1BOBA

Histone acetyltransferase hat1 from saccharomyces cerevisiae in complex with acetyl coenzyme a
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
315
structure length
306
Chain Sequence
FKPETWTSSANEALRVSIVGENAVQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDSVTFKPYVNVKYSAKLGDDNIVDVEKKLLSFLPKDDVIVRDEAKWVDCFAEERKTHNLSDVFEKVSEYSLNGEEFVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLLNKKTKELIGFVTTYKYWHYIDKKFRAKISQFLIFPPYQNKGHGSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKLGYDAVFQKHSDLSDEFLESSRKSLKLEERQFNRLVEMLLLLNNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the histone acetyltransferase Hat1: a paradigm for the GCN5-related N-acetyltransferase superfamily.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Acetyltransferase
molecule keywords HISTONE ACETYLTRANSFERASE
total genus 92
structure length 306
sequence length 315
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 1998-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1bobA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1bobA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 1bobA01
2PDOA 2D4OA 2OH1A 4U5YA 2B5GA 2HV2A 5HH1A 2Q4VA 1YLEA 3PGPA 5KTDA 4PK2A 4PSWA 3LD2A 4H6ZA 1B6BA 4QUSA 4II9A 4R3KA 2JDDA 4JXRA 4Y49C 1CM0A 3TCVA 1CJWA 2OZUA 2Z0ZA 4QC6A 1WK4A 2DXQA 5C88A 1NSLA 3R1KA 1YGHA 1IYKA 1B87A 4JWPA 4UWIA 3WR7A 5IB0A 2BSWA 3VWDA 4LX9A 2CNMA 2R1IA 3D8PA 3LODA 2G0BA 2FS5A 2OU2A 3V8IA 2KCWA 4AVBA 3NE7A 3DR8A 1GHEA 1IICA 4AVAA 2BL1A 1Q2CA 2FIAA 4XPKA 4ORFA 5KTCA 2B5GB 1MJBA 1Z4RA 2B4DA 2Z11A 1QSOA 3FYNA 2VZZA 4CAXA 2Y0MA 3KKWA 4CS0B 3K9UA 4XPDC 3CXSA 3G8WA 4PV6A 4FD5A 4KOXA 3EXNA 1WWZA 1U6MA 1MK4A 4FD4A 2JDCA 3TFYA 2NMTA 5GCNA 2J8NA 3MGDA 3UY5A 3IWGA 2O28A 1V0CA 1MJAA 2P6GA 1QSRA 4FD6A 2OZGA 1M4GA 2PC1A 3FRMA 3I3GA 1PU9A 4B5PA 1L0CA 1M4IA 5DWNA 1KUYA 3PZJA 2ZW5A 3BJ8A 2A4NA 4PSXA 2JEVA 2R8VA 1UFHA 4CAWA 4MBUA 1BOBA 2VI7A 4NXYA 1Y9WA 4K30A 1I21A 2BEIA 3ZZIA 4NEXA 5FVJA 2GE3A 4YFJA 4YGOA 4GS4A 3TT2A 2CNSA 4MHDA 4NCZA 3I9SA 3JVNA 4QBJA 2B58A 2PRBA 4RS2A 3F0AA 2ZW4A 4OADA 1QSNA 3E0KA 5H84A 4XPDB 1IB1E 2FXFA 3D2PA 5H86A 3TTHA 3F8KA 1XMTA 3S6KA 2PR8A 2PR1A 4L8AA 1S7LA 3R9EA 4E2AA 5I0CA 2AE6A 4OLLA 1YREA 2Q4YA 3S6FA 3S6GA 4LUAA 3FNCA 4RI1A 1P4NA 3DR6A 4HNXB 1ON0A 1Y9KA 2JLMA 1YVOA 3DDDA 2I00A 2FL4A 2RC4A 1N71A 3C26A 2Q7BA 5KTAA 3EY5A 1Q2YA 4H6UA 4UA3A 4YRHA 3W6SA 2P6EA 5IX3A 2CNTA 1I12A 4XNHC 1S7FA 3PP9A 5JQ4A 4KORA 1Z4EA 1M4DA 2J8RA 2P0WA 3SHPA 4J3GA 4UBRA 1LRZA 2REEA 5ISVA 3QB8A 1NMTA 4XPLA 2WPWA 2F5IA 4R87A 4HKFA 3D3SA 5IV0A 2VBQA 2H5MA 4UWJA 1YVKA 2X7BA 3EC4A 4I49A 3TO9A 4CRYB 4KVME 2PQ8A 4ZBGA 4IF5A 3R95A 2ATRA 2BUEA 3BJ7A 2IL4A 4QB9A 2J8MA 3W6XA 3S6HA 3P2HA 2Q44A 3RYOA 2QECA 1R57A 2B4BA 2GANA 2B4DB 4R3LA 1RXTA 4KOWA 2QMLA 4JXQA 4AVCA 5J8FA 2EUIA 2Q04A 1YX0A 4KOYA 2OB0A 3QAHA 1M44A 4M3SA 4F0YA 3B8GA 1KUVA 5EC4A 2G3AA 2ZW6A 3P2FA 1S60A 4HNYB 2WPXA 4MY0A 4F6AA 5F48A 4L89A 4X5KA 3G3SA 2C27A 1PUAA 2AJ6A 3T90A 1Q2DA 3SXNA 2EVNA 3FXTA 4CRZB 4KOVA 3H4QA 2HUZA 2ZW7A 3CXQA 2K5TA 1YK3A 2FIWA 5E96A 3BLNA 4XNHB 2ZXVA 3TO6A 1Z9UA 2FSRA 3R9FA 1S5KA 4BMHA 4E0AA 4MY3A 3FBUA 4EVYA 3CXPA 2HQYA 3F5BA 1TIQA 1QSMA 3TO7A 2ARHA 5JPHA 4MJ8A 3GY9A 5HMNA 5F47A 3D2MA 5CNPA 1S7KA 4KOUA 4CAVA 2G3TA 4KVOE 4KLVA 3SXOA 2VXKA 1FY7A 4IUSA 1XE4A 4NSQA 4ONUA 4KLWA 2Q0YA 2GIVA 4HNWB 2FT0A 4KZTA 1KUXA 3FB3A 4AG9A 1I1DA 4R9MA 2VZYA 4B5PB 2CY2A 3GKRA 3GYAA 3OWCA 3EO4A 2VEZA 4FD7A 4KVXA 3DNSA 1YR0A 2QIRA 3TOAA 3DSBA 3W91A 4QVTA 4M85A 3IGRA 4MI4A 4KOSA 1S7NA 3R9GA 1XF8A 2OZHA 1BO4A 3R96A 1XEBA 1P0HA 4KUBA 2REFA 2PSWA 4JJXA 4E8OA 5F46A 4KOTA 1IIDA 5J8CA 1OZPA 2ZPAA 2D4PA 3T9YA 4U9ZA 1S3ZA 1NE9A 4NF1A 3EFAA 2R98A 4B5OA 2B3VA 1Y7RA 4KUAA 2P6FA 4OAEA 1IYLA 4AG7A 4JLYA 3VWEA 1RO5A 4PK3A 2VQYA 4JD6A 5C82A 4U9YA 4DNCA 4AB7A 3TOBA 2I79A 5EBVA 2Z10A 4H89A 1KZFA 3TE4A 1MJ9A 1M1DA 4R57A 1XIXA 2FCKA 3ZJ0A 2B3UA 5F49A 5DWMA 1QSTA 3FIXA 3N7ZA 2R7HA 1SQHA 1VHSA 3JUWA 1K4JA 4Y49B 1J4JA 1VKCA 2FE7A
chains in the Genus database with same CATH superfamily
4MIMA 5KCMA 2F48A 1QQ9A 1KU3A 4XBFA 4HNUA 9ANTA 2PJAA 5G21A 4PXCA 4H2KA 5IB9A 4BUPA 5HH1A 1R36A 1ZLJA 3JW4A 3K10A 4I09A 5E8GA 1YLEA 3PGPA 4ZYQA 2IGMA 3S16J 2XF7A 4PSWA 3LD2A 3WE3A 3MKYB 4H6ZA 4QUSA 3H3UA 3SXYA 4KMFA 1JJ8C 2VLAA 4R3KA 2NNNA 2ZSIB 4XLPF 3D7FA 4Y49C 4ESBA 3PB6X 1X2NA 3D5RC 3FXQA 4QC6A 3ISZA 2MGQA 3HHHA 5HDNA 5EGOA 1NSLA 2QKLB 2E35A 5E3NA 1IU8A 1LDKB 3HG9A 4F55A 4WXDA 1ZLKA 2GLOA 5CJ9A 3JTGA 3BZ6A 3N97A 3WR7A 2ELKA 6CPAA 1VIXA 1TL8A 4XM3A 1J59A 1A35A 3T5XA 3GVAA 1ZYRF 2VONA 4UUSA 1P7IA 1BL0A 3QODA 2ZMEB 1GDTA 2P5LC 4KIBA 1A36A 1V54H 1WJEA 4NUBA 1FT9A 3F3XA 2P8TA 1B8IA 2DDAA 3M3YJ 2G0BA 3LODA 2OU2A 5IT9Z 1AKHB 4XKCA 3GTGJ 1OCTC 5D8LB 3CMYA 5DM6F 2F5FA 2YU9J 4G7OF 4JP0A 4BQQA 4ZH4F 3NE7A 3DR8A 3H8EA 3HEFA 1GHEA 4W9YA 2HOTA 1Y0RA 1KZHA 2BL1A 4G7HF 4IZZA 3VYUB 4LOCA 5L3FA 5KVRA 1Z8TA 1YHQI 1MJBA 2OC6A 4I0AA 3K4JA 3WC5A 3K69A 1HW2A 2VBZA 2QBYB 1IGBA 2HYJA 1Z0XA 5LEKA 2Z11A 4OMEA 1QSOA 5FB2A 1ZAOA 4RAYA 4CAXA 1QHHD 1K4TA 1U3EM 1Z21A 3K9TA 3KYCB 2XROA 2ICWG 4BD9A 4Z6YA 4IOCF 3GTKJ 2K86A 4DYOA 5DCMB 4ZJZA 2VODA 4N4OB 1R1TA 2JA2A 3JRAA 1O3TA 2PJ2A 1WGXA 3SJXA 1FEXA 4CYPA 5TISC 1G3YA 3VWBA 1XDUA 5K5RA 5EYRA 3WU0A 1CF7B 1P2FA 1R22A 4D1QA 4FD5A 4LQ6A 2UUZA 5HODA 2O8KA 2YNCC 5M3MJ 4RB0A 2COMA 1TWHJ 5CVJA 1TBXA 2E1MB 3LSHA 1ZH5A 1MZBA 4L5EA 1Z3YA 2VQGA 3I5UA 3BHXA 5C3EJ 4N9IA 3T8TA 2K4JA 3B73A 4P1WA 2P6GA 1XGOA 3SZGA 4MCRA 2JPBA 5K7ZA 1LE8B 2YX4A 4FD6A 1QA6A 4Q38A 2V4JC 2QSFX 2E7WA 2XAGA 2G9DA 3H3ZA 1DP3A 2MBFA 1YTYA 5JHFA 4XORA 2JSCA 3CCVI 2QBYA 5LYIA 2M0CA 3CDIA 2EFNA 2Z16A 3FZVA 2DA7A 2PE3A 5CVUA 1JUSA 3K4KA 3FVLA 1BR1A 3BJ8A 4NFRA 1Z77A 4F7ZA 3HJEA 5ILSA 3WTWC 1ZGAA 2CW7A 4NBQA 5JH9A 2E19A 3PUFA 3RZDJ 4CGNA 1BOBA 2BVLA 1IDYA 3LFUA 1EE3P 2KJCA 2FBHA 1S72I 3LSIA 4TWEA 3DBRB 1I21A 4K30A 1I39A 2BEIA 4NEXA 1V5EA 3O3KA 2HNHA 2H8WA 4PK4A 3BG3A 2GE3A 5F1JA 2RDPA 2FMLA 1D0ZA 3BTIA 1WHUA 5IP7J 3IRRA 5JVGF 4R6TA 1O3RA 3WTTC 1VQ9I 1YJ9I 4MHDA 3TGNA 4HV5A 2DOAA 4FQGA 5LRSA 3HKZA 2R7DA 3OYFA 4QBJA 4M3GA 4HAMA 2X48A 4XQFA 1HEEA 2YGWA 3MZHA 5J6XA 3AL0C 3F0AA 1HQCA 2BGCA 2FJ1A 2BV6A 2ZJ2A 3DLAA 1QSNA 2Q1ZB 4OADA 3WGHA 3WG7H 2M8GX 3L09A 2XEJA 4YRVA 4MEXF 1LE8A 2PI0A 5G20A 3TTHA 3KP7A 3VOEA 1ZQ3P 1XMTA 2BY3A 2M2EA 2VPRA 1ETXA 3TKYA 3S6KA 2L5QA 2AS5F 1MBFA 2VQHA 1S7LA 4E2AA 3DTKA 2WWYA 4R8HA 2IT0A 2JWTA 1TWCJ 3BG6A 3M8JA 3S6GA 2JBJA 1EV7A 1U5TC 2HDWA 1DGRM 2LFBA 2RQQA 3E0JB 3DR6A 2EBJA 4EMEA 3M1CA 4G12A 4BQAA 1Y9KA 3GLXA 1VTNC 4MEYF 4X0GA 2K4BA 1Z67A 1YVOA 3TW7A 4P5OA 4ZYEA 2VBXA 3KPHA 3DBLB 2R4GA 2YX7A 2Q7BA 4XK4A 4ETSA 1Q2YA 3KP5A 2KIMA 2OAZA 2WY8Q 4G7ZF 1YSJA 4UA3A 4YRHA 3W6SA 4TV7A 2HOAA 2P6EA 2DA4A 4ESJA 3PB4X 4XL9A 2ME6A 1TNTA 2CNTA 3SFZA 4U87A 1I12A 4IQJA 1VQ6I 3QP5A 3B35A 3WU1B 3RNZA 1QHGA 1RKTA 2RGVA 1I1GA 5L3CA 5ERIA 4UVBA 4KORA 5HVHA 1W4MA 3BR2A 4KMUX 2PJ7A 5IOZA 1IAWA 2XF6A 4YIFA 5FLXZ 2BE5F 2J8RA 1MMNA 3S1MJ 1UG2A 4PGHA 3MRUA 2F8HA 2ZXHA 3L2QA 1KU2A 2KFDA 4N0BA 1JUMA 4ENKA 3TP0A 4MFKA 3BCAA 1RESA 2CSOA 1HDQA 3K4NA 4XSXF 1I5ZA 1JE8A 3S8PA 1GLNA 1QRYA 3GW2A 2WPWA 3TX8A 2F5IA 1UB9A 2PMUA 4P96A 5EG0B 2GQQA 4HKFA 4HPQA 1CG2A 5JFRA 1BI0A 1Q1HA 3TO9A 5ICFA 3RQ4A 4CAEA 4CSWA 4HDUA 3SI2A 2HXIA 4X8IA 4OMYA 2O8XA 1XGMA 1BLLE 4ZBGA 1ZG9A 5HOOA 3R95A 1LJ9A 3K1PA 2CW8A 2FA5A 3MVPA 3AG3H 5JR3A 4AIDA 4AVPA 2IL4A 3Q0UA 4U0YA 3FXJA 2Y48A 4RGSA 5GADJ 4LQGA 2Q44A 4HYEA 1XPXA 3T8RA 3WE2A 1WH5A 2B4BA 2W57A 5E1WA 5H20A 2QECA 4UFXA 4R3LA 3PQKA 4LLNA 4Y15A 4ZY1A 2V9PA 1GUUA 4O5VA 1ZRFA 4J19A 1F43A 4E7IA 2IJLA 3FMRA 4GRIA 1TWGJ 1ODDA 1W36D 5IT9K 4MHYA 3TE4A 2JPCA 1JHHA 2HVRA 2OB0A 1ZR4A 3QNVA 2HQAA 4IRHA 3IC7A 3GIUA 4M3SA 2W24A 1WJDA 1G4DA 4L18B 3P2FA 1S9HA 2ZOGA 4RUHA 1VQPI 4PCQA 2YPRA 3K0LA 1OQYA 1G6NA 4HNYB 1X1DA 4HW0A 1BC7C 2DU9A 3D66A 3CCYA 2JQ7A 2M30A 1WJCA 4WJBA 5LYFA 1S7AA 4L89A 4X5KA 2DA6A 2WUUA 1ZG5A 4BY1J 2XAFA 1CX8A 4JZ0A 2Y9ZA 4R76A 1AUGA 1T6SA 1Q2DA 2HEOA 3K7AJ 4B44A 2GWRA 4IPAA 5JHUA 3LSTA 2KQRA 5B1BH 4ZZDA 4FE7A 3D0SA 4EQQA 5J1YA 4F92B 2ZW7A 2P5VA 2OV7A 5CBMA 3QWLA 4PJJA 1Y6IA 1G59A 2L7MP 2ZB9A 4ONWA 4UHTA 3VSKA 2B0LA 1UHWA 1VF9A 2BXZA 3QPHA 4LITA 1QNTA 3TO6A 2L54A 1Z9UA 4P45A 4FE4A 3R9FA 3NE8A 1RI7A 3F6OA 4NJQA 4A6EA 4UCPA 2BBYA 3BG9A 4MY3A 4E0AA 3ABKH 4E7LA 2O9LA 1R6RA 2PIYA 2BW3A 5J1RA 2ZXWH 5JPHA 4MJ8A 2LP0A 3GY9A 5HMNA 5F47A 4LD5A 3IHUA 2XAUA 5IYDJ 4A3DJ 3QRFF 1DTDA 1LAMA 4BHCA 2LY2A 5AIQA 5DUIA 1JT0A 3S9MA 1BI2A 2O6GE 3RKYA 1A6IA 1Z5RA 4KJZA 4K2EA 3COAC 1FY7A 3I54A 1XE4A 1YW4A 3DU5A 4NC6A 3GTOJ 5C4XJ 4ONUA 4G8XA 3IUOA 4A2UA 4GO1A 3IU1A 2RVCA 2GIVA 3H9GA 3C7JA 3DWLE 4Z2YA 3BP8A 4EJTA 4EFDA 3LWFA 2HYGD 2X6WA 3OYAA 2EJRA 1K78A 2ID6A 1XBUA 5M3FJ 2MABA 4A3LJ 4BQNA 4RLQA 1ZG3A 2EINH 5D8KB 3J7ZI 1FNOA 4AYBN 3U1KA 1HDDC 3LSJA 2CY2A 3JAMK 4NNJA 3N5FA 3W2VA 4F52A 3EO4A 3HXLA 2IGOA 4HX4A 2M45A 3CUOA 1MBKA 3CCUI 1W5TA 4IX7A 1SFOJ 1Y1WJ 4FX0A 5LHIA 1K78B 2M5WA 2C6YA 4KVXA 5LEJA 4LIUA 3ROUA 2R7FA 2Z3LA 2VT2A 3MKWB 3D1NI 2ZCWA 3BR5A 3KEQA 1TZLA 1XD7A 3NARA 1PDNC 4IHVA 2V1UA 3TOAA 3GUXA 4FETA 5H6RA 5J40A 2KDZA 3D7HA 5LYDA 2ZNYA 2CV0A 1HDPA 4JQFA 1R71A 3HTSB 1GHCA 4QVTA 2QLZA 2HC9A 4M85A 4X2TA 1HCRA 2NRAC 1BN5A 3OL4A 3CZXA 4KNYA 2CWEA 3L2UA 5LRKA 2XDVA 3R9GA 2V77A 2QSHX 1ONVA 3Q0WA 1ETYA 3TW6A 2OZHA 3ZRGA 4D0PA 2V8HA 1XN7A 3KQXA 4BINA 1P0HA 4QSHA 4XRMA 3JSPA 4F9VA 1MH4A 2MSYA 3VYTB 2WAQN 2NYQA 3G6EI 2Z9OA 3SI1A 1GV5A 4HG2A 2KL4A 3F8CA 2EK5A 2Z33A 3R0AA 1E3OC 1MMGA 4HZFA 1EA3A 3WG9A 3BZKA 2XHKA 4UB8C 2XGEA 4B4CA 4KOTA 1WFXA 3P5JA 5J47A 1G3TA 4QTRA 1WPKA 5LRRA 5D6EA 5L3EA 4I98B 2V8GA 1OFCX 1HW5A 4M6VA 3GMEA 5ICCA 1IN4A 1OZPA 3WU2C 4XR6A 5K7HA 2ZPAA 1X1AA 3ZQFA 4L5IA 4U9ZA 2I5UA 3P7NA 4CCMA 3V38A 3G71I 2DOEA 4XMYA 2CQNA 2X85A 1NE9A 3EFAA 2H1KA 1XCBA 2FBKA 2NVQJ 4A0XA 1ETWA 1S6LA 4BBHA 2WV1A 4I2OA 4KUAA 3M9AA 3S93A 3FM5A 1KONA 4WXCA 4E7HA 2OF7A 2CJJA 4HNVA 1PUEE 5JM6A 1U2WA 2I8DA 2HI3A 2PJBA 3L2NA 4OC4A 4AUXA 3DPLC 3K70D 1MDMB 3L00A 2VQYA 2ZEFA 1YO5C 5C82A 2AHQA 3QQAA 3NH5A 3DEEA 3FXUA 3C3WA 2O61A 3R0JA 2IQ6A 1XIXA 3VYSB 2FCKA 1F36A 1TNSA 2HU9A 1ITYA 1MMDA 3JCUC 1YLOA 3EQLF 2Z3MA 4C7HA 3GF2A 1KQ0A 2C1CA 2JUGA 2DBBA 4A95A 1KU9A 4M6IA 3DBHB 3CMMA 3AL0B 2UXNA 2QKMB 3JUWA 1K4JA 4UFVA 1E3HA 2R7XA 1J4JA 3CLQA 2L9SA 3ZQ7A 1VKCA 4F0XA 3JAMZ 1K79A 2FE7A 1EH6A 4GYGA 2PDOA 1EKEA 3HOXJ 4UF4A 2O7OA 2Q4VA 2ADUA 2HOEA 2LKPA 5KTDA 4EM1A 4UV9A 4PK2A 1F1ZA 1B9NA 3I64A 3B3TA 2X1EA 1F57A 1Z05A 4JXRA 2Y69H 2D45A 4NGTA 1OKRA 1WK4A 2V8VA 5C88A 1BI3A 3V7RA 2PBIA 3JRDA 1FT7A 3R1KA 2DXIA 3RCOA 1QZYA 2M8EA 2E1MC 2WB1A 1J5YA 5J1UA 2F5EA 4IHYA 1G3WA 1S5LC 3MN2A 2BSWA 2EA4A 2JVGA 2A6HF 5C44J 2EV6A 2K9MA 1UMQA 4RDUA 4NGSA 4HF1A 2EZKA 4BE0A 3OYCA 2X4HA 2R1IA 3DTIA 3RKXA 3D8PA 5LYLA 1VQMI 1MW7A 2KCWA 4HA8A 3OYHA 4AVBA 1I6XA 2FEZA 3ZMUA 2NSMA 4NGNA 4A39A 2O53A 2ZEPA 3RSNA 1HSJA 4XNFA 3IWZA 1Q2CA 1IDZA 4L9TA 4A3CJ 5H2FC 4M3EA 2V6EA 3ZMZA 4U0VA 3PSIA 3ZMDA 4XIDA 5EEGA 5E1ZB 4C3IJ 1QVUA 3E3VA 3SHFA 4C2UA 1NK2P 2DK5A 2J5PA 3S1NJ 3EUHA 3ULQB 2PFBA 5GAEJ 3I71A 1FIPA 3QPTA 2FSWA 5CYVA 1KQ9A 2L02A 2PG4A 4BH9A 5HDKA 2STTA 3WT4A 4P10A 2Z1DA 2VBWA 4XN0A 2LSOA 2LY1A 2F4OB 3CXSA 1H8LA 4R7MA 2OR4A 3HSEA 4PJMA 2LYCA 1H88C 3EUKL 1WCMJ 2DQLA 3FXLA 1OMIA 1ZGJA 2ZSHB 3K4MA 4FUUA 1D3YA 1OCZH 1AU7A 1WWZA 3EXNA 1HXDA 2OZ6A 3F72A 1MK4A 4XLCA 1YLFA 3IIBA 4FD4A 4IHXA 1LUJB 4GCVA 2LNBA 2E2JJ 3TFYA 2KDOA 4FHTA 5E3MA 4MFJA 5GCNA 3RIRA 2GOXB 1V0CA 2A5YB 4QLCU 4BJTA 1WJAA 1KWMA 3UKGA 4S0HB 1MJAA 1Z9CA 2XEIA 4M74A 4MCPA 1M1EB 1W36C 1GYTA 3H35A 4GXOA 1K83J 2FNAA 4BEHA 2AXTC 4RN7A 3FXRA 4XRFA 4B43A 1YS7A 2HPMA 1VQ8I 1VI0A 4YEJA 2OZGA 2PC1A 1ULYA 4DGWB 3I3GA 2HPIA 3FEDA 4YWYA 2HWVA 1RTQA 3GFJA 4YU9A 4A3BJ 1L0CA 3H0GJ 2ECBA 1HC8A 5BPDA 3L2RA 4IHSA 2CUJA 2VJ4A 4A37A 4CDGA 2FE3A 1ORKA 1CPSA 1FIAA 4IF4A 1RRJA 4C2XA 4PSXA 1FYMA 3S17J 2LOOA 4BEHB 4C3JJ 4X6AJ 2IP2A 2KLOA 3KYDB 2R8VA 5A2QK 2IW5A 5IPAA 5ILUA 3WTUC 3KASA 1ELLP 2VI7A 2CFOA 4U7BA 3TC8A 1S8NA 1J75A 4P55A 3GEZA 2QSGX 4NXYA 1WH7A 2K9LA 1X3UA 2JRTA 5ICGA 2R5ZB 1Y9WA 4NGRA 4P4EA 3L9FA 3ERMA 3SEZA 4D9JA 1HW1A 2VI6A 2DODA 2R7ZJ 2CUEA 1WQ2A 2W84A 2R7TA 8CPAA 5BWAB 2R7QA 1USTA 5FD6A 1FBQA 5HVQC 4IEJA 2JTVA 2VE9A 1RETA 2IS2A 1W5SA 3PQJA 4DZJA 3QOPA 3LFKA 3E5QA 4RS2A 1KQ8A 1ZK8A 2IA0A 2PJ3A 2CQKA 2ZW4A 3CJRB 3ZQHA 4EJWA 1F5TA 4B13A 2AXLA 1IB1E 1IUFA 4M3FA 4RAGA 2AFXA 2FXFA 1IZ1A 1X3ZB 2Y75A 4BJ5C 5KHDA 2OQGA 2ZEGA 3H1CA 4MXUA 2CFXA 2DTZA 4CA0A 2EIJH 2JN6A 5EJCA 4A3GJ 2AFUA 3I0TA 2X1CA 4LGWA 2PR1A 3KZIC 5HS9A 2JRMA 2Q8KA 3LSPA 3R9EA 1OR7A 1V4RA 2KZVA 4M6GA 1RR7A 3KP4A 5TGTA 4OLLA 1YITI 1YREA 2PMHA 3BTJA 4NDLA 3S6FA 2XASA 5IOYA 2VIXA 1U0JA 3G1LA 2DPUA 2ESHA 1H9GA 3PO2J 2VJIA 1PP7U 4LUAA 4HQEA 2OA4A 2JLMA 2P6TA 2OPTA 1LEBA 4A0YA 3PL8A 2DMPA 4IO9F 4MQVA 2VOPA 2QCOA 3C26A 2ELHA 4KSAA 3S9NA 4H6UA 3L1PA 2Q43A 2H6BA 4B8XA 4R79A 1ETKA 1NTCA 3BI0A 3DU6A 3KHZA 3HKZN 2LBFA 4XNHC 2WSAA 3PP9A 2XKOA 4GFBA 1D1BA 1B59A 3CC2I 4YIRX 3K2KA 1R5GA 2MW8A 2VJ5A 4ZYGA 3ZQLA 2LMDA 1MBGA 1BR2A 5FKNA 1HKQA 1ARLA 4EVIA 3DFGA 4BDYA 4UBRA 3NA6A 1FNNA 4KICA 3KP6A 4HNTA 1UWYA 3PUBA 2VL1A 5DS0A 1AWCA 3ZCOA 5GTIC 4LLLA 2HZTA 5LRGA 3F23A 4BYYA 3B6AA 3HTUA 3VFZA 5GAGJ 1ON2A 4CYDA 3PB8X 4MFEA 4R87A 5FLVA 3RBUA 3GX4X 2XAHA 3AG4H 3HOSA 4L9NA 1TQIA 1F4KA 1IOFA 2VBQA 5IV0A 5K8NA 4LJZF 2GLFA 2NVYJ 2QQBA 2DMNA 3PFIA 4I49A 5LLQA 4KVME 1X10A 3KQZA 1S3JA 2K9NA 1LFBA 2HTJA 3S32A 3WTXC 2E2HJ 3P9KA 1SVOA 4HBLA 3RJPA 4HV6A 3CC4I 3H0DA 3HRUA 4IF5A 3SQNA 3BTCA 2K7LA 4OU0A 1B1BA 1O3QA 5E20A 4M6XA 4YFXF 4FTHA 4CXFA 4CICA 5DM7F 4EATA 3UNGC 4CGZA 1R57A 4B48A 2OD5A 1F2OA 1OLTA 5HVGA 2DT5A 1RXTA 4KOWA 2QMLA 4JXQA 3HRMA 2C6PA 3HC7A 4AVCA 3A1YA 2ANPA 1ZGWA 2EBIA 5J8FA 2XSDC 3CCLI 2EUIA 1REPC 3RYRA 4M6HA 2Q2EB 2L3DA 3S3OA 3ERED 2IAIA 1MNDA 1YX0A 2V26A 5EEHA 1FOXA 4D7MA 3QAYA 3OYJA 2JA5J 3BT9A 5D29A 4RS8A 2LR8A 1M44A 2CTBA 1S7OA 1E17A 4NB5A 3NH4A 1ELMP 4XOPA 3B8GA 3H5RA 3LSMA 4WXHA 4A94A 1E3PA 2ZW6A 1MDMA 4F0YA 3REOA 3Q9VA 1IF1A 1X19A 1LVAA 3PFYA 5EEAA 4AIHA 3RKQA 4O23A 4MCSA 3CUQA 4ASNA 4BY7J 1ETVA 1QVTA 4CYNA 4OIWA 1YJNI 4BL0B 2V7FA 4EWTA 3T8WA 4KDPA 4B14A 1TT0A 4U7DA 4MY0A 4AVZA 3RI4A 4BXFA 2Y0SA 4AD9A 5L3DA 1JTXA 2FD5A 3HIFA 3CO6C 1JKRC 5AG5A 4F6AA 3QOEA 2VJJA 4D5FA 2YNCA 1NH3A 3F8FA 4D7NA 3GUDA 5ILVA 3T90A 1D8JA 2FUG2 3SXNA 3KX2A 2ZOFA 2KRCA 3FXTA 4U0WA 2RN7A 4KOVA 4FT8A 5CVVA 2MD0A 4OWRB 3QPSA 3CESA 3RPUD 1ZREA 4CYQA 3CXQA 2BYVE 4RGXA 2HB6A 4CCLA 3BY6A 4MNUA 4M3BA 2E1OA 4XN3A 4CGPA 5H6QA 5F0CA 4XRSG 4XNHB 5E3LA 1JGGA 3PNYA 4EJUA 1XSDA 1ZN2A 1MMAA 3BG5A 3OWTA 1S5KA 3IEHA 1I3QJ 3H3VK 2PJ8A 4JX4A 5M5YJ 2DDBA 2L2OA 2LK2A 2HQYA 5CQGA 1UG0A 2KKOA 2M4GA 4WX9A 3CCJI 4O6JA 5B3SH 3JRGA 2JZYA 1TIQA 1TKHA 1YMEA 2V1XA 1X4OA 3LA3A 4PJNA 2ZJPF 3KZZA 1Z91A 2HFHA 3J7AY 3I4MJ 2XAQA 3CQZJ 4PDKA 1S7KA 1XFOA 2EH3A 4PFOA 1XSVA 1YW9A 2KISA 1BM9A 2G3TA 4KVOE 4KLVA 3SXOA 4M9XA 3UR3C 1QMUA 2PLYA 4II2A 3JRBA 3K4BA 3D5SC 3F6VA 2MG4A 1XB4A 3LSRA 3FMSA 3Q0VA 3FISA 5FFZA 5K7FA 2R7SA 1UAAA 2R7VA 1MSFC 1ZG7A 3OYEA 4HSRA 4DW6A 3GFLA 2FT0A 4HNWB 3FM3A 4KZTA 1IN6A 3A01A 5FGMA 3IWFA 3ZR8X 2EWBA 2HDCA 4OMZA 4ON0A 2VZYA 2LKSA 4NQWB 4OIRF 1JWQA 3E97A 2CYYA 1BBYA 1RUOA 2DEAA 3JRUA 4M73A 2Q0OA 1BIBA 4EJOA 3A01B 4FD7A 1VNDA 2VN2A 1XGNA 2H8RA 3WABA 3K4LA 2ZEEA 3OYKA 2BY0A 3GLJA 1FMWA 2DFFA 2KIFA 5CVIA 3U21A 3W2AA 2DA3A 1LAPA 4XKBA 2QIRA 2D1HA 4B47A 2MYSA 4OC5A 3A9LA 1ERDA 4DJLA 3PO3J 2WBMA 2BVMA 2KMUA 3DEUA 1QGPA 1SFKA 3ABTA 1Y0YA 3S14J 1Q7LA 4MI4A 3EUAA 1ETOA 2BOLA 4UVCA 3JRHA 2X51A 3BLYA 3DEWA 1OYYA 4O3MA 1XF8A 4MQ9F 3H8GA 3AAFA 2ZBKA 5FKLA 2QQ8A 2NS7A 4OIOF 3R60A 1MKMA 3BWGA 2FNPA 1U9NA 4KUBA 4A3MJ 3SJEA 3BR0A 1W0TA 2HR3A 4E8OA 4OINF 4UCNA 4KT5C 2LVSA 2L9VA 2LF8A 4M3DA 2XGXA 3DKXA 4IXAA 2XF5A 4AU7A 2DQRA 4Y52J 1T8IA 1AMPA 2MH2A 2VOOA 5FFXA 1ZELA 4RAZA 2WC2A 5J1QA 2NVTJ 3VSLA 4IJAA 4RB3C 1NG7A 2DJNA 1I50J 2QVOA 2L01A 5E1XA 3TL4X 3EYIA 3TDUC 2ZKZA 4B5OA 3GFMA 2F5DA 4L9VA 1ZG1A 1Y7RA 2UXXA 5EGOB 1VFCA 3CO7C 1TQMA 4A0ZA 4B11A 1R00A 3C18A 3FK6A 4AG7A 1IRGA 1G2HA 3CTAA 4D5CA 3OSFA 4JLYA 4CAFA 2DA1A 4M72A 2ZC2A 4CCJA 2R5ZA 2KHMA 3FXOA 2L0KA 1ENHA 2HQNA 4PK3A 4WF2A 3CDLA 2PEXA 5JVTA 1G8XA 3TOBA 5F64A 2I79A 4F8ZA 2WAFA 3VB2A 2LH9A 4UXNA 3U9GA 5K5OA 3D67A 4H89A 1SFEA 2IVMA 2IEKA 2W25A 5DDGA 1M1DA 4PQAA 2BEOA 5TRDA 5DS9A 1LKXA 2GXBA 4OOIA 1KGSA 1DUXC 2FVGA 1FJLA 5F49A 2WA0A 4GDFA 3J81K 2Z3PA 2XPVA 4I7HA 4UVAA 3HOYJ 4CGLA 2DAOA 4HLYA 2EFWA 1QSTA 2NYXA 1DDNA 1X1CA 3N7ZA 2R7HA 1TLHB 1LOKA 2V8DA 1PJRA 1SQHA 5F27A 1VHSA 3PEIA 5HLGA 4RB1A 4M9SA 1ZR2A 1Y56A 2OOTA 2XPUA 3LQRA 5LFAA 4JX6A 2OQRA 4UV8A 2ZXJA 2IJZA 3RPQA 3CPXA 4DJAA 4C30A 1EJ9A 3TQNA 4F3QA 2W7NA 2OH1A 5D8NA 3GTPJ 2EV5A 2B5GA 2PJ1A 4U5YA 2X1DA 2HV2A 2YUSA 4DYQA 3HM5A 1T0FC 2K9QA 4ENMA 1IXSB 1HSTA 4E7KA 3WODF 1B6BA 2Z2SB 3FHZA 4IOAF 4II9A 2JDDA 5FO5A 4IHWA 1W7PD 3DKWA 1LDJA 2GREA 3TCVA 2E60A 2RNGA 1DP7P 2X9DA 1CJWA 3E7LA 4KIFA 3VARA 4E6KG 3KE2A 2EZLA 3ZMSA 4IQ4A 4PXBA 1F2PA 2EZIA 4UCMA 3CP2A 2V79A 3IH3A 4CYCB 2XV4S 1YGHA 3BC8A 1ACIA 1SMYF 4MHZA 3K6GA 4JWPA 2CTCA 4UWIA 1F9NA 2G9WA 4ENNA 2G0EA 1TW3A 3KGQA 1BI1A 4LX9A 1FSEA 2HGCA 1APLC 5K1YA 1XMXA 4IHMA 1PCAA 2DA5A 4A3IJ 3FF5A 3GCMA 5FKMA 2VUMJ 3HSRA 3OYMA 2WZNA 3BXMA 4MGRA 1FPQA 4XKVA 1T95A 1KYZA 5BQTA 4MTDA 2RQPA 3BJ6A 3V8IA 3X2QH 4BACA 1S29A 3SDGA 5K5QA 2V6CA 2R93J 2CIJA 7CPAA 2E5ZA 3OS0A 4ESFA 1IICA 3FBNB 4G94A 2N8GA 2QWWA 2TDXA 3GO5A 3SEQA 4DZPA 4WWVA 3SYTA 1LCPA 3K70C 1Y1VJ 3CMEI 4UUVA 5LGTA 4ORFA 4XPKA 2O03A 2M7AA 3BZCA 5IP6A 1YW6A 4DBQA 4OIDA 2B5GB 1MBHA 3HGYA 3ZMTA 3TBIA 4UEFA 1Z4RA 3J80Z 2AQEA 2B4DA 1RPWA 3LACA 3FYNA 4KSIA 1P92A 2VZZA 3N4MA 2L7ZA 2Y0MA 3KKWA 4MRIA 3LWUA 2DFHA 5L3BA 3K9UA 1JUPA 2A05A 1R43A 5AG6A 4C2ZA 1XMAA 4YELA 3KZWA 2V1DA 2X6YA 4YIIA 2CW0F 4BKXA 2LTPA 4XPDC 4YFKF 4F9UA 1X4PA 3DCFA 4CYCA 3SI0A 3M7GA 1OISA 3JRCA 1LVKA 3ZQGA 3S3NA 2X6OA 2Z3KA 4A93J 3WC7A 1OR7C 4PV6A 1DQUA 1SAUA 3LQQA 5JGFA 3MKLA 3W6KB 4A69C 4QPQA 2AO9A 2LRDA 4UY8I 1VZ0A 3HRTA 4E7SA 4L0YB 4MHNA 1FBSA 3B6CA 4G9YA 2LKXA 3BROA 2NMTA 3DQVC 3E1SA 3KI9A 2E2IJ 5CPAA 2GAUA 2R0QC 2J8NA 3HLPA 4G6TB 3UY5A 4ZDPA 1TKJA 2O28A 2GU2A 5M5XJ 1L3LA 2QYOA 4HLXA 3Q9SA 5E3OA 3KEYA 1FYKA 1IY7A 5FKOA 1ON1A 1ZARA 2VXZA 5HNFA 4B10A 2A07F 4B12A 2IBDA 2CRGA 3LOCA 3KLNA 3DPTA 3AG2H 2VKHA 3S3MA 1BAVA 3G4SI 4ZX9A 2FMYA 3DNSA 1FZPB 4QWQA 1YIOA 4HSTA 2L4MA 5HXDA 4ZTJA 5DWNA 1DGWY 2HXOA 3K2ZA 1KUYA 3FH4A 4NJRA 2GXAA 1IRZA 2TCTA 3CC7I 2A68F 2K40A 3W6VA 5GPAA 1D1CA 1YIJI 4MTEA 3MQ0A 1P4WA 3BR3A 3H9QA 1K7AA 1Y39A 1T0FA 3I4NJ 2D1VA 3GZ5A 5HNHA 1N77A 3PM1A 3SDBA 4BGDA 4CO8A 2DPDA 2PVVA 3ZZIA 5FVJA 3MWMA 4KN4X 1FC3A 3BOQA 2XSJC 1P6RA 2YS9A 2K3FA 4S04A 2M34A 3G1MA 5E17F 1AYEA 2C6GA 4GS4A 3OYLA 2CNSA 5DD4A 4PPZA 3TT2A 1VQLI 2COBA 3CT9A 1YJWI 2GLJA 1IXRC 1STZA 3I9SA 4Y13A 3JVNA 5DTDA 2B58A 3MZ8A 5D4RA 2PRBA 3D7GA 4I6ZA 1O7FA 2EWNA 2C6CA 2EIKH 2XGCA 3H5ZA 3EYYA 3E0KA 3MCZA 4XPDB 2Q2EA 5H84A 1X1BA 2ECCA 4A38A 2V1NA 1HDUA 2DFEA 2BZTA 1E2XA 1P9QC 1Z2LA 1FP1D 1I27A 1L0OC 1XG1A 3F8KA 3DP7A 2DYSH 5IYBJ 2R7RA 3I58A 2ELJA 2PR8A 1OCRH 3G73A 4L8AA 4DBRA 1QU3A 2PJ9A 1D5VA 2AE6A 5I0CA 2NXNB 4NGMA 4AWXB 2RFHA 3CPAA 5D5UB 4OP4A 4P4DA 4Q4ZF 2DT7B 3OY9A 4RI1A 1P4NA 3J7YJ 1IXCA 2PMZA 2IRFG 2PMZN 1SD5A 2YU3A 1MGTA 1WWXA 3KP3A 4X3RA 1UHSA 5G1ZA 3IKVA 2GOMA 2IA1A 2VQLA 3DTEA 2I00A 1RKWA 1WSUA 1N71A 4CCNA 2PJ5A 5AG4A 5KTAA 1SD4A 2O0YA 3HOZJ 3EY5A 1KA8A 1T39A 3G1OA 1ZRCA 5GAHJ 4P9FA 4K3NA 2MLKA 5IX3A 1OBRA 4CZCA 4A5NA 2VT3A 3NAUA 3QP6A 4CUGA 5BOXA 4A32A 3BTLA 5F0HA 1YQAA 5EDNA 3FHNA 4NHJA 3B3WA 2DA2A 5F1RA 4IRIA 1M4DA 4PXEA 3QYFA 1GVDA 2P0WA 3F9KA 2F4IA 4J3GA 2G7HA 1JI8A 3PB7X 3VODA 5E8IA 2VASA 2XRLA 1JKPC 4IAVA 1XS9A 3CUQB 3VYRB 1YG2A 4PZJA 5JI6A 1CP6A 2REEA 4P4BA 3VATA 5ISVA 1TT5B 4GYIA 1JQGA 1SANA 4CPAA 1NMTA 3BPVA 4ZYDA 2F4MB 4BNCA 4A30A 4BHBA 3KR4A 3M4OJ 4MHPA 4OC2A 3LNQA 3D3SA 3EPZA 2H5MA 2DMTA 4C2MJ 1YVKA 3ZQIA 2Y0SN 4QPOA 1P4AA 2R3SA 2X7BA 1U5TA 4XLHA 2B7EA 3OYBA 1BJAA 2PQ8A 4C2YA 3T1BA 3JREA 1QPMA 3FMQA 1CQTA 3PSFA 5ED4A 3J7AO 1A5JA 4CYOA 2EFOA 4KITB 2BHZA 3FK7A 2P81A 5FRNA 3ISXA 4PGGA 3ASOH 4I76A 3BJ7A 3AFHA 4QB9A 5FKKA 4BHPA 4UUTA 4EM2A 3GZNB 5FJ8J 4V19K 1JHFA 2HQ5A 4RB2C 2J8MA 1TF8A 1M4LA 3P2HA 3RYOA 2P5KA 2IMOA 4J01A 1R58A 2IXSA 2IS6A 2GANA 3A2KA 2B4DB 3H92A 1YI2I 3LL7A 2PJPA 1X1PA 4BQOA 2JK3A 1OCOH 2MLGA 4A3JJ 3KIOA 1XGSA 1NSAA 4ITVA 1A2ZA 2E71A 1R9TJ 3PNVA 2M0MA 2QA4I 5G22A 4XLFA 4KS9A 2FF4A 1SMTA 2EILH 2EFQA 2JVHA 3K1MA 3MEXA 1V5FA 2X0LA 2ZEHA 2F5CA 3F8BA 1YS6A 3M1EA 5LGUA 1KUVA 1ZG8A 2G3AA 5EC4A 1FOKA 3NFZA 2GXGA 1YYVA 1YOVB 5BPIA 1I1SA 1U8BA 1N25A 2MH9A 4U88A 3A4CA 1D8KA 1OYWA 1Z7LA 1W5CC 5AIPA 3A0HC 3PNTA 3OS2A 1WZ2A 4ZY0A 4XLAA 2ZFUA 4KUMA 1K4SA 2AFZA 5F48A 2AFSA 4BBRJ 3GXOA 2C27A 2GFQA 1Z6RA 4WWCA 1PUAA 1MD0A 1LB2A 1EH7A 3ZP5A 1Q1VA 1BOAA 1TW2A 2PJ0A 3V7SA 4CRZB 3TP3A 1Y0NA 1ARMA 2A6TA 1XSXA 1MIJA 2HUZA 2XB5A 1PUFB 2K5TA 4QIWN 2JA7J 1FWZA 2H94A 3CCEI 2L7KA 2FIWA 2FQ3A 3GTQJ 1N78A 2DTRA 4RM3A 4FWUA 3G2BA 2ZXVA 4XLEA 4KA4A 1U9OA 2Z3OA 5K8MA 5J4VA 2RREA 2EK9A 1OCPA 3HDDA 3RKWA 1K6YA 5HVFA 5HLTA 2J9AA 2K02A 2FSRA 1TXRA 1BR4A 3A02A 2Q51A 1W7PB 2HQRA 3IFEA 4BMHA 4P9UA 2IS1A 3HOTA 2HDDA 3WTZA 3LAJA 2DPTA 5LGNA 3F5BA 5J4YA 1UFMA 2XKPA 1CPXA 2ARHA 4A12A 4LLGF 3HOVJ 3ISPA 1FOYA 1WI9A 2K85A 2L4AA 4FX4A 1J0RA 2R7OA 4BU2A 2NOGA 1HLVA 1R5HA 4A31A 4OC1A 4CAVA 1ZLHA 2ZEMA 3L2VA 2VXDA 3HPHA 4MHGA 3KZYA 4UEZA 4CGOA 1P7JA 1X58A 4RLFA 3NQOA 1I6HJ 4MFLA 5GTHC 2UWMA 4KLWA 2DJIA 2R5YB 3AG1H 1WJ5A 2Q0YA 1J7KA 5CLSA 4LFUA 1YX3A 2VKEA 2W1OA 1V55H 3EUHC 3CMAI 1KUXA 3CZ6A 2H1LA 2KIUA 5CQEA 3PRTA 2LG4A 3FIWA 1IRXA 3S9LA 3FB3A 2CMPA 1UCRA 1V3FA 3HYIA 3IH4A 1I1DA 3PFOA 2QUFA 3OYIA 2HTSA 5A28A 2ETHA 2JMWA 2RAEA 3OIQA 3CCRI 2ZENA 3BQYA 1MBEA 2H6CA 5LBQA 2EIMH 4KT6A 4ZTFA 1DPUA 3KETA 3TEDA 3LMSA 3OWCA 3PBBA 4Q36A 4XSZF 5KNLA 4JX5A 2NVUB 1SFUA 2PJ6A 3ECHA 4ZYHA 2VEZA 2OCCH 1CBXA 2E1CA 4IKFA 4R1HA 1W7PA 3FBIB 1E0EA 4AIKA 1BPNA 1DE4C 3IV5A 3AKZA 3VEPA 3FX6A 1AHDP 3H36A 2KRFA 1XTAA 4Y4RA 1YR0A 3DSBA 3FF3A 5J3LA 3CD6I 2XGDA 3W91A 2QQAA 1TKFA 2ZMEA 5CKTA 3LMMA 3RAMA 3RZAA 5HDGA 3WGGA 2IGNA 2R7UA 3DPUA 3IGRA 2BW3B 3JRIA 3WTYC 4KOSA 1S7NA 3BR6A 3KCCA 2L9RA 1BA5A 2DK8A 3FX3A 4PJ0C 4KISA 3CF5F 2HKXA 3MKZA 3R96A 4EV0A 2PJCA 3NH8A 5AGEA 3HZJA 5FLXK 3V4GA 4FBEA 3R61A 2XUBA 1VQ7I 3NWSA 2A6EF 3ASNH 3GWZA 1LFUP 1B72A 5F46A 2BXYA 3HOUJ 3CUQC 1GT0C 2ZFWA 3L7WA 1IIDA 2BY1A 4Q48A 1Y0UA 2DF5A 1SD7A 2ISYA 2DI3A 4CCOA 3G3ZA 2CV1A 1WRJA 2D4PA 3T9YA 3RPUA 4DOZA 5IY5H 3KEOA 1WVRA 1J9IA 1FMVA 3V8KA 4NF1A 2R98A 2PX9A 4XICA 3IC1A 5HS8A 1K6OA 1QQIA 2B3VA 4MFQA 4ZY2A 4WCGA 2UV1A 1KYWA 1IYLA 1JGSA 4HRIA 5EG0A 3LSGA 1FTTA 1FTZA 1Z6TA 5D5XB 2ACJA 2GA1A 2FRHA 3EETA 3U2RA 4L9JA 1LQ1A 4C2TA 3S2HJ 4P6YA 1XMKA 2NAZA 2P7VB 2O3FA 2LD5A 3H5NA 4DNCA 4S05A 2M9HA 4JYWA 5EBVA 3U1DA 1MH3A 5EZGA 3F21A 3WHBA 3IRQA 1S7EA 6PAXA 5FROA 5KK1A 3EDPA 1BW5A 3QU6A 1XDSA 1WJFA 3MN8A 5LHHA 1TF9A 2XEFA 2A5WA 1B72B 3CF2A 2XIGA 1RC9A 3I55I 1VQKI 4HPSA 2WB1N 2OJED 3KLOA 1C0WA 4E7JA 5LHGA 4RAFA 1G3SA 1MSEC 2ZJQF 4CGMA 3IWWA 2ZMEC 4B1RA 1ZRDA 3GTLJ 3FXMA 1XRYA 3OR1C 4Y49B 4C3HJ 5IT3A 3ZXSA 4TNUA 5LD2C 2HOSA 1VQOI 2EZHA 1LFWA 2A69F 3E6DA 2MFZA 3HPGA 4B3AA 3K4CA 4E7ZA 2R7WA 3KFWX 2D4OA 4ZZLA 3S1QJ 2L9NA 1D0YA 3GB0A 2QJ8A 5K8OA 1FOWA 5D4SA 4Y7NJ 3PIOF 3BCBA 3OS1A 5D5VB 2FU4A 3V42A 3IAS2 3PFEA 1CM0A 2GM4A 2OZUA 2Z0ZA 4NGPA 5EZHA 2DXQA 4UFWA 4MFDA 3KHXA 1YQEA 1RZ4A 4I02A 3P9CA 4UIAA 2FOKA 1YRNA 2JJ7A 3ABLH 1R4NB 1Y8QB 2CH0A 4Y3OA 1B87A 1IYKA 1VGYA 2QVPA 1FP2A 5IB0A 2XAJA 5ELYA 3VWDA 1ZLIA 1FSHA 4P44A 2DCEA 3P9IA 1UHMA 3DXJF 2CNMA 3ML6A 4XLNF 2XVCA 5DV5A 1TP4A 1U8RA 4MFZA 2ID3A 2FX0A 2WV0A 3QYBA 1AA7A 2FS5A 3BPXA 3CCSI 2PVWA 1GVJA 2WAEA 3H8FA 4LK0F 1HOMA 3BDDA 3CCMI 4IVNA 3B02A 4XONA 5E79C 3S2DJ 3QU3A 4Z65A 4A3FJ 2KZGA 4Y33A 1YE9A 4AVAA 5DEQA 3DKYA 4OC0A 1YX5A 2W82A 3O8HA 2FIAA 3IL2A 3D68A 3WC6A 5KTCA 3TDZC 4DYRA 3JTHA 3KYLA 1FX7A 3OR2C 2M7BA 1A04A 4JK1X 4JYKA 3K1NA 2P4WA 2NNYA 2ABZA 2POKA 4ZYAA 1BW6A 1MNEA 2CUZA 4LG0B 2EO8A 3B3SA 4IRGA 1XJOA 2ZJRF 3ZPLA 2PRQA 1SD6A 5LRJA 4CS0B 1FYLA 3JR9A 3OV8A 2JEWA 1JT6A 1HKTA 3BI1A 2KT0A 3ZQCA 5AONA 2ESNA 3I3LA 1VQ5I 2FXAA 1VQNI 4BAYA 3OMYA 1DPRA 3C2GA 1IN7A 2QQ9A 3CJNA 3C2HA 1PP8F 2FQ4A 4I99C 5DYMA 1QBJA 2MC3A 3G8WA 2Z5UA 2HS5A 4HF0A 4ZDLA 5AG7A 2HVQA 2VC0A 4EGZA 3B7IA 4Y17A 1IV8A 4BS9A 4KOXA 3HL2A 3FXKA 4AYBA 2CO5A 2E34A 1U6MA 1RIOH 1POGA 1MNMC 2JT1A 2DFIA 2JDCA 2PCUA 3ZN0A 5ICEA 4CHUA 2YR2A 3CCQI 4B6ZA 1X2MA 3FKJA 1U78A 1SVLA 1JKOC 3MGDA 1VHOA 3IWGA 5BNGA 4A3KJ 3IKTA 1X3WB 2LY9A 3HOWJ 2FOWA 5K8PA 1T56A 2ZELA 2ME0A 4MMOA 2OUMA 3FWEA 4JBAA 4KN7X 1QSRA 4V2FA 2Q7SA 2H27A 4FISA 2OCEA 1EF4A 4ABZA 1M4GA 1T2KA 3HHGA 3FRMA 2AFMA 5EF6A 2B9SA 1PU9A 4B5PA 3IP4B 4L0ZB 2RB7A 1LDDA 4LG0A 3JSOA 4LIVA 3WTVC 3NRVA 3ZMVA 3OSGA 2LDUA 1M4IA 1IN5A 2TRTA 2Q4ZA 5BMZA 2VBYA 3ESWB 3LAPA 4UNOA 2NVXJ 2ZXIA 3M8EA 1BPMA 3PZJA 1UELB 4RM2A 2ZW5A 2A4NA 4A5MA 2JEVA 4ZC3A 4PJLA 2DPSA 1HA8A 4CCKA 3S15J 2LBFB 1TWFJ 2DMUA 2LLKA 2WY7Q 1UFHA 4MBUA 4KYWA 4CAWA 4JOMA 2XC7A 1GXPA 1WI3A 2OTJI 2BCOA 1R1VA 1XMBA 1KU7A 4HX7A 3R4KA 5F0FA 3FEEA 1AKHA 1QZEA 5M5WJ 4YFJA 2PJRB 4YGOA 3F22A 2KP6A 1U6GA 3IJ3A 2WYRA 3PIPF 4KFCA 3ONQA 2DN0A 5DCFA 2WADA 4NCZA 1BIAA 3JRFA 1PYTB 2E36A 2DYRH 2ODFA 3MAJA 3W6JB 2DLLA 3E5XA 1R5ID 4OIPF 2PN6A 2E1NA 2LREA 1D1AA 1W0UA 4OAYA 2STWA 1H8AC 2XRNA 4ENJA 3D2PA 5H86A 4YFNF 1SFXA 2OTLI 2R92J 2MC4A 3IU2A 2GZWA 3ZQQA 4BJ6C 4CH7A 2VPLA 5F04A 1OPCA 4EEFG 3F8NA 2Q4YA 4P4FA 2MA3A 2K3PA 4RGUA 3RQIA 2CG4A 4RMNA 3GZ6A 3FNCA 2Y31A 3B3CA 3VPRA 5GPCA 4HNXB 2WAQA 1ON0A 1J09A 2CXAA 4MCQA 1Y8RB 2EK8A 1Y7EA 4PFPA 2X6XA 3VDXA 4MFPA 3DDDA 1MMSA 4W1UA 2QENA 2FL4A 2RC4A 1J2XA 1D0XA 3MMYB 4BE2A 2NS0A 4P4JA 1OJLA 1RNLA 2ZNZA 1IGNA 3GTMJ 1FBUA 1SVMA 2CQXA 4BXXJ 3ELKA 4G6QA 2I3CA 4UIBA 2GIZA 2FBIA 1IV6A 1S7FA 5HS7A 3D5LA 4KSFA 5JQ4A 2UZKA 2CF4A 2ZEDA 4EM0B 5D6FA 3W3CA 1Z4EA 2YSRA 4FAIA 3CJQB 2HZDA 3HUGA 5DD8A 3HBLA 1ETQA 4HX8A 3SHPA 1O7LA 3H9JA 2GBYA 5KAIC 1GV2A 4UUSB 2BOAA 4NC7A 4YG2F 1YRNB 1LRZA 2IGKA 4HEA2 1TQPA 2GA2A 3SJMA 4A3EJ 1BC8C 4V2GA 1R4MB 3RDIA 2YNDA 3QB8A 3CDXA 4E70A 3OYGA 2V9KA 1LFPA 2F7VA 1UZCA 5IYCJ 4XPLA 2B63J 1B4AA 2VE8A 3B2YA 1R1UA 4HDVA 3V7ZA 4DUKA 3F8MA 1CF7A 4UWJA 4IL6C 2V9VA 3EC4A 2W48A 4L5JA 5F08A 2QM3A 5C4JJ 1YW7A 3C1DA 4CRYB 5I4MA 5B5EC 5A2QZ 2EA2A 3DF8A 5D5WB 3IAM2 2HYFA 2M87A 1XOVA 1R49A 4II3A 1VQ4I 3FKIJ 2O4HA 1NHAA 5GP9A 2ATRA 2BUEA 4W97A 4HOBA 4XRSA 3W6XA 3S6HA 1I3AA 2F2EA 1OYIA 2EFPA 2J5OA 3MFKA 1IG7A 1Z8XA 4AXVA 3HSFA 2PJ4A 4AIJA 2LC2A 2RV8A 3NEUA 2KJBA 3WHCA 5THWA 2AFOA 1Z7UA 2ISZA 2MD5A 4AC0A 3LSKA 1CP7A 3WTSC 1JJ6C 5F09A 3D4UA 3FDYA 3GLLA 1Z3XA 3J81Z 2CS3A 2Q04A 4ZX8A 3J80K 2KIQA 3ZN1A 4OAZA 4A6DA 1VHEA 4KOYA 3I1UA 4EJVA 4Q5SF 3O8GA 4RGRA 3QAHA 4N4NB 3RTRA 3I53A 2JBKA 1P4XA 2H09A 3C2BA 1RR8C 1B8IB 4XOTA 3CDHA 3DLJA 4NGQA 2EQRA 3PB9X 5DUKA 4DYCA 3FJUA 3I4PA 4MO7A 1S60A 2D2WA 1Z8WA 3OYDA 2LF7A 1IUYA 4PXDA 2CU7A 3BR1A 4UB6C 3S2WA 3GFIA 2WPXA 4NC8A 3V7CA 3E6MA 4ZI6A 4CZZA 5B1AH 2DOFA 1RUNA 1H0MA 1JXSA 3G3SA 2BY2A 2CQ7A 3Q3SA 3TMOA 3E5UA 2BHYA 3BQZA 2AJ6A 4H0EA 4NQWA 1R23A 1QPIA 3QYEA 3F0CA 4GXHA 2EVNA 1CGPA 2VKDA 3CLOA 3H4QA 1IN8A 2KPMA 4B09A 4HQMA 3L2CA 1YK3A 1XC5A 2QF7A 4AM3A 5E96A 2CUFA 1USSA 3BLNA 3GTJJ 3W2WA 2JUCA 2K9SA 5HLIA 1LANA 2EV0A 1JTYA 3VH9A 5A27A 2EB7A 3PBEA 2VB6A 1AOYA 4C9YA 4G1PA 1QZZA 5JLWA 3FBUA 1R7JA 4EVYA 1TC3C 3CXPA 5L3GA 1GXQA 3SJGA 3KP2A 1QSMA 3FECA 4ANJA 3TO7A 4M9ZA 2IPQX 4LMYA 1ZTRA 4LG3A 3S1RJ 1IO2A 4I01A 3D2MA 1IW7F 2DMQA 2DW4A 3IWEA 2AFWA 5CNPA 2O5RA 2Z3YA 3LA2A 1TTYA 1T08B 3M07A 4KOUA 1T33A 1W1WE 1UJ8A 3A0BC 1U5TB 3OYNA 4FCYA 4Q7AA 4G6DA 3I9V2 5BS6A 2L7FP 2VXKA 4IUSA 2EPFA 5CPRB 4NSQA 3H5AA 1NG6A 1YW8A 3NWTA 4N9HA 5TJJA 2F5VA 4Q47A 4IK2A 3T0YA 2NOJB 1IRFA 1XX5A 4FASD 2F6CA 3I56I 3BJAA 1SAXA 1IC8A 2JA8J 1B9MA 4AG9A 4LB6B 2I10A 3FMCA 4UEEA 4R9MA 1HKSA 5FD5A 4WK8F 2QYVA 4XKWA 4GGGA 3OIPA 3RO0A 4B5PB 2RNJA 4A2ZA 2K5CA 2CGPA 3GKRA 2W85A 2G7UA 3SZTA 1LPQA 1H9TA 3R6SA 4F93B 3GYAA 2QEXI 1WJBA 3V8JA 1Z1DA 1PYVA 4GM5A 1B6AA 5F6FA 1HF0A 1D5YA 2M4KA 3Q5FA 5B66C 2VQCA 5DCMA 1SC7A 3E6BA 4M71A 2QZ8A 1H89C 2Y9YA 3MZYA 3ABUA 3ABMH 4X1EA 2IS4A 3OL3A 2P7CB 2PJRA 2M1BA 1N75A 5JLXA 2A3SA 1FLIA 4ZGYB 1ZKGA 2KRHA 2Z99A 3I59A 4J00A 3V8LA 3SJFA 4PUSA 4R8FA 4RBOA 2VC1A 3E6CC 1BO4A 3IH2A 1Z8LA 1PVEA 1XEBA 3CJTB 2E7XA 2XPWA 4OIQF 1IJWC 4BDZA 4F91B 2JA6J 2WTEA 4OKOA 2REFA 3GBGA 2PSWA 4JJXA 1T98A 5E18F 3RZOJ 5IP9J 2CQQA 1K61A 2A61A 4I0BA 4M6YA 3OOUA 1O4XA 2DO7A 2ZEOA 1PUFA 3HRSA 1YFHA 3SZPA 1JKQC 5J8CA 5EMIA 3HUVA 2CV2A 1O57A 3CP8A 2XEGA 2AQFA 3MD2A 4H4KC 3WGIA 3LA7A 3DV8A 1NK3P 2ZO4A 2VKVA 3B3VA 1S3ZA 2W4SA 4C7IA 3OOPA 4LB5A 4HF2A 1A31A 2M3AA 4KIGA 1HBXG 2NS8A 2P6FA 2IA2A 4EGYA 4OAEA 1LEAA 4A33A 1ZO0A 3KR5A 2OBPA 1A6QA 2DT6A 2K27A 2XB0X 1R3NA 3QPLA 4MLOA 1SEUA 2YNEA 3GYHX 3IO1A 3JTKA 1LNWA 3M8FA 3ZOBA 1X12A 3VWEA 1WKMA 1DU0A 1O3SA 3BG7A 1RO5A 5CVRA 3D7DA 2W00A 3SFIA 3RYPA 1T38A 3KL9A 4JD6A 2Y30A 3I59B 4C68A 4U9YA 4AB7A 2QGUA 4LK1F 2RKHA 2BO9A 3L2WA 4BE1A 1XCVA 3HUGB 3ZGKA 5FLMJ 4BBSJ 1MJ9A 1KZFA 2Z10A 3N05A 4OC3A 1ZHFA 3K2AA 3PJRA 4R57A 4P4IA 3OIOA 4B3XA 2D5VA 3O2PE 4DIQA 3ZJ0A 4DQ2A 1TWAJ 2JSPA 4BXUA 4E4HA 3DLLF 2R5YA 4IHTA 2B3UA 3DGVA 2VL8A 1IOIA 1BJZA 2PIZA 3BJOA 3O6BB 2Z3NA 3A03A 5DWMA 5FRMA 4ZDOA 1MBJA 1EH8A 1OCCH 2HKOA 3FIXA 3ECOA 5HLHA 2P6SA 3HB9A 1QO0D 2E5NA 5KAFC 4RA2A 3HGGA 1V5GA 2HVSA 1DU6A 4EMSA 2Y2ZA
chains in the Genus database with same CATH topology
5KCMA 4DJAA 5LD2C 4C30A 4HNUA 5G21A 2PDOA 2D4OA 2MFZA 3HPGA 4F3QA 3K4CA 4E7ZA 2W7NA 2R7WA 2B5GA 2OH1A 4U5YA 2X1DA 4BUPA 2HV2A 5HH1A 2Q4VA 3K10A 1T0FC 2L9NA 1D0YA 1YLEA 3PGPA 4E7KA 5KTDA 2IGMA 2XF7A 4PK2A 4PSWA 3LD2A 3MKYB 1B6BA 4H6ZA 2Z2SB 4QUSA 4II9A 4R3KA 2JDDA 3BCBA 2VLAA 2X1EA 3OS1A 2ZSIB 3V42A 4JXRA 4Y49C 3IAS2 1CM0A 3D5RC 2E60A 2RNGA 1CJWA 2OZUA 2Z0ZA 3TCVA 4QC6A 1WK4A 3S6KA 4E6KG 2DXQA 4UFWA 5C88A 4IQ4A 4UCMA 2QKLB 1NSLA 3CP2A 1LDKB 3R1KA 2DXIA 3RCOA 3BC8A 3HG9A 4F55A 2E1MC 1YGHA 2CH0A 3K6GA 1B87A 2WB1A 4Y3OA 1IYKA 4JWPA 4UWIA 3WR7A 5IB0A 2BSWA 3VWDA 4XM3A 2JVGA 4LX9A 2K9MA 2DCEA 3QODA 4BE0A 3OYCA 2CNMA 2R1IA 3DTIA 1WJEA 3OYMA 4MFZA 4NUBA 3QYBA 3D8PA 3LODA 4XKVA 1AA7A 1T95A 2G0BA 2FS5A 1MW7A 2OU2A 2WAEA 4XKCA 4BACA 3V8IA 2KCWA 3OYHA 4BQQA 4AVBA 4XONA 3NE7A 2E5ZA 3DR8A 1GHEA 3OS0A 4Y33A 1IICA 3FBNB 1YE9A 4AVAA 2BL1A 3DKYA 3SEQA 1YX5A 3RSNA 2W82A 4XNFA 3SYTA 3VYUB 4IZZA 3K70C 1Q2CA 2FIAA 4XPKA 4ORFA 5KTCA 2M7AA 3KYLA 3OR2C 4DBQA 2M7BA 2V6EA 2B5GB 2OC6A 1MJBA 3K4JA 4ZYAA 3TBIA 3PSIA 1MNEA 2CUZA 1Z4RA 2AQEA 2B4DA 2Z11A 1QSOA 3FYNA 4C2UA 2VZZA 4CAXA 2Y0MA 1QHHD 3KKWA 4CS0B 1Z21A 3K9UA 3I3LA 5AG6A 4C2ZA 4YELA 2X6YA 3OMYA 3C2GA 4ZJZA 2Z1DA 4XN0A 4XPDC 2LY1A 1X4PA 3C2HA 4N4OB 2JA2A 3CXSA 3G8WA 4LUAA 4PJMA 1LVKA 2LYCA 3S3NA 3EUKL 4ZDLA 2HVQA 2Z3KA 5AG7A 3VWBA 4CYPA 1OR7C 4PV6A 2ZSHB 3K4MA 1DQUA 4D1QA 1SAUA 4FD5A 2UUZA 4BS9A 2YNCC 4KOXA 3HL2A 1WWZA 4QPQA 4AYBA 2LRDA 3EXNA 1VZ0A 4E7SA 1U6MA 1MK4A 4XLCA 2E1MB 4FD4A 3LSHA 2JDCA 3TFYA 1Z3YA 2VQGA 2NMTA 3DQVC 3E1SA 2KDOA 3FKJA 4MFJA 5GCNA 2J8NA 3MGDA 4G6TB 3IWGA 2GOXB 4ZDPA 2O28A 1V0CA 3UY5A 4BJTA 1WJAA 4P1WA 1MJAA 2P6GA 2OUMA 3KEYA 3SZGA 1W36C 3H35A 1QSRA 4BEHA 5HNFA 2VXZA 4B10A 4FD6A 4B43A 2HPMA 2OZGA 4Q38A 1M4GA 2V4JC 4YEJA 4B12A 2PC1A 4DGWB 3FRMA 3I3GA 1DP3A 3DPTA 2HPIA 2VKHA 3S3MA 1PU9A 4B5PA 3IP4B 5JHFA 4XORA 4LIVA 4HSTA 1L0CA 1M4IA 2Z16A 4ZTJA 1DGWY 3L2RA 1KUYA 2CUJA 2VJ4A 5DWNA 2ZXIA 3PZJA 1UELB 3K4KA 4RM2A 2ZW5A 1BR1A 3BJ8A 2A4NA 1D1CA 4PSXA 2JEVA 4ZC3A 4PJLA 2DPSA 2LOOA 4BEHB 1HA8A 4CCKA 2CW7A 2LBFB 2KLOA 3H9QA 2R8VA 2WY7Q 1UFHA 4CAWA 4MBUA 4CGNA 4JOMA 1BOBA 2BVLA 2CFOA 3LFUA 4U7BA 5HNHA 2XC7A 1N77A 2VI7A 3SDBA 4NXYA 4BGDA 2K9LA 3LSIA 1Y9WA 4K30A 1I21A 2BEIA 4D9JA 3SEZA 4NEXA 3ZZIA 1V5EA 2HNHA 5FVJA 4PK4A 2GE3A 2R7TA 4YFJA 2PJRB 2XSJC 4YGOA 5BWAB 1D0ZA 2R7QA 2KP6A 5HVQC 4GS4A 3TT2A 3OYLA 2CNSA 3ONQA 4MHDA 2WADA 2IS2A 2DOAA 4NCZA 3HKZA 3I9SA 3JVNA 3OYFA 4QBJA 2B58A 2PRBA 4RS2A 4XQFA 2YGWA 3AL0C 3F0AA 2ZW4A 3H5ZA 3DLAA 1QSNA 3CJRB 2Q1ZB 3E0KA 4OADA 4XPDB 2LREA 5H84A 1D1AA 4B13A 1X1BA 4OAYA 4YRVA 1IB1E 2FXFA 2V1NA 4BJ5C 3D2PA 5KHDA 5G20A 5H86A 3TTHA 1P9QC 3IU2A 2MC4A 4CA0A 3F8KA 1XMTA 3ZQQA 2R7RA 4BJ6C 4CH7A 2ELJA 2X1CA 2VPLA 2L5QA 2PR1A 2PR8A 4L8AA 2VQHA 4DBRA 1QU3A 1S7LA 2KZVA 3DTKA 2AE6A 3R9EA 4E2AA 5I0CA 5TGTA 4OLLA 1YREA 2Q4YA 3S6FA 2K3PA 3BG6A 3M8JA 3S6GA 2DT7B 4RMNA 2VIXA 1U0JA 2HDWA 3OY9A 3FNCA 1DGRM 2RQQA 3E0JB 2VJIA 2PMZA 1P4NA 2WAQA 1ON0A 3M1CA 1J09A 1Y9KA 2CXAA 4HNXB 2JLMA 4PFPA 2X6XA 3VDXA 4X0GA 2GOMA 5G1ZA 4MFPA 2VQLA 1YVOA 3DDDA 3DTEA 3PL8A 4P5OA 2FL4A 2I00A 3MMYB 1N71A 1D0XA 2R4GA 4CCNA 4BE2A 2RC4A 3C26A 2Q7BA 5AG4A 5KTAA 3EY5A 4KSAA 1Q2YA 2WY8Q 4H6UA 4UA3A 4YRHA 3W6SA 4R79A 2P6EA 3DU6A 4XL9A 5IX3A 2CNTA 4CZCA 2LBFA 4U87A 1I12A 4IQJA 4CUGA 1S7FA 2WSAA 3D5LA 3PP9A 4XNHC 4A32A 4KSFA 5JQ4A 1D1BA 1QHGA 3FHNA 3W3CA 4KORA 1Z4EA 1M4DA 2VJ5A 3QYFA 3CJQB 2XF6A 2HZDA 2J8RA 1BR2A 1MMNA 2P0WA 3SHPA 3F9KA 2F4IA 3H9JA 4BDYA 4J3GA 1JI8A 4UBRA 2ZXHA 3L2QA 4NC7A 2VASA 4HNTA 1LRZA 3PUBA 2IGKA 4HEA2 3VYRB 2REEA 5ISVA 3ZCOA 4MFKA 2YNDA 3BCAA 3QB8A 3K4NA 3OYGA 2V9KA 1LFPA 3S8PA 1GLNA 1NMTA 4XPLA 2WPWA 2F5IA 4R87A 4A30A 4HKFA 4HPQA 3HOSA 3D3SA 5IV0A 3EPZA 2H5MA 2VBQA 4UWJA 1YVKA 2X7BA 4QPOA 3EC4A 4I49A 3TO9A 4XLHA 4CRYB 3RQ4A 3OYBA 2PQ8A 4KVME 4C2YA 4CAEA 4CSWA 3PSFA 4CYOA 3S32A 4KITB 3IAM2 4ZBGA 5FRNA 4II3A 5HOOA 3H0DA 4IF5A 3R95A 2CW8A 2ATRA 2BUEA 3SXOA 3BJ7A 3AFHA 2IL4A 4QB9A 2J8MA 3W6XA 3S6HA 3P2HA 2Q44A 3RYOA 4EATA 2IXSA 3UNGC 4J01A 1R57A 2B4BA 2IS6A 4B48A 2LC2A 2GANA 3A2KA 2B4DB 4R3LA 4UFXA 3LL7A 1OLTA 1RXTA 4BQOA 4KOWA 2QMLA 4JXQA 3HC7A 4ITVA 4AVCA 3A1YA 3LSKA 3PNVA 4E7IA 5J8FA 2M0MA 2EUIA 3FDYA 5G22A 4GRIA 1W36D 1Z3XA 2Q2EB 2CS3A 4XLFA 2Q04A 3S3OA 4KS9A 1MNDA 1YX0A 2V26A 4OAZA 4KOYA 2JVHA 1V5FA 3OYJA 2HVRA 2OB0A 4N4NB 3RTRA 2HQAA 1M44A 3QAHA 4M3SA 1WJDA 4XOPA 3B8GA 3H5RA 3LSMA 4XOTA 1KUVA 2G3AA 2ZW6A 5EC4A 4F0YA 3P2FA 1X19A 3PFYA 1S9HA 1S60A 3OYDA 3A4CA 4CYNA 1Z7LA 4HNYB 2WPXA 4BL0B 2V7FA 4NC8A 1X1DA 3PNTA 3OS2A 4B14A 1TT0A 4XLAA 4MY0A 2ZFUA 4AVZA 4BXFA 2Y0SA 4NSQA 1WJCA 4F6AA 5F48A 5AG5A 4L89A 3QOEA 2VJJA 4X5KA 2WUUA 2YNCA 3G3SA 2C27A 3TMOA 1PUAA 2AJ6A 3T90A 2FUG2 1Q2DA 3QYEA 3SXNA 4B44A 3KX2A 2EVNA 2KRCA 2VKDA 3FXTA 2KQRA 4CRZB 2A6TA 4KOVA 2MD0A 4OWRB 3CESA 3RPUD 3H4QA 4CYQA 4F92B 2HUZA 2ZW7A 3CXQA 2KPMA 2OV7A 2K5TA 4CCLA 1YK3A 2L7KA 4PJJA 1Y6IA 1G59A 2FIWA 5E96A 4XN3A 4CGPA 1N78A 4RM3A 3BLNA 4XNHB 3VSKA 3G2BA 3W2WA 2ZXVA 4XLEA 2Z3OA 3TO6A 4LITA 3PNYA 2RREA 1Z9UA 1K6YA 5HLTA 5A27A 1MMAA 2FSRA 3R9FA 1BR4A 2VB6A 3OWTA 4C9YA 1S5KA 4UCPA 4BMHA 4E0AA 4MY3A 3FBUA 2IS1A 3HOTA 4EVYA 3CXPA 4E7LA 2L2OA 2HQYA 2DPTA 5CQGA 1UG0A 2M4GA 1R6RA 1TIQA 1QSMA 3F5BA 2BW3A 4ANJA 3TO7A 2ARHA 5JPHA 4MJ8A 1X4OA 4LG3A 3GY9A 4PJNA 5F47A 5HMNA 3D2MA 2XAUA 3J7AY 2R7OA 3IWEA 5CNPA 1S7KA 2LY2A 2O5RA 4BU2A 4KOUA 4PFOA 3OYNA 4A31A 4CAVA 4KJZA 3I9V2 2G3TA 4KVOE 3L2VA 4KLVA 2VXKA 2VXDA 3HPHA 3UR3C 1FY7A 1XE4A 4IUSA 4CGOA 4RLFA 5CPRB 4II2A 3DU5A 3K4BA 4MFLA 3D5SC 3H5AA 2UWMA 4KLWA 2DJIA 4ONUA 1NG6A 3NWTA 2QECA 1WJ5A 3IUOA 1UAAA 2R7SA 2R7VA 2Q0YA 2F5VA 3IU1A 3OYEA 2GIVA 1YX3A 3DWLE 3H9GA 4HSRA 2FT0A 2W1OA 2NOJB 4HNWB 4KZTA 3EUHC 2F6CA 2X6WA 4FASD 3CZ6A 3ZR8X 3OYAA 1KUXA 5CQEA 2LG4A 1IRXA 2MABA 3FB3A 2CMPA 4AG9A 4BQNA 1I1DA 4R9MA 3OYIA 2VZYA 4NQWB 4RLQA 5A28A 4XKWA 4B5PB 3OIPA 4A2ZA 3OIQA 2K5CA 2CY2A 3GKRA 4ZTFA 4KT6A 4NNJA 3GYAA 3W2VA 4F52A 4F93B 3HXLA 3EO4A 2IGOA 3OWCA 1WJBA 4Q36A 5KNLA 2VEZA 4C2TA 1PYVA 4IX7A 3DR6A 4IKFA 4FD7A 4KVXA 3FBIB 1E0EA 4LIUA 3AKZA 3K4LA 3OYKA 2Z3LA 3MKWB 1FMWA 2M4KA 3W2AA 3DNSA 3U21A 1TZLA 4Y4RA 1YR0A 4XKBA 2QIRA 2VQCA 4FETA 3TOAA 3DSBA 4B47A 2MYSA 2CV0A 3W91A 3A9LA 1ERDA 4JQFA 5CKTA 2IS4A 2WBMA 3LMMA 4QVTA 2BVMA 4M85A 2KMUA 3OL3A 2IGNA 1SFKA 2R7UA 4RI1A 3OL4A 2PJRA 3DPUA 1N75A 3IGRA 2BW3B 3EUAA 3L2UA 2KRHA 4MI4A 4KOSA 2XDVA 4ZGYB 4J00A 1S7NA 2BOLA 3R9GA 2X51A 3BLYA 1XF8A 2OZHA 4PUSA 3ZRGA 1BO4A 4KISA 3MKZA 3R96A 1XEBA 1P0HA 5AGEA 3VYTB 4BDZA 4F91B 4KUBA 2REFA 3GBGA 3NWSA 2PSWA 4HG2A 2KL4A 4JJXA 4E8OA 4UCNA 1MMGA 5F46A 1EA3A 4KOTA 1WFXA 3OOUA 4C2XA 3DKXA 1IIDA 2XF5A 4AU7A 5J8CA 1OZPA 2CV2A 3CP8A 4XR6A 4CCOA 2AQFA 1X1AA 1ZELA 2CV1A 2D4PA 3MD2A 2ZPAA 4U9ZA 3T9YA 4H4KC 3VSLA 4CCMA 4DOZA 1NG7A 4XMYA 1S3ZA 2W4SA 1FMVA 2X85A 1NE9A 3TL4X 3EFAA 4NF1A 2R98A 4C7IA 4B5OA 2B3VA 4MFQA 2M3AA 1Y7RA 4BBHA 4KUAA 3S93A 2P6FA 4OAEA 2UV1A 1KONA 4A33A 1IYLA 1ZO0A 4B11A 2DT6A 4E7HA 4AG7A 4MLOA 2YNEA 3JTKA 4JLYA 4CAFA 3VWEA 2I8DA 4HRIA 3LSGA 4CCJA 3BG7A 2KHMA 1RO5A 3DPLC 2W00A 3K70D 4PK3A 2VQYA 4JD6A 4C68A 3H5NA 4U9YA 4AB7A 4DNCA 1G8XA 3TOBA 2I79A 5EBVA 5C82A 3L2WA 4BE1A 2WAFA 3DEEA 2LH9A 3HUGB 3ZGKA 1KZFA 2Z10A 1MJ9A 4H89A 3TE4A 3N05A 1M1DA 4R57A 3PJRA 1XIXA 3VYSB 2FCKA 4B3XA 3ZJ0A 2HU9A 5FROA 4DIQA 1LKXA 1MMDA 2JSPA 4E4HA 2B3UA 5F49A 2VL8A 2WA0A 2Z3PA 2Z3MA 1WJFA 4C7HA 2Z3NA 2A5WA 2JUGA 5DWMA 4CGLA 3CF2A 5FRMA 4ZDOA 1QSTA 3FIXA 4A95A 1X1CA 4E7JA 3N7ZA 2E5NA 3CMMA 3AL0B 2QKMB 2R7HA 1PJRA 1SQHA 4CGMA 1VHSA 3JUWA 1V5GA 2HVSA 1Y56A 1K4JA 5LFAA 4UFVA 3OR1C 4Y49B 2R7XA 1J4JA 2L9SA 1VKCA 3ZXSA 4F0XA 2FE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PDO A;  2D4O A;  2OH1 A;  4U5Y A;  2B5G A;  2HV2 A;  5HH1 A;  2Q4V A;  1YLE A;  3PGP A;  5KTD A;  4PK2 A;  4PSW A;  3LD2 A;  4H6Z A;  1B6B A;  4QUS A;  4II9 A;  4R3K A;  2JDD A;  4JXR A;  4Y49 C;  1CM0 A;  3TCV A;  1CJW A;  2OZU A;  2Z0Z A;  4QC6 A;  1WK4 A;  2DXQ A;  5C88 A;  1NSL A;  3R1K A;  1YGH A;  1IYK A;  1B87 A;  4JWP A;  4UWI A;  3WR7 A;  5IB0 A;  2BSW A;  3VWD A;  4LX9 A;  2CNM A;  2R1I A;  3D8P A;  3LOD A;  2G0B A;  2FS5 A;  2OU2 A;  3V8I A;  2KCW A;  4AVB A;  3NE7 A;  3DR8 A;  1GHE A;  1IIC A;  4AVA A;  2BL1 A;  1Q2C A;  2FIA A;  4XPK A;  4ORF A;  5KTC A;  2B5G B;  1MJB A;  1Z4R A;  2B4D A;  2Z11 A;  1QSO A;  3FYN A;  2VZZ A;  4CAX A;  2Y0M A;  3KKW A;  4CS0 B;  3K9U A;  4XPD C;  3CXS A;  3G8W A;  4PV6 A;  4FD5 A;  4KOX A;  3EXN A;  1WWZ A;  1U6M A;  1MK4 A;  4FD4 A;  2JDC A;  3TFY A;  2NMT A;  5GCN A;  2J8N A;  3MGD A;  3UY5 A;  3IWG A;  2O28 A;  1V0C A;  1MJA A;  2P6G A;  1QSR A;  4FD6 A;  2OZG A;  1M4G A;  2PC1 A;  3FRM A;  3I3G A;  1PU9 A;  4B5P A;  1L0C A;  1M4I A;  5DWN A;  1KUY A;  3PZJ A;  2ZW5 A;  3BJ8 A;  2A4N A;  4PSX A;  2JEV A;  2R8V A;  1UFH A;  4CAW A;  4MBU A;  1BOB A;  2VI7 A;  4NXY A;  1Y9W A;  4K30 A;  1I21 A;  2BEI A;  3ZZI A;  4NEX A;  5FVJ A;  2GE3 A;  4YFJ A;  4YGO A;  4GS4 A;  3TT2 A;  2CNS A;  4MHD A;  4NCZ A;  3I9S A;  3JVN A;  4QBJ A;  2B58 A;  2PRB A;  4RS2 A;  3F0A A;  2ZW4 A;  4OAD A;  1QSN A;  3E0K A;  5H84 A;  4XPD B;  1IB1 E;  2FXF A;  3D2P A;  5H86 A;  3TTH A;  3F8K A;  1XMT A;  3S6K A;  2PR8 A;  2PR1 A;  4L8A A;  1S7L A;  3R9E A;  4E2A A;  5I0C A;  2AE6 A;  4OLL A;  1YRE A;  2Q4Y A;  3S6F A;  3S6G A;  4LUA A;  3FNC A;  4RI1 A;  1P4N A;  3DR6 A;  4HNX B;  1ON0 A;  1Y9K A;  2JLM A;  1YVO A;  3DDD A;  2I00 A;  2FL4 A;  2RC4 A;  1N71 A;  3C26 A;  2Q7B A;  5KTA A;  3EY5 A;  1Q2Y A;  4H6U A;  4UA3 A;  4YRH A;  3W6S A;  2P6E A;  5IX3 A;  2CNT A;  1I12 A;  4XNH C;  1S7F A;  3PP9 A;  5JQ4 A;  4KOR A;  1Z4E A;  1M4D A;  2J8R A;  2P0W A;  3SHP A;  4J3G A;  4UBR A;  1LRZ A;  2REE A;  5ISV A;  3QB8 A;  1NMT A;  4XPL A;  2WPW A;  2F5I A;  4R87 A;  4HKF A;  3D3S A;  5IV0 A;  2VBQ A;  2H5M A;  4UWJ A;  1YVK A;  2X7B A;  3EC4 A;  4I49 A;  3TO9 A;  4CRY B;  4KVM E;  2PQ8 A;  4ZBG A;  4IF5 A;  3R95 A;  2ATR A;  2BUE A;  3BJ7 A;  2IL4 A;  4QB9 A;  2J8M A;  3W6X A;  3S6H A;  3P2H A;  2Q44 A;  3RYO A;  2QEC A;  1R57 A;  2B4B A;  2GAN A;  2B4D B;  4R3L A;  1RXT A;  4KOW A;  2QML A;  4JXQ A;  4AVC A;  5J8F A;  2EUI A;  2Q04 A;  1YX0 A;  4KOY A;  2OB0 A;  3QAH A;  1M44 A;  4M3S A;  4F0Y A;  3B8G A;  1KUV A;  5EC4 A;  2G3A A;  2ZW6 A;  3P2F A;  1S60 A;  4HNY B;  2WPX A;  4MY0 A;  4F6A A;  5F48 A;  4L89 A;  4X5K A;  3G3S A;  2C27 A;  1PUA A;  2AJ6 A;  3T90 A;  1Q2D A;  3SXN A;  2EVN A;  3FXT A;  4CRZ B;  4KOV A;  3H4Q A;  2HUZ A;  2ZW7 A;  3CXQ A;  2K5T A;  1YK3 A;  2FIW A;  5E96 A;  3BLN A;  4XNH B;  2ZXV A;  3TO6 A;  1Z9U A;  2FSR A;  3R9F A;  1S5K A;  4BMH A;  4E0A A;  4MY3 A;  3FBU A;  4EVY A;  3CXP A;  2HQY A;  3F5B A;  1TIQ A;  1QSM A;  3TO7 A;  2ARH A;  5JPH A;  4MJ8 A;  3GY9 A;  5HMN A;  5F47 A;  3D2M A;  5CNP A;  1S7K A;  4KOU A;  4CAV A;  2G3T A;  4KVO E;  4KLV A;  3SXO A;  2VXK A;  1FY7 A;  4IUS A;  1XE4 A;  4NSQ A;  4ONU A;  4KLW A;  2Q0Y A;  2GIV A;  4HNW B;  2FT0 A;  4KZT A;  1KUX A;  3FB3 A;  4AG9 A;  1I1D A;  4R9M A;  2VZY A;  4B5P B;  2CY2 A;  3GKR A;  3GYA A;  3OWC A;  3EO4 A;  2VEZ A;  4FD7 A;  4KVX A;  3DNS A;  1YR0 A;  2QIR A;  3TOA A;  3DSB A;  3W91 A;  4QVT A;  4M85 A;  3IGR A;  4MI4 A;  4KOS A;  1S7N A;  3R9G A;  1XF8 A;  2OZH A;  1BO4 A;  3R96 A;  1XEB A;  1P0H A;  4KUB A;  2REF A;  2PSW A;  4JJX A;  4E8O A;  5F46 A;  4KOT A;  1IID A;  5J8C A;  1OZP A;  2ZPA A;  2D4P A;  3T9Y A;  4U9Z A;  1S3Z A;  1NE9 A;  4NF1 A;  3EFA A;  2R98 A;  4B5O A;  2B3V A;  1Y7R A;  4KUA A;  2P6F A;  4OAE A;  1IYL A;  4AG7 A;  4JLY A;  3VWE A;  1RO5 A;  4PK3 A;  2VQY A;  4JD6 A;  5C82 A;  4U9Y A;  4DNC A;  4AB7 A;  3TOB A;  2I79 A;  5EBV A;  2Z10 A;  4H89 A;  1KZF A;  3TE4 A;  1MJ9 A;  1M1D A;  4R57 A;  1XIX A;  2FCK A;  3ZJ0 A;  2B3U A;  5F49 A;  5DWM A;  1QST A;  3FIX A;  3N7Z A;  2R7H A;  1SQH A;  1VHS A;  3JUW A;  1K4J A;  4Y49 B;  1J4J A;  1VKC A;  2FE7 A; 
#chains in the Genus database with same CATH topology
 4MIM A;  5KCM A;  2F48 A;  1QQ9 A;  1KU3 A;  4XBF A;  4HNU A;  9ANT A;  2PJA A;  5G21 A;  4PXC A;  4H2K A;  5IB9 A;  4BUP A;  5HH1 A;  1R36 A;  1ZLJ A;  3JW4 A;  3K10 A;  4I09 A;  5E8G A;  1YLE A;  3PGP A;  4ZYQ A;  2IGM A;  3S16 J;  2XF7 A;  4PSW A;  3LD2 A;  3WE3 A;  3MKY B;  4H6Z A;  4QUS A;  3H3U A;  3SXY A;  4KMF A;  1JJ8 C;  2VLA A;  4R3K A;  2NNN A;  2ZSI B;  4XLP F;  3D7F A;  4Y49 C;  4ESB A;  3PB6 X;  1X2N A;  3D5R C;  3FXQ A;  4QC6 A;  3ISZ A;  2MGQ A;  3HHH A;  5HDN A;  5EGO A;  1NSL A;  2QKL B;  2E35 A;  5E3N A;  1IU8 A;  1LDK B;  3HG9 A;  4F55 A;  4WXD A;  1ZLK A;  2GLO A;  5CJ9 A;  3JTG A;  3BZ6 A;  3N97 A;  3WR7 A;  2ELK A;  6CPA A;  1VIX A;  1TL8 A;  4XM3 A;  1J59 A;  1A35 A;  3T5X A;  3GVA A;  1ZYR F;  2VON A;  4UUS A;  1P7I A;  1BL0 A;  3QOD A;  2ZME B;  1GDT A;  2P5L C;  4KIB A;  1A36 A;  1V54 H;  1WJE A;  4NUB A;  1FT9 A;  3F3X A;  2P8T A;  1B8I A;  2DDA A;  3M3Y J;  2G0B A;  3LOD A;  2OU2 A;  5IT9 Z;  1AKH B;  4XKC A;  3GTG J;  1OCT C;  5D8L B;  3CMY A;  5DM6 F;  2F5F A;  2YU9 J;  4G7O F;  4JP0 A;  4BQQ A;  4ZH4 F;  3NE7 A;  3DR8 A;  3H8E A;  3HEF A;  1GHE A;  4W9Y A;  2HOT A;  1Y0R A;  1KZH A;  2BL1 A;  4G7H F;  4IZZ A;  3VYU B;  4LOC A;  5L3F A;  5KVR A;  1Z8T A;  1YHQ I;  1MJB A;  2OC6 A;  4I0A A;  3K4J A;  3WC5 A;  3K69 A;  1HW2 A;  2VBZ A;  2QBY B;  1IGB A;  2HYJ A;  1Z0X A;  5LEK A;  2Z11 A;  4OME A;  1QSO A;  5FB2 A;  1ZAO A;  4RAY A;  4CAX A;  1QHH D;  1K4T A;  1U3E M;  1Z21 A;  3K9T A;  3KYC B;  2XRO A;  2ICW G;  4BD9 A;  4Z6Y A;  4IOC F;  3GTK J;  2K86 A;  4DYO A;  5DCM B;  4ZJZ A;  2VOD A;  4N4O B;  1R1T A;  2JA2 A;  3JRA A;  1O3T A;  2PJ2 A;  1WGX A;  3SJX A;  1FEX A;  4CYP A;  5TIS C;  1G3Y A;  3VWB A;  1XDU A;  5K5R A;  5EYR A;  3WU0 A;  1CF7 B;  1P2F A;  1R22 A;  4D1Q A;  4FD5 A;  4LQ6 A;  2UUZ A;  5HOD A;  2O8K A;  2YNC C;  5M3M J;  4RB0 A;  2COM A;  1TWH J;  5CVJ A;  1TBX A;  2E1M B;  3LSH A;  1ZH5 A;  1MZB A;  4L5E A;  1Z3Y A;  2VQG A;  3I5U A;  3BHX A;  5C3E J;  4N9I A;  3T8T A;  2K4J A;  3B73 A;  4P1W A;  2P6G A;  1XGO A;  3SZG A;  4MCR A;  2JPB A;  5K7Z A;  1LE8 B;  2YX4 A;  4FD6 A;  1QA6 A;  4Q38 A;  2V4J C;  2QSF X;  2E7W A;  2XAG A;  2G9D A;  3H3Z A;  1DP3 A;  2MBF A;  1YTY A;  5JHF A;  4XOR A;  2JSC A;  3CCV I;  2QBY A;  5LYI A;  2M0C A;  3CDI A;  2EFN A;  2Z16 A;  3FZV A;  2DA7 A;  2PE3 A;  5CVU A;  1JUS A;  3K4K A;  3FVL A;  1BR1 A;  3BJ8 A;  4NFR A;  1Z77 A;  4F7Z A;  3HJE A;  5ILS A;  3WTW C;  1ZGA A;  2CW7 A;  4NBQ A;  5JH9 A;  2E19 A;  3PUF A;  3RZD J;  4CGN A;  1BOB A;  2BVL A;  1IDY A;  3LFU A;  1EE3 P;  2KJC A;  2FBH A;  1S72 I;  3LSI A;  4TWE A;  3DBR B;  1I21 A;  4K30 A;  1I39 A;  2BEI A;  4NEX A;  1V5E A;  3O3K A;  2HNH A;  2H8W A;  4PK4 A;  3BG3 A;  2GE3 A;  5F1J A;  2RDP A;  2FML A;  1D0Z A;  3BTI A;  1WHU A;  5IP7 J;  3IRR A;  5JVG F;  4R6T A;  1O3R A;  3WTT C;  1VQ9 I;  1YJ9 I;  4MHD A;  3TGN A;  4HV5 A;  2DOA A;  4FQG A;  5LRS A;  3HKZ A;  2R7D A;  3OYF A;  4QBJ A;  4M3G A;  4HAM A;  2X48 A;  4XQF A;  1HEE A;  2YGW A;  3MZH A;  5J6X A;  3AL0 C;  3F0A A;  1HQC A;  2BGC A;  2FJ1 A;  2BV6 A;  2ZJ2 A;  3DLA A;  1QSN A;  2Q1Z B;  4OAD A;  3WGH A;  3WG7 H;  2M8G X;  3L09 A;  2XEJ A;  4YRV A;  4MEX F;  1LE8 A;  2PI0 A;  5G20 A;  3TTH A;  3KP7 A;  3VOE A;  1ZQ3 P;  1XMT A;  2BY3 A;  2M2E A;  2VPR A;  1ETX A;  3TKY A;  3S6K A;  2L5Q A;  2AS5 F;  1MBF A;  2VQH A;  1S7L A;  4E2A A;  3DTK A;  2WWY A;  4R8H A;  2IT0 A;  2JWT A;  1TWC J;  3BG6 A;  3M8J A;  3S6G A;  2JBJ A;  1EV7 A;  1U5T C;  2HDW A;  1DGR M;  2LFB A;  2RQQ A;  3E0J B;  3DR6 A;  2EBJ A;  4EME A;  3M1C A;  4G12 A;  4BQA A;  1Y9K A;  3GLX A;  1VTN C;  4MEY F;  4X0G A;  2K4B A;  1Z67 A;  1YVO A;  3TW7 A;  4P5O A;  4ZYE A;  2VBX A;  3KPH A;  3DBL B;  2R4G A;  2YX7 A;  2Q7B A;  4XK4 A;  4ETS A;  1Q2Y A;  3KP5 A;  2KIM A;  2OAZ A;  2WY8 Q;  4G7Z F;  1YSJ A;  4UA3 A;  4YRH A;  3W6S A;  4TV7 A;  2HOA A;  2P6E A;  2DA4 A;  4ESJ A;  3PB4 X;  4XL9 A;  2ME6 A;  1TNT A;  2CNT A;  3SFZ A;  4U87 A;  1I12 A;  4IQJ A;  1VQ6 I;  3QP5 A;  3B35 A;  3WU1 B;  3RNZ A;  1QHG A;  1RKT A;  2RGV A;  1I1G A;  5L3C A;  5ERI A;  4UVB A;  4KOR A;  5HVH A;  1W4M A;  3BR2 A;  4KMU X;  2PJ7 A;  5IOZ A;  1IAW A;  2XF6 A;  4YIF A;  5FLX Z;  2BE5 F;  2J8R A;  1MMN A;  3S1M J;  1UG2 A;  4PGH A;  3MRU A;  2F8H A;  2ZXH A;  3L2Q A;  1KU2 A;  2KFD A;  4N0B A;  1JUM A;  4ENK A;  3TP0 A;  4MFK A;  3BCA A;  1RES A;  2CSO A;  1HDQ A;  3K4N A;  4XSX F;  1I5Z A;  1JE8 A;  3S8P A;  1GLN A;  1QRY A;  3GW2 A;  2WPW A;  3TX8 A;  2F5I A;  1UB9 A;  2PMU A;  4P96 A;  5EG0 B;  2GQQ A;  4HKF A;  4HPQ A;  1CG2 A;  5JFR A;  1BI0 A;  1Q1H A;  3TO9 A;  5ICF A;  3RQ4 A;  4CAE A;  4CSW A;  4HDU A;  3SI2 A;  2HXI A;  4X8I A;  4OMY A;  2O8X A;  1XGM A;  1BLL E;  4ZBG A;  1ZG9 A;  5HOO A;  3R95 A;  1LJ9 A;  3K1P A;  2CW8 A;  2FA5 A;  3MVP A;  3AG3 H;  5JR3 A;  4AID A;  4AVP A;  2IL4 A;  3Q0U A;  4U0Y A;  3FXJ A;  2Y48 A;  4RGS A;  5GAD J;  4LQG A;  2Q44 A;  4HYE A;  1XPX A;  3T8R A;  3WE2 A;  1WH5 A;  2B4B A;  2W57 A;  5E1W A;  5H20 A;  2QEC A;  4UFX A;  4R3L A;  3PQK A;  4LLN A;  4Y15 A;  4ZY1 A;  2V9P A;  1GUU A;  4O5V A;  1ZRF A;  4J19 A;  1F43 A;  4E7I A;  2IJL A;  3FMR A;  4GRI A;  1TWG J;  1ODD A;  1W36 D;  5IT9 K;  4MHY A;  3TE4 A;  2JPC A;  1JHH A;  2HVR A;  2OB0 A;  1ZR4 A;  3QNV A;  2HQA A;  4IRH A;  3IC7 A;  3GIU A;  4M3S A;  2W24 A;  1WJD A;  1G4D A;  4L18 B;  3P2F A;  1S9H A;  2ZOG A;  4RUH A;  1VQP I;  4PCQ A;  2YPR A;  3K0L A;  1OQY A;  1G6N A;  4HNY B;  1X1D A;  4HW0 A;  1BC7 C;  2DU9 A;  3D66 A;  3CCY A;  2JQ7 A;  2M30 A;  1WJC A;  4WJB A;  5LYF A;  1S7A A;  4L89 A;  4X5K A;  2DA6 A;  2WUU A;  1ZG5 A;  4BY1 J;  2XAF A;  1CX8 A;  4JZ0 A;  2Y9Z A;  4R76 A;  1AUG A;  1T6S A;  1Q2D A;  2HEO A;  3K7A J;  4B44 A;  2GWR A;  4IPA A;  5JHU A;  3LST A;  2KQR A;  5B1B H;  4ZZD A;  4FE7 A;  3D0S A;  4EQQ A;  5J1Y A;  4F92 B;  2ZW7 A;  2P5V A;  2OV7 A;  5CBM A;  3QWL A;  4PJJ A;  1Y6I A;  1G59 A;  2L7M P;  2ZB9 A;  4ONW A;  4UHT A;  3VSK A;  2B0L A;  1UHW A;  1VF9 A;  2BXZ A;  3QPH A;  4LIT A;  1QNT A;  3TO6 A;  2L54 A;  1Z9U A;  4P45 A;  4FE4 A;  3R9F A;  3NE8 A;  1RI7 A;  3F6O A;  4NJQ A;  4A6E A;  4UCP A;  2BBY A;  3BG9 A;  4MY3 A;  4E0A A;  3ABK H;  4E7L A;  2O9L A;  1R6R A;  2PIY A;  2BW3 A;  5J1R A;  2ZXW H;  5JPH A;  4MJ8 A;  2LP0 A;  3GY9 A;  5HMN A;  5F47 A;  4LD5 A;  3IHU A;  2XAU A;  5IYD J;  4A3D J;  3QRF F;  1DTD A;  1LAM A;  4BHC A;  2LY2 A;  5AIQ A;  5DUI A;  1JT0 A;  3S9M A;  1BI2 A;  2O6G E;  3RKY A;  1A6I A;  1Z5R A;  4KJZ A;  4K2E A;  3COA C;  1FY7 A;  3I54 A;  1XE4 A;  1YW4 A;  3DU5 A;  4NC6 A;  3GTO J;  5C4X J;  4ONU A;  4G8X A;  3IUO A;  4A2U A;  4GO1 A;  3IU1 A;  2RVC A;  2GIV A;  3H9G A;  3C7J A;  3DWL E;  4Z2Y A;  3BP8 A;  4EJT A;  4EFD A;  3LWF A;  2HYG D;  2X6W A;  3OYA A;  2EJR A;  1K78 A;  2ID6 A;  1XBU A;  5M3F J;  2MAB A;  4A3L J;  4BQN A;  4RLQ A;  1ZG3 A;  2EIN H;  5D8K B;  3J7Z I;  1FNO A;  4AYB N;  3U1K A;  1HDD C;  3LSJ A;  2CY2 A;  3JAM K;  4NNJ A;  3N5F A;  3W2V A;  4F52 A;  3EO4 A;  3HXL A;  2IGO A;  4HX4 A;  2M45 A;  3CUO A;  1MBK A;  3CCU I;  1W5T A;  4IX7 A;  1SFO J;  1Y1W J;  4FX0 A;  5LHI A;  1K78 B;  2M5W A;  2C6Y A;  4KVX A;  5LEJ A;  4LIU A;  3ROU A;  2R7F A;  2Z3L A;  2VT2 A;  3MKW B;  3D1N I;  2ZCW A;  3BR5 A;  3KEQ A;  1TZL A;  1XD7 A;  3NAR A;  1PDN C;  4IHV A;  2V1U A;  3TOA A;  3GUX A;  4FET A;  5H6R A;  5J40 A;  2KDZ A;  3D7H A;  5LYD A;  2ZNY A;  2CV0 A;  1HDP A;  4JQF A;  1R71 A;  3HTS B;  1GHC A;  4QVT A;  2QLZ A;  2HC9 A;  4M85 A;  4X2T A;  1HCR A;  2NRA C;  1BN5 A;  3OL4 A;  3CZX A;  4KNY A;  2CWE A;  3L2U A;  5LRK A;  2XDV A;  3R9G A;  2V77 A;  2QSH X;  1ONV A;  3Q0W A;  1ETY A;  3TW6 A;  2OZH A;  3ZRG A;  4D0P A;  2V8H A;  1XN7 A;  3KQX A;  4BIN A;  1P0H A;  4QSH A;  4XRM A;  3JSP A;  4F9V A;  1MH4 A;  2MSY A;  3VYT B;  2WAQ N;  2NYQ A;  3G6E I;  2Z9O A;  3SI1 A;  1GV5 A;  4HG2 A;  2KL4 A;  3F8C A;  2EK5 A;  2Z33 A;  3R0A A;  1E3O C;  1MMG A;  4HZF A;  1EA3 A;  3WG9 A;  3BZK A;  2XHK A;  4UB8 C;  2XGE A;  4B4C A;  4KOT A;  1WFX A;  3P5J A;  5J47 A;  1G3T A;  4QTR A;  1WPK A;  5LRR A;  5D6E A;  5L3E A;  4I98 B;  2V8G A;  1OFC X;  1HW5 A;  4M6V A;  3GME A;  5ICC A;  1IN4 A;  1OZP A;  3WU2 C;  4XR6 A;  5K7H A;  2ZPA A;  1X1A A;  3ZQF A;  4L5I A;  4U9Z A;  2I5U A;  3P7N A;  4CCM A;  3V38 A;  3G71 I;  2DOE A;  4XMY A;  2CQN A;  2X85 A;  1NE9 A;  3EFA A;  2H1K A;  1XCB A;  2FBK A;  2NVQ J;  4A0X A;  1ETW A;  1S6L A;  4BBH A;  2WV1 A;  4I2O A;  4KUA A;  3M9A A;  3S93 A;  3FM5 A;  1KON A;  4WXC A;  4E7H A;  2OF7 A;  2CJJ A;  4HNV A;  1PUE E;  5JM6 A;  1U2W A;  2I8D A;  2HI3 A;  2PJB A;  3L2N A;  4OC4 A;  4AUX A;  3DPL C;  3K70 D;  1MDM B;  3L00 A;  2VQY A;  2ZEF A;  1YO5 C;  5C82 A;  2AHQ A;  3QQA A;  3NH5 A;  3DEE A;  3FXU A;  3C3W A;  2O61 A;  3R0J A;  2IQ6 A;  1XIX A;  3VYS B;  2FCK A;  1F36 A;  1TNS A;  2HU9 A;  1ITY A;  1MMD A;  3JCU C;  1YLO A;  3EQL F;  2Z3M A;  4C7H A;  3GF2 A;  1KQ0 A;  2C1C A;  2JUG A;  2DBB A;  4A95 A;  1KU9 A;  4M6I A;  3DBH B;  3CMM A;  3AL0 B;  2UXN A;  2QKM B;  3JUW A;  1K4J A;  4UFV A;  1E3H A;  2R7X A;  1J4J A;  3CLQ A;  2L9S A;  3ZQ7 A;  1VKC A;  4F0X A;  3JAM Z;  1K79 A;  2FE7 A;  1EH6 A;  4GYG A;  2PDO A;  1EKE A;  3HOX J;  4UF4 A;  2O7O A;  2Q4V A;  2ADU A;  2HOE A;  2LKP A;  5KTD A;  4EM1 A;  4UV9 A;  4PK2 A;  1F1Z A;  1B9N A;  3I64 A;  3B3T A;  2X1E A;  1F57 A;  1Z05 A;  4JXR A;  2Y69 H;  2D45 A;  4NGT A;  1OKR A;  1WK4 A;  2V8V A;  5C88 A;  1BI3 A;  3V7R A;  2PBI A;  3JRD A;  1FT7 A;  3R1K A;  2DXI A;  3RCO A;  1QZY A;  2M8E A;  2E1M C;  2WB1 A;  1J5Y A;  5J1U A;  2F5E A;  4IHY A;  1G3W A;  1S5L C;  3MN2 A;  2BSW A;  2EA4 A;  2JVG A;  2A6H F;  5C44 J;  2EV6 A;  2K9M A;  1UMQ A;  4RDU A;  4NGS A;  4HF1 A;  2EZK A;  4BE0 A;  3OYC A;  2X4H A;  2R1I A;  3DTI A;  3RKX A;  3D8P A;  5LYL A;  1VQM I;  1MW7 A;  2KCW A;  4HA8 A;  3OYH A;  4AVB A;  1I6X A;  2FEZ A;  3ZMU A;  2NSM A;  4NGN A;  4A39 A;  2O53 A;  2ZEP A;  3RSN A;  1HSJ A;  4XNF A;  3IWZ A;  1Q2C A;  1IDZ A;  4L9T A;  4A3C J;  5H2F C;  4M3E A;  2V6E A;  3ZMZ A;  4U0V A;  3PSI A;  3ZMD A;  4XID A;  5EEG A;  5E1Z B;  4C3I J;  1QVU A;  3E3V A;  3SHF A;  4C2U A;  1NK2 P;  2DK5 A;  2J5P A;  3S1N J;  3EUH A;  3ULQ B;  2PFB A;  5GAE J;  3I71 A;  1FIP A;  3QPT A;  2FSW A;  5CYV A;  1KQ9 A;  2L02 A;  2PG4 A;  4BH9 A;  5HDK A;  2STT A;  3WT4 A;  4P10 A;  2Z1D A;  2VBW A;  4XN0 A;  2LSO A;  2LY1 A;  2F4O B;  3CXS A;  1H8L A;  4R7M A;  2OR4 A;  3HSE A;  4PJM A;  2LYC A;  1H88 C;  3EUK L;  1WCM J;  2DQL A;  3FXL A;  1OMI A;  1ZGJ A;  2ZSH B;  3K4M A;  4FUU A;  1D3Y A;  1OCZ H;  1AU7 A;  1WWZ A;  3EXN A;  1HXD A;  2OZ6 A;  3F72 A;  1MK4 A;  4XLC A;  1YLF A;  3IIB A;  4FD4 A;  4IHX A;  1LUJ B;  4GCV A;  2LNB A;  2E2J J;  3TFY A;  2KDO A;  4FHT A;  5E3M A;  4MFJ A;  5GCN A;  3RIR A;  2GOX B;  1V0C A;  2A5Y B;  4QLC U;  4BJT A;  1WJA A;  1KWM A;  3UKG A;  4S0H B;  1MJA A;  1Z9C A;  2XEI A;  4M74 A;  4MCP A;  1M1E B;  1W36 C;  1GYT A;  3H35 A;  4GXO A;  1K83 J;  2FNA A;  4BEH A;  2AXT C;  4RN7 A;  3FXR A;  4XRF A;  4B43 A;  1YS7 A;  2HPM A;  1VQ8 I;  1VI0 A;  4YEJ A;  2OZG A;  2PC1 A;  1ULY A;  4DGW B;  3I3G A;  2HPI A;  3FED A;  4YWY A;  2HWV A;  1RTQ A;  3GFJ A;  4YU9 A;  4A3B J;  1L0C A;  3H0G J;  2ECB A;  1HC8 A;  5BPD A;  3L2R A;  4IHS A;  2CUJ A;  2VJ4 A;  4A37 A;  4CDG A;  2FE3 A;  1ORK A;  1CPS A;  1FIA A;  4IF4 A;  1RRJ A;  4C2X A;  4PSX A;  1FYM A;  3S17 J;  2LOO A;  4BEH B;  4C3J J;  4X6A J;  2IP2 A;  2KLO A;  3KYD B;  2R8V A;  5A2Q K;  2IW5 A;  5IPA A;  5ILU A;  3WTU C;  3KAS A;  1ELL P;  2VI7 A;  2CFO A;  4U7B A;  3TC8 A;  1S8N A;  1J75 A;  4P55 A;  3GEZ A;  2QSG X;  4NXY A;  1WH7 A;  2K9L A;  1X3U A;  2JRT A;  5ICG A;  2R5Z B;  1Y9W A;  4NGR A;  4P4E A;  3L9F A;  3ERM A;  3SEZ A;  4D9J A;  1HW1 A;  2VI6 A;  2DOD A;  2R7Z J;  2CUE A;  1WQ2 A;  2W84 A;  2R7T A;  8CPA A;  5BWA B;  2R7Q A;  1UST A;  5FD6 A;  1FBQ A;  5HVQ C;  4IEJ A;  2JTV A;  2VE9 A;  1RET A;  2IS2 A;  1W5S A;  3PQJ A;  4DZJ A;  3QOP A;  3LFK A;  3E5Q A;  4RS2 A;  1KQ8 A;  1ZK8 A;  2IA0 A;  2PJ3 A;  2CQK A;  2ZW4 A;  3CJR B;  3ZQH A;  4EJW A;  1F5T A;  4B13 A;  2AXL A;  1IB1 E;  1IUF A;  4M3F A;  4RAG A;  2AFX A;  2FXF A;  1IZ1 A;  1X3Z B;  2Y75 A;  4BJ5 C;  5KHD A;  2OQG A;  2ZEG A;  3H1C A;  4MXU A;  2CFX A;  2DTZ A;  4CA0 A;  2EIJ H;  2JN6 A;  5EJC A;  4A3G J;  2AFU A;  3I0T A;  2X1C A;  4LGW A;  2PR1 A;  3KZI C;  5HS9 A;  2JRM A;  2Q8K A;  3LSP A;  3R9E A;  1OR7 A;  1V4R A;  2KZV A;  4M6G A;  1RR7 A;  3KP4 A;  5TGT A;  4OLL A;  1YIT I;  1YRE A;  2PMH A;  3BTJ A;  4NDL A;  3S6F A;  2XAS A;  5IOY A;  2VIX A;  1U0J A;  3G1L A;  2DPU A;  2ESH A;  1H9G A;  3PO2 J;  2VJI A;  1PP7 U;  4LUA A;  4HQE A;  2OA4 A;  2JLM A;  2P6T A;  2OPT A;  1LEB A;  4A0Y A;  3PL8 A;  2DMP A;  4IO9 F;  4MQV A;  2VOP A;  2QCO A;  3C26 A;  2ELH A;  4KSA A;  3S9N A;  4H6U A;  3L1P A;  2Q43 A;  2H6B A;  4B8X A;  4R79 A;  1ETK A;  1NTC A;  3BI0 A;  3DU6 A;  3KHZ A;  3HKZ N;  2LBF A;  4XNH C;  2WSA A;  3PP9 A;  2XKO A;  4GFB A;  1D1B A;  1B59 A;  3CC2 I;  4YIR X;  3K2K A;  1R5G A;  2MW8 A;  2VJ5 A;  4ZYG A;  3ZQL A;  2LMD A;  1MBG A;  1BR2 A;  5FKN A;  1HKQ A;  1ARL A;  4EVI A;  3DFG A;  4BDY A;  4UBR A;  3NA6 A;  1FNN A;  4KIC A;  3KP6 A;  4HNT A;  1UWY A;  3PUB A;  2VL1 A;  5DS0 A;  1AWC A;  3ZCO A;  5GTI C;  4LLL A;  2HZT A;  5LRG A;  3F23 A;  4BYY A;  3B6A A;  3HTU A;  3VFZ A;  5GAG J;  1ON2 A;  4CYD A;  3PB8 X;  4MFE A;  4R87 A;  5FLV A;  3RBU A;  3GX4 X;  2XAH A;  3AG4 H;  3HOS A;  4L9N A;  1TQI A;  1F4K A;  1IOF A;  2VBQ A;  5IV0 A;  5K8N A;  4LJZ F;  2GLF A;  2NVY J;  2QQB A;  2DMN A;  3PFI A;  4I49 A;  5LLQ A;  4KVM E;  1X10 A;  3KQZ A;  1S3J A;  2K9N A;  1LFB A;  2HTJ A;  3S32 A;  3WTX C;  2E2H J;  3P9K A;  1SVO A;  4HBL A;  3RJP A;  4HV6 A;  3CC4 I;  3H0D A;  3HRU A;  4IF5 A;  3SQN A;  3BTC A;  2K7L A;  4OU0 A;  1B1B A;  1O3Q A;  5E20 A;  4M6X A;  4YFX F;  4FTH A;  4CXF A;  4CIC A;  5DM7 F;  4EAT A;  3UNG C;  4CGZ A;  1R57 A;  4B48 A;  2OD5 A;  1F2O A;  1OLT A;  5HVG A;  2DT5 A;  1RXT A;  4KOW A;  2QML A;  4JXQ A;  3HRM A;  2C6P A;  3HC7 A;  4AVC A;  3A1Y A;  2ANP A;  1ZGW A;  2EBI A;  5J8F A;  2XSD C;  3CCL I;  2EUI A;  1REP C;  3RYR A;  4M6H A;  2Q2E B;  2L3D A;  3S3O A;  3ERE D;  2IAI A;  1MND A;  1YX0 A;  2V26 A;  5EEH A;  1FOX A;  4D7M A;  3QAY A;  3OYJ A;  2JA5 J;  3BT9 A;  5D29 A;  4RS8 A;  2LR8 A;  1M44 A;  2CTB A;  1S7O A;  1E17 A;  4NB5 A;  3NH4 A;  1ELM P;  4XOP A;  3B8G A;  3H5R A;  3LSM A;  4WXH A;  4A94 A;  1E3P A;  2ZW6 A;  1MDM A;  4F0Y A;  3REO A;  3Q9V A;  1IF1 A;  1X19 A;  1LVA A;  3PFY A;  5EEA A;  4AIH A;  3RKQ A;  4O23 A;  4MCS A;  3CUQ A;  4ASN A;  4BY7 J;  1ETV A;  1QVT A;  4CYN A;  4OIW A;  1YJN I;  4BL0 B;  2V7F A;  4EWT A;  3T8W A;  4KDP A;  4B14 A;  1TT0 A;  4U7D A;  4MY0 A;  4AVZ A;  3RI4 A;  4BXF A;  2Y0S A;  4AD9 A;  5L3D A;  1JTX A;  2FD5 A;  3HIF A;  3CO6 C;  1JKR C;  5AG5 A;  4F6A A;  3QOE A;  2VJJ A;  4D5F A;  2YNC A;  1NH3 A;  3F8F A;  4D7N A;  3GUD A;  5ILV A;  3T90 A;  1D8J A;  2FUG 2;  3SXN A;  3KX2 A;  2ZOF A;  2KRC A;  3FXT A;  4U0W A;  2RN7 A;  4KOV A;  4FT8 A;  5CVV A;  2MD0 A;  4OWR B;  3QPS A;  3CES A;  3RPU D;  1ZRE A;  4CYQ A;  3CXQ A;  2BYV E;  4RGX A;  2HB6 A;  4CCL A;  3BY6 A;  4MNU A;  4M3B A;  2E1O A;  4XN3 A;  4CGP A;  5H6Q A;  5F0C A;  4XRS G;  4XNH B;  5E3L A;  1JGG A;  3PNY A;  4EJU A;  1XSD A;  1ZN2 A;  1MMA A;  3BG5 A;  3OWT A;  1S5K A;  3IEH A;  1I3Q J;  3H3V K;  2PJ8 A;  4JX4 A;  5M5Y J;  2DDB A;  2L2O A;  2LK2 A;  2HQY A;  5CQG A;  1UG0 A;  2KKO A;  2M4G A;  4WX9 A;  3CCJ I;  4O6J A;  5B3S H;  3JRG A;  2JZY A;  1TIQ A;  1TKH A;  1YME A;  2V1X A;  1X4O A;  3LA3 A;  4PJN A;  2ZJP F;  3KZZ A;  1Z91 A;  2HFH A;  3J7A Y;  3I4M J;  2XAQ A;  3CQZ J;  4PDK A;  1S7K A;  1XFO A;  2EH3 A;  4PFO A;  1XSV A;  1YW9 A;  2KIS A;  1BM9 A;  2G3T A;  4KVO E;  4KLV A;  3SXO A;  4M9X A;  3UR3 C;  1QMU A;  2PLY A;  4II2 A;  3JRB A;  3K4B A;  3D5S C;  3F6V A;  2MG4 A;  1XB4 A;  3LSR A;  3FMS A;  3Q0V A;  3FIS A;  5FFZ A;  5K7F A;  2R7S A;  1UAA A;  2R7V A;  1MSF C;  1ZG7 A;  3OYE A;  4HSR A;  4DW6 A;  3GFL A;  2FT0 A;  4HNW B;  3FM3 A;  4KZT A;  1IN6 A;  3A01 A;  5FGM A;  3IWF A;  3ZR8 X;  2EWB A;  2HDC A;  4OMZ A;  4ON0 A;  2VZY A;  2LKS A;  4NQW B;  4OIR F;  1JWQ A;  3E97 A;  2CYY A;  1BBY A;  1RUO A;  2DEA A;  3JRU A;  4M73 A;  2Q0O A;  1BIB A;  4EJO A;  3A01 B;  4FD7 A;  1VND A;  2VN2 A;  1XGN A;  2H8R A;  3WAB A;  3K4L A;  2ZEE A;  3OYK A;  2BY0 A;  3GLJ A;  1FMW A;  2DFF A;  2KIF A;  5CVI A;  3U21 A;  3W2A A;  2DA3 A;  1LAP A;  4XKB A;  2QIR A;  2D1H A;  4B47 A;  2MYS A;  4OC5 A;  3A9L A;  1ERD A;  4DJL A;  3PO3 J;  2WBM A;  2BVM A;  2KMU A;  3DEU A;  1QGP A;  1SFK A;  3ABT A;  1Y0Y A;  3S14 J;  1Q7L A;  4MI4 A;  3EUA A;  1ETO A;  2BOL A;  4UVC A;  3JRH A;  2X51 A;  3BLY A;  3DEW A;  1OYY A;  4O3M A;  1XF8 A;  4MQ9 F;  3H8G A;  3AAF A;  2ZBK A;  5FKL A;  2QQ8 A;  2NS7 A;  4OIO F;  3R60 A;  1MKM A;  3BWG A;  2FNP A;  1U9N A;  4KUB A;  4A3M J;  3SJE A;  3BR0 A;  1W0T A;  2HR3 A;  4E8O A;  4OIN F;  4UCN A;  4KT5 C;  2LVS A;  2L9V A;  2LF8 A;  4M3D A;  2XGX A;  3DKX A;  4IXA A;  2XF5 A;  4AU7 A;  2DQR A;  4Y52 J;  1T8I A;  1AMP A;  2MH2 A;  2VOO A;  5FFX A;  1ZEL A;  4RAZ A;  2WC2 A;  5J1Q A;  2NVT J;  3VSL A;  4IJA A;  4RB3 C;  1NG7 A;  2DJN A;  1I50 J;  2QVO A;  2L01 A;  5E1X A;  3TL4 X;  3EYI A;  3TDU C;  2ZKZ A;  4B5O A;  3GFM A;  2F5D A;  4L9V A;  1ZG1 A;  1Y7R A;  2UXX A;  5EGO B;  1VFC A;  3CO7 C;  1TQM A;  4A0Z A;  4B11 A;  1R00 A;  3C18 A;  3FK6 A;  4AG7 A;  1IRG A;  1G2H A;  3CTA A;  4D5C A;  3OSF A;  4JLY A;  4CAF A;  2DA1 A;  4M72 A;  2ZC2 A;  4CCJ A;  2R5Z A;  2KHM A;  3FXO A;  2L0K A;  1ENH A;  2HQN A;  4PK3 A;  4WF2 A;  3CDL A;  2PEX A;  5JVT A;  1G8X A;  3TOB A;  5F64 A;  2I79 A;  4F8Z A;  2WAF A;  3VB2 A;  2LH9 A;  4UXN A;  3U9G A;  5K5O A;  3D67 A;  4H89 A;  1SFE A;  2IVM A;  2IEK A;  2W25 A;  5DDG A;  1M1D A;  4PQA A;  2BEO A;  5TRD A;  5DS9 A;  1LKX A;  2GXB A;  4OOI A;  1KGS A;  1DUX C;  2FVG A;  1FJL A;  5F49 A;  2WA0 A;  4GDF A;  3J81 K;  2Z3P A;  2XPV A;  4I7H A;  4UVA A;  3HOY J;  4CGL A;  2DAO A;  4HLY A;  2EFW A;  1QST A;  2NYX A;  1DDN A;  1X1C A;  3N7Z A;  2R7H A;  1TLH B;  1LOK A;  2V8D A;  1PJR A;  1SQH A;  5F27 A;  1VHS A;  3PEI A;  5HLG A;  4RB1 A;  4M9S A;  1ZR2 A;  1Y56 A;  2OOT A;  2XPU A;  3LQR A;  5LFA A;  4JX6 A;  2OQR A;  4UV8 A;  2ZXJ A;  2IJZ A;  3RPQ A;  3CPX A;  4DJA A;  4C30 A;  1EJ9 A;  3TQN A;  4F3Q A;  2W7N A;  2OH1 A;  5D8N A;  3GTP J;  2EV5 A;  2B5G A;  2PJ1 A;  4U5Y A;  2X1D A;  2HV2 A;  2YUS A;  4DYQ A;  3HM5 A;  1T0F C;  2K9Q A;  4ENM A;  1IXS B;  1HST A;  4E7K A;  3WOD F;  1B6B A;  2Z2S B;  3FHZ A;  4IOA F;  4II9 A;  2JDD A;  5FO5 A;  4IHW A;  1W7P D;  3DKW A;  1LDJ A;  2GRE A;  3TCV A;  2E60 A;  2RNG A;  1DP7 P;  2X9D A;  1CJW A;  3E7L A;  4KIF A;  3VAR A;  4E6K G;  3KE2 A;  2EZL A;  3ZMS A;  4IQ4 A;  4PXB A;  1F2P A;  2EZI A;  4UCM A;  3CP2 A;  2V79 A;  3IH3 A;  4CYC B;  2XV4 S;  1YGH A;  3BC8 A;  1ACI A;  1SMY F;  4MHZ A;  3K6G A;  4JWP A;  2CTC A;  4UWI A;  1F9N A;  2G9W A;  4ENN A;  2G0E A;  1TW3 A;  3KGQ A;  1BI1 A;  4LX9 A;  1FSE A;  2HGC A;  1APL C;  5K1Y A;  1XMX A;  4IHM A;  1PCA A;  2DA5 A;  4A3I J;  3FF5 A;  3GCM A;  5FKM A;  2VUM J;  3HSR A;  3OYM A;  2WZN A;  3BXM A;  4MGR A;  1FPQ A;  4XKV A;  1T95 A;  1KYZ A;  5BQT A;  4MTD A;  2RQP A;  3BJ6 A;  3V8I A;  3X2Q H;  4BAC A;  1S29 A;  3SDG A;  5K5Q A;  2V6C A;  2R93 J;  2CIJ A;  7CPA A;  2E5Z A;  3OS0 A;  4ESF A;  1IIC A;  3FBN B;  4G94 A;  2N8G A;  2QWW A;  2TDX A;  3GO5 A;  3SEQ A;  4DZP A;  4WWV A;  3SYT A;  1LCP A;  3K70 C;  1Y1V J;  3CME I;  4UUV A;  5LGT A;  4ORF A;  4XPK A;  2O03 A;  2M7A A;  3BZC A;  5IP6 A;  1YW6 A;  4DBQ A;  4OID A;  2B5G B;  1MBH A;  3HGY A;  3ZMT A;  3TBI A;  4UEF A;  1Z4R A;  3J80 Z;  2AQE A;  2B4D A;  1RPW A;  3LAC A;  3FYN A;  4KSI A;  1P92 A;  2VZZ A;  3N4M A;  2L7Z A;  2Y0M A;  3KKW A;  4MRI A;  3LWU A;  2DFH A;  5L3B A;  3K9U A;  1JUP A;  2A05 A;  1R43 A;  5AG6 A;  4C2Z A;  1XMA A;  4YEL A;  3KZW A;  2V1D A;  2X6Y A;  4YII A;  2CW0 F;  4BKX A;  2LTP A;  4XPD C;  4YFK F;  4F9U A;  1X4P A;  3DCF A;  4CYC A;  3SI0 A;  3M7G A;  1OIS A;  3JRC A;  1LVK A;  3ZQG A;  3S3N A;  2X6O A;  2Z3K A;  4A93 J;  3WC7 A;  1OR7 C;  4PV6 A;  1DQU A;  1SAU A;  3LQQ A;  5JGF A;  3MKL A;  3W6K B;  4A69 C;  4QPQ A;  2AO9 A;  2LRD A;  4UY8 I;  1VZ0 A;  3HRT A;  4E7S A;  4L0Y B;  4MHN A;  1FBS A;  3B6C A;  4G9Y A;  2LKX A;  3BRO A;  2NMT A;  3DQV C;  3E1S A;  3KI9 A;  2E2I J;  5CPA A;  2GAU A;  2R0Q C;  2J8N A;  3HLP A;  4G6T B;  3UY5 A;  4ZDP A;  1TKJ A;  2O28 A;  2GU2 A;  5M5X J;  1L3L A;  2QYO A;  4HLX A;  3Q9S A;  5E3O A;  3KEY A;  1FYK A;  1IY7 A;  5FKO A;  1ON1 A;  1ZAR A;  2VXZ A;  5HNF A;  4B10 A;  2A07 F;  4B12 A;  2IBD A;  2CRG A;  3LOC A;  3KLN A;  3DPT A;  3AG2 H;  2VKH A;  3S3M A;  1BAV A;  3G4S I;  4ZX9 A;  2FMY A;  3DNS A;  1FZP B;  4QWQ A;  1YIO A;  4HST A;  2L4M A;  5HXD A;  4ZTJ A;  5DWN A;  1DGW Y;  2HXO A;  3K2Z A;  1KUY A;  3FH4 A;  4NJR A;  2GXA A;  1IRZ A;  2TCT A;  3CC7 I;  2A68 F;  2K40 A;  3W6V A;  5GPA A;  1D1C A;  1YIJ I;  4MTE A;  3MQ0 A;  1P4W A;  3BR3 A;  3H9Q A;  1K7A A;  1Y39 A;  1T0F A;  3I4N J;  2D1V A;  3GZ5 A;  5HNH A;  1N77 A;  3PM1 A;  3SDB A;  4BGD A;  4CO8 A;  2DPD A;  2PVV A;  3ZZI A;  5FVJ A;  3MWM A;  4KN4 X;  1FC3 A;  3BOQ A;  2XSJ C;  1P6R A;  2YS9 A;  2K3F A;  4S04 A;  2M34 A;  3G1M A;  5E17 F;  1AYE A;  2C6G A;  4GS4 A;  3OYL A;  2CNS A;  5DD4 A;  4PPZ A;  3TT2 A;  1VQL I;  2COB A;  3CT9 A;  1YJW I;  2GLJ A;  1IXR C;  1STZ A;  3I9S A;  4Y13 A;  3JVN A;  5DTD A;  2B58 A;  3MZ8 A;  5D4R A;  2PRB A;  3D7G A;  4I6Z A;  1O7F A;  2EWN A;  2C6C A;  2EIK H;  2XGC A;  3H5Z A;  3EYY A;  3E0K A;  3MCZ A;  4XPD B;  2Q2E A;  5H84 A;  1X1B A;  2ECC A;  4A38 A;  2V1N A;  1HDU A;  2DFE A;  2BZT A;  1E2X A;  1P9Q C;  1Z2L A;  1FP1 D;  1I27 A;  1L0O C;  1XG1 A;  3F8K A;  3DP7 A;  2DYS H;  5IYB J;  2R7R A;  3I58 A;  2ELJ A;  2PR8 A;  1OCR H;  3G73 A;  4L8A A;  4DBR A;  1QU3 A;  2PJ9 A;  1D5V A;  2AE6 A;  5I0C A;  2NXN B;  4NGM A;  4AWX B;  2RFH A;  3CPA A;  5D5U B;  4OP4 A;  4P4D A;  4Q4Z F;  2DT7 B;  3OY9 A;  4RI1 A;  1P4N A;  3J7Y J;  1IXC A;  2PMZ A;  2IRF G;  2PMZ N;  1SD5 A;  2YU3 A;  1MGT A;  1WWX A;  3KP3 A;  4X3R A;  1UHS A;  5G1Z A;  3IKV A;  2GOM A;  2IA1 A;  2VQL A;  3DTE A;  2I00 A;  1RKW A;  1WSU A;  1N71 A;  4CCN A;  2PJ5 A;  5AG4 A;  5KTA A;  1SD4 A;  2O0Y A;  3HOZ J;  3EY5 A;  1KA8 A;  1T39 A;  3G1O A;  1ZRC A;  5GAH J;  4P9F A;  4K3N A;  2MLK A;  5IX3 A;  1OBR A;  4CZC A;  4A5N A;  2VT3 A;  3NAU A;  3QP6 A;  4CUG A;  5BOX A;  4A32 A;  3BTL A;  5F0H A;  1YQA A;  5EDN A;  3FHN A;  4NHJ A;  3B3W A;  2DA2 A;  5F1R A;  4IRI A;  1M4D A;  4PXE A;  3QYF A;  1GVD A;  2P0W A;  3F9K A;  2F4I A;  4J3G A;  2G7H A;  1JI8 A;  3PB7 X;  3VOD A;  5E8I A;  2VAS A;  2XRL A;  1JKP C;  4IAV A;  1XS9 A;  3CUQ B;  3VYR B;  1YG2 A;  4PZJ A;  5JI6 A;  1CP6 A;  2REE A;  4P4B A;  3VAT A;  5ISV A;  1TT5 B;  4GYI A;  1JQG A;  1SAN A;  4CPA A;  1NMT A;  3BPV A;  4ZYD A;  2F4M B;  4BNC A;  4A30 A;  4BHB A;  3KR4 A;  3M4O J;  4MHP A;  4OC2 A;  3LNQ A;  3D3S A;  3EPZ A;  2H5M A;  2DMT A;  4C2M J;  1YVK A;  3ZQI A;  2Y0S N;  4QPO A;  1P4A A;  2R3S A;  2X7B A;  1U5T A;  4XLH A;  2B7E A;  3OYB A;  1BJA A;  2PQ8 A;  4C2Y A;  3T1B A;  3JRE A;  1QPM A;  3FMQ A;  1CQT A;  3PSF A;  5ED4 A;  3J7A O;  1A5J A;  4CYO A;  2EFO A;  4KIT B;  2BHZ A;  3FK7 A;  2P81 A;  5FRN A;  3ISX A;  4PGG A;  3ASO H;  4I76 A;  3BJ7 A;  3AFH A;  4QB9 A;  5FKK A;  4BHP A;  4UUT A;  4EM2 A;  3GZN B;  5FJ8 J;  4V19 K;  1JHF A;  2HQ5 A;  4RB2 C;  2J8M A;  1TF8 A;  1M4L A;  3P2H A;  3RYO A;  2P5K A;  2IMO A;  4J01 A;  1R58 A;  2IXS A;  2IS6 A;  2GAN A;  3A2K A;  2B4D B;  3H92 A;  1YI2 I;  3LL7 A;  2PJP A;  1X1P A;  4BQO A;  2JK3 A;  1OCO H;  2MLG A;  4A3J J;  3KIO A;  1XGS A;  1NSA A;  4ITV A;  1A2Z A;  2E71 A;  1R9T J;  3PNV A;  2M0M A;  2QA4 I;  5G22 A;  4XLF A;  4KS9 A;  2FF4 A;  1SMT A;  2EIL H;  2EFQ A;  2JVH A;  3K1M A;  3MEX A;  1V5F A;  2X0L A;  2ZEH A;  2F5C A;  3F8B A;  1YS6 A;  3M1E A;  5LGU A;  1KUV A;  1ZG8 A;  2G3A A;  5EC4 A;  1FOK A;  3NFZ A;  2GXG A;  1YYV A;  1YOV B;  5BPI A;  1I1S A;  1U8B A;  1N25 A;  2MH9 A;  4U88 A;  3A4C A;  1D8K A;  1OYW A;  1Z7L A;  1W5C C;  5AIP A;  3A0H C;  3PNT A;  3OS2 A;  1WZ2 A;  4ZY0 A;  4XLA A;  2ZFU A;  4KUM A;  1K4S A;  2AFZ A;  5F48 A;  2AFS A;  4BBR J;  3GXO A;  2C27 A;  2GFQ A;  1Z6R A;  4WWC A;  1PUA A;  1MD0 A;  1LB2 A;  1EH7 A;  3ZP5 A;  1Q1V A;  1BOA A;  1TW2 A;  2PJ0 A;  3V7S A;  4CRZ B;  3TP3 A;  1Y0N A;  1ARM A;  2A6T A;  1XSX A;  1MIJ A;  2HUZ A;  2XB5 A;  1PUF B;  2K5T A;  4QIW N;  2JA7 J;  1FWZ A;  2H94 A;  3CCE I;  2L7K A;  2FIW A;  2FQ3 A;  3GTQ J;  1N78 A;  2DTR A;  4RM3 A;  4FWU A;  3G2B A;  2ZXV A;  4XLE A;  4KA4 A;  1U9O A;  2Z3O A;  5K8M A;  5J4V A;  2RRE A;  2EK9 A;  1OCP A;  3HDD A;  3RKW A;  1K6Y A;  5HVF A;  5HLT A;  2J9A A;  2K02 A;  2FSR A;  1TXR A;  1BR4 A;  3A02 A;  2Q51 A;  1W7P B;  2HQR A;  3IFE A;  4BMH A;  4P9U A;  2IS1 A;  3HOT A;  2HDD A;  3WTZ A;  3LAJ A;  2DPT A;  5LGN A;  3F5B A;  5J4Y A;  1UFM A;  2XKP A;  1CPX A;  2ARH A;  4A12 A;  4LLG F;  3HOV J;  3ISP A;  1FOY A;  1WI9 A;  2K85 A;  2L4A A;  4FX4 A;  1J0R A;  2R7O A;  4BU2 A;  2NOG A;  1HLV A;  1R5H A;  4A31 A;  4OC1 A;  4CAV A;  1ZLH A;  2ZEM A;  3L2V A;  2VXD A;  3HPH A;  4MHG A;  3KZY A;  4UEZ A;  4CGO A;  1P7J A;  1X58 A;  4RLF A;  3NQO A;  1I6H J;  4MFL A;  5GTH C;  2UWM A;  4KLW A;  2DJI A;  2R5Y B;  3AG1 H;  1WJ5 A;  2Q0Y A;  1J7K A;  5CLS A;  4LFU A;  1YX3 A;  2VKE A;  2W1O A;  1V55 H;  3EUH C;  3CMA I;  1KUX A;  3CZ6 A;  2H1L A;  2KIU A;  5CQE A;  3PRT A;  2LG4 A;  3FIW A;  1IRX A;  3S9L A;  3FB3 A;  2CMP A;  1UCR A;  1V3F A;  3HYI A;  3IH4 A;  1I1D A;  3PFO A;  2QUF A;  3OYI A;  2HTS A;  5A28 A;  2ETH A;  2JMW A;  2RAE A;  3OIQ A;  3CCR I;  2ZEN A;  3BQY A;  1MBE A;  2H6C A;  5LBQ A;  2EIM H;  4KT6 A;  4ZTF A;  1DPU A;  3KET A;  3TED A;  3LMS A;  3OWC A;  3PBB A;  4Q36 A;  4XSZ F;  5KNL A;  4JX5 A;  2NVU B;  1SFU A;  2PJ6 A;  3ECH A;  4ZYH A;  2VEZ A;  2OCC H;  1CBX A;  2E1C A;  4IKF A;  4R1H A;  1W7P A;  3FBI B;  1E0E A;  4AIK A;  1BPN A;  1DE4 C;  3IV5 A;  3AKZ A;  3VEP A;  3FX6 A;  1AHD P;  3H36 A;  2KRF A;  1XTA A;  4Y4R A;  1YR0 A;  3DSB A;  3FF3 A;  5J3L A;  3CD6 I;  2XGD A;  3W91 A;  2QQA A;  1TKF A;  2ZME A;  5CKT A;  3LMM A;  3RAM A;  3RZA A;  5HDG A;  3WGG A;  2IGN A;  2R7U A;  3DPU A;  3IGR A;  2BW3 B;  3JRI A;  3WTY C;  4KOS A;  1S7N A;  3BR6 A;  3KCC A;  2L9R A;  1BA5 A;  2DK8 A;  3FX3 A;  4PJ0 C;  4KIS A;  3CF5 F;  2HKX A;  3MKZ A;  3R96 A;  4EV0 A;  2PJC A;  3NH8 A;  5AGE A;  3HZJ A;  5FLX K;  3V4G A;  4FBE A;  3R61 A;  2XUB A;  1VQ7 I;  3NWS A;  2A6E F;  3ASN H;  3GWZ A;  1LFU P;  1B72 A;  5F46 A;  2BXY A;  3HOU J;  3CUQ C;  1GT0 C;  2ZFW A;  3L7W A;  1IID A;  2BY1 A;  4Q48 A;  1Y0U A;  2DF5 A;  1SD7 A;  2ISY A;  2DI3 A;  4CCO A;  3G3Z A;  2CV1 A;  1WRJ A;  2D4P A;  3T9Y A;  3RPU A;  4DOZ A;  5IY5 H;  3KEO A;  1WVR A;  1J9I A;  1FMV A;  3V8K A;  4NF1 A;  2R98 A;  2PX9 A;  4XIC A;  3IC1 A;  5HS8 A;  1K6O A;  1QQI A;  2B3V A;  4MFQ A;  4ZY2 A;  4WCG A;  2UV1 A;  1KYW A;  1IYL A;  1JGS A;  4HRI A;  5EG0 A;  3LSG A;  1FTT A;  1FTZ A;  1Z6T A;  5D5X B;  2ACJ A;  2GA1 A;  2FRH A;  3EET A;  3U2R A;  4L9J A;  1LQ1 A;  4C2T A;  3S2H J;  4P6Y A;  1XMK A;  2NAZ A;  2P7V B;  2O3F A;  2LD5 A;  3H5N A;  4DNC A;  4S05 A;  2M9H A;  4JYW A;  5EBV A;  3U1D A;  1MH3 A;  5EZG A;  3F21 A;  3WHB A;  3IRQ A;  1S7E A;  6PAX A;  5FRO A;  5KK1 A;  3EDP A;  1BW5 A;  3QU6 A;  1XDS A;  1WJF A;  3MN8 A;  5LHH A;  1TF9 A;  2XEF A;  2A5W A;  1B72 B;  3CF2 A;  2XIG A;  1RC9 A;  3I55 I;  1VQK I;  4HPS A;  2WB1 N;  2OJE D;  3KLO A;  1C0W A;  4E7J A;  5LHG A;  4RAF A;  1G3S A;  1MSE C;  2ZJQ F;  4CGM A;  3IWW A;  2ZME C;  4B1R A;  1ZRD A;  3GTL J;  3FXM A;  1XRY A;  3OR1 C;  4Y49 B;  4C3H J;  5IT3 A;  3ZXS A;  4TNU A;  5LD2 C;  2HOS A;  1VQO I;  2EZH A;  1LFW A;  2A69 F;  3E6D A;  2MFZ A;  3HPG A;  4B3A A;  3K4C A;  4E7Z A;  2R7W A;  3KFW X;  2D4O A;  4ZZL A;  3S1Q J;  2L9N A;  1D0Y A;  3GB0 A;  2QJ8 A;  5K8O A;  1FOW A;  5D4S A;  4Y7N J;  3PIO F;  3BCB A;  3OS1 A;  5D5V B;  2FU4 A;  3V42 A;  3IAS 2;  3PFE A;  1CM0 A;  2GM4 A;  2OZU A;  2Z0Z A;  4NGP A;  5EZH A;  2DXQ A;  4UFW A;  4MFD A;  3KHX A;  1YQE A;  1RZ4 A;  4I02 A;  3P9C A;  4UIA A;  2FOK A;  1YRN A;  2JJ7 A;  3ABL H;  1R4N B;  1Y8Q B;  2CH0 A;  4Y3O A;  1B87 A;  1IYK A;  1VGY A;  2QVP A;  1FP2 A;  5IB0 A;  2XAJ A;  5ELY A;  3VWD A;  1ZLI A;  1FSH A;  4P44 A;  2DCE A;  3P9I A;  1UHM A;  3DXJ F;  2CNM A;  3ML6 A;  4XLN F;  2XVC A;  5DV5 A;  1TP4 A;  1U8R A;  4MFZ A;  2ID3 A;  2FX0 A;  2WV0 A;  3QYB A;  1AA7 A;  2FS5 A;  3BPX A;  3CCS I;  2PVW A;  1GVJ A;  2WAE A;  3H8F A;  4LK0 F;  1HOM A;  3BDD A;  3CCM I;  4IVN A;  3B02 A;  4XON A;  5E79 C;  3S2D J;  3QU3 A;  4Z65 A;  4A3F J;  2KZG A;  4Y33 A;  1YE9 A;  4AVA A;  5DEQ A;  3DKY A;  4OC0 A;  1YX5 A;  2W82 A;  3O8H A;  2FIA A;  3IL2 A;  3D68 A;  3WC6 A;  5KTC A;  3TDZ C;  4DYR A;  3JTH A;  3KYL A;  1FX7 A;  3OR2 C;  2M7B A;  1A04 A;  4JK1 X;  4JYK A;  3K1N A;  2P4W A;  2NNY A;  2ABZ A;  2POK A;  4ZYA A;  1BW6 A;  1MNE A;  2CUZ A;  4LG0 B;  2EO8 A;  3B3S A;  4IRG A;  1XJO A;  2ZJR F;  3ZPL A;  2PRQ A;  1SD6 A;  5LRJ A;  4CS0 B;  1FYL A;  3JR9 A;  3OV8 A;  2JEW A;  1JT6 A;  1HKT A;  3BI1 A;  2KT0 A;  3ZQC A;  5AON A;  2ESN A;  3I3L A;  1VQ5 I;  2FXA A;  1VQN I;  4BAY A;  3OMY A;  1DPR A;  3C2G A;  1IN7 A;  2QQ9 A;  3CJN A;  3C2H A;  1PP8 F;  2FQ4 A;  4I99 C;  5DYM A;  1QBJ A;  2MC3 A;  3G8W A;  2Z5U A;  2HS5 A;  4HF0 A;  4ZDL A;  5AG7 A;  2HVQ A;  2VC0 A;  4EGZ A;  3B7I A;  4Y17 A;  1IV8 A;  4BS9 A;  4KOX A;  3HL2 A;  3FXK A;  4AYB A;  2CO5 A;  2E34 A;  1U6M A;  1RIO H;  1POG A;  1MNM C;  2JT1 A;  2DFI A;  2JDC A;  2PCU A;  3ZN0 A;  5ICE A;  4CHU A;  2YR2 A;  3CCQ I;  4B6Z A;  1X2M A;  3FKJ A;  1U78 A;  1SVL A;  1JKO C;  3MGD A;  1VHO A;  3IWG A;  5BNG A;  4A3K J;  3IKT A;  1X3W B;  2LY9 A;  3HOW J;  2FOW A;  5K8P A;  1T56 A;  2ZEL A;  2ME0 A;  4MMO A;  2OUM A;  3FWE A;  4JBA A;  4KN7 X;  1QSR A;  4V2F A;  2Q7S A;  2H27 A;  4FIS A;  2OCE A;  1EF4 A;  4ABZ A;  1M4G A;  1T2K A;  3HHG A;  3FRM A;  2AFM A;  5EF6 A;  2B9S A;  1PU9 A;  4B5P A;  3IP4 B;  4L0Z B;  2RB7 A;  1LDD A;  4LG0 A;  3JSO A;  4LIV A;  3WTV C;  3NRV A;  3ZMV A;  3OSG A;  2LDU A;  1M4I A;  1IN5 A;  2TRT A;  2Q4Z A;  5BMZ A;  2VBY A;  3ESW B;  3LAP A;  4UNO A;  2NVX J;  2ZXI A;  3M8E A;  1BPM A;  3PZJ A;  1UEL B;  4RM2 A;  2ZW5 A;  2A4N A;  4A5M A;  2JEV A;  4ZC3 A;  4PJL A;  2DPS A;  1HA8 A;  4CCK A;  3S15 J;  2LBF B;  1TWF J;  2DMU A;  2LLK A;  2WY7 Q;  1UFH A;  4MBU A;  4KYW A;  4CAW A;  4JOM A;  2XC7 A;  1GXP A;  1WI3 A;  2OTJ I;  2BCO A;  1R1V A;  1XMB A;  1KU7 A;  4HX7 A;  3R4K A;  5F0F A;  3FEE A;  1AKH A;  1QZE A;  5M5W J;  4YFJ A;  2PJR B;  4YGO A;  3F22 A;  2KP6 A;  1U6G A;  3IJ3 A;  2WYR A;  3PIP F;  4KFC A;  3ONQ A;  2DN0 A;  5DCF A;  2WAD A;  4NCZ A;  1BIA A;  3JRF A;  1PYT B;  2E36 A;  2DYR H;  2ODF A;  3MAJ A;  3W6J B;  2DLL A;  3E5X A;  1R5I D;  4OIP F;  2PN6 A;  2E1N A;  2LRE A;  1D1A A;  1W0U A;  4OAY A;  2STW A;  1H8A C;  2XRN A;  4ENJ A;  3D2P A;  5H86 A;  4YFN F;  1SFX A;  2OTL I;  2R92 J;  2MC4 A;  3IU2 A;  2GZW A;  3ZQQ A;  4BJ6 C;  4CH7 A;  2VPL A;  5F04 A;  1OPC A;  4EEF G;  3F8N A;  2Q4Y A;  4P4F A;  2MA3 A;  2K3P A;  4RGU A;  3RQI A;  2CG4 A;  4RMN A;  3GZ6 A;  3FNC A;  2Y31 A;  3B3C A;  3VPR A;  5GPC A;  4HNX B;  2WAQ A;  1ON0 A;  1J09 A;  2CXA A;  4MCQ A;  1Y8R B;  2EK8 A;  1Y7E A;  4PFP A;  2X6X A;  3VDX A;  4MFP A;  3DDD A;  1MMS A;  4W1U A;  2QEN A;  2FL4 A;  2RC4 A;  1J2X A;  1D0X A;  3MMY B;  4BE2 A;  2NS0 A;  4P4J A;  1OJL A;  1RNL A;  2ZNZ A;  1IGN A;  3GTM J;  1FBU A;  1SVM A;  2CQX A;  4BXX J;  3ELK A;  4G6Q A;  2I3C A;  4UIB A;  2GIZ A;  2FBI A;  1IV6 A;  1S7F A;  5HS7 A;  3D5L A;  4KSF A;  5JQ4 A;  2UZK A;  2CF4 A;  2ZED A;  4EM0 B;  5D6F A;  3W3C A;  1Z4E A;  2YSR A;  4FAI A;  3CJQ B;  2HZD A;  3HUG A;  5DD8 A;  3HBL A;  1ETQ A;  4HX8 A;  3SHP A;  1O7L A;  3H9J A;  2GBY A;  5KAI C;  1GV2 A;  4UUS B;  2BOA A;  4NC7 A;  4YG2 F;  1YRN B;  1LRZ A;  2IGK A;  4HEA 2;  1TQP A;  2GA2 A;  3SJM A;  4A3E J;  1BC8 C;  4V2G A;  1R4M B;  3RDI A;  2YND A;  3QB8 A;  3CDX A;  4E70 A;  3OYG A;  2V9K A;  1LFP A;  2F7V A;  1UZC A;  5IYC J;  4XPL A;  2B63 J;  1B4A A;  2VE8 A;  3B2Y A;  1R1U A;  4HDV A;  3V7Z A;  4DUK A;  3F8M A;  1CF7 A;  4UWJ A;  4IL6 C;  2V9V A;  3EC4 A;  2W48 A;  4L5J A;  5F08 A;  2QM3 A;  5C4J J;  1YW7 A;  3C1D A;  4CRY B;  5I4M A;  5B5E C;  5A2Q Z;  2EA2 A;  3DF8 A;  5D5W B;  3IAM 2;  2HYF A;  2M87 A;  1XOV A;  1R49 A;  4II3 A;  1VQ4 I;  3FKI J;  2O4H A;  1NHA A;  5GP9 A;  2ATR A;  2BUE A;  4W97 A;  4HOB A;  4XRS A;  3W6X A;  3S6H A;  1I3A A;  2F2E A;  1OYI A;  2EFP A;  2J5O A;  3MFK A;  1IG7 A;  1Z8X A;  4AXV A;  3HSF A;  2PJ4 A;  4AIJ A;  2LC2 A;  2RV8 A;  3NEU A;  2KJB A;  3WHC A;  5THW A;  2AFO A;  1Z7U A;  2ISZ A;  2MD5 A;  4AC0 A;  3LSK A;  1CP7 A;  3WTS C;  1JJ6 C;  5F09 A;  3D4U A;  3FDY A;  3GLL A;  1Z3X A;  3J81 Z;  2CS3 A;  2Q04 A;  4ZX8 A;  3J80 K;  2KIQ A;  3ZN1 A;  4OAZ A;  4A6D A;  1VHE A;  4KOY A;  3I1U A;  4EJV A;  4Q5S F;  3O8G A;  4RGR A;  3QAH A;  4N4N B;  3RTR A;  3I53 A;  2JBK A;  1P4X A;  2H09 A;  3C2B A;  1RR8 C;  1B8I B;  4XOT A;  3CDH A;  3DLJ A;  4NGQ A;  2EQR A;  3PB9 X;  5DUK A;  4DYC A;  3FJU A;  3I4P A;  4MO7 A;  1S60 A;  2D2W A;  1Z8W A;  3OYD A;  2LF7 A;  1IUY A;  4PXD A;  2CU7 A;  3BR1 A;  4UB6 C;  3S2W A;  3GFI A;  2WPX A;  4NC8 A;  3V7C A;  3E6M A;  4ZI6 A;  4CZZ A;  5B1A H;  2DOF A;  1RUN A;  1H0M A;  1JXS A;  3G3S A;  2BY2 A;  2CQ7 A;  3Q3S A;  3TMO A;  3E5U A;  2BHY A;  3BQZ A;  2AJ6 A;  4H0E A;  4NQW A;  1R23 A;  1QPI A;  3QYE A;  3F0C A;  4GXH A;  2EVN A;  1CGP A;  2VKD A;  3CLO A;  3H4Q A;  1IN8 A;  2KPM A;  4B09 A;  4HQM A;  3L2C A;  1YK3 A;  1XC5 A;  2QF7 A;  4AM3 A;  5E96 A;  2CUF A;  1USS A;  3BLN A;  3GTJ J;  3W2W A;  2JUC A;  2K9S A;  5HLI A;  1LAN A;  2EV0 A;  1JTY A;  3VH9 A;  5A27 A;  2EB7 A;  3PBE A;  2VB6 A;  1AOY A;  4C9Y A;  4G1P A;  1QZZ A;  5JLW A;  3FBU A;  1R7J A;  4EVY A;  1TC3 C;  3CXP A;  5L3G A;  1GXQ A;  3SJG A;  3KP2 A;  1QSM A;  3FEC A;  4ANJ A;  3TO7 A;  4M9Z A;  2IPQ X;  4LMY A;  1ZTR A;  4LG3 A;  3S1R J;  1IO2 A;  4I01 A;  3D2M A;  1IW7 F;  2DMQ A;  2DW4 A;  3IWE A;  2AFW A;  5CNP A;  2O5R A;  2Z3Y A;  3LA2 A;  1TTY A;  1T08 B;  3M07 A;  4KOU A;  1T33 A;  1W1W E;  1UJ8 A;  3A0B C;  1U5T B;  3OYN A;  4FCY A;  4Q7A A;  4G6D A;  3I9V 2;  5BS6 A;  2L7F P;  2VXK A;  4IUS A;  2EPF A;  5CPR B;  4NSQ A;  3H5A A;  1NG6 A;  1YW8 A;  3NWT A;  4N9H A;  5TJJ A;  2F5V A;  4Q47 A;  4IK2 A;  3T0Y A;  2NOJ B;  1IRF A;  1XX5 A;  4FAS D;  2F6C A;  3I56 I;  3BJA A;  1SAX A;  1IC8 A;  2JA8 J;  1B9M A;  4AG9 A;  4LB6 B;  2I10 A;  3FMC A;  4UEE A;  4R9M A;  1HKS A;  5FD5 A;  4WK8 F;  2QYV A;  4XKW A;  4GGG A;  3OIP A;  3RO0 A;  4B5P B;  2RNJ A;  4A2Z A;  2K5C A;  2CGP A;  3GKR A;  2W85 A;  2G7U A;  3SZT A;  1LPQ A;  1H9T A;  3R6S A;  4F93 B;  3GYA A;  2QEX I;  1WJB A;  3V8J A;  1Z1D A;  1PYV A;  4GM5 A;  1B6A A;  5F6F A;  1HF0 A;  1D5Y A;  2M4K A;  3Q5F A;  5B66 C;  2VQC A;  5DCM A;  1SC7 A;  3E6B A;  4M71 A;  2QZ8 A;  1H89 C;  2Y9Y A;  3MZY A;  3ABU A;  3ABM H;  4X1E A;  2IS4 A;  3OL3 A;  2P7C B;  2PJR A;  2M1B A;  1N75 A;  5JLX A;  2A3S A;  1FLI A;  4ZGY B;  1ZKG A;  2KRH A;  2Z99 A;  3I59 A;  4J00 A;  3V8L A;  3SJF A;  4PUS A;  4R8F A;  4RBO A;  2VC1 A;  3E6C C;  1BO4 A;  3IH2 A;  1Z8L A;  1PVE A;  1XEB A;  3CJT B;  2E7X A;  2XPW A;  4OIQ F;  1IJW C;  4BDZ A;  4F91 B;  2JA6 J;  2WTE A;  4OKO A;  2REF A;  3GBG A;  2PSW A;  4JJX A;  1T98 A;  5E18 F;  3RZO J;  5IP9 J;  2CQQ A;  1K61 A;  2A61 A;  4I0B A;  4M6Y A;  3OOU A;  1O4X A;  2DO7 A;  2ZEO A;  1PUF A;  3HRS A;  1YFH A;  3SZP A;  1JKQ C;  5J8C A;  5EMI A;  3HUV A;  2CV2 A;  1O57 A;  3CP8 A;  2XEG A;  2AQF A;  3MD2 A;  4H4K C;  3WGI A;  3LA7 A;  3DV8 A;  1NK3 P;  2ZO4 A;  2VKV A;  3B3V A;  1S3Z A;  2W4S A;  4C7I A;  3OOP A;  4LB5 A;  4HF2 A;  1A31 A;  2M3A A;  4KIG A;  1HBX G;  2NS8 A;  2P6F A;  2IA2 A;  4EGY A;  4OAE A;  1LEA A;  4A33 A;  1ZO0 A;  3KR5 A;  2OBP A;  1A6Q A;  2DT6 A;  2K27 A;  2XB0 X;  1R3N A;  3QPL A;  4MLO A;  1SEU A;  2YNE A;  3GYH X;  3IO1 A;  3JTK A;  1LNW A;  3M8F A;  3ZOB A;  1X12 A;  3VWE A;  1WKM A;  1DU0 A;  1O3S A;  3BG7 A;  1RO5 A;  5CVR A;  3D7D A;  2W00 A;  3SFI A;  3RYP A;  1T38 A;  3KL9 A;  4JD6 A;  2Y30 A;  3I59 B;  4C68 A;  4U9Y A;  4AB7 A;  2QGU A;  4LK1 F;  2RKH A;  2BO9 A;  3L2W A;  4BE1 A;  1XCV A;  3HUG B;  3ZGK A;  5FLM J;  4BBS J;  1MJ9 A;  1KZF A;  2Z10 A;  3N05 A;  4OC3 A;  1ZHF A;  3K2A A;  3PJR A;  4R57 A;  4P4I A;  3OIO A;  4B3X A;  2D5V A;  3O2P E;  4DIQ A;  3ZJ0 A;  4DQ2 A;  1TWA J;  2JSP A;  4BXU A;  4E4H A;  3DLL F;  2R5Y A;  4IHT A;  2B3U A;  3DGV A;  2VL8 A;  1IOI A;  1BJZ A;  2PIZ A;  3BJO A;  3O6B B;  2Z3N A;  3A03 A;  5DWM A;  5FRM A;  4ZDO A;  1MBJ A;  1EH8 A;  1OCC H;  2HKO A;  3FIX A;  3ECO A;  5HLH A;  2P6S A;  3HB9 A;  1QO0 D;  2E5N A;  5KAF C;  4RA2 A;  3HGG A;  1V5G A;  2HVS A;  1DU6 A;  4EMS A;  2Y2Z A; 
#chains in the Genus database with same CATH homology
 5KCM A;  4DJA A;  5LD2 C;  4C30 A;  4HNU A;  5G21 A;  2PDO A;  2D4O A;  2MFZ A;  3HPG A;  4F3Q A;  3K4C A;  4E7Z A;  2W7N A;  2R7W A;  2B5G A;  2OH1 A;  4U5Y A;  2X1D A;  4BUP A;  2HV2 A;  5HH1 A;  2Q4V A;  3K10 A;  1T0F C;  2L9N A;  1D0Y A;  1YLE A;  3PGP A;  4E7K A;  5KTD A;  2IGM A;  2XF7 A;  4PK2 A;  4PSW A;  3LD2 A;  3MKY B;  1B6B A;  4H6Z A;  2Z2S B;  4QUS A;  4II9 A;  4R3K A;  2JDD A;  3BCB A;  2VLA A;  2X1E A;  3OS1 A;  2ZSI B;  3V42 A;  4JXR A;  4Y49 C;  3IAS 2;  1CM0 A;  3D5R C;  2E60 A;  2RNG A;  1CJW A;  2OZU A;  2Z0Z A;  3TCV A;  4QC6 A;  1WK4 A;  3S6K A;  4E6K G;  2DXQ A;  4UFW A;  5C88 A;  4IQ4 A;  4UCM A;  2QKL B;  1NSL A;  3CP2 A;  1LDK B;  3R1K A;  2DXI A;  3RCO A;  3BC8 A;  3HG9 A;  4F55 A;  2E1M C;  1YGH A;  2CH0 A;  3K6G A;  1B87 A;  2WB1 A;  4Y3O A;  1IYK A;  4JWP A;  4UWI A;  3WR7 A;  5IB0 A;  2BSW A;  3VWD A;  4XM3 A;  2JVG A;  4LX9 A;  2K9M A;  2DCE A;  3QOD A;  4BE0 A;  3OYC A;  2CNM A;  2R1I A;  3DTI A;  1WJE A;  3OYM A;  4MFZ A;  4NUB A;  3QYB A;  3D8P A;  3LOD A;  4XKV A;  1AA7 A;  1T95 A;  2G0B A;  2FS5 A;  1MW7 A;  2OU2 A;  2WAE A;  4XKC A;  4BAC A;  3V8I A;  2KCW A;  3OYH A;  4BQQ A;  4AVB A;  4XON A;  3NE7 A;  2E5Z A;  3DR8 A;  1GHE A;  3OS0 A;  4Y33 A;  1IIC A;  3FBN B;  1YE9 A;  4AVA A;  2BL1 A;  3DKY A;  3SEQ A;  1YX5 A;  3RSN A;  2W82 A;  4XNF A;  3SYT A;  3VYU B;  4IZZ A;  3K70 C;  1Q2C A;  2FIA A;  4XPK A;  4ORF A;  5KTC A;  2M7A A;  3KYL A;  3OR2 C;  4DBQ A;  2M7B A;  2V6E A;  2B5G B;  2OC6 A;  1MJB A;  3K4J A;  4ZYA A;  3TBI A;  3PSI A;  1MNE A;  2CUZ A;  1Z4R A;  2AQE A;  2B4D A;  2Z11 A;  1QSO A;  3FYN A;  4C2U A;  2VZZ A;  4CAX A;  2Y0M A;  1QHH D;  3KKW A;  4CS0 B;  1Z21 A;  3K9U A;  3I3L A;  5AG6 A;  4C2Z A;  4YEL A;  2X6Y A;  3OMY A;  3C2G A;  4ZJZ A;  2Z1D A;  4XN0 A;  4XPD C;  2LY1 A;  1X4P A;  3C2H A;  4N4O B;  2JA2 A;  3CXS A;  3G8W A;  4LUA A;  4PJM A;  1LVK A;  2LYC A;  3S3N A;  3EUK L;  4ZDL A;  2HVQ A;  2Z3K A;  5AG7 A;  3VWB A;  4CYP A;  1OR7 C;  4PV6 A;  2ZSH B;  3K4M A;  1DQU A;  4D1Q A;  1SAU A;  4FD5 A;  2UUZ A;  4BS9 A;  2YNC C;  4KOX A;  3HL2 A;  1WWZ A;  4QPQ A;  4AYB A;  2LRD A;  3EXN A;  1VZ0 A;  4E7S A;  1U6M A;  1MK4 A;  4XLC A;  2E1M B;  4FD4 A;  3LSH A;  2JDC A;  3TFY A;  1Z3Y A;  2VQG A;  2NMT A;  3DQV C;  3E1S A;  2KDO A;  3FKJ A;  4MFJ A;  5GCN A;  2J8N A;  3MGD A;  4G6T B;  3IWG A;  2GOX B;  4ZDP A;  2O28 A;  1V0C A;  3UY5 A;  4BJT A;  1WJA A;  4P1W A;  1MJA A;  2P6G A;  2OUM A;  3KEY A;  3SZG A;  1W36 C;  3H35 A;  1QSR A;  4BEH A;  5HNF A;  2VXZ A;  4B10 A;  4FD6 A;  4B43 A;  2HPM A;  2OZG A;  4Q38 A;  1M4G A;  2V4J C;  4YEJ A;  4B12 A;  2PC1 A;  4DGW B;  3FRM A;  3I3G A;  1DP3 A;  3DPT A;  2HPI A;  2VKH A;  3S3M A;  1PU9 A;  4B5P A;  3IP4 B;  5JHF A;  4XOR A;  4LIV A;  4HST A;  1L0C A;  1M4I A;  2Z16 A;  4ZTJ A;  1DGW Y;  3L2R A;  1KUY A;  2CUJ A;  2VJ4 A;  5DWN A;  2ZXI A;  3PZJ A;  1UEL B;  3K4K A;  4RM2 A;  2ZW5 A;  1BR1 A;  3BJ8 A;  2A4N A;  1D1C A;  4PSX A;  2JEV A;  4ZC3 A;  4PJL A;  2DPS A;  2LOO A;  4BEH B;  1HA8 A;  4CCK A;  2CW7 A;  2LBF B;  2KLO A;  3H9Q A;  2R8V A;  2WY7 Q;  1UFH A;  4CAW A;  4MBU A;  4CGN A;  4JOM A;  1BOB A;  2BVL A;  2CFO A;  3LFU A;  4U7B A;  5HNH A;  2XC7 A;  1N77 A;  2VI7 A;  3SDB A;  4NXY A;  4BGD A;  2K9L A;  3LSI A;  1Y9W A;  4K30 A;  1I21 A;  2BEI A;  4D9J A;  3SEZ A;  4NEX A;  3ZZI A;  1V5E A;  2HNH A;  5FVJ A;  4PK4 A;  2GE3 A;  2R7T A;  4YFJ A;  2PJR B;  2XSJ C;  4YGO A;  5BWA B;  1D0Z A;  2R7Q A;  2KP6 A;  5HVQ C;  4GS4 A;  3TT2 A;  3OYL A;  2CNS A;  3ONQ A;  4MHD A;  2WAD A;  2IS2 A;  2DOA A;  4NCZ A;  3HKZ A;  3I9S A;  3JVN A;  3OYF A;  4QBJ A;  2B58 A;  2PRB A;  4RS2 A;  4XQF A;  2YGW A;  3AL0 C;  3F0A A;  2ZW4 A;  3H5Z A;  3DLA A;  1QSN A;  3CJR B;  2Q1Z B;  3E0K A;  4OAD A;  4XPD B;  2LRE A;  5H84 A;  1D1A A;  4B13 A;  1X1B A;  4OAY A;  4YRV A;  1IB1 E;  2FXF A;  2V1N A;  4BJ5 C;  3D2P A;  5KHD A;  5G20 A;  5H86 A;  3TTH A;  1P9Q C;  3IU2 A;  2MC4 A;  4CA0 A;  3F8K A;  1XMT A;  3ZQQ A;  2R7R A;  4BJ6 C;  4CH7 A;  2ELJ A;  2X1C A;  2VPL A;  2L5Q A;  2PR1 A;  2PR8 A;  4L8A A;  2VQH A;  4DBR A;  1QU3 A;  1S7L A;  2KZV A;  3DTK A;  2AE6 A;  3R9E A;  4E2A A;  5I0C A;  5TGT A;  4OLL A;  1YRE A;  2Q4Y A;  3S6F A;  2K3P A;  3BG6 A;  3M8J A;  3S6G A;  2DT7 B;  4RMN A;  2VIX A;  1U0J A;  2HDW A;  3OY9 A;  3FNC A;  1DGR M;  2RQQ A;  3E0J B;  2VJI A;  2PMZ A;  1P4N A;  2WAQ A;  1ON0 A;  3M1C A;  1J09 A;  1Y9K A;  2CXA A;  4HNX B;  2JLM A;  4PFP A;  2X6X A;  3VDX A;  4X0G A;  2GOM A;  5G1Z A;  4MFP A;  2VQL A;  1YVO A;  3DDD A;  3DTE A;  3PL8 A;  4P5O A;  2FL4 A;  2I00 A;  3MMY B;  1N71 A;  1D0X A;  2R4G A;  4CCN A;  4BE2 A;  2RC4 A;  3C26 A;  2Q7B A;  5AG4 A;  5KTA A;  3EY5 A;  4KSA A;  1Q2Y A;  2WY8 Q;  4H6U A;  4UA3 A;  4YRH A;  3W6S A;  4R79 A;  2P6E A;  3DU6 A;  4XL9 A;  5IX3 A;  2CNT A;  4CZC A;  2LBF A;  4U87 A;  1I12 A;  4IQJ A;  4CUG A;  1S7F A;  2WSA A;  3D5L A;  3PP9 A;  4XNH C;  4A32 A;  4KSF A;  5JQ4 A;  1D1B A;  1QHG A;  3FHN A;  3W3C A;  4KOR A;  1Z4E A;  1M4D A;  2VJ5 A;  3QYF A;  3CJQ B;  2XF6 A;  2HZD A;  2J8R A;  1BR2 A;  1MMN A;  2P0W A;  3SHP A;  3F9K A;  2F4I A;  3H9J A;  4BDY A;  4J3G A;  1JI8 A;  4UBR A;  2ZXH A;  3L2Q A;  4NC7 A;  2VAS A;  4HNT A;  1LRZ A;  3PUB A;  2IGK A;  4HEA 2;  3VYR B;  2REE A;  5ISV A;  3ZCO A;  4MFK A;  2YND A;  3BCA A;  3QB8 A;  3K4N A;  3OYG A;  2V9K A;  1LFP A;  3S8P A;  1GLN A;  1NMT A;  4XPL A;  2WPW A;  2F5I A;  4R87 A;  4A30 A;  4HKF A;  4HPQ A;  3HOS A;  3D3S A;  5IV0 A;  3EPZ A;  2H5M A;  2VBQ A;  4UWJ A;  1YVK A;  2X7B A;  4QPO A;  3EC4 A;  4I49 A;  3TO9 A;  4XLH A;  4CRY B;  3RQ4 A;  3OYB A;  2PQ8 A;  4KVM E;  4C2Y A;  4CAE A;  4CSW A;  3PSF A;  4CYO A;  3S32 A;  4KIT B;  3IAM 2;  4ZBG A;  5FRN A;  4II3 A;  5HOO A;  3H0D A;  4IF5 A;  3R95 A;  2CW8 A;  2ATR A;  2BUE A;  3SXO A;  3BJ7 A;  3AFH A;  2IL4 A;  4QB9 A;  2J8M A;  3W6X A;  3S6H A;  3P2H A;  2Q44 A;  3RYO A;  4EAT A;  2IXS A;  3UNG C;  4J01 A;  1R57 A;  2B4B A;  2IS6 A;  4B48 A;  2LC2 A;  2GAN A;  3A2K A;  2B4D B;  4R3L A;  4UFX A;  3LL7 A;  1OLT A;  1RXT A;  4BQO A;  4KOW A;  2QML A;  4JXQ A;  3HC7 A;  4ITV A;  4AVC A;  3A1Y A;  3LSK A;  3PNV A;  4E7I A;  5J8F A;  2M0M A;  2EUI A;  3FDY A;  5G22 A;  4GRI A;  1W36 D;  1Z3X A;  2Q2E B;  2CS3 A;  4XLF A;  2Q04 A;  3S3O A;  4KS9 A;  1MND A;  1YX0 A;  2V26 A;  4OAZ A;  4KOY A;  2JVH A;  1V5F A;  3OYJ A;  2HVR A;  2OB0 A;  4N4N B;  3RTR A;  2HQA A;  1M44 A;  3QAH A;  4M3S A;  1WJD A;  4XOP A;  3B8G A;  3H5R A;  3LSM A;  4XOT A;  1KUV A;  2G3A A;  2ZW6 A;  5EC4 A;  4F0Y A;  3P2F A;  1X19 A;  3PFY A;  1S9H A;  1S60 A;  3OYD A;  3A4C A;  4CYN A;  1Z7L A;  4HNY B;  2WPX A;  4BL0 B;  2V7F A;  4NC8 A;  1X1D A;  3PNT A;  3OS2 A;  4B14 A;  1TT0 A;  4XLA A;  4MY0 A;  2ZFU A;  4AVZ A;  4BXF A;  2Y0S A;  4NSQ A;  1WJC A;  4F6A A;  5F48 A;  5AG5 A;  4L89 A;  3QOE A;  2VJJ A;  4X5K A;  2WUU A;  2YNC A;  3G3S A;  2C27 A;  3TMO A;  1PUA A;  2AJ6 A;  3T90 A;  2FUG 2;  1Q2D A;  3QYE A;  3SXN A;  4B44 A;  3KX2 A;  2EVN A;  2KRC A;  2VKD A;  3FXT A;  2KQR A;  4CRZ B;  2A6T A;  4KOV A;  2MD0 A;  4OWR B;  3CES A;  3RPU D;  3H4Q A;  4CYQ A;  4F92 B;  2HUZ A;  2ZW7 A;  3CXQ A;  2KPM A;  2OV7 A;  2K5T A;  4CCL A;  1YK3 A;  2L7K A;  4PJJ A;  1Y6I A;  1G59 A;  2FIW A;  5E96 A;  4XN3 A;  4CGP A;  1N78 A;  4RM3 A;  3BLN A;  4XNH B;  3VSK A;  3G2B A;  3W2W A;  2ZXV A;  4XLE A;  2Z3O A;  3TO6 A;  4LIT A;  3PNY A;  2RRE A;  1Z9U A;  1K6Y A;  5HLT A;  5A27 A;  1MMA A;  2FSR A;  3R9F A;  1BR4 A;  2VB6 A;  3OWT A;  4C9Y A;  1S5K A;  4UCP A;  4BMH A;  4E0A A;  4MY3 A;  3FBU A;  2IS1 A;  3HOT A;  4EVY A;  3CXP A;  4E7L A;  2L2O A;  2HQY A;  2DPT A;  5CQG A;  1UG0 A;  2M4G A;  1R6R A;  1TIQ A;  1QSM A;  3F5B A;  2BW3 A;  4ANJ A;  3TO7 A;  2ARH A;  5JPH A;  4MJ8 A;  1X4O A;  4LG3 A;  3GY9 A;  4PJN A;  5F47 A;  5HMN A;  3D2M A;  2XAU A;  3J7A Y;  2R7O A;  3IWE A;  5CNP A;  1S7K A;  2LY2 A;  2O5R A;  4BU2 A;  4KOU A;  4PFO A;  3OYN A;  4A31 A;  4CAV A;  4KJZ A;  3I9V 2;  2G3T A;  4KVO E;  3L2V A;  4KLV A;  2VXK A;  2VXD A;  3HPH A;  3UR3 C;  1FY7 A;  1XE4 A;  4IUS A;  4CGO A;  4RLF A;  5CPR B;  4II2 A;  3DU5 A;  3K4B A;  4MFL A;  3D5S C;  3H5A A;  2UWM A;  4KLW A;  2DJI A;  4ONU A;  1NG6 A;  3NWT A;  2QEC A;  1WJ5 A;  3IUO A;  1UAA A;  2R7S A;  2R7V A;  2Q0Y A;  2F5V A;  3IU1 A;  3OYE A;  2GIV A;  1YX3 A;  3DWL E;  3H9G A;  4HSR A;  2FT0 A;  2W1O A;  2NOJ B;  4HNW B;  4KZT A;  3EUH C;  2F6C A;  2X6W A;  4FAS D;  3CZ6 A;  3ZR8 X;  3OYA A;  1KUX A;  5CQE A;  2LG4 A;  1IRX A;  2MAB A;  3FB3 A;  2CMP A;  4AG9 A;  4BQN A;  1I1D A;  4R9M A;  3OYI A;  2VZY A;  4NQW B;  4RLQ A;  5A28 A;  4XKW A;  4B5P B;  3OIP A;  4A2Z A;  3OIQ A;  2K5C A;  2CY2 A;  3GKR A;  4ZTF A;  4KT6 A;  4NNJ A;  3GYA A;  3W2V A;  4F52 A;  4F93 B;  3HXL A;  3EO4 A;  2IGO A;  3OWC A;  1WJB A;  4Q36 A;  5KNL A;  2VEZ A;  4C2T A;  1PYV A;  4IX7 A;  3DR6 A;  4IKF A;  4FD7 A;  4KVX A;  3FBI B;  1E0E A;  4LIU A;  3AKZ A;  3K4L A;  3OYK A;  2Z3L A;  3MKW B;  1FMW A;  2M4K A;  3W2A A;  3DNS A;  3U21 A;  1TZL A;  4Y4R A;  1YR0 A;  4XKB A;  2QIR A;  2VQC A;  4FET A;  3TOA A;  3DSB A;  4B47 A;  2MYS A;  2CV0 A;  3W91 A;  3A9L A;  1ERD A;  4JQF A;  5CKT A;  2IS4 A;  2WBM A;  3LMM A;  4QVT A;  2BVM A;  4M85 A;  2KMU A;  3OL3 A;  2IGN A;  1SFK A;  2R7U A;  4RI1 A;  3OL4 A;  2PJR A;  3DPU A;  1N75 A;  3IGR A;  2BW3 B;  3EUA A;  3L2U A;  2KRH A;  4MI4 A;  4KOS A;  2XDV A;  4ZGY B;  4J00 A;  1S7N A;  2BOL A;  3R9G A;  2X51 A;  3BLY A;  1XF8 A;  2OZH A;  4PUS A;  3ZRG A;  1BO4 A;  4KIS A;  3MKZ A;  3R96 A;  1XEB A;  1P0H A;  5AGE A;  3VYT B;  4BDZ A;  4F91 B;  4KUB A;  2REF A;  3GBG A;  3NWS A;  2PSW A;  4HG2 A;  2KL4 A;  4JJX A;  4E8O A;  4UCN A;  1MMG A;  5F46 A;  1EA3 A;  4KOT A;  1WFX A;  3OOU A;  4C2X A;  3DKX A;  1IID A;  2XF5 A;  4AU7 A;  5J8C A;  1OZP A;  2CV2 A;  3CP8 A;  4XR6 A;  4CCO A;  2AQF A;  1X1A A;  1ZEL A;  2CV1 A;  2D4P A;  3MD2 A;  2ZPA A;  4U9Z A;  3T9Y A;  4H4K C;  3VSL A;  4CCM A;  4DOZ A;  1NG7 A;  4XMY A;  1S3Z A;  2W4S A;  1FMV A;  2X85 A;  1NE9 A;  3TL4 X;  3EFA A;  4NF1 A;  2R98 A;  4C7I A;  4B5O A;  2B3V A;  4MFQ A;  2M3A A;  1Y7R A;  4BBH A;  4KUA A;  3S93 A;  2P6F A;  4OAE A;  2UV1 A;  1KON A;  4A33 A;  1IYL A;  1ZO0 A;  4B11 A;  2DT6 A;  4E7H A;  4AG7 A;  4MLO A;  2YNE A;  3JTK A;  4JLY A;  4CAF A;  3VWE A;  2I8D A;  4HRI A;  3LSG A;  4CCJ A;  3BG7 A;  2KHM A;  1RO5 A;  3DPL C;  2W00 A;  3K70 D;  4PK3 A;  2VQY A;  4JD6 A;  4C68 A;  3H5N A;  4U9Y A;  4AB7 A;  4DNC A;  1G8X A;  3TOB A;  2I79 A;  5EBV A;  5C82 A;  3L2W A;  4BE1 A;  2WAF A;  3DEE A;  2LH9 A;  3HUG B;  3ZGK A;  1KZF A;  2Z10 A;  1MJ9 A;  4H89 A;  3TE4 A;  3N05 A;  1M1D A;  4R57 A;  3PJR A;  1XIX A;  3VYS B;  2FCK A;  4B3X A;  3ZJ0 A;  2HU9 A;  5FRO A;  4DIQ A;  1LKX A;  1MMD A;  2JSP A;  4E4H A;  2B3U A;  5F49 A;  2VL8 A;  2WA0 A;  2Z3P A;  2Z3M A;  1WJF A;  4C7H A;  2Z3N A;  2A5W A;  2JUG A;  5DWM A;  4CGL A;  3CF2 A;  5FRM A;  4ZDO A;  1QST A;  3FIX A;  4A95 A;  1X1C A;  4E7J A;  3N7Z A;  2E5N A;  3CMM A;  3AL0 B;  2QKM B;  2R7H A;  1PJR A;  1SQH A;  4CGM A;  1VHS A;  3JUW A;  1V5G A;  2HVS A;  1Y56 A;  1K4J A;  5LFA A;  4UFV A;  3OR1 C;  4Y49 B;  2R7X A;  1J4J A;  2L9S A;  1VKC A;  3ZXS A;  4F0X A;  2FE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...