11 A;  2OU2 A;  3TO9 A;  2BUE A;  2AFS A;  4CAE A;  4LQG A;  3S6K A;  4E0A A;  2ZOG A;  1KWM A;  4XPL A;  3L2N A;  4MCR A;  5CNP A;  3SJF A;  4C2Z A;  2AFO A;  3FXT A;  4NGP A;  3R1K A;  3VWD A;  4UFV A;  5H84 A;  5C88 A;  2CNM A;  3WAB A;  4ONW A;  2GE3 A;  2V8D A;  2IMO A;  1B87 A;  2H5M A;  4PSW A;  1Y9W A;  5ISV A;  2GFQ A;  1FNO A;  3PP9 A;  2Z0Z A;  1KUX A;  4JYW A;  1PU9 A;  5KTC A;  3T90 A;  3PZJ A;  1OZP A;  2RB7 A;  2G3A A;  4C7H A;  5DWM A;  1MJB A;  3D3S A;  2BL1 A;  4XNH C;  4NJQ A;  1BPN A;  4B10 A;  3S6F A;  1ZG7 A;  1FY7 A;  3IC1 A; 
#chains in the Genus database with same CATH homology
 2QIR A;  3GKR A;  3TCV A;  4MHD A;  2QEC A;  2Q7B A;  2EVN A;  1M44 A;  4CAF A;  5IB0 A;  3LOD A;  1N71 A;  4U5Y A;  1YGH A;  4ZBG A;  1ZO0 A;  2P6E A;  1XIX A;  1S7N A;  2FL4 A;  3TE4 A;  4LUA A;  2G3T A;  2Q4V A;  4H6U A;  2GIV A;  3DR8 A;  4QVT A;  4MFQ A;  2AJ6 A;  2WPW A;  1NMT A;  5F48 A;  4UA3 A;  4H89 A;  4KOS A;  4X5K A;  4UCN A;  4JLY A;  1MJA A;  2DPT A;  3DDD A;  4MY0 A;  4KOU A;  4JJX A;  4M3S A;  3IWG A;  3OWC A;  3ZZI A;  4KOT A;  4B5O A;  2DXQ A;  2Q44 A;  3R96 A;  2YNC A;  4CAV A;  1WWZ A;  3C26 A;  4JD6 A;  3UY5 A;  5FVJ A;  4CGM A;  4XNH B;  1K4J A;  4CYQ A;  2YND A;  2Z3O A;  2WPX A;  4KLW A;  4E2A A;  2G0B A;  3G8W A;  1S60 A;  4L89 A;  4C7I A;  2Z10 A;  4A30 A;  1YX0 A;  3F8K A;  4F0X A;  5EC4 A;  4ONU A;  3BLN A;  1ON0 A;  1S5K A;  2JLM A;  5GCN A;  1UFH A;  1YVO A;  4KOY A;  2VZZ A;  2Z3M A;  5A27 A;  2YGW A;  4C2X A;  4B5P A;  4MI4 A;  1QST A;  2ARH A;  2K5T A;  3TO6 A;  3TOA A;  5AG5 A;  2NMT A;  2C27 A;  2JDC A;  3N7Z A;  2VXK A;  5F46 A;  3A9L A;  1GHE A;  2DPS A;  1NSL A;  2R8V A;  5F49 A;  4CGN A;  2PQ8 A;  2P6G A;  4YGO A;  3I9S A;  3TFY A;  4U9Y A;  2BSW A;  1XEB A;  4HNW B;  3EO4 A;  4MFP A;  4KVX A;  5JPH A;  4PK3 A;  2FS5 A;  4ORF A;  4CYO A;  1S7L A;  4QBJ A;  2VEZ A;  4FD6 A;  4E8O A;  1QSM A;  4YFJ A;  3TT2 A;  3GY9 A;  3R9E A;  2CNT A;  4AVA A;  4MBU A;  4UWJ A;  1RXT A;  2D4P A;  1Z4R A;  2ZW7 A;  2OZU A;  3CXQ A;  3K9U A;  4CYP A;  5AG7 A;  2HQY A;  4UFW A;  4KVM E;  4OAE A;  4J3G A;  4A32 A;  2ZPA A;  4QUS A;  1YVK A;  3GYA A;  1IYK A;  2YNE A;  3D2M A;  1P0H A;  3MGD A;  2P0W A;  4B13 A;  3IGR A;  1Q2D A;  4FD7 A;  1IID A;  1Y7R A;  3H4Q A;  2FSR A;  4KUB A;  1U6M A;  3QAH A;  4UCM A;  2Z3N A;  1LRZ A;  3FYN A;  1M4D A;  1IB1 E;  4Y49 C;  3WR7 A;  2CXA A;  3R95 A;  1Z4E A;  2F5I A;  3SXN A;  2A4N A;  3W6X A;  3E0K A;  2ZW6 A;  3TOB A;  4R57 A;  1I21 A;  4FD5 A;  1NE9 A;  2R7H A;  4DNC A;  4M85 A;  5HH1 A;  2QML A;  2EUI A;  2RC4 A;  5AG6 A;  1KZF A;  2OZG A;  4KUA A;  1XE4 A;  1WK4 A;  3CXS A;  4IF5 A;  2X7B A;  5EBV A;  4JXQ A;  4KOW A;  2Z3L A;  2PSW A;  3F0A A;  1M1D A;  1SQH A;  3PGP A;  2O28 A;  4EVY A;  5A28 A;  1CJW A;  1M4I A;  2JEV A;  3TTH A;  4C68 A;  4GS4 A;  3IU2 A;  2J8N A;  4KS9 A;  5C82 A;  3IU1 A;  4OLL A;  5H86 A;  4IUS A;  2FXF A;  2D4O A;  4KLV A;  2REF A;  5G1Z A;  1Q2C A;  4CAW A;  1R57 A;  3FIX A;  1XMT A;  3RYO A;  1V0C A;  4Y49 B;  1BO4 A;  4NSQ A;  3EC4 A;  3NE7 A;  4Q38 A;  4U9Z A;  4CAX A;  4YRH A;  3H5Z A;  1S7K A;  3EXN A;  5KTA A;  2PRB A;  5G20 A;  5AG4 A;  5G21 A;  4A95 A;  3V8I A;  4R9M A;  2IL4 A;  2FIA A;  4MFJ A;  2WSA A;  4C2Y A;  4CS0 B;  3P2H A;  2J8M A;  2B5G B;  2Z3P A;  5F47 A;  2OB0 A;  2R98 A;  3D8P A;  3SXO A;  4KOV A;  1PUA A;  2B4D A;  3QB8 A;  3SHP A;  2I00 A;  3EY5 A;  4AG9 A;  1VKC A;  2Z11 A;  2OZH A;  4AB7 A;  3F5B A;  3T9Y A;  4B12 A;  1CM0 A;  2B4B A;  1QSR A;  4R3L A;  5IV0 A;  4KVO E;  2CY2 A;  4BMH A;  3BJ8 A;  4KZT A;  1TIQ A;  3DSB A;  4PV6 A;  4QB9 A;  2WUU A;  2FCK A;  2VZY A;  2ATR A;  4CRZ B;  2FE7 A;  3W91 A;  4HKF A;  5I0C A;  1Y9K A;  4MFZ A;  4BBH A;  2YNC C;  2REE A;  4JWP A;  3FNC A;  3EFA A;  5AGE A;  3S6H A;  3VWE A;  4H6Z A;  4CGP A;  4OAD A;  2B3V A;  2Q04 A;  1L0C A;  4AVB A;  2VQY A;  3P2F A;  1YK3 A;  1B6B A;  1S3Z A;  3FRM A;  3I3G A;  4XPD C;  1I12 A;  1KUV A;  4KOR A;  2HV2 A;  2I79 A;  4F0Y A;  4UFX A;  1BOB A;  2R1I A;  4MJ8 A;  5KTD A;  4L8A A;  4KOX A;  4KSF A;  2ZW5 A;  5IX3 A;  3W6S A;  1VHS A;  2Y0M A;  4FD4 A;  4XPK A;  4MFK A;  2P6F A;  4R3K A;  2FIW A;  3BJ7 A;  1IIC A;  4F6A A;  2PR1 A;  2J8R A;  4RI1 A;  4CGO A;  1YLE A;  4MFL A;  4A33 A;  4UCP A;  4NEX A;  2Q4Y A;  2VI7 A;  4B14 A;  4II9 A;  1S7F A;  1RO5 A;  1MK4 A;  4NCZ A;  2KCW A;  4UWI A;  3S6G A;  4CGL A;  4CRY B;  3D2P A;  4AVC A;  3TO7 A;  4CYN A;  3B8G A;  1KUY A;  4MY3 A;  4PK2 A;  1QSN A;  2CNS A;  3JUW A;  4KSA A;  2PR8 A;  4A2Z A;  2B58 A;  3FB3 A;  2PC1 A;  2B3U A;  2Z3K A;  2VBQ A;  4K30 A;  3ZJ0 A;  4QC6 A;  2ZXV A;  1I1D A;  2Q0Y A;  4Q36 A;  1XF8 A;  4XPD B;  3JTK A;  1QSO A;  2JDD A;  4NXY A;  2BEI A;  1M4G A;  5G22 A;  3DNS A;  1YRE A;  5J8C A;  2HUZ A;  3JVN A;  4LX9 A;  4RS2 A;  4UBR A;  4HNX B;  4R87 A;  5DWN A;  2PDO A;  3G3S A;  1P4N A;  4AG7 A;  4B5P B;  4HNY B;  3FBU A;  5J8F A;  2B5G A;  4NF1 A;  4A31 A;  2ZW4 A;  3R9G A;  2OH1 A;  4I49 A;  4PSX A;  3LD2 A;  3R9F A;  1Z9U A;  3IWE A;  3KKW A;  2AE6 A;  5E96 A;  5JQ4 A;  1MJ9 A;  1IYL A;  1J4J A;  1YR0 A;  4JXR A;  4ZGY B;  3DR6 A;  5BWA B;  2B4D B;  2GAN A;  3CXP A;  5HMN A;  2FT0 A;  1Q2Y A;  4B11 A;  2OU2 A;  3TO9 A;  2BUE A;  4CAE A;  3S6K A;  4E0A A;  5CNP A;  4XPL A;  4C2Z A;  3FXT A;  3R1K A;  3VWD A;  4UFV A;  5H84 A;  5C88 A;  2CNM A;  2GE3 A;  1B87 A;  2H5M A;  4PSW A;  1Y9W A;  5ISV A;  3PP9 A;  2Z0Z A;  1KUX A;  1PU9 A;  5KTC A;  3T90 A;  3PZJ A;  1OZP A;  4C7H A;  2G3A A;  5DWM A;  1MJB A;  3D3S A;  2BL1 A;  4XNH C;  4B10 A;  3S6F A;  1FY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...