2B58A

Ssat with coa_sp, spermine disordered, k26r mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
167
structure length
167
Chain Sequence
FVIRPATAADCSDILRLIKELARYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Diamine acetyltransferase 1
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 167
sequence length 167
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b58A00
5CNPA 5FVJA 1LRZA 2ARHA 3EFAA 1KUXA 2CNTA 4JXRA 4J3GA 2ZW7A 4U9YA 1TIQA 1P0HA 1MJAA 4JJXA 1Z9UA 4UA3A 2FS5A 3P2HA 4B5OA 3E0KA 1YGHA 2B3VA 2EUIA 3JUWA 2P6FA 2AE6A 2H5MA 4AVAA 4JWPA 2OB0A 3FRMA 4FD7A 3R95A 1P4NA 3GY9A 3W6XA 2B5GA 2R98A 4GS4A 5KTAA 4XPLA 4E8OA 4NSQA 4AG7A 3GKRA 2P0WA 4L8AA 2PSWA 3K9UA 4HNYB 4AG9A 3R1KA 3FB3A 4H6UA 2G0BA 2BL1A 2P6EA 4QC6A 3EC4A 1KUVA 5C82A 1BO4A 4MI4A 2NMTA 1YX0A 2REFA 2A4NA 4CAXA 3KKWA 1U6MA 3TO7A 1NMTA 3C26A 5F49A 3I9SA 5JPHA 2WPWA 4M85A 2ZXVA 3JVNA 4U9ZA 4Y49B 4X5KA 5EBVA 3TE4A 5I0CA 4XPDB 3PP9A 4B5PA 2Z11A 2OH1A 2ZW6A 1QSMA 4FD4A 3FYNA 2VZZA 4HNWB 3R9EA 3BLNA 4QVTA 4KOVA 4ZBGA 4R3LA 1Z4EA 1IB1E 3V8IA 4YRHA 2JLMA 3B8GA 3P2FA 5J8FA 4KOTA 1FY7A 1IIDA 1N71A 3SHPA 2QIRA 1QSRA 4LUAA 1RXTA 2R7HA 2ATRA 1M4IA 2C27A 5EC4A 4PSXA 3DSBA 2GE3A 1B6BA 3TO9A 5IX3A 1Q2YA 1YR0A 2Z10A 2CY2A 4XNHB 3D2MA 5H86A 5E96A 3GYAA 4RS2A 3IGRA 3S6GA 2BUEA 2PRBA 5HMNA 3TFYA 4R9MA 1S7LA 2JDDA 4E2AA 2P6GA 2R1IA 2PR8A 4KOSA 4AVBA 4KOUA 2DXQA 3QAHA 1MK4A 4U5YA 2FL4A 5JQ4A 2VXKA 2FIWA 1S7FA 3F5BA 4F0YA 3SXNA 3H4QA 2VI7A 2G3TA 2QECA 2Z0ZA 4YGOA 1Q2DA 3R9GA 2HQYA 4CAWA 3EXNA 4IF5A 3ZJ0A 3W6SA 1S7KA 4H6ZA 4XPKA 1SQHA 1XE4A 5GCNA 4PV6A 4QUSA 1Z4RA 4KORA 4MY3A 2O28A 2PDOA 2B4DB 5DWMA 1XIXA 1OZPA 3S6HA 5KTDA 5ISVA 4KVME 3G8WA 2JDCA 1UFHA 1QSNA 3D8PA 1R57A 1IICA 4MJ8A 3EO4A 4UWJA 2Q44A 2PC1A 1I12A 4KLVA 2CNMA 1MJ9A 2Q4VA 4CAVA 1Y9KA 3FIXA 2BSWA 3W91A 2B58A 2BEIA 3MGDA 3BJ7A 3SXOA 1IYLA 4PSWA 3RYOA 3WR7A 2G3AA 1YLEA 1M4DA 4ONUA 4BMHA 3CXQA 4E0AA 2ZPAA 4KOWA 1Q2CA 4AB7A 3TTHA 4KVOE 2I00A 4B5PB 5J8CA 2AJ6A 2Y0MA 4MY0A 2VBQA 3R9FA 3TT2A 4MBUA 4JD6A 4JLYA 1NSLA 1BOBA 3G3SA 4KUAA 1Y7RA 4L89A 4EVYA 2VEZA 3NE7A 5H84A 4NF1A 2FXFA 2OZHA 1NE9A 1XEBA 3F8KA 4MHDA 3T9YA 3CXSA 1I1DA 3FXTA 3OWCA 1S7NA 4Y49C 2KCWA 4ORFA 3S6KA 1WWZA 4KUBA 5IB0A 3I3GA 1J4JA 4XPDC 1Y9WA 2OZUA 2PR1A 2IL4A 5F47A 2QMLA 4PK2A 3DNSA 4K30A 4I49A 2PQ8A 2REEA 3DR8A 4H89A 2Q7BA 5HH1A 1YREA 2X7BA 4NEXA 1V0CA 1K4JA 3D3SA 1VKCA 3EY5A 2J8MA 3N7ZA 1YVKA 3LD2A 3TOBA 4AVCA 4UBRA 2Q4YA 3BJ8A 3T90A 1S5KA 1XF8A 3DDDA 4XNHC 1MJBA 3TCVA 1B87A 1YVOA 4OAEA 5F46A 1QSTA 1S60A 5IV0A 3QB8A 5KTCA 3FNCA 1RO5A 2B5GB 1M4GA 4KZTA 3R96A 4UWIA 3VWDA 2FCKA 1GHEA 4KLWA 4M3SA 3TOAA 2B4DA 1CM0A 4DNCA 5DWNA 1M1DA 2WPXA 2FSRA 4CS0B 4RI1A 4F6AA 4R57A 3IWGA 2Q0YA 1QSOA 1XMTA 3LODA 2J8RA 2ZW4A 2R8VA 2D4OA 4FD5A 5F48A 1M44A 5C88A 4LX9A 3DR6A 2K5TA 3CXPA 1KZFA 2F5IA 4FD6A 4PK3A 3VWEA 1L0CA 3PZJA 1YK3A 1S3ZA 2D4PA 1IYKA 3PGPA 2JEVA 2I79A 2EVNA 4R87A 1ON0A 2CNSA 1I21A 4II9A 2J8NA 4R3KA 1PUAA 4JXQA 4KOYA 4YFJA 4OADA 4HKFA 3FBUA 2GIVA 2OU2A 1KUYA 1PU9A 2VQYA 4HNXB 4NXYA 1WK4A 2OZGA 3D2PA 2RC4A 2GANA 2B3UA 1CJWA 3S6FA 4KOXA 4IUSA 4OLLA 2VZYA 4QB9A 4QBJA 2Q04A 4NCZA 2HV2A 3TO6A 2HUZA 2FE7A 3F0AA 4CRYB 3UY5A 2ZW5A 2FIAA 2FT0A 3ZZIA 2B4BA 4KVXA 1VHSA 4CRZB
chains in the Genus database with same CATH superfamily
3FVLA 1R3NA 4DYOA 4MRIA 5CNPA 3FX6A 2G9DA 2ZEGA 5FVJA 2ZEEA 3B3TA 3JRUA 3KR5A 4OC2A 7CPAA 3PBBA 4ZX9A 4B12A 1LRZA 2AFXA 2ARHA 2EO8A 3EFAA 4AXVA 1KUXA 2CNTA 4JXRA 1H8LA 4CYNA 4J3GA 2ZW7A 3K2KA 4U9YA 3A9LA 4MFJA 1TIQA 2PJCA 1P0HA 4OIDA 1MJAA 4JJXA 1Z9UA 4K3NA 1Q7LA 3I1UA 4UA3A 3IWWA 4NJQA 5EMIA 2CIJA 2DPTA 2FS5A 3D7DA 3P2HA 1Z8LA 2BCOA 2I3CA 2PJ0A 3E0KA 4B5OA 1YGHA 1YLOA 2B3VA 2EUIA 4NFRA 3B3SA 5THWA 1YW6A 3JUWA 2P6FA 1VGYA 2AE6A 3D66A 2ZOGA 2H5MA 2PIZA 4AVAA 4JWPA 2OB0A 1DE4C 3FRMA 4FD7A 3BHXA 2POKA 3R95A 3FEDA 1P4NA 3GY9A 2GU2A 3PBEA 3W6XA 2B5GA 2R98A 4GS4A 4JZ0A 4NGQA 5KTAA 2AFZA 4XPLA 4E8OA 4F0XA 3B3CA 2PVVA 4NSQA 3BI1A 4AG7A 1XFOA 3GKRA 2F8HA 2P0WA 4OKOA 4L8AA 4WWVA 2PSWA 3KR4A 1Z8TA 4ONWA 2Z3PA 3K9UA 4HNYB 4KSIA 4AG9A 3R1KA 2PRQA 4RN7A 2XEJA 2O4HA 3FB3A 4FUUA 4ZY1A 4H6UA 6CPAA 1IOFA 2G0BA 4OIWA 1CPXA 2BL1A 1ZG9A 1ARLA 2PJAA 2P6EA 3IJ3A 4QC6A 3H8EA 3EC4A 2BOAA 2V8VA 4P4EA 1KUVA 2ZEHA 3GB0A 5C82A 1BO4A 2GREA 4R6TA 3MRUA 4MI4A 4YWYA 2NMTA 4KSFA 1YX0A 2REFA 3V38A 2A4NA 4CAXA 3FJUA 5D8NA 1PYTB 3KKWA 1U6MA 1DTDA 3KGQA 4GM5A 3TO7A 1NMTA 3C26A 5F49A 4B10A 4MMOA 2ANPA 1TXRA 3I9SA 4P4DA 2ZEOA 4A31A 4CGMA 2WPWA 4IK2A 3WC6A 5JPHA 4M85A 2ZXVA 3RZAA 3JVNA 3IEHA 4U9ZA 4Y49B 4Z65A 4A95A 2V8HA 4X5KA 5EBVA 1QMUA 4UFVA 3TE4A 5I0CA 2PJ3A 4XPDB 3PP9A 4B5PA 4X3RA 4C2YA 2Z11A 2V8GA 4F9UA 2OH1A 2AFUA 2ZW6A 4NGRA 1M4LA 1Z2LA 1Z8WA 5LRJA 1QSMA 3D7HA 4FD4A 4MFLA 3FYNA 2VZZA 4HNWB 3R9EA 3GUXA 4NGSA 3BLNA 4O23A 3RAMA 4QVTA 4KOVA 4ZBGA 2J9AA 3KHZA 4R3LA 1FT7A 4MFQA 4JYWA 1Z5RA 1Z4EA 2NSMA 5F09A 2ZELA 1IB1E 4CPAA 3V8IA 4EWTA 3NE8A 2JLMA 4YRHA 3B8GA 3P2FA 1CP7A 5J8FA 4KOTA 1FY7A 1JQGA 1XMBA 1CG2A 3D7FA 1IIDA 1N71A 3SHPA 2QIRA 1QSRA 5CPAA 5JH9A 2ZEPA 4LUAA 1RXTA 3B3VA 2R7HA 2ATRA 1M4IA 2FVGA 2C27A 5EC4A 4PSXA 3KASA 5LYDA 3KQZA 3DSBA 2GE3A 3LACA 1B6BA 4MFKA 3TO9A 5IX3A 1CP6A 5K8OA 1Q2YA 1YR0A 5ELYA 2YNEA 2GLJA 2Q4ZA 2Z10A 4OP4A 2CY2A 4XNHB 5J1QA 3D2MA 4LQ6A 5H86A 5E96A 3GYAA 4B14A 4RS2A 5K8MA 4EMEA 2CTCA 2JBJA 3IGRA 3S6GA 5LRGA 2BUEA 4PXEA 2PRBA 5HMNA 3KQXA 4M6HA 4NGPA 4TNUA 1CPSA 3TFYA 2YNDA 4OMEA 4MHYA 4OC3A 2EBJA 4P45A 5HVHA 1XOVA 2EK9A 4R9MA 4C7HA 1S7LA 1YW4A 3FH4A 3TX8A 1YMEA 2O53A 2EWBA 2JDDA 4E2AA 2P6GA 3FF3A 4G1PA 2R1IA 4H2KA 2PR8A 2Q7SA 1LAMA 3NH8A 4KOSA 4AVBA 2XEGA 3QAYA 1ARMA 2DXQA 4KOUA 4MFPA 2WZNA 3CPXA 3PB7X 3PFOA 1MK4A 3QAHA 4U5YA 4CGOA 2EK8A 3B35A 5LYLA 1PCAA 2FL4A 4CGLA 5JQ4A 4P6YA 2CXAA 2VXKA 4Q36A 2FIWA 4Q38A 1VIXA 4ZY2A 3D7GA 3PB8X 1RTQA 1S7FA 3F5BA 4F0YA 4NGMA 2JEWA 1HDQA 3H4QA 3SXNA 4A32A 3RO0A 2C6PA 2VI7A 2G3TA 4TWEA 2QECA 2Z0ZA 4B13A 2V77A 3SI1A 4YGOA 1Q2DA 3R9GA 1YSJA 2HQYA 4CAWA 3EXNA 3N5FA 4CGNA 5HVGA 1HDUA 4IF5A 4PQAA 3IC1A 3ZJ0A 1HEEA 3W6SA 1S7KA 4H6ZA 4XPKA 1SQHA 1XE4A 2ABZA 3FECA 4PXCA 3VARA 3B2YA 1ZG8A 2PJ5A 5GCNA 4MHZA 3CT9A 2C6CA 3D68A 3KL9A 4PV6A 4ZI6A 4X8IA 4QUSA 1Z4RA 2IQ6A 4KORA 1Y7EA 4MY3A 2O28A 2PDOA 4P4BA 2B4DB 2F7VA 5DWMA 3K9TA 2OOTA 3IU2A 4MXUA 3PB4X 5G1ZA 1XIXA 1OZPA 4IAVA 2CTBA 3S6HA 5KTDA 5ISVA 4KVME 3G8WA 2JDCA 4FBEA 2Q51A 1UFHA 1QSNA 3D8PA 1R57A 4UCMA 1XRYA 1F2PA 1XJOA 1IICA 1A2ZA 3EO4A 4MJ8A 4UWJA 2Q44A 3FEEA 2PC1A 3PB9X 4A30A 4CAEA 1I12A 4GXHA 4KLVA 5IB9A 2ZOFA 3SI0A 2CNMA 1Y0YA 2IMOA 2PJ9A 2WYRA 1MJ9A 2Q4VA 4CAVA 4UCPA 1Y9KA 4BBHA 3FIXA 2IJZA 2BSWA 3W91A 4DJLA 3SJGA 2B58A 2BEIA 3MGDA 3BJ7A 3SXOA 1IYLA 3WT4A 4PSWA 5HXDA 2WSAA 4A33A 3IFEA 2BO9A 3IO1A 3RYOA 2G3AA 3WR7A 1YLEA 1Y0RA 1LAPA 1M4DA 4ONUA 4BMHA 3CXQA 1NSAA 4E0AA 4BINA 3SJFA 2ZPAA 2YNCC 4KOWA 1BLLE 1Q2CA 4C7IA 2CF4A 4AB7A 3S9NA 3TTHA 4KVOE 2I00A 4B5PB 3HLPA 4OC4A 4UFWA 5J8CA 2AJ6A 2Y0MA 4MY0A 2VBQA 4Q7AA 5LRKA 3KZWA 4CGPA 3R9FA 3TT2A 4MBUA 4JD6A 3VATA 4JLYA 1NSLA 4UEFA 3NH4A 5AG5A 3NFZA 1BOBA 2Z3LA 2XEFA 3G3SA 4KUAA 3DGVA 1Y7RA 1TKJA 4L89A 4R76A 4MHNA 4EVYA 2VEZA 3H8FA 4UIBA 5LYIA 4EFDA 3HUVA 4PXDA 3NE7A 5H84A 4NF1A 2FXFA 1VHOA 2GFQA 2Z3OA 1TKFA 1NE9A 2ODFA 1XEBA 2OZHA 2ZEDA 3F8KA 4MHDA 3T9YA 4F9VA 3LMSA 1X10A 4KSAA 5HVFA 3CXSA 1I1DA 3FXTA 2PJ1A 1S7NA 2WUUA 3OWCA 2KCWA 4FWUA 3CDXA 4Y49C 1EE3P 3WC5A 5AG4A 4ORFA 2ZENA 4M6IA 3S6KA 1CBXA 1R43A 1WWZA 4KUBA 2GLFA 3I3GA 5IB0A 1J4JA 2DEAA 4W9YA 2ZEMA 1Y9WA 4XPDC 4B6ZA 2OZUA 2PR1A 2IL4A 4F8ZA 5F47A 4MFZA 5K8PA 2Q43A 4CYOA 2QMLA 1ELMP 1KWMA 4A38A 4C2XA 5LYFA 4DUKA 1FNOA 3LWUA 2PJ2A 2QYVA 4PK2A 3SJEA 3DNSA 2PQ8A 2REEA 1IOIA 3H8GA 4I49A 3DR8A 4H89A 4K30A 1GYTA 3FMCA 4OC5A 2Q7BA 3JTKA 2DPSA 3S9MA 5HH1A 1YREA 2X7BA 3ISZA 4NJRA 3IU1A 1IY7A 3PEIA 4NEXA 4UFXA 4FAIA 5I4MA 3SI2A 1V0CA 1K4JA 4A94A 1YQEA 2Z3NA 4MCRA 4KS9A 2XEIA 3D3SA 2C1CA 1VKCA 4UF4A 3EY5A 3VH9A 2J8MA 4MCPA 3N7ZA 3D4UA 4PXBA 2RB7A 1YVKA 3ISXA 3T8WA 2HC9A 3B7IA 3LD2A 2DF5A 3TOBA 4AVCA 5JM6A 4OC0A 2V8DA 2Q4YA 4UBRA 2AFWA 3D67A 3KHXA 1VHEA 2PJ6A 3BJ8A 3T90A 4OC1A 5AG6A 5CBMA 1BPMA 1S5KA 4ZYQA 4MCSA 1XF8A 3DDDA 4XNHC 2PJ4A 5D29A 4ZX8A 1MJBA 2QJ8A 1ZO0A 3TCVA 1B87A 2AFOA 3IIBA 1YVOA 4OAEA 5F46A 1QSTA 1S60A 4B11A 3RBUA 1QQ9A 3QB8A 4UIAA 5IV0A 5KTCA 1ELLP 3FNCA 1RO5A 1TF9A 2B5GB 1M4GA 4HPSA 4KZTA 3V7ZA 1ZLIA 3R96A 1LOKA 1TF8A 2PE3A 3GLJA 4P44A 5JGFA 4UWIA 3VWDA 2FCKA 2RFHA 2YNCA 1GHEA 4KLWA 4M3SA 3WC7A 2NYQA 3TOAA 4M6GA 3BXMA 1X12A 2B4DA 4NGTA 1CM0A 4DNCA 5DWNA 4CYPA 8CPAA 1UWYA 1F2OA 4R8FA 1M1DA 2WPXA 4P4FA 3BI0A 4P10A 4UCNA 2FSRA 4CS0B 1AYEA 4C2ZA 3NA6A 1ZG7A 4RI1A 5DS0A 4F6AA 3CZXA 4R57A 1TKHA 3IWGA 1AMPA 4NGNA 1IGBA 1XBUA 4A2ZA 1ZLHA 2Q0YA 3NH5A 4P4IA 3QNVA 2Z3MA 1QSOA 1XMTA 3TC8A 4RUHA 3LODA 2J8RA 2ZW4A 2R8VA 3KI9A 1BPNA 4MHPA 2D4OA 2C6GA 3RNZA 4FD5A 5F48A 1M44A 3H5ZA 4LX9A 5C88A 1JWQA 2HB6A 2K5TA 3DR6A 3CXPA 1KZFA 5G22A 3DLJA 2F5IA 2Z3KA 2PVWA 4FD6A 4PK3A 3WABA 3VWEA 1L0CA 3PZJA 1YK3A 2AFMA 5K8NA 4X2TA 1S3ZA 2D4PA 1IYKA 3PGPA 2QVPA 1LCPA 2JEVA 2I79A 2EVNA 4R87A 1ON0A 3PRTA 3PB6X 3B3WA 2CNSA 1I21A 4C68A 4R7MA 2J8NA 3CPAA 1PUAA 4R3KA 4JXQA 4KOYA 4YFJA 4II9A 4OADA 5AG7A 4LQGA 3GIUA 4MCQA 1BAVA 4BD9A 1LFWA 4HKFA 3S9LA 3FBUA 2GIVA 3PFEA 2OU2A 3SJXA 4CYQA 1KUYA 4CAFA 5BWAB 2PCUA 1PU9A 5A27A 2VQYA 2YGWA 4HNXB 4NXYA 1WK4A 2OZGA 3D2PA 4PPZA 2RC4A 4WJBA 1LANA 2GANA 2B3UA 3L2NA 1CJWA 3S6FA 4KOXA 4IUSA 5A28A 4OLLA 2VZYA 2JBKA 4QB9A 5AGEA 2PIYA 1Z8XA 4IHMA 4QBJA 1F57A 2PJ8A 2Q04A 3IWEA 4NCZA 4UEZA 4ZGYB 2HV2A 2AFSA 3TO6A 2HUZA 2PJBA 3MN8A 2FE7A 1IU8A 1CX8A 1AUGA 3F0AA 4CRYB 2VL1A 2OR4A 5G20A 3UY5A 4ZY0A 2PJ7A 2ZEFA 4A37A 2ZW5A 1OBRA 2FIAA 2FT0A 5G21A 3ZZIA 4UEEA 2B4BA 4P4JA 4KVXA 4YU9A 1VHSA 4CRZB 4A39A
chains in the Genus database with same CATH topology
5CNPA 5FVJA 4B12A 1LRZA 2ARHA 3EFAA 1KUXA 2CNTA 4JXRA 4CYNA 4J3GA 2ZW7A 4U9YA 3A9LA 4MFJA 1TIQA 1P0HA 1MJAA 4JJXA 1Z9UA 4UA3A 2DPTA 2FS5A 3P2HA 4B5OA 3E0KA 1YGHA 2B3VA 2EUIA 3JUWA 2P6FA 2AE6A 2H5MA 4AVAA 4JWPA 2OB0A 3FRMA 4FD7A 3R95A 1P4NA 3GY9A 3W6XA 2B5GA 2R98A 4GS4A 5KTAA 4XPLA 4E8OA 4F0XA 4NSQA 4AG7A 3GKRA 2P0WA 4L8AA 2PSWA 2Z3PA 3K9UA 4HNYB 4AG9A 3R1KA 3FB3A 4H6UA 2G0BA 2BL1A 2P6EA 4QC6A 3EC4A 1KUVA 5C82A 1BO4A 4MI4A 2NMTA 4KSFA 1YX0A 2REFA 2A4NA 4CAXA 3KKWA 1U6MA 3TO7A 1NMTA 3C26A 5F49A 4B10A 3I9SA 4A31A 5JPHA 4CGMA 2WPWA 4M85A 2ZXVA 3JVNA 4U9ZA 4Y49B 4A95A 4X5KA 5EBVA 4UFVA 3TE4A 5I0CA 4XPDB 3PP9A 4B5PA 4C2YA 2Z11A 2OH1A 2ZW6A 1QSMA 4FD4A 4MFLA 3FYNA 2VZZA 4HNWB 3R9EA 3BLNA 4QVTA 4KOVA 4ZBGA 4R3LA 4MFQA 1Z4EA 1IB1E 3V8IA 4YRHA 2JLMA 3B8GA 3P2FA 5J8FA 4KOTA 1FY7A 1IIDA 1N71A 3SHPA 2QIRA 1QSRA 4LUAA 1RXTA 2R7HA 2ATRA 1M4IA 2C27A 5EC4A 4PSXA 3DSBA 2GE3A 1B6BA 4MFKA 3TO9A 5IX3A 1Q2YA 1YR0A 2YNEA 2Z10A 2CY2A 4XNHB 3D2MA 5H86A 5E96A 3GYAA 4B14A 4RS2A 3IGRA 3S6GA 2BUEA 2PRBA 5HMNA 3TFYA 2YNDA 4R9MA 4C7HA 1S7LA 2JDDA 4E2AA 2P6GA 2R1IA 2PR8A 4KOSA 4AVBA 4KOUA 2DXQA 4MFPA 3QAHA 1MK4A 4U5YA 4CGOA 2FL4A 4CGLA 5JQ4A 2CXAA 2VXKA 4Q36A 2FIWA 4Q38A 1S7FA 3F5BA 4F0YA 4A32A 3SXNA 3H4QA 2VI7A 2G3TA 2QECA 2Z0ZA 4B13A 4YGOA 1Q2DA 3R9GA 2HQYA 4CAWA 3EXNA 4CGNA 4IF5A 3ZJ0A 3W6SA 1S7KA 4H6ZA 4XPKA 1SQHA 1XE4A 5GCNA 4PV6A 4QUSA 1Z4RA 4KORA 4MY3A 2O28A 2PDOA 2B4DB 5DWMA 3IU2A 5G1ZA 1XIXA 1OZPA 3S6HA 5KTDA 5ISVA 4KVME 3G8WA 2JDCA 1UFHA 1QSNA 3D8PA 1R57A 4UCMA 1IICA 4MJ8A 3EO4A 4UWJA 2Q44A 2PC1A 4A30A 4CAEA 1I12A 4KLVA 2CNMA 1MJ9A 2Q4VA 4CAVA 4UCPA 1Y9KA 4BBHA 3FIXA 2BSWA 3W91A 2B58A 2BEIA 3MGDA 3BJ7A 3SXOA 1IYLA 4PSWA 2WSAA 4A33A 3RYOA 3WR7A 2G3AA 1YLEA 1M4DA 4ONUA 4BMHA 3CXQA 4E0AA 2ZPAA 2YNCC 4KOWA 1Q2CA 4C7IA 4AB7A 3TTHA 4KVOE 2I00A 4B5PB 4UFWA 5J8CA 2AJ6A 2Y0MA 4MY0A 2VBQA 4CGPA 3R9FA 3TT2A 4MBUA 4JD6A 4JLYA 1NSLA 5AG5A 1BOBA 2Z3LA 3G3SA 4KUAA 1Y7RA 4L89A 4EVYA 2VEZA 3NE7A 5H84A 4NF1A 2FXFA 5G20A 2Z3OA 2OZHA 1NE9A 1XEBA 3F8KA 4MHDA 3T9YA 4KSAA 3CXSA 1I1DA 3FXTA 3OWCA 1S7NA 2WUUA 4Y49C 2KCWA 5AG4A 4ORFA 3S6KA 1WWZA 4KUBA 5IB0A 3I3GA 1J4JA 4XPDC 1Y9WA 2OZUA 2PR1A 2IL4A 5F47A 4MFZA 4CYOA 2QMLA 4C2XA 4PK2A 3DNSA 2PQ8A 4I49A 2REEA 4K30A 3DR8A 4H89A 2Q7BA 3JTKA 2DPSA 5HH1A 1YREA 2X7BA 3IU1A 4NEXA 4UFXA 1V0CA 1K4JA 2Z3NA 4KS9A 3D3SA 1VKCA 3EY5A 2J8MA 3N7ZA 1YVKA 3LD2A 3TOBA 4AVCA 4UBRA 2Q4YA 3BJ8A 3T90A 5AG6A 1S5KA 1XF8A 3DDDA 4XNHC 1MJBA 1ZO0A 3TCVA 1B87A 1YVOA 4OAEA 5F46A 1QSTA 1S60A 4B11A 5IV0A 3QB8A 5KTCA 3FNCA 1RO5A 2B5GB 1M4GA 4KZTA 3R96A 4UWIA 3VWDA 2FCKA 2YNCA 1GHEA 4KLWA 4M3SA 3TOAA 2B4DA 1CM0A 4DNCA 5DWNA 4CYPA 1M1DA 2WPXA 4UCNA 2FSRA 4CS0B 4C2ZA 4RI1A 4F6AA 4R57A 3IWGA 4A2ZA 2Q0YA 2Z3MA 1QSOA 1XMTA 3LODA 2J8RA 2ZW4A 2R8VA 2D4OA 4FD5A 5F48A 1M44A 3H5ZA 4LX9A 5C88A 3DR6A 2K5TA 3CXPA 1KZFA 5G22A 2F5IA 2Z3KA 4FD6A 4PK3A 3VWEA 1L0CA 3PZJA 1YK3A 1S3ZA 2D4PA 1IYKA 3PGPA 2JEVA 2I79A 2EVNA 4R87A 1ON0A 2CNSA 1I21A 4C68A 4II9A 2J8NA 4R3KA 1PUAA 4JXQA 4KOYA 4YFJA 4OADA 5AG7A 4HKFA 3FBUA 2GIVA 4CYQA 2OU2A 1KUYA 4CAFA 5BWAB 1PU9A 5A27A 2VQYA 2YGWA 4HNXB 4NXYA 1WK4A 2OZGA 3D2PA 2RC4A 2GANA 2B3UA 1CJWA 3S6FA 4KOXA 4IUSA 5A28A 4OLLA 2VZYA 4QB9A 5AGEA 4QBJA 2Q04A 3IWEA 4NCZA 4ZGYB 2HV2A 3TO6A 2HUZA 2FE7A 3F0AA 4CRYB 3UY5A 2ZW5A 2FIAA 2FT0A 5G21A 3ZZIA 2B4BA 4KVXA 1VHSA 4CRZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CNP A;  5FVJ A;  1LRZ A;  2ARH A;  3EFA A;  1KUX A;  2CNT A;  4JXR A;  4J3G A;  2ZW7 A;  4U9Y A;  1TIQ A;  1P0H A;  1MJA A;  4JJX A;  1Z9U A;  4UA3 A;  2FS5 A;  3P2H A;  4B5O A;  3E0K A;  1YGH A;  2B3V A;  2EUI A;  3JUW A;  2P6F A;  2AE6 A;  2H5M A;  4AVA A;  4JWP A;  2OB0 A;  3FRM A;  4FD7 A;  3R95 A;  1P4N A;  3GY9 A;  3W6X A;  2B5G A;  2R98 A;  4GS4 A;  5KTA A;  4XPL A;  4E8O A;  4NSQ A;  4AG7 A;  3GKR A;  2P0W A;  4L8A A;  2PSW A;  3K9U A;  4HNY B;  4AG9 A;  3R1K A;  3FB3 A;  4H6U A;  2G0B A;  2BL1 A;  2P6E A;  4QC6 A;  3EC4 A;  1KUV A;  5C82 A;  1BO4 A;  4MI4 A;  2NMT A;  1YX0 A;  2REF A;  2A4N A;  4CAX A;  3KKW A;  1U6M A;  3TO7 A;  1NMT A;  3C26 A;  5F49 A;  3I9S A;  5JPH A;  2WPW A;  4M85 A;  2ZXV A;  3JVN A;  4U9Z A;  4Y49 B;  4X5K A;  5EBV A;  3TE4 A;  5I0C A;  4XPD B;  3PP9 A;  4B5P A;  2Z11 A;  2OH1 A;  2ZW6 A;  1QSM A;  4FD4 A;  3FYN A;  2VZZ A;  4HNW B;  3R9E A;  3BLN A;  4QVT A;  4KOV A;  4ZBG A;  4R3L A;  1Z4E A;  1IB1 E;  3V8I A;  4YRH A;  2JLM A;  3B8G A;  3P2F A;  5J8F A;  4KOT A;  1FY7 A;  1IID A;  1N71 A;  3SHP A;  2QIR A;  1QSR A;  4LUA A;  1RXT A;  2R7H A;  2ATR A;  1M4I A;  2C27 A;  5EC4 A;  4PSX A;  3DSB A;  2GE3 A;  1B6B A;  3TO9 A;  5IX3 A;  1Q2Y A;  1YR0 A;  2Z10 A;  2CY2 A;  4XNH B;  3D2M A;  5H86 A;  5E96 A;  3GYA A;  4RS2 A;  3IGR A;  3S6G A;  2BUE A;  2PRB A;  5HMN A;  3TFY A;  4R9M A;  1S7L A;  2JDD A;  4E2A A;  2P6G A;  2R1I A;  2PR8 A;  4KOS A;  4AVB A;  4KOU A;  2DXQ A;  3QAH A;  1MK4 A;  4U5Y A;  2FL4 A;  5JQ4 A;  2VXK A;  2FIW A;  1S7F A;  3F5B A;  4F0Y A;  3SXN A;  3H4Q A;  2VI7 A;  2G3T A;  2QEC A;  2Z0Z A;  4YGO A;  1Q2D A;  3R9G A;  2HQY A;  4CAW A;  3EXN A;  4IF5 A;  3ZJ0 A;  3W6S A;  1S7K A;  4H6Z A;  4XPK A;  1SQH A;  1XE4 A;  5GCN A;  4PV6 A;  4QUS A;  1Z4R A;  4KOR A;  4MY3 A;  2O28 A;  2PDO A;  2B4D B;  5DWM A;  1XIX A;  1OZP A;  3S6H A;  5KTD A;  5ISV A;  4KVM E;  3G8W A;  2JDC A;  1UFH A;  1QSN A;  3D8P A;  1R57 A;  1IIC A;  4MJ8 A;  3EO4 A;  4UWJ A;  2Q44 A;  2PC1 A;  1I12 A;  4KLV A;  2CNM A;  1MJ9 A;  2Q4V A;  4CAV A;  1Y9K A;  3FIX A;  2BSW A;  3W91 A;  2B58 A;  2BEI A;  3MGD A;  3BJ7 A;  3SXO A;  1IYL A;  4PSW A;  3RYO A;  3WR7 A;  2G3A A;  1YLE A;  1M4D A;  4ONU A;  4BMH A;  3CXQ A;  4E0A A;  2ZPA A;  4KOW A;  1Q2C A;  4AB7 A;  3TTH A;  4KVO E;  2I00 A;  4B5P B;  5J8C A;  2AJ6 A;  2Y0M A;  4MY0 A;  2VBQ A;  3R9F A;  3TT2 A;  4MBU A;  4JD6 A;  4JLY A;  1NSL A;  1BOB A;  3G3S A;  4KUA A;  1Y7R A;  4L89 A;  4EVY A;  2VEZ A;  3NE7 A;  5H84 A;  4NF1 A;  2FXF A;  2OZH A;  1NE9 A;  1XEB A;  3F8K A;  4MHD A;  3T9Y A;  3CXS A;  1I1D A;  3FXT A;  3OWC A;  1S7N A;  4Y49 C;  2KCW A;  4ORF A;  3S6K A;  1WWZ A;  4KUB A;  5IB0 A;  3I3G A;  1J4J A;  4XPD C;  1Y9W A;  2OZU A;  2PR1 A;  2IL4 A;  5F47 A;  2QML A;  4PK2 A;  3DNS A;  4K30 A;  4I49 A;  2PQ8 A;  2REE A;  3DR8 A;  4H89 A;  2Q7B A;  5HH1 A;  1YRE A;  2X7B A;  4NEX A;  1V0C A;  1K4J A;  3D3S A;  1VKC A;  3EY5 A;  2J8M A;  3N7Z A;  1YVK A;  3LD2 A;  3TOB A;  4AVC A;  4UBR A;  2Q4Y A;  3BJ8 A;  3T90 A;  1S5K A;  1XF8 A;  3DDD A;  4XNH C;  1MJB A;  3TCV A;  1B87 A;  1YVO A;  4OAE A;  5F46 A;  1QST A;  1S60 A;  5IV0 A;  3QB8 A;  5KTC A;  3FNC A;  1RO5 A;  2B5G B;  1M4G A;  4KZT A;  3R96 A;  4UWI A;  3VWD A;  2FCK A;  1GHE A;  4KLW A;  4M3S A;  3TOA A;  2B4D A;  1CM0 A;  4DNC A;  5DWN A;  1M1D A;  2WPX A;  2FSR A;  4CS0 B;  4RI1 A;  4F6A A;  4R57 A;  3IWG A;  2Q0Y A;  1QSO A;  1XMT A;  3LOD A;  2J8R A;  2ZW4 A;  2R8V A;  2D4O A;  4FD5 A;  5F48 A;  1M44 A;  5C88 A;  4LX9 A;  3DR6 A;  2K5T A;  3CXP A;  1KZF A;  2F5I A;  4FD6 A;  4PK3 A;  3VWE A;  1L0C A;  3PZJ A;  1YK3 A;  1S3Z A;  2D4P A;  1IYK A;  3PGP A;  2JEV A;  2I79 A;  2EVN A;  4R87 A;  1ON0 A;  2CNS A;  1I21 A;  4II9 A;  2J8N A;  4R3K A;  1PUA A;  4JXQ A;  4KOY A;  4YFJ A;  4OAD A;  4HKF A;  3FBU A;  2GIV A;  2OU2 A;  1KUY A;  1PU9 A;  2VQY A;  4HNX B;  4NXY A;  1WK4 A;  2OZG A;  3D2P A;  2RC4 A;  2GAN A;  2B3U A;  1CJW A;  3S6F A;  4KOX A;  4IUS A;  4OLL A;  2VZY A;  4QB9 A;  4QBJ A;  2Q04 A;  4NCZ A;  2HV2 A;  3TO6 A;  2HUZ A;  2FE7 A;  3F0A A;  4CRY B;  3UY5 A;  2ZW5 A;  2FIA A;  2FT0 A;  3ZZI A;  2B4B A;  4KVX A;  1VHS A;  4CRZ B; 
#chains in the Genus database with same CATH topology
 3FVL A;  1R3N A;  4DYO A;  4MRI A;  5CNP A;  3FX6 A;  2G9D A;  2ZEG A;  5FVJ A;  2ZEE A;  3B3T A;  3JRU A;  3KR5 A;  4OC2 A;  7CPA A;  3PBB A;  4ZX9 A;  4B12 A;  1LRZ A;  2AFX A;  2ARH A;  2EO8 A;  3EFA A;  4AXV A;  1KUX A;  2CNT A;  4JXR A;  1H8L A;  4CYN A;  4J3G A;  2ZW7 A;  3K2K A;  4U9Y A;  3A9L A;  4MFJ A;  1TIQ A;  2PJC A;  1P0H A;  4OID A;  1MJA A;  4JJX A;  1Z9U A;  4K3N A;  1Q7L A;  3I1U A;  4UA3 A;  3IWW A;  4NJQ A;  5EMI A;  2CIJ A;  2DPT A;  2FS5 A;  3D7D A;  3P2H A;  1Z8L A;  2BCO A;  2I3C A;  2PJ0 A;  3E0K A;  4B5O A;  1YGH A;  1YLO A;  2B3V A;  2EUI A;  4NFR A;  3B3S A;  5THW A;  1YW6 A;  3JUW A;  2P6F A;  1VGY A;  2AE6 A;  3D66 A;  2ZOG A;  2H5M A;  2PIZ A;  4AVA A;  4JWP A;  2OB0 A;  1DE4 C;  3FRM A;  4FD7 A;  3BHX A;  2POK A;  3R95 A;  3FED A;  1P4N A;  3GY9 A;  2GU2 A;  3PBE A;  3W6X A;  2B5G A;  2R98 A;  4GS4 A;  4JZ0 A;  4NGQ A;  5KTA A;  2AFZ A;  4XPL A;  4E8O A;  4F0X A;  3B3C A;  2PVV A;  4NSQ A;  3BI1 A;  4AG7 A;  1XFO A;  3GKR A;  2F8H A;  2P0W A;  4OKO A;  4L8A A;  4WWV A;  2PSW A;  3KR4 A;  1Z8T A;  4ONW A;  2Z3P A;  3K9U A;  4HNY B;  4KSI A;  4AG9 A;  3R1K A;  2PRQ A;  4RN7 A;  2XEJ A;  2O4H A;  3FB3 A;  4FUU A;  4ZY1 A;  4H6U A;  6CPA A;  1IOF A;  2G0B A;  4OIW A;  1CPX A;  2BL1 A;  1ZG9 A;  1ARL A;  2PJA A;  2P6E A;  3IJ3 A;  4QC6 A;  3H8E A;  3EC4 A;  2BOA A;  2V8V A;  4P4E A;  1KUV A;  2ZEH A;  3GB0 A;  5C82 A;  1BO4 A;  2GRE A;  4R6T A;  3MRU A;  4MI4 A;  4YWY A;  2NMT A;  4KSF A;  1YX0 A;  2REF A;  3V38 A;  2A4N A;  4CAX A;  3FJU A;  5D8N A;  1PYT B;  3KKW A;  1U6M A;  1DTD A;  3KGQ A;  4GM5 A;  3TO7 A;  1NMT A;  3C26 A;  5F49 A;  4B10 A;  4MMO A;  2ANP A;  1TXR A;  3I9S A;  4P4D A;  2ZEO A;  4A31 A;  4CGM A;  2WPW A;  4IK2 A;  3WC6 A;  5JPH A;  4M85 A;  2ZXV A;  3RZA A;  3JVN A;  3IEH A;  4U9Z A;  4Y49 B;  4Z65 A;  4A95 A;  2V8H A;  4X5K A;  5EBV A;  1QMU A;  4UFV A;  3TE4 A;  5I0C A;  2PJ3 A;  4XPD B;  3PP9 A;  4B5P A;  4X3R A;  4C2Y A;  2Z11 A;  2V8G A;  4F9U A;  2OH1 A;  2AFU A;  2ZW6 A;  4NGR A;  1M4L A;  1Z2L A;  1Z8W A;  5LRJ A;  1QSM A;  3D7H A;  4FD4 A;  4MFL A;  3FYN A;  2VZZ A;  4HNW B;  3R9E A;  3GUX A;  4NGS A;  3BLN A;  4O23 A;  3RAM A;  4QVT A;  4KOV A;  4ZBG A;  2J9A A;  3KHZ A;  4R3L A;  1FT7 A;  4MFQ A;  4JYW A;  1Z5R A;  1Z4E A;  2NSM A;  5F09 A;  2ZEL A;  1IB1 E;  4CPA A;  3V8I A;  4EWT A;  3NE8 A;  2JLM A;  4YRH A;  3B8G A;  3P2F A;  1CP7 A;  5J8F A;  4KOT A;  1FY7 A;  1JQG A;  1XMB A;  1CG2 A;  3D7F A;  1IID A;  1N71 A;  3SHP A;  2QIR A;  1QSR A;  5CPA A;  5JH9 A;  2ZEP A;  4LUA A;  1RXT A;  3B3V A;  2R7H A;  2ATR A;  1M4I A;  2FVG A;  2C27 A;  5EC4 A;  4PSX A;  3KAS A;  5LYD A;  3KQZ A;  3DSB A;  2GE3 A;  3LAC A;  1B6B A;  4MFK A;  3TO9 A;  5IX3 A;  1CP6 A;  5K8O A;  1Q2Y A;  1YR0 A;  5ELY A;  2YNE A;  2GLJ A;  2Q4Z A;  2Z10 A;  4OP4 A;  2CY2 A;  4XNH B;  5J1Q A;  3D2M A;  4LQ6 A;  5H86 A;  5E96 A;  3GYA A;  4B14 A;  4RS2 A;  5K8M A;  4EME A;  2CTC A;  2JBJ A;  3IGR A;  3S6G A;  5LRG A;  2BUE A;  4PXE A;  2PRB A;  5HMN A;  3KQX A;  4M6H A;  4NGP A;  4TNU A;  1CPS A;  3TFY A;  2YND A;  4OME A;  4MHY A;  4OC3 A;  2EBJ A;  4P45 A;  5HVH A;  1XOV A;  2EK9 A;  4R9M A;  4C7H A;  1S7L A;  1YW4 A;  3FH4 A;  3TX8 A;  1YME A;  2O53 A;  2EWB A;  2JDD A;  4E2A A;  2P6G A;  3FF3 A;  4G1P A;  2R1I A;  4H2K A;  2PR8 A;  2Q7S A;  1LAM A;  3NH8 A;  4KOS A;  4AVB A;  2XEG A;  3QAY A;  1ARM A;  2DXQ A;  4KOU A;  4MFP A;  2WZN A;  3CPX A;  3PB7 X;  3PFO A;  1MK4 A;  3QAH A;  4U5Y A;  4CGO A;  2EK8 A;  3B35 A;  5LYL A;  1PCA A;  2FL4 A;  4CGL A;  5JQ4 A;  4P6Y A;  2CXA A;  2VXK A;  4Q36 A;  2FIW A;  4Q38 A;  1VIX A;  4ZY2 A;  3D7G A;  3PB8 X;  1RTQ A;  1S7F A;  3F5B A;  4F0Y A;  4NGM A;  2JEW A;  1HDQ A;  3H4Q A;  3SXN A;  4A32 A;  3RO0 A;  2C6P A;  2VI7 A;  2G3T A;  4TWE A;  2QEC A;  2Z0Z A;  4B13 A;  2V77 A;  3SI1 A;  4YGO A;  1Q2D A;  3R9G A;  1YSJ A;  2HQY A;  4CAW A;  3EXN A;  3N5F A;  4CGN A;  5HVG A;  1HDU A;  4IF5 A;  4PQA A;  3IC1 A;  3ZJ0 A;  1HEE A;  3W6S A;  1S7K A;  4H6Z A;  4XPK A;  1SQH A;  1XE4 A;  2ABZ A;  3FEC A;  4PXC A;  3VAR A;  3B2Y A;  1ZG8 A;  2PJ5 A;  5GCN A;  4MHZ A;  3CT9 A;  2C6C A;  3D68 A;  3KL9 A;  4PV6 A;  4ZI6 A;  4X8I A;  4QUS A;  1Z4R A;  2IQ6 A;  4KOR A;  1Y7E A;  4MY3 A;  2O28 A;  2PDO A;  4P4B A;  2B4D B;  2F7V A;  5DWM A;  3K9T A;  2OOT A;  3IU2 A;  4MXU A;  3PB4 X;  5G1Z A;  1XIX A;  1OZP A;  4IAV A;  2CTB A;  3S6H A;  5KTD A;  5ISV A;  4KVM E;  3G8W A;  2JDC A;  4FBE A;  2Q51 A;  1UFH A;  1QSN A;  3D8P A;  1R57 A;  4UCM A;  1XRY A;  1F2P A;  1XJO A;  1IIC A;  1A2Z A;  3EO4 A;  4MJ8 A;  4UWJ A;  2Q44 A;  3FEE A;  2PC1 A;  3PB9 X;  4A30 A;  4CAE A;  1I12 A;  4GXH A;  4KLV A;  5IB9 A;  2ZOF A;  3SI0 A;  2CNM A;  1Y0Y A;  2IMO A;  2PJ9 A;  2WYR A;  1MJ9 A;  2Q4V A;  4CAV A;  4UCP A;  1Y9K A;  4BBH A;  3FIX A;  2IJZ A;  2BSW A;  3W91 A;  4DJL A;  3SJG A;  2B58 A;  2BEI A;  3MGD A;  3BJ7 A;  3SXO A;  1IYL A;  3WT4 A;  4PSW A;  5HXD A;  2WSA A;  4A33 A;  3IFE A;  2BO9 A;  3IO1 A;  3RYO A;  2G3A A;  3WR7 A;  1YLE A;  1Y0R A;  1LAP A;  1M4D A;  4ONU A;  4BMH A;  3CXQ A;  1NSA A;  4E0A A;  4BIN A;  3SJF A;  2ZPA A;  2YNC C;  4KOW A;  1BLL E;  1Q2C A;  4C7I A;  2CF4 A;  4AB7 A;  3S9N A;  3TTH A;  4KVO E;  2I00 A;  4B5P B;  3HLP A;  4OC4 A;  4UFW A;  5J8C A;  2AJ6 A;  2Y0M A;  4MY0 A;  2VBQ A;  4Q7A A;  5LRK A;  3KZW A;  4CGP A;  3R9F A;  3TT2 A;  4MBU A;  4JD6 A;  3VAT A;  4JLY A;  1NSL A;  4UEF A;  3NH4 A;  5AG5 A;  3NFZ A;  1BOB A;  2Z3L A;  2XEF A;  3G3S A;  4KUA A;  3DGV A;  1Y7R A;  1TKJ A;  4L89 A;  4R76 A;  4MHN A;  4EVY A;  2VEZ A;  3H8F A;  4UIB A;  5LYI A;  4EFD A;  3HUV A;  4PXD A;  3NE7 A;  5H84 A;  4NF1 A;  2FXF A;  1VHO A;  2GFQ A;  2Z3O A;  1TKF A;  1NE9 A;  2ODF A;  1XEB A;  2OZH A;  2ZED A;  3F8K A;  4MHD A;  3T9Y A;  4F9V A;  3LMS A;  1X10 A;  4KSA A;  5HVF A;  3CXS A;  1I1D A;  3FXT A;  2PJ1 A;  1S7N A;  2WUU A;  3OWC A;  2KCW A;  4FWU A;  3CDX A;  4Y49 C;  1EE3 P;  3WC5 A;  5AG4 A;  4ORF A;  2ZEN A;  4M6I A;  3S6K A;  1CBX A;  1R43 A;  1WWZ A;  4KUB A;  2GLF A;  3I3G A;  5IB0 A;  1J4J A;  2DEA A;  4W9Y A;  2ZEM A;  1Y9W A;  4XPD C;  4B6Z A;  2OZU A;  2PR1 A;  2IL4 A;  4F8Z A;  5F47 A;  4MFZ A;  5K8P A;  2Q43 A;  4CYO A;  2QML A;  1ELM P;  1KWM A;  4A38 A;  4C2X A;  5LYF A;  4DUK A;  1FNO A;  3LWU A;  2PJ2 A;  2QYV A;  4PK2 A;  3SJE A;  3DNS A;  2PQ8 A;  2REE A;  1IOI A;  3H8G A;  4I49 A;  3DR8 A;  4H89 A;  4K30 A;  1GYT A;  3FMC A;  4OC5 A;  2Q7B A;  3JTK A;  2DPS A;  3S9M A;  5HH1 A;  1YRE A;  2X7B A;  3ISZ A;  4NJR A;  3IU1 A;  1IY7 A;  3PEI A;  4NEX A;  4UFX A;  4FAI A;  5I4M A;  3SI2 A;  1V0C A;  1K4J A;  4A94 A;  1YQE A;  2Z3N A;  4MCR A;  4KS9 A;  2XEI A;  3D3S A;  2C1C A;  1VKC A;  4UF4 A;  3EY5 A;  3VH9 A;  2J8M A;  4MCP A;  3N7Z A;  3D4U A;  4PXB A;  2RB7 A;  1YVK A;  3ISX A;  3T8W A;  2HC9 A;  3B7I A;  3LD2 A;  2DF5 A;  3TOB A;  4AVC A;  5JM6 A;  4OC0 A;  2V8D A;  2Q4Y A;  4UBR A;  2AFW A;  3D67 A;  3KHX A;  1VHE A;  2PJ6 A;  3BJ8 A;  3T90 A;  4OC1 A;  5AG6 A;  5CBM A;  1BPM A;  1S5K A;  4ZYQ A;  4MCS A;  1XF8 A;  3DDD A;  4XNH C;  2PJ4 A;  5D29 A;  4ZX8 A;  1MJB A;  2QJ8 A;  1ZO0 A;  3TCV A;  1B87 A;  2AFO A;  3IIB A;  1YVO A;  4OAE A;  5F46 A;  1QST A;  1S60 A;  4B11 A;  3RBU A;  1QQ9 A;  3QB8 A;  4UIA A;  5IV0 A;  5KTC A;  1ELL P;  3FNC A;  1RO5 A;  1TF9 A;  2B5G B;  1M4G A;  4HPS A;  4KZT A;  3V7Z A;  1ZLI A;  3R96 A;  1LOK A;  1TF8 A;  2PE3 A;  3GLJ A;  4P44 A;  5JGF A;  4UWI A;  3VWD A;  2FCK A;  2RFH A;  2YNC A;  1GHE A;  4KLW A;  4M3S A;  3WC7 A;  2NYQ A;  3TOA A;  4M6G A;  3BXM A;  1X12 A;  2B4D A;  4NGT A;  1CM0 A;  4DNC A;  5DWN A;  4CYP A;  8CPA A;  1UWY A;  1F2O A;  4R8F A;  1M1D A;  2WPX A;  4P4F A;  3BI0 A;  4P10 A;  4UCN A;  2FSR A;  4CS0 B;  1AYE A;  4C2Z A;  3NA6 A;  1ZG7 A;  4RI1 A;  5DS0 A;  4F6A A;  3CZX A;  4R57 A;  1TKH A;  3IWG A;  1AMP A;  4NGN A;  1IGB A;  1XBU A;  4A2Z A;  1ZLH A;  2Q0Y A;  3NH5 A;  4P4I A;  3QNV A;  2Z3M A;  1QSO A;  1XMT A;  3TC8 A;  4RUH A;  3LOD A;  2J8R A;  2ZW4 A;  2R8V A;  3KI9 A;  1BPN A;  4MHP A;  2D4O A;  2C6G A;  3RNZ A;  4FD5 A;  5F48 A;  1M44 A;  3H5Z A;  4LX9 A;  5C88 A;  1JWQ A;  2HB6 A;  2K5T A;  3DR6 A;  3CXP A;  1KZF A;  5G22 A;  3DLJ A;  2F5I A;  2Z3K A;  2PVW A;  4FD6 A;  4PK3 A;  3WAB A;  3VWE A;  1L0C A;  3PZJ A;  1YK3 A;  2AFM A;  5K8N A;  4X2T A;  1S3Z A;  2D4P A;  1IYK A;  3PGP A;  2QVP A;  1LCP A;  2JEV A;  2I79 A;  2EVN A;  4R87 A;  1ON0 A;  3PRT A;  3PB6 X;  3B3W A;  2CNS A;  1I21 A;  4C68 A;  4R7M A;  2J8N A;  3CPA A;  1PUA A;  4R3K A;  4JXQ A;  4KOY A;  4YFJ A;  4II9 A;  4OAD A;  5AG7 A;  4LQG A;  3GIU A;  4MCQ A;  1BAV A;  4BD9 A;  1LFW A;  4HKF A;  3S9L A;  3FBU A;  2GIV A;  3PFE A;  2OU2 A;  3SJX A;  4CYQ A;  1KUY A;  4CAF A;  5BWA B;  2PCU A;  1PU9 A;  5A27 A;  2VQY A;  2YGW A;  4HNX B;  4NXY A;  1WK4 A;  2OZG A;  3D2P A;  4PPZ A;  2RC4 A;  4WJB A;  1LAN A;  2GAN A;  2B3U A;  3L2N A;  1CJW A;  3S6F A;  4KOX A;  4IUS A;  5A28 A;  4OLL A;  2VZY A;  2JBK A;  4QB9 A;  5AGE A;  2PIY A;  1Z8X A;  4IHM A;  4QBJ A;  1F57 A;  2PJ8 A;  2Q04 A;  3IWE A;  4NCZ A;  4UEZ A;  4ZGY B;  2HV2 A;  2AFS A;  3TO6 A;  2HUZ A;  2PJB A;  3MN8 A;  2FE7 A;  1IU8 A;  1CX8 A;  1AUG A;  3F0A A;  4CRY B;  2VL1 A;  2OR4 A;  5G20 A;  3UY5 A;  4ZY0 A;  2PJ7 A;  2ZEF A;  4A37 A;  2ZW5 A;  1OBR A;  2FIA A;  2FT0 A;  5G21 A;  3ZZI A;  4UEE A;  2B4B A;  4P4J A;  4KVX A;  4YU9 A;  1VHS A;  4CRZ B;  4A39 A; 
#chains in the Genus database with same CATH homology
 5CNP A;  5FVJ A;  4B12 A;  1LRZ A;  2ARH A;  3EFA A;  1KUX A;  2CNT A;  4JXR A;  4CYN A;  4J3G A;  2ZW7 A;  4U9Y A;  3A9L A;  4MFJ A;  1TIQ A;  1P0H A;  1MJA A;  4JJX A;  1Z9U A;  4UA3 A;  2DPT A;  2FS5 A;  3P2H A;  4B5O A;  3E0K A;  1YGH A;  2B3V A;  2EUI A;  3JUW A;  2P6F A;  2AE6 A;  2H5M A;  4AVA A;  4JWP A;  2OB0 A;  3FRM A;  4FD7 A;  3R95 A;  1P4N A;  3GY9 A;  3W6X A;  2B5G A;  2R98 A;  4GS4 A;  5KTA A;  4XPL A;  4E8O A;  4F0X A;  4NSQ A;  4AG7 A;  3GKR A;  2P0W A;  4L8A A;  2PSW A;  2Z3P A;  3K9U A;  4HNY B;  4AG9 A;  3R1K A;  3FB3 A;  4H6U A;  2G0B A;  2BL1 A;  2P6E A;  4QC6 A;  3EC4 A;  1KUV A;  5C82 A;  1BO4 A;  4MI4 A;  2NMT A;  4KSF A;  1YX0 A;  2REF A;  2A4N A;  4CAX A;  3KKW A;  1U6M A;  3TO7 A;  1NMT A;  3C26 A;  5F49 A;  4B10 A;  3I9S A;  4A31 A;  5JPH A;  4CGM A;  2WPW A;  4M85 A;  2ZXV A;  3JVN A;  4U9Z A;  4Y49 B;  4A95 A;  4X5K A;  5EBV A;  4UFV A;  3TE4 A;  5I0C A;  4XPD B;  3PP9 A;  4B5P A;  4C2Y A;  2Z11 A;  2OH1 A;  2ZW6 A;  1QSM A;  4FD4 A;  4MFL A;  3FYN A;  2VZZ A;  4HNW B;  3R9E A;  3BLN A;  4QVT A;  4KOV A;  4ZBG A;  4R3L A;  4MFQ A;  1Z4E A;  1IB1 E;  3V8I A;  4YRH A;  2JLM A;  3B8G A;  3P2F A;  5J8F A;  4KOT A;  1FY7 A;  1IID A;  1N71 A;  3SHP A;  2QIR A;  1QSR A;  4LUA A;  1RXT A;  2R7H A;  2ATR A;  1M4I A;  2C27 A;  5EC4 A;  4PSX A;  3DSB A;  2GE3 A;  1B6B A;  4MFK A;  3TO9 A;  5IX3 A;  1Q2Y A;  1YR0 A;  2YNE A;  2Z10 A;  2CY2 A;  4XNH B;  3D2M A;  5H86 A;  5E96 A;  3GYA A;  4B14 A;  4RS2 A;  3IGR A;  3S6G A;  2BUE A;  2PRB A;  5HMN A;  3TFY A;  2YND A;  4R9M A;  4C7H A;  1S7L A;  2JDD A;  4E2A A;  2P6G A;  2R1I A;  2PR8 A;  4KOS A;  4AVB A;  4KOU A;  2DXQ A;  4MFP A;  3QAH A;  1MK4 A;  4U5Y A;  4CGO A;  2FL4 A;  4CGL A;  5JQ4 A;  2CXA A;  2VXK A;  4Q36 A;  2FIW A;  4Q38 A;  1S7F A;  3F5B A;  4F0Y A;  4A32 A;  3SXN A;  3H4Q A;  2VI7 A;  2G3T A;  2QEC A;  2Z0Z A;  4B13 A;  4YGO A;  1Q2D A;  3R9G A;  2HQY A;  4CAW A;  3EXN A;  4CGN A;  4IF5 A;  3ZJ0 A;  3W6S A;  1S7K A;  4H6Z A;  4XPK A;  1SQH A;  1XE4 A;  5GCN A;  4PV6 A;  4QUS A;  1Z4R A;  4KOR A;  4MY3 A;  2O28 A;  2PDO A;  2B4D B;  5DWM A;  3IU2 A;  5G1Z A;  1XIX A;  1OZP A;  3S6H A;  5KTD A;  5ISV A;  4KVM E;  3G8W A;  2JDC A;  1UFH A;  1QSN A;  3D8P A;  1R57 A;  4UCM A;  1IIC A;  4MJ8 A;  3EO4 A;  4UWJ A;  2Q44 A;  2PC1 A;  4A30 A;  4CAE A;  1I12 A;  4KLV A;  2CNM A;  1MJ9 A;  2Q4V A;  4CAV A;  4UCP A;  1Y9K A;  4BBH A;  3FIX A;  2BSW A;  3W91 A;  2B58 A;  2BEI A;  3MGD A;  3BJ7 A;  3SXO A;  1IYL A;  4PSW A;  2WSA A;  4A33 A;  3RYO A;  3WR7 A;  2G3A A;  1YLE A;  1M4D A;  4ONU A;  4BMH A;  3CXQ A;  4E0A A;  2ZPA A;  2YNC C;  4KOW A;  1Q2C A;  4C7I A;  4AB7 A;  3TTH A;  4KVO E;  2I00 A;  4B5P B;  4UFW A;  5J8C A;  2AJ6 A;  2Y0M A;  4MY0 A;  2VBQ A;  4CGP A;  3R9F A;  3TT2 A;  4MBU A;  4JD6 A;  4JLY A;  1NSL A;  5AG5 A;  1BOB A;  2Z3L A;  3G3S A;  4KUA A;  1Y7R A;  4L89 A;  4EVY A;  2VEZ A;  3NE7 A;  5H84 A;  4NF1 A;  2FXF A;  5G20 A;  2Z3O A;  2OZH A;  1NE9 A;  1XEB A;  3F8K A;  4MHD A;  3T9Y A;  4KSA A;  3CXS A;  1I1D A;  3FXT A;  3OWC A;  1S7N A;  2WUU A;  4Y49 C;  2KCW A;  5AG4 A;  4ORF A;  3S6K A;  1WWZ A;  4KUB A;  5IB0 A;  3I3G A;  1J4J A;  4XPD C;  1Y9W A;  2OZU A;  2PR1 A;  2IL4 A;  5F47 A;  4MFZ A;  4CYO A;  2QML A;  4C2X A;  4PK2 A;  3DNS A;  2PQ8 A;  4I49 A;  2REE A;  4K30 A;  3DR8 A;  4H89 A;  2Q7B A;  3JTK A;  2DPS A;  5HH1 A;  1YRE A;  2X7B A;  3IU1 A;  4NEX A;  4UFX A;  1V0C A;  1K4J A;  2Z3N A;  4KS9 A;  3D3S A;  1VKC A;  3EY5 A;  2J8M A;  3N7Z A;  1YVK A;  3LD2 A;  3TOB A;  4AVC A;  4UBR A;  2Q4Y A;  3BJ8 A;  3T90 A;  5AG6 A;  1S5K A;  1XF8 A;  3DDD A;  4XNH C;  1MJB A;  1ZO0 A;  3TCV A;  1B87 A;  1YVO A;  4OAE A;  5F46 A;  1QST A;  1S60 A;  4B11 A;  5IV0 A;  3QB8 A;  5KTC A;  3FNC A;  1RO5 A;  2B5G B;  1M4G A;  4KZT A;  3R96 A;  4UWI A;  3VWD A;  2FCK A;  2YNC A;  1GHE A;  4KLW A;  4M3S A;  3TOA A;  2B4D A;  1CM0 A;  4DNC A;  5DWN A;  4CYP A;  1M1D A;  2WPX A;  4UCN A;  2FSR A;  4CS0 B;  4C2Z A;  4RI1 A;  4F6A A;  4R57 A;  3IWG A;  4A2Z A;  2Q0Y A;  2Z3M A;  1QSO A;  1XMT A;  3LOD A;  2J8R A;  2ZW4 A;  2R8V A;  2D4O A;  4FD5 A;  5F48 A;  1M44 A;  3H5Z A;  4LX9 A;  5C88 A;  3DR6 A;  2K5T A;  3CXP A;  1KZF A;  5G22 A;  2F5I A;  2Z3K A;  4FD6 A;  4PK3 A;  3VWE A;  1L0C A;  3PZJ A;  1YK3 A;  1S3Z A;  2D4P A;  1IYK A;  3PGP A;  2JEV A;  2I79 A;  2EVN A;  4R87 A;  1ON0 A;  2CNS A;  1I21 A;  4C68 A;  4II9 A;  2J8N A;  4R3K A;  1PUA A;  4JXQ A;  4KOY A;  4YFJ A;  4OAD A;  5AG7 A;  4HKF A;  3FBU A;  2GIV A;  4CYQ A;  2OU2 A;  1KUY A;  4CAF A;  5BWA B;  1PU9 A;  5A27 A;  2VQY A;  2YGW A;  4HNX B;  4NXY A;  1WK4 A;  2OZG A;  3D2P A;  2RC4 A;  2GAN A;  2B3U A;  1CJW A;  3S6F A;  4KOX A;  4IUS A;  5A28 A;  4OLL A;  2VZY A;  4QB9 A;  5AGE A;  4QBJ A;  2Q04 A;  3IWE A;  4NCZ A;  4ZGY B;  2HV2 A;  3TO6 A;  2HUZ A;  2FE7 A;  3F0A A;  4CRY B;  3UY5 A;  2ZW5 A;  2FIA A;  2FT0 A;  5G21 A;  3ZZI A;  2B4B A;  4KVX A;  1VHS A;  4CRZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...