1BOBA

Histone acetyltransferase hat1 from saccharomyces cerevisiae in complex with acetyl coenzyme a
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
315
structure length
306
Chain Sequence
FKPETWTSSANEALRVSIVGENAVQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDSVTFKPYVNVKYSAKLGDDNIVDVEKKLLSFLPKDDVIVRDEAKWVDCFAEERKTHNLSDVFEKVSEYSLNGEEFVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLLNKKTKELIGFVTTYKYWHYIDKKFRAKISQFLIFPPYQNKGHGSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKLGYDAVFQKHSDLSDEFLESSRKSLKLEERQFNRLVEMLLLLNNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE ACETYLTRANSFERASE
publication title Structure of the histone acetyltransferase Hat1: a paradigm for the GCN5-related N-acetyltransferase superfamily.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Acetyltransferase
total genus 92
structure length 306
sequence length 315
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 1998-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1bobA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1bobA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 1bobA01
2QIRA 5F49A 3JUWA 4RS2A 4H6ZA 4QC6A 2P6EA 2G0BA 2B3UA 4JXRA 2BEIA 2ARHA 3CXSA 5F47A 2QMLA 3FBUA 1NSLA 2HV2A 2ZPAA 4DNCA 1WK4A 3TO9A 4CAWA 1XF8A 3QB8A 4L8AA 2ZW6A 4KUBA 1YGHA 4F0YA 1BO4A 3B8GA 4AG9A 2VQYA 4U9YA 2G3AA 4Y49B 2ZW5A 3ZZIA 1VKCA 2O28A 2FXFA 1I1DA 3R1KA 4CAXA 4HNYB 1YR0A 3DR6A 4PSWA 2BL1A 4HKFA 4QBJA 5FVJA 1Z9UA 2PRBA 2ZXVA 4MJ8A 4XNHB 1IB1E 2CNMA 1MJAA 2B4DA 4JD6A 3TT2A 5HH1A 2PR1A 1YREA 4E2AA 3DR8A 4MHDA 3SXOA 1QSRA 1M4IA 4R3KA 1GHEA 4PSXA 2FSRA 5J8FA 3T90A 4XPKA 1U6MA 3R9EA 3TO7A 2VZYA 1L0CA 4YRHA 4R87A 4UA3A 5C82A 3PGPA 5F46A 4FD4A 2GIVA 4IF5A 3KKWA 2VEZA 1P4NA 4CRYB 2FT0A 2I79A 4M3SA 4KZTA 3S6HA 3SXNA 4H6UA 4NEXA 1TIQA 1OZPA 1YVKA 2OB0A 4ORFA 1RO5A 4UWJA 3TE4A 3D2PA 2OZUA 3QAHA 3I9SA 3FIXA 3IGRA 3D2MA 2J8NA 2J8RA 3VWEA 1XE4A 2JDCA 1YK3A 3JVNA 4EVYA 1XEBA 1I21A 2Z10A 4KOUA 1Z4RA 1IYKA 4B5PA 1KUXA 2P0WA 1UFHA 2J8MA 4FD6A 4XPLA 2AE6A 1V0CA 3EXNA 3G8WA 1KUYA 1VHSA 3EC4A 2FCKA 3TTHA 2R98A 2VZZA 1S7NA 1Y7RA 3V8IA 4JJXA 2EVNA 4U5YA 1NE9A 1QSTA 1YLEA 5IX3A 3LODA 3W6SA 3TCVA 5F48A 4KLWA 4E8OA 3CXPA 1KUVA 3N7ZA 5DWNA 2K5TA 3R9FA 2X7BA 4OADA 2Q44A 2REEA 3RYOA 4KOXA 4M85A 2FIWA 4AVCA 3FRMA 3TFYA 2Z0ZA 1S5KA 3TO6A 4NXYA 3FB3A 1QSMA 4JWPA 4KVXA 4KUAA 1B87A 1M4GA 1M44A 1S7KA 4YFJA 4AB7A 2OZGA 3H4QA 5HMNA 5CNPA 2WPXA 2ATRA 3WR7A 4B5PB 2C27A 4NSQA 1FY7A 2CNTA 5IB0A 2B58A 4LX9A 3F0AA 1PU9A 3W91A 5KTCA 1YX0A 3UY5A 3ZJ0A 4JXQA 3TOAA 5I0CA 2Q4VA 1R57A 4AVAA 4IUSA 4HNWB 4R3LA 3BLNA 1MJ9A 2Q04A 1YVOA 2KCWA 2PDOA 3FXTA 3P2FA 4CRZB 1K4JA 2ZW7A 2BUEA 3D8PA 4QUSA 1IICA 2REFA 2OZHA 1I12A 4K30A 4RI1A 2WPWA 3GKRA 1WWZA 3FYNA 3GY9A 2NMTA 1SQHA 2G3TA 3DDDA 2Q0YA 1RXTA 3G3SA 5GCNA 4AG7A 4KOYA 3GYAA 1BOBA 4XPDC 3W6XA 1LRZA 4MI4A 4AVBA 2D4PA 2B5GA 4H89A 4YGOA 4I49A 2BSWA 5JQ4A 5C88A 3DNSA 2D4OA 5KTAA 4JLYA 1P0HA 1S60A 4B5OA 2QECA 3CXQA 1IYLA 3EO4A 4OLLA 5KTDA 3P2HA 5EBVA 4R57A 4MY3A 4J3GA 4FD5A 3NE7A 4X5KA 2Z11A 3S6FA 5ISVA 4KLVA 3F8KA 4KOWA 3I3GA 2F5IA 2R8VA 2JDDA 2B4BA 3EY5A 1CJWA 2PR8A 3S6GA 1IIDA 4U9ZA 5DWMA 1S7FA 2Q4YA 2JEVA 4R9MA 2FE7A 4KOTA 4UBRA 4MBUA 3PP9A 3VWDA 2VXKA 5E96A 4GS4A 4CAVA 2FIAA 3D3SA 2HUZA 5EC4A 5JPHA 4KORA 4XPDB 2A4NA 1XIXA 1NMTA 3LD2A 2B5GB 2GANA 1N71A 4MY0A 3S6KA 3F5BA 3K9UA 3C26A 4KOVA 2RC4A 1Z4EA 4PV6A 4NCZA 5H84A 3E0KA 1Q2CA 1Q2DA 4QVTA 2H5MA 2OH1A 1M1DA 1Y9WA 1J4JA 1M4DA 4KVME 4ONUA 3OWCA 3PZJA 2IL4A 4CS0B 2FS5A 1KZFA 2CNSA 2CY2A 3TOBA 2R7HA 3IWGA 4PK3A 2JLMA 3T9YA 2AJ6A 4E0AA 3BJ7A 3BJ8A 3MGDA 2GE3A 2OU2A 4KOSA 2PC1A 5IV0A 4NF1A 1Y9KA 2I00A 3FNCA 1CM0A 3R96A 4F6AA 2DXQA 4II9A 4Y49C 1MJBA 1PUAA 3R9GA 1XMTA 1B6BA 1QSNA 1Q2YA 5J8CA 2HQYA 1S7LA 3R95A 4HNXB 3DSBA 4UWIA 4XNHC 4OAEA 1QSOA 2PSWA 2Y0MA 4L89A 4BMHA 2VBQA 2VI7A 1S3ZA 4KVOE 4PK2A 2ZW4A 2FL4A 5H86A 3SHPA 2Q7BA 3EFAA 2B3VA 4FD7A 4QB9A 4LUAA 2B4DB 4ZBGA 1MK4A 2EUIA 1ON0A 2R1IA 2PQ8A 2P6FA 2P6GA
chains in the Genus database with same CATH superfamily
1X1DA 2QIRA 4D7MA 2BVLA 1QHGA 2NXNB 2B3UA 4A3DJ 5CVIA 4JXRA 2X9DA 5D4RA 3CP8A 2YU9J 1XMBA 1AKHA 1BC8C 3I59A 4BY7J 5GTIC 1MNEA 3ZCOA 5LYDA 4C2UA 2PMHA 4B10A 1MBEA 2CQNA 3CUQB 2CV2A 4P5OA 3FMSA 3V42A 4BACA 3P7NA 1TNTA 4CAWA 4ZDPA 1D1BA 1LNWA 2UXNA 1QZEA 3GZ5A 3KZYA 1VQ8I 1TNSA 2F48A 1HOMA 3PBEA 4RM2A 4ASNA 3QB8A 1KGSA 2OQGA 1SAUA 1IV8A 3ZRGA 1SFEA 3E5QA 2Q2EB 4BQAA 4F0YA 1KU3A 3DPUA 3OYNA 1KQ9A 1MD0A 2WV1A 4MCPA 2I8DA 4NC7A 2F8HA 3GUXA 4NJRA 4U9YA 2G3AA 1OYWA 2O28A 5BPDA 3WG7H 1HEEA 4F93B 1I1DA 4HNYB 4A38A 1X4OA 1O3TA 4LOCA 5IYCJ 4KNYA 2EFPA 5LEJA 2L4MA 2QCOA 3FECA 2PJ7A 3I56I 3OSGA 3H8FA 2DK8A 1V4RA 4P4FA 3OYBA 2HOTA 3E5UA 1H89C 2WY8Q 5CBMA 1Q1HA 2ZXVA 2JWTA 1IB1E 4IKFA 2CNMA 1MJAA 3JRUA 3PFOA 4JD6A 4XNHB 3GCMA 1OR7A 3RQ4A 1OR7C 5A2QZ 5HH1A 1YS7A 3BROA 5EGOB 2GQQA 3H1CA 1ZG3A 4BAYA 4IX7A 1CP6A 4Q4ZF 4UEFA 4ZI6A 2L7KA 2DMTA 1SVLA 3GF2A 5L3CA 3AL0C 5F0FA 2XAFA 3M9AA 1MNMC 3IWEA 3A01A 1BOAA 2NVUB 1EKEA 1VNDA 3HL2A 3KCCA 1JT6A 1M4IA 4R3KA 4XRFA 1Y39A 5D6FA 5ICCA 1YW6A 2QLZA 1FNNA 2HPIA 4XPKA 3T90A 1FEXA 2RAEA 3BJ6A 2STTA 1RI7A 2QZ8A 4CCLA 2X1CA 3FXQA 1WJ5A 3DBLB 2HFHA 2VZYA 3ZR8X 4YRHA 4TV7A 1DGRM 2QWWA 3KFWX 3B3CA 5GAEJ 4UA3A 5C82A 3PGPA 2IGOA 1E2XA 2KJBA 2DA2A 2Z1DA 1XJOA 2NAZA 4QPOA 1HCRA 2Q51A 2FT0A 2I79A 4M3SA 3TQNA 1CQTA 4BGDA 2V9KA 5AIQA 3G6EI 4H6UA 4NEXA 1U5TB 4V2GA 1TIQA 1I1SA 4NGQA 1TC3C 4NQWA 4N9HA 5F08A 4PQAA 3ECHA 5HOOA 1YVKA 3CDIA 4XLHA 5HXDA 2LKPA 2P5KA 2PMZA 2M7BA 3VB2A 1YMEA 2IRFG 2Z5UA 4B6ZA 4HAMA 2NVQJ 4F92B 2OQRA 4U0WA 3O8GA 3IEHA 3V7CA 3D4UA 2ECCA 3LMMA 3OR1C 3ISZA 1BI1A 5JFRA 1J59A 3GTMJ 1XGOA 1RR7A 3QAHA 3FIXA 4NDLA 4CDGA 1YO5C 3GTKJ 5F27A 1TBXA 3D2MA 2J8RA 3IU2A 3LA3A 2CFOA 3TW6A 4EM2A 1VGYA 1DPRA 2XV4S 1WH5A 3WTVC 3U9GA 3WT4A 2P5VA 4Y7NJ 5HS8A 5CVUA 1I21A 3GX4X 2K9MA 2R4GA 3FM5A 5L3GA 2Z10A 3VSLA 1UFHA 1ZGWA 4FD6A 3RKYA 1WJAA 2DFFA 4AXVA 5M5WJ 2QKMB 1ZKGA 1ZRDA 3S16J 3ZMZA 3G8WA 2AHQA 2K40A 3BQYA 4BD9A 1IN8A 1UAAA 3FX3A 1CGPA 1OYYA 3RAMA 2DBBA 4G8XA 3EC4A 1P2FA 1YS6A 1MH3A 3DFGA 2JA6J 4KSAA 4LQGA 1XFOA 4NGMA 2EK8A 3BG7A 4A94A 2MLGA 4ZX9A 4Y4RA 4AVPA 1CG2A 2HTSA 4BE0A 2YPRA 1QSTA 1YLEA 1AU7A 2XAHA 4A3JJ 2CUJA 3BPXA 5LD2C 8CPAA 2HWVA 2R7UA 3VFZA 5I4MA 2RV8A 3LODA 1KYWA 4HLXA 3CCQI 2AFOA 2CTBA 3L2VA 2M34A 2LC2A 2J5OA 3DXJF 4ZX8A 3SJXA 1LE8A 5M3FJ 1ZG5A 2HXOA 3CLOA 3LFUA 4G6TB 3MKWB 2EILH 4ZDLA 4ETSA 3CXPA 1X19A 3ABUA 1F2OA 4C7HA 2XB0X 3H3UA 3R9FA 1UG0A 1TW2A 2CO5A 2DA6A 2LY2A 4KIGA 2CWEA 4M3BA 3ZGKA 2Q44A 2REEA 3RYOA 4CGNA 4R7MA 5GTHC 1BAVA 2CYYA 2KDZA 4AVCA 1R23A 4FISA 3FRMA 3FMQA 3LSHA 2XB5A 1ULYA 1B6AA 3KI9A 3I4NJ 1MMSA 3C18A 4A3EJ 2BV6A 2EV0A 4IHWA 2JBJA 3RSNA 1R1VA 3SDGA 5AONA 5E20A 1RETA 5LGUA 1F4KA 1B8IA 1M4GA 3LOCA 4CICA 1YI2I 3CCEI 4JBAA 3T8WA 4UCNA 3CC7I 3JTHA 3PJRA 3QODA 4ZH4F 5FFZA 1IXSB 1HSTA 1PYTB 1IO2A 3Q0UA 4S0HB 2A5YB 2ZSHB 3PQKA 5ILVA 3RZDJ 2CV1A 2PX9A 5FRMA 2C27A 1B72A 3H5AA 2FVGA 3QOEA 1Y0YA 3F0AA 2F4MB 2H6BA 2VQLA 1PU9A 2VASA 1HBXG 3GFMA 1YX0A 3KASA 5GPCA 5JLWA 3R0AA 5L3EA 2E2IJ 1S9HA 4FE4A 3CCYA 3HUVA 4GM5A 4IUSA 4MCSA 1ZK8A 3QPTA 4A3LJ 1ERDA 2GLJA 1MJ9A 2EWNA 4M6YA 2IMOA 3S15J 1WJBA 2JVGA 2GOXB 1FOKA 2ZJQF 4CXFA 3H5ZA 1IZ1A 4CUGA 3OSFA 1IG7A 1HDDC 1ZN2A 3FXTA 4ZYQA 1SFKA 4AVZA 5FROA 2O9LA 4MFQA 3OYAA 2M8EA 5ILSA 1TW3A 3LL7A 4NGPA 4D5CA 1I3QJ 1S72I 2ZW7A 2EFWA 3KP4A 2O53A 1D0ZA 1V5EA 1D5YA 4P55A 1T98A 1J7KA 1R4MB 2G9WA 3GUDA 1HDUA 1SVOA 2IS1A 3HSFA 1IICA 1I5ZA 1SD7A 1BIAA 2B0LA 1I12A 4JZ0A 3W2WA 4RI1A 2VBWA 4YFNF 1Z67A 1YITI 3RI4A 1ZYRF 5KNLA 2BY0A 2L4AA 2PFBA 2NMTA 4XONA 1OCCH 2DMQA 2Q4ZA 3B3TA 2VOPA 3B6CA 4G1PA 4AG7A 2DA3A 1V3FA 2LF8A 3DWLE 1XS9A 3PNTA 4MFEA 4XPDC 3HSEA 3K4JA 1FOXA 1K78B 1LRZA 5CKTA 4XSZF 2KIMA 5CQGA 3GTQJ 3Q0WA 3JRDA 3NEUA 1ELMP 1YLFA 4FE7A 4RGSA 1H0MA 1ZAOA 1MW7A 1JWQA 1UJ8A 2MBFA 3BG9A 1ETQA 4NC6A 3J81Z 2NSMA 4ZYEA 1ZGJA 3BQZA 1X10A 4Y15A 1N78A 5EYRA 4JOMA 1ZLKA 1Y8QB 2OPTA 2RGVA 1S60A 2DXIA 4CYOA 3IJ3A 1YW9A 2OAZA 3BCAA 5LGNA 4XLNF 2B7EA 5K5QA 2COBA 1I6XA 4QIWN 4C68A 1TWCJ 3RYPA 3HOXJ 4ZYHA 3LWUA 4OLLA 2EZLA 4LQ6A 4J00A 5A28A 4MCRA 3UNGC 3Q9SA 3CP2A 3MKLA 4D9JA 2M3AA 4DW6A 5LYLA 4E7JA 3P2HA 2DT7B 4F7ZA 3PIOF 3CCJI 2HGCA 4HQEA 4BDZA 4PXDA 2NYQA 1HDPA 2QSFX 1R5HA 3W6KB 4B3XA 3H5NA 2K27A 1CPSA 2QSGX 4P4DA 4MQ9F 3DQVC 5EZHA 5ED4A 2OTJI 2L54A 3FKIJ 2FOWA 4A93J 2QQ9A 2QM3A 2A6TA 2M45A 4HZFA 4M3GA 3OS0A 2JDDA 2B4BA 3DKXA 3H92A 3HKZA 5F04A 2M30A 2V1DA 3VH9A 3FZVA 3HB9A 3KP6A 3TW7A 5DWMA 2ZMEB 1V5GA 2GA1A 1S7FA 5D5VB 2UXXA 3ZMDA 3MD2A 2O8KA 3O2PE 2NS8A 5K5OA 4ONWA 2HOSA 5IYDJ 5K8MA 4R9MA 1SMYF 2ECBA 4WF2A 1CP7A 3SZPA 2L3DA 2FE7A 1S7AA 4QWQA 1IGNA 4FQGA 4MO7A 5H6RA 5E96A 2L7FP 3IH4A 2ELJA 4UV8A 1MIJA 4CAVA 5G1ZA 3OYJA 2CXAA 2FIAA 5EC4A 2LKXA 2R5ZB 2F2EA 2DA4A 2WB1N 4HRIA 5B1BH 4WX9A 5JPHA 3D7DA 4KORA 1CF7A 2H6CA 5LHGA 2FUG2 3RZOJ 4RN7A 3ZOBA 2AFZA 3JTKA 2XSDC 2ZENA 3FK7A 3EUHA 2CS3A 3EUHC 4UVAA 4A0ZA 4C3JJ 2LD5A 1U8BA 2Z3OA 3FH4A 3C26A 4KOVA 1UCRA 4PV6A 2EINH 5EMIA 4BEHB 2BHZA 3D67A 3V7SA 1XCBA 4JK1X 2LREA 4MHNA 3I9V2 4F3QA 1LVAA 2CU7A 4LD5A 2QKLB 4RDUA 1OFCX 2IS4A 1FP1D 4EEFG 1R49A 4QVTA 3V7ZA 1VQOI 4WCGA 3BI1A 5B3SH 2XAGA 3L2CA 2RREA 4KVME 2Y69H 2A6HF 2WAFA 2J9AA 4A33A 3ABLH 2XROA 1JKPC 4ONUA 1IXCA 3ZQLA 3ZQHA 2E1CA 3PSIA 4JX4A 5D8LB 3PB4X 3J80K 3FXKA 1RTQA 1R6RA 1IC8A 3WTYC 1Y7EA 1YJNI 3A1YA 5BWAB 4EJUA 2RB7A 5JHUA 2K7LA 5LEKA 5LHHA 3DCFA 4D7NA 4RUHA 2KPMA 5EEHA 1Z7UA 4RB1A 1DU0A 4N4OB 3PB9X 4RA2A 1E3HA 3F3XA 1IUYA 3ONQA 2HZTA 1ARMA 2JSCA 3T9YA 1Y56A 2VQCA 3U21A 4N0BA 1LEAA 3KGQA 1Z3XA 2NOJB 5DUIA 1X3WB 2OU2A 1NTCA 3EDPA 5JHFA 2VT3A 4EJVA 1OQYA 2Q2EA 3VSKA 1LVKA 4OU0A 4B4CA 1RR8C 4F6AA 2DXQA 1VI0A 1USSA 1WRJA 4IAVA 1YRNB 2UZKA 4II9A 1WI9A 2HNHA 2ETHA 3ASNH 5EJCA 5FRNA 1IOIA 3TC8A 1KU7A 1MJBA 2FSWA 4ZC3A 4FX4A 5KHDA 1PUAA 2IA0A 1B6BA 4QPQA 3C2BA 2WUUA 4ESJA 3QU6A 2L9RA 5J8CA 2HQYA 5FLXK 3ISPA 4M73A 4RMNA 3VYTB 4C3HJ 1K7AA 3CPAA 4Z65A 4RLQA 3S2WA 2VJ4A 4UWIA 4UV9A 4XNHC 4OAEA 1QSOA 2PSWA 3PO3J 3WODF 4GYGA 1YW8A 3LMSA 4BMHA 5HNHA 1EA3A 3S2HJ 2X48A 2VI7A 1NG6A 2FQ4A 1OYIA 1OKRA 4M6GA 2A05A 4P45A 3WTUC 3S2DJ 1IN7A 5CYVA 2BYVE 2ZW4A 3F8MA 5H86A 3N97A 3JRFA 4B3AA 5H2FC 3FIWA 3DTEA 2ME0A 3BCBA 4A37A 4ZBGA 1MK4A 2DDBA 3KP2A 3ERMA 1LAPA 3BZ6A 1ON0A 4A39A 3BR6A 5E1ZB 2KHMA 4P10A 3GLLA 4LLGF 4CGZA 2ZEEA 1LFUP 2A07F 4ZTFA 4QC6A 4EM0B 1MBHA 2ZBKA 1MZBA 3GIUA 2P4WA 1FOYA 3ECOA 4MFJA 3G4SI 5TGTA 4GDFA 2ICWG 9ANTA 3BR1A 2QMLA 2ZOGA 4IL6C 1Y8RB 4V19K 2L02A 3KZIC 4OAZA 1JGSA 1GUUA 4DNCA 5HVQC 2P6TA 2BY3A 3JRIA 3MMYB 3CCRI 1G3YA 2M4KA 3M8FA 1QMUA 2CFXA 4XR6A 4DBRA 4G7HF 2G9DA 5D29A 2E19A 4OIOF 4ESBA 4XICA 4XLCA 3RQIA 1D1AA 1XSDA 1IN6A 1W5TA 2AFXA 5E79C 1YGHA 3QNVA 4WJBA 2KFDA 3CESA 3SQNA 4A0YA 3RKWA 1HC8A 5E3OA 4CAEA 3I55I 2OZ6A 4HX4A 1Z6RA 3WHCA 2DPDA 3SFIA 4Y49B 4Z6YA 3SZGA 4HF2A 2K9SA 4CAXA 2KIFA 1QRYA 1ETYA 1YR0A 1L3LA 3K4KA 1VQ6I 4BINA 1PUFB 1XC5A 3MQ0A 3BJOA 3ZN0A 3CPXA 4UY8I 3G73A 1XMXA 3RCOA 1LFWA 1GXQA 4PSWA 1XOVA 2G7UA 4S05A 3D5LA 4P4BA 1ARLA 3IL2A 1VQKI 2GM4A 5FVJA 4M3FA 1S6LA 2XF6A 5HLIA 4MJ8A 3QYEA 3OIQA 3L2RA 2B4DA 3O6BB 4UXNA 3E6CC 3TT2A 4KFCA 3E5XA 2IW5A 1YREA 3E6MA 2G7HA 4UHTA 1KWMA 2CGPA 2V4JC 4DGWB 2EFQA 1AHDP 2GXBA 1LFPA 1WJFA 4XOPA 3RTRA 2PJRA 4MHDA 3H0GJ 3SXOA 2KRFA 2KRCA 3ASOH 3LQRA 2WAQA 3VODA 4U0YA 4IRIA 2XPWA 5ICEA 5LRSA 1GHEA 1BPMA 3D7GA 1OCPA 4PJLA 1W1WE 3FXJA 5LGTA 2QEXI 2BGCA 4E7IA 2DMNA 2H1LA 4OC0A 2EK5A 2POKA 2ISYA 2MC3A 2PJ5A 4O6JA 4FD4A 2GIVA 2O6GE 4IF5A 3KKWA 4UUVA 1XN7A 1SFOJ 4UNOA 1YTYA 2QBYB 1E3PA 1XRYA 3S6HA 2KP6A 3B7IA 4EJTA 3W6VA 3DTIA 2ZEHA 2ESHA 1R5ID 4UUTA 2HYGD 5CVVA 1YOVB 2VOOA 1USTA 2ZEDA 2HVQA 4IK2A 3P9KA 1IXRC 4UWJA 2FQ3A 2RQPA 2BOAA 2W7NA 2FD5A 1VF9A 3PB7X 1GDTA 5J1QA 1FBQA 1XX5A 3NQOA 3TE4A 3B6AA 2GZWA 3GVAA 4CGLA 1FIAA 2HKOA 2JT1A 2OZUA 3DEEA 4F0XA 4E7SA 3H9JA 3R61A 3I4PA 3VPRA 5EEAA 4GXHA 2WYRA 1MSEC 4CCJA 4OWRB 2LK2A 5BS6A 3GTGJ 3SJEA 3M8EA 3GZ6A 3VWEA 2DMPA 2HYJA 2VPLA 2ABZA 2JDCA 1TWGJ 3I5UA 3OYIA 2JA2A 3GFLA 3SJMA 3CF5F 1YW4A 4CYNA 5FLXZ 3Q9VA 3U1KA 4AU7A 1P7JA 2XVCA 4KOUA 4J19A 1AMPA 1Z4RA 1IYKA 2R93J 4IOAF 2JQ7A 4M6VA 2JEWA 4YFKF 2X6XA 4PDKA 3RYRA 2B9SA 1TKJA 2A6EF 2O7OA 4A2UA 4O3MA 4M3EA 1A6IA 4B1RA 2VUMJ 3BTIA 1KUYA 2IXSA 3K1NA 4KDPA 3DV8A 3RJPA 5E17F 3WGIA 1WVRA 2CG4A 1Q1VA 2ZJPF 5D5XB 2Q1ZB 4OC4A 3EPZA 2VZZA 1IRGA 2M2EA 3SEQA 4A0XA 1IJWC 3ZQQA 2DYSH 2DOEA 3VYRB 2LH9A 4II2A 3HXLA 3RNZA 1UMQA 2PMZN 3F8NA 4BHBA 2FU4A 1QU3A 4HNUA 2O0YA 2AFMA 1BN5A 4NGNA 3OV8A 3HOZJ 2UUZA 2IPQX 3F8FA 2YU3A 2KKOA 1W5CC 4XOTA 4C2TA 3HRSA 4EMSA 5C4XJ 3KZWA 1WGXA 1K4SA 3S1RJ 3ZPLA 3M4OJ 4FTHA 2R7FA 4XN0A 1KA8A 2YGWA 5DWNA 3V7RA 4EV0A 2EV5A 2K5TA 2V8HA 1ZRCA 2HQNA 4CYQA 3FISA 2X7BA 4BXUA 2JUGA 4N9IA 5LRGA 1SVMA 5G22A 2XIGA 4D0PA 4M85A 2F5CA 3I0TA 2FIWA 3K7AJ 3KQXA 1K78A 4KISA 1S5KA 3TO6A 1G4DA 2EPFA 3ESWB 3BG5A 4IXAA 4OOIA 4DOZA 3PNYA 2DFHA 1D1CA 2IJLA 1QQIA 4WK8F 2PJ8A 4MHYA 4LITA 2GREA 4LB5A 1IUFA 3HGYA 1XB4A 4BY1J 3JCUC 1MMDA 4KUAA 2P81A 2KLOA 1YHQI 4BBHA 2E1OA 5JR3A 4BJTA 3FF5A 1M44A 1S7KA 3PQJA 3F72A 2VJ5A 3FK6A 4FUUA 1ZR4A 2WPXA 4OP4A 3ABTA 1GV2A 2K5CA 4CGMA 1G8XA 5FJ8J 1PJRA 2DYRH 1BW5A 5CVJA 5J47A 1BIBA 5LBQA 1R22A 4UIAA 2J5PA 1U9NA 4KIFA 3W91A 1S3JA 1ORKA 1R00A 1W7PD 2CUZA 5EDNA 1ZO0A 2ANPA 1TWAJ 3HRTA 2NS7A 4R79A 5KAFC 5I0CA 1Z8WA 2IA1A 4BQNA 1FTZA 2PJPA 3U1DA 4CYPA 1XGNA 4Q7AA 4Y52J 2RDPA 4M6XA 3CD6I 5E18F 4I01A 2DA5A 3COAC 1Z1DA 2Q0OA 1A35A 2Q04A 1ETOA 1ZREA 2JMWA 2KCWA 3C1DA 1PVEA 3NA6A 2V1XA 1RRJA 2PDOA 2V6EA 1LOKA 4RM3A 2FXAA 2NVXJ 5CPRB 1IGBA 2BZTA 4CRZB 3K2AA 2ZMEA 3SDBA 2ZMEC 3FJUA 1O3QA 2MLKA 2W00A 4PK4A 2YNCA 2YNCC 3RKXA 3ROUA 2L5QA 3JRGA 2RNJA 2XGCA 4MTDA 2VLAA 4K30A 2CQKA 4BE2A 3E3VA 4BUPA 5AG5A 2PIZA 3OYDA 1YJWI 2EQRA 5HVHA 2EZKA 1R1UA 2W82A 4B48A 2G3TA 4HPSA 3FMCA 3PO2J 1QO0D 2Q0YA 1ZG8A 2KMUA 2PVWA 5GCNA 2IBDA 4PPZA 3T5XA 1OCTC 4H4KC 1KU9A 2HOEA 3LACA 1SMTA 2ESNA 2ZB9A 3L7WA 1NK2P 4EWTA 1XTAA 3GTLJ 5GPAA 1VQMI 2ZEPA 1JUMA 1T08B 2JTVA 4HQMA 1YLOA 1G6NA 4IRGA 2VL1A 4H89A 4C2YA 3BR0A 2LBFB 1B59A 1LAMA 4B14A 1VZ0A 1HW2A 3HDDA 5JQ4A 3DPLC 2WTEA 2PBIA 3LSGA 3TMOA 5EF6A 2Z3KA 3T8RA 3PFEA 3EUKL 4G94A 3JSOA 3CC2I 4UB6C 3J7YJ 4B5OA 4A31A 1Z77A 1T2KA 1BR2A 3GFJA 2VONA 1AYEA 5BQTA 1GV5A 2MYSA 1IYLA 1TXRA 2NVTJ 4BH9A 1X3UA 2STWA 6PAXA 5D8NA 3RZAA 3IWZA 3S1NJ 4BBRJ 3SI0A 4QTRA 2UV1A 5EBVA 4B13A 5HDKA 4F9UA 4J01A 4KS9A 4I09A 2E71A 1K79A 2IAIA 5CVRA 5M5XJ 4MY3A 4M71A 1ITYA 1WJDA 2AFUA 4CGOA 3PSFA 3O3KA 3V8KA 3DTKA 4I6ZA 2D45A 1Z0XA 2OCEA 1PUEE 4KLVA 2KIQA 2O8XA 4AUXA 4P44A 1HW5A 3GW2A 2MD0A 2P6SA 1ETKA 5FKNA 4D1QA 2ACJA 2QYOA 3HTUA 2E2HJ 2ZXWH 1A04A 3V4GA 3EY5A 4MTEA 2PR8A 1JGGA 1X4PA 4HOBA 2CW7A 2Z3NA 4U9ZA 2E34A 2XPVA 4PJNA 1IRXA 1BR1A 2B63J 2IGMA 1R5GA 2MD5A 3TKYA 1BLLE 2OBPA 1UHSA 2K86A 3KYLA 1GLNA 3PM1A 4LG0B 1HW1A 4RAGA 1Z8XA 2F6CA 2K85A 4HF0A 3NH8A 3BP8A 3KLNA 2VXKA 4GS4A 2OD5A 4OKOA 3KHZA 4NGRA 2HUZA 1NH3A 3OYMA 2Q43A 4IRHA 2K4BA 1TT5B 2WC2A 2TCTA 2FBIA 4A3KJ 2PJ0A 2F5VA 3PEIA 4OIWA 2DMUA 3MVPA 1BI2A 1TKHA 1JKQC 1W7PB 2B5GB 1EH8A 1ENHA 1N71A 1BI3A 1VQ9I 4KMFA 4A3BJ 4MY0A 5AG7A 5E8IA 2EO8A 1KONA 3AG4H 4LK0F 3WTZA 4CCKA 2HVSA 1HA8A 2Y48A 4C2MJ 3ML6A 1AA7A 1H8LA 1IV6A 2Y0SA 1VQ5I 1IF1A 4GYIA 4OIRF 2H8RA 1BW6A 3CC4I 3C7JA 1WJEA 2MSYA 3HKZN 1KZHA 4RB3C 3M1CA 3CF2A 4B12A 2OH1A 1M1DA 2YS9A 4E7LA 5G21A 4B44A 1M4DA 2AFWA 2V7FA 2EH3A 4UF4A 4FHTA 4LGWA 2ZNZA 1GT0C 4OC1A 1W5SA 2V8DA 2TDXA 3L9FA 3G2BA 2D2WA 4MRIA 4CS0B 3CMMA 3K1PA 1KZFA 1K61A 3MN8A 2K9QA 2P5LC 1FNOA 4BQQA 2YR2A 2Z2SB 3BT9A 2CY2A 2VB6A 4RGUA 2M4GA 2MH9A 4LMYA 4ZYAA 1SANA 3PBBA 1N77A 3IWGA 1FOWA 1QBJA 2JLMA 3DLJA 5FO5A 4YELA 3ZMUA 1D3YA 3HOTA 3TP0A 3FXRA 1GVJA 4CYDA 1CBXA 2AJ6A 1PP7U 2BVMA 3K1MA 3K4CA 2QGUA 4C2ZA 4CGPA 1SD6A 2VKEA 3HRMA 1LDJA 4LFUA 3QPHA 4F52A 3I64A 5BPIA 4KOSA 1QPIA 5K7FA 1X3ZB 5IV0A 4CSWA 2DA1A 1WSUA 2M0CA 4FX0A 2I00A 4RAZA 5LHIA 2ODFA 4P9UA 2JPCA 1MSFC 3P9CA 2NNYA 1A5JA 1TF8A 3KPHA 3GTPJ 4Y49C 3IRQA 1YX5A 2ZKZA 1RUNA 1R3NA 5D8KB 4MNUA 2E7XA 2V26A 5K5RA 4ENNA 3TBIA 4NGSA 2VT2A 2MA3A 1Z9CA 1O57A 2DU9A 2F4OB 1PUFA 4PXBA 1Q2YA 4O5VA 1FT7A 1MKMA 1ZG1A 2HQ5A 1R43A 1Z91A 1B9MA 1XG1A 4CCMA 5F0HA 1P92A 3M1EA 2GBYA 3SXYA 3CO6C 2P7CB 4IQ4A 3LQQA 4HNVA 4OMYA 3KL9A 5IB9A 1BJAA 4X6AJ 4L89A 2L9SA 2VBQA 1J9IA 2DLLA 1S3ZA 1T56A 4IVNA 4NBQA 1FT9A 1R7JA 3SHPA 2Z3PA 3DGVA 1FJLA 4UCMA 2COMA 3K0LA 4UVCA 4AC0A 2WV0A 1MBKA 5GAHJ 1DP3A 3BLYA 1ELLP 4EATA 4QB9A 3OL4A 3PB6X 1EE3P 2Y30A 4F55A 4ZJZA 3HEFA 1Z7LA 3GMEA 3OL3A 2P6GA 2G0EA 4BXFA 3IC7A 2V9VA 3WU0A 3CUOA 2IGKA 1UHMA 2H09A 2XUBA 3OY9A 4RS2A 2F5DA 2EFOA 5F49A 4L9TA 4H6ZA 3AL0B 2F5FA 2P6EA 4UCPA 2VKDA 2BEIA 4E4HA 3F9KA 5C4JJ 1H8AC 4A2ZA 1O7LA 1H9TA 3CXSA 3V8LA 4ENKA 4EGZA 1CX8A 4MQVA 2QBYA 3FBUA 4C3IJ 1NSLA 2OOTA 4AYBA 2Z16A 1OCOH 3L2NA 2HV2A 2ZPAA 3ZQCA 4I0AA 2HDWA 2DOFA 1XF8A 4ZDOA 2FEZA 4XKCA 4L8AA 3SJFA 1TTYA 5H6QA 4KT5C 4S04A 4KUBA 1FYKA 2O4HA 2VBZA 5E1WA 4BDYA 2JA7J 1SD4A 3B3VA 3B8GA 2O03A 5EEGA 3H0DA 2CRGA 4AG9A 5DS0A 3VEPA 3LSRA 2VQYA 2Y9YA 2XEJA 3SFZA 4HNTA 2ZW5A 3S8PA 4HX7A 1VKCA 5FKOA 4MLOA 2R7DA 5K7HA 1DP7P 5KK1A 3JTGA 3R1KA 4AIHA 4IQJA 4PXEA 5ILUA 3KE2A 1R71A 1XCVA 2E5NA 3A03A 4MHPA 4HF1A 4BYYA 3CMYA 2Z33A 1FPQA 4P4JA 1JXSA 4M72A 1J0RA 5LYFA 4KVXA 1AOYA 3E1SA 4XKVA 3AFHA 1MGTA 2PRBA 3HPHA 4KUMA 5E8GA 3EUAA 4PXCA 3IWWA 1HLVA 1LKXA 2AO9A 1YIJI 3EETA 3M8JA 3FX6A 2ZXHA 2C6CA 1O4XA 4IHVA 2XKOA 5DM6F 4ABZA 1J09A 4L18B 4E2AA 2JPBA 1BBYA 1ZRFA 2FOKA 2MG4A 4M74A 1YW7A 4KN7X 5H20A 3E0JB 3GLJA 2BBYA 4B09A 4PSXA 5F64A 3ZMVA 2LG4A 2FSRA 5J8FA 1HKQA 2CIJA 1UZCA 1U6MA 2DT6A 5IT3A 4LLLA 1IOFA 3CUQA 1F57A 3CUQC 3KEYA 2YUSA 3TO7A 4IHSA 4I98B 1R4NB 2R7XA 4R8HA 1DU6A 2EWBA 3BR3A 3M7GA 2ZFUA 3VDXA 5IT9K 1HXDA 3FBIB 1DPUA 1UWYA 4IOCF 2NOGA 3I1UA 4R87A 5F46A 4YFXF 2FMLA 1DDNA 4CRYB 3FBNB 4A3MJ 2R7RA 1I50J 2DODA 4KT6A 2AQFA 4BJ6C 3GFIA 5AIPA 4MHZA 4A95A 1T33A 3MKZA 1K83J 1ZQ3P 3H9GA 3QP6A 4DZJA 4XQFA 1D8JA 1JTYA 4A5NA 2VKVA 1W36C 2I10A 3QYBA 2ZJRF 3PB8X 4WWVA 4M3DA 1RO5A 4C2XA 2HDCA 5DYMA 3I3LA 4L5JA 3ZQ7A 3ZMSA 5EG0B 2XAJA 5HODA 4CCNA 2V8VA 4MMOA 2C6GA 1R1TA 1WJCA 3D2PA 4P96A 3IU1A 2W25A 2FBKA 1U6GA 2ID3A 2RVCA 2QF7A 3I9SA 2GA2A 5J4YA 1F5TA 1YQAA 2J8NA 2WAQN 4PUSA 3U2RA 1I27A 1WQ2A 2L0KA 2ZJ2A 1K4TA 3FEEA 2LOOA 5EGOA 4EVYA 1R36A 3DU6A 1XEBA 4LIUA 4ZYDA 2PLYA 4MFLA 3BHXA 2JUCA 2XKPA 4LK1F 1X1AA 2PJ6A 3CCLI 2P0WA 3S1QJ 2J8MA 4NC8A 4UFXA 2CW8A 3ZMTA 1U8RA 4OIPF 3LAJA 1UB9A 4M9SA 1B8IB 2KL4A 3EXNA 1FMVA 3LSKA 4K3NA 1ZG9A 2R7WA 1VHSA 4R1HA 2E1NA 3HPGA 2VC0A 3REOA 4CCOA 1J75A 4WXDA 2NNNA 3GYHX 4BXXJ 4BU2A 3TTHA 4JYKA 2ZEFA 2BW3B 2R98A 3NRVA 3WTXC 3BJAA 2DQLA 2LP0A 1VHOA 4NSQA 4PGHA 3WC7A 4U5YA 2X85A 3LSIA 3CQZJ 1J2XA 4PJ0C 2RKHA 1D0YA 5ICGA 4GFBA 2N8GA 2M0MA 5J1RA 3AAFA 1U5TA 1U5TC 4Z2YA 3W6SA 2M9HA 1S29A 3V38A 3WU1B 3RPUA 2A69F 5EZGA 5CJ9A 5F48A 1LCPA 4KLWA 3S32A 2WBMA 2L9NA 1ZGAA 1G3SA 3ULQB 3OYKA 4HDVA 2JRTA 5BMZA 3EYYA 3I53A 1HQCA 1V5FA 5DCFA 2PJCA 4BHPA 5E1XA 3GO5A 3CJRB 2EIKH 4OINF 1U78A 3D7FA 1MBGA 4OADA 2K9LA 4L0ZB 3K70D 1RNLA 3LSPA 3FXMA 4UB8C 5G20A 5DD4A 4WXCA 2NYXA 1XGMA 2QVPA 3TFYA 1POGA 2IGNA 5L3DA 2E60A 2EA2A 1U9OA 2IA2A 2EIJH 1WFXA 3HHGA 4BNCA 2E35A 3CZXA 4NXYA 2FX0A 1ODDA 2BY1A 1QSMA 2DDAA 4PCQA 3H3VK 2PCUA 3D5SC 4R6TA 3CCUI 2H94A 2VBXA 2X6YA 1Z6TA 3JRAA 5IY5H 2IVMA 2R5YB 2V9PA 2XRNA 1Z21A 2AXLA 2QQ8A 2MFZA 4MGRA 5KVRA 3JRBA 4ZTJA 4A5MA 4Q47A 4XL9A 4O23A 4H0EA 4P6YA 3OYLA 3VATA 4E7KA 5LRJA 4YFJA 2OZGA 2OC6A 2EFNA 3BI0A 3MFKA 3G71I 4P4EA 3BDDA 1IN5A 1IW7F 1TQPA 3BG6A 2MABA 3BR5A 3MN2A 2Q8KA 3OYGA 3DLLF 1YE9A 1Z8TA 2RNGA 4B5PB 3K6GA 5IB0A 2B58A 3SYTA 4LX9A 1XDSA 4HLYA 4RAFA 1IDYA 1YX3A 1X1BA 2E1MB 5B5EC 5IOYA 5DS9A 2V77A 3UY5A 3ZJ0A 2GXGA 1PYVA 3BPVA 3K4MA 1ETVA 3W2AA 3J80Z 3DLAA 2BOLA 1QGPA 1RKTA 4HA8A 1JTXA 3CCVI 1BM9A 2E36A 4XK4A 2RQQA 1VQNI 1R57A 4AVAA 4KSIA 3BLNA 2CMPA 4MFZA 1LEBA 2MC4A 4QLCU 2HTJA 1TL8A 4Y3OA 1QQ9A 1UFMA 5KCMA 2OA4A 2CQ7A 2FA5A 4HV5A 2X6WA 1HKSA 1P4XA 2DI3A 2HYFA 2BUEA 1XSXA 3D8PA 1YJ9I 1P7IA 3FXOA 4QUSA 4ZGYB 2H1KA 2YSRA 1IY7A 5THWA 2PVVA 4CO8A 4KICA 4W97A 4LG0A 5B66C 3PRTA 4JP0A 3F21A 2WPWA 3HRUA 1WWZA 5F09A 3KHXA 3FYNA 4XM3A 5C44J 4EVIA 3HOVJ 2NVYJ 2VC1A 1FTTA 1SQHA 2LNBA 2A5WA 1UHWA 2XHKA 4FT8A 3DDDA 3OWTA 4K2EA 3G3SA 4ZZLA 3G1LA 2OTLI 2EBIA 4KOYA 4YIFA 4MIMA 3TDUC 3FM3A 5K7ZA 3GYAA 1DTDA 2CJJA 3OYEA 4A6EA 4YIRX 3JREA 2K4JA 4UUSB 4UFWA 1VTNC 3PUBA 4F8ZA 4MI4A 1W7PA 2D4PA 1LDKB 3Q0VA 3Q5FA 4AVBA 4Y33A 4XIDA 2B5GA 4I49A 2BSWA 2PJ1A 2LFBA 2X1DA 4XBFA 5C88A 3DNSA 2AXTC 3JAMK 3B2YA 3EQLF 2A3SA 3VOEA 2LTPA 3WGGA 1YIOA 5IP9J 1CF7B 4ESFA 1ZH5A 3K9TA 3H35A 1I1GA 1TF9A 3IH2A 2L9VA 1TP4A 2O3FA 3FEDA 2HB6A 2Y9ZA 3CXQA 3FVLA 2BEOA 2DO7A 3SZTA 3G3ZA 3EO4A 2OUMA 2JA8J 3OOUA 5FD6A 4M9ZA 3KR5A 5JGFA 1E3OC 3OIOA 1RKWA 4HPQA 4KJZA 3WE3A 1F9NA 2ZELA 3NE8A 4FAIA 1WCMJ 1JJ8C 1X2NA 5JI6A 3H5RA 3IUOA 2XGDA 3NE7A 4J3GA 4X5KA 2Z11A 3IIBA 5ISVA 1SFXA 3E6BA 1V54H 4ON0A 1P9QC 1ZHFA 3AG1H 4NUBA 1BPNA 3I3GA 2F5IA 2ID6A 3KYDB 2HOAA 2PG4A 2KZGA 2KDOA 2W24A 1GVDA 4AIDA 5CPAA 1XBUA 2LMDA 2JJ7A 3B35A 3O8HA 1IRZA 2XAUA 2VE9A 4I0BA 1WH7A 2M87A 5LFAA 5K8OA 3Q3SA 2VJIA 3WHBA 4MCQA 4KOTA 3DBHB 3F22A 2OJED 4UBRA 2Z3YA 1QHHD 4MBUA 2EZHA 3VWDA 3IFEA 1W4MA 1JQGA 2LY9A 1RPWA 3QP5A 2RFHA 5GADJ 1LB2A 3GXOA 1JT0A 2D1VA 1S8NA 1KYZA 2QENA 3QPSA 2W1OA 3W6JB 2W4SA 3BOQA 4QSHA 3WE2A 3B02A 3B3SA 4LG3A 4H2KA 2H8WA 4B11A 2PJAA 3ABMH 4TWEA 4OMZA 4E7HA 2H27A 1G3WA 4G12A 1NMTA 3LD2A 3S6KA 3MZHA 3K9UA 2GAUA 4RB2C 1BA5A 2KISA 4Y13A 1Z4EA 2YNEA 2DFEA 3BXMA 2XC7A 4NCZA 2NRAC 2L7ZA 1SFUA 1WHUA 2RN7A 4JX5A 4RBOA 1HF0A 2OCCH 2FE3A 4XRSA 1Q2DA 1P6RA 2VQGA 2R7SA 2VI6A 3KEOA 3CDXA 3KR4A 1DQUA 1J4JA 4BJ5C 4DYCA 4AM3A 4B8XA 3HIFA 1BI0A 5FB2A 2UWMA 2HKXA 3QQAA 1FSHA 3OWCA 3MKYB 3X2QH 3PZJA 2HZDA 3HZJA 3CJQB 4A69C 1REPC 1L0OC 3C2GA 1MNDA 2LLKA 3C3WA 1MDMB 2FS5A 4CPAA 3HM5A 2X1EA 3SEZA 5IYBJ 4OC2A 2LR8A 3D5RC 1NK3P 4MEXF 1HKTA 3TOBA 4V2FA 3DEUA 1ON1A 2XEIA 2MGQA 1Q7LA 3W2VA 5D5UB 1QZYA 2W48A 3FMRA 2I5UA 4G6QA 3WC5A 5K8NA 1VIXA 4E0AA 4OIDA 3S9NA 3BJ7A 5LYIA 3J7ZI 4Q38A 2IS6A 3MGDA 2GE3A 1MBJA 4XLFA 3F6OA 2M7AA 5IP7J 5E3NA 5GP9A 1FBSA 4D5FA 2R5ZA 1F36A 3S9MA 4W1UA 2PJ2A 1T0FA 5K8PA 1T0FC 2Y0SN 3MCZA 1QVTA 2LVSA 4OAYA 3QU3A 2DQRA 3MRUA 2R7VA 1XMAA 4U7BA 3JRHA 3BZCA 3BTCA 3RDIA 4JX6A 1FC3A 2X0LA 3IHUA 3OMYA 4IHYA 4F91B 1O7FA 2R7OA 2V1UA 3M3YJ 1QSNA 3NAUA 3WG9A 4BEHA 1JHHA 1I39A 1X12A 1U2WA 2W84A 4NNJA 3LNQA 1QA6A 1S7LA 3E97A 3GWZA 2EJRA 2P8TA 5ICFA 5F1RA 3SI1A 3FDYA 1O3SA 3J7AY 1IDZA 4UVBA 3DSBA 2VQHA 3J81K 2TRTA 2Y2ZA 2LRDA 1S5LC 3IC1A 4EMEA 3LA2A 4HEA2 2Z99A 3JAMZ 4KYWA 4KVOE 4MHGA 4GCVA 4AD9A 4KSFA 5CLSA 4BS9A 3MZYA 2GOMA 2XRLA 5JVGF 5JLXA 3IO1A 1X1CA 1NSAA 2XEFA 1X2MA 2AQEA 3EFAA 3HBLA 2B3VA 2LDUA 1MBFA 3KZZA 2GXAA 3JW4A 5DTDA 1FMWA 4LLNA 2B4DB 3A9LA 3IKVA 3FF3A 2JRMA 2EUIA 3CTAA 1XPXA 4X1EA 1B1BA 3W6XA 2P6FA 2E7WA 5LLQA 1FIPA 4U88A 2DF5A 4FCYA 3GBGA 3JUWA 2PJRB 1RESA 2DTRA 2G0BA 3K2ZA 2FRHA 2JN6A 2M1BA 1ETWA 5K1YA 3HOUJ 2ARHA 1Y6IA 2AFSA 3PNVA 2C6PA 3KX2A 2HDDA 3ZXSA 2DJNA 1Z3YA 1TZLA 5F47A 3UR3C 2FF4A 4WWCA 2OV7A 1TT0A 2L7MP 2WADA 3KP5A 4DUKA 3DBRB 5DD8A 5E3LA 1WK4A 1YRNA 3LSMA 3G1MA 3TO9A 1OJLA 2HVRA 1D0XA 4IPAA 4KMUX 3K2KA 3E7LA 4X0GA 3DKWA 4PZJA 4L0YB 1A36A 3HJEA 1VQ4I 2C6YA 1DE4C 2OF7A 1X1PA 5LRKA 5DUKA 2ZW6A 3H8GA 1M1EB 5EG0A 1D5VA 1BO4A 2HPMA 1G2HA 3H36A 3S1MJ 3T1BA 3MWMA 3D66A 2JK3A 2F4IA 2PMUA 2X51A 5E3MA 3ZZIA 3HSRA 4HX8A 2IP2A 2FXFA 5HDGA 1W0UA 3ZQFA 5BOXA 2X4HA 3T0YA 1MMNA 3OYCA 2R7ZJ 2ZNYA 4IF4A 3VWBA 3DR6A 5L3BA 2DFIA 2DOAA 3L00A 3PUFA 4GRIA 4CZZA 1I6HJ 1PCAA 2R3SA 1WPKA 3TP3A 1N25A 3HTSB 4I02A 2BL1A 2CUFA 4HKFA 4QBJA 1SEUA 1Z9UA 4HSRA 2L01A 1H88C 2XDVA 2D5VA 2R7TA 1B4AA 3WU2C 4A3CJ 2ME6A 2PR1A 1JUSA 2V8GA 2DEAA 5M5YJ 3TEDA 3CT9A 4AYBN 3CDLA 3DF8A 3KIOA 3D7HA 4CYCB 3DR8A 2BW3A 1JKOC 2QVOA 3S93A 1QSRA 2X6OA 1G3TA 3H8EA 5TISC 2EB7A 4B43A 1XDUA 2VE8A 5DCMB 1FSEA 3QOPA 3HC7A 4BQOA 4I2OA 3HUGB 2PRQA 1GYTA 1WI3A 4XSXF 1O3RA 3R9EA 1FBUA 1ZR2A 3A02A 1IN4A 3WTWC 2WWYA 1L0CA 1FWZA 3LFKA 4MFDA 5J40A 4CZCA 4YIIA 5FKMA 5FKKA 3GZNB 1U3EM 3QYFA 3WTTC 3RKQA 3CLQA 5JVTA 3IH3A 3IWFA 4XN3A 4X8IA 1AKHB 2A61A 2W57A 2Y75A 3I59B 3QPLA 3R4KA 4FASD 1P4NA 2VEZA 3IP4B 2GLFA 2DN0A 1ZARA 2JSPA 3ZQIA 4Q36A 3CDHA 2FJ1A 2CF4A 4KZTA 3TGNA 3SXNA 1QVUA 4FWUA 2I3CA 1VHEA 4P9FA 2KIUA 1YFHA 1EH6A 3NARA 3DPTA 4EJWA 3KEQA 1OZPA 2OB0A 2WSAA 1A31A 5F6FA 5IPAA 4ORFA 1EV7A 5DDGA 1ZELA 4AIJA 2W85A 1XD7A 3TX8A 3JR9A 4M9XA 5M3MJ 2ADUA 1S7OA 1E17A 3OYFA 2CH0A 1GXPA 2OR4A 5DEQA 3MAJA 7CPAA 3M07A 3W3CA 2R5YA 4MEYF 3IAM2 3IGRA 2QQAA 4E6KG 3OS2A 1RIOH 2L2OA 3BTJA 3HOYJ 3PFYA 2R0QC 2CSOA 4DBQA 1XE4A 4OMEA 1BJZA 4IHTA 1YK3A 3JVNA 3OYHA 1T38A 2DJIA 2HU9A 3FHZA 4G9YA 5KTAA 3FXUA 2JVHA 2CQXA 3WABA 4B5PA 1RC9A 1KUXA 2HI3A 1IAWA 1OCZH 3FWEA 4R76A 1IRFA 1H9GA 2Z9OA 4RGXA 2F7VA 4XPLA 5F0CA 1MH4A 2AE6A 5KAIC 1V0CA 2PE3A 2E1MC 5HLGA 1N75A 4M6HA 1LPQA 3P9IA 4X2TA 4EFDA 2QQBA 4A12A 1TKFA 2EBJA 1W0TA 2XEGA 2FNPA 4RLFA 2ZC2A 2FCKA 4A6DA 1JUPA 2EZIA 2K02A 1S7NA 1Y0UA 3LSJA 1QZZA 1Y7RA 3KETA 3V8IA 4EM1A 3A01B 3A0BC 1PDNC 4JJXA 1I3AA 2CTCA 3D68A 2EVNA 4ANJA 4LB6B 1APLC 1NE9A 1OMIA 3K10A 4L9JA 5IX3A 3TDZC 3GEZA 1TWFJ 1LQ1A 2DA7A 3ZQGA 3F8BA 3JSPA 3R60A 5DV5A 4PFOA 2KZVA 4L5EA 2EA4A 4IO9F 5ELYA 4YEJA 1BR4A 2ZEMA 3CJNA 1ZLIA 1T39A 1XSVA 3N4MA 2F5EA 4UIBA 3TCVA 5FGMA 4ENJA 2MW8A 1Y1VJ 2KQRA 2XF5A 3E6DA 3MEXA 3CO7C 2IJZA 4E8OA 2JBKA 4P1WA 1KUVA 1YSJA 5J4VA 3HOSA 1T8IA 3N7ZA 4L9VA 2FNAA 4OC5A 3NH4A 3S17J 1LDDA 3GTJJ 4A3IJ 3GLXA 1E0EA 2ZEOA 2KRHA 5FKLA 2KJCA 2FBHA 4NQWB 2VXDA 4KOXA 2Q7SA 2GFQA 2PEXA 2QA4I 1HDQA 3F8CA 2R92J 3I58A 1ZG7A 2XF7A 5HLTA 4ZY2A 1AWCA 2QUFA 1WZ2A 2Z0ZA 4UUSA 3PFIA 2IS2A 4KIBA 1FX7A 4C30A 3FB3A 2DK5A 2O5RA 2PJ4A 2P7VB 1JHFA 1LUJB 3CMEI 2PI0A 4JWPA 4HW0A 5C3EJ 3L09A 1X58A 3C2HA 5B1AH 2ELKA 3UKGA 2GLOA 1B87A 1KQ8A 4W9YA 2WY7Q 4AB7A 1DGWY 2ZFWA 3LSTA 2YX7A 4FETA 2WA0A 4IHXA 4BE1A 2BXZA 2YNDA 3H4QA 2DT5A 2EV6A 5HMNA 4MFPA 5CNPA 4WXHA 2ATRA 3WR7A 3J7AO 1FY7A 2CNTA 2K3PA 3CZ6A 3HYIA 4II3A 4EJOA 2VXZA 5J1UA 2ZXJA 2IQ6A 3QWLA 2A68F 1EJ9A 3A2KA 2ZEGA 1DUXC 2CV0A 5KTCA 3GTOJ 4JXQA 4YU9A 4BBSJ 1R9TJ 3TOAA 2Q4VA 1JI8A 5AGEA 3P5JA 2LYCA 5FLVA 4UFVA 4R3LA 2ZCWA 1RUOA 3IAS2 5GAGJ 3F0CA 5ERIA 3OIPA 1R58A 1YVOA 3K70C 2VIXA 1FP2A 1TWHJ 3DU5A 5HVFA 3A0HC 2CQQA 2D1HA 4NB5A 4E70A 3K69A 1Z2LA 3P2FA 1K4JA 3ISXA 3TL4X 1K6YA 1KQ0A 4Q48A 4DZPA 3IKTA 4RS8A 1G59A 5FLMJ 3BG3A 4HYEA 1WKMA 2HQRA 4ZZDA 3OOPA 3L2QA 2REFA 3NH5A 1LE8B 1U0JA 2OZHA 1VFCA 4Y17A 2E2JJ 3GKRA 2QSHX 2AS5F 5J1YA 4GXOA 2DW4A 2LKSA 4MFKA 2XSJC 4XMYA 4JQFA 3GY9A 2O61A 4CA0A 1OCRH 4EQQA 1B9NA 4PJJA 4AIKA 4UEEA 3BZKA 1WWXA 2DCEA 3KLOA 1YG2A 3KQZA 5D5WB 1RXTA 3AG2H 5FFXA 4M6IA 3RPQA 2VBYA 1OPCA 2JA5J 1LJ9A 2LSOA 1BOBA 4YG2F 3OS1A 1Y0NA 4DYRA 2CW0F 3AG3H 5HS9A 2C1CA 3V8JA 4NGTA 3HG9A 1YYVA 4OC3A 3BY6A 4I76A 3I71A 3KP3A 4G6DA 3EYIA 4L9NA 1D8KA 3ZP5A 2BHYA 3QRFF 3B3WA 1UELB 4CAFA 4DYOA 4YGOA 2WAEA 2XGXA 3K4LA 5F1JA 2XASA 4A30A 2NS0A 2V79A 1BL0A 2D4OA 3LWFA 2MH2A 4JLYA 3RO0A 2EIMH 5HLHA 2Y31A 1P0HA 3IRRA 3L1PA 2GU2A 2PJ3A 1ZLJA 2VN2A 3FKJA 4PGGA 5D6EA 5HS7A 2DPUA 2QECA 3CJTB 1PP8F 1VQPI 1FYLA 3S14J 1VQ7I 3PL8A 1B72B 2WB1A 4G7OF 4A32A 3N05A 3BTLA 2VKHA 4GGGA 2DPSA 1Z8LA 4R8FA 5KTDA 2QYVA 4U87A 2LY1A 3BWGA 4I7HA 1Y1WJ 4C9YA 4G7ZF 2BO9A 1A6QA 3FXLA 1MDMA 2ELHA 5LRRA 4R57A 1P4WA 1V55H 2HXIA 2VODA 2VL8A 5J6XA 2EK9A 3SJGA 1SAXA 4FD5A 1ON2A 3RBUA 1XGSA 3AKZA 3HOWJ 5HVGA 3L2UA 1VQLI 2R7QA 3S6FA 3I54A 1ONVA 3WTSC 2BCOA 3D1NI 3F8KA 4KOWA 1LFBA 4XRSG 5IOZA 5IP6A 1LANA 1JE8A 4JYWA 2R8VA 4L5IA 5JH9A 1IU8A 3PIPF 4PJMA 1T95A 1CJWA 1Z05A 4ITVA 1JKRC 3S6GA 2ZOFA 4HG2A 1IIDA 3DEWA 2ZO4A 1M4LA 2IEKA 2JZYA 2Z3MA 2XGEA 3ABKH 2PJ9A 2Q4YA 4Q5SF 3FHNA 3ERED 4XKWA 2JEVA 2CUEA 4YWYA 3S3NA 2XPUA 1HSJA 4N4NB 2BXYA 2BE5F 1OBRA 1P4AA 1A2ZA 3PP9A 3NWTA 3HLPA 4EGYA 4C7IA 4MXUA 1SD5A 2LBFA 4U7DA 4A3GJ 4XKBA 1Y0RA 5AG4A 4ZY1A 4XLEA 1GHCA 4I99C 3CCSI 3D3SA 1TQIA 1EH7A 2IT0A 4XRMA 4XPDB 3F23A 3WC6A 3BR2A 2A4NA 1XIXA 3NFZA 2VJJA 3MZ8A 1K6OA 2HS5A 3HGGA 4RGRA 1MMAA 2V1NA 5J3LA 3L2WA 5AG6A 3VARA 2GANA 2GIZA 3F5BA 2HQAA 3T8TA 2RC4A 3DP7A 4B47A 5A2QK 3H3ZA 4HNWB 2PN6A 5H84A 1FYMA 2ZXIA 3JRCA 1RZ4A 4DIQA 3E0KA 1W36D 3IV5A 1AUGA 3K4NA 1Q2CA 3CMAI 4CHUA 2XAQA 2KT0A 2V6CA 4XNFA 3ZN1A 4A3FJ 4IHMA 3RIRA 1STZA 3LA7A 2HEOA 3CCMI 1Y9WA 2H5MA 4HBLA 4XLPF 1UG2A 4OIQF 3GB0A 4GO1A 1YQEA 2PIYA 4IJAA 3D0SA 3OR2C 3VYUB 2IL4A 5D4SA 4AWXB 1C0WA 1S7EA 2M8GX 3VYSB 4BKXA 1NHAA 3KP7A 5BNGA 2CNSA 4LJZF 2R7HA 4NFRA 1QNTA 1ZTRA 4DJAA 3H9QA 1QPMA 5IT9Z 2K3FA 3DKYA 1F2PA 4PK3A 4IEJA 1ACIA 1OISA 2LF7A 2VPRA 3NWSA 3S3MA 3R0JA 1SC7A 1J5YA 4RAYA 5TJJA 4UEZA 1FZPB 3BJ8A 1EF4A 1XMKA 4KN4X 2HR3A 1Z5RA 4CH7A 4PFPA 5HDNA 4KA4A 1JJ6C 2PC1A 2E5ZA 5L3FA 4NF1A 3BC8A 1Y9KA 2DPTA 4X3RA 2HC9A 2FMYA 1TQMA 3FNCA 1CM0A 5A27A 1F43A 3R96A 1CPXA 3SHFA 3K4BA 4ENMA 1NG7A 4HV6A 1TLHB 5FD5A 4HSTA 4XLAA 5HNFA 3LAPA 3S9LA 3I4MJ 4YRVA 2QJ8A 1T6SA 3S3OA 2PJBA 3QAYA 3G1OA 2YX4A 4TNUA 4DYQA 3R9GA 5TRDA 5CQEA 1XMTA 4LIVA 4NJQA 5JM6A 2ISZA 4BHCA 4NHJA 2GWRA 1FLIA 4HDUA 3RPUD 3KYCB 4E7ZA 2M5WA 1BC7C 4P4IA 3R95A 4XORA 3WGHA 3SI2A 4HNXB 2ZSIB 4DQ2A 2DAOA 3HHHA 2K9NA 3F6VA 4IZZA 1ETXA 2Y0MA 3B73A 2DTZA 4RB0A 4DJLA 2BY2A 5DM7F 1KU2A 3N5FA 1ZLHA 4PK2A 3R6SA 4CYCA 2FL4A 4F9VA 1MMGA 1F1ZA 4FBEA 2Q7BA 4KITB 6CPAA 4FD7A 4ZY0A 5DCMA 4LUAA 3HUGA 3ELKA 1OLTA 2Z3LA 2WZNA 2R1IA 4BL0B 3A4CA 2PQ8A 4U0VA 4ZYGA
chains in the Genus database with same CATH topology
1X1DA 4BXFA 2QIRA 3OY9A 2IGKA 5F49A 3JUWA 3GBGA 4RS2A 2PJRB 2BVLA 1QHGA 4ZTFA 4H6ZA 4QC6A 3AL0B 2P6EA 2G0BA 2B3UA 4UCPA 2VKDA 4JXRA 2BEIA 4E4HA 3CP8A 2ARHA 3F9KA 4MFJA 1Y6IA 4A2ZA 3PNVA 5TGTA 3KX2A 3ZXSA 3CXSA 1Z3YA 1TZLA 1MNEA 5F47A 3UR3C 3ZCOA 2QMLA 3FBUA 4C2UA 2OV7A 1TT0A 1NSLA 2CV2A 4B10A 4AYBA 2WADA 4P5OA 2Z16A 3V42A 4BACA 5HVQC 4OAZA 2HV2A 2ZPAA 4DNCA 1WK4A 3LSMA 3MMYB 4ZDPA 2M4KA 2HVRA 3TO9A 4CAWA 1D1BA 1D0XA 2HDWA 4XR6A 4DBRA 1XF8A 4X0GA 4ZDOA 3QB8A 4RM2A 4XLCA 4XKCA 4L8AA 1D1AA 1SAUA 3ZRGA 2Q2EB 2ZW6A 4KUBA 1YGHA 4F0YA 1BO4A 4BDYA 3DPUA 3B8GA 3CESA 3OYNA 2HPMA 3H0DA 4CAEA 4AG9A 2I8DA 4NC7A 2VQYA 4U9YA 2G3AA 2F4IA 2X51A 3S8PA 4HNTA 2ZW5A 4Y49B 1VKCA 2O28A 3ZZIA 4MLOA 3SZGA 2FXFA 4F93B 1I1DA 3R1KA 4IQJA 4CAXA 4HNYB 2E5NA 1YR0A 1MMNA 3OYCA 3K4KA 1X4OA 3VWBA 3DR6A 2DOAA 4GRIA 3RCOA 4PSWA 2BL1A 3E1SA 3D5LA 4XKVA 4HKFA 5FVJA 3AFHA 3OYBA 1Z9UA 2PRBA 3HPHA 2WY8Q 4QBJA 4HSRA 2XF6A 3EUAA 2ZXVA 2R7TA 2XDVA 3QYEA 3OIQA 3L2RA 4IKFA 1IB1E 1MJAA 2B4DA 2CNMA 1LKXA 4JD6A 3TT2A 3RQ4A 1OR7C 3M8JA 2ZXHA 2PR1A 5HH1A 1YREA 4IX7A 1J09A 2V4JC 2L7KA 4E2AA 4DGWB 3DR8A 4MHDA 1LFPA 1WJFA 2BW3A 4XOPA 3RTRA 2PJRA 3S93A 1QSRA 3SXOA 3AL0C 2KRCA 4B43A 3IWEA 2WAQA 3E0JB 3HL2A 1M4IA 3HC7A 4BQOA 4R3KA 3HUGB 1GHEA 4PSXA 2FSRA 2LG4A 5J8FA 2HPIA 3T90A 4XPKA 1U6MA 2DT6A 4PJLA 3R9EA 4CCLA 3KEYA 2X1CA 3TO7A 1WJ5A 2R7XA 1L0CA 2VZYA 4E7IA 3ZR8X 4YRHA 4CZCA 1DGRM 2ZFUA 3VDXA 3FBIB 4R87A 3QYFA 4UA3A 5C82A 3PGPA 5F46A 4FD4A 2IGOA 4XN3A 2GIVA 2Z1DA 4IF5A 3KKWA 4QPOA 4FASD 1P4NA 3FBNB 2FT0A 2I79A 2VEZA 4CRYB 3IP4B 2R7RA 4Q36A 2JSPA 4M3SA 4KT6A 4BGDA 2AQFA 4KZTA 2V9KA 2KP6A 4BJ6C 4H6UA 4NEXA 3S6HA 1TIQA 3SXNA 4A95A 3MKZA 3DTIA 3H9GA 3DPTA 4XQFA 5HOOA 1OZPA 1YVKA 2OB0A 2WSAA 1W36C 3QYBA 4XLHA 4ORFA 1RO5A 1ZELA 2HVQA 2M7BA 2PMZA 4C2XA 4UWJA 4F92B 2W7NA 3I3LA 3OYFA 2CH0A 4CCNA 3TE4A 1WJCA 3D2PA 3LMMA 4CGLA 3DEEA 3OR1C 2OZUA 3IU1A 3W3CA 3H9JA 4E7SA 4F0XA 3QAHA 3IAM2 3FIXA 3I9SA 3IGRA 4E6KG 3OS2A 3D2MA 4CCJA 4OWRB 2L2OA 2J8NA 2J8RA 3IU2A 2CFOA 3PFYA 3VWEA 4PUSA 4DBQA 2VPLA 1XE4A 2JDCA 3OYIA 2JA2A 4CYNA 2LOOA 1YK3A 3JVNA 3OYHA 3DU6A 4EVYA 1XEBA 4LIUA 2DJIA 2HU9A 4AU7A 1I21A 4MFLA 2K9MA 2R4GA 2Z10A 4KOUA 2JVHA 1Z4RA 1X1AA 1IYKA 4B5PA 1KUXA 2P0WA 3VSLA 1UFHA 2J8MA 4NC8A 4FD6A 4UFXA 1WJAA 2X6XA 2CW8A 2QKMB 4XPLA 2KL4A 1V0CA 2AE6A 1FMVA 3EXNA 3G8WA 2E1MC 3LSKA 2IXSA 1N75A 1UAAA 1KUYA 2R7WA 1VHSA 3HPGA 4CCOA 3EC4A 4KSAA 4RLFA 2FCKA 4BU2A 3TTHA 2BW3B 2Q1ZB 3BG7A 3EPZA 2R98A 2VZZA 4Y4RA 1S7NA 3SEQA 1Y7RA 3ZQQA 3V8IA 4BE0A 4JJXA 3VYRB 4NSQA 2LH9A 2EVNA 4II2A 3HXLA 4ANJA 2X85A 4U5YA 3LSIA 1NE9A 1QSTA 1YLEA 3K10A 1D0YA 5IX3A 2CUJA 5LD2C 1QU3A 4HNUA 2R7UA 2M0MA 4PFOA 2KZVA 3LODA 2UUZA 4YEJA 1BR4A 5G21A 3TCVA 3W6SA 3L2VA 2LC2A 4XOTA 4C2TA 5F48A 2KQRA 2XF5A 4KLWA 3S32A 2WBMA 2L9NA 3OYKA 3LFUA 3MKWB 4G6TB 4E8OA 4XN0A 4ZDLA 3CXPA 4P1WA 1V5FA 1KUVA 1X19A 3HOSA 3N7ZA 2YGWA 5DWNA 4C7HA 2K5TA 3CJRB 3R9FA 1UG0A 4CYQA 2LY2A 2X7BA 4OADA 3ZGKA 2K9LA 1E0EA 2JUGA 2Q44A 2KRHA 2REEA 4NQWB 3RYOA 3K70D 2VXDA 5G22A 4KOXA 4M85A 5G20A 2FIWA 4AVCA 3FRMA 3LSHA 3TFYA 2IGNA 2XF7A 2E60A 5HLTA 4KISA 2Z0ZA 1WFXA 1S5KA 3TO6A 2IS2A 4NXYA 4C30A 4DOZA 3FB3A 1QSMA 2O5RA 3PNYA 3D5SC 1Z7LA 1D1CA 2X6YA 3RSNA 4LITA 4JWPA 1Z21A 4KVXA 2MFZA 4ZTJA 1MMDA 3C2HA 4KUAA 4XL9A 1B87A 2KLOA 3OYLA 1M4GA 4BBHA 1M44A 4BJTA 1S7KA 4E7KA 2WY7Q 4AB7A 1DGWY 2OZGA 2OC6A 4FETA 4YFJA 2YNDA 2WA0A 4BE1A 4UCNA 3H4QA 3PJRA 2VJ5A 3QODA 4C7IA 5HMNA 3BG6A 2MABA 2WPXA 4MFPA 3OYGA 2ATRA 5CNPA 1YE9A 2K5CA 3WR7A 2RNGA 2ZSHB 1G8XA 2C27A 2CV1A 1PJRA 3K6GA 5FRMA 1FY7A 2K3PA 2B58A 3H5AA 3SYTA 3CZ6A 3QOEA 4II3A 2CNTA 2VXZA 4LX9A 3F0AA 2VQLA 1PU9A 3W91A 1YX3A 2VASA 1X1BA 2CUZA 2E1MB 3A2KA 2CV0A 1ZO0A 5KTCA 1YX0A 3UY5A 3ZJ0A 4JXQA 1PYVA 3K4MA 2PQ8A 3W2AA 4R79A 3TOAA 5I0CA 4BQNA 3DLAA 2BOLA 1S9HA 1R57A 2Q4VA 1JI8A 5AGEA 4AVAA 2RQQA 4IUSA 4CYPA 5AG7A 2LYCA 4UFVA 1ERDA 4HNWB 4R3LA 3BLNA 1MJ9A 2CMPA 1WJBA 2JVGA 2GOXB 4MFZA 2MC4A 3IAS2 2Q04A 3OIPA 1YVOA 2KCWA 4Y3OA 2VIXA 3K70C 3H5ZA 4CUGA 3DU5A 2PDOA 3FXTA 1SFKA 5KCMA 5FROA 4AVZA 4RM3A 3OYAA 2V6EA 4MFQA 3LL7A 5CPRB 4MJ8A 2X6WA 3P2FA 4CRZB 1K4JA 2ZW7A 3SDBA 3TL4X 1K6YA 2BUEA 3D8PA 1D0ZA 4QUSA 2W00A 4PK4A 1V5EA 1G59A 4ZGYB 2YNCA 2YNCC 3L2QA 1IICA 2REFA 2L5QA 2IS1A 1U0JA 2VLAA 1I12A 2OZHA 4K30A 2WPWA 3W2WA 1WWZA 3GKRA 4RI1A 4BE2A 3FYNA 4BUPA 5AG5A 4MFKA 2XSJC 4XMYA 4XM3A 4JQFA 3OYDA 3GY9A 4CA0A 4PJJA 5KNLA 2W82A 4B48A 1SQHA 2A5WA 2DCEA 4XONA 2G3TA 2NMTA 3DDDA 3OWTA 2Q0YA 1RXTA 3G3SA 2KMUA 5GCNA 4AG7A 4KOYA 3GYAA 4H4KC 3DWLE 1BOBA 3PNTA 3OS1A 3OYEA 4XPDC 3W6XA 3K4JA 1LRZA 3HG9A 5CKTA 5CQGA 4UFWA 3PUBA 4MI4A 4AVBA 2D4PA 1LDKB 4Y33A 1UELB 2B5GA 4H89A 4YGOA 2WAEA 2LBFB 4C2YA 4CAFA 3K4LA 4I49A 4B14A 1VZ0A 2BSWA 4A30A 1MW7A 5JQ4A 2X1DA 3DPLC 5C88A 3DNSA 2D4OA 4CGNA 5KTAA 3LSGA 3TMOA 4JLYA 2Z3KA 3H35A 1N78A 4JOMA 1P0HA 3EUKL 3FKJA 4CYOA 1S60A 2DXIA 4B5OA 2QECA 3CXQA 4A31A 1BR2A 3BCAA 2MYSA 1IYLA 4C68A 3EO4A 2OUMA 3OOUA 3PL8A 4OLLA 2WB1A 4J00A 4A32A 3N05A 5A28A 3UNGC 4D9JA 2VKHA 3CP2A 2DPSA 2M3AA 5KTDA 4E7JA 3P2HA 4U87A 2DT7B 2LY1A 2UV1A 5EBVA 4C9YA 4B13A 4J01A 4BDZA 4KS9A 5IB0A 4HPQA 4R57A 4KJZA 4MY3A 2VL8A 1WJDA 4B3XA 4CGOA 3PSFA 4J3GA 3H5RA 3H5NA 3IUOA 3NE7A 4FD5A 4X5KA 3DTKA 3AKZA 2Z11A 3L2UA 3S6FA 2R7QA 3DQVC 5ISVA 4KLVA 3F8KA 4KOWA 1P9QC 4NUBA 2MD0A 4D1QA 3I3GA 2A6TA 2F5IA 2R8VA 3OS0A 2JDDA 2B4BA 3DKXA 4PJMA 3EY5A 3HKZA 1T95A 1CJWA 4ITVA 2KDOA 2PR8A 3S6GA 4HG2A 1X4PA 1IIDA 2CW7A 2Z3NA 4U9ZA 5DWMA 1V5GA 2Z3MA 4PJNA 1S7FA 1IRXA 1BR1A 2XAUA 2IGMA 2Q4YA 3MD2A 3FHNA 4XKWA 5LFAA 3KYLA 1GLNA 3S3NA 2JEVA 4R9MA 2VJIA 2FE7A 4N4NB 2F6CA 4KOTA 4UBRA 4MBUA 1QHHD 4CGMA 3PP9A 3NWTA 3VWDA 2VXKA 5E96A 4GS4A 2ELJA 2LBFA 5AG4A 4XKBA 4XLEA 4CAVA 5G1ZA 3OYJA 2CXAA 2FIAA 2HUZA 3OYMA 3D3SA 5EC4A 2W1OA 2W4SA 4HRIA 5JPHA 4KORA 4LG3A 4XPDB 2A4NA 4B11A 2FUG2 2F5VA 1XIXA 2VJJA 3JTKA 4E7HA 3L2WA 1MMAA 2V1NA 1NMTA 3LD2A 5AG6A 2B5GB 2CS3A 3EUHC 1N71A 2GANA 4MY0A 3S6KA 3F5BA 2Z3OA 3K9UA 2HQAA 3C26A 1KONA 2YNEA 2HVSA 1Z4EA 2RC4A 4B47A 4CCKA 1HA8A 4KOVA 4PV6A 4NCZA 4BEHB 2XC7A 1AA7A 5H84A 2Y0SA 2ZXIA 2LREA 4DIQA 3E0KA 3I9V2 4F3QA 1W36D 3K4NA 2QKLB 1Q2CA 1Q2DA 2IS4A 1WJEA 4XNFA 4QVTA 2VQGA 2R7SA 3M1CA 3CF2A 2H5MA 4B12A 2OH1A 1M1DA 1DQUA 4E7LA 1J4JA 4B44A 4BJ5C 2UWMA 1M4DA 1Y9WA 2P6GA 2RREA 2V7FA 4KVME 2WAFA 4A33A 4ONUA 3OWCA 3OR2C 3VYUB 3MKYB 3PZJA 3G2BA 2HZDA 3PSIA 2IL4A 3CJQB 4CS0B 3C2GA 1MNDA 3CMMA 1KZFA 2FS5A 1R6RA 3VYSB 2X1EA 3SEZA 4BQQA 3A1YA 2Z2SB 3D5RC 5BWAB 2CNSA 2CY2A 2VB6A 4ZYAA 2M4GA 3TOBA 2R7HA 4DJAA 1N77A 3H9QA 3IWGA 3DKYA 2KPMA 2JLMA 4PK3A 3NWSA 4N4OB 4YELA 3HOTA 3S3MA 3ONQA 3W2VA 3T9YA 1Y56A 2AJ6A 2BVMA 2VQCA 3K4CA 3U21A 4E0AA 3BJ7A 4C2ZA 4CGPA 4Q38A 1Z3XA 3BJ8A 2NOJB 2IS6A 4F52A 2GE3A 3MGDA 4CH7A 2OU2A 4PFPA 4XLFA 4KOSA 2PC1A 5IV0A 4CSWA 2M7AA 5JHFA 2E5ZA 4NF1A 3BC8A 1Y9KA 2DPTA 2I00A 3VSKA 1LVKA 3FNCA 5A27A 1CM0A 4B5PB 3R96A 1T0FC 4F6AA 3K4BA 2DXQA 1NG7A 4OAYA 4II9A 4HSTA 4XLAA 2HNHA 5HNFA 4U7BA 2R7VA 5FRNA 4YRVA 4Y49C 3S3OA 1YX5A 1MJBA 4ZC3A 1PUAA 5KHDA 3R9GA 2V26A 5CQEA 1XMTA 4LIVA 3TBIA 3OMYA 1B6BA 4QPQA 4F91B 1QSNA 2R7OA 2WUUA 4BEHA 1Q2YA 4NNJA 3RPUD 2HQYA 5J8CA 1S7LA 4E7ZA 3R95A 4XORA 4CCMA 4RMNA 4HNXB 3VYTB 2ZSIB 3FDYA 3J7AY 4RLQA 3DSBA 2VJ4A 4UWIA 2VQHA 4IQ4A 4OAEA 1QSOA 2PSWA 4XNHC 2LRDA 4IZZA 2Y0MA 4L89A 4BMHA 4HEA2 5HNHA 1EA3A 2L9SA 2VBQA 2VI7A 1NG6A 1S3ZA 4KVOE 4KSFA 4PK2A 4BS9A 2GOMA 2ZW4A 2FL4A 1X1CA 2Z3PA 5H86A 3SHPA 1MMGA 4UCMA 1DP3A 2Q7BA 2AQEA 4KITB 3EFAA 3BLYA 2B3VA 4FD7A 3DTEA 4EATA 4QB9A 3BCBA 4LUAA 3A9LA 3OL4A 2B4DB 4ZBGA 1FMWA 1MK4A 1OLTA 2Z3LA 2EUIA 1ON0A 2R1IA 4BL0B 4F55A 4ZJZA 4XNHB 3A4CA 2KHMA 2P6FA 3OL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIR A;  5F49 A;  3JUW A;  4RS2 A;  4H6Z A;  4QC6 A;  2P6E A;  2G0B A;  2B3U A;  4JXR A;  2BEI A;  2ARH A;  3CXS A;  5F47 A;  2QML A;  3FBU A;  1NSL A;  2HV2 A;  2ZPA A;  4DNC A;  1WK4 A;  3TO9 A;  4CAW A;  1XF8 A;  3QB8 A;  4L8A A;  2ZW6 A;  4KUB A;  1YGH A;  4F0Y A;  1BO4 A;  3B8G A;  4AG9 A;  2VQY A;  4U9Y A;  2G3A A;  4Y49 B;  2ZW5 A;  3ZZI A;  1VKC A;  2O28 A;  2FXF A;  1I1D A;  3R1K A;  4CAX A;  4HNY B;  1YR0 A;  3DR6 A;  4PSW A;  2BL1 A;  4HKF A;  4QBJ A;  5FVJ A;  1Z9U A;  2PRB A;  2ZXV A;  4MJ8 A;  4XNH B;  1IB1 E;  2CNM A;  1MJA A;  2B4D A;  4JD6 A;  3TT2 A;  5HH1 A;  2PR1 A;  1YRE A;  4E2A A;  3DR8 A;  4MHD A;  3SXO A;  1QSR A;  1M4I A;  4R3K A;  1GHE A;  4PSX A;  2FSR A;  5J8F A;  3T90 A;  4XPK A;  1U6M A;  3R9E A;  3TO7 A;  2VZY A;  1L0C A;  4YRH A;  4R87 A;  4UA3 A;  5C82 A;  3PGP A;  5F46 A;  4FD4 A;  2GIV A;  4IF5 A;  3KKW A;  2VEZ A;  1P4N A;  4CRY B;  2FT0 A;  2I79 A;  4M3S A;  4KZT A;  3S6H A;  3SXN A;  4H6U A;  4NEX A;  1TIQ A;  1OZP A;  1YVK A;  2OB0 A;  4ORF A;  1RO5 A;  4UWJ A;  3TE4 A;  3D2P A;  2OZU A;  3QAH A;  3I9S A;  3FIX A;  3IGR A;  3D2M A;  2J8N A;  2J8R A;  3VWE A;  1XE4 A;  2JDC A;  1YK3 A;  3JVN A;  4EVY A;  1XEB A;  1I21 A;  2Z10 A;  4KOU A;  1Z4R A;  1IYK A;  4B5P A;  1KUX A;  2P0W A;  1UFH A;  2J8M A;  4FD6 A;  4XPL A;  2AE6 A;  1V0C A;  3EXN A;  3G8W A;  1KUY A;  1VHS A;  3EC4 A;  2FCK A;  3TTH A;  2R98 A;  2VZZ A;  1S7N A;  1Y7R A;  3V8I A;  4JJX A;  2EVN A;  4U5Y A;  1NE9 A;  1QST A;  1YLE A;  5IX3 A;  3LOD A;  3W6S A;  3TCV A;  5F48 A;  4KLW A;  4E8O A;  3CXP A;  1KUV A;  3N7Z A;  5DWN A;  2K5T A;  3R9F A;  2X7B A;  4OAD A;  2Q44 A;  2REE A;  3RYO A;  4KOX A;  4M85 A;  2FIW A;  4AVC A;  3FRM A;  3TFY A;  2Z0Z A;  1S5K A;  3TO6 A;  4NXY A;  3FB3 A;  1QSM A;  4JWP A;  4KVX A;  4KUA A;  1B87 A;  1M4G A;  1M44 A;  1S7K A;  4YFJ A;  4AB7 A;  2OZG A;  3H4Q A;  5HMN A;  5CNP A;  2WPX A;  2ATR A;  3WR7 A;  4B5P B;  2C27 A;  4NSQ A;  1FY7 A;  2CNT A;  5IB0 A;  2B58 A;  4LX9 A;  3F0A A;  1PU9 A;  3W91 A;  5KTC A;  1YX0 A;  3UY5 A;  3ZJ0 A;  4JXQ A;  3TOA A;  5I0C A;  2Q4V A;  1R57 A;  4AVA A;  4IUS A;  4HNW B;  4R3L A;  3BLN A;  1MJ9 A;  2Q04 A;  1YVO A;  2KCW A;  2PDO A;  3FXT A;  3P2F A;  4CRZ B;  1K4J A;  2ZW7 A;  2BUE A;  3D8P A;  4QUS A;  1IIC A;  2REF A;  2OZH A;  1I12 A;  4K30 A;  4RI1 A;  2WPW A;  3GKR A;  1WWZ A;  3FYN A;  3GY9 A;  2NMT A;  1SQH A;  2G3T A;  3DDD A;  2Q0Y A;  1RXT A;  3G3S A;  5GCN A;  4AG7 A;  4KOY A;  3GYA A;  1BOB A;  4XPD C;  3W6X A;  1LRZ A;  4MI4 A;  4AVB A;  2D4P A;  2B5G A;  4H89 A;  4YGO A;  4I49 A;  2BSW A;  5JQ4 A;  5C88 A;  3DNS A;  2D4O A;  5KTA A;  4JLY A;  1P0H A;  1S60 A;  4B5O A;  2QEC A;  3CXQ A;  1IYL A;  3EO4 A;  4OLL A;  5KTD A;  3P2H A;  5EBV A;  4R57 A;  4MY3 A;  4J3G A;  4FD5 A;  3NE7 A;  4X5K A;  2Z11 A;  3S6F A;  5ISV A;  4KLV A;  3F8K A;  4KOW A;  3I3G A;  2F5I A;  2R8V A;  2JDD A;  2B4B A;  3EY5 A;  1CJW A;  2PR8 A;  3S6G A;  1IID A;  4U9Z A;  5DWM A;  1S7F A;  2Q4Y A;  2JEV A;  4R9M A;  2FE7 A;  4KOT A;  4UBR A;  4MBU A;  3PP9 A;  3VWD A;  2VXK A;  5E96 A;  4GS4 A;  4CAV A;  2FIA A;  3D3S A;  2HUZ A;  5EC4 A;  5JPH A;  4KOR A;  4XPD B;  2A4N A;  1XIX A;  1NMT A;  3LD2 A;  2B5G B;  2GAN A;  1N71 A;  4MY0 A;  3S6K A;  3F5B A;  3K9U A;  3C26 A;  4KOV A;  2RC4 A;  1Z4E A;  4PV6 A;  4NCZ A;  5H84 A;  3E0K A;  1Q2C A;  1Q2D A;  4QVT A;  2H5M A;  2OH1 A;  1M1D A;  1Y9W A;  1J4J A;  1M4D A;  4KVM E;  4ONU A;  3OWC A;  3PZJ A;  2IL4 A;  4CS0 B;  2FS5 A;  1KZF A;  2CNS A;  2CY2 A;  3TOB A;  2R7H A;  3IWG A;  4PK3 A;  2JLM A;  3T9Y A;  2AJ6 A;  4E0A A;  3BJ7 A;  3BJ8 A;  3MGD A;  2GE3 A;  2OU2 A;  4KOS A;  2PC1 A;  5IV0 A;  4NF1 A;  1Y9K A;  2I00 A;  3FNC A;  1CM0 A;  3R96 A;  4F6A A;  2DXQ A;  4II9 A;  4Y49 C;  1MJB A;  1PUA A;  3R9G A;  1XMT A;  1B6B A;  1QSN A;  1Q2Y A;  5J8C A;  2HQY A;  1S7L A;  3R95 A;  4HNX B;  3DSB A;  4UWI A;  4XNH C;  4OAE A;  1QSO A;  2PSW A;  2Y0M A;  4L89 A;  4BMH A;  2VBQ A;  2VI7 A;  1S3Z A;  4KVO E;  4PK2 A;  2ZW4 A;  2FL4 A;  5H86 A;  3SHP A;  2Q7B A;  3EFA A;  2B3V A;  4FD7 A;  4QB9 A;  4LUA A;  2B4D B;  4ZBG A;  1MK4 A;  2EUI A;  1ON0 A;  2R1I A;  2PQ8 A;  2P6F A;  2P6G A; 
#chains in the Genus database with same CATH topology
 1X1D A;  2QIR A;  4D7M A;  2BVL A;  1QHG A;  2NXN B;  2B3U A;  4A3D J;  5CVI A;  4JXR A;  2X9D A;  5D4R A;  3CP8 A;  2YU9 J;  1XMB A;  1AKH A;  1BC8 C;  3I59 A;  4BY7 J;  5GTI C;  1MNE A;  3ZCO A;  5LYD A;  4C2U A;  2PMH A;  4B10 A;  1MBE A;  2CQN A;  3CUQ B;  2CV2 A;  4P5O A;  3FMS A;  3V42 A;  4BAC A;  3P7N A;  1TNT A;  4CAW A;  4ZDP A;  1D1B A;  1LNW A;  2UXN A;  1QZE A;  3GZ5 A;  3KZY A;  1VQ8 I;  1TNS A;  2F48 A;  1HOM A;  3PBE A;  4RM2 A;  4ASN A;  3QB8 A;  1KGS A;  2OQG A;  1SAU A;  1IV8 A;  3ZRG A;  1SFE A;  3E5Q A;  2Q2E B;  4BQA A;  4F0Y A;  1KU3 A;  3DPU A;  3OYN A;  1KQ9 A;  1MD0 A;  2WV1 A;  4MCP A;  2I8D A;  4NC7 A;  2F8H A;  3GUX A;  4NJR A;  4U9Y A;  2G3A A;  1OYW A;  2O28 A;  5BPD A;  3WG7 H;  1HEE A;  4F93 B;  1I1D A;  4HNY B;  4A38 A;  1X4O A;  1O3T A;  4LOC A;  5IYC J;  4KNY A;  2EFP A;  5LEJ A;  2L4M A;  2QCO A;  3FEC A;  2PJ7 A;  3I56 I;  3OSG A;  3H8F A;  2DK8 A;  1V4R A;  4P4F A;  3OYB A;  2HOT A;  3E5U A;  1H89 C;  2WY8 Q;  5CBM A;  1Q1H A;  2ZXV A;  2JWT A;  1IB1 E;  4IKF A;  2CNM A;  1MJA A;  3JRU A;  3PFO A;  4JD6 A;  4XNH B;  3GCM A;  1OR7 A;  3RQ4 A;  1OR7 C;  5A2Q Z;  5HH1 A;  1YS7 A;  3BRO A;  5EGO B;  2GQQ A;  3H1C A;  1ZG3 A;  4BAY A;  4IX7 A;  1CP6 A;  4Q4Z F;  4UEF A;  4ZI6 A;  2L7K A;  2DMT A;  1SVL A;  3GF2 A;  5L3C A;  3AL0 C;  5F0F A;  2XAF A;  3M9A A;  1MNM C;  3IWE A;  3A01 A;  1BOA A;  2NVU B;  1EKE A;  1VND A;  3HL2 A;  3KCC A;  1JT6 A;  1M4I A;  4R3K A;  4XRF A;  1Y39 A;  5D6F A;  5ICC A;  1YW6 A;  2QLZ A;  1FNN A;  2HPI A;  4XPK A;  3T90 A;  1FEX A;  2RAE A;  3BJ6 A;  2STT A;  1RI7 A;  2QZ8 A;  4CCL A;  2X1C A;  3FXQ A;  1WJ5 A;  3DBL B;  2HFH A;  2VZY A;  3ZR8 X;  4YRH A;  4TV7 A;  1DGR M;  2QWW A;  3KFW X;  3B3C A;  5GAE J;  4UA3 A;  5C82 A;  3PGP A;  2IGO A;  1E2X A;  2KJB A;  2DA2 A;  2Z1D A;  1XJO A;  2NAZ A;  4QPO A;  1HCR A;  2Q51 A;  2FT0 A;  2I79 A;  4M3S A;  3TQN A;  1CQT A;  4BGD A;  2V9K A;  5AIQ A;  3G6E I;  4H6U A;  4NEX A;  1U5T B;  4V2G A;  1TIQ A;  1I1S A;  4NGQ A;  1TC3 C;  4NQW A;  4N9H A;  5F08 A;  4PQA A;  3ECH A;  5HOO A;  1YVK A;  3CDI A;  4XLH A;  5HXD A;  2LKP A;  2P5K A;  2PMZ A;  2M7B A;  3VB2 A;  1YME A;  2IRF G;  2Z5U A;  4B6Z A;  4HAM A;  2NVQ J;  4F92 B;  2OQR A;  4U0W A;  3O8G A;  3IEH A;  3V7C A;  3D4U A;  2ECC A;  3LMM A;  3OR1 C;  3ISZ A;  1BI1 A;  5JFR A;  1J59 A;  3GTM J;  1XGO A;  1RR7 A;  3QAH A;  3FIX A;  4NDL A;  4CDG A;  1YO5 C;  3GTK J;  5F27 A;  1TBX A;  3D2M A;  2J8R A;  3IU2 A;  3LA3 A;  2CFO A;  3TW6 A;  4EM2 A;  1VGY A;  1DPR A;  2XV4 S;  1WH5 A;  3WTV C;  3U9G A;  3WT4 A;  2P5V A;  4Y7N J;  5HS8 A;  5CVU A;  1I21 A;  3GX4 X;  2K9M A;  2R4G A;  3FM5 A;  5L3G A;  2Z10 A;  3VSL A;  1UFH A;  1ZGW A;  4FD6 A;  3RKY A;  1WJA A;  2DFF A;  4AXV A;  5M5W J;  2QKM B;  1ZKG A;  1ZRD A;  3S16 J;  3ZMZ A;  3G8W A;  2AHQ A;  2K40 A;  3BQY A;  4BD9 A;  1IN8 A;  1UAA A;  3FX3 A;  1CGP A;  1OYY A;  3RAM A;  2DBB A;  4G8X A;  3EC4 A;  1P2F A;  1YS6 A;  1MH3 A;  3DFG A;  2JA6 J;  4KSA A;  4LQG A;  1XFO A;  4NGM A;  2EK8 A;  3BG7 A;  4A94 A;  2MLG A;  4ZX9 A;  4Y4R A;  4AVP A;  1CG2 A;  2HTS A;  4BE0 A;  2YPR A;  1QST A;  1YLE A;  1AU7 A;  2XAH A;  4A3J J;  2CUJ A;  3BPX A;  5LD2 C;  8CPA A;  2HWV A;  2R7U A;  3VFZ A;  5I4M A;  2RV8 A;  3LOD A;  1KYW A;  4HLX A;  3CCQ I;  2AFO A;  2CTB A;  3L2V A;  2M34 A;  2LC2 A;  2J5O A;  3DXJ F;  4ZX8 A;  3SJX A;  1LE8 A;  5M3F J;  1ZG5 A;  2HXO A;  3CLO A;  3LFU A;  4G6T B;  3MKW B;  2EIL H;  4ZDL A;  4ETS A;  3CXP A;  1X19 A;  3ABU A;  1F2O A;  4C7H A;  2XB0 X;  3H3U A;  3R9F A;  1UG0 A;  1TW2 A;  2CO5 A;  2DA6 A;  2LY2 A;  4KIG A;  2CWE A;  4M3B A;  3ZGK A;  2Q44 A;  2REE A;  3RYO A;  4CGN A;  4R7M A;  5GTH C;  1BAV A;  2CYY A;  2KDZ A;  4AVC A;  1R23 A;  4FIS A;  3FRM A;  3FMQ A;  3LSH A;  2XB5 A;  1ULY A;  1B6A A;  3KI9 A;  3I4N J;  1MMS A;  3C18 A;  4A3E J;  2BV6 A;  2EV0 A;  4IHW A;  2JBJ A;  3RSN A;  1R1V A;  3SDG A;  5AON A;  5E20 A;  1RET A;  5LGU A;  1F4K A;  1B8I A;  1M4G A;  3LOC A;  4CIC A;  1YI2 I;  3CCE I;  4JBA A;  3T8W A;  4UCN A;  3CC7 I;  3JTH A;  3PJR A;  3QOD A;  4ZH4 F;  5FFZ A;  1IXS B;  1HST A;  1PYT B;  1IO2 A;  3Q0U A;  4S0H B;  2A5Y B;  2ZSH B;  3PQK A;  5ILV A;  3RZD J;  2CV1 A;  2PX9 A;  5FRM A;  2C27 A;  1B72 A;  3H5A A;  2FVG A;  3QOE A;  1Y0Y A;  3F0A A;  2F4M B;  2H6B A;  2VQL A;  1PU9 A;  2VAS A;  1HBX G;  3GFM A;  1YX0 A;  3KAS A;  5GPC A;  5JLW A;  3R0A A;  5L3E A;  2E2I J;  1S9H A;  4FE4 A;  3CCY A;  3HUV A;  4GM5 A;  4IUS A;  4MCS A;  1ZK8 A;  3QPT A;  4A3L J;  1ERD A;  2GLJ A;  1MJ9 A;  2EWN A;  4M6Y A;  2IMO A;  3S15 J;  1WJB A;  2JVG A;  2GOX B;  1FOK A;  2ZJQ F;  4CXF A;  3H5Z A;  1IZ1 A;  4CUG A;  3OSF A;  1IG7 A;  1HDD C;  1ZN2 A;  3FXT A;  4ZYQ A;  1SFK A;  4AVZ A;  5FRO A;  2O9L A;  4MFQ A;  3OYA A;  2M8E A;  5ILS A;  1TW3 A;  3LL7 A;  4NGP A;  4D5C A;  1I3Q J;  1S72 I;  2ZW7 A;  2EFW A;  3KP4 A;  2O53 A;  1D0Z A;  1V5E A;  1D5Y A;  4P55 A;  1T98 A;  1J7K A;  1R4M B;  2G9W A;  3GUD A;  1HDU A;  1SVO A;  2IS1 A;  3HSF A;  1IIC A;  1I5Z A;  1SD7 A;  1BIA A;  2B0L A;  1I12 A;  4JZ0 A;  3W2W A;  4RI1 A;  2VBW A;  4YFN F;  1Z67 A;  1YIT I;  3RI4 A;  1ZYR F;  5KNL A;  2BY0 A;  2L4A A;  2PFB A;  2NMT A;  4XON A;  1OCC H;  2DMQ A;  2Q4Z A;  3B3T A;  2VOP A;  3B6C A;  4G1P A;  4AG7 A;  2DA3 A;  1V3F A;  2LF8 A;  3DWL E;  1XS9 A;  3PNT A;  4MFE A;  4XPD C;  3HSE A;  3K4J A;  1FOX A;  1K78 B;  1LRZ A;  5CKT A;  4XSZ F;  2KIM A;  5CQG A;  3GTQ J;  3Q0W A;  3JRD A;  3NEU A;  1ELM P;  1YLF A;  4FE7 A;  4RGS A;  1H0M A;  1ZAO A;  1MW7 A;  1JWQ A;  1UJ8 A;  2MBF A;  3BG9 A;  1ETQ A;  4NC6 A;  3J81 Z;  2NSM A;  4ZYE A;  1ZGJ A;  3BQZ A;  1X10 A;  4Y15 A;  1N78 A;  5EYR A;  4JOM A;  1ZLK A;  1Y8Q B;  2OPT A;  2RGV A;  1S60 A;  2DXI A;  4CYO A;  3IJ3 A;  1YW9 A;  2OAZ A;  3BCA A;  5LGN A;  4XLN F;  2B7E A;  5K5Q A;  2COB A;  1I6X A;  4QIW N;  4C68 A;  1TWC J;  3RYP A;  3HOX J;  4ZYH A;  3LWU A;  4OLL A;  2EZL A;  4LQ6 A;  4J00 A;  5A28 A;  4MCR A;  3UNG C;  3Q9S A;  3CP2 A;  3MKL A;  4D9J A;  2M3A A;  4DW6 A;  5LYL A;  4E7J A;  3P2H A;  2DT7 B;  4F7Z A;  3PIO F;  3CCJ I;  2HGC A;  4HQE A;  4BDZ A;  4PXD A;  2NYQ A;  1HDP A;  2QSF X;  1R5H A;  3W6K B;  4B3X A;  3H5N A;  2K27 A;  1CPS A;  2QSG X;  4P4D A;  4MQ9 F;  3DQV C;  5EZH A;  5ED4 A;  2OTJ I;  2L54 A;  3FKI J;  2FOW A;  4A93 J;  2QQ9 A;  2QM3 A;  2A6T A;  2M45 A;  4HZF A;  4M3G A;  3OS0 A;  2JDD A;  2B4B A;  3DKX A;  3H92 A;  3HKZ A;  5F04 A;  2M30 A;  2V1D A;  3VH9 A;  3FZV A;  3HB9 A;  3KP6 A;  3TW7 A;  5DWM A;  2ZME B;  1V5G A;  2GA1 A;  1S7F A;  5D5V B;  2UXX A;  3ZMD A;  3MD2 A;  2O8K A;  3O2P E;  2NS8 A;  5K5O A;  4ONW A;  2HOS A;  5IYD J;  5K8M A;  4R9M A;  1SMY F;  2ECB A;  4WF2 A;  1CP7 A;  3SZP A;  2L3D A;  2FE7 A;  1S7A A;  4QWQ A;  1IGN A;  4FQG A;  4MO7 A;  5H6R A;  5E96 A;  2L7F P;  3IH4 A;  2ELJ A;  4UV8 A;  1MIJ A;  4CAV A;  5G1Z A;  3OYJ A;  2CXA A;  2FIA A;  5EC4 A;  2LKX A;  2R5Z B;  2F2E A;  2DA4 A;  2WB1 N;  4HRI A;  5B1B H;  4WX9 A;  5JPH A;  3D7D A;  4KOR A;  1CF7 A;  2H6C A;  5LHG A;  2FUG 2;  3RZO J;  4RN7 A;  3ZOB A;  2AFZ A;  3JTK A;  2XSD C;  2ZEN A;  3FK7 A;  3EUH A;  2CS3 A;  3EUH C;  4UVA A;  4A0Z A;  4C3J J;  2LD5 A;  1U8B A;  2Z3O A;  3FH4 A;  3C26 A;  4KOV A;  1UCR A;  4PV6 A;  2EIN H;  5EMI A;  4BEH B;  2BHZ A;  3D67 A;  3V7S A;  1XCB A;  4JK1 X;  2LRE A;  4MHN A;  3I9V 2;  4F3Q A;  1LVA A;  2CU7 A;  4LD5 A;  2QKL B;  4RDU A;  1OFC X;  2IS4 A;  1FP1 D;  4EEF G;  1R49 A;  4QVT A;  3V7Z A;  1VQO I;  4WCG A;  3BI1 A;  5B3S H;  2XAG A;  3L2C A;  2RRE A;  4KVM E;  2Y69 H;  2A6H F;  2WAF A;  2J9A A;  4A33 A;  3ABL H;  2XRO A;  1JKP C;  4ONU A;  1IXC A;  3ZQL A;  3ZQH A;  2E1C A;  3PSI A;  4JX4 A;  5D8L B;  3PB4 X;  3J80 K;  3FXK A;  1RTQ A;  1R6R A;  1IC8 A;  3WTY C;  1Y7E A;  1YJN I;  3A1Y A;  5BWA B;  4EJU A;  2RB7 A;  5JHU A;  2K7L A;  5LEK A;  5LHH A;  3DCF A;  4D7N A;  4RUH A;  2KPM A;  5EEH A;  1Z7U A;  4RB1 A;  1DU0 A;  4N4O B;  3PB9 X;  4RA2 A;  1E3H A;  3F3X A;  1IUY A;  3ONQ A;  2HZT A;  1ARM A;  2JSC A;  3T9Y A;  1Y56 A;  2VQC A;  3U21 A;  4N0B A;  1LEA A;  3KGQ A;  1Z3X A;  2NOJ B;  5DUI A;  1X3W B;  2OU2 A;  1NTC A;  3EDP A;  5JHF A;  2VT3 A;  4EJV A;  1OQY A;  2Q2E A;  3VSK A;  1LVK A;  4OU0 A;  4B4C A;  1RR8 C;  4F6A A;  2DXQ A;  1VI0 A;  1USS A;  1WRJ A;  4IAV A;  1YRN B;  2UZK A;  4II9 A;  1WI9 A;  2HNH A;  2ETH A;  3ASN H;  5EJC A;  5FRN A;  1IOI A;  3TC8 A;  1KU7 A;  1MJB A;  2FSW A;  4ZC3 A;  4FX4 A;  5KHD A;  1PUA A;  2IA0 A;  1B6B A;  4QPQ A;  3C2B A;  2WUU A;  4ESJ A;  3QU6 A;  2L9R A;  5J8C A;  2HQY A;  5FLX K;  3ISP A;  4M73 A;  4RMN A;  3VYT B;  4C3H J;  1K7A A;  3CPA A;  4Z65 A;  4RLQ A;  3S2W A;  2VJ4 A;  4UWI A;  4UV9 A;  4XNH C;  4OAE A;  1QSO A;  2PSW A;  3PO3 J;  3WOD F;  4GYG A;  1YW8 A;  3LMS A;  4BMH A;  5HNH A;  1EA3 A;  3S2H J;  2X48 A;  2VI7 A;  1NG6 A;  2FQ4 A;  1OYI A;  1OKR A;  4M6G A;  2A05 A;  4P45 A;  3WTU C;  3S2D J;  1IN7 A;  5CYV A;  2BYV E;  2ZW4 A;  3F8M A;  5H86 A;  3N97 A;  3JRF A;  4B3A A;  5H2F C;  3FIW A;  3DTE A;  2ME0 A;  3BCB A;  4A37 A;  4ZBG A;  1MK4 A;  2DDB A;  3KP2 A;  3ERM A;  1LAP A;  3BZ6 A;  1ON0 A;  4A39 A;  3BR6 A;  5E1Z B;  2KHM A;  4P10 A;  3GLL A;  4LLG F;  4CGZ A;  2ZEE A;  1LFU P;  2A07 F;  4ZTF A;  4QC6 A;  4EM0 B;  1MBH A;  2ZBK A;  1MZB A;  3GIU A;  2P4W A;  1FOY A;  3ECO A;  4MFJ A;  3G4S I;  5TGT A;  4GDF A;  2ICW G;  9ANT A;  3BR1 A;  2QML A;  2ZOG A;  4IL6 C;  1Y8R B;  4V19 K;  2L02 A;  3KZI C;  4OAZ A;  1JGS A;  1GUU A;  4DNC A;  5HVQ C;  2P6T A;  2BY3 A;  3JRI A;  3MMY B;  3CCR I;  1G3Y A;  2M4K A;  3M8F A;  1QMU A;  2CFX A;  4XR6 A;  4DBR A;  4G7H F;  2G9D A;  5D29 A;  2E19 A;  4OIO F;  4ESB A;  4XIC A;  4XLC A;  3RQI A;  1D1A A;  1XSD A;  1IN6 A;  1W5T A;  2AFX A;  5E79 C;  1YGH A;  3QNV A;  4WJB A;  2KFD A;  3CES A;  3SQN A;  4A0Y A;  3RKW A;  1HC8 A;  5E3O A;  4CAE A;  3I55 I;  2OZ6 A;  4HX4 A;  1Z6R A;  3WHC A;  2DPD A;  3SFI A;  4Y49 B;  4Z6Y A;  3SZG A;  4HF2 A;  2K9S A;  4CAX A;  2KIF A;  1QRY A;  1ETY A;  1YR0 A;  1L3L A;  3K4K A;  1VQ6 I;  4BIN A;  1PUF B;  1XC5 A;  3MQ0 A;  3BJO A;  3ZN0 A;  3CPX A;  4UY8 I;  3G73 A;  1XMX A;  3RCO A;  1LFW A;  1GXQ A;  4PSW A;  1XOV A;  2G7U A;  4S05 A;  3D5L A;  4P4B A;  1ARL A;  3IL2 A;  1VQK I;  2GM4 A;  5FVJ A;  4M3F A;  1S6L A;  2XF6 A;  5HLI A;  4MJ8 A;  3QYE A;  3OIQ A;  3L2R A;  2B4D A;  3O6B B;  4UXN A;  3E6C C;  3TT2 A;  4KFC A;  3E5X A;  2IW5 A;  1YRE A;  3E6M A;  2G7H A;  4UHT A;  1KWM A;  2CGP A;  2V4J C;  4DGW B;  2EFQ A;  1AHD P;  2GXB A;  1LFP A;  1WJF A;  4XOP A;  3RTR A;  2PJR A;  4MHD A;  3H0G J;  3SXO A;  2KRF A;  2KRC A;  3ASO H;  3LQR A;  2WAQ A;  3VOD A;  4U0Y A;  4IRI A;  2XPW A;  5ICE A;  5LRS A;  1GHE A;  1BPM A;  3D7G A;  1OCP A;  4PJL A;  1W1W E;  3FXJ A;  5LGT A;  2QEX I;  2BGC A;  4E7I A;  2DMN A;  2H1L A;  4OC0 A;  2EK5 A;  2POK A;  2ISY A;  2MC3 A;  2PJ5 A;  4O6J A;  4FD4 A;  2GIV A;  2O6G E;  4IF5 A;  3KKW A;  4UUV A;  1XN7 A;  1SFO J;  4UNO A;  1YTY A;  2QBY B;  1E3P A;  1XRY A;  3S6H A;  2KP6 A;  3B7I A;  4EJT A;  3W6V A;  3DTI A;  2ZEH A;  2ESH A;  1R5I D;  4UUT A;  2HYG D;  5CVV A;  1YOV B;  2VOO A;  1UST A;  2ZED A;  2HVQ A;  4IK2 A;  3P9K A;  1IXR C;  4UWJ A;  2FQ3 A;  2RQP A;  2BOA A;  2W7N A;  2FD5 A;  1VF9 A;  3PB7 X;  1GDT A;  5J1Q A;  1FBQ A;  1XX5 A;  3NQO A;  3TE4 A;  3B6A A;  2GZW A;  3GVA A;  4CGL A;  1FIA A;  2HKO A;  2JT1 A;  2OZU A;  3DEE A;  4F0X A;  4E7S A;  3H9J A;  3R61 A;  3I4P A;  3VPR A;  5EEA A;  4GXH A;  2WYR A;  1MSE C;  4CCJ A;  4OWR B;  2LK2 A;  5BS6 A;  3GTG J;  3SJE A;  3M8E A;  3GZ6 A;  3VWE A;  2DMP A;  2HYJ A;  2VPL A;  2ABZ A;  2JDC A;  1TWG J;  3I5U A;  3OYI A;  2JA2 A;  3GFL A;  3SJM A;  3CF5 F;  1YW4 A;  4CYN A;  5FLX Z;  3Q9V A;  3U1K A;  4AU7 A;  1P7J A;  2XVC A;  4KOU A;  4J19 A;  1AMP A;  1Z4R A;  1IYK A;  2R93 J;  4IOA F;  2JQ7 A;  4M6V A;  2JEW A;  4YFK F;  2X6X A;  4PDK A;  3RYR A;  2B9S A;  1TKJ A;  2A6E F;  2O7O A;  4A2U A;  4O3M A;  4M3E A;  1A6I A;  4B1R A;  2VUM J;  3BTI A;  1KUY A;  2IXS A;  3K1N A;  4KDP A;  3DV8 A;  3RJP A;  5E17 F;  3WGI A;  1WVR A;  2CG4 A;  1Q1V A;  2ZJP F;  5D5X B;  2Q1Z B;  4OC4 A;  3EPZ A;  2VZZ A;  1IRG A;  2M2E A;  3SEQ A;  4A0X A;  1IJW C;  3ZQQ A;  2DYS H;  2DOE A;  3VYR B;  2LH9 A;  4II2 A;  3HXL A;  3RNZ A;  1UMQ A;  2PMZ N;  3F8N A;  4BHB A;  2FU4 A;  1QU3 A;  4HNU A;  2O0Y A;  2AFM A;  1BN5 A;  4NGN A;  3OV8 A;  3HOZ J;  2UUZ A;  2IPQ X;  3F8F A;  2YU3 A;  2KKO A;  1W5C C;  4XOT A;  4C2T A;  3HRS A;  4EMS A;  5C4X J;  3KZW A;  1WGX A;  1K4S A;  3S1R J;  3ZPL A;  3M4O J;  4FTH A;  2R7F A;  4XN0 A;  1KA8 A;  2YGW A;  5DWN A;  3V7R A;  4EV0 A;  2EV5 A;  2K5T A;  2V8H A;  1ZRC A;  2HQN A;  4CYQ A;  3FIS A;  2X7B A;  4BXU A;  2JUG A;  4N9I A;  5LRG A;  1SVM A;  5G22 A;  2XIG A;  4D0P A;  4M85 A;  2F5C A;  3I0T A;  2FIW A;  3K7A J;  3KQX A;  1K78 A;  4KIS A;  1S5K A;  3TO6 A;  1G4D A;  2EPF A;  3ESW B;  3BG5 A;  4IXA A;  4OOI A;  4DOZ A;  3PNY A;  2DFH A;  1D1C A;  2IJL A;  1QQI A;  4WK8 F;  2PJ8 A;  4MHY A;  4LIT A;  2GRE A;  4LB5 A;  1IUF A;  3HGY A;  1XB4 A;  4BY1 J;  3JCU C;  1MMD A;  4KUA A;  2P81 A;  2KLO A;  1YHQ I;  4BBH A;  2E1O A;  5JR3 A;  4BJT A;  3FF5 A;  1M44 A;  1S7K A;  3PQJ A;  3F72 A;  2VJ5 A;  3FK6 A;  4FUU A;  1ZR4 A;  2WPX A;  4OP4 A;  3ABT A;  1GV2 A;  2K5C A;  4CGM A;  1G8X A;  5FJ8 J;  1PJR A;  2DYR H;  1BW5 A;  5CVJ A;  5J47 A;  1BIB A;  5LBQ A;  1R22 A;  4UIA A;  2J5P A;  1U9N A;  4KIF A;  3W91 A;  1S3J A;  1ORK A;  1R00 A;  1W7P D;  2CUZ A;  5EDN A;  1ZO0 A;  2ANP A;  1TWA J;  3HRT A;  2NS7 A;  4R79 A;  5KAF C;  5I0C A;  1Z8W A;  2IA1 A;  4BQN A;  1FTZ A;  2PJP A;  3U1D A;  4CYP A;  1XGN A;  4Q7A A;  4Y52 J;  2RDP A;  4M6X A;  3CD6 I;  5E18 F;  4I01 A;  2DA5 A;  3COA C;  1Z1D A;  2Q0O A;  1A35 A;  2Q04 A;  1ETO A;  1ZRE A;  2JMW A;  2KCW A;  3C1D A;  1PVE A;  3NA6 A;  2V1X A;  1RRJ A;  2PDO A;  2V6E A;  1LOK A;  4RM3 A;  2FXA A;  2NVX J;  5CPR B;  1IGB A;  2BZT A;  4CRZ B;  3K2A A;  2ZME A;  3SDB A;  2ZME C;  3FJU A;  1O3Q A;  2MLK A;  2W00 A;  4PK4 A;  2YNC A;  2YNC C;  3RKX A;  3ROU A;  2L5Q A;  3JRG A;  2RNJ A;  2XGC A;  4MTD A;  2VLA A;  4K30 A;  2CQK A;  4BE2 A;  3E3V A;  4BUP A;  5AG5 A;  2PIZ A;  3OYD A;  1YJW I;  2EQR A;  5HVH A;  2EZK A;  1R1U A;  2W82 A;  4B48 A;  2G3T A;  4HPS A;  3FMC A;  3PO2 J;  1QO0 D;  2Q0Y A;  1ZG8 A;  2KMU A;  2PVW A;  5GCN A;  2IBD A;  4PPZ A;  3T5X A;  1OCT C;  4H4K C;  1KU9 A;  2HOE A;  3LAC A;  1SMT A;  2ESN A;  2ZB9 A;  3L7W A;  1NK2 P;  4EWT A;  1XTA A;  3GTL J;  5GPA A;  1VQM I;  2ZEP A;  1JUM A;  1T08 B;  2JTV A;  4HQM A;  1YLO A;  1G6N A;  4IRG A;  2VL1 A;  4H89 A;  4C2Y A;  3BR0 A;  2LBF B;  1B59 A;  1LAM A;  4B14 A;  1VZ0 A;  1HW2 A;  3HDD A;  5JQ4 A;  3DPL C;  2WTE A;  2PBI A;  3LSG A;  3TMO A;  5EF6 A;  2Z3K A;  3T8R A;  3PFE A;  3EUK L;  4G94 A;  3JSO A;  3CC2 I;  4UB6 C;  3J7Y J;  4B5O A;  4A31 A;  1Z77 A;  1T2K A;  1BR2 A;  3GFJ A;  2VON A;  1AYE A;  5BQT A;  1GV5 A;  2MYS A;  1IYL A;  1TXR A;  2NVT J;  4BH9 A;  1X3U A;  2STW A;  6PAX A;  5D8N A;  3RZA A;  3IWZ A;  3S1N J;  4BBR J;  3SI0 A;  4QTR A;  2UV1 A;  5EBV A;  4B13 A;  5HDK A;  4F9U A;  4J01 A;  4KS9 A;  4I09 A;  2E71 A;  1K79 A;  2IAI A;  5CVR A;  5M5X J;  4MY3 A;  4M71 A;  1ITY A;  1WJD A;  2AFU A;  4CGO A;  3PSF A;  3O3K A;  3V8K A;  3DTK A;  4I6Z A;  2D45 A;  1Z0X A;  2OCE A;  1PUE E;  4KLV A;  2KIQ A;  2O8X A;  4AUX A;  4P44 A;  1HW5 A;  3GW2 A;  2MD0 A;  2P6S A;  1ETK A;  5FKN A;  4D1Q A;  2ACJ A;  2QYO A;  3HTU A;  2E2H J;  2ZXW H;  1A04 A;  3V4G A;  3EY5 A;  4MTE A;  2PR8 A;  1JGG A;  1X4P A;  4HOB A;  2CW7 A;  2Z3N A;  4U9Z A;  2E34 A;  2XPV A;  4PJN A;  1IRX A;  1BR1 A;  2B63 J;  2IGM A;  1R5G A;  2MD5 A;  3TKY A;  1BLL E;  2OBP A;  1UHS A;  2K86 A;  3KYL A;  1GLN A;  3PM1 A;  4LG0 B;  1HW1 A;  4RAG A;  1Z8X A;  2F6C A;  2K85 A;  4HF0 A;  3NH8 A;  3BP8 A;  3KLN A;  2VXK A;  4GS4 A;  2OD5 A;  4OKO A;  3KHZ A;  4NGR A;  2HUZ A;  1NH3 A;  3OYM A;  2Q43 A;  4IRH A;  2K4B A;  1TT5 B;  2WC2 A;  2TCT A;  2FBI A;  4A3K J;  2PJ0 A;  2F5V A;  3PEI A;  4OIW A;  2DMU A;  3MVP A;  1BI2 A;  1TKH A;  1JKQ C;  1W7P B;  2B5G B;  1EH8 A;  1ENH A;  1N71 A;  1BI3 A;  1VQ9 I;  4KMF A;  4A3B J;  4MY0 A;  5AG7 A;  5E8I A;  2EO8 A;  1KON A;  3AG4 H;  4LK0 F;  3WTZ A;  4CCK A;  2HVS A;  1HA8 A;  2Y48 A;  4C2M J;  3ML6 A;  1AA7 A;  1H8L A;  1IV6 A;  2Y0S A;  1VQ5 I;  1IF1 A;  4GYI A;  4OIR F;  2H8R A;  1BW6 A;  3CC4 I;  3C7J A;  1WJE A;  2MSY A;  3HKZ N;  1KZH A;  4RB3 C;  3M1C A;  3CF2 A;  4B12 A;  2OH1 A;  1M1D A;  2YS9 A;  4E7L A;  5G21 A;  4B44 A;  1M4D A;  2AFW A;  2V7F A;  2EH3 A;  4UF4 A;  4FHT A;  4LGW A;  2ZNZ A;  1GT0 C;  4OC1 A;  1W5S A;  2V8D A;  2TDX A;  3L9F A;  3G2B A;  2D2W A;  4MRI A;  4CS0 B;  3CMM A;  3K1P A;  1KZF A;  1K61 A;  3MN8 A;  2K9Q A;  2P5L C;  1FNO A;  4BQQ A;  2YR2 A;  2Z2S B;  3BT9 A;  2CY2 A;  2VB6 A;  4RGU A;  2M4G A;  2MH9 A;  4LMY A;  4ZYA A;  1SAN A;  3PBB A;  1N77 A;  3IWG A;  1FOW A;  1QBJ A;  2JLM A;  3DLJ A;  5FO5 A;  4YEL A;  3ZMU A;  1D3Y A;  3HOT A;  3TP0 A;  3FXR A;  1GVJ A;  4CYD A;  1CBX A;  2AJ6 A;  1PP7 U;  2BVM A;  3K1M A;  3K4C A;  2QGU A;  4C2Z A;  4CGP A;  1SD6 A;  2VKE A;  3HRM A;  1LDJ A;  4LFU A;  3QPH A;  4F52 A;  3I64 A;  5BPI A;  4KOS A;  1QPI A;  5K7F A;  1X3Z B;  5IV0 A;  4CSW A;  2DA1 A;  1WSU A;  2M0C A;  4FX0 A;  2I00 A;  4RAZ A;  5LHI A;  2ODF A;  4P9U A;  2JPC A;  1MSF C;  3P9C A;  2NNY A;  1A5J A;  1TF8 A;  3KPH A;  3GTP J;  4Y49 C;  3IRQ A;  1YX5 A;  2ZKZ A;  1RUN A;  1R3N A;  5D8K B;  4MNU A;  2E7X A;  2V26 A;  5K5R A;  4ENN A;  3TBI A;  4NGS A;  2VT2 A;  2MA3 A;  1Z9C A;  1O57 A;  2DU9 A;  2F4O B;  1PUF A;  4PXB A;  1Q2Y A;  4O5V A;  1FT7 A;  1MKM A;  1ZG1 A;  2HQ5 A;  1R43 A;  1Z91 A;  1B9M A;  1XG1 A;  4CCM A;  5F0H A;  1P92 A;  3M1E A;  2GBY A;  3SXY A;  3CO6 C;  2P7C B;  4IQ4 A;  3LQQ A;  4HNV A;  4OMY A;  3KL9 A;  5IB9 A;  1BJA A;  4X6A J;  4L89 A;  2L9S A;  2VBQ A;  1J9I A;  2DLL A;  1S3Z A;  1T56 A;  4IVN A;  4NBQ A;  1FT9 A;  1R7J A;  3SHP A;  2Z3P A;  3DGV A;  1FJL A;  4UCM A;  2COM A;  3K0L A;  4UVC A;  4AC0 A;  2WV0 A;  1MBK A;  5GAH J;  1DP3 A;  3BLY A;  1ELL P;  4EAT A;  4QB9 A;  3OL4 A;  3PB6 X;  1EE3 P;  2Y30 A;  4F55 A;  4ZJZ A;  3HEF A;  1Z7L A;  3GME A;  3OL3 A;  2P6G A;  2G0E A;  4BXF A;  3IC7 A;  2V9V A;  3WU0 A;  3CUO A;  2IGK A;  1UHM A;  2H09 A;  2XUB A;  3OY9 A;  4RS2 A;  2F5D A;  2EFO A;  5F49 A;  4L9T A;  4H6Z A;  3AL0 B;  2F5F A;  2P6E A;  4UCP A;  2VKD A;  2BEI A;  4E4H A;  3F9K A;  5C4J J;  1H8A C;  4A2Z A;  1O7L A;  1H9T A;  3CXS A;  3V8L A;  4ENK A;  4EGZ A;  1CX8 A;  4MQV A;  2QBY A;  3FBU A;  4C3I J;  1NSL A;  2OOT A;  4AYB A;  2Z16 A;  1OCO H;  3L2N A;  2HV2 A;  2ZPA A;  3ZQC A;  4I0A A;  2HDW A;  2DOF A;  1XF8 A;  4ZDO A;  2FEZ A;  4XKC A;  4L8A A;  3SJF A;  1TTY A;  5H6Q A;  4KT5 C;  4S04 A;  4KUB A;  1FYK A;  2O4H A;  2VBZ A;  5E1W A;  4BDY A;  2JA7 J;  1SD4 A;  3B3V A;  3B8G A;  2O03 A;  5EEG A;  3H0D A;  2CRG A;  4AG9 A;  5DS0 A;  3VEP A;  3LSR A;  2VQY A;  2Y9Y A;  2XEJ A;  3SFZ A;  4HNT A;  2ZW5 A;  3S8P A;  4HX7 A;  1VKC A;  5FKO A;  4MLO A;  2R7D A;  5K7H A;  1DP7 P;  5KK1 A;  3JTG A;  3R1K A;  4AIH A;  4IQJ A;  4PXE A;  5ILU A;  3KE2 A;  1R71 A;  1XCV A;  2E5N A;  3A03 A;  4MHP A;  4HF1 A;  4BYY A;  3CMY A;  2Z33 A;  1FPQ A;  4P4J A;  1JXS A;  4M72 A;  1J0R A;  5LYF A;  4KVX A;  1AOY A;  3E1S A;  4XKV A;  3AFH A;  1MGT A;  2PRB A;  3HPH A;  4KUM A;  5E8G A;  3EUA A;  4PXC A;  3IWW A;  1HLV A;  1LKX A;  2AO9 A;  1YIJ I;  3EET A;  3M8J A;  3FX6 A;  2ZXH A;  2C6C A;  1O4X A;  4IHV A;  2XKO A;  5DM6 F;  4ABZ A;  1J09 A;  4L18 B;  4E2A A;  2JPB A;  1BBY A;  1ZRF A;  2FOK A;  2MG4 A;  4M74 A;  1YW7 A;  4KN7 X;  5H20 A;  3E0J B;  3GLJ A;  2BBY A;  4B09 A;  4PSX A;  5F64 A;  3ZMV A;  2LG4 A;  2FSR A;  5J8F A;  1HKQ A;  2CIJ A;  1UZC A;  1U6M A;  2DT6 A;  5IT3 A;  4LLL A;  1IOF A;  3CUQ A;  1F57 A;  3CUQ C;  3KEY A;  2YUS A;  3TO7 A;  4IHS A;  4I98 B;  1R4N B;  2R7X A;  4R8H A;  1DU6 A;  2EWB A;  3BR3 A;  3M7G A;  2ZFU A;  3VDX A;  5IT9 K;  1HXD A;  3FBI B;  1DPU A;  1UWY A;  4IOC F;  2NOG A;  3I1U A;  4R87 A;  5F46 A;  4YFX F;  2FML A;  1DDN A;  4CRY B;  3FBN B;  4A3M J;  2R7R A;  1I50 J;  2DOD A;  4KT6 A;  2AQF A;  4BJ6 C;  3GFI A;  5AIP A;  4MHZ A;  4A95 A;  1T33 A;  3MKZ A;  1K83 J;  1ZQ3 P;  3H9G A;  3QP6 A;  4DZJ A;  4XQF A;  1D8J A;  1JTY A;  4A5N A;  2VKV A;  1W36 C;  2I10 A;  3QYB A;  2ZJR F;  3PB8 X;  4WWV A;  4M3D A;  1RO5 A;  4C2X A;  2HDC A;  5DYM A;  3I3L A;  4L5J A;  3ZQ7 A;  3ZMS A;  5EG0 B;  2XAJ A;  5HOD A;  4CCN A;  2V8V A;  4MMO A;  2C6G A;  1R1T A;  1WJC A;  3D2P A;  4P96 A;  3IU1 A;  2W25 A;  2FBK A;  1U6G A;  2ID3 A;  2RVC A;  2QF7 A;  3I9S A;  2GA2 A;  5J4Y A;  1F5T A;  1YQA A;  2J8N A;  2WAQ N;  4PUS A;  3U2R A;  1I27 A;  1WQ2 A;  2L0K A;  2ZJ2 A;  1K4T A;  3FEE A;  2LOO A;  5EGO A;  4EVY A;  1R36 A;  3DU6 A;  1XEB A;  4LIU A;  4ZYD A;  2PLY A;  4MFL A;  3BHX A;  2JUC A;  2XKP A;  4LK1 F;  1X1A A;  2PJ6 A;  3CCL I;  2P0W A;  3S1Q J;  2J8M A;  4NC8 A;  4UFX A;  2CW8 A;  3ZMT A;  1U8R A;  4OIP F;  3LAJ A;  1UB9 A;  4M9S A;  1B8I B;  2KL4 A;  3EXN A;  1FMV A;  3LSK A;  4K3N A;  1ZG9 A;  2R7W A;  1VHS A;  4R1H A;  2E1N A;  3HPG A;  2VC0 A;  3REO A;  4CCO A;  1J75 A;  4WXD A;  2NNN A;  3GYH X;  4BXX J;  4BU2 A;  3TTH A;  4JYK A;  2ZEF A;  2BW3 B;  2R98 A;  3NRV A;  3WTX C;  3BJA A;  2DQL A;  2LP0 A;  1VHO A;  4NSQ A;  4PGH A;  3WC7 A;  4U5Y A;  2X85 A;  3LSI A;  3CQZ J;  1J2X A;  4PJ0 C;  2RKH A;  1D0Y A;  5ICG A;  4GFB A;  2N8G A;  2M0M A;  5J1R A;  3AAF A;  1U5T A;  1U5T C;  4Z2Y A;  3W6S A;  2M9H A;  1S29 A;  3V38 A;  3WU1 B;  3RPU A;  2A69 F;  5EZG A;  5CJ9 A;  5F48 A;  1LCP A;  4KLW A;  3S32 A;  2WBM A;  2L9N A;  1ZGA A;  1G3S A;  3ULQ B;  3OYK A;  4HDV A;  2JRT A;  5BMZ A;  3EYY A;  3I53 A;  1HQC A;  1V5F A;  5DCF A;  2PJC A;  4BHP A;  5E1X A;  3GO5 A;  3CJR B;  2EIK H;  4OIN F;  1U78 A;  3D7F A;  1MBG A;  4OAD A;  2K9L A;  4L0Z B;  3K70 D;  1RNL A;  3LSP A;  3FXM A;  4UB8 C;  5G20 A;  5DD4 A;  4WXC A;  2NYX A;  1XGM A;  2QVP A;  3TFY A;  1POG A;  2IGN A;  5L3D A;  2E60 A;  2EA2 A;  1U9O A;  2IA2 A;  2EIJ H;  1WFX A;  3HHG A;  4BNC A;  2E35 A;  3CZX A;  4NXY A;  2FX0 A;  1ODD A;  2BY1 A;  1QSM A;  2DDA A;  4PCQ A;  3H3V K;  2PCU A;  3D5S C;  4R6T A;  3CCU I;  2H94 A;  2VBX A;  2X6Y A;  1Z6T A;  3JRA A;  5IY5 H;  2IVM A;  2R5Y B;  2V9P A;  2XRN A;  1Z21 A;  2AXL A;  2QQ8 A;  2MFZ A;  4MGR A;  5KVR A;  3JRB A;  4ZTJ A;  4A5M A;  4Q47 A;  4XL9 A;  4O23 A;  4H0E A;  4P6Y A;  3OYL A;  3VAT A;  4E7K A;  5LRJ A;  4YFJ A;  2OZG A;  2OC6 A;  2EFN A;  3BI0 A;  3MFK A;  3G71 I;  4P4E A;  3BDD A;  1IN5 A;  1IW7 F;  1TQP A;  3BG6 A;  2MAB A;  3BR5 A;  3MN2 A;  2Q8K A;  3OYG A;  3DLL F;  1YE9 A;  1Z8T A;  2RNG A;  4B5P B;  3K6G A;  5IB0 A;  2B58 A;  3SYT A;  4LX9 A;  1XDS A;  4HLY A;  4RAF A;  1IDY A;  1YX3 A;  1X1B A;  2E1M B;  5B5E C;  5IOY A;  5DS9 A;  2V77 A;  3UY5 A;  3ZJ0 A;  2GXG A;  1PYV A;  3BPV A;  3K4M A;  1ETV A;  3W2A A;  3J80 Z;  3DLA A;  2BOL A;  1QGP A;  1RKT A;  4HA8 A;  1JTX A;  3CCV I;  1BM9 A;  2E36 A;  4XK4 A;  2RQQ A;  1VQN I;  1R57 A;  4AVA A;  4KSI A;  3BLN A;  2CMP A;  4MFZ A;  1LEB A;  2MC4 A;  4QLC U;  2HTJ A;  1TL8 A;  4Y3O A;  1QQ9 A;  1UFM A;  5KCM A;  2OA4 A;  2CQ7 A;  2FA5 A;  4HV5 A;  2X6W A;  1HKS A;  1P4X A;  2DI3 A;  2HYF A;  2BUE A;  1XSX A;  3D8P A;  1YJ9 I;  1P7I A;  3FXO A;  4QUS A;  4ZGY B;  2H1K A;  2YSR A;  1IY7 A;  5THW A;  2PVV A;  4CO8 A;  4KIC A;  4W97 A;  4LG0 A;  5B66 C;  3PRT A;  4JP0 A;  3F21 A;  2WPW A;  3HRU A;  1WWZ A;  5F09 A;  3KHX A;  3FYN A;  4XM3 A;  5C44 J;  4EVI A;  3HOV J;  2NVY J;  2VC1 A;  1FTT A;  1SQH A;  2LNB A;  2A5W A;  1UHW A;  2XHK A;  4FT8 A;  3DDD A;  3OWT A;  4K2E A;  3G3S A;  4ZZL A;  3G1L A;  2OTL I;  2EBI A;  4KOY A;  4YIF A;  4MIM A;  3TDU C;  3FM3 A;  5K7Z A;  3GYA A;  1DTD A;  2CJJ A;  3OYE A;  4A6E A;  4YIR X;  3JRE A;  2K4J A;  4UUS B;  4UFW A;  1VTN C;  3PUB A;  4F8Z A;  4MI4 A;  1W7P A;  2D4P A;  1LDK B;  3Q0V A;  3Q5F A;  4AVB A;  4Y33 A;  4XID A;  2B5G A;  4I49 A;  2BSW A;  2PJ1 A;  2LFB A;  2X1D A;  4XBF A;  5C88 A;  3DNS A;  2AXT C;  3JAM K;  3B2Y A;  3EQL F;  2A3S A;  3VOE A;  2LTP A;  3WGG A;  1YIO A;  5IP9 J;  1CF7 B;  4ESF A;  1ZH5 A;  3K9T A;  3H35 A;  1I1G A;  1TF9 A;  3IH2 A;  2L9V A;  1TP4 A;  2O3F A;  3FED A;  2HB6 A;  2Y9Z A;  3CXQ A;  3FVL A;  2BEO A;  2DO7 A;  3SZT A;  3G3Z A;  3EO4 A;  2OUM A;  2JA8 J;  3OOU A;  5FD6 A;  4M9Z A;  3KR5 A;  5JGF A;  1E3O C;  3OIO A;  1RKW A;  4HPQ A;  4KJZ A;  3WE3 A;  1F9N A;  2ZEL A;  3NE8 A;  4FAI A;  1WCM J;  1JJ8 C;  1X2N A;  5JI6 A;  3H5R A;  3IUO A;  2XGD A;  3NE7 A;  4J3G A;  4X5K A;  2Z11 A;  3IIB A;  5ISV A;  1SFX A;  3E6B A;  1V54 H;  4ON0 A;  1P9Q C;  1ZHF A;  3AG1 H;  4NUB A;  1BPN A;  3I3G A;  2F5I A;  2ID6 A;  3KYD B;  2HOA A;  2PG4 A;  2KZG A;  2KDO A;  2W24 A;  1GVD A;  4AID A;  5CPA A;  1XBU A;  2LMD A;  2JJ7 A;  3B35 A;  3O8H A;  1IRZ A;  2XAU A;  2VE9 A;  4I0B A;  1WH7 A;  2M87 A;  5LFA A;  5K8O A;  3Q3S A;  2VJI A;  3WHB A;  4MCQ A;  4KOT A;  3DBH B;  3F22 A;  2OJE D;  4UBR A;  2Z3Y A;  1QHH D;  4MBU A;  2EZH A;  3VWD A;  3IFE A;  1W4M A;  1JQG A;  2LY9 A;  1RPW A;  3QP5 A;  2RFH A;  5GAD J;  1LB2 A;  3GXO A;  1JT0 A;  2D1V A;  1S8N A;  1KYZ A;  2QEN A;  3QPS A;  2W1O A;  3W6J B;  2W4S A;  3BOQ A;  4QSH A;  3WE2 A;  3B02 A;  3B3S A;  4LG3 A;  4H2K A;  2H8W A;  4B11 A;  2PJA A;  3ABM H;  4TWE A;  4OMZ A;  4E7H A;  2H27 A;  1G3W A;  4G12 A;  1NMT A;  3LD2 A;  3S6K A;  3MZH A;  3K9U A;  2GAU A;  4RB2 C;  1BA5 A;  2KIS A;  4Y13 A;  1Z4E A;  2YNE A;  2DFE A;  3BXM A;  2XC7 A;  4NCZ A;  2NRA C;  2L7Z A;  1SFU A;  1WHU A;  2RN7 A;  4JX5 A;  4RBO A;  1HF0 A;  2OCC H;  2FE3 A;  4XRS A;  1Q2D A;  1P6R A;  2VQG A;  2R7S A;  2VI6 A;  3KEO A;  3CDX A;  3KR4 A;  1DQU A;  1J4J A;  4BJ5 C;  4DYC A;  4AM3 A;  4B8X A;  3HIF A;  1BI0 A;  5FB2 A;  2UWM A;  2HKX A;  3QQA A;  1FSH A;  3OWC A;  3MKY B;  3X2Q H;  3PZJ A;  2HZD A;  3HZJ A;  3CJQ B;  4A69 C;  1REP C;  1L0O C;  3C2G A;  1MND A;  2LLK A;  3C3W A;  1MDM B;  2FS5 A;  4CPA A;  3HM5 A;  2X1E A;  3SEZ A;  5IYB J;  4OC2 A;  2LR8 A;  3D5R C;  1NK3 P;  4MEX F;  1HKT A;  3TOB A;  4V2F A;  3DEU A;  1ON1 A;  2XEI A;  2MGQ A;  1Q7L A;  3W2V A;  5D5U B;  1QZY A;  2W48 A;  3FMR A;  2I5U A;  4G6Q A;  3WC5 A;  5K8N A;  1VIX A;  4E0A A;  4OID A;  3S9N A;  3BJ7 A;  5LYI A;  3J7Z I;  4Q38 A;  2IS6 A;  3MGD A;  2GE3 A;  1MBJ A;  4XLF A;  3F6O A;  2M7A A;  5IP7 J;  5E3N A;  5GP9 A;  1FBS A;  4D5F A;  2R5Z A;  1F36 A;  3S9M A;  4W1U A;  2PJ2 A;  1T0F A;  5K8P A;  1T0F C;  2Y0S N;  3MCZ A;  1QVT A;  2LVS A;  4OAY A;  3QU3 A;  2DQR A;  3MRU A;  2R7V A;  1XMA A;  4U7B A;  3JRH A;  3BZC A;  3BTC A;  3RDI A;  4JX6 A;  1FC3 A;  2X0L A;  3IHU A;  3OMY A;  4IHY A;  4F91 B;  1O7F A;  2R7O A;  2V1U A;  3M3Y J;  1QSN A;  3NAU A;  3WG9 A;  4BEH A;  1JHH A;  1I39 A;  1X12 A;  1U2W A;  2W84 A;  4NNJ A;  3LNQ A;  1QA6 A;  1S7L A;  3E97 A;  3GWZ A;  2EJR A;  2P8T A;  5ICF A;  5F1R A;  3SI1 A;  3FDY A;  1O3S A;  3J7A Y;  1IDZ A;  4UVB A;  3DSB A;  2VQH A;  3J81 K;  2TRT A;  2Y2Z A;  2LRD A;  1S5L C;  3IC1 A;  4EME A;  3LA2 A;  4HEA 2;  2Z99 A;  3JAM Z;  4KYW A;  4KVO E;  4MHG A;  4GCV A;  4AD9 A;  4KSF A;  5CLS A;  4BS9 A;  3MZY A;  2GOM A;  2XRL A;  5JVG F;  5JLX A;  3IO1 A;  1X1C A;  1NSA A;  2XEF A;  1X2M A;  2AQE A;  3EFA A;  3HBL A;  2B3V A;  2LDU A;  1MBF A;  3KZZ A;  2GXA A;  3JW4 A;  5DTD A;  1FMW A;  4LLN A;  2B4D B;  3A9L A;  3IKV A;  3FF3 A;  2JRM A;  2EUI A;  3CTA A;  1XPX A;  4X1E A;  1B1B A;  3W6X A;  2P6F A;  2E7W A;  5LLQ A;  1FIP A;  4U88 A;  2DF5 A;  4FCY A;  3GBG A;  3JUW A;  2PJR B;  1RES A;  2DTR A;  2G0B A;  3K2Z A;  2FRH A;  2JN6 A;  2M1B A;  1ETW A;  5K1Y A;  3HOU J;  2ARH A;  1Y6I A;  2AFS A;  3PNV A;  2C6P A;  3KX2 A;  2HDD A;  3ZXS A;  2DJN A;  1Z3Y A;  1TZL A;  5F47 A;  3UR3 C;  2FF4 A;  4WWC A;  2OV7 A;  1TT0 A;  2L7M P;  2WAD A;  3KP5 A;  4DUK A;  3DBR B;  5DD8 A;  5E3L A;  1WK4 A;  1YRN A;  3LSM A;  3G1M A;  3TO9 A;  1OJL A;  2HVR A;  1D0X A;  4IPA A;  4KMU X;  3K2K A;  3E7L A;  4X0G A;  3DKW A;  4PZJ A;  4L0Y B;  1A36 A;  3HJE A;  1VQ4 I;  2C6Y A;  1DE4 C;  2OF7 A;  1X1P A;  5LRK A;  5DUK A;  2ZW6 A;  3H8G A;  1M1E B;  5EG0 A;  1D5V A;  1BO4 A;  2HPM A;  1G2H A;  3H36 A;  3S1M J;  3T1B A;  3MWM A;  3D66 A;  2JK3 A;  2F4I A;  2PMU A;  2X51 A;  5E3M A;  3ZZI A;  3HSR A;  4HX8 A;  2IP2 A;  2FXF A;  5HDG A;  1W0U A;  3ZQF A;  5BOX A;  2X4H A;  3T0Y A;  1MMN A;  3OYC A;  2R7Z J;  2ZNY A;  4IF4 A;  3VWB A;  3DR6 A;  5L3B A;  2DFI A;  2DOA A;  3L00 A;  3PUF A;  4GRI A;  4CZZ A;  1I6H J;  1PCA A;  2R3S A;  1WPK A;  3TP3 A;  1N25 A;  3HTS B;  4I02 A;  2BL1 A;  2CUF A;  4HKF A;  4QBJ A;  1SEU A;  1Z9U A;  4HSR A;  2L01 A;  1H88 C;  2XDV A;  2D5V A;  2R7T A;  1B4A A;  3WU2 C;  4A3C J;  2ME6 A;  2PR1 A;  1JUS A;  2V8G A;  2DEA A;  5M5Y J;  3TED A;  3CT9 A;  4AYB N;  3CDL A;  3DF8 A;  3KIO A;  3D7H A;  4CYC B;  3DR8 A;  2BW3 A;  1JKO C;  2QVO A;  3S93 A;  1QSR A;  2X6O A;  1G3T A;  3H8E A;  5TIS C;  2EB7 A;  4B43 A;  1XDU A;  2VE8 A;  5DCM B;  1FSE A;  3QOP A;  3HC7 A;  4BQO A;  4I2O A;  3HUG B;  2PRQ A;  1GYT A;  1WI3 A;  4XSX F;  1O3R A;  3R9E A;  1FBU A;  1ZR2 A;  3A02 A;  1IN4 A;  3WTW C;  2WWY A;  1L0C A;  1FWZ A;  3LFK A;  4MFD A;  5J40 A;  4CZC A;  4YII A;  5FKM A;  5FKK A;  3GZN B;  1U3E M;  3QYF A;  3WTT C;  3RKQ A;  3CLQ A;  5JVT A;  3IH3 A;  3IWF A;  4XN3 A;  4X8I A;  1AKH B;  2A61 A;  2W57 A;  2Y75 A;  3I59 B;  3QPL A;  3R4K A;  4FAS D;  1P4N A;  2VEZ A;  3IP4 B;  2GLF A;  2DN0 A;  1ZAR A;  2JSP A;  3ZQI A;  4Q36 A;  3CDH A;  2FJ1 A;  2CF4 A;  4KZT A;  3TGN A;  3SXN A;  1QVU A;  4FWU A;  2I3C A;  1VHE A;  4P9F A;  2KIU A;  1YFH A;  1EH6 A;  3NAR A;  3DPT A;  4EJW A;  3KEQ A;  1OZP A;  2OB0 A;  2WSA A;  1A31 A;  5F6F A;  5IPA A;  4ORF A;  1EV7 A;  5DDG A;  1ZEL A;  4AIJ A;  2W85 A;  1XD7 A;  3TX8 A;  3JR9 A;  4M9X A;  5M3M J;  2ADU A;  1S7O A;  1E17 A;  3OYF A;  2CH0 A;  1GXP A;  2OR4 A;  5DEQ A;  3MAJ A;  7CPA A;  3M07 A;  3W3C A;  2R5Y A;  4MEY F;  3IAM 2;  3IGR A;  2QQA A;  4E6K G;  3OS2 A;  1RIO H;  2L2O A;  3BTJ A;  3HOY J;  3PFY A;  2R0Q C;  2CSO A;  4DBQ A;  1XE4 A;  4OME A;  1BJZ A;  4IHT A;  1YK3 A;  3JVN A;  3OYH A;  1T38 A;  2DJI A;  2HU9 A;  3FHZ A;  4G9Y A;  5KTA A;  3FXU A;  2JVH A;  2CQX A;  3WAB A;  4B5P A;  1RC9 A;  1KUX A;  2HI3 A;  1IAW A;  1OCZ H;  3FWE A;  4R76 A;  1IRF A;  1H9G A;  2Z9O A;  4RGX A;  2F7V A;  4XPL A;  5F0C A;  1MH4 A;  2AE6 A;  5KAI C;  1V0C A;  2PE3 A;  2E1M C;  5HLG A;  1N75 A;  4M6H A;  1LPQ A;  3P9I A;  4X2T A;  4EFD A;  2QQB A;  4A12 A;  1TKF A;  2EBJ A;  1W0T A;  2XEG A;  2FNP A;  4RLF A;  2ZC2 A;  2FCK A;  4A6D A;  1JUP A;  2EZI A;  2K02 A;  1S7N A;  1Y0U A;  3LSJ A;  1QZZ A;  1Y7R A;  3KET A;  3V8I A;  4EM1 A;  3A01 B;  3A0B C;  1PDN C;  4JJX A;  1I3A A;  2CTC A;  3D68 A;  2EVN A;  4ANJ A;  4LB6 B;  1APL C;  1NE9 A;  1OMI A;  3K10 A;  4L9J A;  5IX3 A;  3TDZ C;  3GEZ A;  1TWF J;  1LQ1 A;  2DA7 A;  3ZQG A;  3F8B A;  3JSP A;  3R60 A;  5DV5 A;  4PFO A;  2KZV A;  4L5E A;  2EA4 A;  4IO9 F;  5ELY A;  4YEJ A;  1BR4 A;  2ZEM A;  3CJN A;  1ZLI A;  1T39 A;  1XSV A;  3N4M A;  2F5E A;  4UIB A;  3TCV A;  5FGM A;  4ENJ A;  2MW8 A;  1Y1V J;  2KQR A;  2XF5 A;  3E6D A;  3MEX A;  3CO7 C;  2IJZ A;  4E8O A;  2JBK A;  4P1W A;  1KUV A;  1YSJ A;  5J4V A;  3HOS A;  1T8I A;  3N7Z A;  4L9V A;  2FNA A;  4OC5 A;  3NH4 A;  3S17 J;  1LDD A;  3GTJ J;  4A3I J;  3GLX A;  1E0E A;  2ZEO A;  2KRH A;  5FKL A;  2KJC A;  2FBH A;  4NQW B;  2VXD A;  4KOX A;  2Q7S A;  2GFQ A;  2PEX A;  2QA4 I;  1HDQ A;  3F8C A;  2R92 J;  3I58 A;  1ZG7 A;  2XF7 A;  5HLT A;  4ZY2 A;  1AWC A;  2QUF A;  1WZ2 A;  2Z0Z A;  4UUS A;  3PFI A;  2IS2 A;  4KIB A;  1FX7 A;  4C30 A;  3FB3 A;  2DK5 A;  2O5R A;  2PJ4 A;  2P7V B;  1JHF A;  1LUJ B;  3CME I;  2PI0 A;  4JWP A;  4HW0 A;  5C3E J;  3L09 A;  1X58 A;  3C2H A;  5B1A H;  2ELK A;  3UKG A;  2GLO A;  1B87 A;  1KQ8 A;  4W9Y A;  2WY7 Q;  4AB7 A;  1DGW Y;  2ZFW A;  3LST A;  2YX7 A;  4FET A;  2WA0 A;  4IHX A;  4BE1 A;  2BXZ A;  2YND A;  3H4Q A;  2DT5 A;  2EV6 A;  5HMN A;  4MFP A;  5CNP A;  4WXH A;  2ATR A;  3WR7 A;  3J7A O;  1FY7 A;  2CNT A;  2K3P A;  3CZ6 A;  3HYI A;  4II3 A;  4EJO A;  2VXZ A;  5J1U A;  2ZXJ A;  2IQ6 A;  3QWL A;  2A68 F;  1EJ9 A;  3A2K A;  2ZEG A;  1DUX C;  2CV0 A;  5KTC A;  3GTO J;  4JXQ A;  4YU9 A;  4BBS J;  1R9T J;  3TOA A;  2Q4V A;  1JI8 A;  5AGE A;  3P5J A;  2LYC A;  5FLV A;  4UFV A;  4R3L A;  2ZCW A;  1RUO A;  3IAS 2;  5GAG J;  3F0C A;  5ERI A;  3OIP A;  1R58 A;  1YVO A;  3K70 C;  2VIX A;  1FP2 A;  1TWH J;  3DU5 A;  5HVF A;  3A0H C;  2CQQ A;  2D1H A;  4NB5 A;  4E70 A;  3K69 A;  1Z2L A;  3P2F A;  1K4J A;  3ISX A;  3TL4 X;  1K6Y A;  1KQ0 A;  4Q48 A;  4DZP A;  3IKT A;  4RS8 A;  1G59 A;  5FLM J;  3BG3 A;  4HYE A;  1WKM A;  2HQR A;  4ZZD A;  3OOP A;  3L2Q A;  2REF A;  3NH5 A;  1LE8 B;  1U0J A;  2OZH A;  1VFC A;  4Y17 A;  2E2J J;  3GKR A;  2QSH X;  2AS5 F;  5J1Y A;  4GXO A;  2DW4 A;  2LKS A;  4MFK A;  2XSJ C;  4XMY A;  4JQF A;  3GY9 A;  2O61 A;  4CA0 A;  1OCR H;  4EQQ A;  1B9N A;  4PJJ A;  4AIK A;  4UEE A;  3BZK A;  1WWX A;  2DCE A;  3KLO A;  1YG2 A;  3KQZ A;  5D5W B;  1RXT A;  3AG2 H;  5FFX A;  4M6I A;  3RPQ A;  2VBY A;  1OPC A;  2JA5 J;  1LJ9 A;  2LSO A;  1BOB A;  4YG2 F;  3OS1 A;  1Y0N A;  4DYR A;  2CW0 F;  3AG3 H;  5HS9 A;  2C1C A;  3V8J A;  4NGT A;  3HG9 A;  1YYV A;  4OC3 A;  3BY6 A;  4I76 A;  3I71 A;  3KP3 A;  4G6D A;  3EYI A;  4L9N A;  1D8K A;  3ZP5 A;  2BHY A;  3QRF F;  3B3W A;  1UEL B;  4CAF A;  4DYO A;  4YGO A;  2WAE A;  2XGX A;  3K4L A;  5F1J A;  2XAS A;  4A30 A;  2NS0 A;  2V79 A;  1BL0 A;  2D4O A;  3LWF A;  2MH2 A;  4JLY A;  3RO0 A;  2EIM H;  5HLH A;  2Y31 A;  1P0H A;  3IRR A;  3L1P A;  2GU2 A;  2PJ3 A;  1ZLJ A;  2VN2 A;  3FKJ A;  4PGG A;  5D6E A;  5HS7 A;  2DPU A;  2QEC A;  3CJT B;  1PP8 F;  1VQP I;  1FYL A;  3S14 J;  1VQ7 I;  3PL8 A;  1B72 B;  2WB1 A;  4G7O F;  4A32 A;  3N05 A;  3BTL A;  2VKH A;  4GGG A;  2DPS A;  1Z8L A;  4R8F A;  5KTD A;  2QYV A;  4U87 A;  2LY1 A;  3BWG A;  4I7H A;  1Y1W J;  4C9Y A;  4G7Z F;  2BO9 A;  1A6Q A;  3FXL A;  1MDM A;  2ELH A;  5LRR A;  4R57 A;  1P4W A;  1V55 H;  2HXI A;  2VOD A;  2VL8 A;  5J6X A;  2EK9 A;  3SJG A;  1SAX A;  4FD5 A;  1ON2 A;  3RBU A;  1XGS A;  3AKZ A;  3HOW J;  5HVG A;  3L2U A;  1VQL I;  2R7Q A;  3S6F A;  3I54 A;  1ONV A;  3WTS C;  2BCO A;  3D1N I;  3F8K A;  4KOW A;  1LFB A;  4XRS G;  5IOZ A;  5IP6 A;  1LAN A;  1JE8 A;  4JYW A;  2R8V A;  4L5I A;  5JH9 A;  1IU8 A;  3PIP F;  4PJM A;  1T95 A;  1CJW A;  1Z05 A;  4ITV A;  1JKR C;  3S6G A;  2ZOF A;  4HG2 A;  1IID A;  3DEW A;  2ZO4 A;  1M4L A;  2IEK A;  2JZY A;  2Z3M A;  2XGE A;  3ABK H;  2PJ9 A;  2Q4Y A;  4Q5S F;  3FHN A;  3ERE D;  4XKW A;  2JEV A;  2CUE A;  4YWY A;  3S3N A;  2XPU A;  1HSJ A;  4N4N B;  2BXY A;  2BE5 F;  1OBR A;  1P4A A;  1A2Z A;  3PP9 A;  3NWT A;  3HLP A;  4EGY A;  4C7I A;  4MXU A;  1SD5 A;  2LBF A;  4U7D A;  4A3G J;  4XKB A;  1Y0R A;  5AG4 A;  4ZY1 A;  4XLE A;  1GHC A;  4I99 C;  3CCS I;  3D3S A;  1TQI A;  1EH7 A;  2IT0 A;  4XRM A;  4XPD B;  3F23 A;  3WC6 A;  3BR2 A;  2A4N A;  1XIX A;  3NFZ A;  2VJJ A;  3MZ8 A;  1K6O A;  2HS5 A;  3HGG A;  4RGR A;  1MMA A;  2V1N A;  5J3L A;  3L2W A;  5AG6 A;  3VAR A;  2GAN A;  2GIZ A;  3F5B A;  2HQA A;  3T8T A;  2RC4 A;  3DP7 A;  4B47 A;  5A2Q K;  3H3Z A;  4HNW B;  2PN6 A;  5H84 A;  1FYM A;  2ZXI A;  3JRC A;  1RZ4 A;  4DIQ A;  3E0K A;  1W36 D;  3IV5 A;  1AUG A;  3K4N A;  1Q2C A;  3CMA I;  4CHU A;  2XAQ A;  2KT0 A;  2V6C A;  4XNF A;  3ZN1 A;  4A3F J;  4IHM A;  3RIR A;  1STZ A;  3LA7 A;  2HEO A;  3CCM I;  1Y9W A;  2H5M A;  4HBL A;  4XLP F;  1UG2 A;  4OIQ F;  3GB0 A;  4GO1 A;  1YQE A;  2PIY A;  4IJA A;  3D0S A;  3OR2 C;  3VYU B;  2IL4 A;  5D4S A;  4AWX B;  1C0W A;  1S7E A;  2M8G X;  3VYS B;  4BKX A;  1NHA A;  3KP7 A;  5BNG A;  2CNS A;  4LJZ F;  2R7H A;  4NFR A;  1QNT A;  1ZTR A;  4DJA A;  3H9Q A;  1QPM A;  5IT9 Z;  2K3F A;  3DKY A;  1F2P A;  4PK3 A;  4IEJ A;  1ACI A;  1OIS A;  2LF7 A;  2VPR A;  3NWS A;  3S3M A;  3R0J A;  1SC7 A;  1J5Y A;  4RAY A;  5TJJ A;  4UEZ A;  1FZP B;  3BJ8 A;  1EF4 A;  1XMK A;  4KN4 X;  2HR3 A;  1Z5R A;  4CH7 A;  4PFP A;  5HDN A;  4KA4 A;  1JJ6 C;  2PC1 A;  2E5Z A;  5L3F A;  4NF1 A;  3BC8 A;  1Y9K A;  2DPT A;  4X3R A;  2HC9 A;  2FMY A;  1TQM A;  3FNC A;  1CM0 A;  5A27 A;  1F43 A;  3R96 A;  1CPX A;  3SHF A;  3K4B A;  4ENM A;  1NG7 A;  4HV6 A;  1TLH B;  5FD5 A;  4HST A;  4XLA A;  5HNF A;  3LAP A;  3S9L A;  3I4M J;  4YRV A;  2QJ8 A;  1T6S A;  3S3O A;  2PJB A;  3QAY A;  3G1O A;  2YX4 A;  4TNU A;  4DYQ A;  3R9G A;  5TRD A;  5CQE A;  1XMT A;  4LIV A;  4NJQ A;  5JM6 A;  2ISZ A;  4BHC A;  4NHJ A;  2GWR A;  1FLI A;  4HDU A;  3RPU D;  3KYC B;  4E7Z A;  2M5W A;  1BC7 C;  4P4I A;  3R95 A;  4XOR A;  3WGH A;  3SI2 A;  4HNX B;  2ZSI B;  4DQ2 A;  2DAO A;  3HHH A;  2K9N A;  3F6V A;  4IZZ A;  1ETX A;  2Y0M A;  3B73 A;  2DTZ A;  4RB0 A;  4DJL A;  2BY2 A;  5DM7 F;  1KU2 A;  3N5F A;  1ZLH A;  4PK2 A;  3R6S A;  4CYC A;  2FL4 A;  4F9V A;  1MMG A;  1F1Z A;  4FBE A;  2Q7B A;  4KIT B;  6CPA A;  4FD7 A;  4ZY0 A;  5DCM A;  4LUA A;  3HUG A;  3ELK A;  1OLT A;  2Z3L A;  2WZN A;  2R1I A;  4BL0 B;  3A4C A;  2PQ8 A;  4U0V A;  4ZYG A; 
#chains in the Genus database with same CATH homology
 1X1D A;  4BXF A;  2QIR A;  3OY9 A;  2IGK A;  5F49 A;  3JUW A;  3GBG A;  4RS2 A;  2PJR B;  2BVL A;  1QHG A;  4ZTF A;  4H6Z A;  4QC6 A;  3AL0 B;  2P6E A;  2G0B A;  2B3U A;  4UCP A;  2VKD A;  4JXR A;  2BEI A;  4E4H A;  3CP8 A;  2ARH A;  3F9K A;  4MFJ A;  1Y6I A;  4A2Z A;  3PNV A;  5TGT A;  3KX2 A;  3ZXS A;  3CXS A;  1Z3Y A;  1TZL A;  1MNE A;  5F47 A;  3UR3 C;  3ZCO A;  2QML A;  3FBU A;  4C2U A;  2OV7 A;  1TT0 A;  1NSL A;  2CV2 A;  4B10 A;  4AYB A;  2WAD A;  4P5O A;  2Z16 A;  3V42 A;  4BAC A;  5HVQ C;  4OAZ A;  2HV2 A;  2ZPA A;  4DNC A;  1WK4 A;  3LSM A;  3MMY B;  4ZDP A;  2M4K A;  2HVR A;  3TO9 A;  4CAW A;  1D1B A;  1D0X A;  2HDW A;  4XR6 A;  4DBR A;  1XF8 A;  4X0G A;  4ZDO A;  3QB8 A;  4RM2 A;  4XLC A;  4XKC A;  4L8A A;  1D1A A;  1SAU A;  3ZRG A;  2Q2E B;  2ZW6 A;  4KUB A;  1YGH A;  4F0Y A;  1BO4 A;  4BDY A;  3DPU A;  3B8G A;  3CES A;  3OYN A;  2HPM A;  3H0D A;  4CAE A;  4AG9 A;  2I8D A;  4NC7 A;  2VQY A;  4U9Y A;  2G3A A;  2F4I A;  2X51 A;  3S8P A;  4HNT A;  2ZW5 A;  4Y49 B;  1VKC A;  2O28 A;  3ZZI A;  4MLO A;  3SZG A;  2FXF A;  4F93 B;  1I1D A;  3R1K A;  4IQJ A;  4CAX A;  4HNY B;  2E5N A;  1YR0 A;  1MMN A;  3OYC A;  3K4K A;  1X4O A;  3VWB A;  3DR6 A;  2DOA A;  4GRI A;  3RCO A;  4PSW A;  2BL1 A;  3E1S A;  3D5L A;  4XKV A;  4HKF A;  5FVJ A;  3AFH A;  3OYB A;  1Z9U A;  2PRB A;  3HPH A;  2WY8 Q;  4QBJ A;  4HSR A;  2XF6 A;  3EUA A;  2ZXV A;  2R7T A;  2XDV A;  3QYE A;  3OIQ A;  3L2R A;  4IKF A;  1IB1 E;  1MJA A;  2B4D A;  2CNM A;  1LKX A;  4JD6 A;  3TT2 A;  3RQ4 A;  1OR7 C;  3M8J A;  2ZXH A;  2PR1 A;  5HH1 A;  1YRE A;  4IX7 A;  1J09 A;  2V4J C;  2L7K A;  4E2A A;  4DGW B;  3DR8 A;  4MHD A;  1LFP A;  1WJF A;  2BW3 A;  4XOP A;  3RTR A;  2PJR A;  3S93 A;  1QSR A;  3SXO A;  3AL0 C;  2KRC A;  4B43 A;  3IWE A;  2WAQ A;  3E0J B;  3HL2 A;  1M4I A;  3HC7 A;  4BQO A;  4R3K A;  3HUG B;  1GHE A;  4PSX A;  2FSR A;  2LG4 A;  5J8F A;  2HPI A;  3T90 A;  4XPK A;  1U6M A;  2DT6 A;  4PJL A;  3R9E A;  4CCL A;  3KEY A;  2X1C A;  3TO7 A;  1WJ5 A;  2R7X A;  1L0C A;  2VZY A;  4E7I A;  3ZR8 X;  4YRH A;  4CZC A;  1DGR M;  2ZFU A;  3VDX A;  3FBI B;  4R87 A;  3QYF A;  4UA3 A;  5C82 A;  3PGP A;  5F46 A;  4FD4 A;  2IGO A;  4XN3 A;  2GIV A;  2Z1D A;  4IF5 A;  3KKW A;  4QPO A;  4FAS D;  1P4N A;  3FBN B;  2FT0 A;  2I79 A;  2VEZ A;  4CRY B;  3IP4 B;  2R7R A;  4Q36 A;  2JSP A;  4M3S A;  4KT6 A;  4BGD A;  2AQF A;  4KZT A;  2V9K A;  2KP6 A;  4BJ6 C;  4H6U A;  4NEX A;  3S6H A;  1TIQ A;  3SXN A;  4A95 A;  3MKZ A;  3DTI A;  3H9G A;  3DPT A;  4XQF A;  5HOO A;  1OZP A;  1YVK A;  2OB0 A;  2WSA A;  1W36 C;  3QYB A;  4XLH A;  4ORF A;  1RO5 A;  1ZEL A;  2HVQ A;  2M7B A;  2PMZ A;  4C2X A;  4UWJ A;  4F92 B;  2W7N A;  3I3L A;  3OYF A;  2CH0 A;  4CCN A;  3TE4 A;  1WJC A;  3D2P A;  3LMM A;  4CGL A;  3DEE A;  3OR1 C;  2OZU A;  3IU1 A;  3W3C A;  3H9J A;  4E7S A;  4F0X A;  3QAH A;  3IAM 2;  3FIX A;  3I9S A;  3IGR A;  4E6K G;  3OS2 A;  3D2M A;  4CCJ A;  4OWR B;  2L2O A;  2J8N A;  2J8R A;  3IU2 A;  2CFO A;  3PFY A;  3VWE A;  4PUS A;  4DBQ A;  2VPL A;  1XE4 A;  2JDC A;  3OYI A;  2JA2 A;  4CYN A;  2LOO A;  1YK3 A;  3JVN A;  3OYH A;  3DU6 A;  4EVY A;  1XEB A;  4LIU A;  2DJI A;  2HU9 A;  4AU7 A;  1I21 A;  4MFL A;  2K9M A;  2R4G A;  2Z10 A;  4KOU A;  2JVH A;  1Z4R A;  1X1A A;  1IYK A;  4B5P A;  1KUX A;  2P0W A;  3VSL A;  1UFH A;  2J8M A;  4NC8 A;  4FD6 A;  4UFX A;  1WJA A;  2X6X A;  2CW8 A;  2QKM B;  4XPL A;  2KL4 A;  1V0C A;  2AE6 A;  1FMV A;  3EXN A;  3G8W A;  2E1M C;  3LSK A;  2IXS A;  1N75 A;  1UAA A;  1KUY A;  2R7W A;  1VHS A;  3HPG A;  4CCO A;  3EC4 A;  4KSA A;  4RLF A;  2FCK A;  4BU2 A;  3TTH A;  2BW3 B;  2Q1Z B;  3BG7 A;  3EPZ A;  2R98 A;  2VZZ A;  4Y4R A;  1S7N A;  3SEQ A;  1Y7R A;  3ZQQ A;  3V8I A;  4BE0 A;  4JJX A;  3VYR B;  4NSQ A;  2LH9 A;  2EVN A;  4II2 A;  3HXL A;  4ANJ A;  2X85 A;  4U5Y A;  3LSI A;  1NE9 A;  1QST A;  1YLE A;  3K10 A;  1D0Y A;  5IX3 A;  2CUJ A;  5LD2 C;  1QU3 A;  4HNU A;  2R7U A;  2M0M A;  4PFO A;  2KZV A;  3LOD A;  2UUZ A;  4YEJ A;  1BR4 A;  5G21 A;  3TCV A;  3W6S A;  3L2V A;  2LC2 A;  4XOT A;  4C2T A;  5F48 A;  2KQR A;  2XF5 A;  4KLW A;  3S32 A;  2WBM A;  2L9N A;  3OYK A;  3LFU A;  3MKW B;  4G6T B;  4E8O A;  4XN0 A;  4ZDL A;  3CXP A;  4P1W A;  1V5F A;  1KUV A;  1X19 A;  3HOS A;  3N7Z A;  2YGW A;  5DWN A;  4C7H A;  2K5T A;  3CJR B;  3R9F A;  1UG0 A;  4CYQ A;  2LY2 A;  2X7B A;  4OAD A;  3ZGK A;  2K9L A;  1E0E A;  2JUG A;  2Q44 A;  2KRH A;  2REE A;  4NQW B;  3RYO A;  3K70 D;  2VXD A;  5G22 A;  4KOX A;  4M85 A;  5G20 A;  2FIW A;  4AVC A;  3FRM A;  3LSH A;  3TFY A;  2IGN A;  2XF7 A;  2E60 A;  5HLT A;  4KIS A;  2Z0Z A;  1WFX A;  1S5K A;  3TO6 A;  2IS2 A;  4NXY A;  4C30 A;  4DOZ A;  3FB3 A;  1QSM A;  2O5R A;  3PNY A;  3D5S C;  1Z7L A;  1D1C A;  2X6Y A;  3RSN A;  4LIT A;  4JWP A;  1Z21 A;  4KVX A;  2MFZ A;  4ZTJ A;  1MMD A;  3C2H A;  4KUA A;  4XL9 A;  1B87 A;  2KLO A;  3OYL A;  1M4G A;  4BBH A;  1M44 A;  4BJT A;  1S7K A;  4E7K A;  2WY7 Q;  4AB7 A;  1DGW Y;  2OZG A;  2OC6 A;  4FET A;  4YFJ A;  2YND A;  2WA0 A;  4BE1 A;  4UCN A;  3H4Q A;  3PJR A;  2VJ5 A;  3QOD A;  4C7I A;  5HMN A;  3BG6 A;  2MAB A;  2WPX A;  4MFP A;  3OYG A;  2ATR A;  5CNP A;  1YE9 A;  2K5C A;  3WR7 A;  2RNG A;  2ZSH B;  1G8X A;  2C27 A;  2CV1 A;  1PJR A;  3K6G A;  5FRM A;  1FY7 A;  2K3P A;  2B58 A;  3H5A A;  3SYT A;  3CZ6 A;  3QOE A;  4II3 A;  2CNT A;  2VXZ A;  4LX9 A;  3F0A A;  2VQL A;  1PU9 A;  3W91 A;  1YX3 A;  2VAS A;  1X1B A;  2CUZ A;  2E1M B;  3A2K A;  2CV0 A;  1ZO0 A;  5KTC A;  1YX0 A;  3UY5 A;  3ZJ0 A;  4JXQ A;  1PYV A;  3K4M A;  2PQ8 A;  3W2A A;  4R79 A;  3TOA A;  5I0C A;  4BQN A;  3DLA A;  2BOL A;  1S9H A;  1R57 A;  2Q4V A;  1JI8 A;  5AGE A;  4AVA A;  2RQQ A;  4IUS A;  4CYP A;  5AG7 A;  2LYC A;  4UFV A;  1ERD A;  4HNW B;  4R3L A;  3BLN A;  1MJ9 A;  2CMP A;  1WJB A;  2JVG A;  2GOX B;  4MFZ A;  2MC4 A;  3IAS 2;  2Q04 A;  3OIP A;  1YVO A;  2KCW A;  4Y3O A;  2VIX A;  3K70 C;  3H5Z A;  4CUG A;  3DU5 A;  2PDO A;  3FXT A;  1SFK A;  5KCM A;  5FRO A;  4AVZ A;  4RM3 A;  3OYA A;  2V6E A;  4MFQ A;  3LL7 A;  5CPR B;  4MJ8 A;  2X6W A;  3P2F A;  4CRZ B;  1K4J A;  2ZW7 A;  3SDB A;  3TL4 X;  1K6Y A;  2BUE A;  3D8P A;  1D0Z A;  4QUS A;  2W00 A;  4PK4 A;  1V5E A;  1G59 A;  4ZGY B;  2YNC A;  2YNC C;  3L2Q A;  1IIC A;  2REF A;  2L5Q A;  2IS1 A;  1U0J A;  2VLA A;  1I12 A;  2OZH A;  4K30 A;  2WPW A;  3W2W A;  1WWZ A;  3GKR A;  4RI1 A;  4BE2 A;  3FYN A;  4BUP A;  5AG5 A;  4MFK A;  2XSJ C;  4XMY A;  4XM3 A;  4JQF A;  3OYD A;  3GY9 A;  4CA0 A;  4PJJ A;  5KNL A;  2W82 A;  4B48 A;  1SQH A;  2A5W A;  2DCE A;  4XON A;  2G3T A;  2NMT A;  3DDD A;  3OWT A;  2Q0Y A;  1RXT A;  3G3S A;  2KMU A;  5GCN A;  4AG7 A;  4KOY A;  3GYA A;  4H4K C;  3DWL E;  1BOB A;  3PNT A;  3OS1 A;  3OYE A;  4XPD C;  3W6X A;  3K4J A;  1LRZ A;  3HG9 A;  5CKT A;  5CQG A;  4UFW A;  3PUB A;  4MI4 A;  4AVB A;  2D4P A;  1LDK B;  4Y33 A;  1UEL B;  2B5G A;  4H89 A;  4YGO A;  2WAE A;  2LBF B;  4C2Y A;  4CAF A;  3K4L A;  4I49 A;  4B14 A;  1VZ0 A;  2BSW A;  4A30 A;  1MW7 A;  5JQ4 A;  2X1D A;  3DPL C;  5C88 A;  3DNS A;  2D4O A;  4CGN A;  5KTA A;  3LSG A;  3TMO A;  4JLY A;  2Z3K A;  3H35 A;  1N78 A;  4JOM A;  1P0H A;  3EUK L;  3FKJ A;  4CYO A;  1S60 A;  2DXI A;  4B5O A;  2QEC A;  3CXQ A;  4A31 A;  1BR2 A;  3BCA A;  2MYS A;  1IYL A;  4C68 A;  3EO4 A;  2OUM A;  3OOU A;  3PL8 A;  4OLL A;  2WB1 A;  4J00 A;  4A32 A;  3N05 A;  5A28 A;  3UNG C;  4D9J A;  2VKH A;  3CP2 A;  2DPS A;  2M3A A;  5KTD A;  4E7J A;  3P2H A;  4U87 A;  2DT7 B;  2LY1 A;  2UV1 A;  5EBV A;  4C9Y A;  4B13 A;  4J01 A;  4BDZ A;  4KS9 A;  5IB0 A;  4HPQ A;  4R57 A;  4KJZ A;  4MY3 A;  2VL8 A;  1WJD A;  4B3X A;  4CGO A;  3PSF A;  4J3G A;  3H5R A;  3H5N A;  3IUO A;  3NE7 A;  4FD5 A;  4X5K A;  3DTK A;  3AKZ A;  2Z11 A;  3L2U A;  3S6F A;  2R7Q A;  3DQV C;  5ISV A;  4KLV A;  3F8K A;  4KOW A;  1P9Q C;  4NUB A;  2MD0 A;  4D1Q A;  3I3G A;  2A6T A;  2F5I A;  2R8V A;  3OS0 A;  2JDD A;  2B4B A;  3DKX A;  4PJM A;  3EY5 A;  3HKZ A;  1T95 A;  1CJW A;  4ITV A;  2KDO A;  2PR8 A;  3S6G A;  4HG2 A;  1X4P A;  1IID A;  2CW7 A;  2Z3N A;  4U9Z A;  5DWM A;  1V5G A;  2Z3M A;  4PJN A;  1S7F A;  1IRX A;  1BR1 A;  2XAU A;  2IGM A;  2Q4Y A;  3MD2 A;  3FHN A;  4XKW A;  5LFA A;  3KYL A;  1GLN A;  3S3N A;  2JEV A;  4R9M A;  2VJI A;  2FE7 A;  4N4N B;  2F6C A;  4KOT A;  4UBR A;  4MBU A;  1QHH D;  4CGM A;  3PP9 A;  3NWT A;  3VWD A;  2VXK A;  5E96 A;  4GS4 A;  2ELJ A;  2LBF A;  5AG4 A;  4XKB A;  4XLE A;  4CAV A;  5G1Z A;  3OYJ A;  2CXA A;  2FIA A;  2HUZ A;  3OYM A;  3D3S A;  5EC4 A;  2W1O A;  2W4S A;  4HRI A;  5JPH A;  4KOR A;  4LG3 A;  4XPD B;  2A4N A;  4B11 A;  2FUG 2;  2F5V A;  1XIX A;  2VJJ A;  3JTK A;  4E7H A;  3L2W A;  1MMA A;  2V1N A;  1NMT A;  3LD2 A;  5AG6 A;  2B5G B;  2CS3 A;  3EUH C;  1N71 A;  2GAN A;  4MY0 A;  3S6K A;  3F5B A;  2Z3O A;  3K9U A;  2HQA A;  3C26 A;  1KON A;  2YNE A;  2HVS A;  1Z4E A;  2RC4 A;  4B47 A;  4CCK A;  1HA8 A;  4KOV A;  4PV6 A;  4NCZ A;  4BEH B;  2XC7 A;  1AA7 A;  5H84 A;  2Y0S A;  2ZXI A;  2LRE A;  4DIQ A;  3E0K A;  3I9V 2;  4F3Q A;  1W36 D;  3K4N A;  2QKL B;  1Q2C A;  1Q2D A;  2IS4 A;  1WJE A;  4XNF A;  4QVT A;  2VQG A;  2R7S A;  3M1C A;  3CF2 A;  2H5M A;  4B12 A;  2OH1 A;  1M1D A;  1DQU A;  4E7L A;  1J4J A;  4B44 A;  4BJ5 C;  2UWM A;  1M4D A;  1Y9W A;  2P6G A;  2RRE A;  2V7F A;  4KVM E;  2WAF A;  4A33 A;  4ONU A;  3OWC A;  3OR2 C;  3VYU B;  3MKY B;  3PZJ A;  3G2B A;  2HZD A;  3PSI A;  2IL4 A;  3CJQ B;  4CS0 B;  3C2G A;  1MND A;  3CMM A;  1KZF A;  2FS5 A;  1R6R A;  3VYS B;  2X1E A;  3SEZ A;  4BQQ A;  3A1Y A;  2Z2S B;  3D5R C;  5BWA B;  2CNS A;  2CY2 A;  2VB6 A;  4ZYA A;  2M4G A;  3TOB A;  2R7H A;  4DJA A;  1N77 A;  3H9Q A;  3IWG A;  3DKY A;  2KPM A;  2JLM A;  4PK3 A;  3NWS A;  4N4O B;  4YEL A;  3HOT A;  3S3M A;  3ONQ A;  3W2V A;  3T9Y A;  1Y56 A;  2AJ6 A;  2BVM A;  2VQC A;  3K4C A;  3U21 A;  4E0A A;  3BJ7 A;  4C2Z A;  4CGP A;  4Q38 A;  1Z3X A;  3BJ8 A;  2NOJ B;  2IS6 A;  4F52 A;  2GE3 A;  3MGD A;  4CH7 A;  2OU2 A;  4PFP A;  4XLF A;  4KOS A;  2PC1 A;  5IV0 A;  4CSW A;  2M7A A;  5JHF A;  2E5Z A;  4NF1 A;  3BC8 A;  1Y9K A;  2DPT A;  2I00 A;  3VSK A;  1LVK A;  3FNC A;  5A27 A;  1CM0 A;  4B5P B;  3R96 A;  1T0F C;  4F6A A;  3K4B A;  2DXQ A;  1NG7 A;  4OAY A;  4II9 A;  4HST A;  4XLA A;  2HNH A;  5HNF A;  4U7B A;  2R7V A;  5FRN A;  4YRV A;  4Y49 C;  3S3O A;  1YX5 A;  1MJB A;  4ZC3 A;  1PUA A;  5KHD A;  3R9G A;  2V26 A;  5CQE A;  1XMT A;  4LIV A;  3TBI A;  3OMY A;  1B6B A;  4QPQ A;  4F91 B;  1QSN A;  2R7O A;  2WUU A;  4BEH A;  1Q2Y A;  4NNJ A;  3RPU D;  2HQY A;  5J8C A;  1S7L A;  4E7Z A;  3R95 A;  4XOR A;  4CCM A;  4RMN A;  4HNX B;  3VYT B;  2ZSI B;  3FDY A;  3J7A Y;  4RLQ A;  3DSB A;  2VJ4 A;  4UWI A;  2VQH A;  4IQ4 A;  4OAE A;  1QSO A;  2PSW A;  4XNH C;  2LRD A;  4IZZ A;  2Y0M A;  4L89 A;  4BMH A;  4HEA 2;  5HNH A;  1EA3 A;  2L9S A;  2VBQ A;  2VI7 A;  1NG6 A;  1S3Z A;  4KVO E;  4KSF A;  4PK2 A;  4BS9 A;  2GOM A;  2ZW4 A;  2FL4 A;  1X1C A;  2Z3P A;  5H86 A;  3SHP A;  1MMG A;  4UCM A;  1DP3 A;  2Q7B A;  2AQE A;  4KIT B;  3EFA A;  3BLY A;  2B3V A;  4FD7 A;  3DTE A;  4EAT A;  4QB9 A;  3BCB A;  4LUA A;  3A9L A;  3OL4 A;  2B4D B;  4ZBG A;  1FMW A;  1MK4 A;  1OLT A;  2Z3L A;  2EUI A;  1ON0 A;  2R1I A;  4BL0 B;  4F55 A;  4ZJZ A;  4XNH B;  3A4C A;  2KHM A;  2P6F A;  3OL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...