1BOBA

Histone acetyltransferase hat1 from saccharomyces cerevisiae in complex with acetyl coenzyme a
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
315
structure length
306
Chain Sequence
FKPETWTSSANEALRVSIVGENAVQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDSVTFKPYVNVKYSAKLGDDNIVDVEKKLLSFLPKDDVIVRDEAKWVDCFAEERKTHNLSDVFEKVSEYSLNGEEFVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLLNKKTKELIGFVTTYKYWHYIDKKFRAKISQFLIFPPYQNKGHGSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKLGYDAVFQKHSDLSDEFLESSRKSLKLEERQFNRLVEMLLLLNNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the histone acetyltransferase Hat1: a paradigm for the GCN5-related N-acetyltransferase superfamily.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Acetyltransferase
molecule keywords HISTONE ACETYLTRANSFERASE
total genus 92
structure length 306
sequence length 315
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 1998-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1bobA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1bobA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 1bobA01
3C26A 4NXYA 4YRHA 1IIDA 1WK4A 1YREA 2Z11A 2Q04A 4R87A 4U9ZA 1J4JA 2B5GB 1YX0A 3VWDA 3FRMA 2ZW7A 3TCVA 3D3SA 3W6XA 4RS2A 3SXOA 4QB9A 4F0YA 4CAWA 3N7ZA 4E0AA 1Q2DA 4IF5A 1QSMA 2OU2A 4Y49C 4OADA 1IYLA 4HNXB 1M4DA 3EO4A 1P4NA 1MJBA 2VEZA 4L89A 2GIVA 4FD7A 3SHPA 4AG9A 1S60A 3MGDA 3UY5A 1V0CA 3QB8A 2PR8A 1KUVA 1M4IA 1XF8A 5J8CA 3PP9A 4BMHA 1YVKA 1B6BA 4KOXA 1U6MA 3TO9A 3H4QA 1XEBA 3JUWA 2ZW4A 2FE7A 4XPDB 3F8KA 2ATRA 2EVNA 5CNPA 1YGHA 4J3GA 5ISVA 2J8NA 3R9EA 2G3TA 2VXKA 4MY3A 2ZW6A 1Z9UA 2FCKA 1QSRA 2FSRA 3I3GA 1I21A 1YLEA 5F47A 4XPKA 4NEXA 4KLWA 2R7HA 3GKRA 1Z4EA 4QC6A 4MY0A 2G0BA 2P6FA 3V8IA 5C88A 5DWMA 4FD4A 3DSBA 4MI4A 1YK3A 2PRBA 4UWJA 4GS4A 4EVYA 1K4JA 4PK2A 3ZZIA 2PR1A 3I9SA 3E0KA 1M44A 1VHSA 2OZUA 2P6GA 3CXPA 1Y9WA 2EUIA 3FBUA 4E8OA 4UBRA 3D2PA 3R9GA 4NF1A 1QSNA 2REEA 3D2MA 3DR8A 5H86A 4PSWA 5EC4A 1XE4A 3TOAA 1IICA 1KUYA 4AB7A 5F46A 2D4OA 3G3SA 2GANA 4F6AA 2Q0YA 2WPWA 3NE7A 4ONUA 5C82A 4H6UA 3VWEA 2FIAA 2FT0A 2VZZA 4JWPA 4H6ZA 4ZBGA 2BSWA 5JQ4A 1S7FA 3KKWA 1Z4RA 4B5OA 4QUSA 1B87A 3FIXA 3S6HA 2P0WA 4JLYA 4R57A 1NMTA 1KZFA 4KOTA 3T9YA 1OZPA 4OLLA 1Q2CA 3S6GA 1Y9KA 4LX9A 1ON0A 1UFHA 3TT2A 2K5TA 2B5GA 1IB1E 4KLVA 4UWIA 1S7KA 2Q7BA 2BUEA 1I12A 4KOUA 4FD5A 4UA3A 3DNSA 2C27A 2H5MA 2ARHA 1M1DA 1PU9A 2WPXA 4PSXA 2AJ6A 5GCNA 2KCWA 3P2HA 3RYOA 4JXRA 4DNCA 4KORA 4B5PA 2OB0A 3T90A 2F5IA 3EFAA 2CNTA 3G8WA 1SQHA 4KVOE 4KOWA 4L8AA 5JPHA 1I1DA 2JDCA 1YVOA 4CAXA 2OZHA 5IX3A 2VI7A 1MJAA 1RO5A 2JDDA 4XPLA 1S3ZA 4QBJA 2R8VA 4I49A 3LODA 1KUXA 4Y49B 2FIWA 2I79A 3EXNA 5IV0A 2PC1A 4NSQA 4K30A 4ORFA 3K9UA 3S6KA 2PSWA 1WWZA 2IL4A 1BOBA 3EC4A 2JEVA 1Y7RA 5H84A 2HV2A 2VBQA 5HMNA 3R1KA 1QSTA 2Q44A 2G3AA 5FVJA 4II9A 4B5PB 1QSOA 2Z10A 3TOBA 1XMTA 4AG7A 2CNSA 4MBUA 1M4GA 3JVNA 3TTHA 3WR7A 4PV6A 2BEIA 2ZXVA 4NCZA 1S7LA 2PDOA 3OWCA 4X5KA 4XPDC 4KOSA 2GE3A 3S6FA 5KTCA 4HKFA 2FL4A 5I0CA 3TE4A 3BJ7A 2VZYA 4CRYB 3R95A 3ZJ0A 2DXQA 1BO4A 4H89A 1L0CA 3IWGA 4XNHB 5F48A 3FYNA 3R96A 2OH1A 1S5KA 3DR6A 1TIQA 2B58A 5KTAA 4U9YA 2Q4VA 4R3KA 1FY7A 4KUAA 2X7BA 4JD6A 4RI1A 5EBVA 2J8MA 4R9MA 4YGOA 4AVBA 1NSLA 4R3LA 5HH1A 4M85A 2Q4YA 5IB0A 4CRZB 3CXSA 4JXQA 2Z0ZA 1P0HA 3GY9A 3W6SA 2QECA 3PGPA 1S7NA 4U5YA 2HQYA 3F5BA 2AE6A 4QVTA 1PUAA 2Y0MA 2B4DB 5E96A 3TO7A 3QAHA 2OZGA 3DDDA 3P2FA 4MHDA 2JLMA 1LRZA 4KUBA 5F49A 1GHEA 2PQ8A 1MK4A 2REFA 2NMTA 2VQYA 3BJ8A 1Q2YA 3W91A 3SXNA 3B8GA 2D4PA 1XIXA 4M3SA 2RC4A 4AVCA 3EY5A 1N71A 2BL1A 1NE9A 1YR0A 4LUAA 2A4NA 2QMLA 3D8PA 2R98A 4KVXA 4CS0B 1CJWA 4YFJA 2FS5A 2FXFA 4KOYA 1VKCA 3PZJA 2CNMA 3IGRA 4XNHC 4IUSA 3FNCA 3CXQA 2B4BA 2J8RA 4FD6A 4KZTA 2B3VA 2R1IA 4OAEA 5J8FA 3TFYA 4HNWB 2CY2A 4HNYB 4PK3A 2P6EA 3TO6A 1R57A 3FXTA 1MJ9A 2B4DA 4CAVA 4AVAA 1IYKA 2QIRA 4KOVA 2B3UA 3LD2A 2HUZA 3FB3A 3BLNA 4E2AA 1RXTA 3F0AA 5KTDA 2I00A 4KVME 5DWNA 1CM0A 4MJ8A 2ZW5A 3GYAA 4JJXA 2O28A 3R9FA 2ZPAA
chains in the Genus database with same CATH superfamily
2ZXIA 5EDNA 3C26A 4YRHA 4BJ6C 5FB2A 3RPQA 3JTGA 3VYRB 1KWMA 1BN5A 4HSRA 4BDZA 1IZ1A 5E8GA 1RRJA 3B3SA 4A3DJ 3DXJF 1F43A 4MHGA 4BE1A 1SAXA 2IA0A 2A69F 2XB0X 1BPNA 1YX0A 2ZEOA 2Y69H 4KN4X 4RS2A 4S0HB 1JKRC 3C2HA 4UCPA 3SXOA 3VATA 1ETYA 1AWCA 3LL7A 2XPVA 4CAWA 3VYSB 1Q2DA 3T0YA 2H1KA 4L5EA 4IF5A 4UIBA 2CRGA 2OU2A 2DF5A 5HLHA 1TQPA 2IW5A 1YX5A 4CGZA 3LAPA 3KL9A 5JGFA 3OYJA 3I1UA 1M4DA 1TWFJ 1LVKA 2M3AA 2OA4A 1P4NA 4HLXA 3M9AA 1U8BA 1ZR4A 5DS0A 5F1RA 3JRDA 4U7DA 1WSUA 2EFWA 2V1UA 1H9TA 2WZNA 1IN7A 2XPWA 3OV8A 4E7IA 1YS6A 3KEQA 1U5TB 2YU3A 3F8BA 2IGOA 2V7FA 4LJZF 3LSGA 3WG9A 3H0DA 4ZZDA 4UVBA 1VHOA 1YLOA 4A30A 4A3EJ 2VQCA 3SZPA 5E20A 2DQRA 2E34A 4FE4A 3V4GA 3X2QH 4PUSA 1RNLA 3E6MA 3FM3A 3A01A 1VQ4I 2DPSA 2NYXA 5ICFA 2K9LA 3SFIA 1S29A 5TRDA 1BIBA 1WVRA 2PR8A 1ZR2A 2M34A 4MFLA 2L7FP 3PP9A 1W5TA 5JI6A 5KAIC 1BIAA 3CJNA 3R60A 3F6OA 2LSOA 3Q3SA 2A6TA 5DTDA 3WG7H 5HMNA 3DGVA 1XEBA 2VBZA 4A3BJ 3FVLA 1BJAA 3I4PA 3OL4A 1XDUA 4C2ZA 4E7SA 1FYMA 3JUWA 3ABUA 3G1MA 4U0VA 3RSNA 4JX4A 3J81Z 3MWMA 4Y4RA 3S93A 2FE7A 3LFUA 5EG0B 3F8KA 3R61A 3MN8A 1K4SA 2EVNA 1I3AA 3CJTB 3DTKA 1WQ2A 5CNPA 4MQVA 1X4PA 3EYIA 1T6SA 3PO3J 3NH5A 4OIWA 4MRIA 1FC3A 4ESFA 2QQBA 5LRSA 3OYIA 4AIDA 3KIOA 3IAS2 3TDUC 4F92B 2G3TA 2VXKA 2ZW6A 1LJ9A 2COMA 2G7HA 3FK6A 4B1RA 3ERMA 3I3GA 4E7ZA 1IGBA 1YLEA 4PPZA 1ZG3A 1EA3A 3ECOA 4JQFA 4NNJA 5ELYA 2EH3A 3OR1C 3ECHA 5TGTA 4J00A 5E79C 1ZK8A 1GLNA 5BOXA 1MNMC 2BOLA 3IWWA 2L54A 1U78A 2OOTA 1N25A 3GKRA 4QC6A 4PZJA 2G0BA 3RKXA 2QSHX 4IHYA 2L7KA 4XN0A 5GPAA 4IPAA 5H6RA 5AONA 5IOYA 2GM4A 4KS9A 5K5QA 1GHCA 4A3KJ 2PRBA 3HTUA 4DUKA 2XSDC 3S3MA 4PK2A 1OFCX 3JAMK 3PB6X 4OWRB 3I9SA 3E0KA 2NVQJ 2LMDA 2OF7A 1ELMP 1LUJB 1R7JA 3HOXJ 1QQIA 2P6GA 4XKVA 3CXPA 3PM1A 5CVJA 5E1WA 2E5NA 3V7SA 1B8IB 2STTA 2KMUA 3ABMH 3E6DA 1HDUA 4EVIA 5G20A 2WTEA 1S72I 4UEFA 1XC5A 2HVQA 4YRVA 4JX5A 2CTCA 1NH3A 1OCPA 3AG4H 4ENJA 3D2PA 4LLNA 2BY0A 1ZKGA 4UXNA 1WRJA 2DDAA 3H3ZA 1WCMJ 4RB2C 3DR8A 2VQLA 4HF1A 3DP7A 4NQWB 5DM6F 1RIOH 1X19A 3TOAA 4CCNA 1AMPA 1WHUA 1SVOA 5EZHA 1G6NA 1N75A 3SDGA 3ZQFA 3L2RA 1HOMA 2Z3MA 5G1ZA 3TW6A 2W25A 3TW7A 2NS8A 3CDHA 3GFMA 1TKJA 1YLFA 1LNWA 1LDDA 1P4XA 5D6EA 2VT2A 4WWVA 1Y6IA 2LD5A 3DPUA 1MMAA 2P5KA 3CLOA 4KMUX 2HVSA 3OIPA 4I98B 3I64A 1V3FA 4A6EA 1HA8A 4HNUA 1HKTA 4HV5A 5J4YA 1RUOA 3WE2A 4IZZA 2Q0YA 4XSZF 3WTWC 4BGDA 4RB1A 3A03A 2Y0SN 2FT0A 4JWPA 3BCBA 3ERED 2KRHA 3VYUB 1X10A 2DFHA 4CCMA 1IC8A 4UV8A 4FQGA 3QQAA 2CGPA 2BSWA 5C3EJ 5JQ4A 1Z5RA 5C44J 5EGOB 5M5XJ 2TCTA 3BDDA 4A3GJ 3GZ5A 3B35A 4B5OA 4QUSA 5D5UB 4BY1J 1X3WB 2YUSA 2H09A 3FIXA 2XF5A 2E71A 1EF4A 4IK2A 2CQXA 4M74A 5JH9A 2V1XA 4BXFA 1DP7P 1IRFA 2V8DA 4A3FJ 3T9YA 2XGCA 3GYHX 3RYRA 1VQLI 2V26A 3TT2A 1UFHA 1OCZH 5L3FA 5E3NA 4HLYA 2R7DA 4NC6A 3S9NA 2V1DA 1BL0A 2QA4I 4XOPA 4UB6C 4OC1A 3WGIA 2L0KA 9ANTA 1Y0UA 3CMEI 1XBUA 2JBKA 5EJCA 3D0SA 3KP5A 4B43A 2ARHA 4MFZA 3RKYA 2HR3A 1PU9A 2WPXA 2RFHA 2VPRA 4MFDA 4MCSA 2HDWA 5GCNA 2K7LA 1U2WA 5E1XA 3SQNA 4DNCA 5KNLA 4ZYQA 1OBRA 4GGGA 5HVHA 5D8LB 2IA1A 2LH9A 3OYDA 1K83J 2HQAA 3TQNA 3DEUA 2ANPA 5F04A 2F5IA 2Q4ZA 2DT7B 5K8NA 3G3ZA 3HRUA 5AIQA 4ZTJA 4IHTA 1RTQA 2GLOA 3KZZA 2ZEGA 1U0JA 1SQHA 4J01A 4CICA 1SD4A 2BCOA 4B48A 2K4BA 3BQYA 1ON2A 2GOXB 2F2EA 2XEIA 2XSJC 2MW8A 4EJWA 3A01B 5HS8A 1XGSA 1YVOA 2PE3A 3JRHA 2FRHA 2ISYA 3K4BA 1HSJA 1USSA 3AG1H 3HSFA 2NVTJ 4NGRA 2A5YB 4AWXB 4A2ZA 2K3PA 3M7GA 2JA5J 3BXMA 4NBQA 2Y75A 3LSPA 4WJBA 4CUGA 2JDDA 2CF4A 3IU2A 3AL0C 1T98A 3ZXSA 4S05A 2XKOA 2VJ4A 2X1DA 5EG0A 4BXUA 4JX6A 1ZAOA 2K85A 1IG7A 5IV0A 1YOVB 4BJ5C 3GTOJ 4PK4A 3REOA 1QHGA 1GT0C 2MG4A 2VOOA 2OQGA 1XGOA 4MIMA 2XROA 1IF1A 1HF0A 2LRDA 3K1PA 5LHHA 2L5QA 1E3PA 4CAFA 2DMPA 2X9DA 3RZAA 1UB9A 3ISZA 2WAQN 3P9CA 3EUHC 4M3BA 2CS3A 2HTSA 3BZKA 3TMOA 4QPQA 3MAJA 4CYDA 3WTSC 2R5YB 3V8LA 1QSTA 1D3YA 3Q0VA 4GM5A 2G3AA 5DM7F 2ZPAA 2NNNA 5H20A 4B5PB 2ELJA 1LVAA 3QWLA 2BZTA 1N77A 4Y52J 4HNTA 5HVFA 1XFOA 2MH2A 4CAEA 4AG7A 1X3UA 3OS1A 5HXDA 4CGLA 4CYPA 4I01A 4ZY2A 3HRSA 2VIXA 1TW2A 4PV6A 2HQRA 4KIFA 3KE2A 2MH9A 4BHBA 1TXRA 1W7PA 2ZXVA 3RQIA 1LDKB 3ZQGA 1VQ6I 2HPIA 2WV1A 2ZBKA 3MRUA 2E1OA 1Z8WA 4KIGA 3ZN1A 4F6AA 2PDOA 3CXQA 3F3XA 1Z3XA 1DUXC 2EIKH 4HBLA 2R7RA 2GE3A 3BI1A 4YU9A 1UWYA 4HKFA 1CX8A 1ON1A 1Q7LA 4LITA 2GAUA 3H3UA 2Q8KA 5I0CA 3TE4A 1JUPA 2ZEMA 5AG6A 4E70A 1XMAA 3GFJA 3HUGA 1IV8A 2KIQA 4AVZA 3HOTA 2I3CA 4FHTA 3BOQA 3HKZA 3CLQA 3U9GA 3RKQA 1MH4A 3V7ZA 3L2UA 1YYVA 1PJRA 3V38A 3FMRA 3OMYA 4ETSA 1JTXA 1VQNI 3H35A 3JR9A 3S16J 4HAMA 3KYDB 4GYIA 5LGNA 4MCPA 1POGA 4IHSA 4Q5SF 3HSEA 4XNHB 3BR2A 2F4IA 2M45A 2LG4A 1W4MA 1MMGA 2IBDA 2EA2A 2VQHA 3FX3A 4AIJA 2OH1A 4Z65A 3CTAA 2E2JJ 5LD2C 1CPSA 3MKLA 2M0MA 5J1YA 4MNUA 4EGZA 2M2EA 3M8JA 8CPAA 2PMHA 4YFKF 3GFIA 1AYEA 2R7WA 2WC2A 4RDUA 2L3DA 2E36A 2B58A 4RB0A 3IH3A 1FY7A 5JR3A 1X2MA 2HKXA 3M1EA 5FKOA 3EUHA 1IUFA 1YG2A 1TNTA 4YGOA 1O4XA 4AVBA 1BC7C 1JI8A 4WWCA 4R3LA 4M85A 2EILH 2MFZA 5LHGA 4F9UA 2BHYA 2MC4A 3HXLA 4I76A 5C4JJ 3KYCB 2TRTA 4II3A 2IGNA 1ETWA 3M1CA 2PJRB 3OIOA 4IRHA 2GZWA 1K78B 1RR7A 1UELB 1G2HA 5FLMJ 1YW4A 4H2KA 4OC3A 4ZYDA 5LRJA 3M8EA 3KYLA 2LREA 4N0BA 2Z2SB 1VQ9I 2A61A 3HRMA 1B6AA 1PVEA 1AKHB 2HEOA 4A38A 1S8NA 1HDQA 2NVXJ 2EZKA 1MBHA 3MMYB 1SAUA 1WJDA 2QCOA 1CPXA 2HQYA 3F5BA 3OSGA 3N05A 2POKA 4NFRA 2QVOA 1Y39A 2AE6A 4X8IA 3CCQI 2JRMA 1I6HJ 4RA2A 3C2GA 3FXKA 4XKWA 3P2FA 4Y13A 3BWGA 2Q0OA 4JOMA 5ICEA 3IFEA 1FOWA 1IN5A 2REFA 3E1SA 2W48A 3BJ8A 2LR8A 1BBYA 4H0EA 4ZY0A 4P4FA 1MBGA 5JLWA 3W91A 2EFOA 3SXNA 2D4PA 1O7FA 3GW2A 4RMNA 2RC4A 1IO2A 1Z8TA 1MNDA 1QRYA 3EY5A 1PP8F 1L3LA 2ZJPF 2OC6A 1GVDA 4HV6A 2HVRA 4XQFA 1N71A 1VI0A 4M6VA 4BBHA 3F8CA 1NE9A 4BHPA 3LACA 3L2CA 1VQOI 2EBIA 2IJLA 2ZO4A 2HXIA 4I7HA 2XAQA 2JT1A 4AD9A 2P81A 3H9GA 3TDZC 1IU8A 2F5CA 1XN7A 3DCFA 3CJQB 2M5WA 3KLOA 2KZGA 1JQGA 3RI4A 3D8PA 1VQ5I 2WB1N 1R6RA 2I5UA 1U5TC 2XAUA 2EINH 1BPMA 4Y33A 1ZRCA 4R79A 2IJZA 3OYBA 4KOYA 2PEXA 1MH3A 3U1DA 3ZCOA 1XMBA 4XNHC 4IHXA 4Z2YA 2XB5A 2DDBA 5F6FA 4QLCU 2ACJA 3OYNA 3BROA 1RKWA 4G6DA 5FFXA 4R7MA 3WABA 2WA0A 3GWZA 1YITI 3IEHA 2ABZA 3J7AO 2B3VA 1TNSA 1ZARA 4AU7A 3LSIA 1IDZA 3KP2A 3M07A 2P5VA 1Z67A 2D1VA 4JYKA 4EJOA 1UG2A 4KJZA 3Q5FA 3EPZA 2YX7A 5ILSA 1OLTA 4LK1F 1R9TJ 2HGCA 1ZLKA 2LF7A 2R7ZJ 1R57A 1MBFA 3KQXA 1A35A 4IL6C 3CO6C 3NH8A 1QQ9A 3SHFA 1BA5A 1KONA 1TWAJ 5LGUA 4MCRA 5E3OA 4BKXA 2STWA 1XD7A 4I09A 4IO9F 4E2AA 1RXTA 2OJED 1ZYRF 5AGEA 1J09A 3GVAA 3KZYA 4Y15A 1B72B 1IRZA 3TP0A 1VIXA 4NGSA 2HQNA 1M1EB 3FMSA 2DT6A 1QBJA 1CM0A 3KP6A 2R5YA 3CUOA 1ZLHA 1WKMA 2DK5A 1S7AA 1BM9A 4XLPF 4IOAF 3B3WA 1NSAA 2A6HF 3B73A 4BHCA 2Q04A 4R8HA 1X58A 4R87A 1O3TA 3R0JA 3OYAA 2KPMA 3FK7A 3ZMUA 4Q38A 3AG3H 2B5GB 2NNYA 1R23A 2PBIA 1D1AA 2ZOFA 3KPHA 3I4NJ 3BG7A 3FRMA 2HZTA 1KQ8A 3PIOF 3LSKA 2XRNA 2ESHA 2HOEA 2P6SA 3TCVA 1CP6A 1IY7A 1G3YA 4QB9A 4F0YA 3I5UA 3L00A 4L0ZB 4PJJA 2WUUA 4E7LA 1SVLA 2DMUA 1BC8C 3C18A 3GTPJ 4UHTA 3W6VA 2DA4A 2E5ZA 1JUSA 1ZGAA 3MVPA 1W0TA 2EIJH 3H1CA 2UXXA 2LF8A 3AFHA 3S1RJ 1B9NA 5ICGA 1X12A 2ZEDA 2VKDA 4L89A 2DJNA 2DT5A 2FQ4A 5LRRA 1DU0A 2GLJA 2QSGX 2DFEA 3JSPA 4HYEA 3SHPA 4AG9A 3CDLA 2AXLA 3ZQLA 2JUCA 1V0CA 3QB8A 3FECA 2JPCA 2FBHA 3BZ6A 4OOIA 1M4IA 1XF8A 4FE7A 3BR6A 3FXMA 2X0LA 1YVKA 2C6GA 4A94A 2VUMJ 1BI0A 1U6MA 3B02A 2Y30A 3TO9A 3H4QA 4LQ6A 3QPLA 1ETVA 1G3SA 2JRTA 4G6TB 1X3ZB 1O57A 3IH4A 4IVNA 4F9VA 1W5SA 3ISPA 5F0FA 3PIPF 1SFUA 4IX7A 3IJ3A 4RBOA 2ZW4A 1IGNA 4CYQA 4LB5A 2Z9OA 2L4AA 4HX8A 5IYBJ 2IMOA 1V5FA 3GEZA 1OCRH 4PFOA 1ZREA 3CCUI 4WCGA 4HF0A 1SD6A 3O3KA 2XAJA 2KLOA 2VODA 1OCCH 3E3VA 3IAM2 5EZGA 2O6GE 3PUBA 1VQ7I 1OR7A 2F5DA 4ZX9A 3GTLJ 2PJRA 2HYGD 2FOKA 3R9EA 1OCTC 1YRNA 2XASA 2H8RA 2K40A 1HDPA 3S17J 1IOFA 3RTRA 2FSRA 3PFEA 1I21A 5F1JA 5L3DA 1MDMA 3O8GA 5F47A 4EM2A 4XPKA 1R43A 3K2AA 3FEDA 4B10A 3S3NA 2DYRH 4NEXA 1T0FA 2CWEA 3GLXA 2CMPA 1ZRFA 3E97A 2AQEA 1A6QA 1ETOA 3KGQA 3NFZA 5C88A 3QP6A 5HVGA 3I71A 1QU3A 4DIQA 1FT9A 4OMEA 1ZG5A 2O8XA 4GXOA 2NS0A 1U5TA 5JVGF 4FD4A 1F5TA 1PDNC 3DSBA 1YK3A 1TW3A 3DQVC 4BXXJ 5THWA 1UZCA 2O0YA 3GFLA 5TISC 4V19K 3LQQA 4A95A 1K4JA 2DA2A 3KR4A 4NGNA 4P4JA 1XOVA 4BDYA 3WC6A 2DA6A 2DODA 1BW5A 4M9SA 5DD4A 3T5XA 3RPUA 2NXNB 2OZUA 4PGGA 4CZCA 1VHSA 2ZELA 4DZJA 2ZFWA 1CQTA 4YIFA 1D0XA 5ERIA 1Y9WA 3QAYA 3O2PE 1E2XA 2GIZA 3H92A 1O3QA 1VQPI 3HTSB 1S3JA 2DA7A 1OYIA 2FSWA 1XTAA 3D1NI 3JCUC 4XR6A 2G9WA 1XGNA 4UBRA 2IS6A 1QSNA 4NF1A 3V7CA 2JEWA 3CF2A 4GO1A 2M7BA 3FISA 3FMQA 3I3LA 4PSWA 5FD6A 3GIUA 2VOPA 5EC4A 3Q9SA 1XE4A 4AXVA 1SEUA 2YNCA 2ZSIB 2XRLA 3WHBA 1KUYA 4EMEA 3E5UA 3HEFA 1G59A 4KICA 1E17A 3LSMA 3K2KA 3LQRA 2EFPA 5K8MA 2KQRA 3VSKA 1Z7UA 2GANA 3LWFA 1X1CA 3CCYA 3H5ZA 2COBA 1JTYA 3NE7A 2HB6A 4ONUA 1YW9A 4IOCF 4CCLA 2PIZA 4H6UA 4CGMA 3VFZA 2VZZA 2ZMEA 3MN2A 4LD5A 3K4NA 5J1RA 1SVMA 4M3DA 4JZ0A 2M8EA 2M4GA 3KEOA 4LG3A 1W0UA 4HSTA 1J75A 4ANJA 3WU2C 4CGPA 4CZZA 4XRSG 2EK8A 2PJAA 2CIJA 2DBBA 4OINF 3PQJA 2EFNA 4B12A 3BG5A 4RAZA 4OC4A 3S6HA 3UNGC 5B66C 2P0WA 4XORA 3P5JA 3SI1A 3NQOA 2MGQA 1Z21A 2NOGA 4JLYA 4IHMA 3IRQA 5JM6A 1NMTA 4D7MA 1IW7F 3B6CA 3WGHA 3S2HJ 4P9UA 2PJ6A 2LOOA 5J4VA 5M3FJ 4FTHA 3W6KB 3TGNA 3N97A 1Y9KA 4XM3A 2Y2ZA 2PMZA 2K5TA 5DEQA 2B5GA 3K9TA 4UWIA 1ACIA 3GTMJ 1S7KA 2Q7BA 2UWMA 2DOFA 1TQMA 3DLLF 4E7HA 3HJEA 2QVPA 2R7SA 1NG7A 4XICA 2DAOA 3LA2A 1BLLE 2F48A 4G94A 2H5MA 3I53A 2KP6A 1M1DA 2Z1DA 3KZWA 5I4MA 2AJ6A 4M6XA 3WTXC 1HLVA 2Z3LA 2EZLA 3P2HA 3ZQ7A 2R0QC 3S1QJ 2CYYA 1F2OA 2HQ5A 2X48A 2G9DA 4NJRA 1FT7A 3OL3A 1WZ2A 4LG0B 5FLXK 1Y0YA 2V8VA 4HX4A 2B7EA 3PNVA 1LDJA 3F21A 3KP7A 1YFHA 1KYZA 1Y8QB 1R4MB 3IUOA 1D8KA 2PJ2A 5FKKA 3OYCA 2YR2A 4KITB 2CW7A 4KVOE 2VC1A 5LBQA 1XRYA 1ZO0A 2EK9A 4MXUA 4L8AA 1FZPB 3B3CA 2EV6A 1T8IA 2F5VA 1P7JA 2MBFA 4ENNA 3PB4X 4A3LJ 4GXHA 4X2TA 5F64A 4IJAA 1F57A 2E1MB 2PJCA 3RZDJ 3HB9A 1H89C 1UG0A 2OV7A 2WAEA 3K4KA 2KIFA 1IJWC 2CH0A 4UCMA 1F36A 2YX4A 1A31A 1JGGA 4F52A 2YNCC 2XEJA 5M5WJ 3L9FA 1J2XA 5IOZA 5EGOA 5LYDA 1RESA 4E7KA 1R5HA 5CVVA 4BYYA 3TBIA 2D45A 2VI7A 1I27A 2BXZA 1NK3P 1RO5A 3GF2A 5K8PA 4ZJZA 5BWAB 1S3ZA 4XOTA 2LFBA 1ZTRA 2E1NA 2CV2A 3EYYA 3W2WA 1WWXA 2RDPA 3MZHA 4U0YA 3EUAA 1X4OA 2L9RA 1QZEA 1U9OA 4A0ZA 2V9VA 2M9HA 1GYTA 1KUXA 1J59A 2QYOA 1RI7A 2I79A 2DOAA 2AFWA 4N9HA 4UFXA 2PC1A 3GO5A 4ZC3A 5LYLA 4KA4A 3CUQA 3V8KA 2IPQX 3DLJA 1QMUA 4O6JA 4B44A 1R71A 4CCJA 4A3MJ 3VYTB 2TDXA 3BJAA 2IS4A 3EC4A 3H36A 3A4CA 1LAMA 4A31A 4AYBN 2HOAA 1MDMB 2JEVA 1Y7RA 4RGUA 2QF7A 1Z9CA 3IU1A 4A69C 2VBXA 3OYLA 3FKIJ 2BVMA 3R1KA 1UJ8A 4PJ0C 4FASD 3G71I 1MMDA 3F8NA 2QJ8A 4U88A 2NYQA 2FXAA 5LYIA 4B14A 3BR5A 4II9A 2E35A 2EPFA 2HXOA 3SDBA 1QSOA 3KCCA 3KHXA 4GRIA 3TOBA 2QQ9A 4BBSJ 3HHHA 5LFAA 1FYLA 1FNOA 1STZA 2D1HA 2DTZA 3JVNA 3WR7A 5EYRA 2K3FA 3ABTA 4NCZA 1R5ID 4H4KC 1JKQC 1S7LA 3KR5A 4MFQA 3T1BA 3WE3A 2PMZN 3FF3A 1ULYA 5L3BA 3Q0WA 3OWCA 5A27A 4KOSA 1IUYA 2XEFA 1WI3A 1KGSA 2BOAA 4XL9A 1JUMA 2IP2A 2JMWA 2QSFX 1G4DA 3HOUJ 2YGWA 4HNVA 3CT9A 3R6SA 3CPXA 2R7UA 2HPMA 3TX8A 2G0EA 1T08B 3WTTC 3BC8A 2DPDA 2VZYA 2M0CA 4CRYB 1YS7A 4I6ZA 1YHQI 3GCMA 3U1KA 2X4HA 2X1CA 4EATA 3ZJ0A 2IXSA 3K4JA 2DXQA 3B6AA 4H89A 1MBJA 5CPAA 4LLLA 4RM2A 1QZZA 5DUKA 4CYCB 5HDNA 2H6CA 3FYNA 1UCRA 4PXCA 1S5KA 1XGMA 2GREA 1YI2I 3PBEA 4IXAA 2AFZA 2PI0A 1HSTA 3BTLA 3ZN0A 1LOKA 2E19A 3OR2C 1GV2A 1D5YA 5KTAA 4R3KA 4BEHA 3PB9X 2BY1A 1LFBA 1P4AA 4CPAA 4QVTA 1Y1VJ 2PLYA 3OS0A 3ZQCA 4C2YA 4NUBA 1KYWA 4Y17A 2Z3KA 3MQ0A 1TT5B 4XLFA 4CO8A 2JZYA 4A2UA 1DQUA 4R9MA 4ZZLA 4RI1A 2JJ7A 2Y31A 4OIPF 3OYGA 1R22A 2BV6A 4P9FA 3OOPA 2P7CB 5D4RA 3NH4A 4MCQA 2VL8A 1V5GA 1CP7A 5IB0A 5HLTA 2DA5A 4RGRA 1HXDA 1YE9A 3GZ6A 2JA2A 2K9NA 4JBAA 2KFDA 4XBFA 3N5FA 2Y9ZA 1B4AA 4O3MA 3I55I 1P2FA 3PB7X 2E7XA 1XCVA 4F0XA 3D5RC 5C82A 4AVPA 4I2OA 4OU0A 4OC2A 2QKLB 4C7IA 2YNDA 6PAXA 3W6SA 2Z5UA 1RUNA 4OIQF 1W7PB 2V6CA 3PGPA 1DPRA 1R58A 2PIYA 1W7PD 1VQKI 1EJ9A 4U5YA 2B0LA 4WX9A 1ZRDA 4IQJA 1OISA 5L3GA 1NK2P 3SEZA 4IAVA 3LSRA 3K1MA 4L0YB 3FXOA 1PUAA 3JTHA 1UMQA 4D1QA 3TO7A 4P4DA 5J47A 4XLHA 5FGMA 4RAFA 2JLMA 4IHVA 4B3XA 1JHFA 4W9YA 4EJVA 1ZLIA 1EH8A 2GLFA 4KUBA 2VJIA 1AHDP 3HOZJ 4CDGA 1MK4A 2ECBA 3ELKA 5J1UA 2WAFA 4QIWN 1BJZA 3OY9A 2VQYA 2Y48A 4PJNA 3KETA 1Q2YA 2KDOA 2XAHA 3B8GA 3KP3A 3BQZA 4C2TA 4NJQA 5LYFA 4EGYA 1GXPA 4M3SA 2GFQA 1Y0RA 4AVCA 4P5OA 3DKWA 2BL1A 4A5MA 3WGGA 4BQOA 4ZY1A 3A02A 4GYGA 1YR0A 1VHEA 3E5XA 4K3NA 3D5SC 4UUVA 2A4NA 2RQPA 4N4NB 5EEHA 2J5PA 3LAJA 2H27A 2ZEEA 2QMLA 5F0CA 3D7GA 4G6QA 3HYIA 4PFPA 4XRFA 4F93B 4M3FA 3J80K 3SI2A 4CH7A 4KVXA 2KIMA 4AIHA 2KDZA 4CS0B 3LSHA 4K2EA 1YQAA 5CPRB 2IS2A 1CJWA 5IT3A 1ONVA 1ARMA 4ZH4F 1ZELA 2RV8A 1FEXA 4LK0F 1VKCA 3PUFA 1YIOA 2NAZA 3E6CC 5DCFA 3HGGA 1OQYA 4JYWA 2O61A 2J8RA 1H9GA 1O3RA 1P92A 2RVCA 5FKNA 4KMFA 4KZTA 3CMAI 3BI0A 1WH7A 1SFOJ 4N4OB 5J8FA 4R76A 2NVYJ 5J6XA 1X1BA 1ETQA 2XHKA 3S9LA 1MIJA 1XS9A 5IY5H 1KU9A 3VDXA 1AKHA 2OPTA 3NEUA 4A32A 2EBJA 1PYVA 4UEZA 2P6EA 5AG5A 3E6BA 4KSIA 5HLGA 4CCKA 1D5VA 3G73A 2DXIA 1YQEA 5DS9A 2RNJA 3DKXA 4P44A 2ZEPA 1XX5A 4CAVA 3JRIA 2NS7A 3CCRI 4E4HA 2K27A 1IYKA 1M4LA 5H2FC 2P8TA 2B3UA 2QIRA 4G1PA 4KOVA 5HS7A 5FLXZ 3BHXA 3FB3A 1B1BA 3CC4I 1I5ZA 4TWEA 1R4NB 1K6YA 2BVLA 3IRRA 4UF4A 3ESWB 3GX4X 1FIPA 5HS9A 2FOWA 3GXOA 1F2PA 1APLC 5DV5A 3GYAA 4YIRX 1FTZA 3R9FA 2O28A 3IWFA 4OAYA 2MYSA 3P7NA 5DYMA 3BG6A 4NXYA 2CJJA 1J9IA 1IIDA 4A5NA 2E60A 1LB2A 5A28A 1BI1A 2BEOA 1YREA 2LKSA 3WTYC 1U8RA 3FHNA 2RAEA 2ZXJA 5IP9J 4ZYEA 4U9ZA 4C3JJ 2D2WA 3AG2H 2LKXA 4L9NA 1J4JA 5CBMA 3A2KA 1E0EA 3FXJA 3VWDA 2QLZA 4FT8A 3WT4A 2O5RA 2LYCA 3D3SA 3W6XA 4A0YA 1SFEA 4DYRA 2ZEFA 3L2WA 1BW6A 1P6RA 2F4OB 4E0AA 3S2DJ 2KIUA 4HPQA 4EEFG 2M4KA 1MNEA 3FHZA 4OADA 1IYLA 2AQFA 4HNXB 2H1LA 1R00A 1TF8A 1LFPA 3B7IA 3EO4A 2JN6A 2FNAA 2IRFG 4LOCA 3MKWB 4G7HF 1T2KA 2Z3PA 4NGTA 3JRCA 4NDLA 2VEZA 2IVMA 2PCUA 3A1YA 2O03A 5E18F 2LY9A 3D7DA 1Q1VA 3P9KA 1MKMA 2GIVA 1GDTA 1T56A 2EZHA 2XKPA 5FKMA 5G21A 2W4SA 1REPC 1JWQA 2ID6A 4RAYA 5D4SA 1S60A 4J19A 3CC7I 1ZG7A 3BJOA 3MGDA 5HNFA 1UAAA 4CYOA 5ICCA 4P4EA 4CYCA 3E7LA 2ID3A 2Q1ZB 3NWSA 1KUVA 5J8CA 5KHDA 2VPLA 1IN8A 1J0RA 2BY3A 4KT6A 1B6BA 4KOXA 3K4CA 1I3QJ 1E3OC 3KLNA 2R7VA 1BR2A 2RQQA 1PUEE 1X1PA 2CU7A 3K1NA 3HC7A 3HRTA 4HQEA 4WXDA 4P45A 2JSPA 2FEZA 3C7JA 3K7AJ 1WGXA 3CESA 3QYEA 1ZH5A 3VH9A 1S7EA 3F22A 3L2QA 4J3GA 2ECCA 2RB7A 2CFXA 1OPCA 4I0BA 3J7ZI 4ZDLA 2F7VA 5HVQC 1Z9UA 4C3IJ 5DD8A 1GVJA 4HDVA 1QVUA 4Z6YA 4C3HJ 1EH6A 2NSMA 4DYOA 2FQ3A 1A04A 4ESBA 3BR0A 2I8DA 3DBHB 1LEBA 1FBUA 3F72A 5J1QA 4A3JJ 4KLWA 4ZYGA 2AHQA 2R7HA 5GTHC 1PUFB 2EK5A 3JSOA 1U3EM 2DFFA 3CCSI 1A2ZA 4MY0A 3V8IA 4PXBA 4M73A 3FM5A 5DWMA 3GMEA 3QYBA 5TJJA 2ETHA 2ZJRF 1AOYA 4B3AA 2CG4A 4OIRF 4IHWA 2R7OA 5L3EA 2X85A 2CQQA 5B1AH 4MLOA 2C6PA 2FMLA 4KFCA 4KN7X 1R1VA 3F8FA 4OC5A 3ZZIA 2PR1A 4UVCA 3K4MA 5B3SH 1M44A 3GBGA 2B63J 5AG4A 3CP2A 3TP3A 4KISA 2EUIA 2OCCH 2PMUA 3FBUA 4A93J 3O8HA 2ZXHA 3BPVA 2Y9YA 4E7JA 4E8OA 2HI3A 2Q43A 3PB8X 1T95A 3KX2A 3VARA 2LC2A 5GAEJ 3RQ4A 5D29A 5IB9A 4EV0A 5LRGA 2QQ8A 3F0CA 2OUMA 4BAYA 1D1CA 3IWZA 1HW5A 1XCBA 1QNTA 3RYPA 3W2VA 4DBRA 3HOSA 1IICA 2W84A 1VQ8I 4G7OF 2ZEHA 2O3FA 3H8GA 3HGYA 4AB7A 1EV7A 2IT0A 4XLCA 1D0YA 4GCVA 1YJNI 1LQ1A 1YRNB 2AFXA 2EZIA 3I58A 2D4OA 5IPAA 2HU9A 3K69A 5K7HA 2YPRA 1JKPC 1DGWY 3SFZA 2K4JA 4ESJA 3KFWX 2JK3A 2O8KA 3P9IA 2FA5A 1H88C 1LEAA 4NGQA 2OD5A 4L5IA 2FIAA 3SJXA 4QWQA 3BZCA 3BTIA 3HL2A 5JHUA 4FWUA 3MFKA 1FLIA 1EE3P 4XLAA 4C2XA 1MBKA 1B59A 1WJAA 1S7OA 5D5WB 2W24A 3M3YJ 2PVWA 4G8XA 3MKZA 2Z3NA 3KKWA 4X1EA 2FBIA 2ICWG 2VE9A 3BTCA 2XDVA 3GLJA 4RGXA 3QU6A 3EDPA 3K10A 1KU3A 4R57A 3FXQA 1V54H 2F5EA 4B4CA 1BOAA 4EJUA 4KOTA 2KL4A 3ZGKA 1FTTA 3PL8A 4HG2A 1OZPA 2LVSA 1Q2CA 3S6GA 3JW4A 1YO5C 4LX9A 3CUQC 3FDYA 5FFZA 2FF4A 3RPUD 1MW7A 2XF6A 1YMEA 1IB1E 2ADUA 4KLVA 3CCEI 5D8NA 2BUEA 3B2YA 3S1NJ 3DU5A 5CVIA 4KOUA 4UEEA 2KRCA 2LBFB 4L5JA 3HDDA 4DW6A 2V9KA 1LCPA 4EMSA 1FBQA 2JPBA 1ETXA 4PSXA 4CCOA 4C9YA 2Q51A 4MHYA 3BG9A 2KCWA 3OWTA 4BQNA 2PJ8A 4M71A 5JHFA 2V8HA 1W36D 2ZFUA 3T90A 4RUHA 3IV5A 3DV8A 2GBYA 3J80Z 2HWVA 4KDPA 3EUKL 3SXYA 2CNTA 2Z16A 1FNNA 3ASNH 3G8WA 4LQGA 2PJ5A 1LAPA 3JRGA 2VONA 4KOWA 2YSRA 3SZTA 3G1OA 2XAGA 1DTDA 1FPQA 2DU9A 5JPHA 2H94A 1I1DA 4MO7A 2JDCA 1WFXA 2ZMEB 1Q1HA 3HHGA 2R3SA 2H6BA 3I59A 3PQKA 3QNVA 2J9AA 2XUBA 4A3CJ 1Z7LA 1IOIA 2X6OA 1FMVA 5E1ZB 3J7YJ 1HC8A 3HG9A 2CV1A 1JXSA 1SANA 3H8FA 2DA3A 1XPXA 1H8AC 3OYKA 4RAGA 1MSEC 2DCEA 2JSCA 4M6GA 2OAZA 4XPLA 2O9LA 2WY7Q 2X6WA 1RETA 4AYBA 2VQGA 3CMYA 2LK2A 1IXCA 4CA0A 1O7LA 3ZMSA 5IP7J 1G3TA 4RB3C 4I49A 2OZ6A 2VXDA 5EEGA 1PCAA 1TL8A 4Y49B 4A39A 5CQEA 4IRGA 1T39A 2Q2EB 3EXNA 4L9VA 3DU6A 4NHJA 4NSQA 2VL1A 1OR7C 4PQAA 4BH9A 2ZKZA 4BQQA 4YFXF 4ORFA 3Q9VA 4AC0A 1X1DA 1WWZA 2IL4A 1KQ9A 1RKTA 1TKHA 5G22A 2VC0A 2AO9A 1ZGJA 3ZMDA 4ZX8A 2E7WA 3LNQA 2A6EF 2H8WA 4YELA 4D9JA 5H84A 1Z6TA 4MTEA 2KHMA 1FOXA 1F4KA 4FX4A 3T8WA 1YW7A 3OS2A 2PG4A 2ZB9A 4LG0A 3VWBA 3VB2A 4MFJA 1A6IA 4L18B 1W1WE 5E3LA 4YFNF 1TBXA 4R1HA 1DP3A 3WC7A 3ZPLA 2DTRA 2BE5F 4P55A 4MBUA 2GQQA 1QVTA 3WU1B 3D67A 1FX7A 1RC9A 2BEIA 2PJ4A 1J5YA 4ON0A 3KEYA 3VPRA 4C7HA 3CCJI 3WU0A 4UFWA 5B1BH 2VJ5A 1Z8LA 3S9MA 1WJ5A 4OMZA 4X5KA 1V4RA 2O4HA 3IL2A 1QA6A 2W00A 1LFUP 5KK1A 3FBIB 2FL4A 2L01A 5D6FA 1U9NA 1TTYA 2M8GX 4M6IA 3QP5A 3NA6A 1D1BA 3ML6A 2N8GA 1SD5A 1VGYA 5CQGA 3R4KA 3FJUA 1F1ZA 5IT9Z 3VSLA 4ZDPA 1E3HA 5FD5A 4U87A 4AUXA 1NHAA 1HW2A 5CYVA 1YIJI 3DBRB 2W57A 3IHUA 4LFUA 5CLSA 4A37A 3QPTA 1VNDA 4UVAA 2ELHA 3K70D 2WBMA 3L1PA 3JAMZ 1XSVA 1HEEA 1U6GA 5K8OA 5GP9A 1SC7A 3DR6A 3DKYA 1TIQA 3CUQB 4PGHA 2DPUA 4YWYA 2LLKA 3C2BA 2KJBA 3ZOBA 5KAFC 4U9YA 2BHZA 4KIBA 5GPCA 2P5LC 5AG7A 3AL0B 3S15J 4CYNA 4L9JA 3T8TA 4UB8C 1CG2A 1TWHJ 4UV9A 2J8MA 2LTPA 1TC3C 4P4BA 3BCAA 1QO0D 2GU2A 5HH1A 3MEXA 3QYFA 4BNCA 1MD0A 3J7AY 3ROUA 2JTVA 1FWZA 2G7UA 4UUSA 4LB6B 2NVUB 3QRFF 3B3VA 2RKHA 3ZRGA 4LLGF 5FJ8J 1MSFC 1QGPA 2QWWA 2WB1A 4B09A 3LFKA 4EJTA 3IWEA 3M4OJ 4JXQA 1P0HA 2QBYB 4M6YA 1IN6A 4M9ZA 2L9NA 3DFGA 1QPIA 2UZKA 3S1MJ 2HC9A 5ED4A 1WJFA 2QECA 3MCZA 1S7NA 5HLIA 2QZ8A 4BL0B 1XDSA 3DTIA 7CPAA 1I50J 4KYWA 4EFDA 1FBSA 2X51A 1TZLA 4HDUA 2Y0MA 1UHMA 3HPHA 4OIOF 3F6VA 2B4DB 4Q36A 4ZI6A 3RCOA 2A68F 2FE3A 2K9MA 4MHDA 2RREA 2L7MP 3ZMZA 4EQQA 4MEYF 2GXAA 2KZVA 5IT9K 4A33A 4MHZA 1DE4C 3RNZA 3GB0A 1GHEA 5A2QZ 2EV5A 1HW1A 2LBFA 1ZG1A 4BS9A 4RM3A 3HLPA 3KHZA 4CGNA 2W85A 3KZIC 2X6XA 4DQ2A 3NRVA 1OYYA 1XG1A 3SJFA 3S14J 4FISA 2HOTA 2PRQA 3CDIA 3LA3A 1YSJA 1F9NA 4G9YA 5LLQA 1MZBA 1P7IA 3CP8A 4WXCA 2DLLA 2F4MB 4IKFA 4BE0A 2QUFA 2PVVA 3VOEA 2Z33A 4BEHB 2XIGA 2ME6A 2X6YA 4OC0A 2Z99A 1LE8B 4QPOA 3J81K 2JA6J 2FXFA 3PZJA 4DZPA 3HUVA 3H8EA 1ETKA 2ZJQF 1Y7EA 5FRMA 1R49A 3PFIA 2V1NA 1WJEA 2OCEA 3F9KA 2P6TA 2BGCA 3I59B 4HA8A 1OKRA 3MKYB 2JQ7A 1A5JA 2B4BA 2OR4A 3I0TA 4FD6A 1LANA 4XLEA 6CPAA 3PNYA 1OJLA 2MA3A 2R1IA 1Z6RA 3TFYA 2DOEA 2HDDA 2PJ0A 1ZGWA 4PXDA 2L2OA 1CGPA 2GA1A 3QOPA 4HNWB 2RGVA 3WODF 3BY6A 4NB5A 3T8RA 3CPAA 2W7NA 5GTIC 1S6LA 1MGTA 2BW3B 3D7FA 3BJ6A 2Q2EA 3ABLH 1KQ0A 3BG3A 5DCMA 1QPMA 2HYJA 4NC8A 3SJMA 2R7XA 1R1TA 2HUZA 1TWGJ 4WXHA 2R7QA 5C4XJ 1Z91A 2CFOA 4RLFA 3MZ8A 3F0AA 5KTDA 2I00A 4S04A 2VXZA 3FWEA 3G1LA 4BU2A 2A07F 4KVME 4F7ZA 5DWNA 3W6JB 4DYCA 2ZW5A 4MJ8A 2LP0A 3KQZA 5H6QA 5FO5A 3I4MJ 3ZQIA 2CW8A 4EWTA 1WK4A 2FX0A 2ZMEC 1WJCA 5JLXA 2Z11A 3RAMA 2E1MC 4JK1X 4V2GA 3RO0A 4W97A 3I56I 1YTYA 3BTJA 2NOJB 2YS9A 3IC1A 2F8HA 3FXRA 3EETA 3W3CA 4IF4A 3IKTA 2WSAA 4HEA2 3C1DA 4GDFA 4A6DA 4OMYA 2M87A 2DFIA 4Q7AA 1P4WA 1R1UA 2ZW7A 4ZDOA 3U2RA 2XPUA 4E6KG 3K6GA 3CC2I 2GXGA 4CHUA 3D7HA 4ABZA 3N7ZA 5BNGA 1Z3YA 1QSMA 3SJEA 4QSHA 3AKZA 4Y49C 4IRIA 1SD7A 2MLGA 3DTEA 2XGDA 2XEGA 1Z0XA 2QGUA 2CW0F 5FLVA 4MHPA 3H3VK 3F23A 4KT5C 5M5YJ 1K6OA 1K79A 4QTRA 1KU2A 2D5VA 1MJBA 4O5VA 4A3IJ 1GUUA 3E0JB 4B47A 3BR3A 2EJRA 3QPSA 4X6AJ 3GUXA 3VODA 4O23A 4XKBA 4FD7A 3TC8A 3LMSA 3OOUA 1R36A 2R92J 3PSFA 1WJBA 3DBLB 1A36A 2ZC2A 4W1UA 4ZYHA 1JHHA 3HM5A 2KT0A 2MLKA 2DYSH 3HKZN 3HBLA 3UKGA 1Z8XA 4WF2A 4EM1A 3S3OA 1XMXA 3LOCA 3PFOA 2HKOA 5BPDA 4BMHA 4U0WA 3NAUA 3U21A 5FKLA 3UY5A 3BP8A 2R7FA 5LEKA 1J7KA 5CVRA 4RLQA 2VKVA 3OYMA 1IRGA 4C30A 2IEKA 5K1YA 2DEAA 2GOMA 2M1BA 1PP7U 1MMNA 4JP0A 4F55A 1YX3A 4XPDB 3ASOH 4BE2A 1T0FC 2R4GA 4NQWA 5LRKA 2M7AA 2ATRA 2V79A 2NRAC 5B5EC 3IO1A 1HBXG 2KRFA 5E17F 1YGHA 1OMIA 1XJOA 1TKFA 1ELLP 5ISVA 2XF7A 1C0WA 2J8NA 2WWYA 3FIWA 4MY3A 4D0PA 5J3LA 2QENA 4XRSA 2FCKA 2IGKA 1QSRA 1FOKA 1V5EA 1AU7A 4Y3OA 2ODFA 3QOEA 4A0XA 1XB4A 3SJGA 5EMIA 4LMYA 4MFPA 2XAFA 3FXUA 1Z05A 4PDKA 1ZLJA 3OYHA 2RNGA 3PJRA 5BMZA 2MC3A 3ULQB 4U7BA 5FRNA 5D5XB 4HW0A 4P6YA 3MD2A 1GV5A 1Z4EA 3QPHA 2DMNA 1MMSA 1DPUA 2P6FA 1BI3A 4ENMA 4KSFA 4ONWA 5EEAA 4PJLA 1T38A 3ZQHA 1JJ8C 1FOYA 1EKEA 3HOVJ 2LDUA 4F3QA 4F8ZA 5ILUA 2HNHA 3LWUA 3DPLC 5E8IA 2HTJA 3HOWJ 3IIBA 4MI4A 3I9V2 4B6ZA 4P4IA 4UWJA 4FCYA 3G2BA 4GS4A 5GAHJ 4EVYA 3PNTA 2A3SA 4MGRA 5LHIA 3CQZJ 1VQMI 3G4SI 2P4WA 4C68A 4MHNA 1MBEA 2FNPA 3FH4A 5F09A 3PSIA 4UFVA 4FUUA 4XMYA 2FU4A 2DA1A 1FSEA 5JVTA 1TF9A 1ERDA 3A0BC 1S5LC 2HS5A 5D5VB 3OIQA 1LE8A 1FYKA 1KU7A 3R9GA 5LEJA 3PFYA 2DJIA 4RS8A 2REEA 3D2MA 2CSOA 2CQ7A 3KI9A 4D5CA 5H86A 2WADA 1TP4A 2CUJA 2VN2A 4I0AA 4HPSA 1IDYA 1BR1A 1LKXA 1Y0NA 2IQ6A 4LIUA 2W82A 5F46A 2FBKA 2EA4A 1USTA 2V77A 1Y8RB 3GTGJ 3Q0UA 3LA7A 2EO8A 5DUIA 1L0OC 3G3SA 2CTBA 2I10A 1KZHA 3RDIA 1H0MA 5KCMA 1CF7B 3BT9A 3W2AA 4GFBA 2XV4S 2WPWA 4R6TA 2JWTA 1XSDA 3FEEA 3QODA 4BACA 3VWEA 1ARLA 3GLLA 3GUDA 2BW3A 2CQNA 2K5CA 3ZQQA 1PUFA 1D8JA 3V8JA 4H6ZA 4L9TA 2R5ZB 4HZFA 3VEPA 5DCMB 2BBYA 4ZBGA 5GAGJ 2B9SA 2HOSA 2VT3A 4HF2A 2BO9A 1S7FA 1I6XA 5GADJ 5K7FA 5D8KB 4HX7A 2VLAA 1Z4RA 2BY2A 2K86A 2HV2A 2RN7A 2A05A 1B87A 2OQRA 4Q4ZF 3ZMTA 4LGWA 3PBBA 3DEEA 3EQLF 1KZFA 1V55H 2LY2A 1H8LA 2LKPA 2CUFA 2R7TA 4OLLA 2R93J 2QYVA 1FIAA 4M3GA 1ON0A 2EFQA 1HKQA 3C3WA 3DPTA 2DN0A 3GTJJ 1UHSA 4Q48A 4MTDA 1IXSB 3FXLA 1D0ZA 4B13A 1I12A 4II2A 3B3TA 4FD5A 2L7ZA 3F8MA 2QEXI 4UA3A 3I54A 4PXEA 3KP4A 3S2WA 3H9QA 3JRBA 2C27A 3DNSA 4X3RA 1Z77A 2GWRA 2DW4A 2L9VA 3LSJA 4M72A 2UV1A 5EF6A 3O6BB 2E2HJ 2AXTC 4D7NA 5CVUA 3RYOA 1X1AA 2HZDA 2C6YA 4JXRA 3LMMA 4OKOA 2F6CA 2Y0SA 4BBRJ 3CCVI 3CDXA 3K2ZA 4KORA 4B5PA 2OB0A 4UCNA 1NG6A 2ZSHB 3DWLE 4AIKA 2E1CA 2X1EA 3GTQJ 1DU6A 3ABKH 4V2FA 4RN7A 2XGEA 2CV0A 3EFAA 1WI9A 3HIFA 4ITVA 4FETA 1SMTA 3OYFA 2JA7J 2JUGA 2ZJ2A 1ODDA 2UXNA 4P1WA 3COAC 1BR4A 2C6CA 2OTJI 3D5LA 1BAVA 2CUZA 3H5AA 1JKOC 5CJ9A 4CAXA 2K02A 5J40A 4BD9A 1TWCJ 2OZHA 3TKYA 3G6EI 5IX3A 2E2IJ 3HUGB 1SMYF 5HNHA 5K7ZA 1IV6A 3S8PA 2O53A 1T33A 1MJAA 4HQMA 1FSHA 2VKEA 2L9SA 2JVHA 3FKJA 3R0AA 4QBJA 2PN6A 1ZN2A 3H5RA 3K0LA 2DQLA 2EIMH 2IGMA 1VFCA 4D5FA 1JT6A 5IYCJ 2CXAA 2R8VA 2WYRA 3QU3A 3JREA 4NGMA 1RR8C 4YIIA 3LODA 4CXFA 3RKWA 1JE8A 2FVGA 4ZYAA 3RZOJ 2FIWA 3CZ6A 1RPWA 4MFKA 4MMOA 3NE8A 4K30A 4UUTA 2ISZA 1W36C 2LY1A 3K9UA 3S6KA 3WTZA 1HCRA 2PSWA 2FUG2 1N78A 3RIRA 1BOBA 2GXBA 4FBEA 1B9MA 2CUEA 2AS5F 1AA7A 2BXYA 3RJPA 4F91B 2DPTA 1GXQA 4TV7A 2PJ7A 2K9QA 4DJAA 2VBQA 2QKMB 4G12A 2Q44A 4TNUA 4OAZA 4YEJA 2XC7A 4XRMA 4XLNF 4I99C 5FVJA 1X2NA 4XONA 1WPKA 3DLAA 1VTNC 4MEXF 2Z10A 1BI2A 2Z3YA 2YNEA 1XMTA 2PJBA 1LPQA 2KKOA 1K78A 1FJLA 5IP6A 2DI3A 2CNSA 1M4GA 5HODA 4M9XA 3TTHA 5AIPA 1KA8A 4M3EA 3WHCA 4ENKA 2PJPA 1ZQ3P 4HOBA 2V9PA 3IKVA 3S32A 2BYVE 1LFWA 2VB6A 3SYTA 4P10A 3FBNB 3CD6I 1ITYA 4XPDC 3OSFA 1AUGA 2DO7A 3S6FA 2HFHA 2ZXWH 3K4LA 4I02A 2PJ9A 4B11A 5KTCA 1IXRC 2JBJA 3MZYA 4XKCA 1G3WA 3N4MA 2VBWA 4X0GA 2GA2A 3BJ7A 2JVGA 5JFRA 2VKHA 2AFSA 4ZTFA 3R95A 3CJRB 1BO4A 1ENHA 3WTVC 1L0CA 4N9IA 3JRFA 3IWGA 3JRAA 5ILVA 3K70C 5F48A 3R96A 3NWTA 1HQCA 2CO5A 1TT0A 4LIVA 5LGTA 4DBQA 2EWBA 4XK4A 4MFEA 2ME0A 5F0HA 2JA8J 4KSAA 3SI0A 1FMWA 5KVRA 4WK8F 1RZ4A 1R5GA 1IN4A 4A12A 2IS1A 3FX6A 3PEIA 2Q4VA 4C2MJ 4BY7J 3CF5F 4HRIA 3PRTA 4KUAA 5L3CA 2X7BA 1CF7A 4JD6A 5BQTA 2VBYA 3CZXA 2ZNZA 5EBVA 1FP1D 3V42A 2FD5A 2J5OA 1SFKA 1NSLA 3CCMI 4R8FA 2W1OA 2R5ZA 1YW8A 2AFOA 2Q4YA 5BPIA 4UIAA 4CGOA 2WY8Q 4CRZB 4IEJA 1TQIA 5F27A 3M8FA 4XNFA 2F5FA 5K5RA 3ZP5A 4KNYA 4RGSA 3CXSA 1UHWA 3CO7C 1I39A 2Z0ZA 1I1GA 3GY9A 4PCQA 2EWNA 2MABA 5IYDJ 1UFMA 1ZG8A 3TL4X 3V7RA 2ESNA 2HYFA 1JGSA 1YJ9I 3IH2A 4Y7NJ 4XN3A 1OYWA 3FMCA 2EV0A 2LNBA 1XSXA 2L4MA 5M3MJ 3NARA 4FAIA 4YG2F 4DYQA 4OP4A 1XMKA 1EH7A 3CMMA 4BUPA 4CSWA 2QQAA 3WTUC 4BQAA 5FROA 1Y1WJ 3BPXA 2PJ1A 5E3MA 3ISXA 5E96A 3QAHA 2IA2A 4P96A 3FZVA 4Q47A 2KJCA 2AFUA 2OZGA 4MQ9F 3DDDA 3L7WA 4G7ZF 3H9JA 2ELKA 1K61A 1LRZA 3D66A 2C1CA 1O3SA 5F49A 1TLHB 5A2QK 2PQ8A 1B72A 3RBUA 1HKSA 2CQKA 2L02A 2ZNYA 2NMTA 1HDDC 1Y56A 2V4JC 4BJTA 4UY8I 3A9LA 1XIXA 3IC7A 3LSTA 3H0GJ 1K7AA 2Z3OA 1OCOH 4DOZA 4EM0B 1NTCA 1YW6A 2P7VB 1S9HA 5K5OA 2DK8A 2ZENA 2O7OA 4IQ4A 2KISA 2DMTA 1DDNA 4LUAA 3JRUA 2OBPA 3WC5A 5HOOA 1WH5A 3ONQA 1PYTB 4ASNA 1DGRM 1B8IA 2PX9A 1K4TA 3L2VA 2AFMA 1W5CC 1QHHD 3FF5A 2OTLI 2V8GA 2UUZA 1JT0A 2FMYA 3GTKJ 3A0HC 2R98A 3ZMVA 3DEWA 4YFJA 4C2UA 3CCLI 2FS5A 2ZCWA 2VJJA 2CNMA 3IGRA 2A5WA 4BINA 4IUSA 3FNCA 2EQRA 2VASA 1QZYA 1FP2A 2MD5A 4FX0A 2XVCA 4KUMA 1IAWA 5HDKA 4UUSB 1VF9A 3OYEA 4B8XA 1ORKA 3JTKA 3BLYA 4DGWB 1Z2LA 2M30A 1R3NA 4ZGYB 1SFXA 5CKTA 2V6EA 4XIDA 4OAEA 2MD0A 2XGXA 3H5NA 1ZG9A 1JJ6C 1I1SA 1IRXA 1VZ0A 2QBYA 2CY2A 4HNYB 2MSYA 2FJ1A 4NC7A 3DF8A 3PO2J 2ZOGA 4PK3A 3SZGA 1G8XA 2QM3A 3TO6A 3L2NA 1CBXA 4NGPA 3HPGA 5BS6A 3HZJA 2EB7A 4OIDA 3E5QA 3BR1A 4AM3A 3FXTA 3KASA 4M6HA 1MJ9A 1ZHFA 3GZNB 3D4UA 2B4DA 4XSXF 4AVAA 3LD2A 3AAFA 1Z1DA 2DMQA 4PJMA 5HDGA 3ZR8X 4UNOA 3BLNA 2IAIA 3HSRA 2VI6A 5DDGA 1YJWI 2PFBA 3UR3C 2Q7SA 4DJLA 2WV0A 2YU9J 3D68A 3L09A 2K9SA 2WAQA 5F08A 3SEQA 2HDCA 3HOYJ 2PJ3A 3TEDA 4JJXA 1P9QC 2VE8A 3IP4B
chains in the Genus database with same CATH topology
2ZXIA 2CW8A 3BG6A 3C26A 4BJ6C 4NXYA 1IIDA 4YRHA 2E60A 1WK4A 5A28A 1WJCA 1YREA 2Z11A 2E1MC 3VYRB 4HSRA 4BDZA 3FHNA 2Q04A 4R87A 4U9ZA 2NOJB 3OYAA 2KPMA 1J4JA 3W3CA 4Q38A 2B5GB 2WSAA 4HEA2 3A2KA 4BE1A 1E0EA 1D1AA 1YX0A 3VWDA 3FRMA 3BG7A 3LSKA 2O5RA 2LYCA 4ZDOA 2ZW7A 3D3SA 4RS2A 3TCVA 3W6XA 3C2HA 4UCPA 3SXOA 4E6KG 3K6GA 3L2WA 4QB9A 3LL7A 4F0YA 4CAWA 3N7ZA 4E0AA 3VYSB 4PJJA 1Q2DA 4IF5A 1Z3YA 1QSMA 4HPQA 2M4KA 1MNEA 3AKZA 2OU2A 2WUUA 4Y49C 4E7LA 4OADA 1YX5A 1IYLA 2AQFA 3DTEA 3OYJA 4HNXB 1M4DA 1LFPA 3EO4A 1LVKA 2E5ZA 2M3AA 1P4NA 3MKWB 2Z3PA 1MJBA 2VEZA 3E0JB 3A1YA 3AFHA 4E7IA 3H0DA 4B47A 2IGOA 2V7FA 2VKDA 3LSGA 4L89A 2GIVA 5G21A 4XKBA 2VQCA 4FD7A 2W4SA 3OOUA 3SHPA 4AG9A 1S60A 4PUSA 3MGDA 3PSFA 1WJBA 5HNFA 1UAAA 4CYOA 3UY5A 2DPSA 1V0CA 2K9LA 3QB8A 2Q1ZB 3NWSA 2PR8A 3S3OA 1KUVA 1M4IA 5KHDA 1XF8A 3PP9A 4MFLA 2VPLA 4BMHA 5J8CA 1YVKA 3U21A 4KT6A 1B6BA 4KOXA 3K4CA 1U6MA 3TO9A 3H4QA 2A6TA 4RLQA 4G6TB 3OYMA 1BR2A 2R7VA 1XEBA 5HMNA 2RQQA 4C30A 3OL4A 2GOMA 4C2ZA 4E7SA 3HC7A 3JUWA 1MMNA 4IX7A 3RSNA 4CYQA 2ZW4A 4F55A 2JSPA 4Y4RA 1YX3A 3S93A 2FE7A 4XPDB 3CESA 3LFUA 1V5FA 4BE2A 1T0FC 2R4GA 4PFOA 3F8KA 2M7AA 3QYEA 2ATRA 3DTKA 2EVNA 2KLOA 5CNPA 3IAM2 3L2QA 1X4PA 3PUBA 1YGHA 4J3GA 5ISVA 2XF7A 3OYIA 4F92B 3IAS2 2PJRA 2G3TA 2J8NA 3R9EA 2VXKA 4MY3A 4ZDLA 2ZW6A 5HVQC 1Z9UA 2IGKA 1QSRA 2FCKA 3RTRA 2FSRA 3I3GA 1V5EA 4E7ZA 4Y3OA 1I21A 1YLEA 3QOEA 1EA3A 4JQFA 4NNJA 5F47A 4XPKA 3OR1C 4MFPA 5TGTA 4J00A 2I8DA 3S3NA 4B10A 1GLNA 4NEXA 3OYHA 2BOLA 2CMPA 4KLWA 5IV0A 2RNGA 3PJRA 2R7HA 5FRNA 4U7BA 2AQEA 3GKRA 3MD2A 1Z4EA 4QC6A 4MY0A 2G0BA 2P6FA 4KSFA 3V8IA 5C88A 4PJLA 4DIQA 1QU3A 5DWMA 2L7KA 3QYBA 4XN0A 4KS9A 4F3QA 2HNHA 4FD4A 3DPLC 3DSBA 1YK3A 3DQVC 3I9V2 4MI4A 2R7OA 2PRBA 2X85A 4UWJA 4MLOA 3G2BA 4GS4A 4A95A 3S3MA 1K4JA 4PK2A 3PNTA 4EVYA 4C68A 3ZZIA 4OWRB 2PR1A 3E0KA 4BDYA 3I9SA 3K4MA 3PSIA 1M44A 3GBGA 5AG4A 1VHSA 2OZUA 4XMYA 4CZCA 2P6GA 4XKVA 4UFVA 3CP2A 4KISA 3CXPA 2E5NA 1D0XA 1Y9WA 2KMUA 2EUIA 3FBUA 1ERDA 5G20A 2ZXHA 4E7JA 2HVQA 4E8OA 3OIQA 4XR6A 4YRVA 4UBRA 3D2PA 3R9GA 1T95A 3KX2A 3PFYA 2DJIA 2IS6A 2LC2A 1QSNA 4NF1A 3RQ4A 2REEA 3D2MA 3CF2A 3DR8A 2VQLA 2M7BA 3I3LA 2OUMA 2WADA 1D1CA 4PSWA 4NQWB 5EC4A 5H86A 2CUJA 3W2VA 1X19A 4DBRA 1XE4A 4CCNA 3HOSA 1IICA 3TOAA 1BR1A 1LKXA 2YNCA 2ZSIB 1N75A 2Z3MA 5H84A 3L2RA 1KUYA 5G1ZA 4LIUA 3R96A 4F0XA 2W82A 1G59A 4AB7A 5F46A 3LSMA 4XLCA 1D0YA 2D4OA 1Y6IA 2KQRA 3DPUA 2HU9A 3VSKA 3G3SA 1MMAA 2HVSA 1DGWY 3OIPA 2GANA 1X1CA 5KCMA 1HA8A 4HNUA 3W2AA 2Q0YA 2WPWA 3H5ZA 4IZZA 3NE7A 4ONUA 4CGMA 4CCLA 4H6UA 3QODA 4BGDA 4BACA 3VWEA 2FIAA 2FT0A 2BW3A 3HL2A 3BCBA 2VZZA 4JWPA 2K5CA 2KRHA 3K4NA 3VYUB 3ZQQA 4H6ZA 4CCMA 4ZBGA 4XLAA 4C2XA 2M4GA 4LG3A 4HSTA 2BSWA 1WJAA 4ANJA 4CGPA 5JQ4A 1S7FA 3MKZA 2Z3NA 3KKWA 2VLAA 1Z4RA 4B5OA 4B12A 4QUSA 1B87A 3FIXA 2XF5A 3S6HA 2XDVA 3UNGC 2P0WA 4XORA 4JLYA 1Z21A 4BXFA 3K10A 4R57A 3DEEA 1NMTA 1KZFA 2LY2A 3TO7A 4KOTA 2KL4A 3T9YA 2LOOA 3ZGKA 3PL8A 4HG2A 2R7TA 1OZPA 4OLLA 1Q2CA 3S6GA 1Y9KA 4XM3A 4LX9A 2V26A 1ON0A 3FDYA 1UFHA 3TT2A 3DPTA 2PMZA 3RPUD 1MW7A 2XF6A 4NCZA 2K5TA 2B5GA 1IB1E 4KLVA 4UWIA 1S7KA 2Q7BA 2BUEA 2UWMA 1D0ZA 3DU5A 1I12A 4II2A 4XOPA 4B13A 4KOUA 4E7HA 2KRCA 4FD5A 2LBFB 4UA3A 2R7SA 1NG7A 2V9KA 3DNSA 3H9QA 2C27A 2H5MA 4B43A 2ARHA 4MFZA 2KP6A 2UV1A 2Z1DA 1M1DA 4PSXA 4CCOA 4C9YA 1PU9A 2AJ6A 2WPXA 5GCNA 2HDWA 2KCWA 3OWTA 2Z3LA 3P2HA 3RYOA 1X1AA 4BQNA 2HZDA 4JXRA 4DNCA 3LMMA 5KNLA 2F6CA 2Y0SA 3OL3A 5JHFA 4KORA 1W36D 4B5PA 2LH9A 2ZFUA 3OYDA 2OB0A 4UCNA 1NG6A 2HQAA 2ZSHB 3DWLE 3PNVA 2X1EA 2F5IA 2DT7B 3T90A 4ZTJA 3EFAA 2CV0A 3EUKL 2CNTA 2Z16A 3IUOA 3G8WA 1U0JA 3OYCA 4ITVA 4FETA 4KITB 2CW7A 4J01A 1SQHA 4KOWA 3OYFA 4B48A 1ZO0A 4KVOE 2JUGA 4L8AA 2GOXB 5JPHA 2F5VA 2XSJC 4P1WA 1I1DA 1BR4A 2JDCA 1WFXA 2E1MB 1YVOA 3D5LA 3K4BA 1UG0A 2CUZA 2OV7A 3H5AA 2WAEA 3K4KA 4CAXA 2CH0A 4UCMA 2YNCC 4F52A 4A2ZA 1Z7LA 1FMVA 2K3PA 2OZHA 3HG9A 4E7KA 2CV1A 5IX3A 3HUGB 3OYKA 2DCEA 5HNHA 2VI7A 3S8PA 3TBIA 2PSWA 4CUGA 1MJAA 1RO5A 2JDDA 4ZJZA 4XPLA 5BWAB 2L9SA 1S3ZA 2JVHA 3FKJA 4XOTA 2WY7Q 2X6WA 4QBJA 3H5RA 2CXAA 4AYBA 2IGMA 2VQGA 3W2WA 2CV2A 2R8VA 3AL0C 3IU2A 3ZXSA 4CA0A 3EUAA 1X4OA 2VJ4A 2X1DA 4I49A 3LODA 1KUXA 2VXDA 4Y49B 4ZYAA 5CQEA 2FIWA 2DOAA 4BJ5C 2Q2EB 3CZ6A 2I79A 3EXNA 4UFXA 4PK4A 3DU6A 1QHGA 4ZC3A 2PC1A 4MFKA 4NSQA 1OR7C 4K30A 4BQQA 4ORFA 4B44A 4CCJA 1W36C 2LY1A 3K9UA 3S6KA 3VYTB 1X1DA 2FUG2 2LRDA 1N78A 2IS4A 2L5QA 1WWZA 1BOBA 2IL4A 3EC4A 5G22A 3A4CA 4CAFA 4A31A 2JEVA 1AA7A 1Y7RA 2DPTA 4F91B 3EUHC 4YELA 2CS3A 3TMOA 4D9JA 4DJAA 4QPQA 2HV2A 3OYLA 2VBQA 3IU1A 3R1KA 2BVMA 2KHMA 1QSTA 4FASD 2QKMB 2Q44A 1MMDA 4OAZA 4YEJA 2XC7A 4B14A 2G3AA 2ZPAA 5FVJA 3OS2A 4II9A 4XONA 3SDBA 4B5PB 3VWBA 1QSOA 4MFJA 2ELJA 3DLAA 1N77A 4GRIA 2Z10A 3TOBA 4HNTA 2YNEA 1DP3A 5LFAA 1XMTA 4CAEA 4AG7A 3OS1A 2CNSA 4MBUA 4CGLA 1M4GA 4CYPA 3JVNA 3TTHA 3WR7A 2VIXA 4PV6A 2BEIA 3KEYA 3S32A 4H4KC 1S7LA 2ZXVA 1LDKB 4MFQA 2VB6A 2HPIA 3SYTA 4C7HA 4UFWA 2VJ5A 3FBNB 1WJ5A 4F6AA 2PDOA 3OWCA 4X5KA 1Z3XA 4KOSA 4XPDC 5A27A 2R7RA 2GE3A 3S6FA 3K4LA 4B11A 2W00A 5KTCA 4HKFA 3FBIB 4XL9A 4LITA 2FL4A 2YGWA 5I0CA 3TE4A 5AG6A 4XKCA 1D1BA 3HOTA 2R7UA 4AVZA 2HPMA 4X0GA 5CQGA 3BJ7A 2JVGA 3BC8A 2VKHA 3HKZA 2VZYA 3VSLA 4ZDPA 4CRYB 4ZTFA 3L2UA 4U87A 1PJRA 3R95A 2X1CA 4EATA 3OMYA 3ZJ0A 2IXSA 3K4JA 2DXQA 3CJRB 1BO4A 3H35A 4H89A 1L0CA 4RM2A 3IWGA 3K70D 2WBMA 4XNHB 4A30A 2F4IA 3K70C 1MMGA 2LG4A 2VQHA 3FYNA 5E96A 3NWTA 5F48A 4LIVA 1TT0A 1S5KA 2OH1A 4DBQA 3DKYA 1TIQA 3DR6A 5LD2C 2M0MA 4KSAA 3M8JA 1FMWA 3OR2C 2R7WA 2B58A 2IS1A 5KTAA 4U9YA 2Q4VA 4BEHA 4R3KA 1FY7A 4HRIA 4KUAA 5AG7A 3AL0B 2X7BA 3OS0A 4C2YA 4JD6A 4CYNA 4NUBA 2Z3KA 4XLFA 4RI1A 5EBVA 2J8MA 1DQUA 4R9MA 4YGOA 4AVBA 3V42A 3OYGA 1JI8A 1SFKA 3BCAA 1NSLA 4R3LA 5HH1A 4M85A 3QYFA 2MFZA 2W1OA 3HXLA 2MC4A 3J7AY 2VL8A 1V5GA 2Q4YA 5IB0A 5HLTA 1YE9A 4CGOA 2WY8Q 2IGNA 4II3A 3ZRGA 4CRZB 2JA2A 4XNFA 3M1CA 2WB1A 2PJRB 3IWEA 3CXSA 4JXQA 1UELB 2Z0ZA 3D5RC 1P0HA 3GY9A 5C82A 2L9NA 2QKLB 2MABA 3KYLA 2LREA 2YNDA 4C7IA 2Z2SB 3TL4X 3W6SA 1WJFA 2QECA 3PGPA 3MMYB 4XN3A 1S7NA 4U5YA 1SAUA 1WJDA 2HQYA 4BL0B 3F5BA 3N05A 3DTIA 4IQJA 2AE6A 4QVTA 3SEZA 3CMMA 2X51A 1TZLA 4BUPA 4CSWA 1PUAA 3HPHA 5FROA 2B4DB 3C2GA 4D1QA 2Y0MA 3RCOA 4Q36A 3QAHA 4XKWA 2K9MA 2OZGA 4XLHA 3DDDA 3P2FA 4MHDA 2JLMA 2RREA 4B3XA 3H9JA 4JOMA 2KZVA 1LRZA 4A33A 4KUBA 5F49A 2VJIA 1GHEA 2PQ8A 3E1SA 1MK4A 2REFA 2NMTA 2VQYA 3OY9A 2LBFA 2WAFA 3BJ8A 4BS9A 4PJNA 1Q2YA 1Y56A 2KDOA 2V4JC 4RM3A 4BJTA 2D4PA 4C2TA 1XIXA 3A9LA 3B8GA 4M3SA 3SXNA 4RMNA 2RC4A 4CGNA 2X6XA 4AVCA 1MNDA 2Z3OA 3EY5A 4DOZA 2OC6A 4P5OA 2HVRA 4XQFA 1N71A 2BL1A 4BBHA 1NE9A 4BQOA 1S9HA 1YR0A 4LUAA 4IQ4A 3D5SC 3CP8A 2A4NA 4IKFA 3H9GA 4N4NB 3ONQA 5HOOA 4BE0A 2QMLA 1DGRM 3CJQB 4PFPA 3L2VA 1QHHD 4BEHB 4F93B 3D8PA 2UUZA 1R6RA 2X6YA 4CH7A 2R98A 4KVXA 4CS0B 3LSHA 5CPRB 2XAUA 2IS2A 1CJWA 4Y33A 4YFJA 4QPOA 4R79A 4C2UA 3OYBA 1ZELA 2FS5A 2FXFA 4KOYA 2VJJA 1VKCA 3ZCOA 2CNMA 3IGRA 2A5WA 3PZJA 4XNHC 5FRMA 4IUSA 3FNCA 2VASA 2V1NA 1WJEA 3CXQA 3F9KA 3OYEA 3MKYB 3OYNA 2B4BA 2J8RA 3JTKA 3BLYA 2WA0A 4DGWB 4FD6A 4XLEA 3PNYA 4KZTA 4ZGYB 2B3VA 5CKTA 2V6EA 4AU7A 4N4OB 3LSIA 2R1IA 2MD0A 4OAEA 5J8FA 3H5NA 3TFYA 1X1BA 1IRXA 1VZ0A 2L2OA 2CY2A 4HNWB 4HNYB 4NC7A 4KJZA 3VDXA 4PK3A 3EPZA 3SZGA 4A32A 1OLTA 1G8XA 1PYVA 2P6EA 2W7NA 3TO6A 5AG5A 1R57A 3HPGA 4CCKA 2DXIA 3FXTA 2BW3B 1MJ9A 3DKXA 2B4DA 4CAVA 4AVAA 1KONA 1IYKA 4E4HA 2QIRA 4NC8A 4KOVA 2B3UA 3LD2A 2HUZA 2R7XA 3ZR8X 3FB3A 4PJMA 3BLNA 4E2AA 2R7QA 1RXTA 5AGEA 1J09A 1K6YA 2BVLA 2CFOA 4RLFA 3UR3C 3F0AA 5KTDA 2I00A 3W91A 2VXZA 2DT6A 3SEQA 2WAQA 4BU2A 4KVME 5DWNA 1CM0A 2ZW5A 3GYAA 4JJXA 1P9QC 2O28A 4MJ8A 4OAYA 2MYSA 3IP4B 3R9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C26 A;  4NXY A;  4YRH A;  1IID A;  1WK4 A;  1YRE A;  2Z11 A;  2Q04 A;  4R87 A;  4U9Z A;  1J4J A;  2B5G B;  1YX0 A;  3VWD A;  3FRM A;  2ZW7 A;  3TCV A;  3D3S A;  3W6X A;  4RS2 A;  3SXO A;  4QB9 A;  4F0Y A;  4CAW A;  3N7Z A;  4E0A A;  1Q2D A;  4IF5 A;  1QSM A;  2OU2 A;  4Y49 C;  4OAD A;  1IYL A;  4HNX B;  1M4D A;  3EO4 A;  1P4N A;  1MJB A;  2VEZ A;  4L89 A;  2GIV A;  4FD7 A;  3SHP A;  4AG9 A;  1S60 A;  3MGD A;  3UY5 A;  1V0C A;  3QB8 A;  2PR8 A;  1KUV A;  1M4I A;  1XF8 A;  5J8C A;  3PP9 A;  4BMH A;  1YVK A;  1B6B A;  4KOX A;  1U6M A;  3TO9 A;  3H4Q A;  1XEB A;  3JUW A;  2ZW4 A;  2FE7 A;  4XPD B;  3F8K A;  2ATR A;  2EVN A;  5CNP A;  1YGH A;  4J3G A;  5ISV A;  2J8N A;  3R9E A;  2G3T A;  2VXK A;  4MY3 A;  2ZW6 A;  1Z9U A;  2FCK A;  1QSR A;  2FSR A;  3I3G A;  1I21 A;  1YLE A;  5F47 A;  4XPK A;  4NEX A;  4KLW A;  2R7H A;  3GKR A;  1Z4E A;  4QC6 A;  4MY0 A;  2G0B A;  2P6F A;  3V8I A;  5C88 A;  5DWM A;  4FD4 A;  3DSB A;  4MI4 A;  1YK3 A;  2PRB A;  4UWJ A;  4GS4 A;  4EVY A;  1K4J A;  4PK2 A;  3ZZI A;  2PR1 A;  3I9S A;  3E0K A;  1M44 A;  1VHS A;  2OZU A;  2P6G A;  3CXP A;  1Y9W A;  2EUI A;  3FBU A;  4E8O A;  4UBR A;  3D2P A;  3R9G A;  4NF1 A;  1QSN A;  2REE A;  3D2M A;  3DR8 A;  5H86 A;  4PSW A;  5EC4 A;  1XE4 A;  3TOA A;  1IIC A;  1KUY A;  4AB7 A;  5F46 A;  2D4O A;  3G3S A;  2GAN A;  4F6A A;  2Q0Y A;  2WPW A;  3NE7 A;  4ONU A;  5C82 A;  4H6U A;  3VWE A;  2FIA A;  2FT0 A;  2VZZ A;  4JWP A;  4H6Z A;  4ZBG A;  2BSW A;  5JQ4 A;  1S7F A;  3KKW A;  1Z4R A;  4B5O A;  4QUS A;  1B87 A;  3FIX A;  3S6H A;  2P0W A;  4JLY A;  4R57 A;  1NMT A;  1KZF A;  4KOT A;  3T9Y A;  1OZP A;  4OLL A;  1Q2C A;  3S6G A;  1Y9K A;  4LX9 A;  1ON0 A;  1UFH A;  3TT2 A;  2K5T A;  2B5G A;  1IB1 E;  4KLV A;  4UWI A;  1S7K A;  2Q7B A;  2BUE A;  1I12 A;  4KOU A;  4FD5 A;  4UA3 A;  3DNS A;  2C27 A;  2H5M A;  2ARH A;  1M1D A;  1PU9 A;  2WPX A;  4PSX A;  2AJ6 A;  5GCN A;  2KCW A;  3P2H A;  3RYO A;  4JXR A;  4DNC A;  4KOR A;  4B5P A;  2OB0 A;  3T90 A;  2F5I A;  3EFA A;  2CNT A;  3G8W A;  1SQH A;  4KVO E;  4KOW A;  4L8A A;  5JPH A;  1I1D A;  2JDC A;  1YVO A;  4CAX A;  2OZH A;  5IX3 A;  2VI7 A;  1MJA A;  1RO5 A;  2JDD A;  4XPL A;  1S3Z A;  4QBJ A;  2R8V A;  4I49 A;  3LOD A;  1KUX A;  4Y49 B;  2FIW A;  2I79 A;  3EXN A;  5IV0 A;  2PC1 A;  4NSQ A;  4K30 A;  4ORF A;  3K9U A;  3S6K A;  2PSW A;  1WWZ A;  2IL4 A;  1BOB A;  3EC4 A;  2JEV A;  1Y7R A;  5H84 A;  2HV2 A;  2VBQ A;  5HMN A;  3R1K A;  1QST A;  2Q44 A;  2G3A A;  5FVJ A;  4II9 A;  4B5P B;  1QSO A;  2Z10 A;  3TOB A;  1XMT A;  4AG7 A;  2CNS A;  4MBU A;  1M4G A;  3JVN A;  3TTH A;  3WR7 A;  4PV6 A;  2BEI A;  2ZXV A;  4NCZ A;  1S7L A;  2PDO A;  3OWC A;  4X5K A;  4XPD C;  4KOS A;  2GE3 A;  3S6F A;  5KTC A;  4HKF A;  2FL4 A;  5I0C A;  3TE4 A;  3BJ7 A;  2VZY A;  4CRY B;  3R95 A;  3ZJ0 A;  2DXQ A;  1BO4 A;  4H89 A;  1L0C A;  3IWG A;  4XNH B;  5F48 A;  3FYN A;  3R96 A;  2OH1 A;  1S5K A;  3DR6 A;  1TIQ A;  2B58 A;  5KTA A;  4U9Y A;  2Q4V A;  4R3K A;  1FY7 A;  4KUA A;  2X7B A;  4JD6 A;  4RI1 A;  5EBV A;  2J8M A;  4R9M A;  4YGO A;  4AVB A;  1NSL A;  4R3L A;  5HH1 A;  4M85 A;  2Q4Y A;  5IB0 A;  4CRZ B;  3CXS A;  4JXQ A;  2Z0Z A;  1P0H A;  3GY9 A;  3W6S A;  2QEC A;  3PGP A;  1S7N A;  4U5Y A;  2HQY A;  3F5B A;  2AE6 A;  4QVT A;  1PUA A;  2Y0M A;  2B4D B;  5E96 A;  3TO7 A;  3QAH A;  2OZG A;  3DDD A;  3P2F A;  4MHD A;  2JLM A;  1LRZ A;  4KUB A;  5F49 A;  1GHE A;  2PQ8 A;  1MK4 A;  2REF A;  2NMT A;  2VQY A;  3BJ8 A;  1Q2Y A;  3W91 A;  3SXN A;  3B8G A;  2D4P A;  1XIX A;  4M3S A;  2RC4 A;  4AVC A;  3EY5 A;  1N71 A;  2BL1 A;  1NE9 A;  1YR0 A;  4LUA A;  2A4N A;  2QML A;  3D8P A;  2R98 A;  4KVX A;  4CS0 B;  1CJW A;  4YFJ A;  2FS5 A;  2FXF A;  4KOY A;  1VKC A;  3PZJ A;  2CNM A;  3IGR A;  4XNH C;  4IUS A;  3FNC A;  3CXQ A;  2B4B A;  2J8R A;  4FD6 A;  4KZT A;  2B3V A;  2R1I A;  4OAE A;  5J8F A;  3TFY A;  4HNW B;  2CY2 A;  4HNY B;  4PK3 A;  2P6E A;  3TO6 A;  1R57 A;  3FXT A;  1MJ9 A;  2B4D A;  4CAV A;  4AVA A;  1IYK A;  2QIR A;  4KOV A;  2B3U A;  3LD2 A;  2HUZ A;  3FB3 A;  3BLN A;  4E2A A;  1RXT A;  3F0A A;  5KTD A;  2I00 A;  4KVM E;  5DWN A;  1CM0 A;  4MJ8 A;  2ZW5 A;  3GYA A;  4JJX A;  2O28 A;  3R9F A;  2ZPA A; 
#chains in the Genus database with same CATH topology
 2ZXI A;  5EDN A;  3C26 A;  4YRH A;  4BJ6 C;  5FB2 A;  3RPQ A;  3JTG A;  3VYR B;  1KWM A;  1BN5 A;  4HSR A;  4BDZ A;  1IZ1 A;  5E8G A;  1RRJ A;  3B3S A;  4A3D J;  3DXJ F;  1F43 A;  4MHG A;  4BE1 A;  1SAX A;  2IA0 A;  2A69 F;  2XB0 X;  1BPN A;  1YX0 A;  2ZEO A;  2Y69 H;  4KN4 X;  4RS2 A;  4S0H B;  1JKR C;  3C2H A;  4UCP A;  3SXO A;  3VAT A;  1ETY A;  1AWC A;  3LL7 A;  2XPV A;  4CAW A;  3VYS B;  1Q2D A;  3T0Y A;  2H1K A;  4L5E A;  4IF5 A;  4UIB A;  2CRG A;  2OU2 A;  2DF5 A;  5HLH A;  1TQP A;  2IW5 A;  1YX5 A;  4CGZ A;  3LAP A;  3KL9 A;  5JGF A;  3OYJ A;  3I1U A;  1M4D A;  1TWF J;  1LVK A;  2M3A A;  2OA4 A;  1P4N A;  4HLX A;  3M9A A;  1U8B A;  1ZR4 A;  5DS0 A;  5F1R A;  3JRD A;  4U7D A;  1WSU A;  2EFW A;  2V1U A;  1H9T A;  2WZN A;  1IN7 A;  2XPW A;  3OV8 A;  4E7I A;  1YS6 A;  3KEQ A;  1U5T B;  2YU3 A;  3F8B A;  2IGO A;  2V7F A;  4LJZ F;  3LSG A;  3WG9 A;  3H0D A;  4ZZD A;  4UVB A;  1VHO A;  1YLO A;  4A30 A;  4A3E J;  2VQC A;  3SZP A;  5E20 A;  2DQR A;  2E34 A;  4FE4 A;  3V4G A;  3X2Q H;  4PUS A;  1RNL A;  3E6M A;  3FM3 A;  3A01 A;  1VQ4 I;  2DPS A;  2NYX A;  5ICF A;  2K9L A;  3SFI A;  1S29 A;  5TRD A;  1BIB A;  1WVR A;  2PR8 A;  1ZR2 A;  2M34 A;  4MFL A;  2L7F P;  3PP9 A;  1W5T A;  5JI6 A;  5KAI C;  1BIA A;  3CJN A;  3R60 A;  3F6O A;  2LSO A;  3Q3S A;  2A6T A;  5DTD A;  3WG7 H;  5HMN A;  3DGV A;  1XEB A;  2VBZ A;  4A3B J;  3FVL A;  1BJA A;  3I4P A;  3OL4 A;  1XDU A;  4C2Z A;  4E7S A;  1FYM A;  3JUW A;  3ABU A;  3G1M A;  4U0V A;  3RSN A;  4JX4 A;  3J81 Z;  3MWM A;  4Y4R A;  3S93 A;  2FE7 A;  3LFU A;  5EG0 B;  3F8K A;  3R61 A;  3MN8 A;  1K4S A;  2EVN A;  1I3A A;  3CJT B;  3DTK A;  1WQ2 A;  5CNP A;  4MQV A;  1X4P A;  3EYI A;  1T6S A;  3PO3 J;  3NH5 A;  4OIW A;  4MRI A;  1FC3 A;  4ESF A;  2QQB A;  5LRS A;  3OYI A;  4AID A;  3KIO A;  3IAS 2;  3TDU C;  4F92 B;  2G3T A;  2VXK A;  2ZW6 A;  1LJ9 A;  2COM A;  2G7H A;  3FK6 A;  4B1R A;  3ERM A;  3I3G A;  4E7Z A;  1IGB A;  1YLE A;  4PPZ A;  1ZG3 A;  1EA3 A;  3ECO A;  4JQF A;  4NNJ A;  5ELY A;  2EH3 A;  3OR1 C;  3ECH A;  5TGT A;  4J00 A;  5E79 C;  1ZK8 A;  1GLN A;  5BOX A;  1MNM C;  2BOL A;  3IWW A;  2L54 A;  1U78 A;  2OOT A;  1N25 A;  3GKR A;  4QC6 A;  4PZJ A;  2G0B A;  3RKX A;  2QSH X;  4IHY A;  2L7K A;  4XN0 A;  5GPA A;  4IPA A;  5H6R A;  5AON A;  5IOY A;  2GM4 A;  4KS9 A;  5K5Q A;  1GHC A;  4A3K J;  2PRB A;  3HTU A;  4DUK A;  2XSD C;  3S3M A;  4PK2 A;  1OFC X;  3JAM K;  3PB6 X;  4OWR B;  3I9S A;  3E0K A;  2NVQ J;  2LMD A;  2OF7 A;  1ELM P;  1LUJ B;  1R7J A;  3HOX J;  1QQI A;  2P6G A;  4XKV A;  3CXP A;  3PM1 A;  5CVJ A;  5E1W A;  2E5N A;  3V7S A;  1B8I B;  2STT A;  2KMU A;  3ABM H;  3E6D A;  1HDU A;  4EVI A;  5G20 A;  2WTE A;  1S72 I;  4UEF A;  1XC5 A;  2HVQ A;  4YRV A;  4JX5 A;  2CTC A;  1NH3 A;  1OCP A;  3AG4 H;  4ENJ A;  3D2P A;  4LLN A;  2BY0 A;  1ZKG A;  4UXN A;  1WRJ A;  2DDA A;  3H3Z A;  1WCM J;  4RB2 C;  3DR8 A;  2VQL A;  4HF1 A;  3DP7 A;  4NQW B;  5DM6 F;  1RIO H;  1X19 A;  3TOA A;  4CCN A;  1AMP A;  1WHU A;  1SVO A;  5EZH A;  1G6N A;  1N75 A;  3SDG A;  3ZQF A;  3L2R A;  1HOM A;  2Z3M A;  5G1Z A;  3TW6 A;  2W25 A;  3TW7 A;  2NS8 A;  3CDH A;  3GFM A;  1TKJ A;  1YLF A;  1LNW A;  1LDD A;  1P4X A;  5D6E A;  2VT2 A;  4WWV A;  1Y6I A;  2LD5 A;  3DPU A;  1MMA A;  2P5K A;  3CLO A;  4KMU X;  2HVS A;  3OIP A;  4I98 B;  3I64 A;  1V3F A;  4A6E A;  1HA8 A;  4HNU A;  1HKT A;  4HV5 A;  5J4Y A;  1RUO A;  3WE2 A;  4IZZ A;  2Q0Y A;  4XSZ F;  3WTW C;  4BGD A;  4RB1 A;  3A03 A;  2Y0S N;  2FT0 A;  4JWP A;  3BCB A;  3ERE D;  2KRH A;  3VYU B;  1X10 A;  2DFH A;  4CCM A;  1IC8 A;  4UV8 A;  4FQG A;  3QQA A;  2CGP A;  2BSW A;  5C3E J;  5JQ4 A;  1Z5R A;  5C44 J;  5EGO B;  5M5X J;  2TCT A;  3BDD A;  4A3G J;  3GZ5 A;  3B35 A;  4B5O A;  4QUS A;  5D5U B;  4BY1 J;  1X3W B;  2YUS A;  2H09 A;  3FIX A;  2XF5 A;  2E71 A;  1EF4 A;  4IK2 A;  2CQX A;  4M74 A;  5JH9 A;  2V1X A;  4BXF A;  1DP7 P;  1IRF A;  2V8D A;  4A3F J;  3T9Y A;  2XGC A;  3GYH X;  3RYR A;  1VQL I;  2V26 A;  3TT2 A;  1UFH A;  1OCZ H;  5L3F A;  5E3N A;  4HLY A;  2R7D A;  4NC6 A;  3S9N A;  2V1D A;  1BL0 A;  2QA4 I;  4XOP A;  4UB6 C;  4OC1 A;  3WGI A;  2L0K A;  9ANT A;  1Y0U A;  3CME I;  1XBU A;  2JBK A;  5EJC A;  3D0S A;  3KP5 A;  4B43 A;  2ARH A;  4MFZ A;  3RKY A;  2HR3 A;  1PU9 A;  2WPX A;  2RFH A;  2VPR A;  4MFD A;  4MCS A;  2HDW A;  5GCN A;  2K7L A;  1U2W A;  5E1X A;  3SQN A;  4DNC A;  5KNL A;  4ZYQ A;  1OBR A;  4GGG A;  5HVH A;  5D8L B;  2IA1 A;  2LH9 A;  3OYD A;  1K83 J;  2HQA A;  3TQN A;  3DEU A;  2ANP A;  5F04 A;  2F5I A;  2Q4Z A;  2DT7 B;  5K8N A;  3G3Z A;  3HRU A;  5AIQ A;  4ZTJ A;  4IHT A;  1RTQ A;  2GLO A;  3KZZ A;  2ZEG A;  1U0J A;  1SQH A;  4J01 A;  4CIC A;  1SD4 A;  2BCO A;  4B48 A;  2K4B A;  3BQY A;  1ON2 A;  2GOX B;  2F2E A;  2XEI A;  2XSJ C;  2MW8 A;  4EJW A;  3A01 B;  5HS8 A;  1XGS A;  1YVO A;  2PE3 A;  3JRH A;  2FRH A;  2ISY A;  3K4B A;  1HSJ A;  1USS A;  3AG1 H;  3HSF A;  2NVT J;  4NGR A;  2A5Y B;  4AWX B;  4A2Z A;  2K3P A;  3M7G A;  2JA5 J;  3BXM A;  4NBQ A;  2Y75 A;  3LSP A;  4WJB A;  4CUG A;  2JDD A;  2CF4 A;  3IU2 A;  3AL0 C;  1T98 A;  3ZXS A;  4S05 A;  2XKO A;  2VJ4 A;  2X1D A;  5EG0 A;  4BXU A;  4JX6 A;  1ZAO A;  2K85 A;  1IG7 A;  5IV0 A;  1YOV B;  4BJ5 C;  3GTO J;  4PK4 A;  3REO A;  1QHG A;  1GT0 C;  2MG4 A;  2VOO A;  2OQG A;  1XGO A;  4MIM A;  2XRO A;  1IF1 A;  1HF0 A;  2LRD A;  3K1P A;  5LHH A;  2L5Q A;  1E3P A;  4CAF A;  2DMP A;  2X9D A;  3RZA A;  1UB9 A;  3ISZ A;  2WAQ N;  3P9C A;  3EUH C;  4M3B A;  2CS3 A;  2HTS A;  3BZK A;  3TMO A;  4QPQ A;  3MAJ A;  4CYD A;  3WTS C;  2R5Y B;  3V8L A;  1QST A;  1D3Y A;  3Q0V A;  4GM5 A;  2G3A A;  5DM7 F;  2ZPA A;  2NNN A;  5H20 A;  4B5P B;  2ELJ A;  1LVA A;  3QWL A;  2BZT A;  1N77 A;  4Y52 J;  4HNT A;  5HVF A;  1XFO A;  2MH2 A;  4CAE A;  4AG7 A;  1X3U A;  3OS1 A;  5HXD A;  4CGL A;  4CYP A;  4I01 A;  4ZY2 A;  3HRS A;  2VIX A;  1TW2 A;  4PV6 A;  2HQR A;  4KIF A;  3KE2 A;  2MH9 A;  4BHB A;  1TXR A;  1W7P A;  2ZXV A;  3RQI A;  1LDK B;  3ZQG A;  1VQ6 I;  2HPI A;  2WV1 A;  2ZBK A;  3MRU A;  2E1O A;  1Z8W A;  4KIG A;  3ZN1 A;  4F6A A;  2PDO A;  3CXQ A;  3F3X A;  1Z3X A;  1DUX C;  2EIK H;  4HBL A;  2R7R A;  2GE3 A;  3BI1 A;  4YU9 A;  1UWY A;  4HKF A;  1CX8 A;  1ON1 A;  1Q7L A;  4LIT A;  2GAU A;  3H3U A;  2Q8K A;  5I0C A;  3TE4 A;  1JUP A;  2ZEM A;  5AG6 A;  4E70 A;  1XMA A;  3GFJ A;  3HUG A;  1IV8 A;  2KIQ A;  4AVZ A;  3HOT A;  2I3C A;  4FHT A;  3BOQ A;  3HKZ A;  3CLQ A;  3U9G A;  3RKQ A;  1MH4 A;  3V7Z A;  3L2U A;  1YYV A;  1PJR A;  3V38 A;  3FMR A;  3OMY A;  4ETS A;  1JTX A;  1VQN I;  3H35 A;  3JR9 A;  3S16 J;  4HAM A;  3KYD B;  4GYI A;  5LGN A;  4MCP A;  1POG A;  4IHS A;  4Q5S F;  3HSE A;  4XNH B;  3BR2 A;  2F4I A;  2M45 A;  2LG4 A;  1W4M A;  1MMG A;  2IBD A;  2EA2 A;  2VQH A;  3FX3 A;  4AIJ A;  2OH1 A;  4Z65 A;  3CTA A;  2E2J J;  5LD2 C;  1CPS A;  3MKL A;  2M0M A;  5J1Y A;  4MNU A;  4EGZ A;  2M2E A;  3M8J A;  8CPA A;  2PMH A;  4YFK F;  3GFI A;  1AYE A;  2R7W A;  2WC2 A;  4RDU A;  2L3D A;  2E36 A;  2B58 A;  4RB0 A;  3IH3 A;  1FY7 A;  5JR3 A;  1X2M A;  2HKX A;  3M1E A;  5FKO A;  3EUH A;  1IUF A;  1YG2 A;  1TNT A;  4YGO A;  1O4X A;  4AVB A;  1BC7 C;  1JI8 A;  4WWC A;  4R3L A;  4M85 A;  2EIL H;  2MFZ A;  5LHG A;  4F9U A;  2BHY A;  2MC4 A;  3HXL A;  4I76 A;  5C4J J;  3KYC B;  2TRT A;  4II3 A;  2IGN A;  1ETW A;  3M1C A;  2PJR B;  3OIO A;  4IRH A;  2GZW A;  1K78 B;  1RR7 A;  1UEL B;  1G2H A;  5FLM J;  1YW4 A;  4H2K A;  4OC3 A;  4ZYD A;  5LRJ A;  3M8E A;  3KYL A;  2LRE A;  4N0B A;  2Z2S B;  1VQ9 I;  2A61 A;  3HRM A;  1B6A A;  1PVE A;  1AKH B;  2HEO A;  4A38 A;  1S8N A;  1HDQ A;  2NVX J;  2EZK A;  1MBH A;  3MMY B;  1SAU A;  1WJD A;  2QCO A;  1CPX A;  2HQY A;  3F5B A;  3OSG A;  3N05 A;  2POK A;  4NFR A;  2QVO A;  1Y39 A;  2AE6 A;  4X8I A;  3CCQ I;  2JRM A;  1I6H J;  4RA2 A;  3C2G A;  3FXK A;  4XKW A;  3P2F A;  4Y13 A;  3BWG A;  2Q0O A;  4JOM A;  5ICE A;  3IFE A;  1FOW A;  1IN5 A;  2REF A;  3E1S A;  2W48 A;  3BJ8 A;  2LR8 A;  1BBY A;  4H0E A;  4ZY0 A;  4P4F A;  1MBG A;  5JLW A;  3W91 A;  2EFO A;  3SXN A;  2D4P A;  1O7F A;  3GW2 A;  4RMN A;  2RC4 A;  1IO2 A;  1Z8T A;  1MND A;  1QRY A;  3EY5 A;  1PP8 F;  1L3L A;  2ZJP F;  2OC6 A;  1GVD A;  4HV6 A;  2HVR A;  4XQF A;  1N71 A;  1VI0 A;  4M6V A;  4BBH A;  3F8C A;  1NE9 A;  4BHP A;  3LAC A;  3L2C A;  1VQO I;  2EBI A;  2IJL A;  2ZO4 A;  2HXI A;  4I7H A;  2XAQ A;  2JT1 A;  4AD9 A;  2P81 A;  3H9G A;  3TDZ C;  1IU8 A;  2F5C A;  1XN7 A;  3DCF A;  3CJQ B;  2M5W A;  3KLO A;  2KZG A;  1JQG A;  3RI4 A;  3D8P A;  1VQ5 I;  2WB1 N;  1R6R A;  2I5U A;  1U5T C;  2XAU A;  2EIN H;  1BPM A;  4Y33 A;  1ZRC A;  4R79 A;  2IJZ A;  3OYB A;  4KOY A;  2PEX A;  1MH3 A;  3U1D A;  3ZCO A;  1XMB A;  4XNH C;  4IHX A;  4Z2Y A;  2XB5 A;  2DDB A;  5F6F A;  4QLC U;  2ACJ A;  3OYN A;  3BRO A;  1RKW A;  4G6D A;  5FFX A;  4R7M A;  3WAB A;  2WA0 A;  3GWZ A;  1YIT I;  3IEH A;  2ABZ A;  3J7A O;  2B3V A;  1TNS A;  1ZAR A;  4AU7 A;  3LSI A;  1IDZ A;  3KP2 A;  3M07 A;  2P5V A;  1Z67 A;  2D1V A;  4JYK A;  4EJO A;  1UG2 A;  4KJZ A;  3Q5F A;  3EPZ A;  2YX7 A;  5ILS A;  1OLT A;  4LK1 F;  1R9T J;  2HGC A;  1ZLK A;  2LF7 A;  2R7Z J;  1R57 A;  1MBF A;  3KQX A;  1A35 A;  4IL6 C;  3CO6 C;  3NH8 A;  1QQ9 A;  3SHF A;  1BA5 A;  1KON A;  1TWA J;  5LGU A;  4MCR A;  5E3O A;  4BKX A;  2STW A;  1XD7 A;  4I09 A;  4IO9 F;  4E2A A;  1RXT A;  2OJE D;  1ZYR F;  5AGE A;  1J09 A;  3GVA A;  3KZY A;  4Y15 A;  1B72 B;  1IRZ A;  3TP0 A;  1VIX A;  4NGS A;  2HQN A;  1M1E B;  3FMS A;  2DT6 A;  1QBJ A;  1CM0 A;  3KP6 A;  2R5Y A;  3CUO A;  1ZLH A;  1WKM A;  2DK5 A;  1S7A A;  1BM9 A;  4XLP F;  4IOA F;  3B3W A;  1NSA A;  2A6H F;  3B73 A;  4BHC A;  2Q04 A;  4R8H A;  1X58 A;  4R87 A;  1O3T A;  3R0J A;  3OYA A;  2KPM A;  3FK7 A;  3ZMU A;  4Q38 A;  3AG3 H;  2B5G B;  2NNY A;  1R23 A;  2PBI A;  1D1A A;  2ZOF A;  3KPH A;  3I4N J;  3BG7 A;  3FRM A;  2HZT A;  1KQ8 A;  3PIO F;  3LSK A;  2XRN A;  2ESH A;  2HOE A;  2P6S A;  3TCV A;  1CP6 A;  1IY7 A;  1G3Y A;  4QB9 A;  4F0Y A;  3I5U A;  3L00 A;  4L0Z B;  4PJJ A;  2WUU A;  4E7L A;  1SVL A;  2DMU A;  1BC8 C;  3C18 A;  3GTP J;  4UHT A;  3W6V A;  2DA4 A;  2E5Z A;  1JUS A;  1ZGA A;  3MVP A;  1W0T A;  2EIJ H;  3H1C A;  2UXX A;  2LF8 A;  3AFH A;  3S1R J;  1B9N A;  5ICG A;  1X12 A;  2ZED A;  2VKD A;  4L89 A;  2DJN A;  2DT5 A;  2FQ4 A;  5LRR A;  1DU0 A;  2GLJ A;  2QSG X;  2DFE A;  3JSP A;  4HYE A;  3SHP A;  4AG9 A;  3CDL A;  2AXL A;  3ZQL A;  2JUC A;  1V0C A;  3QB8 A;  3FEC A;  2JPC A;  2FBH A;  3BZ6 A;  4OOI A;  1M4I A;  1XF8 A;  4FE7 A;  3BR6 A;  3FXM A;  2X0L A;  1YVK A;  2C6G A;  4A94 A;  2VUM J;  1BI0 A;  1U6M A;  3B02 A;  2Y30 A;  3TO9 A;  3H4Q A;  4LQ6 A;  3QPL A;  1ETV A;  1G3S A;  2JRT A;  4G6T B;  1X3Z B;  1O57 A;  3IH4 A;  4IVN A;  4F9V A;  1W5S A;  3ISP A;  5F0F A;  3PIP F;  1SFU A;  4IX7 A;  3IJ3 A;  4RBO A;  2ZW4 A;  1IGN A;  4CYQ A;  4LB5 A;  2Z9O A;  2L4A A;  4HX8 A;  5IYB J;  2IMO A;  1V5F A;  3GEZ A;  1OCR H;  4PFO A;  1ZRE A;  3CCU I;  4WCG A;  4HF0 A;  1SD6 A;  3O3K A;  2XAJ A;  2KLO A;  2VOD A;  1OCC H;  3E3V A;  3IAM 2;  5EZG A;  2O6G E;  3PUB A;  1VQ7 I;  1OR7 A;  2F5D A;  4ZX9 A;  3GTL J;  2PJR A;  2HYG D;  2FOK A;  3R9E A;  1OCT C;  1YRN A;  2XAS A;  2H8R A;  2K40 A;  1HDP A;  3S17 J;  1IOF A;  3RTR A;  2FSR A;  3PFE A;  1I21 A;  5F1J A;  5L3D A;  1MDM A;  3O8G A;  5F47 A;  4EM2 A;  4XPK A;  1R43 A;  3K2A A;  3FED A;  4B10 A;  3S3N A;  2DYR H;  4NEX A;  1T0F A;  2CWE A;  3GLX A;  2CMP A;  1ZRF A;  3E97 A;  2AQE A;  1A6Q A;  1ETO A;  3KGQ A;  3NFZ A;  5C88 A;  3QP6 A;  5HVG A;  3I71 A;  1QU3 A;  4DIQ A;  1FT9 A;  4OME A;  1ZG5 A;  2O8X A;  4GXO A;  2NS0 A;  1U5T A;  5JVG F;  4FD4 A;  1F5T A;  1PDN C;  3DSB A;  1YK3 A;  1TW3 A;  3DQV C;  4BXX J;  5THW A;  1UZC A;  2O0Y A;  3GFL A;  5TIS C;  4V19 K;  3LQQ A;  4A95 A;  1K4J A;  2DA2 A;  3KR4 A;  4NGN A;  4P4J A;  1XOV A;  4BDY A;  3WC6 A;  2DA6 A;  2DOD A;  1BW5 A;  4M9S A;  5DD4 A;  3T5X A;  3RPU A;  2NXN B;  2OZU A;  4PGG A;  4CZC A;  1VHS A;  2ZEL A;  4DZJ A;  2ZFW A;  1CQT A;  4YIF A;  1D0X A;  5ERI A;  1Y9W A;  3QAY A;  3O2P E;  1E2X A;  2GIZ A;  3H92 A;  1O3Q A;  1VQP I;  3HTS B;  1S3J A;  2DA7 A;  1OYI A;  2FSW A;  1XTA A;  3D1N I;  3JCU C;  4XR6 A;  2G9W A;  1XGN A;  4UBR A;  2IS6 A;  1QSN A;  4NF1 A;  3V7C A;  2JEW A;  3CF2 A;  4GO1 A;  2M7B A;  3FIS A;  3FMQ A;  3I3L A;  4PSW A;  5FD6 A;  3GIU A;  2VOP A;  5EC4 A;  3Q9S A;  1XE4 A;  4AXV A;  1SEU A;  2YNC A;  2ZSI B;  2XRL A;  3WHB A;  1KUY A;  4EME A;  3E5U A;  3HEF A;  1G59 A;  4KIC A;  1E17 A;  3LSM A;  3K2K A;  3LQR A;  2EFP A;  5K8M A;  2KQR A;  3VSK A;  1Z7U A;  2GAN A;  3LWF A;  1X1C A;  3CCY A;  3H5Z A;  2COB A;  1JTY A;  3NE7 A;  2HB6 A;  4ONU A;  1YW9 A;  4IOC F;  4CCL A;  2PIZ A;  4H6U A;  4CGM A;  3VFZ A;  2VZZ A;  2ZME A;  3MN2 A;  4LD5 A;  3K4N A;  5J1R A;  1SVM A;  4M3D A;  4JZ0 A;  2M8E A;  2M4G A;  3KEO A;  4LG3 A;  1W0U A;  4HST A;  1J75 A;  4ANJ A;  3WU2 C;  4CGP A;  4CZZ A;  4XRS G;  2EK8 A;  2PJA A;  2CIJ A;  2DBB A;  4OIN F;  3PQJ A;  2EFN A;  4B12 A;  3BG5 A;  4RAZ A;  4OC4 A;  3S6H A;  3UNG C;  5B66 C;  2P0W A;  4XOR A;  3P5J A;  3SI1 A;  3NQO A;  2MGQ A;  1Z21 A;  2NOG A;  4JLY A;  4IHM A;  3IRQ A;  5JM6 A;  1NMT A;  4D7M A;  1IW7 F;  3B6C A;  3WGH A;  3S2H J;  4P9U A;  2PJ6 A;  2LOO A;  5J4V A;  5M3F J;  4FTH A;  3W6K B;  3TGN A;  3N97 A;  1Y9K A;  4XM3 A;  2Y2Z A;  2PMZ A;  2K5T A;  5DEQ A;  2B5G A;  3K9T A;  4UWI A;  1ACI A;  3GTM J;  1S7K A;  2Q7B A;  2UWM A;  2DOF A;  1TQM A;  3DLL F;  4E7H A;  3HJE A;  2QVP A;  2R7S A;  1NG7 A;  4XIC A;  2DAO A;  3LA2 A;  1BLL E;  2F48 A;  4G94 A;  2H5M A;  3I53 A;  2KP6 A;  1M1D A;  2Z1D A;  3KZW A;  5I4M A;  2AJ6 A;  4M6X A;  3WTX C;  1HLV A;  2Z3L A;  2EZL A;  3P2H A;  3ZQ7 A;  2R0Q C;  3S1Q J;  2CYY A;  1F2O A;  2HQ5 A;  2X48 A;  2G9D A;  4NJR A;  1FT7 A;  3OL3 A;  1WZ2 A;  4LG0 B;  5FLX K;  1Y0Y A;  2V8V A;  4HX4 A;  2B7E A;  3PNV A;  1LDJ A;  3F21 A;  3KP7 A;  1YFH A;  1KYZ A;  1Y8Q B;  1R4M B;  3IUO A;  1D8K A;  2PJ2 A;  5FKK A;  3OYC A;  2YR2 A;  4KIT B;  2CW7 A;  4KVO E;  2VC1 A;  5LBQ A;  1XRY A;  1ZO0 A;  2EK9 A;  4MXU A;  4L8A A;  1FZP B;  3B3C A;  2EV6 A;  1T8I A;  2F5V A;  1P7J A;  2MBF A;  4ENN A;  3PB4 X;  4A3L J;  4GXH A;  4X2T A;  5F64 A;  4IJA A;  1F57 A;  2E1M B;  2PJC A;  3RZD J;  3HB9 A;  1H89 C;  1UG0 A;  2OV7 A;  2WAE A;  3K4K A;  2KIF A;  1IJW C;  2CH0 A;  4UCM A;  1F36 A;  2YX4 A;  1A31 A;  1JGG A;  4F52 A;  2YNC C;  2XEJ A;  5M5W J;  3L9F A;  1J2X A;  5IOZ A;  5EGO A;  5LYD A;  1RES A;  4E7K A;  1R5H A;  5CVV A;  4BYY A;  3TBI A;  2D45 A;  2VI7 A;  1I27 A;  2BXZ A;  1NK3 P;  1RO5 A;  3GF2 A;  5K8P A;  4ZJZ A;  5BWA B;  1S3Z A;  4XOT A;  2LFB A;  1ZTR A;  2E1N A;  2CV2 A;  3EYY A;  3W2W A;  1WWX A;  2RDP A;  3MZH A;  4U0Y A;  3EUA A;  1X4O A;  2L9R A;  1QZE A;  1U9O A;  4A0Z A;  2V9V A;  2M9H A;  1GYT A;  1KUX A;  1J59 A;  2QYO A;  1RI7 A;  2I79 A;  2DOA A;  2AFW A;  4N9H A;  4UFX A;  2PC1 A;  3GO5 A;  4ZC3 A;  5LYL A;  4KA4 A;  3CUQ A;  3V8K A;  2IPQ X;  3DLJ A;  1QMU A;  4O6J A;  4B44 A;  1R71 A;  4CCJ A;  4A3M J;  3VYT B;  2TDX A;  3BJA A;  2IS4 A;  3EC4 A;  3H36 A;  3A4C A;  1LAM A;  4A31 A;  4AYB N;  2HOA A;  1MDM B;  2JEV A;  1Y7R A;  4RGU A;  2QF7 A;  1Z9C A;  3IU1 A;  4A69 C;  2VBX A;  3OYL A;  3FKI J;  2BVM A;  3R1K A;  1UJ8 A;  4PJ0 C;  4FAS D;  3G71 I;  1MMD A;  3F8N A;  2QJ8 A;  4U88 A;  2NYQ A;  2FXA A;  5LYI A;  4B14 A;  3BR5 A;  4II9 A;  2E35 A;  2EPF A;  2HXO A;  3SDB A;  1QSO A;  3KCC A;  3KHX A;  4GRI A;  3TOB A;  2QQ9 A;  4BBS J;  3HHH A;  5LFA A;  1FYL A;  1FNO A;  1STZ A;  2D1H A;  2DTZ A;  3JVN A;  3WR7 A;  5EYR A;  2K3F A;  3ABT A;  4NCZ A;  1R5I D;  4H4K C;  1JKQ C;  1S7L A;  3KR5 A;  4MFQ A;  3T1B A;  3WE3 A;  2PMZ N;  3FF3 A;  1ULY A;  5L3B A;  3Q0W A;  3OWC A;  5A27 A;  4KOS A;  1IUY A;  2XEF A;  1WI3 A;  1KGS A;  2BOA A;  4XL9 A;  1JUM A;  2IP2 A;  2JMW A;  2QSF X;  1G4D A;  3HOU J;  2YGW A;  4HNV A;  3CT9 A;  3R6S A;  3CPX A;  2R7U A;  2HPM A;  3TX8 A;  2G0E A;  1T08 B;  3WTT C;  3BC8 A;  2DPD A;  2VZY A;  2M0C A;  4CRY B;  1YS7 A;  4I6Z A;  1YHQ I;  3GCM A;  3U1K A;  2X4H A;  2X1C A;  4EAT A;  3ZJ0 A;  2IXS A;  3K4J A;  2DXQ A;  3B6A A;  4H89 A;  1MBJ A;  5CPA A;  4LLL A;  4RM2 A;  1QZZ A;  5DUK A;  4CYC B;  5HDN A;  2H6C A;  3FYN A;  1UCR A;  4PXC A;  1S5K A;  1XGM A;  2GRE A;  1YI2 I;  3PBE A;  4IXA A;  2AFZ A;  2PI0 A;  1HST A;  3BTL A;  3ZN0 A;  1LOK A;  2E19 A;  3OR2 C;  1GV2 A;  1D5Y A;  5KTA A;  4R3K A;  4BEH A;  3PB9 X;  2BY1 A;  1LFB A;  1P4A A;  4CPA A;  4QVT A;  1Y1V J;  2PLY A;  3OS0 A;  3ZQC A;  4C2Y A;  4NUB A;  1KYW A;  4Y17 A;  2Z3K A;  3MQ0 A;  1TT5 B;  4XLF A;  4CO8 A;  2JZY A;  4A2U A;  1DQU A;  4R9M A;  4ZZL A;  4RI1 A;  2JJ7 A;  2Y31 A;  4OIP F;  3OYG A;  1R22 A;  2BV6 A;  4P9F A;  3OOP A;  2P7C B;  5D4R A;  3NH4 A;  4MCQ A;  2VL8 A;  1V5G A;  1CP7 A;  5IB0 A;  5HLT A;  2DA5 A;  4RGR A;  1HXD A;  1YE9 A;  3GZ6 A;  2JA2 A;  2K9N A;  4JBA A;  2KFD A;  4XBF A;  3N5F A;  2Y9Z A;  1B4A A;  4O3M A;  3I55 I;  1P2F A;  3PB7 X;  2E7X A;  1XCV A;  4F0X A;  3D5R C;  5C82 A;  4AVP A;  4I2O A;  4OU0 A;  4OC2 A;  2QKL B;  4C7I A;  2YND A;  6PAX A;  3W6S A;  2Z5U A;  1RUN A;  4OIQ F;  1W7P B;  2V6C A;  3PGP A;  1DPR A;  1R58 A;  2PIY A;  1W7P D;  1VQK I;  1EJ9 A;  4U5Y A;  2B0L A;  4WX9 A;  1ZRD A;  4IQJ A;  1OIS A;  5L3G A;  1NK2 P;  3SEZ A;  4IAV A;  3LSR A;  3K1M A;  4L0Y B;  3FXO A;  1PUA A;  3JTH A;  1UMQ A;  4D1Q A;  3TO7 A;  4P4D A;  5J47 A;  4XLH A;  5FGM A;  4RAF A;  2JLM A;  4IHV A;  4B3X A;  1JHF A;  4W9Y A;  4EJV A;  1ZLI A;  1EH8 A;  2GLF A;  4KUB A;  2VJI A;  1AHD P;  3HOZ J;  4CDG A;  1MK4 A;  2ECB A;  3ELK A;  5J1U A;  2WAF A;  4QIW N;  1BJZ A;  3OY9 A;  2VQY A;  2Y48 A;  4PJN A;  3KET A;  1Q2Y A;  2KDO A;  2XAH A;  3B8G A;  3KP3 A;  3BQZ A;  4C2T A;  4NJQ A;  5LYF A;  4EGY A;  1GXP A;  4M3S A;  2GFQ A;  1Y0R A;  4AVC A;  4P5O A;  3DKW A;  2BL1 A;  4A5M A;  3WGG A;  4BQO A;  4ZY1 A;  3A02 A;  4GYG A;  1YR0 A;  1VHE A;  3E5X A;  4K3N A;  3D5S C;  4UUV A;  2A4N A;  2RQP A;  4N4N B;  5EEH A;  2J5P A;  3LAJ A;  2H27 A;  2ZEE A;  2QML A;  5F0C A;  3D7G A;  4G6Q A;  3HYI A;  4PFP A;  4XRF A;  4F93 B;  4M3F A;  3J80 K;  3SI2 A;  4CH7 A;  4KVX A;  2KIM A;  4AIH A;  2KDZ A;  4CS0 B;  3LSH A;  4K2E A;  1YQA A;  5CPR B;  2IS2 A;  1CJW A;  5IT3 A;  1ONV A;  1ARM A;  4ZH4 F;  1ZEL A;  2RV8 A;  1FEX A;  4LK0 F;  1VKC A;  3PUF A;  1YIO A;  2NAZ A;  3E6C C;  5DCF A;  3HGG A;  1OQY A;  4JYW A;  2O61 A;  2J8R A;  1H9G A;  1O3R A;  1P92 A;  2RVC A;  5FKN A;  4KMF A;  4KZT A;  3CMA I;  3BI0 A;  1WH7 A;  1SFO J;  4N4O B;  5J8F A;  4R76 A;  2NVY J;  5J6X A;  1X1B A;  1ETQ A;  2XHK A;  3S9L A;  1MIJ A;  1XS9 A;  5IY5 H;  1KU9 A;  3VDX A;  1AKH A;  2OPT A;  3NEU A;  4A32 A;  2EBJ A;  1PYV A;  4UEZ A;  2P6E A;  5AG5 A;  3E6B A;  4KSI A;  5HLG A;  4CCK A;  1D5V A;  3G73 A;  2DXI A;  1YQE A;  5DS9 A;  2RNJ A;  3DKX A;  4P44 A;  2ZEP A;  1XX5 A;  4CAV A;  3JRI A;  2NS7 A;  3CCR I;  4E4H A;  2K27 A;  1IYK A;  1M4L A;  5H2F C;  2P8T A;  2B3U A;  2QIR A;  4G1P A;  4KOV A;  5HS7 A;  5FLX Z;  3BHX A;  3FB3 A;  1B1B A;  3CC4 I;  1I5Z A;  4TWE A;  1R4N B;  1K6Y A;  2BVL A;  3IRR A;  4UF4 A;  3ESW B;  3GX4 X;  1FIP A;  5HS9 A;  2FOW A;  3GXO A;  1F2P A;  1APL C;  5DV5 A;  3GYA A;  4YIR X;  1FTZ A;  3R9F A;  2O28 A;  3IWF A;  4OAY A;  2MYS A;  3P7N A;  5DYM A;  3BG6 A;  4NXY A;  2CJJ A;  1J9I A;  1IID A;  4A5N A;  2E60 A;  1LB2 A;  5A28 A;  1BI1 A;  2BEO A;  1YRE A;  2LKS A;  3WTY C;  1U8R A;  3FHN A;  2RAE A;  2ZXJ A;  5IP9 J;  4ZYE A;  4U9Z A;  4C3J J;  2D2W A;  3AG2 H;  2LKX A;  4L9N A;  1J4J A;  5CBM A;  3A2K A;  1E0E A;  3FXJ A;  3VWD A;  2QLZ A;  4FT8 A;  3WT4 A;  2O5R A;  2LYC A;  3D3S A;  3W6X A;  4A0Y A;  1SFE A;  4DYR A;  2ZEF A;  3L2W A;  1BW6 A;  1P6R A;  2F4O B;  4E0A A;  3S2D J;  2KIU A;  4HPQ A;  4EEF G;  2M4K A;  1MNE A;  3FHZ A;  4OAD A;  1IYL A;  2AQF A;  4HNX B;  2H1L A;  1R00 A;  1TF8 A;  1LFP A;  3B7I A;  3EO4 A;  2JN6 A;  2FNA A;  2IRF G;  4LOC A;  3MKW B;  4G7H F;  1T2K A;  2Z3P A;  4NGT A;  3JRC A;  4NDL A;  2VEZ A;  2IVM A;  2PCU A;  3A1Y A;  2O03 A;  5E18 F;  2LY9 A;  3D7D A;  1Q1V A;  3P9K A;  1MKM A;  2GIV A;  1GDT A;  1T56 A;  2EZH A;  2XKP A;  5FKM A;  5G21 A;  2W4S A;  1REP C;  1JWQ A;  2ID6 A;  4RAY A;  5D4S A;  1S60 A;  4J19 A;  3CC7 I;  1ZG7 A;  3BJO A;  3MGD A;  5HNF A;  1UAA A;  4CYO A;  5ICC A;  4P4E A;  4CYC A;  3E7L A;  2ID3 A;  2Q1Z B;  3NWS A;  1KUV A;  5J8C A;  5KHD A;  2VPL A;  1IN8 A;  1J0R A;  2BY3 A;  4KT6 A;  1B6B A;  4KOX A;  3K4C A;  1I3Q J;  1E3O C;  3KLN A;  2R7V A;  1BR2 A;  2RQQ A;  1PUE E;  1X1P A;  2CU7 A;  3K1N A;  3HC7 A;  3HRT A;  4HQE A;  4WXD A;  4P45 A;  2JSP A;  2FEZ A;  3C7J A;  3K7A J;  1WGX A;  3CES A;  3QYE A;  1ZH5 A;  3VH9 A;  1S7E A;  3F22 A;  3L2Q A;  4J3G A;  2ECC A;  2RB7 A;  2CFX A;  1OPC A;  4I0B A;  3J7Z I;  4ZDL A;  2F7V A;  5HVQ C;  1Z9U A;  4C3I J;  5DD8 A;  1GVJ A;  4HDV A;  1QVU A;  4Z6Y A;  4C3H J;  1EH6 A;  2NSM A;  4DYO A;  2FQ3 A;  1A04 A;  4ESB A;  3BR0 A;  2I8D A;  3DBH B;  1LEB A;  1FBU A;  3F72 A;  5J1Q A;  4A3J J;  4KLW A;  4ZYG A;  2AHQ A;  2R7H A;  5GTH C;  1PUF B;  2EK5 A;  3JSO A;  1U3E M;  2DFF A;  3CCS I;  1A2Z A;  4MY0 A;  3V8I A;  4PXB A;  4M73 A;  3FM5 A;  5DWM A;  3GME A;  3QYB A;  5TJJ A;  2ETH A;  2ZJR F;  1AOY A;  4B3A A;  2CG4 A;  4OIR F;  4IHW A;  2R7O A;  5L3E A;  2X85 A;  2CQQ A;  5B1A H;  4MLO A;  2C6P A;  2FML A;  4KFC A;  4KN7 X;  1R1V A;  3F8F A;  4OC5 A;  3ZZI A;  2PR1 A;  4UVC A;  3K4M A;  5B3S H;  1M44 A;  3GBG A;  2B63 J;  5AG4 A;  3CP2 A;  3TP3 A;  4KIS A;  2EUI A;  2OCC H;  2PMU A;  3FBU A;  4A93 J;  3O8H A;  2ZXH A;  3BPV A;  2Y9Y A;  4E7J A;  4E8O A;  2HI3 A;  2Q43 A;  3PB8 X;  1T95 A;  3KX2 A;  3VAR A;  2LC2 A;  5GAE J;  3RQ4 A;  5D29 A;  5IB9 A;  4EV0 A;  5LRG A;  2QQ8 A;  3F0C A;  2OUM A;  4BAY A;  1D1C A;  3IWZ A;  1HW5 A;  1XCB A;  1QNT A;  3RYP A;  3W2V A;  4DBR A;  3HOS A;  1IIC A;  2W84 A;  1VQ8 I;  4G7O F;  2ZEH A;  2O3F A;  3H8G A;  3HGY A;  4AB7 A;  1EV7 A;  2IT0 A;  4XLC A;  1D0Y A;  4GCV A;  1YJN I;  1LQ1 A;  1YRN B;  2AFX A;  2EZI A;  3I58 A;  2D4O A;  5IPA A;  2HU9 A;  3K69 A;  5K7H A;  2YPR A;  1JKP C;  1DGW Y;  3SFZ A;  2K4J A;  4ESJ A;  3KFW X;  2JK3 A;  2O8K A;  3P9I A;  2FA5 A;  1H88 C;  1LEA A;  4NGQ A;  2OD5 A;  4L5I A;  2FIA A;  3SJX A;  4QWQ A;  3BZC A;  3BTI A;  3HL2 A;  5JHU A;  4FWU A;  3MFK A;  1FLI A;  1EE3 P;  4XLA A;  4C2X A;  1MBK A;  1B59 A;  1WJA A;  1S7O A;  5D5W B;  2W24 A;  3M3Y J;  2PVW A;  4G8X A;  3MKZ A;  2Z3N A;  3KKW A;  4X1E A;  2FBI A;  2ICW G;  2VE9 A;  3BTC A;  2XDV A;  3GLJ A;  4RGX A;  3QU6 A;  3EDP A;  3K10 A;  1KU3 A;  4R57 A;  3FXQ A;  1V54 H;  2F5E A;  4B4C A;  1BOA A;  4EJU A;  4KOT A;  2KL4 A;  3ZGK A;  1FTT A;  3PL8 A;  4HG2 A;  1OZP A;  2LVS A;  1Q2C A;  3S6G A;  3JW4 A;  1YO5 C;  4LX9 A;  3CUQ C;  3FDY A;  5FFZ A;  2FF4 A;  3RPU D;  1MW7 A;  2XF6 A;  1YME A;  1IB1 E;  2ADU A;  4KLV A;  3CCE I;  5D8N A;  2BUE A;  3B2Y A;  3S1N J;  3DU5 A;  5CVI A;  4KOU A;  4UEE A;  2KRC A;  2LBF B;  4L5J A;  3HDD A;  4DW6 A;  2V9K A;  1LCP A;  4EMS A;  1FBQ A;  2JPB A;  1ETX A;  4PSX A;  4CCO A;  4C9Y A;  2Q51 A;  4MHY A;  3BG9 A;  2KCW A;  3OWT A;  4BQN A;  2PJ8 A;  4M71 A;  5JHF A;  2V8H A;  1W36 D;  2ZFU A;  3T90 A;  4RUH A;  3IV5 A;  3DV8 A;  2GBY A;  3J80 Z;  2HWV A;  4KDP A;  3EUK L;  3SXY A;  2CNT A;  2Z16 A;  1FNN A;  3ASN H;  3G8W A;  4LQG A;  2PJ5 A;  1LAP A;  3JRG A;  2VON A;  4KOW A;  2YSR A;  3SZT A;  3G1O A;  2XAG A;  1DTD A;  1FPQ A;  2DU9 A;  5JPH A;  2H94 A;  1I1D A;  4MO7 A;  2JDC A;  1WFX A;  2ZME B;  1Q1H A;  3HHG A;  2R3S A;  2H6B A;  3I59 A;  3PQK A;  3QNV A;  2J9A A;  2XUB A;  4A3C J;  1Z7L A;  1IOI A;  2X6O A;  1FMV A;  5E1Z B;  3J7Y J;  1HC8 A;  3HG9 A;  2CV1 A;  1JXS A;  1SAN A;  3H8F A;  2DA3 A;  1XPX A;  1H8A C;  3OYK A;  4RAG A;  1MSE C;  2DCE A;  2JSC A;  4M6G A;  2OAZ A;  4XPL A;  2O9L A;  2WY7 Q;  2X6W A;  1RET A;  4AYB A;  2VQG A;  3CMY A;  2LK2 A;  1IXC A;  4CA0 A;  1O7L A;  3ZMS A;  5IP7 J;  1G3T A;  4RB3 C;  4I49 A;  2OZ6 A;  2VXD A;  5EEG A;  1PCA A;  1TL8 A;  4Y49 B;  4A39 A;  5CQE A;  4IRG A;  1T39 A;  2Q2E B;  3EXN A;  4L9V A;  3DU6 A;  4NHJ A;  4NSQ A;  2VL1 A;  1OR7 C;  4PQA A;  4BH9 A;  2ZKZ A;  4BQQ A;  4YFX F;  4ORF A;  3Q9V A;  4AC0 A;  1X1D A;  1WWZ A;  2IL4 A;  1KQ9 A;  1RKT A;  1TKH A;  5G22 A;  2VC0 A;  2AO9 A;  1ZGJ A;  3ZMD A;  4ZX8 A;  2E7W A;  3LNQ A;  2A6E F;  2H8W A;  4YEL A;  4D9J A;  5H84 A;  1Z6T A;  4MTE A;  2KHM A;  1FOX A;  1F4K A;  4FX4 A;  3T8W A;  1YW7 A;  3OS2 A;  2PG4 A;  2ZB9 A;  4LG0 A;  3VWB A;  3VB2 A;  4MFJ A;  1A6I A;  4L18 B;  1W1W E;  5E3L A;  4YFN F;  1TBX A;  4R1H A;  1DP3 A;  3WC7 A;  3ZPL A;  2DTR A;  2BE5 F;  4P55 A;  4MBU A;  2GQQ A;  1QVT A;  3WU1 B;  3D67 A;  1FX7 A;  1RC9 A;  2BEI A;  2PJ4 A;  1J5Y A;  4ON0 A;  3KEY A;  3VPR A;  4C7H A;  3CCJ I;  3WU0 A;  4UFW A;  5B1B H;  2VJ5 A;  1Z8L A;  3S9M A;  1WJ5 A;  4OMZ A;  4X5K A;  1V4R A;  2O4H A;  3IL2 A;  1QA6 A;  2W00 A;  1LFU P;  5KK1 A;  3FBI B;  2FL4 A;  2L01 A;  5D6F A;  1U9N A;  1TTY A;  2M8G X;  4M6I A;  3QP5 A;  3NA6 A;  1D1B A;  3ML6 A;  2N8G A;  1SD5 A;  1VGY A;  5CQG A;  3R4K A;  3FJU A;  1F1Z A;  5IT9 Z;  3VSL A;  4ZDP A;  1E3H A;  5FD5 A;  4U87 A;  4AUX A;  1NHA A;  1HW2 A;  5CYV A;  1YIJ I;  3DBR B;  2W57 A;  3IHU A;  4LFU A;  5CLS A;  4A37 A;  3QPT A;  1VND A;  4UVA A;  2ELH A;  3K70 D;  2WBM A;  3L1P A;  3JAM Z;  1XSV A;  1HEE A;  1U6G A;  5K8O A;  5GP9 A;  1SC7 A;  3DR6 A;  3DKY A;  1TIQ A;  3CUQ B;  4PGH A;  2DPU A;  4YWY A;  2LLK A;  3C2B A;  2KJB A;  3ZOB A;  5KAF C;  4U9Y A;  2BHZ A;  4KIB A;  5GPC A;  2P5L C;  5AG7 A;  3AL0 B;  3S15 J;  4CYN A;  4L9J A;  3T8T A;  4UB8 C;  1CG2 A;  1TWH J;  4UV9 A;  2J8M A;  2LTP A;  1TC3 C;  4P4B A;  3BCA A;  1QO0 D;  2GU2 A;  5HH1 A;  3MEX A;  3QYF A;  4BNC A;  1MD0 A;  3J7A Y;  3ROU A;  2JTV A;  1FWZ A;  2G7U A;  4UUS A;  4LB6 B;  2NVU B;  3QRF F;  3B3V A;  2RKH A;  3ZRG A;  4LLG F;  5FJ8 J;  1MSF C;  1QGP A;  2QWW A;  2WB1 A;  4B09 A;  3LFK A;  4EJT A;  3IWE A;  3M4O J;  4JXQ A;  1P0H A;  2QBY B;  4M6Y A;  1IN6 A;  4M9Z A;  2L9N A;  3DFG A;  1QPI A;  2UZK A;  3S1M J;  2HC9 A;  5ED4 A;  1WJF A;  2QEC A;  3MCZ A;  1S7N A;  5HLI A;  2QZ8 A;  4BL0 B;  1XDS A;  3DTI A;  7CPA A;  1I50 J;  4KYW A;  4EFD A;  1FBS A;  2X51 A;  1TZL A;  4HDU A;  2Y0M A;  1UHM A;  3HPH A;  4OIO F;  3F6V A;  2B4D B;  4Q36 A;  4ZI6 A;  3RCO A;  2A68 F;  2FE3 A;  2K9M A;  4MHD A;  2RRE A;  2L7M P;  3ZMZ A;  4EQQ A;  4MEY F;  2GXA A;  2KZV A;  5IT9 K;  4A33 A;  4MHZ A;  1DE4 C;  3RNZ A;  3GB0 A;  1GHE A;  5A2Q Z;  2EV5 A;  1HW1 A;  2LBF A;  1ZG1 A;  4BS9 A;  4RM3 A;  3HLP A;  3KHZ A;  4CGN A;  2W85 A;  3KZI C;  2X6X A;  4DQ2 A;  3NRV A;  1OYY A;  1XG1 A;  3SJF A;  3S14 J;  4FIS A;  2HOT A;  2PRQ A;  3CDI A;  3LA3 A;  1YSJ A;  1F9N A;  4G9Y A;  5LLQ A;  1MZB A;  1P7I A;  3CP8 A;  4WXC A;  2DLL A;  2F4M B;  4IKF A;  4BE0 A;  2QUF A;  2PVV A;  3VOE A;  2Z33 A;  4BEH B;  2XIG A;  2ME6 A;  2X6Y A;  4OC0 A;  2Z99 A;  1LE8 B;  4QPO A;  3J81 K;  2JA6 J;  2FXF A;  3PZJ A;  4DZP A;  3HUV A;  3H8E A;  1ETK A;  2ZJQ F;  1Y7E A;  5FRM A;  1R49 A;  3PFI A;  2V1N A;  1WJE A;  2OCE A;  3F9K A;  2P6T A;  2BGC A;  3I59 B;  4HA8 A;  1OKR A;  3MKY B;  2JQ7 A;  1A5J A;  2B4B A;  2OR4 A;  3I0T A;  4FD6 A;  1LAN A;  4XLE A;  6CPA A;  3PNY A;  1OJL A;  2MA3 A;  2R1I A;  1Z6R A;  3TFY A;  2DOE A;  2HDD A;  2PJ0 A;  1ZGW A;  4PXD A;  2L2O A;  1CGP A;  2GA1 A;  3QOP A;  4HNW B;  2RGV A;  3WOD F;  3BY6 A;  4NB5 A;  3T8R A;  3CPA A;  2W7N A;  5GTI C;  1S6L A;  1MGT A;  2BW3 B;  3D7F A;  3BJ6 A;  2Q2E A;  3ABL H;  1KQ0 A;  3BG3 A;  5DCM A;  1QPM A;  2HYJ A;  4NC8 A;  3SJM A;  2R7X A;  1R1T A;  2HUZ A;  1TWG J;  4WXH A;  2R7Q A;  5C4X J;  1Z91 A;  2CFO A;  4RLF A;  3MZ8 A;  3F0A A;  5KTD A;  2I00 A;  4S04 A;  2VXZ A;  3FWE A;  3G1L A;  4BU2 A;  2A07 F;  4KVM E;  4F7Z A;  5DWN A;  3W6J B;  4DYC A;  2ZW5 A;  4MJ8 A;  2LP0 A;  3KQZ A;  5H6Q A;  5FO5 A;  3I4M J;  3ZQI A;  2CW8 A;  4EWT A;  1WK4 A;  2FX0 A;  2ZME C;  1WJC A;  5JLX A;  2Z11 A;  3RAM A;  2E1M C;  4JK1 X;  4V2G A;  3RO0 A;  4W97 A;  3I56 I;  1YTY A;  3BTJ A;  2NOJ B;  2YS9 A;  3IC1 A;  2F8H A;  3FXR A;  3EET A;  3W3C A;  4IF4 A;  3IKT A;  2WSA A;  4HEA 2;  3C1D A;  4GDF A;  4A6D A;  4OMY A;  2M87 A;  2DFI A;  4Q7A A;  1P4W A;  1R1U A;  2ZW7 A;  4ZDO A;  3U2R A;  2XPU A;  4E6K G;  3K6G A;  3CC2 I;  2GXG A;  4CHU A;  3D7H A;  4ABZ A;  3N7Z A;  5BNG A;  1Z3Y A;  1QSM A;  3SJE A;  4QSH A;  3AKZ A;  4Y49 C;  4IRI A;  1SD7 A;  2MLG A;  3DTE A;  2XGD A;  2XEG A;  1Z0X A;  2QGU A;  2CW0 F;  5FLV A;  4MHP A;  3H3V K;  3F23 A;  4KT5 C;  5M5Y J;  1K6O A;  1K79 A;  4QTR A;  1KU2 A;  2D5V A;  1MJB A;  4O5V A;  4A3I J;  1GUU A;  3E0J B;  4B47 A;  3BR3 A;  2EJR A;  3QPS A;  4X6A J;  3GUX A;  3VOD A;  4O23 A;  4XKB A;  4FD7 A;  3TC8 A;  3LMS A;  3OOU A;  1R36 A;  2R92 J;  3PSF A;  1WJB A;  3DBL B;  1A36 A;  2ZC2 A;  4W1U A;  4ZYH A;  1JHH A;  3HM5 A;  2KT0 A;  2MLK A;  2DYS H;  3HKZ N;  3HBL A;  3UKG A;  1Z8X A;  4WF2 A;  4EM1 A;  3S3O A;  1XMX A;  3LOC A;  3PFO A;  2HKO A;  5BPD A;  4BMH A;  4U0W A;  3NAU A;  3U21 A;  5FKL A;  3UY5 A;  3BP8 A;  2R7F A;  5LEK A;  1J7K A;  5CVR A;  4RLQ A;  2VKV A;  3OYM A;  1IRG A;  4C30 A;  2IEK A;  5K1Y A;  2DEA A;  2GOM A;  2M1B A;  1PP7 U;  1MMN A;  4JP0 A;  4F55 A;  1YX3 A;  4XPD B;  3ASO H;  4BE2 A;  1T0F C;  2R4G A;  4NQW A;  5LRK A;  2M7A A;  2ATR A;  2V79 A;  2NRA C;  5B5E C;  3IO1 A;  1HBX G;  2KRF A;  5E17 F;  1YGH A;  1OMI A;  1XJO A;  1TKF A;  1ELL P;  5ISV A;  2XF7 A;  1C0W A;  2J8N A;  2WWY A;  3FIW A;  4MY3 A;  4D0P A;  5J3L A;  2QEN A;  4XRS A;  2FCK A;  2IGK A;  1QSR A;  1FOK A;  1V5E A;  1AU7 A;  4Y3O A;  2ODF A;  3QOE A;  4A0X A;  1XB4 A;  3SJG A;  5EMI A;  4LMY A;  4MFP A;  2XAF A;  3FXU A;  1Z05 A;  4PDK A;  1ZLJ A;  3OYH A;  2RNG A;  3PJR A;  5BMZ A;  2MC3 A;  3ULQ B;  4U7B A;  5FRN A;  5D5X B;  4HW0 A;  4P6Y A;  3MD2 A;  1GV5 A;  1Z4E A;  3QPH A;  2DMN A;  1MMS A;  1DPU A;  2P6F A;  1BI3 A;  4ENM A;  4KSF A;  4ONW A;  5EEA A;  4PJL A;  1T38 A;  3ZQH A;  1JJ8 C;  1FOY A;  1EKE A;  3HOV J;  2LDU A;  4F3Q A;  4F8Z A;  5ILU A;  2HNH A;  3LWU A;  3DPL C;  5E8I A;  2HTJ A;  3HOW J;  3IIB A;  4MI4 A;  3I9V 2;  4B6Z A;  4P4I A;  4UWJ A;  4FCY A;  3G2B A;  4GS4 A;  5GAH J;  4EVY A;  3PNT A;  2A3S A;  4MGR A;  5LHI A;  3CQZ J;  1VQM I;  3G4S I;  2P4W A;  4C68 A;  4MHN A;  1MBE A;  2FNP A;  3FH4 A;  5F09 A;  3PSI A;  4UFV A;  4FUU A;  4XMY A;  2FU4 A;  2DA1 A;  1FSE A;  5JVT A;  1TF9 A;  1ERD A;  3A0B C;  1S5L C;  2HS5 A;  5D5V B;  3OIQ A;  1LE8 A;  1FYK A;  1KU7 A;  3R9G A;  5LEJ A;  3PFY A;  2DJI A;  4RS8 A;  2REE A;  3D2M A;  2CSO A;  2CQ7 A;  3KI9 A;  4D5C A;  5H86 A;  2WAD A;  1TP4 A;  2CUJ A;  2VN2 A;  4I0A A;  4HPS A;  1IDY A;  1BR1 A;  1LKX A;  1Y0N A;  2IQ6 A;  4LIU A;  2W82 A;  5F46 A;  2FBK A;  2EA4 A;  1UST A;  2V77 A;  1Y8R B;  3GTG J;  3Q0U A;  3LA7 A;  2EO8 A;  5DUI A;  1L0O C;  3G3S A;  2CTB A;  2I10 A;  1KZH A;  3RDI A;  1H0M A;  5KCM A;  1CF7 B;  3BT9 A;  3W2A A;  4GFB A;  2XV4 S;  2WPW A;  4R6T A;  2JWT A;  1XSD A;  3FEE A;  3QOD A;  4BAC A;  3VWE A;  1ARL A;  3GLL A;  3GUD A;  2BW3 A;  2CQN A;  2K5C A;  3ZQQ A;  1PUF A;  1D8J A;  3V8J A;  4H6Z A;  4L9T A;  2R5Z B;  4HZF A;  3VEP A;  5DCM B;  2BBY A;  4ZBG A;  5GAG J;  2B9S A;  2HOS A;  2VT3 A;  4HF2 A;  2BO9 A;  1S7F A;  1I6X A;  5GAD J;  5K7F A;  5D8K B;  4HX7 A;  2VLA A;  1Z4R A;  2BY2 A;  2K86 A;  2HV2 A;  2RN7 A;  2A05 A;  1B87 A;  2OQR A;  4Q4Z F;  3ZMT A;  4LGW A;  3PBB A;  3DEE A;  3EQL F;  1KZF A;  1V55 H;  2LY2 A;  1H8L A;  2LKP A;  2CUF A;  2R7T A;  4OLL A;  2R93 J;  2QYV A;  1FIA A;  4M3G A;  1ON0 A;  2EFQ A;  1HKQ A;  3C3W A;  3DPT A;  2DN0 A;  3GTJ J;  1UHS A;  4Q48 A;  4MTD A;  1IXS B;  3FXL A;  1D0Z A;  4B13 A;  1I12 A;  4II2 A;  3B3T A;  4FD5 A;  2L7Z A;  3F8M A;  2QEX I;  4UA3 A;  3I54 A;  4PXE A;  3KP4 A;  3S2W A;  3H9Q A;  3JRB A;  2C27 A;  3DNS A;  4X3R A;  1Z77 A;  2GWR A;  2DW4 A;  2L9V A;  3LSJ A;  4M72 A;  2UV1 A;  5EF6 A;  3O6B B;  2E2H J;  2AXT C;  4D7N A;  5CVU A;  3RYO A;  1X1A A;  2HZD A;  2C6Y A;  4JXR A;  3LMM A;  4OKO A;  2F6C A;  2Y0S A;  4BBR J;  3CCV I;  3CDX A;  3K2Z A;  4KOR A;  4B5P A;  2OB0 A;  4UCN A;  1NG6 A;  2ZSH B;  3DWL E;  4AIK A;  2E1C A;  2X1E A;  3GTQ J;  1DU6 A;  3ABK H;  4V2F A;  4RN7 A;  2XGE A;  2CV0 A;  3EFA A;  1WI9 A;  3HIF A;  4ITV A;  4FET A;  1SMT A;  3OYF A;  2JA7 J;  2JUG A;  2ZJ2 A;  1ODD A;  2UXN A;  4P1W A;  3COA C;  1BR4 A;  2C6C A;  2OTJ I;  3D5L A;  1BAV A;  2CUZ A;  3H5A A;  1JKO C;  5CJ9 A;  4CAX A;  2K02 A;  5J40 A;  4BD9 A;  1TWC J;  2OZH A;  3TKY A;  3G6E I;  5IX3 A;  2E2I J;  3HUG B;  1SMY F;  5HNH A;  5K7Z A;  1IV6 A;  3S8P A;  2O53 A;  1T33 A;  1MJA A;  4HQM A;  1FSH A;  2VKE A;  2L9S A;  2JVH A;  3FKJ A;  3R0A A;  4QBJ A;  2PN6 A;  1ZN2 A;  3H5R A;  3K0L A;  2DQL A;  2EIM H;  2IGM A;  1VFC A;  4D5F A;  1JT6 A;  5IYC J;  2CXA A;  2R8V A;  2WYR A;  3QU3 A;  3JRE A;  4NGM A;  1RR8 C;  4YII A;  3LOD A;  4CXF A;  3RKW A;  1JE8 A;  2FVG A;  4ZYA A;  3RZO J;  2FIW A;  3CZ6 A;  1RPW A;  4MFK A;  4MMO A;  3NE8 A;  4K30 A;  4UUT A;  2ISZ A;  1W36 C;  2LY1 A;  3K9U A;  3S6K A;  3WTZ A;  1HCR A;  2PSW A;  2FUG 2;  1N78 A;  3RIR A;  1BOB A;  2GXB A;  4FBE A;  1B9M A;  2CUE A;  2AS5 F;  1AA7 A;  2BXY A;  3RJP A;  4F91 B;  2DPT A;  1GXQ A;  4TV7 A;  2PJ7 A;  2K9Q A;  4DJA A;  2VBQ A;  2QKM B;  4G12 A;  2Q44 A;  4TNU A;  4OAZ A;  4YEJ A;  2XC7 A;  4XRM A;  4XLN F;  4I99 C;  5FVJ A;  1X2N A;  4XON A;  1WPK A;  3DLA A;  1VTN C;  4MEX F;  2Z10 A;  1BI2 A;  2Z3Y A;  2YNE A;  1XMT A;  2PJB A;  1LPQ A;  2KKO A;  1K78 A;  1FJL A;  5IP6 A;  2DI3 A;  2CNS A;  1M4G A;  5HOD A;  4M9X A;  3TTH A;  5AIP A;  1KA8 A;  4M3E A;  3WHC A;  4ENK A;  2PJP A;  1ZQ3 P;  4HOB A;  2V9P A;  3IKV A;  3S32 A;  2BYV E;  1LFW A;  2VB6 A;  3SYT A;  4P10 A;  3FBN B;  3CD6 I;  1ITY A;  4XPD C;  3OSF A;  1AUG A;  2DO7 A;  3S6F A;  2HFH A;  2ZXW H;  3K4L A;  4I02 A;  2PJ9 A;  4B11 A;  5KTC A;  1IXR C;  2JBJ A;  3MZY A;  4XKC A;  1G3W A;  3N4M A;  2VBW A;  4X0G A;  2GA2 A;  3BJ7 A;  2JVG A;  5JFR A;  2VKH A;  2AFS A;  4ZTF A;  3R95 A;  3CJR B;  1BO4 A;  1ENH A;  3WTV C;  1L0C A;  4N9I A;  3JRF A;  3IWG A;  3JRA A;  5ILV A;  3K70 C;  5F48 A;  3R96 A;  3NWT A;  1HQC A;  2CO5 A;  1TT0 A;  4LIV A;  5LGT A;  4DBQ A;  2EWB A;  4XK4 A;  4MFE A;  2ME0 A;  5F0H A;  2JA8 J;  4KSA A;  3SI0 A;  1FMW A;  5KVR A;  4WK8 F;  1RZ4 A;  1R5G A;  1IN4 A;  4A12 A;  2IS1 A;  3FX6 A;  3PEI A;  2Q4V A;  4C2M J;  4BY7 J;  3CF5 F;  4HRI A;  3PRT A;  4KUA A;  5L3C A;  2X7B A;  1CF7 A;  4JD6 A;  5BQT A;  2VBY A;  3CZX A;  2ZNZ A;  5EBV A;  1FP1 D;  3V42 A;  2FD5 A;  2J5O A;  1SFK A;  1NSL A;  3CCM I;  4R8F A;  2W1O A;  2R5Z A;  1YW8 A;  2AFO A;  2Q4Y A;  5BPI A;  4UIA A;  4CGO A;  2WY8 Q;  4CRZ B;  4IEJ A;  1TQI A;  5F27 A;  3M8F A;  4XNF A;  2F5F A;  5K5R A;  3ZP5 A;  4KNY A;  4RGS A;  3CXS A;  1UHW A;  3CO7 C;  1I39 A;  2Z0Z A;  1I1G A;  3GY9 A;  4PCQ A;  2EWN A;  2MAB A;  5IYD J;  1UFM A;  1ZG8 A;  3TL4 X;  3V7R A;  2ESN A;  2HYF A;  1JGS A;  1YJ9 I;  3IH2 A;  4Y7N J;  4XN3 A;  1OYW A;  3FMC A;  2EV0 A;  2LNB A;  1XSX A;  2L4M A;  5M3M J;  3NAR A;  4FAI A;  4YG2 F;  4DYQ A;  4OP4 A;  1XMK A;  1EH7 A;  3CMM A;  4BUP A;  4CSW A;  2QQA A;  3WTU C;  4BQA A;  5FRO A;  1Y1W J;  3BPX A;  2PJ1 A;  5E3M A;  3ISX A;  5E96 A;  3QAH A;  2IA2 A;  4P96 A;  3FZV A;  4Q47 A;  2KJC A;  2AFU A;  2OZG A;  4MQ9 F;  3DDD A;  3L7W A;  4G7Z F;  3H9J A;  2ELK A;  1K61 A;  1LRZ A;  3D66 A;  2C1C A;  1O3S A;  5F49 A;  1TLH B;  5A2Q K;  2PQ8 A;  1B72 A;  3RBU A;  1HKS A;  2CQK A;  2L02 A;  2ZNY A;  2NMT A;  1HDD C;  1Y56 A;  2V4J C;  4BJT A;  4UY8 I;  3A9L A;  1XIX A;  3IC7 A;  3LST A;  3H0G J;  1K7A A;  2Z3O A;  1OCO H;  4DOZ A;  4EM0 B;  1NTC A;  1YW6 A;  2P7V B;  1S9H A;  5K5O A;  2DK8 A;  2ZEN A;  2O7O A;  4IQ4 A;  2KIS A;  2DMT A;  1DDN A;  4LUA A;  3JRU A;  2OBP A;  3WC5 A;  5HOO A;  1WH5 A;  3ONQ A;  1PYT B;  4ASN A;  1DGR M;  1B8I A;  2PX9 A;  1K4T A;  3L2V A;  2AFM A;  1W5C C;  1QHH D;  3FF5 A;  2OTL I;  2V8G A;  2UUZ A;  1JT0 A;  2FMY A;  3GTK J;  3A0H C;  2R98 A;  3ZMV A;  3DEW A;  4YFJ A;  4C2U A;  3CCL I;  2FS5 A;  2ZCW A;  2VJJ A;  2CNM A;  3IGR A;  2A5W A;  4BIN A;  4IUS A;  3FNC A;  2EQR A;  2VAS A;  1QZY A;  1FP2 A;  2MD5 A;  4FX0 A;  2XVC A;  4KUM A;  1IAW A;  5HDK A;  4UUS B;  1VF9 A;  3OYE A;  4B8X A;  1ORK A;  3JTK A;  3BLY A;  4DGW B;  1Z2L A;  2M30 A;  1R3N A;  4ZGY B;  1SFX A;  5CKT A;  2V6E A;  4XID A;  4OAE A;  2MD0 A;  2XGX A;  3H5N A;  1ZG9 A;  1JJ6 C;  1I1S A;  1IRX A;  1VZ0 A;  2QBY A;  2CY2 A;  4HNY B;  2MSY A;  2FJ1 A;  4NC7 A;  3DF8 A;  3PO2 J;  2ZOG A;  4PK3 A;  3SZG A;  1G8X A;  2QM3 A;  3TO6 A;  3L2N A;  1CBX A;  4NGP A;  3HPG A;  5BS6 A;  3HZJ A;  2EB7 A;  4OID A;  3E5Q A;  3BR1 A;  4AM3 A;  3FXT A;  3KAS A;  4M6H A;  1MJ9 A;  1ZHF A;  3GZN B;  3D4U A;  2B4D A;  4XSX F;  4AVA A;  3LD2 A;  3AAF A;  1Z1D A;  2DMQ A;  4PJM A;  5HDG A;  3ZR8 X;  4UNO A;  3BLN A;  2IAI A;  3HSR A;  2VI6 A;  5DDG A;  1YJW I;  2PFB A;  3UR3 C;  2Q7S A;  4DJL A;  2WV0 A;  2YU9 J;  3D68 A;  3L09 A;  2K9S A;  2WAQ A;  5F08 A;  3SEQ A;  2HDC A;  3HOY J;  2PJ3 A;  3TED A;  4JJX A;  1P9Q C;  2VE8 A;  3IP4 B; 
#chains in the Genus database with same CATH homology
 2ZXI A;  2CW8 A;  3BG6 A;  3C26 A;  4BJ6 C;  4NXY A;  1IID A;  4YRH A;  2E60 A;  1WK4 A;  5A28 A;  1WJC A;  1YRE A;  2Z11 A;  2E1M C;  3VYR B;  4HSR A;  4BDZ A;  3FHN A;  2Q04 A;  4R87 A;  4U9Z A;  2NOJ B;  3OYA A;  2KPM A;  1J4J A;  3W3C A;  4Q38 A;  2B5G B;  2WSA A;  4HEA 2;  3A2K A;  4BE1 A;  1E0E A;  1D1A A;  1YX0 A;  3VWD A;  3FRM A;  3BG7 A;  3LSK A;  2O5R A;  2LYC A;  4ZDO A;  2ZW7 A;  3D3S A;  4RS2 A;  3TCV A;  3W6X A;  3C2H A;  4UCP A;  3SXO A;  4E6K G;  3K6G A;  3L2W A;  4QB9 A;  3LL7 A;  4F0Y A;  4CAW A;  3N7Z A;  4E0A A;  3VYS B;  4PJJ A;  1Q2D A;  4IF5 A;  1Z3Y A;  1QSM A;  4HPQ A;  2M4K A;  1MNE A;  3AKZ A;  2OU2 A;  2WUU A;  4Y49 C;  4E7L A;  4OAD A;  1YX5 A;  1IYL A;  2AQF A;  3DTE A;  3OYJ A;  4HNX B;  1M4D A;  1LFP A;  3EO4 A;  1LVK A;  2E5Z A;  2M3A A;  1P4N A;  3MKW B;  2Z3P A;  1MJB A;  2VEZ A;  3E0J B;  3A1Y A;  3AFH A;  4E7I A;  3H0D A;  4B47 A;  2IGO A;  2V7F A;  2VKD A;  3LSG A;  4L89 A;  2GIV A;  5G21 A;  4XKB A;  2VQC A;  4FD7 A;  2W4S A;  3OOU A;  3SHP A;  4AG9 A;  1S60 A;  4PUS A;  3MGD A;  3PSF A;  1WJB A;  5HNF A;  1UAA A;  4CYO A;  3UY5 A;  2DPS A;  1V0C A;  2K9L A;  3QB8 A;  2Q1Z B;  3NWS A;  2PR8 A;  3S3O A;  1KUV A;  1M4I A;  5KHD A;  1XF8 A;  3PP9 A;  4MFL A;  2VPL A;  4BMH A;  5J8C A;  1YVK A;  3U21 A;  4KT6 A;  1B6B A;  4KOX A;  3K4C A;  1U6M A;  3TO9 A;  3H4Q A;  2A6T A;  4RLQ A;  4G6T B;  3OYM A;  1BR2 A;  2R7V A;  1XEB A;  5HMN A;  2RQQ A;  4C30 A;  3OL4 A;  2GOM A;  4C2Z A;  4E7S A;  3HC7 A;  3JUW A;  1MMN A;  4IX7 A;  3RSN A;  4CYQ A;  2ZW4 A;  4F55 A;  2JSP A;  4Y4R A;  1YX3 A;  3S93 A;  2FE7 A;  4XPD B;  3CES A;  3LFU A;  1V5F A;  4BE2 A;  1T0F C;  2R4G A;  4PFO A;  3F8K A;  2M7A A;  3QYE A;  2ATR A;  3DTK A;  2EVN A;  2KLO A;  5CNP A;  3IAM 2;  3L2Q A;  1X4P A;  3PUB A;  1YGH A;  4J3G A;  5ISV A;  2XF7 A;  3OYI A;  4F92 B;  3IAS 2;  2PJR A;  2G3T A;  2J8N A;  3R9E A;  2VXK A;  4MY3 A;  4ZDL A;  2ZW6 A;  5HVQ C;  1Z9U A;  2IGK A;  1QSR A;  2FCK A;  3RTR A;  2FSR A;  3I3G A;  1V5E A;  4E7Z A;  4Y3O A;  1I21 A;  1YLE A;  3QOE A;  1EA3 A;  4JQF A;  4NNJ A;  5F47 A;  4XPK A;  3OR1 C;  4MFP A;  5TGT A;  4J00 A;  2I8D A;  3S3N A;  4B10 A;  1GLN A;  4NEX A;  3OYH A;  2BOL A;  2CMP A;  4KLW A;  5IV0 A;  2RNG A;  3PJR A;  2R7H A;  5FRN A;  4U7B A;  2AQE A;  3GKR A;  3MD2 A;  1Z4E A;  4QC6 A;  4MY0 A;  2G0B A;  2P6F A;  4KSF A;  3V8I A;  5C88 A;  4PJL A;  4DIQ A;  1QU3 A;  5DWM A;  2L7K A;  3QYB A;  4XN0 A;  4KS9 A;  4F3Q A;  2HNH A;  4FD4 A;  3DPL C;  3DSB A;  1YK3 A;  3DQV C;  3I9V 2;  4MI4 A;  2R7O A;  2PRB A;  2X85 A;  4UWJ A;  4MLO A;  3G2B A;  4GS4 A;  4A95 A;  3S3M A;  1K4J A;  4PK2 A;  3PNT A;  4EVY A;  4C68 A;  3ZZI A;  4OWR B;  2PR1 A;  3E0K A;  4BDY A;  3I9S A;  3K4M A;  3PSI A;  1M44 A;  3GBG A;  5AG4 A;  1VHS A;  2OZU A;  4XMY A;  4CZC A;  2P6G A;  4XKV A;  4UFV A;  3CP2 A;  4KIS A;  3CXP A;  2E5N A;  1D0X A;  1Y9W A;  2KMU A;  2EUI A;  3FBU A;  1ERD A;  5G20 A;  2ZXH A;  4E7J A;  2HVQ A;  4E8O A;  3OIQ A;  4XR6 A;  4YRV A;  4UBR A;  3D2P A;  3R9G A;  1T95 A;  3KX2 A;  3PFY A;  2DJI A;  2IS6 A;  2LC2 A;  1QSN A;  4NF1 A;  3RQ4 A;  2REE A;  3D2M A;  3CF2 A;  3DR8 A;  2VQL A;  2M7B A;  3I3L A;  2OUM A;  2WAD A;  1D1C A;  4PSW A;  4NQW B;  5EC4 A;  5H86 A;  2CUJ A;  3W2V A;  1X19 A;  4DBR A;  1XE4 A;  4CCN A;  3HOS A;  1IIC A;  3TOA A;  1BR1 A;  1LKX A;  2YNC A;  2ZSI B;  1N75 A;  2Z3M A;  5H84 A;  3L2R A;  1KUY A;  5G1Z A;  4LIU A;  3R96 A;  4F0X A;  2W82 A;  1G59 A;  4AB7 A;  5F46 A;  3LSM A;  4XLC A;  1D0Y A;  2D4O A;  1Y6I A;  2KQR A;  3DPU A;  2HU9 A;  3VSK A;  3G3S A;  1MMA A;  2HVS A;  1DGW Y;  3OIP A;  2GAN A;  1X1C A;  5KCM A;  1HA8 A;  4HNU A;  3W2A A;  2Q0Y A;  2WPW A;  3H5Z A;  4IZZ A;  3NE7 A;  4ONU A;  4CGM A;  4CCL A;  4H6U A;  3QOD A;  4BGD A;  4BAC A;  3VWE A;  2FIA A;  2FT0 A;  2BW3 A;  3HL2 A;  3BCB A;  2VZZ A;  4JWP A;  2K5C A;  2KRH A;  3K4N A;  3VYU B;  3ZQQ A;  4H6Z A;  4CCM A;  4ZBG A;  4XLA A;  4C2X A;  2M4G A;  4LG3 A;  4HST A;  2BSW A;  1WJA A;  4ANJ A;  4CGP A;  5JQ4 A;  1S7F A;  3MKZ A;  2Z3N A;  3KKW A;  2VLA A;  1Z4R A;  4B5O A;  4B12 A;  4QUS A;  1B87 A;  3FIX A;  2XF5 A;  3S6H A;  2XDV A;  3UNG C;  2P0W A;  4XOR A;  4JLY A;  1Z21 A;  4BXF A;  3K10 A;  4R57 A;  3DEE A;  1NMT A;  1KZF A;  2LY2 A;  3TO7 A;  4KOT A;  2KL4 A;  3T9Y A;  2LOO A;  3ZGK A;  3PL8 A;  4HG2 A;  2R7T A;  1OZP A;  4OLL A;  1Q2C A;  3S6G A;  1Y9K A;  4XM3 A;  4LX9 A;  2V26 A;  1ON0 A;  3FDY A;  1UFH A;  3TT2 A;  3DPT A;  2PMZ A;  3RPU D;  1MW7 A;  2XF6 A;  4NCZ A;  2K5T A;  2B5G A;  1IB1 E;  4KLV A;  4UWI A;  1S7K A;  2Q7B A;  2BUE A;  2UWM A;  1D0Z A;  3DU5 A;  1I12 A;  4II2 A;  4XOP A;  4B13 A;  4KOU A;  4E7H A;  2KRC A;  4FD5 A;  2LBF B;  4UA3 A;  2R7S A;  1NG7 A;  2V9K A;  3DNS A;  3H9Q A;  2C27 A;  2H5M A;  4B43 A;  2ARH A;  4MFZ A;  2KP6 A;  2UV1 A;  2Z1D A;  1M1D A;  4PSX A;  4CCO A;  4C9Y A;  1PU9 A;  2AJ6 A;  2WPX A;  5GCN A;  2HDW A;  2KCW A;  3OWT A;  2Z3L A;  3P2H A;  3RYO A;  1X1A A;  4BQN A;  2HZD A;  4JXR A;  4DNC A;  3LMM A;  5KNL A;  2F6C A;  2Y0S A;  3OL3 A;  5JHF A;  4KOR A;  1W36 D;  4B5P A;  2LH9 A;  2ZFU A;  3OYD A;  2OB0 A;  4UCN A;  1NG6 A;  2HQA A;  2ZSH B;  3DWL E;  3PNV A;  2X1E A;  2F5I A;  2DT7 B;  3T90 A;  4ZTJ A;  3EFA A;  2CV0 A;  3EUK L;  2CNT A;  2Z16 A;  3IUO A;  3G8W A;  1U0J A;  3OYC A;  4ITV A;  4FET A;  4KIT B;  2CW7 A;  4J01 A;  1SQH A;  4KOW A;  3OYF A;  4B48 A;  1ZO0 A;  4KVO E;  2JUG A;  4L8A A;  2GOX B;  5JPH A;  2F5V A;  2XSJ C;  4P1W A;  1I1D A;  1BR4 A;  2JDC A;  1WFX A;  2E1M B;  1YVO A;  3D5L A;  3K4B A;  1UG0 A;  2CUZ A;  2OV7 A;  3H5A A;  2WAE A;  3K4K A;  4CAX A;  2CH0 A;  4UCM A;  2YNC C;  4F52 A;  4A2Z A;  1Z7L A;  1FMV A;  2K3P A;  2OZH A;  3HG9 A;  4E7K A;  2CV1 A;  5IX3 A;  3HUG B;  3OYK A;  2DCE A;  5HNH A;  2VI7 A;  3S8P A;  3TBI A;  2PSW A;  4CUG A;  1MJA A;  1RO5 A;  2JDD A;  4ZJZ A;  4XPL A;  5BWA B;  2L9S A;  1S3Z A;  2JVH A;  3FKJ A;  4XOT A;  2WY7 Q;  2X6W A;  4QBJ A;  3H5R A;  2CXA A;  4AYB A;  2IGM A;  2VQG A;  3W2W A;  2CV2 A;  2R8V A;  3AL0 C;  3IU2 A;  3ZXS A;  4CA0 A;  3EUA A;  1X4O A;  2VJ4 A;  2X1D A;  4I49 A;  3LOD A;  1KUX A;  2VXD A;  4Y49 B;  4ZYA A;  5CQE A;  2FIW A;  2DOA A;  4BJ5 C;  2Q2E B;  3CZ6 A;  2I79 A;  3EXN A;  4UFX A;  4PK4 A;  3DU6 A;  1QHG A;  4ZC3 A;  2PC1 A;  4MFK A;  4NSQ A;  1OR7 C;  4K30 A;  4BQQ A;  4ORF A;  4B44 A;  4CCJ A;  1W36 C;  2LY1 A;  3K9U A;  3S6K A;  3VYT B;  1X1D A;  2FUG 2;  2LRD A;  1N78 A;  2IS4 A;  2L5Q A;  1WWZ A;  1BOB A;  2IL4 A;  3EC4 A;  5G22 A;  3A4C A;  4CAF A;  4A31 A;  2JEV A;  1AA7 A;  1Y7R A;  2DPT A;  4F91 B;  3EUH C;  4YEL A;  2CS3 A;  3TMO A;  4D9J A;  4DJA A;  4QPQ A;  2HV2 A;  3OYL A;  2VBQ A;  3IU1 A;  3R1K A;  2BVM A;  2KHM A;  1QST A;  4FAS D;  2QKM B;  2Q44 A;  1MMD A;  4OAZ A;  4YEJ A;  2XC7 A;  4B14 A;  2G3A A;  2ZPA A;  5FVJ A;  3OS2 A;  4II9 A;  4XON A;  3SDB A;  4B5P B;  3VWB A;  1QSO A;  4MFJ A;  2ELJ A;  3DLA A;  1N77 A;  4GRI A;  2Z10 A;  3TOB A;  4HNT A;  2YNE A;  1DP3 A;  5LFA A;  1XMT A;  4CAE A;  4AG7 A;  3OS1 A;  2CNS A;  4MBU A;  4CGL A;  1M4G A;  4CYP A;  3JVN A;  3TTH A;  3WR7 A;  2VIX A;  4PV6 A;  2BEI A;  3KEY A;  3S32 A;  4H4K C;  1S7L A;  2ZXV A;  1LDK B;  4MFQ A;  2VB6 A;  2HPI A;  3SYT A;  4C7H A;  4UFW A;  2VJ5 A;  3FBN B;  1WJ5 A;  4F6A A;  2PDO A;  3OWC A;  4X5K A;  1Z3X A;  4KOS A;  4XPD C;  5A27 A;  2R7R A;  2GE3 A;  3S6F A;  3K4L A;  4B11 A;  2W00 A;  5KTC A;  4HKF A;  3FBI B;  4XL9 A;  4LIT A;  2FL4 A;  2YGW A;  5I0C A;  3TE4 A;  5AG6 A;  4XKC A;  1D1B A;  3HOT A;  2R7U A;  4AVZ A;  2HPM A;  4X0G A;  5CQG A;  3BJ7 A;  2JVG A;  3BC8 A;  2VKH A;  3HKZ A;  2VZY A;  3VSL A;  4ZDP A;  4CRY B;  4ZTF A;  3L2U A;  4U87 A;  1PJR A;  3R95 A;  2X1C A;  4EAT A;  3OMY A;  3ZJ0 A;  2IXS A;  3K4J A;  2DXQ A;  3CJR B;  1BO4 A;  3H35 A;  4H89 A;  1L0C A;  4RM2 A;  3IWG A;  3K70 D;  2WBM A;  4XNH B;  4A30 A;  2F4I A;  3K70 C;  1MMG A;  2LG4 A;  2VQH A;  3FYN A;  5E96 A;  3NWT A;  5F48 A;  4LIV A;  1TT0 A;  1S5K A;  2OH1 A;  4DBQ A;  3DKY A;  1TIQ A;  3DR6 A;  5LD2 C;  2M0M A;  4KSA A;  3M8J A;  1FMW A;  3OR2 C;  2R7W A;  2B58 A;  2IS1 A;  5KTA A;  4U9Y A;  2Q4V A;  4BEH A;  4R3K A;  1FY7 A;  4HRI A;  4KUA A;  5AG7 A;  3AL0 B;  2X7B A;  3OS0 A;  4C2Y A;  4JD6 A;  4CYN A;  4NUB A;  2Z3K A;  4XLF A;  4RI1 A;  5EBV A;  2J8M A;  1DQU A;  4R9M A;  4YGO A;  4AVB A;  3V42 A;  3OYG A;  1JI8 A;  1SFK A;  3BCA A;  1NSL A;  4R3L A;  5HH1 A;  4M85 A;  3QYF A;  2MFZ A;  2W1O A;  3HXL A;  2MC4 A;  3J7A Y;  2VL8 A;  1V5G A;  2Q4Y A;  5IB0 A;  5HLT A;  1YE9 A;  4CGO A;  2WY8 Q;  2IGN A;  4II3 A;  3ZRG A;  4CRZ B;  2JA2 A;  4XNF A;  3M1C A;  2WB1 A;  2PJR B;  3IWE A;  3CXS A;  4JXQ A;  1UEL B;  2Z0Z A;  3D5R C;  1P0H A;  3GY9 A;  5C82 A;  2L9N A;  2QKL B;  2MAB A;  3KYL A;  2LRE A;  2YND A;  4C7I A;  2Z2S B;  3TL4 X;  3W6S A;  1WJF A;  2QEC A;  3PGP A;  3MMY B;  4XN3 A;  1S7N A;  4U5Y A;  1SAU A;  1WJD A;  2HQY A;  4BL0 B;  3F5B A;  3N05 A;  3DTI A;  4IQJ A;  2AE6 A;  4QVT A;  3SEZ A;  3CMM A;  2X51 A;  1TZL A;  4BUP A;  4CSW A;  1PUA A;  3HPH A;  5FRO A;  2B4D B;  3C2G A;  4D1Q A;  2Y0M A;  3RCO A;  4Q36 A;  3QAH A;  4XKW A;  2K9M A;  2OZG A;  4XLH A;  3DDD A;  3P2F A;  4MHD A;  2JLM A;  2RRE A;  4B3X A;  3H9J A;  4JOM A;  2KZV A;  1LRZ A;  4A33 A;  4KUB A;  5F49 A;  2VJI A;  1GHE A;  2PQ8 A;  3E1S A;  1MK4 A;  2REF A;  2NMT A;  2VQY A;  3OY9 A;  2LBF A;  2WAF A;  3BJ8 A;  4BS9 A;  4PJN A;  1Q2Y A;  1Y56 A;  2KDO A;  2V4J C;  4RM3 A;  4BJT A;  2D4P A;  4C2T A;  1XIX A;  3A9L A;  3B8G A;  4M3S A;  3SXN A;  4RMN A;  2RC4 A;  4CGN A;  2X6X A;  4AVC A;  1MND A;  2Z3O A;  3EY5 A;  4DOZ A;  2OC6 A;  4P5O A;  2HVR A;  4XQF A;  1N71 A;  2BL1 A;  4BBH A;  1NE9 A;  4BQO A;  1S9H A;  1YR0 A;  4LUA A;  4IQ4 A;  3D5S C;  3CP8 A;  2A4N A;  4IKF A;  3H9G A;  4N4N B;  3ONQ A;  5HOO A;  4BE0 A;  2QML A;  1DGR M;  3CJQ B;  4PFP A;  3L2V A;  1QHH D;  4BEH B;  4F93 B;  3D8P A;  2UUZ A;  1R6R A;  2X6Y A;  4CH7 A;  2R98 A;  4KVX A;  4CS0 B;  3LSH A;  5CPR B;  2XAU A;  2IS2 A;  1CJW A;  4Y33 A;  4YFJ A;  4QPO A;  4R79 A;  4C2U A;  3OYB A;  1ZEL A;  2FS5 A;  2FXF A;  4KOY A;  2VJJ A;  1VKC A;  3ZCO A;  2CNM A;  3IGR A;  2A5W A;  3PZJ A;  4XNH C;  5FRM A;  4IUS A;  3FNC A;  2VAS A;  2V1N A;  1WJE A;  3CXQ A;  3F9K A;  3OYE A;  3MKY B;  3OYN A;  2B4B A;  2J8R A;  3JTK A;  3BLY A;  2WA0 A;  4DGW B;  4FD6 A;  4XLE A;  3PNY A;  4KZT A;  4ZGY B;  2B3V A;  5CKT A;  2V6E A;  4AU7 A;  4N4O B;  3LSI A;  2R1I A;  2MD0 A;  4OAE A;  5J8F A;  3H5N A;  3TFY A;  1X1B A;  1IRX A;  1VZ0 A;  2L2O A;  2CY2 A;  4HNW B;  4HNY B;  4NC7 A;  4KJZ A;  3VDX A;  4PK3 A;  3EPZ A;  3SZG A;  4A32 A;  1OLT A;  1G8X A;  1PYV A;  2P6E A;  2W7N A;  3TO6 A;  5AG5 A;  1R57 A;  3HPG A;  4CCK A;  2DXI A;  3FXT A;  2BW3 B;  1MJ9 A;  3DKX A;  2B4D A;  4CAV A;  4AVA A;  1KON A;  1IYK A;  4E4H A;  2QIR A;  4NC8 A;  4KOV A;  2B3U A;  3LD2 A;  2HUZ A;  2R7X A;  3ZR8 X;  3FB3 A;  4PJM A;  3BLN A;  4E2A A;  2R7Q A;  1RXT A;  5AGE A;  1J09 A;  1K6Y A;  2BVL A;  2CFO A;  4RLF A;  3UR3 C;  3F0A A;  5KTD A;  2I00 A;  3W91 A;  2VXZ A;  2DT6 A;  3SEQ A;  2WAQ A;  4BU2 A;  4KVM E;  5DWN A;  1CM0 A;  2ZW5 A;  3GYA A;  4JJX A;  1P9Q C;  2O28 A;  4MJ8 A;  4OAY A;  2MYS A;  3IP4 B;  3R9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...