1BOBA

Histone acetyltransferase hat1 from saccharomyces cerevisiae in complex with acetyl coenzyme a
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
315
structure length
306
Chain Sequence
FKPETWTSSANEALRVSIVGENAVQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDSVTFKPYVNVKYSAKLGDDNIVDVEKKLLSFLPKDDVIVRDEAKWVDCFAEERKTHNLSDVFEKVSEYSLNGEEFVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLLNKKTKELIGFVTTYKYWHYIDKKFRAKISQFLIFPPYQNKGHGSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKLGYDAVFQKHSDLSDEFLESSRKSLKLEERQFNRLVEMLLLLNNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE ACETYLTRANSFERASE
publication title Structure of the histone acetyltransferase Hat1: a paradigm for the GCN5-related N-acetyltransferase superfamily.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Acetyltransferase
total genus 92
structure length 306
sequence length 315
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 1998-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1bobA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1bobA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 1bobA01
2FS5A 2EVNA 1I1DA 1OZPA 3DDDA 4H89A 4KUAA 2P6GA 4RI1A 4EVYA 4YGOA 2FT0A 2VQYA 1WWZA 4KOXA 2ARHA 3PP9A 3DSBA 4OAEA 4KLWA 3FB3A 1B87A 3IGRA 2WPXA 5ISVA 3K9UA 4KVOE 3TTHA 1IICA 3IWGA 3ZJ0A 1M44A 4CRYB 1L0CA 3I3GA 1RXTA 2VZZA 5F48A 3JVNA 4HNWB 3I9SA 3PZJA 4CAVA 4AVCA 3W6XA 1P0HA 4KOSA 4HNYB 4H6ZA 4II9A 3B8GA 2GIVA 3QAHA 3OWCA 5H86A 3S6GA 4ZBGA 3H4QA 3DR6A 2VBQA 5F47A 1NE9A 4NEXA 2VZYA 1V0CA 2EUIA 3GY9A 1TIQA 1M4GA 1U6MA 4AG9A 2OH1A 1Y9WA 2H5MA 2I79A 3EC4A 4R3LA 1PU9A 2R98A 3TO6A 4H6UA 5C88A 3G3SA 1QSMA 3EXNA 3TOBA 1YGHA 3FBUA 3G8WA 2O28A 1Q2YA 4CAWA 2JDDA 2Q4YA 3R9EA 3SXNA 2A4NA 2G3AA 2Q7BA 2CNSA 3CXQA 3DR8A 2FIAA 4HKFA 2REEA 2Z11A 4JJXA 1QSTA 2DXQA 4PK3A 3CXPA 2G3TA 3C26A 1S60A 4JXRA 4M3SA 2Q0YA 4PK2A 1S5KA 1MJBA 1VHSA 4B5PB 2Q44A 4MJ8A 4B5PA 1IYKA 2I00A 3SHPA 3W6SA 5HMNA 4HNXB 3V8IA 2BUEA 4XNHB 3F0AA 1UFHA 4JXQA 4AVBA 3TE4A 4E2AA 4F6AA 2BL1A 5DWNA 3F5BA 4R3KA 4DNCA 4OLLA 2WPWA 2ZW5A 2GANA 4KORA 2R8VA 2JEVA 1N71A 4KOTA 3TO7A 4LUAA 4FD7A 1YVOA 2OZUA 2PC1A 2J8NA 4R57A 4JLYA 3R9GA 1NSLA 1M4DA 3R95A 1I12A 3FYNA 2PQ8A 1QSRA 2D4OA 2KCWA 2HV2A 4B5OA 4KOVA 4IUSA 5HH1A 4IF5A 3UY5A 1KUYA 5JPHA 4YFJA 4XPKA 2FE7A 4XPDB 1BOBA 1ON0A 3EFAA 1Q2DA 5I0CA 1S7LA 1FY7A 3FIXA 1CJWA 3T9YA 2B4DB 5E96A 3D2MA 3TFYA 4E8OA 1KZFA 3S6FA 3RYOA 2B4DA 4U9YA 2B5GB 2F5IA 1S7KA 4Y49B 2AJ6A 2GE3A 4YRHA 4FD6A 2B5GA 3GYAA 4F0YA 1IYLA 1MJAA 2QIRA 1XIXA 4R87A 2FSRA 2IL4A 1Y9KA 2FIWA 5CNPA 2PRBA 2Z10A 4MY0A 3S6KA 5KTCA 2CNMA 3ZZIA 2JDCA 4E0AA 1LRZA 2OB0A 2QMLA 2ZW6A 4FD5A 5H84A 1QSNA 2VEZA 5DWMA 3EY5A 4R9MA 5J8FA 2P6EA 1IIDA 2B58A 5IB0A 4NXYA 3GKRA 3D2PA 4QVTA 4KUBA 4KVME 4QB9A 2FCKA 3D3SA 5C82A 2OZHA 2J8MA 2Q04A 3QB8A 1KUXA 1MJ9A 4JWPA 1GHEA 1KUVA 3CXSA 4QC6A 1WK4A 4AG7A 3TO9A 1RO5A 2OZGA 3S6HA 2CY2A 3VWEA 1Y7RA 4OADA 3R96A 4AB7A 4PSWA 4ORFA 1XF8A 4ONUA 1NMTA 1Z4RA 2K5TA 2B3UA 3R9FA 1YLEA 4Y49C 5GCNA 2ZW4A 2AE6A 3E0KA 3D8PA 3T90A 2D4PA 2J8RA 1Z4EA 2PR8A 1IB1E 2PR1A 1SQHA 2VI7A 1YVKA 1I21A 2B3VA 2B4BA 2RC4A 3WR7A 4CRZB 4CS0B 2OU2A 4I49A 2JLMA 3NE7A 1P4NA 2FXFA 4KOWA 4UA3A 4LX9A 2R1IA 4U9ZA 4XPLA 2PDOA 4GS4A 4MI4A 3KKWA 4U5YA 1M4IA 1M1DA 1YR0A 3SXOA 4XNHC 1MK4A 4M85A 1YREA 1S7FA 4AVAA 4NF1A 4MHDA 3JUWA 5F49A 2PSWA 4L8AA 2VXKA 4J3GA 4X5KA 1Q2CA 4MY3A 1S3ZA 5IV0A 4KVXA 3MGDA 4PV6A 3DNSA 2ZW7A 2X7BA 5KTAA 1K4JA 4JD6A 1S7NA 2G0BA 2C27A 1CM0A 4L89A 3W91A 1B6BA 4PSXA 3EO4A 2FL4A 3N7ZA 5EC4A 2BEIA 4NSQA 3VWDA 2ZXVA 2REFA 4UWIA 4KOYA 3TT2A 3FXTA 4QBJA 3FRMA 1PUAA 3TCVA 2HQYA 3P2HA 4XPDC 2CNTA 2P0WA 1VKCA 5EBVA 3TOAA 4NCZA 3F8KA 1Z9UA 4K30A 4CAXA 2ATRA 4BMHA 3PGPA 3R1KA 1YX0A 3LODA 4UWJA 1R57A 1XEBA 2Q4VA 4UBRA 2Z0ZA 1BO4A 2Y0MA 2NMTA 4KOUA 1XMTA 1YK3A 3BJ7A 2HUZA 5JQ4A 4QUSA 3LD2A 3BJ8A 2BSWA 5KTDA 5FVJA 4MBUA 2P6FA 3P2FA 4KLVA 4KZTA 4FD4A 5IX3A 1QSOA 4RS2A 5J8CA 2QECA 5F46A 3FNCA 1J4JA 3BLNA 1XE4A 2R7HA 2ZPAA
chains in the Genus database with same CATH superfamily
1R4MB 2KPMA 4BJTA 5CVJA 1I1DA 1OZPA 1H8AC 4UY8I 2ZCWA 4BE0A 5A2QZ 2Z3OA 3DDDA 4H89A 3H5NA 1HQCA 1TF8A 3MQ0A 2JJ7A 3GFIA 2XPVA 1ZGJA 2X6XA 3J7AO 3F8CA 4UV8A 4EVYA 2KT0A 4M6YA 3HDDA 4KOXA 3ZXSA 2GQQA 3KFWX 2KP6A 1WI9A 4AU7A 4MRIA 2V1UA 3NH8A 1XC5A 2V6EA 2OTJI 3TW6A 2R5ZB 3PEIA 4ZYQA 5ISVA 5DCFA 4MCQA 2VKVA 2BY0A 3JAMZ 3K9UA 1S7EA 2R7OA 1IICA 3TTHA 2JN6A 2QQBA 3WTYC 1XMKA 4BGDA 3JREA 1IJWC 4C9YA 3D68A 1L0CA 1RXTA 1TWAJ 3F6OA 3I1UA 3SJMA 1A6IA 2ELHA 1XB4A 3ZOBA 2QUFA 3PJRA 2CV1A 3I9SA 4W9YA 4HLYA 3PZJA 2WY8Q 3KEOA 4ZYAA 4GFBA 4XOPA 3LMSA 1PCAA 3E97A 3IH4A 3G1LA 3PSIA 1YW9A 4F55A 4MEYF 1DU6A 4NGQA 2HEOA 3LMMA 3OYEA 1I27A 4OU0A 5G1ZA 5L3EA 3ZGKA 3C2GA 3WU0A 4XRFA 3DR6A 4E7HA 1ODDA 2GZWA 2Y69H 3FWEA 1AKHB 3S1MJ 5F47A 1SD7A 1NE9A 2P6TA 4HYEA 1V0CA 1TKHA 4D1QA 2GOMA 3KPHA 3CLQA 4D7NA 5IP7J 2IS2A 3V42A 3L2UA 3KL9A 4AG9A 4WWVA 1Y9WA 1LAMA 3K70C 2GWRA 2I79A 3EC4A 3RKWA 1G4DA 2L3DA 5D8NA 1PU9A 2R98A 1EH7A 4HF1A 1Q1HA 2F2EA 1BM9A 2K4BA 2C6PA 5A27A 3DQVC 2HPMA 3PB4X 3F8BA 3K1MA 3S8PA 3EXNA 3HB9A 4FCYA 1MMGA 3ASNH 1WCMJ 2HOTA 4G7OF 3S2DJ 1UWYA 5FKOA 1XSXA 1T38A 2O28A 5F08A 3G8WA 1Y56A 3CCEI 2ESNA 1Q2YA 3D66A 1RC9A 1MMNA 4NBQA 4CPAA 3OYNA 2CS3A 1F36A 1XS9A 5D5WB 3GLJA 4BL0B 2JMWA 3GW2A 2Z16A 2XEIA 1I3AA 4IOCF 3N97A 1MMSA 2Q4YA 2A4NA 4EMSA 2ID6A 1HBXG 4D5FA 2GA1A 2CG4A 2L54A 4AVZA 2GXGA 3ECHA 1F9NA 1FOXA 1IUYA 1QQIA 4A3FJ 3EUHA 5KCMA 4WK8F 5G21A 1Z91A 2CFXA 4HQMA 3LACA 2DXQA 1EA3A 3DPLC 3S9NA 5JI6A 3KP2A 1ZKGA 2HOAA 2VPRA 3FHNA 1S60A 2E36A 1ORKA 4PK2A 4BYYA 2IVMA 2IPQX 1FJLA 2AFOA 4F9UA 1UHMA 3NH5A 4XONA 3H1CA 2LNBA 4P4EA 5D8KB 3IP4B 2LD5A 4UIAA 1SD6A 1R71A 1J75A 2CUEA 2VT3A 1X3UA 3T5XA 1FP1D 3ABTA 3R61A 5L3FA 4A38A 4OAZA 2X6OA 1HLVA 4P45A 4DYCA 3SHPA 1SD4A 3QYFA 5HMNA 1ACIA 4HNXB 1D0XA 4RBOA 2BUEA 1MKMA 3P9CA 4XNHB 2K9LA 2NS0A 1VGYA 4KA4A 3OYLA 2WZNA 4UFVA 1MBHA 2NYQA 3NWTA 5HLTA 4HOBA 3KASA 3LA7A 2GXBA 4F6AA 1ETXA 3NRVA 2ZEEA 4I6ZA 2O61A 1IDZA 4RGRA 5JH9A 2W1OA 1OFCX 1W5SA 2DEAA 4F0XA 2QSHX 1CPXA 2V8GA 1H88C 2D1HA 2M2EA 4B09A 3OYHA 3IH2A 4PJJA 1J0RA 2WPWA 4EJOA 2IA2A 3QWLA 3NFZA 3L2WA 2AFSA 4O6JA 2GANA 4MHPA 5EGOB 3PFYA 1DTDA 3TO7A 4IJAA 4NUBA 5TISC 2JPCA 2PJ6A 5H20A 3P7NA 4IRHA 3QODA 5J1UA 3HTUA 3RO0A 5HDGA 3N5FA 2ME0A 1YTYA 2ME6A 3L00A 2PIYA 1T98A 3IH3A 2RKHA 5GTIC 1JGSA 2PEXA 1TQPA 3WHBA 1DPRA 2VQLA 2K3PA 3S93A 4M71A 4AWXB 2WV1A 3I4PA 4FE4A 4S0HB 1GXQA 2H6CA 4IF5A 1RIOH 5JGFA 1TNSA 4PJ0C 1LVAA 4YFJA 1AU7A 4XPKA 2LK2A 1YJNI 1VQ9I 2E2JJ 3PIOF 3H8EA 4O5VA 3JSPA 2FQ3A 1W0UA 4RGSA 1Z8TA 2FD5A 2WAFA 4HQEA 2KRFA 3MKYB 2GREA 1U2WA 2Z3LA 3J81K 4ZTFA 3SYTA 1Q2DA 3DLJA 4MHNA 1Y8RB 3C1DA 3FJUA 3U1DA 4PFOA 4LGWA 5K7ZA 1AHDP 2E19A 2VKHA 2VQHA 2UV1A 3CESA 3RKYA 1SC7A 2X9DA 1SAXA 5IY5H 4O3MA 3C18A 3MZ8A 5E96A 5KAFC 1ZRCA 4HA8A 1IG7A 4C2UA 4DUKA 2CWEA 2WB1N 2W48A 3O8GA 2VBXA 5FD6A 4A3IJ 2W24A 2XASA 3WTTC 2ODFA 2QSGX 1R43A 1MSEC 3F6VA 4QIWN 4AD9A 5EEAA 4GM5A 4HSRA 3FIWA 3H0GJ 5ICEA 4F92B 1ZRDA 4Y49B 2DA5A 4YRHA 2Z1DA 5HVQC 4UVAA 4E4HA 2GXAA 2HKXA 3CCJI 1HKQA 5M5WJ 3R60A 1DPUA 2R7UA 3P9KA 2EPFA 3RBUA 5DCMB 4L9NA 1IN7A 3CO6C 4MFPA 1MJAA 2QIRA 1R00A 1XIXA 4R87A 2W7NA 5D5XB 3V4GA 3DEWA 3WE3A 1YS7A 3P5JA 2FIWA 2PRBA 5FKKA 5EJCA 1ZK8A 3QP5A 2AQFA 3LSGA 3GTQJ 3I58A 4J01A 1R5GA 3R0JA 1W7PB 3ZZIA 4HPQA 4M9SA 2I3CA 4EMEA 1LRZA 2IQ6A 2OB0A 3HUGB 2HZTA 2KIFA 1RR8C 5DWMA 3E6DA 1WGXA 1M1EB 3O3KA 1ENHA 1D8KA 3HRUA 2EINH 5J8FA 1OCOH 1JT0A 4FQGA 5IB0A 2ZOGA 4UXNA 4NXYA 1Z8XA 2MH9A 3LSKA 2E2IJ 4BNCA 4UUSA 1AMPA 4U0YA 2CUZA 1FIPA 4QVTA 1KA8A 3CT9A 4AIJA 3GZNB 2O4HA 3OMYA 2XKPA 4NGMA 1X3WB 2COBA 2EV5A 3I59B 3V7SA 4FASD 2GAUA 2IW5A 2F6CA 4U7BA 5C82A 4QPOA 2DW4A 1OR7C 2J8MA 2PMHA 4PDKA 2DA3A 4A69C 2ZENA 5LRJA 4AIDA 4UCMA 5H6QA 4ZDPA 4HNVA 1XX5A 2OPTA 3AG1H 2L9NA 3FBIB 3IWFA 2XAFA 2BE5F 4P4FA 4YRVA 1YQAA 2WA0A 2UWMA 3BI1A 3VWEA 3IWWA 3R96A 3G2BA 3V7ZA 4AB7A 2J5PA 3H9QA 2HXOA 3E7LA 6PAXA 3J7ZI 3VARA 1CX8A 4NQWA 4BXFA 4R76A 4ORFA 1XF8A 3Q0WA 3G71I 2EZIA 3SFZA 2L0KA 3I64A 3NH4A 1NG7A 3LWUA 5DM6F 2V77A 4ZZLA 2Q1ZB 4C3IJ 5EEHA 3OOUA 4ENKA 3H5ZA 2M0MA 1O3QA 2B3UA 3JTHA 3NWSA 4Q36A 1HSTA 1VZ0A 4YIIA 1BC8C 1CQTA 2B63J 2A69F 1XOVA 4IHWA 4A93J 1X1BA 3BY6A 3A0BC 5FKMA 3ISPA 2HVQA 4I09A 2NVUB 4H0EA 1XSDA 5L3BA 2BCOA 3D8PA 3RPUD 3W6JB 1MDMA 4GXHA 5A28A 1Z21A 4F8ZA 1BLLE 3FM3A 5DUIA 3DF8A 3KR5A 3EETA 4UEFA 4G6TB 1Y6IA 4UNOA 1U5TA 1Z4EA 1OKRA 2PR8A 2C6GA 3QPTA 5TJJA 4G94A 4EWTA 2VOPA 4L5IA 3S17J 5D6EA 4XLEA 3R4KA 1IB1E 2FQ4A 2P5VA 1WSUA 3D5SC 3HPHA 3MN8A 2EK9A 4BY7J 1I21A 2B4BA 2FEZA 5JVTA 3OYIA 3P9IA 4FT8A 3B3VA 2LFBA 4JBAA 3FBNB 4IX7A 1HSJA 5HLIA 3AG4H 4CRZB 1ETWA 1KQ9A 1XDUA 4B6ZA 2VIXA 2WSAA 4I49A 3IO1A 3G6EI 5K8PA 3KQZA 1W4MA 3NE7A 4LG3A 1SVOA 3C2HA 2RQQA 4XQFA 4XMYA 1P4NA 1HA8A 4H2KA 4UA3A 4XIDA 2NRAC 4XPLA 4U9ZA 1TQMA 3ECOA 5BPDA 2H8RA 4ENMA 4GS4A 4CCOA 5E3NA 4MI4A 4WXDA 3WTVC 4A2UA 4NC8A 3FK7A 2X48A 2PMZA 1JTXA 5HOOA 1H9TA 2GU2A 2Z3NA 4OAYA 1W5CC 2P8TA 2Z3MA 3GBGA 2D1VA 2VKEA 3FMQA 4A31A 3QYBA 2DO7A 3A02A 3OYJA 3WTZA 2MC3A 4P1WA 1A2ZA 1D0ZA 4YFXF 2FBIA 1HKSA 3REOA 4HNTA 2GLJA 3JUWA 1YMEA 2LF7A 2XEGA 5F49A 2PSWA 3M4OJ 3SJGA 4LLLA 3A0HC 2XSDC 4NC6A 1NHAA 2VXKA 2IBDA 1AOYA 2DK8A 2AO9A 4MO7A 2X1DA 4P5OA 1U8RA 1N78A 2OA4A 3K4KA 4DQ2A 2ZSHB 3CDHA 3VPRA 1ZAOA 3RYRA 1GLNA 4BQNA 1Y0RA 1PUEE 2NSMA 1UHWA 1G3TA 1FWZA 2QZ8A 3HGGA 5IV0A 2VBYA 3RSNA 5BQTA 4G6DA 2LF8A 3OYFA 5E20A 4PCQA 1R36A 4UUSB 2X7BA 3UKGA 2R92J 1K4JA 2G0BA 2ZW6A 2JRTA 1AUGA 1CM0A 2OR4A 5HS9A 2KLOA 4N4NB 4OIRF 1AWCA 4LJZF 2L4AA 1S72I 3W91A 3L1PA 1B6BA 3FHZA 4PSXA 2R7WA 1WJDA 1CF7B 3VWDA 2N8GA 1I6HJ 1RTQA 5HNFA 5K8MA 1ETYA 2DI3A 5LGNA 2CU7A 2K86A 1G3YA 4UWIA 3I53A 1J59A 4KN4X 1QGPA 1X1DA 1ZELA 2ZJRF 2HQYA 3VATA 2DDBA 3L2QA 2QGUA 2V7FA 3G1OA 2P0WA 3MZHA 4B14A 3BR5A 2O3FA 5EBVA 1V5EA 3PO3J 3L9FA 3T8TA 3HOYJ 4Z6YA 3F8KA 1Z9UA 3BPXA 2XAQA 1PP7U 2X1CA 2ATRA 4CCMA 1O4XA 2DOEA 1TXRA 4V2GA 1W1WE 3G1MA 3R1KA 2NNNA 2UUZA 1YX0A 3GUDA 1EH6A 3LODA 2A68F 4A3BJ 3GTOJ 2DOFA 3M7GA 2DFFA 2Z3PA 2Z0ZA 1BW6A 3NEUA 2NMTA 3HM5A 1YRNB 5JQ4A 4RUHA 4GRIA 1WWXA 1RKTA 1P6RA 5DYMA 1IRZA 3F9KA 1BR1A 3HHHA 5B1AH 3LD2A 4MFLA 3U1KA 5KTDA 5FD5A 2ZKZA 4ZY1A 4XNFA 2XHKA 5IX3A 4E7KA 4YIRX 2ABZA 4B48A 2O8KA 5K5QA 5F46A 2EO8A 4LIVA 1IRGA 1OPCA 3KR4A 2R7HA 1K7AA 4I02A 3MFKA 3WU1B 2FS5A 4P4BA 2O7OA 2L4MA 3DLLF 2M5WA 1BI1A 3MZYA 4IPAA 3VYSB 3BR6A 1I39A 2ZELA 1RUNA 3DKWA 2VUMJ 2FOKA 2ZEPA 3QPHA 2P6GA 2ZOFA 2E5NA 3PSFA 1BJAA 1J5YA 3UNGC 3DPUA 4YGOA 2ZNYA 1JQGA 2FT0A 4XLAA 2ARHA 3PP9A 4OAEA 4E6KG 4KLWA 3E6MA 2L5QA 3O2PE 2ISZA 4DYOA 2HFHA 3SZGA 3CZ6A 4H4KC 2WPXA 3IGRA 2AHQA 2L9VA 2XF7A 3I54A 4KVOE 3IWGA 3ZJ0A 1LJ9A 2K40A 3BR1A 3FISA 3RTRA 1ARLA 6CPAA 3HSRA 3S2HJ 2R5ZA 1IF1A 1SVLA 2VJ5A 2E34A 1FBSA 2FX0A 3WHCA 3GWZA 2JZYA 3JVNA 4A3JJ 3KI9A 4LLGF 3QPLA 3W2VA 1Z3YA 2JA8J 3S3OA 3Q9SA 4EJTA 4HDUA 2GA2A 4OC4A 5KK1A 4OIOF 4KOSA 1UFMA 4II9A 3OWTA 3G4SI 4A32A 2GIVA 5KHDA 1IRXA 5H86A 1P92A 4ZY2A 1F4KA 3K4LA 1TQIA 2DA1A 4JX4A 4EM0B 1GV5A 1OYYA 3I55I 2DPUA 4OP4A 2JPBA 4K2EA 2A07F 2LRDA 1XMXA 2VZYA 3BLYA 5FLMJ 4NEXA 2PJ2A 3ZQGA 1AKHA 2MFZA 5K5OA 3KCCA 1OQYA 4GCVA 3HLPA 1JUSA 4X8IA 3CCMI 4BKXA 2CV2A 3IU2A 2KQRA 2JVHA 4H6UA 1NG6A 4XRMA 2ZMEC 3RQIA 3Q5FA 3QQAA 3G3SA 1SFKA 2E1MC 1XCBA 2M7AA 2R5YB 3HKZA 4P9UA 4U7DA 2PJ8A 4LQGA 5K5RA 1UCRA 5TRDA 4DJLA 2GOXB 2X6WA 1TT5B 3B3WA 1HF0A 2YGWA 5HXDA 4BE2A 4RLQA 4CAWA 4IKFA 1O3RA 2QWWA 4OIPF 2DMPA 4ZC3A 2JDDA 4UHTA 1VHOA 4C3JJ 3R9EA 3WTSC 2PIZA 2ZEFA 3CQZJ 5L3GA 1OJLA 1T0FA 4MMOA 4XLFA 4MLOA 5LHGA 2FIAA 1VQ7I 4DYRA 2Z11A 3MKLA 4RA2A 2GIZA 1QSTA 3VODA 1Q1VA 1WJ5A 2XF5A 1E3OC 2M34A 3ZMUA 1JWQA 1VQNI 1GVDA 1X3ZB 2WBMA 4UIBA 4XN0A 5K7FA 5E1ZB 4JXRA 1TL8A 3KLNA 1R49A 1VHSA 4RAYA 1N77A 4B5PB 3JRFA 4A0YA 4J19A 1NH3A 2HNHA 2OZ6A 1T6SA 3WC5A 4KFCA 1HCRA 2H1KA 4XLNF 4CZZA 2UXNA 4EJWA 1G2HA 1ZHFA 2CUJA 3KZYA 1LVKA 5GAEJ 2XGXA 1FT9A 1W7PD 5HLHA 3G73A 4M3GA 4LOCA 2RQPA 1IDYA 3S1QJ 1Z2LA 1AA7A 2IEKA 3JTGA 3RQ4A 1QO0D 4A5MA 4PXEA 1LEAA 3OS1A 1LFUP 1UFHA 1Y0UA 3TBIA 3GTLJ 3F0AA 4AXVA 4M72A 3D4UA 2ETHA 1WKMA 2AXTC 5FFZA 4ANJA 3CCUI 2PLYA 3GFLA 5AG5A 4IO9F 4E2AA 2I8DA 3FMRA 4CGOA 4DIQA 5A2QK 3AL0B 1IN8A 1LNWA 1MBEA 1UB9A 1Z05A 3K2ZA 3Q3SA 4AYBA 2GFQA 2P7VB 4R3KA 4L9VA 4E7LA 2VOOA 2BY2A 2EILH 4DNCA 3AKZA 2HDDA 4ZI6A 2VN2A 3WG9A 2JUGA 4F91B 1NK2P 3LOCA 1ZRFA 1VQ6I 2XF6A 3L09A 3IRQA 2XB0X 2ZXJA 3IUOA 3SHFA 3JAMK 3OY9A 2EK8A 4AC0A 2Z3YA 4NHJA 4IHYA 3H3ZA 4O23A 4UB8C 1N71A 2JVGA 1Y0YA 1R1VA 4IXAA 4LUAA 3U2RA 3LSPA 2AXLA 1RKWA 5E3MA 2E60A 1WZ2A 1T33A 3C2BA 4CCNA 2PC1A 5L3DA 5EGOA 3SI1A 4XICA 4CYOA 5LYFA 4HZFA 3R9GA 4CH7A 1V3FA 3CCVI 4MHZA 3R95A 3FYNA 2PQ8A 2ZEOA 3CUQB 4CA0A 2CO5A 5ILVA 2GBYA 2VI6A 1S7AA 2XB5A 2XGCA 2VXZA 2C1CA 3OR1C 2OC6A 3DEUA 2DYRH 2ZJQF 1T8IA 2GLOA 1E0EA 2WAQA 3N05A 3UY5A 1T0FC 2X1EA 3BG3A 2W25A 5BPIA 3F8NA 2CFOA 1YX5A 1BOBA 2J5OA 4CXFA 2ACJA 2ID3A 3J7AY 1WHUA 5IP9J 1LAPA 2HOEA 3EFAA 2Y31A 2ZO4A 5CJ9A 2X6YA 4IRGA 1Z7UA 2R7SA 4P44A 5K1YA 1S7LA 3CCQI 2NVQJ 2IGNA 1WJEA 4Y4RA 2IAIA 3IIBA 3EYIA 4A33A 1CJWA 4MNUA 2MLKA 1ZLKA 2O53A 2Z3KA 2ZEHA 2PJRB 2B4DB 1B9NA 3TFYA 5AG6A 3HRMA 3RKQA 1HEEA 3IWZA 4PXDA 4U88A 4KN7X 3S6FA 5E3OA 1YIJI 3RYOA 2RDPA 4IOAF 5LRRA 3VDXA 5IPAA 2B5GB 1R4NB 5IOYA 2ZFUA 3CC7I 1FEXA 1BN5A 4W1UA 2AJ6A 1WJCA 2O9LA 3J7YJ 4DW6A 1HDPA 1Y0NA 1TP4A 2V8DA 3KHXA 1YS6A 2EFWA 4CSWA 1FIAA 1R58A 2VT2A 3OIQA 5J4YA 1ZLHA 4JP0A 1IYLA 1RPWA 1MBKA 1I50J 2JSPA 5AONA 2AFMA 1A35A 2MD0A 3R0AA 2G7HA 4I0BA 5DCMA 3W6VA 5AGEA 1S9HA 4ZTJA 3M1EA 4N9HA 2LSOA 4L18B 3GIUA 3SJEA 2OV7A 1DU0A 4PPZA 4MY0A 1JKRC 3BTCA 2WTEA 2W00A 4V19K 5KTCA 1J9IA 2F5EA 3LA2A 4RMNA 2TDXA 3EYYA 3HOXJ 2JDCA 3F22A 1PVEA 2QMLA 2QENA 4A95A 2F5FA 4UUTA 3OYDA 1QSNA 3KP4A 5F0HA 2PJPA 4BQOA 2AFXA 4U87A 2IJZA 1W7PA 2KJBA 4BS9A 3EY5A 3MWMA 3KQXA 3ZQLA 1X4OA 2NS8A 1IIDA 3HSFA 2B58A 2L7KA 1JTYA 3DBHB 3HUGA 3VYUB 2YNDA 2W82A 4R8HA 2F4IA 4NDLA 1E17A 3FEDA 4HF0A 2L9SA 3GYHX 4E7IA 4Q38A 4XKBA 5ICCA 4KUBA 1WH5A 4KVME 3E6CC 4QB9A 4YIFA 2IGOA 1R1TA 1Y1WJ 1P4WA 4LK1F 1BC7C 1HOMA 4AM3A 2F4MB 3LSRA 4N9IA 1HW2A 2VL1A 3GFJA 4NNJA 3CMYA 3QAYA 3SJFA 3I59A 3JR9A 3S3MA 1KUXA 4C30A 3I71A 4MQVA 4RAFA 4DGWB 1MW7A 4HAMA 4RB2C 4JWPA 4C68A 1IO2A 1KUVA 3CXSA 4QC6A 4IHSA 4MTEA 4EQQA 4RGUA 3A1YA 3LSMA 4P55A 1WK4A 1S7OA 3BTJA 1XDSA 4M74A 4E7SA 4YG2F 3E0JB 4JZ0A 1WI3A 1RO5A 5TGTA 2OZGA 3S6HA 1ARMA 2CY2A 4LB5A 4KSAA 4PJNA 5EMIA 3RIRA 4ONWA 2CTCA 3WGHA 3ML6A 2EFOA 1I5ZA 5LRSA 1ZG5A 3IFEA 3KIOA 1B8IB 4ONUA 1SEUA 2ZEMA 5CBMA 3M8FA 4KUMA 2PJ9A 2ESHA 1EJ9A 3D7GA 1NMTA 2OAZA 3FM5A 4DBQA 1PDNC 1Z4RA 3OIOA 2K5TA 1Z0XA 2M45A 1LDDA 5DDGA 1WJBA 2NOJB 1RR7A 4XM3A 3LFKA 5FJ8J 2JQ7A 3COAC 1O57A 1QHGA 5IT9K 4Y49C 4MFJA 1ZG7A 1MGTA 2ZW4A 5EEGA 1JKPC 1DGRM 2Q2EB 3C7JA 2Q8KA 2V4JC 2AE6A 2DQRA 4DZJA 3M3YJ 4FX0A 4UVCA 5IB9A 2K5CA 4BHPA 4PXCA 2A5YB 2TRTA 1UMQA 4Y13A 3H5RA 1H9GA 2VKDA 4CCKA 2E1CA 1TT0A 1X2NA 4XN3A 2HR3A 1FYMA 1OBRA 2KIMA 4EGYA 3EDPA 3HG9A 2J8RA 5FKNA 2EA4A 4ZDLA 1RESA 3WG7H 5IP6A 2AFZA 1VHEA 1QHHD 2EZKA 2DFEA 4IHVA 3S9LA 5JM6A 1R5ID 5FLVA 2FXAA 1SQHA 3EUHC 3EUAA 2H8WA 2F5VA 1YVKA 2VI7A 2RC4A 2RV8A 1IV6A 2PJAA 3I56I 2ZB9A 1YHQI 2DT5A 1BOAA 1BI0A 1X10A 3NARA 4CS0B 2WC2A 3FKJA 4Y33A 2K02A 2HDWA 5GAHJ 4QLCU 2L01A 1T2KA 2LVSA 2OU2A 4RB1A 2PRQA 4NGNA 4OKOA 4OC0A 3HTSB 2K85A 2REFA 2EFQA 3B7IA 3FXQA 2O0YA 4IZZA 2FXFA 4LX9A 2STWA 2PDOA 3PNTA 1HDDC 2CTBA 4B12A 3HPGA 4I7HA 3RCOA 4KNYA 3VB2A 5JLWA 2RNJA 4KS9A 2KIQA 4U5YA 4IQ4A 3JRAA 3QPSA 2AS5F 2EQRA 4CYPA 5LGTA 2DMTA 1A31A 5HVGA 1VQLI 2ZSIB 4UF4A 3B3SA 2OQGA 4PK4A 2UXXA 1HC8A 3J80K 3KZWA 1YREA 1ZYRF 1S7FA 3CJNA 1X12A 4Q47A 3PB9X 1G3SA 3B6AA 1J7KA 2EB7A 2MLGA 1VQ8I 1VIXA 3OYKA 1ELMP 1CP6A 3F8MA 2FBKA 3ZMDA 3H9JA 2ADUA 3W3CA 1D1CA 2E1OA 4HG2A 1Z7LA 4XR6A 2NVXJ 3FK6A 4KISA 4J3GA 5B66C 2M3AA 5J6XA 8CPAA 4P96A 2K9QA 1R6RA 3VFZA 1U3EM 3WTXC 5HVFA 5M3MJ 1YX3A 1ITYA 2M9HA 4HX4A 1S3ZA 2CXAA 3D7FA 3SEZA 3H8GA 3ZN0A 4G7HF 1FSEA 2B7EA 2W4SA 3I3LA 3K2KA 3MGDA 4XLCA 2ZW7A 4C2ZA 5KTAA 5HVHA 3BR0A 5AIQA 1LDJA 5ILUA 2DU9A 4MCSA 4F9VA 4L89A 3BQZA 2G0EA 4L9TA 5D4SA 2O5RA 2Y0SA 1X1CA 4BH9A 3LL7A 3CMMA 2CQKA 5HDKA 5CLSA 1B72B 4V2FA 1GDTA 2V8HA 3N7ZA 2ZXVA 3R6SA 1V55H 1D3YA 3DXJF 4ZYEA 5F1RA 4P4JA 3UR3C 1W5TA 2HWVA 2PN6A 3FXJA 3GX4X 2WUUA 5CYVA 1CF7A 3FRMA 3M1CA 4L9JA 1PUAA 1GT0C 4BUPA 3RDIA 2VQCA 2XEJA 2LYCA 4MIMA 4L0ZB 5CPRB 3ZMTA 5GTHC 3GMEA 2XKOA 4WX9A 3MKZA 2JRMA 2O8XA 5LD2C 1CG2A 5EZHA 3ERED 2PI0A 1VKCA 1S29A 2XPUA 5CVIA 3S2WA 3TOAA 3BWGA 3HXLA 3LQQA 4HLXA 4Y17A 1FYKA 2K9MA 1AYEA 4NCZA 4CAXA 1HXDA 2EV6A 5LEJA 1LUJB 2A5WA 3RZOJ 1FNOA 5FLXZ 3PL8A 3PGPA 2KISA 3V7RA 1UJ8A 3BQYA 4A30A 3KP7A 3DBRB 4UWJA 2FE3A 4WXCA 1XFOA 5F0FA 5HODA 2VQGA 1XEBA 5K8OA 1X4PA 4X0GA 3FX3A 4ESJA 3OYAA 4A3LJ 2Y0MA 3LSTA 2IGKA 4HEA2 1OISA 3WC7A 2R4GA 5M5YJ 3BJ7A 3D67A 5CQGA 4ZGYB 2CF4A 2ICWG 1L3LA 3BJ8A 2EH3A 3CCSI 4L0YB 3H0DA 2PMUA 2R7XA 3E6BA 2BSWA 4A5NA 5E8GA 2NNYA 1YRNA 1YFHA 3PB7X 5CPAA 3GCMA 4IHXA 2Q7SA 1QSOA 1KQ0A 2BY3A 4OC2A 2BOLA 2IS6A 5C3EJ 5H2FC 2E5ZA 3FNCA 3OIPA 1F57A 2V9PA 5J47A 4B8XA 4X2TA 1V5GA 2XEFA 4BBHA 2R93J 3CDLA 1YIOA 3ZMVA 1IZ1A 1ZTRA 2EVNA 1VTNC 1Q7LA 1PJRA 2VBZA 2F5DA 5IT3A 2KMUA 5J40A 1NSAA 5I4MA 4IRIA 1OCCH 1K61A 2D2WA 1TWFJ 2HVRA 3BR3A 4CUGA 2DA4A 2VQYA 2W84A 3K4NA 2KZGA 1WWZA 1Z8WA 2H09A 4YEJA 3DSBA 2YUSA 1QPMA 4GYGA 3BR2A 2XPWA 1WPKA 3MVPA 3FB3A 1ZARA 1B87A 1ETQA 2M8GX 2Q51A 2BBYA 3WTUC 1M44A 3KP6A 3BDDA 2XRNA 4II2A 2KKOA 3WGGA 3D5LA 2CV0A 3A4CA 4TWEA 3GTGJ 4ZJZA 1XJOA 2LKPA 1VQKI 1D5VA 3DU6A 3PNVA 4FTHA 2D5VA 2JWTA 4A3CJ 4MHGA 1GUUA 3CZXA 5LHHA 4AVCA 3ABUA 4KIGA 1LFBA 2BVLA 2A6EF 1YOVB 5ICFA 1E3PA 2K3FA 2L2OA 1MBGA 1D1AA 2X85A 4HNYB 3K0LA 2IT0A 4F93B 3QAHA 1LFPA 3IHUA 2GM4A 3S16J 3B8GA 3OWCA 5AG7A 2FOWA 3S6GA 5DD4A 3AFHA 1YW4A 4ZBGA 3F23A 5FRMA 2P81A 2HC9A 4CYNA 4BE1A 1T56A 2VBQA 5EYRA 2V79A 4MCPA 4IHMA 1TIQA 2LLKA 3A03A 1P7IA 3LSJA 1U6MA 4AIKA 1ZGWA 3S1RJ 1G3WA 5DEQA 4AIHA 2AQEA 2XRLA 1JE8A 1PYTB 1I6XA 2DLLA 3PBEA 3TO6A 4HRIA 3HBLA 1B4AA 2PJ4A 2Q43A 3W2AA 4HV6A 3ELKA 4AUXA 1IGBA 2PX9A 3TDZC 4ZX9A 4XKCA 3FH4A 2XVCA 1YGHA 1USSA 4W97A 3FBUA 3RAMA 3PNYA 5D5UB 2R5YA 2HS5A 1QMUA 3KHZA 1QZYA 2CQNA 2EJRA 4M6XA 3A01B 4LQ6A 2K27A 3PUFA 4GGGA 3SXNA 1U5TC 2JA5J 2G3AA 4BHBA 2QBYB 2KRHA 2HU9A 3GVAA 1TKJA 1N75A 3CXQA 3E5XA 4HKFA 2REEA 1STZA 2BXZA 3GTJJ 4I99C 1TWHJ 2W85A 4QWQA 4J00A 4PK3A 4BQAA 3CXPA 4OIQF 1JT6A 1XBUA 2G3TA 1SAUA 3HOWJ 1Z3XA 4M3SA 2FMLA 2EFNA 1CBXA 1NK3P 2W57A 3JRBA 2XSJC 2MD5A 4UCNA 3HOUJ 3ZQFA 2ZXIA 3KE2A 1ZO0A 2YS9A 2VBWA 4KSIA 5C4JJ 1VQOI 3PQKA 4MJ8A 4B5PA 2ELJA 4NGSA 1C0WA 1P7JA 1HDQA 4ZZDA 3Q0UA 5E3LA 4PGGA 5LFAA 1YO5C 4R7MA 5JHUA 2HPIA 3DWLE 4XLPF 3JRDA 3RPUA 1ON2A 2OJED 2IA1A 4GYIA 2JBJA 4RN7A 2EWNA 2EZLA 2RNGA 2O03A 4CAFA 4CGPA 2R7RA 2ZJPF 4B3AA 2QM3A 4JXQA 4CGMA 3BCAA 2KZVA 1PUFB 4RS8A 3I5UA 4AVBA 1S8NA 1LPQA 1YE9A 1XGOA 3RKXA 4M6GA 1IOIA 1HDUA 3F5BA 3L2CA 1UELB 2OTLI 3V8LA 1BAVA 4KITB 2HVSA 1YW7A 4I2OA 1IN6A 2LP0A 2CW7A 4RAGA 1OCRH 1BI2A 5ELYA 1KU9A 1QNTA 1FTZA 3AG3H 4XOTA 1CGPA 2STTA 3AAFA 2R8VA 3GFMA 1KU7A 2DMUA 2JEVA 2V9VA 1IXCA 4B4CA 1FOYA 2YR2A 4FD7A 4C2XA 1T39A 1YVOA 3RZAA 3P2HA 2JT1A 4R57A 4JLYA 3KYDB 1NSLA 4ITVA 2NOGA 2EIJH 1TLHB 2DN0A 4M3DA 4E70A 2QYOA 2EZHA 3PUBA 1RETA 2M4KA 5DD8A 3ZCOA 3K70D 2D4OA 2KCWA 3HIFA 5F09A 2ZXHA 3KGQA 2LBFB 1A04A 4KOVA 1XGSA 1ZG8A 4IUSA 2R7DA 1H89C 5HH1A 3CUQA 2BOAA 2QCOA 4MFDA 2DFIA 3TGNA 1KUYA 4FE7A 1BJZA 1FZPB 2P7CB 3NQOA 2IJLA 2VONA 2YSRA 2BGCA 1IN5A 1SMTA 1MBFA 2HQRA 7CPAA 2V1DA 4G7ZF 3HOSA 1ON0A 2X4HA 2K9NA 1IRFA 4M9XA 4CGZA 1BPNA 4WCGA 3FZVA 1DP3A 1FY7A 4D7MA 3FIXA 3S14J 4M3BA 4Y15A 3K4MA 2QQ9A 2HZDA 3ZMSA 4EVIA 1BL0A 1MNDA 3H36A 1Z6TA 2FBHA 3WE2A 2V6CA 5D5VB 1SFXA 2G7UA 2V8VA 2QSFX 1IC8A 2R0QC 4EGZA 1OYIA 3VSKA 5DS0A 1IXRC 1XSVA 1TW2A 3BROA 3RPQA 2PJRA 2L7ZA 4C2MJ 2B4DA 4PZJA 2MH2A 2PJ0A 4U9YA 4F7ZA 4DZPA 3FF5A 4AVPA 4DJAA 3BT9A 5G20A 3BZCA 4P9FA 2B5GA 3K69A 5IOZA 5DV5A 1FPQA 1ON1A 3GYAA 4F0YA 1NTCA 2MABA 3FXMA 4KMUX 5BMZA 2OD5A 3K6GA 1SVMA 2HQ5A 3CCYA 3JCUC 3K1PA 3K9TA 4I01A 4DYQA 4BBSJ 3BP8A 3V8KA 4MTDA 2VC1A 2WB1A 2FSRA 2CH0A 4CAEA 4M9ZA 4OINF 5LRGA 4XRSG 1KYWA 4HDVA 2R7VA 5K8NA 1D1BA 5CNPA 2Z10A 1QZEA 1S6LA 4Y3OA 5BNGA 2WY7Q 5HDNA 2Y75A 3ZP5A 4IAVA 3FXRA 4R79A 3OR2C 1SD5A 2TCTA 5M3FJ 3PFEA 2F8HA 2QVOA 2V1NA 3M9AA 5B1BH 4FD5A 5H84A 2VEZA 1F43A 2YU9J 2RGVA 2H6BA 4NB5A 2P6EA 4BEHB 2KHMA 4UVBA 4B11A 4PJMA 5HNHA 3CJQB 1FT7A 1R7JA 1O7FA 3D2PA 1SFUA 3SJXA 3PM1A 2Q0OA 4LD5A 1IOFA 5LHIA 4A39A 2M1BA 4A0XA 3DKYA 4PGHA 3D3SA 2LKXA 3E3VA 2DTRA 3RNZA 3ZQCA 3PB6X 2OZHA 1VQPI 3M8JA 4LFUA 4B10A 3VOEA 1JKQC 4KJZA 3T8RA 2QYVA 2RREA 2DQLA 5JHFA 1MJ9A 5F04A 3I4NJ 2DF5A 4TV7A 3CP2A 1Y7EA 4Z2YA 2ZEGA 1FC3A 1POGA 1R23A 4RLFA 1XD7A 2I10A 4HNUA 2JA6J 3KEYA 2Q4ZA 2DPTA 5DUKA 4Z65A 2HYFA 1RRJA 4ZH4F 1HW5A 4BBRJ 1J2XA 1IN4A 2VPLA 3CMAI 2FF4A 1U9NA 3EPZA 2LH9A 2XGEA 2ZMEB 4R8FA 2BVMA 3H92A 3SI0A 1B8IA 4LITA 3VH9A 2E71A 3IAM2 3D5RC 3BG6A 3R9FA 2DOAA 1YLEA 3KP5A 4ETSA 4BAYA 2R7TA 2COMA 2PCUA 3DTEA 3QOPA 5GAGJ 3D1NI 2QQAA 2PJCA 2DXIA 4XLHA 3E0KA 4OIWA 2HTSA 3LNQA 1KU2A 3DTIA 3QU6A 4EJUA 3H9GA 4N0BA 1U0JA 3T90A 2Q2EA 2P5LC 5EDNA 4G9YA 2D4PA 2M4GA 3TP0A 3RZDJ 1DDNA 3S9MA 1USTA 2E7XA 4WF2A 4XK4A 1GVJA 2Y2ZA 5EZGA 2PJ5A 1QQ9A 3ZR8X 1Y1VJ 4BDYA 2JEWA 3HL2A 4A94A 3FXOA 1KQ8A 1K79A 2ZC2A 2PMZN 3U9GA 4F3QA 4XPDC 1DE4C 3WR7A 5BS6A 1BIAA 3V7CA 2V26A 2JLMA 3BZKA 3FVLA 1ETVA 5J1YA 4KYWA 1W0TA 1TWGJ 5E17F 4KOWA 1U6GA 1W36C 2HYGD 3VWBA 2R1IA 2IP2A 5ED4A 2E2HJ 3HOZJ 4CYDA 2BZTA 4BU2A 1R9TJ 2NS7A 3B2YA 3FF3A 3KYCB 3E1SA 3MAJA 1M4IA 3PFIA 5D8LB 4ZYDA 2G9DA 4OC1A 3SXOA 1TZLA 2H94A 2OBPA 3HHGA 1KONA 2DJNA 1WVRA 3DPTA 1F5TA 3IJ3A 4XNHC 1ZGAA 2IS1A 1MK4A 1TF9A 5LYLA 2QA4I 3DFGA 1TTYA 3KZZA 1KZHA 1X58A 2EBJA 2RN7A 4M73A 2IGMA 4Q5SF 2VJJA 2Z2SB 5DTDA 2Y9YA 5FFXA 4XORA 3S32A 1T08B 4X6AJ 1ULYA 2KIUA 4XSZF 4X5KA 1I1SA 5GPAA 3GTPJ 3QOEA 1X1AA 2LDUA 5B3SH 1BA5A 1B9MA 4FETA 3C3WA 1JI8A 1YYVA 2X51A 4LG0B 2XAHA 5BOXA 4NC7A 2XROA 1UG2A 2KDOA 1MZBA 4A6EA 1A5JA 1X2MA 4CYCB 3ZQQA 4KVXA 4FX4A 2RFHA 4PV6A 1R1UA 1XGMA 5ERIA 3T0YA 3DNSA 4PUSA 5LEKA 4BXUA 3ZMZA 4JD6A 4GXOA 5H6RA 4YWYA 2C27A 4MQ9F 2H1LA 3CMEI 2P4WA 3HOTA 1JHFA 1JUPA 2CW8A 3NE8A 1UZCA 2EIKH 1K78B 1F1ZA 3EO4A 2BEIA 4OWRB 1Z1DA 1D5YA 2ECCA 5F6FA 1KYZA 2L7MP 2R3SA 2VXDA 3OL4A 3QU3A 4HSTA 4RM3A 3U21A 3I4MJ 4OC5A 5EG0B 4NGPA 4UB6C 5LLQA 3LSIA 3WU2C 3FXTA 4KOYA 1B72A 4JYWA 1R3NA 3JRHA 3WC6A 1MIJA 1OCTC 4NFRA 2YU3A 3ABLH 1MMAA 2NVTJ 3CJTB 1QPIA 3ESWB 4XL9A 1CPSA 1Z8LA 3RJPA 5AG4A 2VL8A 4IQJA 5K7HA 3ABMH 1XMAA 3L7WA 3V38A 2MSYA 3OS2A 4BJ5C 2FA5A 2M8EA 4CICA 1VF9A 3SI2A 3PQJA 5GP9A 3LSHA 1APLC 2BW3B 2V1XA 3SXYA 2V9KA 2KJCA 3ASOH 3ZRGA 4M6IA 3T8WA 5J1QA 4U0WA 3OYCA 3CPAA 1F2PA 1YJWI 2BO9A 3BG9A 1RUOA 2FSWA 3IKVA 2CQ7A 3HYIA 2L7FP 3NA6A 3BOQA 4R6TA 2Q4VA 2M7BA 1VI0A 4UBRA 3PO2J 1BO4A 1M4LA 5IYDJ 4P4IA 4M3FA 3OL3A 1FBQA 1LE8B 5F64A 1ZG9A 2RVCA 3IKTA 1XMTA 1YK3A 3H3VK 2YX7A 3ULQB 2HUZA 2QKMB 2WWYA 2L9RA 3S3NA 4ON0A 1FBUA 1QU3A 5HLGA 5FVJA 1KWMA 1QVUA 2A6HF 1BI3A 2F7VA 4KZTA 2CQXA 3CCRI 2K9SA 4RS2A 2QKLB 1K4SA 1FOWA 5KAIC 2PJBA 2A61A 2QECA 4RB0A 5F0CA 4PFPA 3PBBA 3BLNA 3D7HA 1XE4A 5IYCJ 2MW8A 2LY1A 2DJIA 2DFHA 3SZTA 4UFXA 4OMEA 3FKIJ 2EV0A 4BDZA 3GTMJ 4CCLA 1K4TA 1G8XA 3LFUA 4KUAA 1TBXA 5CVVA 1JGGA 1BIBA 3ONQA 3X2QH 3CO7C 4RI1A 3MKWB 4BHCA 3IC7A 4GDFA 1LEBA 1G6NA 1B1BA 2MA3A 2ZXWH 3E5UA 3K4CA 2DA6A 3G3ZA 4OIDA 2CJJA 3DKXA 2JSCA 1IU8A 2POKA 4A3EJ 3FMCA 1IW7F 3S15J 1WH7A 5FB2A 4L5EA 2VE9A 3BHXA 4NJRA 4C7HA 4EM2A 1N25A 4CRYB 4CGLA 3E5QA 2DAOA 5IT9Z 4C3HJ 1JJ8C 3I3GA 2VZZA 5F48A 1BPMA 3FECA 4HNWB 3DP7A 3DCFA 2F48A 2M0CA 2R7FA 4G6QA 2MYSA 3ERMA 1OR7A 4CAVA 4P6YA 4A2ZA 1OLTA 2MGQA 3GLXA 4MFEA 2XAUA 2ZJ2A 4EV0A 5D4RA 1IGNA 1GHCA 1P0HA 3W6XA 3IU1A 2HYJA 2XIGA 2E1NA 3BTIA 4H6ZA 3KZIC 2JTVA 3JTKA 2DYSH 1LCPA 5CVRA 2LR8A 3H4QA 5BWAB 1A6QA 2JA2A 2Z99A 3FMSA 3HKZN 4S05A 3IAS2 3MEXA 2QJ8A 3IEHA 3SZPA 3L2NA 3MMYB 3IWEA 4FWUA 3H8FA 2EUIA 3GY9A 4D5CA 1G59A 2HTJA 1M4GA 3GB0A 2VC0A 2K4JA 4TNUA 4B13A 3J81Z 2OH1A 4UFWA 3TDUC 2JBKA 3HC7A 2H5MA 1JKOC 2R7ZJ 3MCZA 4A3MJ 4UEZA 4R3LA 5LYIA 2XGDA 1VQ5I 2DPDA 1UAAA 5THWA 3DEEA 2VB6A 4ZX8A 1SFOJ 3SDGA 3H3UA 4IHTA 5C88A 1FP2A 2A3SA 4LK0F 4ZDOA 1MMDA 1MNEA 1QSMA 1Z67A 4EEFG 4EJVA 4ENNA 3TOBA 5M5XJ 3SQNA 1YW8A 3JRUA 3B3TA 2QLZA 4QTRA 5DM7F 4BY1J 2OQRA 2D45A 3GXOA 1PP8F 4JX6A 2FVGA 4A37A 2DT7B 2AFUA 5C44J 3CUOA 3BG5A 3T1BA 1IAWA 5EF6A 5CVUA 5JVGF 1EKEA 3J80Z 2Q7BA 2BEOA 2EA2A 5JFRA 4G8XA 2CNSA 2E7WA 3A01A 3B6CA 3DR8A 1H8LA 4JQFA 1QRYA 1V4RA 3TKYA 2QBYA 3CC4I 4MHYA 4Y52J 5FLXK 4JJXA 1XGNA 3GF2A 4G12A 2PBIA 3K2AA 2HKOA 3ZQ7A 2QVPA 3L2RA 3C26A 1Y8QB 1FTTA 2HDCA 3HUVA 4M6HA 3W6SA 4FISA 1OCZH 1S5KA 3HRTA 1MJBA 2Q0YA 4PQAA 1QVTA 2LC2A 4N4OB 5LGUA 2HOSA 2EWBA 2OF7A 3F21A 1O3SA 2JA7J 1JUMA 2F5CA 3WTWC 1H0MA 2Q44A 4AYBN 2Y30A 3FXUA 3SFIA 1IYKA 5AIPA 1L0OC 3TC8A 3CDXA 2I00A 1MBJA 3H35A 5B5EC 1MH4A 2NXNB 3B02A 2Z9OA 1OCPA 3FX6A 3V8IA 4K3NA 3HEFA 1TKFA 1EE3P 5HS8A 2XC7A 2ZNZA 2C6CA 4UCPA 5C4XJ 5ILSA 3QNVA 3TE4A 2IS4A 1TNTA 4MFQA 1WFXA 5FO5A 1WRJA 2BL1A 4HF2A 1WQ2A 2J9AA 5DWNA 2OCEA 1PUFA 4CCJA 3DLAA 1Z77A 3KP3A 3PFOA 2XAJA 4WXHA 2B9SA 1T95A 4L5JA 4LMYA 4U0VA 2VODA 1ZLIA 3CP8A 3HRSA 4D0PA 2LY9A 2LTPA 4OLLA 1SFEA 3HZJA 1ZREA 1EH8A 1X19A 4RB3C 2ZW5A 1ETOA 1LKXA 4BINA 4KORA 2WAQN 2EFPA 2VJ4A 2DODA 4B47A 3GZ6A 5FRNA 1ZG1A 2M30A 4I0AA 4KIFA 4KOTA 2DPSA 2IA0A 4FHTA 2OZUA 3Q0VA 1P4XA 1YI2I 2J8NA 5D29A 5E1WA 3TW7A 3GLLA 5E79C 2Y9ZA 4A3GJ 1I12A 1M4DA 2WAEA 1QSRA 1X1PA 3A2KA 3PB8X 4E7ZA 3GZ5A 4BACA 1YLFA 2KRCA 2LOOA 4CDGA 3TQNA 4MEXF 2HV2A 1S3JA 4B5OA 5J1RA 3OYGA 2EIMH 3VYTB 2ISYA 3K7AJ 5FKLA 3WODF 5JPHA 2LBFA 2FE7A 1D0YA 4XPDB 3KLOA 2CSOA 4A12A 3ABKH 4CZCA 5KNLA 5GPCA 1ZQ3P 4NGRA 4RAZA 4FAIA 1ZG3A 3CC2I 3OSGA 1MSFC 2DMNA 1O3TA 1E3HA 5I0CA 1P9QC 4R1HA 3SEQA 3F8FA 4UV9A 2FJ1A 1FX7A 2MC4A 5LYDA 3LA3A 3AG2H 3VEPA 2XAGA 4P10A 1Z9CA 2ANPA 3BJOA 3F3XA 3T9YA 2VASA 2FRHA 1REPC 3D2MA 2CRGA 1YW6A 4E8OA 1KGSA 2ZBKA 3IC1A 1KZFA 3IV5A 2XUBA 4KT6A 3F0CA 1U78A 3VSLA 2YNEA 2F5IA 3CJRB 4X3RA 4M3EA 2XV4S 4GO1A 1IXSB 1JHHA 1LOKA 3OOPA 1VQ4I 1S7KA 2GE3A 2CMPA 4FD6A 3K1NA 1JXSA 4I76A 1SMYF 4JYKA 4A3KJ 2HI3A 3EQLF 2NYXA 1S5LC 4OMYA 4D9JA 4XKVA 3VYRB 4MGRA 3CCLI 5D6FA 3BC8A 3ZQIA 3KYLA 2R7QA 4KSFA 2IRFG 4A6DA 5ICGA 2FU4A 1XN7A 4I98B 4RGXA 1Y9KA 1CP7A 2IL4A 1LB2A 3K4JA 4S04A 1FSHA 1HW1A 2PJ3A 2DT6A 1LDKB 1K6YA 1Z5RA 3S6KA 1BR2A 4RDUA 2CNMA 4KT5C 4PJLA 2CYYA 5E8IA 2ZFWA 4P4DA 3DV8A 4MFZA 4E0AA 3LAPA 1I3QJ 4IK2A 1RNLA 2OCCH 2YX4A 1P2FA 3GEZA 3WGIA 4XKWA 4Q4ZF 3BPVA 3OYBA 5LBQA 1TWCJ 1VFCA 4HW0A 1DUXC 4R9MA 3RYPA 2ELKA 2I5UA 2VE8A 1UHSA 2LY2A 2QF7A 3W2WA 1V54H 3OSFA 3GKRA 2WYRA 4IF4A 2PJ7A 3BXMA 2BV6A 3K4BA 4BEHA 4FBEA 3ISZA 3WABA 4HV5A 4F52A 2FCKA 3M07A 2VJIA 3NAUA 2C6YA 1Y39A 2ECBA 3DGVA 2Q04A 4CO8A 2PFBA 3TL4X 5JR3A 1IUFA 4ASNA 4YFKF 2O6GE 3QB8A 4C7IA 2HQAA 4X1EA 3HJEA 1GHEA 4ABZA 2JUCA 1R5HA 4C2YA 5CQEA 2RB7A 3B3CA 4AG7A 4ENJA 5J3LA 4IVNA 3TO9A 2BYVE 4XRSA 2CNTA 4NQWB 3RI4A 3I9V2 1EV7A 3Q9VA 1RI7A 2P6SA 1Y7RA 4OADA 2PVWA 4PSWA 4WJBA 1GXPA 2DTZA 4LIUA 4E7JA 2EK5A 2X0LA 3IL2A 1BBYA 2IMOA 3L2VA 1E2XA 1I1GA 3MD2A 3B35A 4Q7AA 3IRRA 2JK3A 4B1RA 1YJ9I 3D7DA 4BJ6C 1YG2A 1XMBA 5GADJ 1FMWA 1YSJA 3BG7A 2B0LA 5KVRA 9ANTA 1GYTA 4A3DJ 5G22A 1VQMI 3CPXA 3SDBA 2ZMEA 4BD9A 4KICA 5E18F 4EATA 1W36D 2PVVA 1MDMB 3MRUA 5GCNA 1K6OA 4KIBA 2Z5UA 2M87A 4B44A 2FNPA 4MCRA 1WJFA 4ESFA 1U5TB 4OC3A 4WWCA 3PIPF 3BJ6A 4HX7A 4YELA 1V5FA 3JW4A 4M6VA 1ZH5A 1QBJA 3DU5A 2IXSA 4RM2A 1FNNA 2PG4A 4KDPA 3PRTA 2LMDA 3CLOA 2CUFA 3F72A 3BZ6A 3GO5A 3OS0A 2PE3A 2PR1A 2A05A 2DMQA 2B3VA 3TX8A 3M8EA 1LANA 2F4OB 2L02A 2WV0A 3QP6A 1DP7P 2DDAA 4II3A 2RAEA 4YU9A 1K83J 3KX2A 1MNMC 1YITI 4JOMA 1QA6A 5F1JA 2LKSA 3CDIA 3BCBA 4ZY0A 2DBBA 3B73A 2LREA 1IV8A 4EM1A 5FROA 1ERDA 3KKWA 2FMYA 3MN2A 2KDZA 4XSXF 4BXXJ 2BY1A 3ROUA 1EF4A 2DA7A 3LAJA 2BHYA 1M1DA 1YR0A 1F2OA 2XDVA 4NJQA 2NVYJ 1MH3A 1P4AA 4KMFA 2DA2A 1B59A 3A9LA 4CGNA 3OV8A 4Q48A 2YNCA 4M85A 1FLIA 4CYQA 3LQRA 4AVAA 4NF1A 1JJ6C 2KFDA 2ZEDA 4MHDA 2CGPA 1ZLJA 3CTAA 3KETA 4XBFA 3ZQHA 2HB6A 4HPSA 1Z6RA 4L8AA 3EUKL 3AL0C 4C2TA 3W6KB 2YPRA 3H5AA 4MXUA 1ETKA 2Y0SN 1BW5A 2KL4A 2MG4A 3BTLA 4CHUA 1TW3A 1SANA 1U9OA 2FNAA 3O6BB 1Q2CA 4MY3A 3CD6I 4HX8A 4DBRA 4UEEA 2CIJA 1IY7A 3GTKJ 3HGYA 4LG0A 4Y7NJ 2PJ1A 2HGCA 4A0ZA 4LLNA 1S7NA 5CKTA 2BHZA 4CYCA 4ZYGA 1DGWY 1RZ4A 2OUMA 5JLXA 3N4MA 1ONVA 1OYWA 1R22A 4NGTA 1XCVA 1ZN2A 1LQ1A 2LG4A 3TEDA 3ZPLA 3QYEA 4LB6B 4B3XA 2FL4A 5FGMA 3D0SA 1GV2A 1FMVA 2K7LA 3CUQC 1B6AA 3TMOA 4NSQA 5EC4A 4EFDA 2UZKA 4BQQA 2WADA 3ISXA 3CF2A 2A6TA 5L3CA 1K78A 1FYLA 1XG1A 4JX5A 1FOKA 1LFWA 3TT2A 3WT4A 1QZZA 4QBJA 4YFNF 3FDYA 3CF5F 3BJAA 1HKTA 1PYVA 1VNDA 3TCVA 4OOIA 4ESBA 5HS7A 4QSHA 3FEEA 5F27A 2P5KA 2Y48A 5EG0A 1TC3C 5E1XA 2MBFA 5IYBJ 3BI0A 1KU3A 2FUG2 2NAZA 4MFKA 3FXKA 3K10A 2Z33A 1U8BA 3LWFA 1MD0A 3JRIA 3HOVJ 2G9WA 2HQNA 3DTKA 2CQQA 4IEJA 4QPQA 3GUXA 1D8JA 2CW0F 1YLOA 4K30A 1XTAA 1O7LA 3I0TA 3JSOA 3TP3A 4BMHA 2DCEA 3QRFF 3JRCA 2OOTA 1WJAA 1ZR2A 2BW3A 5DS9A 1UG0A 1DQUA 4UUVA 1R57A 3DBLB 1YQEA 4JK1X 4IL6C 2QEXI 2E1MB 1ZR4A 3HSEA 4DOZA 4KOUA 2GLFA 5J4VA 2DK5A 5LRKA 4B43A 4QUSA 2YNCC 4HBLA 2VLAA 3V8JA 3FXLA 1LE8A 1A36A 2H27A 3ZN1A 2P6FA 4MBUA 2BXYA 4G1PA 1BR4A 3JRGA 3P2FA 4KLVA 2HXIA 4FD4A 3KEQA 4ZYHA 2AFWA 4OMZA 5J8CA 4PXBA 1J09A 2E35A 1ELLP 1XRYA 1XPXA 1OMIA 2EBIA 1J4JA 4FUUA 3O8HA 2QQ8A 3OYMA 3S1NJ 2ZPAA
chains in the Genus database with same CATH topology
2LY1A 2FS5A 4BBHA 2KPMA 2DJIA 4BJTA 2EVNA 1I1DA 1OZPA 3VYSB 4UFXA 4BDZA 4CCLA 1G8XA 1PJRA 3LFUA 4BE0A 2KMUA 2Z3OA 3DDDA 4H89A 3H5NA 4KUAA 3ONQA 2P6GA 2E5NA 4RI1A 3PSFA 4EVYA 3MKWB 2X6XA 3UNGC 3DPUA 2HVRA 4YGOA 4CUGA 2FT0A 2VQYA 1WWZA 3K4NA 4XLAA 3ZXSA 2ARHA 3DSBA 2KP6A 3K4CA 4YEJA 4AU7A 4E6KG 3PP9A 4OAEA 4KLWA 3DKXA 2L5QA 3FB3A 2V6EA 3SZGA 3CZ6A 4H4KC 1B87A 2WPXA 3IGRA 5ISVA 2XF7A 3K9UA 4KVOE 3TTHA 2R7OA 1IICA 4C7HA 3IWGA 3ZJ0A 1M44A 4CRYB 3RTRA 4CGLA 4II2A 4BGDA 2VJ5A 3D5LA 4C9YA 1L0CA 2CV0A 3A4CA 1RXTA 2VZZA 3I3GA 4ZJZA 5F48A 3JVNA 4HNWB 3DU6A 3PNVA 3I9SA 2MYSA 3PJRA 3W2VA 2CV1A 3PZJA 1Z3YA 4CAVA 2WY8Q 4A2ZA 1OLTA 3S3OA 4ZYAA 4AVCA 2XAUA 4XOPA 3W6XA 1P0HA 2BVLA 3IU1A 4KOSA 2L2OA 2X85A 3PSIA 4H6ZA 1D1AA 4F55A 4HNYB 4II9A 3OWTA 4F93B 2GIVA 1LFPA 3LMMA 5KHDA 1IRXA 3OYEA 3B8GA 3JTKA 3OWCA 3QAHA 5AG7A 5G1ZA 3AFHA 3C2GA 3ZGKA 4ZBGA 5FRMA 3K4LA 3H4QA 5BWAB 2JA2A 3DR6A 4BE1A 4E7HA 3IAS2 4CYNA 2VBQA 5F47A 1NE9A 2LRDA 2VZYA 3MMYB 3BLYA 3IWEA 1V0CA 4NEXA 2EUIA 3GY9A 4D1QA 1G59A 2GOMA 1M4GA 2IS2A 1TIQA 1U6MA 3V42A 3L2UA 2MFZA 4AG9A 4B13A 2OH1A 1Y9WA 4UFWA 2AQEA 3K70C 3HC7A 2H5MA 2I79A 3EC4A 4R3LA 1PU9A 2R98A 2CV2A 1UAAA 3DEEA 2VB6A 2KQRA 4HRIA 2JVHA 3IU2A 4H6UA 3W2AA 1NG6A 3DQVC 5A27A 2HPMA 5C88A 3G3SA 1SFKA 2E1MC 2M7AA 3S8PA 4KOXA 3HKZA 1MMDA 1MNEA 4XKCA 4ZDOA 1QSMA 3EXNA 1MMGA 3TOBA 1YGHA 3FBUA 2GOXB 2X6WA 2O28A 3G8WA 3PNYA 1Y56A 1Q2YA 2YGWA 1MMNA 3OYNA 2CS3A 4BE2A 4RLQA 4CAWA 4BL0B 4IKFA 2DT7B 2Z16A 4ZC3A 2JDDA 3S6GA 2Q4YA 3R9EA 3SXNA 2A4NA 2G3AA 2Q7BA 2KRHA 2HU9A 1N75A 4AVZA 2CNSA 3CXQA 3DR8A 4XLFA 4MLOA 4JQFA 2FIAA 4HKFA 2REEA 2Z11A 5KCMA 4JJXA 5G21A 1QSTA 1WJ5A 2DXQA 1EA3A 2XF5A 3DPLC 4J00A 4PK3A 2WBMA 2G3TA 3CXPA 4XN0A 1SAUA 3L2RA 3FHNA 1Z3XA 1S60A 3C26A 4JXRA 4M3SA 2Q0YA 4PK2A 1S5KA 1MJBA 1VHSA 2XSJC 1N77A 4B5PB 4XONA 2LC2A 4UCNA 2HNHA 3IP4B 4N4OB 2ZXIA 1ZO0A 2Q44A 4OAZA 4MJ8A 2ELJA 4B5PA 1IYKA 2CUJA 1LVKA 2I00A 3SHPA 3QYFA 3H35A 3W6SA 5HMNA 5LFAA 2HPIA 1AA7A 1D0XA 3DWLE 4HNXB 3V8IA 3RQ4A 2BUEA 4XNHB 4CAFA 2RNGA 4CGPA 2K9LA 3OS1A 2R7RA 2XC7A 3OYLA 3TBIA 1UFHA 3F0AA 5H86A 4JXQA 4UCPA 4CGMA 3BCAA 4UFVA 2KZVA 3NWTA 4ANJA 4AVBA 5HLTA 3TE4A 2IS4A 5AG5A 4E2AA 4MFQA 1YE9A 2I8DA 1WFXA 4CGOA 4F6AA 4DIQA 3AL0B 2BL1A 5DWNA 3F5BA 3TO6A 1UELB 4AYBA 4CCJA 3DLAA 2W1OA 4F0XA 4R3KA 4E7LA 3AKZA 1T95A 4KITB 4DNCA 2HVSA 3OYHA 4F91B 2JUGA 3CP8A 4PJJA 4OLLA 2WPWA 2CW7A 2XF6A 3L2WA 2ZW5A 1X19A 1LKXA 3IUOA 4XOTA 3OY9A 2GANA 4KORA 2R8VA 2VJ4A 4B47A 5FRNA 2JEVA 3PFYA 1N71A 2JVGA 4KOTA 3TO7A 4NUBA 4LUAA 2DPSA 4FD7A 4C2XA 1YVOA 2E60A 2OZUA 4CCNA 2PC1A 2J8NA 4R57A 3QODA 4CYOA 4JLYA 3R9GA 1NSLA 4CH7A 4ITVA 5IB0A 1M4DA 3R95A 1I12A 2WAEA 3FYNA 2PQ8A 1QSRA 4CA0A 3A2KA 3PUBA 3K70D 2M4KA 3ZCOA 4E7ZA 2D4OA 2KCWA 2VQLA 2K3PA 4BACA 2KRCA 2LOOA 2ZXHA 2HV2A 4B5OA 2VXZA 3S93A 3OR1C 2OC6A 2LBFB 4KOVA 3OYGA 4IUSA 1E0EA 3VYTB 5HH1A 2WAQA 3N05A 4IF5A 3UY5A 1KUYA 1T0FC 2X1EA 5JPHA 4YFJA 2CFOA 4XPKA 2LBFA 1YX5A 1D0YA 2FE7A 4XPDB 1BOBA 4CZCA 2WAFA 5KNLA 3J7AY 3MKYB 3HOSA 1ON0A 2Z3LA 3EFAA 4ZTFA 1Q2DA 3SYTA 5I0CA 2X6YA 1P9QC 3SEQA 2R7SA 1DP3A 1S7LA 2MC4A 1FY7A 4PFOA 3FIXA 2IGNA 1WJEA 2VKHA 4Y4RA 4B11A 2VQHA 2UV1A 3CESA 4A33A 1CJWA 3K4MA 2Z3KA 2HZDA 3T9YA 2VASA 1MNDA 2PJRB 2B4DB 3D2MA 5E96A 3TFYA 5AG6A 4E8OA 4C2UA 1KZFA 4KT6A 3S6FA 3VSKA 3RYOA 3VSLA 2YNEA 2PJRA 2B4DA 4U9YA 3VDXA 2B5GB 3CJRB 2F5IA 2ZFUA 4DJAA 4HSRA 5G20A 1S7KA 4F92B 2AJ6A 4Y49B 2GE3A 4YRHA 1WJCA 2CMPA 2Z1DA 4FD6A 5HVQC 2B5GA 4E4HA 4CSWA 2R7UA 4D9JA 4XKVA 3OIQA 3GYAA 3VYRB 4F0YA 2MABA 3K6GA 4MFPA 1IYLA 1MJAA 3BC8A 3KYLA 2QIRA 2R7QA 4KSFA 1XIXA 4R87A 2W7NA 2WB1A 2FSRA 2CH0A 2JSPA 4CAEA 2MD0A 5AGEA 1S9HA 4ZTJA 2R7VA 1Y9KA 2IL4A 1D1BA 2FIWA 2OV7A 3K4JA 2PRBA 5CNPA 2DT6A 2Z10A 2AQFA 3LSGA 4Y3OA 2WY7Q 1LDKB 1K6YA 4MY0A 3S6KA 4J01A 1BR2A 2W00A 5KTCA 4R79A 2CNMA 3OR2C 4RMNA 4PJLA 3ZZIA 4HPQA 2JDCA 4MFZA 4E0AA 1LRZA 2OB0A 2QMLA 2V1NA 2ZW6A 4FD5A 5H84A 3HUGB 4XKWA 3OYBA 3OYDA 1QSNA 2VEZA 5DWMA 4BQOA 3EY5A 4U87A 4BS9A 4R9MA 5J8FA 2P6EA 1X4OA 1IIDA 2LY2A 4BEHB 2KHMA 2B58A 2L7KA 3VYUB 3W2WA 4PJMA 3GKRA 4NXYA 3LSKA 5HNHA 3CJQB 2YNDA 2W82A 2F4IA 2CUZA 3D2PA 4QVTA 3K4BA 2L9SA 4BEHA 4E7IA 4XKBA 4KUBA 4Q38A 3OMYA 4KVME 4QB9A 4F52A 2FCKA 2IGOA 4FASD 2VJIA 3DKYA 3D3SA 2F6CA 4U7BA 5C82A 4QPOA 2OZHA 1OR7C 2J8MA 3M8JA 4B10A 4NNJA 2Q04A 4KJZA 3TL4X 3S3MA 4C7IA 3QB8A 1KUXA 4C30A 2HQAA 2RREA 5JHFA 4DGWB 1MJ9A 1MW7A 4JWPA 4ZDPA 4UCMA 4C68A 1GHEA 1KUVA 3CXSA 4QC6A 2L9NA 3FBIB 4C2YA 1WK4A 3CP2A 3A1YA 3LSMA 5CQEA 4AG7A 3TO9A 4E7SA 4YRVA 3E0JB 4NQWB 1RO5A 5TGTA 3I9V2 2WA0A 2UWMA 2OZGA 3S6HA 2CY2A 4RLFA 4KSAA 4PJNA 3VWEA 1Y7RA 4OADA 3R96A 3G2BA 4HNUA 4AB7A 4PSWA 3KEYA 3H9QA 2DPTA 4LIUA 4E7JA 4BXFA 4ORFA 1XF8A 4ONUA 3L2VA 3MD2A 2VPLA 1NG7A 3EPZA 2LH9A 4BJ6C 1FMWA 2BVMA 1NMTA 4DBQA 1Z4RA 3BG7A 2Q1ZB 4LITA 2K5TA 3IAM2 1WJBA 3OOUA 3H5ZA 2NOJB 2M0MA 5G22A 4XM3A 3D5RC 3BG6A 3SDBA 2B3UA 2DOAA 1YLEA 3R9FA 3NWSA 4Q36A 1VZ0A 1QHGA 4EATA 1W36D 4Y49C 4MFJA 2R7TA 5GCNA 2ZW4A 3DTEA 1DGRM 1X1BA 2Q2EB 4B44A 2V4JC 2AE6A 2DXIA 4XLHA 2HVQA 1WJFA 3E0KA 3D8PA 3RPUD 3DTIA 2K5CA 3H9GA 3T90A 1U0JA 1Z21A 5A28A 4YELA 3H5RA 2VKDA 4CCKA 4G6TB 1TT0A 1V5FA 1Y6IA 2M4GA 2D4PA 4XN3A 2J8RA 1Z4EA 3DU5A 2IXSA 3HG9A 2PR8A 4RM2A 4ZDLA 1QHHD 4XLEA 3OS0A 1IB1E 3EO4A 3ZR8X 3D5SC 3HPHA 2PR1A 4BDYA 1SQHA 3EUHC 3EUAA 3HL2A 2F5VA 1I21A 1YVKA 2B3VA 2B4BA 2RC4A 3OYIA 4F3QA 3FBNB 4II3A 4XPDC 4IX7A 3WR7A 2VI7A 4CRZB 4CS0B 3FKJA 4Y33A 2V26A 2HDWA 2VIXA 3KX2A 2WSAA 2OU2A 4I49A 2JLMA 4JOMA 3NE7A 4LG3A 3C2HA 2RQQA 4XQFA 4XMYA 4IZZA 1P4NA 1HA8A 2FXFA 3BCBA 1W36C 4KOWA 4UA3A 4LX9A 3VWBA 2R1IA 4U9ZA 2PDOA 3LD2A 4XPLA 3PNTA 4B12A 2LREA 3HPGA 4GS4A 4MI4A 4CCOA 5FROA 1ERDA 3KKWA 3RCOA 4BU2A 4U5YA 4KS9A 4A32A 3E1SA 4IQ4A 4NC8A 2Z3NA 2PMZA 5HOOA 1M4IA 4OAYA 1M1DA 1TZLA 1YR0A 2Z3MA 3SXOA 4CYPA 2XDVA 1KONA 2ZSIB 3GBGA 3DPTA 4PK4A 4A31A 3QYBA 3A9LA 4CGNA 4XNHC 2IS1A 1MK4A 3OYJA 1YREA 2YNCA 4M85A 4P1WA 1S7FA 4AVAA 4CYQA 4NF1A 4MHDA 1D0ZA 4HNTA 3JUWA 3OYKA 5F49A 2PSWA 4L8AA 2IGMA 4A95A 3EUKL 3H9JA 2VJJA 2Z2SB 3AL0C 2VXKA 3W3CA 4C2TA 1D1CA 4HG2A 4XR6A 1Z7LA 4XORA 3S32A 4KISA 4J3GA 3H5AA 2M3AA 2X1DA 4P5OA 1N78A 4X5KA 1R6RA 2KL4A 3K4KA 3QOEA 1X1AA 2ZSHB 4FETA 1Q2CA 1JI8A 4MY3A 2X51A 1YX3A 4BQNA 1GLNA 4DBRA 4NC7A 1S3ZA 2CXAA 2KDOA 3SEZA 5IV0A 4KVXA 3RSNA 3ZQQA 3MGDA 2W4SA 3I3LA 3OYFA 3DNSA 4XLCA 2ZW7A 2X7BA 4PUSA 4PV6A 4C2ZA 5KTAA 1K4JA 4JD6A 1S7NA 5CKTA 2G0BA 2C27A 1CM0A 4L89A 1DGWY 2KLOA 2OUMA 4N4NB 3HOTA 2O5RA 3W91A 2CW8A 2Y0SA 1X1CA 2LG4A 1B6BA 3LL7A 3QYEA 3CMMA 1WJDA 4PSXA 4B3XA 2R7WA 2FL4A 1FMVA 4OWRB 3TMOA 2BEIA 2ZXVA 3N7ZA 4NSQA 5EC4A 2VXDA 2REFA 3OL4A 4BQQA 4HSTA 5HNFA 4RM3A 3U21A 3UR3C 2WADA 3CF2A 2A6TA 2WUUA 4UWIA 3LSIA 4KOYA 3FXTA 3TT2A 4QBJA 1X1DA 3FDYA 3FRMA 3M1CA 1ZELA 1PYVA 1PUAA 1MMAA 2HQYA 3TCVA 4BUPA 4XL9A 2VQCA 5AG4A 2LYCA 2VL8A 4IQJA 2FUG2 5CPRB 3MKZA 3L2QA 3P2HA 2V7FA 3K10A 5LD2C 2P0WA 1VKCA 2CNTA 4MFKA 3VWDA 4B14A 3OS2A 5EBVA 4BJ5C 3TOAA 3DTKA 1V5EA 3HXLA 4NCZA 3LSHA 2K9MA 4QPQA 2BW3B 3F8KA 1Z9UA 2V9KA 4K30A 4CAXA 2X1CA 2ATRA 4CCMA 2A5WA 3ZRGA 3PL8A 3OYCA 2DCEA 3PGPA 4BMHA 3R1KA 4A30A 1WJAA 2BW3A 2UUZA 1YX0A 3LODA 4UWJA 1UG0A 1DQUA 1R57A 1XEBA 2VQGA 2Q4VA 2M7BA 1X4PA 2Z3PA 4UBRA 4X0GA 2Z0ZA 1BO4A 2E1MB 3OYAA 3OL3A 4HEA2 2NMTA 2IGKA 4DOZA 1XMTA 1YK3A 2Y0MA 2R4GA 3BJ7A 4KOUA 2HUZA 5CQGA 2QKMB 4ZGYB 4GRIA 4B43A 5JQ4A 4QUSA 3S3NA 2YNCC 3F9KA 1BR1A 2VLAA 1QU3A 2BSWA 3BJ8A 3H0DA 2R7XA 4MFLA 5FVJA 5KTDA 4MBUA 2P6FA 4XNFA 1BR4A 3P2FA 4KLVA 4KZTA 4E7KA 4FD4A 5IX3A 1QSOA 4RS2A 5J8CA 2QKLB 4B48A 2QECA 1J09A 2BOLA 2IS6A 5F46A 2E5ZA 3FNCA 3OIPA 4PFPA 1J4JA 4LIVA 3BLNA 1XE4A 3OYMA 1V5GA 2R7HA 2ZPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FS5 A;  2EVN A;  1I1D A;  1OZP A;  3DDD A;  4H89 A;  4KUA A;  2P6G A;  4RI1 A;  4EVY A;  4YGO A;  2FT0 A;  2VQY A;  1WWZ A;  4KOX A;  2ARH A;  3PP9 A;  3DSB A;  4OAE A;  4KLW A;  3FB3 A;  1B87 A;  3IGR A;  2WPX A;  5ISV A;  3K9U A;  4KVO E;  3TTH A;  1IIC A;  3IWG A;  3ZJ0 A;  1M44 A;  4CRY B;  1L0C A;  3I3G A;  1RXT A;  2VZZ A;  5F48 A;  3JVN A;  4HNW B;  3I9S A;  3PZJ A;  4CAV A;  4AVC A;  3W6X A;  1P0H A;  4KOS A;  4HNY B;  4H6Z A;  4II9 A;  3B8G A;  2GIV A;  3QAH A;  3OWC A;  5H86 A;  3S6G A;  4ZBG A;  3H4Q A;  3DR6 A;  2VBQ A;  5F47 A;  1NE9 A;  4NEX A;  2VZY A;  1V0C A;  2EUI A;  3GY9 A;  1TIQ A;  1M4G A;  1U6M A;  4AG9 A;  2OH1 A;  1Y9W A;  2H5M A;  2I79 A;  3EC4 A;  4R3L A;  1PU9 A;  2R98 A;  3TO6 A;  4H6U A;  5C88 A;  3G3S A;  1QSM A;  3EXN A;  3TOB A;  1YGH A;  3FBU A;  3G8W A;  2O28 A;  1Q2Y A;  4CAW A;  2JDD A;  2Q4Y A;  3R9E A;  3SXN A;  2A4N A;  2G3A A;  2Q7B A;  2CNS A;  3CXQ A;  3DR8 A;  2FIA A;  4HKF A;  2REE A;  2Z11 A;  4JJX A;  1QST A;  2DXQ A;  4PK3 A;  3CXP A;  2G3T A;  3C26 A;  1S60 A;  4JXR A;  4M3S A;  2Q0Y A;  4PK2 A;  1S5K A;  1MJB A;  1VHS A;  4B5P B;  2Q44 A;  4MJ8 A;  4B5P A;  1IYK A;  2I00 A;  3SHP A;  3W6S A;  5HMN A;  4HNX B;  3V8I A;  2BUE A;  4XNH B;  3F0A A;  1UFH A;  4JXQ A;  4AVB A;  3TE4 A;  4E2A A;  4F6A A;  2BL1 A;  5DWN A;  3F5B A;  4R3K A;  4DNC A;  4OLL A;  2WPW A;  2ZW5 A;  2GAN A;  4KOR A;  2R8V A;  2JEV A;  1N71 A;  4KOT A;  3TO7 A;  4LUA A;  4FD7 A;  1YVO A;  2OZU A;  2PC1 A;  2J8N A;  4R57 A;  4JLY A;  3R9G A;  1NSL A;  1M4D A;  3R95 A;  1I12 A;  3FYN A;  2PQ8 A;  1QSR A;  2D4O A;  2KCW A;  2HV2 A;  4B5O A;  4KOV A;  4IUS A;  5HH1 A;  4IF5 A;  3UY5 A;  1KUY A;  5JPH A;  4YFJ A;  4XPK A;  2FE7 A;  4XPD B;  1BOB A;  1ON0 A;  3EFA A;  1Q2D A;  5I0C A;  1S7L A;  1FY7 A;  3FIX A;  1CJW A;  3T9Y A;  2B4D B;  5E96 A;  3D2M A;  3TFY A;  4E8O A;  1KZF A;  3S6F A;  3RYO A;  2B4D A;  4U9Y A;  2B5G B;  2F5I A;  1S7K A;  4Y49 B;  2AJ6 A;  2GE3 A;  4YRH A;  4FD6 A;  2B5G A;  3GYA A;  4F0Y A;  1IYL A;  1MJA A;  2QIR A;  1XIX A;  4R87 A;  2FSR A;  2IL4 A;  1Y9K A;  2FIW A;  5CNP A;  2PRB A;  2Z10 A;  4MY0 A;  3S6K A;  5KTC A;  2CNM A;  3ZZI A;  2JDC A;  4E0A A;  1LRZ A;  2OB0 A;  2QML A;  2ZW6 A;  4FD5 A;  5H84 A;  1QSN A;  2VEZ A;  5DWM A;  3EY5 A;  4R9M A;  5J8F A;  2P6E A;  1IID A;  2B58 A;  5IB0 A;  4NXY A;  3GKR A;  3D2P A;  4QVT A;  4KUB A;  4KVM E;  4QB9 A;  2FCK A;  3D3S A;  5C82 A;  2OZH A;  2J8M A;  2Q04 A;  3QB8 A;  1KUX A;  1MJ9 A;  4JWP A;  1GHE A;  1KUV A;  3CXS A;  4QC6 A;  1WK4 A;  4AG7 A;  3TO9 A;  1RO5 A;  2OZG A;  3S6H A;  2CY2 A;  3VWE A;  1Y7R A;  4OAD A;  3R96 A;  4AB7 A;  4PSW A;  4ORF A;  1XF8 A;  4ONU A;  1NMT A;  1Z4R A;  2K5T A;  2B3U A;  3R9F A;  1YLE A;  4Y49 C;  5GCN A;  2ZW4 A;  2AE6 A;  3E0K A;  3D8P A;  3T90 A;  2D4P A;  2J8R A;  1Z4E A;  2PR8 A;  1IB1 E;  2PR1 A;  1SQH A;  2VI7 A;  1YVK A;  1I21 A;  2B3V A;  2B4B A;  2RC4 A;  3WR7 A;  4CRZ B;  4CS0 B;  2OU2 A;  4I49 A;  2JLM A;  3NE7 A;  1P4N A;  2FXF A;  4KOW A;  4UA3 A;  4LX9 A;  2R1I A;  4U9Z A;  4XPL A;  2PDO A;  4GS4 A;  4MI4 A;  3KKW A;  4U5Y A;  1M4I A;  1M1D A;  1YR0 A;  3SXO A;  4XNH C;  1MK4 A;  4M85 A;  1YRE A;  1S7F A;  4AVA A;  4NF1 A;  4MHD A;  3JUW A;  5F49 A;  2PSW A;  4L8A A;  2VXK A;  4J3G A;  4X5K A;  1Q2C A;  4MY3 A;  1S3Z A;  5IV0 A;  4KVX A;  3MGD A;  4PV6 A;  3DNS A;  2ZW7 A;  2X7B A;  5KTA A;  1K4J A;  4JD6 A;  1S7N A;  2G0B A;  2C27 A;  1CM0 A;  4L89 A;  3W91 A;  1B6B A;  4PSX A;  3EO4 A;  2FL4 A;  3N7Z A;  5EC4 A;  2BEI A;  4NSQ A;  3VWD A;  2ZXV A;  2REF A;  4UWI A;  4KOY A;  3TT2 A;  3FXT A;  4QBJ A;  3FRM A;  1PUA A;  3TCV A;  2HQY A;  3P2H A;  4XPD C;  2CNT A;  2P0W A;  1VKC A;  5EBV A;  3TOA A;  4NCZ A;  3F8K A;  1Z9U A;  4K30 A;  4CAX A;  2ATR A;  4BMH A;  3PGP A;  3R1K A;  1YX0 A;  3LOD A;  4UWJ A;  1R57 A;  1XEB A;  2Q4V A;  4UBR A;  2Z0Z A;  1BO4 A;  2Y0M A;  2NMT A;  4KOU A;  1XMT A;  1YK3 A;  3BJ7 A;  2HUZ A;  5JQ4 A;  4QUS A;  3LD2 A;  3BJ8 A;  2BSW A;  5KTD A;  5FVJ A;  4MBU A;  2P6F A;  3P2F A;  4KLV A;  4KZT A;  4FD4 A;  5IX3 A;  1QSO A;  4RS2 A;  5J8C A;  2QEC A;  5F46 A;  3FNC A;  1J4J A;  3BLN A;  1XE4 A;  2R7H A;  2ZPA A; 
#chains in the Genus database with same CATH topology
 1R4M B;  2KPM A;  4BJT A;  5CVJ A;  1I1D A;  1OZP A;  1H8A C;  4UY8 I;  2ZCW A;  4BE0 A;  5A2Q Z;  2Z3O A;  3DDD A;  4H89 A;  3H5N A;  1HQC A;  1TF8 A;  3MQ0 A;  2JJ7 A;  3GFI A;  2XPV A;  1ZGJ A;  2X6X A;  3J7A O;  3F8C A;  4UV8 A;  4EVY A;  2KT0 A;  4M6Y A;  3HDD A;  4KOX A;  3ZXS A;  2GQQ A;  3KFW X;  2KP6 A;  1WI9 A;  4AU7 A;  4MRI A;  2V1U A;  3NH8 A;  1XC5 A;  2V6E A;  2OTJ I;  3TW6 A;  2R5Z B;  3PEI A;  4ZYQ A;  5ISV A;  5DCF A;  4MCQ A;  2VKV A;  2BY0 A;  3JAM Z;  3K9U A;  1S7E A;  2R7O A;  1IIC A;  3TTH A;  2JN6 A;  2QQB A;  3WTY C;  1XMK A;  4BGD A;  3JRE A;  1IJW C;  4C9Y A;  3D68 A;  1L0C A;  1RXT A;  1TWA J;  3F6O A;  3I1U A;  3SJM A;  1A6I A;  2ELH A;  1XB4 A;  3ZOB A;  2QUF A;  3PJR A;  2CV1 A;  3I9S A;  4W9Y A;  4HLY A;  3PZJ A;  2WY8 Q;  3KEO A;  4ZYA A;  4GFB A;  4XOP A;  3LMS A;  1PCA A;  3E97 A;  3IH4 A;  3G1L A;  3PSI A;  1YW9 A;  4F55 A;  4MEY F;  1DU6 A;  4NGQ A;  2HEO A;  3LMM A;  3OYE A;  1I27 A;  4OU0 A;  5G1Z A;  5L3E A;  3ZGK A;  3C2G A;  3WU0 A;  4XRF A;  3DR6 A;  4E7H A;  1ODD A;  2GZW A;  2Y69 H;  3FWE A;  1AKH B;  3S1M J;  5F47 A;  1SD7 A;  1NE9 A;  2P6T A;  4HYE A;  1V0C A;  1TKH A;  4D1Q A;  2GOM A;  3KPH A;  3CLQ A;  4D7N A;  5IP7 J;  2IS2 A;  3V42 A;  3L2U A;  3KL9 A;  4AG9 A;  4WWV A;  1Y9W A;  1LAM A;  3K70 C;  2GWR A;  2I79 A;  3EC4 A;  3RKW A;  1G4D A;  2L3D A;  5D8N A;  1PU9 A;  2R98 A;  1EH7 A;  4HF1 A;  1Q1H A;  2F2E A;  1BM9 A;  2K4B A;  2C6P A;  5A27 A;  3DQV C;  2HPM A;  3PB4 X;  3F8B A;  3K1M A;  3S8P A;  3EXN A;  3HB9 A;  4FCY A;  1MMG A;  3ASN H;  1WCM J;  2HOT A;  4G7O F;  3S2D J;  1UWY A;  5FKO A;  1XSX A;  1T38 A;  2O28 A;  5F08 A;  3G8W A;  1Y56 A;  3CCE I;  2ESN A;  1Q2Y A;  3D66 A;  1RC9 A;  1MMN A;  4NBQ A;  4CPA A;  3OYN A;  2CS3 A;  1F36 A;  1XS9 A;  5D5W B;  3GLJ A;  4BL0 B;  2JMW A;  3GW2 A;  2Z16 A;  2XEI A;  1I3A A;  4IOC F;  3N97 A;  1MMS A;  2Q4Y A;  2A4N A;  4EMS A;  2ID6 A;  1HBX G;  4D5F A;  2GA1 A;  2CG4 A;  2L54 A;  4AVZ A;  2GXG A;  3ECH A;  1F9N A;  1FOX A;  1IUY A;  1QQI A;  4A3F J;  3EUH A;  5KCM A;  4WK8 F;  5G21 A;  1Z91 A;  2CFX A;  4HQM A;  3LAC A;  2DXQ A;  1EA3 A;  3DPL C;  3S9N A;  5JI6 A;  3KP2 A;  1ZKG A;  2HOA A;  2VPR A;  3FHN A;  1S60 A;  2E36 A;  1ORK A;  4PK2 A;  4BYY A;  2IVM A;  2IPQ X;  1FJL A;  2AFO A;  4F9U A;  1UHM A;  3NH5 A;  4XON A;  3H1C A;  2LNB A;  4P4E A;  5D8K B;  3IP4 B;  2LD5 A;  4UIA A;  1SD6 A;  1R71 A;  1J75 A;  2CUE A;  2VT3 A;  1X3U A;  3T5X A;  1FP1 D;  3ABT A;  3R61 A;  5L3F A;  4A38 A;  4OAZ A;  2X6O A;  1HLV A;  4P45 A;  4DYC A;  3SHP A;  1SD4 A;  3QYF A;  5HMN A;  1ACI A;  4HNX B;  1D0X A;  4RBO A;  2BUE A;  1MKM A;  3P9C A;  4XNH B;  2K9L A;  2NS0 A;  1VGY A;  4KA4 A;  3OYL A;  2WZN A;  4UFV A;  1MBH A;  2NYQ A;  3NWT A;  5HLT A;  4HOB A;  3KAS A;  3LA7 A;  2GXB A;  4F6A A;  1ETX A;  3NRV A;  2ZEE A;  4I6Z A;  2O61 A;  1IDZ A;  4RGR A;  5JH9 A;  2W1O A;  1OFC X;  1W5S A;  2DEA A;  4F0X A;  2QSH X;  1CPX A;  2V8G A;  1H88 C;  2D1H A;  2M2E A;  4B09 A;  3OYH A;  3IH2 A;  4PJJ A;  1J0R A;  2WPW A;  4EJO A;  2IA2 A;  3QWL A;  3NFZ A;  3L2W A;  2AFS A;  4O6J A;  2GAN A;  4MHP A;  5EGO B;  3PFY A;  1DTD A;  3TO7 A;  4IJA A;  4NUB A;  5TIS C;  2JPC A;  2PJ6 A;  5H20 A;  3P7N A;  4IRH A;  3QOD A;  5J1U A;  3HTU A;  3RO0 A;  5HDG A;  3N5F A;  2ME0 A;  1YTY A;  2ME6 A;  3L00 A;  2PIY A;  1T98 A;  3IH3 A;  2RKH A;  5GTI C;  1JGS A;  2PEX A;  1TQP A;  3WHB A;  1DPR A;  2VQL A;  2K3P A;  3S93 A;  4M71 A;  4AWX B;  2WV1 A;  3I4P A;  4FE4 A;  4S0H B;  1GXQ A;  2H6C A;  4IF5 A;  1RIO H;  5JGF A;  1TNS A;  4PJ0 C;  1LVA A;  4YFJ A;  1AU7 A;  4XPK A;  2LK2 A;  1YJN I;  1VQ9 I;  2E2J J;  3PIO F;  3H8E A;  4O5V A;  3JSP A;  2FQ3 A;  1W0U A;  4RGS A;  1Z8T A;  2FD5 A;  2WAF A;  4HQE A;  2KRF A;  3MKY B;  2GRE A;  1U2W A;  2Z3L A;  3J81 K;  4ZTF A;  3SYT A;  1Q2D A;  3DLJ A;  4MHN A;  1Y8R B;  3C1D A;  3FJU A;  3U1D A;  4PFO A;  4LGW A;  5K7Z A;  1AHD P;  2E19 A;  2VKH A;  2VQH A;  2UV1 A;  3CES A;  3RKY A;  1SC7 A;  2X9D A;  1SAX A;  5IY5 H;  4O3M A;  3C18 A;  3MZ8 A;  5E96 A;  5KAF C;  1ZRC A;  4HA8 A;  1IG7 A;  4C2U A;  4DUK A;  2CWE A;  2WB1 N;  2W48 A;  3O8G A;  2VBX A;  5FD6 A;  4A3I J;  2W24 A;  2XAS A;  3WTT C;  2ODF A;  2QSG X;  1R43 A;  1MSE C;  3F6V A;  4QIW N;  4AD9 A;  5EEA A;  4GM5 A;  4HSR A;  3FIW A;  3H0G J;  5ICE A;  4F92 B;  1ZRD A;  4Y49 B;  2DA5 A;  4YRH A;  2Z1D A;  5HVQ C;  4UVA A;  4E4H A;  2GXA A;  2HKX A;  3CCJ I;  1HKQ A;  5M5W J;  3R60 A;  1DPU A;  2R7U A;  3P9K A;  2EPF A;  3RBU A;  5DCM B;  4L9N A;  1IN7 A;  3CO6 C;  4MFP A;  1MJA A;  2QIR A;  1R00 A;  1XIX A;  4R87 A;  2W7N A;  5D5X B;  3V4G A;  3DEW A;  3WE3 A;  1YS7 A;  3P5J A;  2FIW A;  2PRB A;  5FKK A;  5EJC A;  1ZK8 A;  3QP5 A;  2AQF A;  3LSG A;  3GTQ J;  3I58 A;  4J01 A;  1R5G A;  3R0J A;  1W7P B;  3ZZI A;  4HPQ A;  4M9S A;  2I3C A;  4EME A;  1LRZ A;  2IQ6 A;  2OB0 A;  3HUG B;  2HZT A;  2KIF A;  1RR8 C;  5DWM A;  3E6D A;  1WGX A;  1M1E B;  3O3K A;  1ENH A;  1D8K A;  3HRU A;  2EIN H;  5J8F A;  1OCO H;  1JT0 A;  4FQG A;  5IB0 A;  2ZOG A;  4UXN A;  4NXY A;  1Z8X A;  2MH9 A;  3LSK A;  2E2I J;  4BNC A;  4UUS A;  1AMP A;  4U0Y A;  2CUZ A;  1FIP A;  4QVT A;  1KA8 A;  3CT9 A;  4AIJ A;  3GZN B;  2O4H A;  3OMY A;  2XKP A;  4NGM A;  1X3W B;  2COB A;  2EV5 A;  3I59 B;  3V7S A;  4FAS D;  2GAU A;  2IW5 A;  2F6C A;  4U7B A;  5C82 A;  4QPO A;  2DW4 A;  1OR7 C;  2J8M A;  2PMH A;  4PDK A;  2DA3 A;  4A69 C;  2ZEN A;  5LRJ A;  4AID A;  4UCM A;  5H6Q A;  4ZDP A;  4HNV A;  1XX5 A;  2OPT A;  3AG1 H;  2L9N A;  3FBI B;  3IWF A;  2XAF A;  2BE5 F;  4P4F A;  4YRV A;  1YQA A;  2WA0 A;  2UWM A;  3BI1 A;  3VWE A;  3IWW A;  3R96 A;  3G2B A;  3V7Z A;  4AB7 A;  2J5P A;  3H9Q A;  2HXO A;  3E7L A;  6PAX A;  3J7Z I;  3VAR A;  1CX8 A;  4NQW A;  4BXF A;  4R76 A;  4ORF A;  1XF8 A;  3Q0W A;  3G71 I;  2EZI A;  3SFZ A;  2L0K A;  3I64 A;  3NH4 A;  1NG7 A;  3LWU A;  5DM6 F;  2V77 A;  4ZZL A;  2Q1Z B;  4C3I J;  5EEH A;  3OOU A;  4ENK A;  3H5Z A;  2M0M A;  1O3Q A;  2B3U A;  3JTH A;  3NWS A;  4Q36 A;  1HST A;  1VZ0 A;  4YII A;  1BC8 C;  1CQT A;  2B63 J;  2A69 F;  1XOV A;  4IHW A;  4A93 J;  1X1B A;  3BY6 A;  3A0B C;  5FKM A;  3ISP A;  2HVQ A;  4I09 A;  2NVU B;  4H0E A;  1XSD A;  5L3B A;  2BCO A;  3D8P A;  3RPU D;  3W6J B;  1MDM A;  4GXH A;  5A28 A;  1Z21 A;  4F8Z A;  1BLL E;  3FM3 A;  5DUI A;  3DF8 A;  3KR5 A;  3EET A;  4UEF A;  4G6T B;  1Y6I A;  4UNO A;  1U5T A;  1Z4E A;  1OKR A;  2PR8 A;  2C6G A;  3QPT A;  5TJJ A;  4G94 A;  4EWT A;  2VOP A;  4L5I A;  3S17 J;  5D6E A;  4XLE A;  3R4K A;  1IB1 E;  2FQ4 A;  2P5V A;  1WSU A;  3D5S C;  3HPH A;  3MN8 A;  2EK9 A;  4BY7 J;  1I21 A;  2B4B A;  2FEZ A;  5JVT A;  3OYI A;  3P9I A;  4FT8 A;  3B3V A;  2LFB A;  4JBA A;  3FBN B;  4IX7 A;  1HSJ A;  5HLI A;  3AG4 H;  4CRZ B;  1ETW A;  1KQ9 A;  1XDU A;  4B6Z A;  2VIX A;  2WSA A;  4I49 A;  3IO1 A;  3G6E I;  5K8P A;  3KQZ A;  1W4M A;  3NE7 A;  4LG3 A;  1SVO A;  3C2H A;  2RQQ A;  4XQF A;  4XMY A;  1P4N A;  1HA8 A;  4H2K A;  4UA3 A;  4XID A;  2NRA C;  4XPL A;  4U9Z A;  1TQM A;  3ECO A;  5BPD A;  2H8R A;  4ENM A;  4GS4 A;  4CCO A;  5E3N A;  4MI4 A;  4WXD A;  3WTV C;  4A2U A;  4NC8 A;  3FK7 A;  2X48 A;  2PMZ A;  1JTX A;  5HOO A;  1H9T A;  2GU2 A;  2Z3N A;  4OAY A;  1W5C C;  2P8T A;  2Z3M A;  3GBG A;  2D1V A;  2VKE A;  3FMQ A;  4A31 A;  3QYB A;  2DO7 A;  3A02 A;  3OYJ A;  3WTZ A;  2MC3 A;  4P1W A;  1A2Z A;  1D0Z A;  4YFX F;  2FBI A;  1HKS A;  3REO A;  4HNT A;  2GLJ A;  3JUW A;  1YME A;  2LF7 A;  2XEG A;  5F49 A;  2PSW A;  3M4O J;  3SJG A;  4LLL A;  3A0H C;  2XSD C;  4NC6 A;  1NHA A;  2VXK A;  2IBD A;  1AOY A;  2DK8 A;  2AO9 A;  4MO7 A;  2X1D A;  4P5O A;  1U8R A;  1N78 A;  2OA4 A;  3K4K A;  4DQ2 A;  2ZSH B;  3CDH A;  3VPR A;  1ZAO A;  3RYR A;  1GLN A;  4BQN A;  1Y0R A;  1PUE E;  2NSM A;  1UHW A;  1G3T A;  1FWZ A;  2QZ8 A;  3HGG A;  5IV0 A;  2VBY A;  3RSN A;  5BQT A;  4G6D A;  2LF8 A;  3OYF A;  5E20 A;  4PCQ A;  1R36 A;  4UUS B;  2X7B A;  3UKG A;  2R92 J;  1K4J A;  2G0B A;  2ZW6 A;  2JRT A;  1AUG A;  1CM0 A;  2OR4 A;  5HS9 A;  2KLO A;  4N4N B;  4OIR F;  1AWC A;  4LJZ F;  2L4A A;  1S72 I;  3W91 A;  3L1P A;  1B6B A;  3FHZ A;  4PSX A;  2R7W A;  1WJD A;  1CF7 B;  3VWD A;  2N8G A;  1I6H J;  1RTQ A;  5HNF A;  5K8M A;  1ETY A;  2DI3 A;  5LGN A;  2CU7 A;  2K86 A;  1G3Y A;  4UWI A;  3I53 A;  1J59 A;  4KN4 X;  1QGP A;  1X1D A;  1ZEL A;  2ZJR F;  2HQY A;  3VAT A;  2DDB A;  3L2Q A;  2QGU A;  2V7F A;  3G1O A;  2P0W A;  3MZH A;  4B14 A;  3BR5 A;  2O3F A;  5EBV A;  1V5E A;  3PO3 J;  3L9F A;  3T8T A;  3HOY J;  4Z6Y A;  3F8K A;  1Z9U A;  3BPX A;  2XAQ A;  1PP7 U;  2X1C A;  2ATR A;  4CCM A;  1O4X A;  2DOE A;  1TXR A;  4V2G A;  1W1W E;  3G1M A;  3R1K A;  2NNN A;  2UUZ A;  1YX0 A;  3GUD A;  1EH6 A;  3LOD A;  2A68 F;  4A3B J;  3GTO J;  2DOF A;  3M7G A;  2DFF A;  2Z3P A;  2Z0Z A;  1BW6 A;  3NEU A;  2NMT A;  3HM5 A;  1YRN B;  5JQ4 A;  4RUH A;  4GRI A;  1WWX A;  1RKT A;  1P6R A;  5DYM A;  1IRZ A;  3F9K A;  1BR1 A;  3HHH A;  5B1A H;  3LD2 A;  4MFL A;  3U1K A;  5KTD A;  5FD5 A;  2ZKZ A;  4ZY1 A;  4XNF A;  2XHK A;  5IX3 A;  4E7K A;  4YIR X;  2ABZ A;  4B48 A;  2O8K A;  5K5Q A;  5F46 A;  2EO8 A;  4LIV A;  1IRG A;  1OPC A;  3KR4 A;  2R7H A;  1K7A A;  4I02 A;  3MFK A;  3WU1 B;  2FS5 A;  4P4B A;  2O7O A;  2L4M A;  3DLL F;  2M5W A;  1BI1 A;  3MZY A;  4IPA A;  3VYS B;  3BR6 A;  1I39 A;  2ZEL A;  1RUN A;  3DKW A;  2VUM J;  2FOK A;  2ZEP A;  3QPH A;  2P6G A;  2ZOF A;  2E5N A;  3PSF A;  1BJA A;  1J5Y A;  3UNG C;  3DPU A;  4YGO A;  2ZNY A;  1JQG A;  2FT0 A;  4XLA A;  2ARH A;  3PP9 A;  4OAE A;  4E6K G;  4KLW A;  3E6M A;  2L5Q A;  3O2P E;  2ISZ A;  4DYO A;  2HFH A;  3SZG A;  3CZ6 A;  4H4K C;  2WPX A;  3IGR A;  2AHQ A;  2L9V A;  2XF7 A;  3I54 A;  4KVO E;  3IWG A;  3ZJ0 A;  1LJ9 A;  2K40 A;  3BR1 A;  3FIS A;  3RTR A;  1ARL A;  6CPA A;  3HSR A;  3S2H J;  2R5Z A;  1IF1 A;  1SVL A;  2VJ5 A;  2E34 A;  1FBS A;  2FX0 A;  3WHC A;  3GWZ A;  2JZY A;  3JVN A;  4A3J J;  3KI9 A;  4LLG F;  3QPL A;  3W2V A;  1Z3Y A;  2JA8 J;  3S3O A;  3Q9S A;  4EJT A;  4HDU A;  2GA2 A;  4OC4 A;  5KK1 A;  4OIO F;  4KOS A;  1UFM A;  4II9 A;  3OWT A;  3G4S I;  4A32 A;  2GIV A;  5KHD A;  1IRX A;  5H86 A;  1P92 A;  4ZY2 A;  1F4K A;  3K4L A;  1TQI A;  2DA1 A;  4JX4 A;  4EM0 B;  1GV5 A;  1OYY A;  3I55 I;  2DPU A;  4OP4 A;  2JPB A;  4K2E A;  2A07 F;  2LRD A;  1XMX A;  2VZY A;  3BLY A;  5FLM J;  4NEX A;  2PJ2 A;  3ZQG A;  1AKH A;  2MFZ A;  5K5O A;  3KCC A;  1OQY A;  4GCV A;  3HLP A;  1JUS A;  4X8I A;  3CCM I;  4BKX A;  2CV2 A;  3IU2 A;  2KQR A;  2JVH A;  4H6U A;  1NG6 A;  4XRM A;  2ZME C;  3RQI A;  3Q5F A;  3QQA A;  3G3S A;  1SFK A;  2E1M C;  1XCB A;  2M7A A;  2R5Y B;  3HKZ A;  4P9U A;  4U7D A;  2PJ8 A;  4LQG A;  5K5R A;  1UCR A;  5TRD A;  4DJL A;  2GOX B;  2X6W A;  1TT5 B;  3B3W A;  1HF0 A;  2YGW A;  5HXD A;  4BE2 A;  4RLQ A;  4CAW A;  4IKF A;  1O3R A;  2QWW A;  4OIP F;  2DMP A;  4ZC3 A;  2JDD A;  4UHT A;  1VHO A;  4C3J J;  3R9E A;  3WTS C;  2PIZ A;  2ZEF A;  3CQZ J;  5L3G A;  1OJL A;  1T0F A;  4MMO A;  4XLF A;  4MLO A;  5LHG A;  2FIA A;  1VQ7 I;  4DYR A;  2Z11 A;  3MKL A;  4RA2 A;  2GIZ A;  1QST A;  3VOD A;  1Q1V A;  1WJ5 A;  2XF5 A;  1E3O C;  2M34 A;  3ZMU A;  1JWQ A;  1VQN I;  1GVD A;  1X3Z B;  2WBM A;  4UIB A;  4XN0 A;  5K7F A;  5E1Z B;  4JXR A;  1TL8 A;  3KLN A;  1R49 A;  1VHS A;  4RAY A;  1N77 A;  4B5P B;  3JRF A;  4A0Y A;  4J19 A;  1NH3 A;  2HNH A;  2OZ6 A;  1T6S A;  3WC5 A;  4KFC A;  1HCR A;  2H1K A;  4XLN F;  4CZZ A;  2UXN A;  4EJW A;  1G2H A;  1ZHF A;  2CUJ A;  3KZY A;  1LVK A;  5GAE J;  2XGX A;  1FT9 A;  1W7P D;  5HLH A;  3G73 A;  4M3G A;  4LOC A;  2RQP A;  1IDY A;  3S1Q J;  1Z2L A;  1AA7 A;  2IEK A;  3JTG A;  3RQ4 A;  1QO0 D;  4A5M A;  4PXE A;  1LEA A;  3OS1 A;  1LFU P;  1UFH A;  1Y0U A;  3TBI A;  3GTL J;  3F0A A;  4AXV A;  4M72 A;  3D4U A;  2ETH A;  1WKM A;  2AXT C;  5FFZ A;  4ANJ A;  3CCU I;  2PLY A;  3GFL A;  5AG5 A;  4IO9 F;  4E2A A;  2I8D A;  3FMR A;  4CGO A;  4DIQ A;  5A2Q K;  3AL0 B;  1IN8 A;  1LNW A;  1MBE A;  1UB9 A;  1Z05 A;  3K2Z A;  3Q3S A;  4AYB A;  2GFQ A;  2P7V B;  4R3K A;  4L9V A;  4E7L A;  2VOO A;  2BY2 A;  2EIL H;  4DNC A;  3AKZ A;  2HDD A;  4ZI6 A;  2VN2 A;  3WG9 A;  2JUG A;  4F91 B;  1NK2 P;  3LOC A;  1ZRF A;  1VQ6 I;  2XF6 A;  3L09 A;  3IRQ A;  2XB0 X;  2ZXJ A;  3IUO A;  3SHF A;  3JAM K;  3OY9 A;  2EK8 A;  4AC0 A;  2Z3Y A;  4NHJ A;  4IHY A;  3H3Z A;  4O23 A;  4UB8 C;  1N71 A;  2JVG A;  1Y0Y A;  1R1V A;  4IXA A;  4LUA A;  3U2R A;  3LSP A;  2AXL A;  1RKW A;  5E3M A;  2E60 A;  1WZ2 A;  1T33 A;  3C2B A;  4CCN A;  2PC1 A;  5L3D A;  5EGO A;  3SI1 A;  4XIC A;  4CYO A;  5LYF A;  4HZF A;  3R9G A;  4CH7 A;  1V3F A;  3CCV I;  4MHZ A;  3R95 A;  3FYN A;  2PQ8 A;  2ZEO A;  3CUQ B;  4CA0 A;  2CO5 A;  5ILV A;  2GBY A;  2VI6 A;  1S7A A;  2XB5 A;  2XGC A;  2VXZ A;  2C1C A;  3OR1 C;  2OC6 A;  3DEU A;  2DYR H;  2ZJQ F;  1T8I A;  2GLO A;  1E0E A;  2WAQ A;  3N05 A;  3UY5 A;  1T0F C;  2X1E A;  3BG3 A;  2W25 A;  5BPI A;  3F8N A;  2CFO A;  1YX5 A;  1BOB A;  2J5O A;  4CXF A;  2ACJ A;  2ID3 A;  3J7A Y;  1WHU A;  5IP9 J;  1LAP A;  2HOE A;  3EFA A;  2Y31 A;  2ZO4 A;  5CJ9 A;  2X6Y A;  4IRG A;  1Z7U A;  2R7S A;  4P44 A;  5K1Y A;  1S7L A;  3CCQ I;  2NVQ J;  2IGN A;  1WJE A;  4Y4R A;  2IAI A;  3IIB A;  3EYI A;  4A33 A;  1CJW A;  4MNU A;  2MLK A;  1ZLK A;  2O53 A;  2Z3K A;  2ZEH A;  2PJR B;  2B4D B;  1B9N A;  3TFY A;  5AG6 A;  3HRM A;  3RKQ A;  1HEE A;  3IWZ A;  4PXD A;  4U88 A;  4KN7 X;  3S6F A;  5E3O A;  1YIJ I;  3RYO A;  2RDP A;  4IOA F;  5LRR A;  3VDX A;  5IPA A;  2B5G B;  1R4N B;  5IOY A;  2ZFU A;  3CC7 I;  1FEX A;  1BN5 A;  4W1U A;  2AJ6 A;  1WJC A;  2O9L A;  3J7Y J;  4DW6 A;  1HDP A;  1Y0N A;  1TP4 A;  2V8D A;  3KHX A;  1YS6 A;  2EFW A;  4CSW A;  1FIA A;  1R58 A;  2VT2 A;  3OIQ A;  5J4Y A;  1ZLH A;  4JP0 A;  1IYL A;  1RPW A;  1MBK A;  1I50 J;  2JSP A;  5AON A;  2AFM A;  1A35 A;  2MD0 A;  3R0A A;  2G7H A;  4I0B A;  5DCM A;  3W6V A;  5AGE A;  1S9H A;  4ZTJ A;  3M1E A;  4N9H A;  2LSO A;  4L18 B;  3GIU A;  3SJE A;  2OV7 A;  1DU0 A;  4PPZ A;  4MY0 A;  1JKR C;  3BTC A;  2WTE A;  2W00 A;  4V19 K;  5KTC A;  1J9I A;  2F5E A;  3LA2 A;  4RMN A;  2TDX A;  3EYY A;  3HOX J;  2JDC A;  3F22 A;  1PVE A;  2QML A;  2QEN A;  4A95 A;  2F5F A;  4UUT A;  3OYD A;  1QSN A;  3KP4 A;  5F0H A;  2PJP A;  4BQO A;  2AFX A;  4U87 A;  2IJZ A;  1W7P A;  2KJB A;  4BS9 A;  3EY5 A;  3MWM A;  3KQX A;  3ZQL A;  1X4O A;  2NS8 A;  1IID A;  3HSF A;  2B58 A;  2L7K A;  1JTY A;  3DBH B;  3HUG A;  3VYU B;  2YND A;  2W82 A;  4R8H A;  2F4I A;  4NDL A;  1E17 A;  3FED A;  4HF0 A;  2L9S A;  3GYH X;  4E7I A;  4Q38 A;  4XKB A;  5ICC A;  4KUB A;  1WH5 A;  4KVM E;  3E6C C;  4QB9 A;  4YIF A;  2IGO A;  1R1T A;  1Y1W J;  1P4W A;  4LK1 F;  1BC7 C;  1HOM A;  4AM3 A;  2F4M B;  3LSR A;  4N9I A;  1HW2 A;  2VL1 A;  3GFJ A;  4NNJ A;  3CMY A;  3QAY A;  3SJF A;  3I59 A;  3JR9 A;  3S3M A;  1KUX A;  4C30 A;  3I71 A;  4MQV A;  4RAF A;  4DGW B;  1MW7 A;  4HAM A;  4RB2 C;  4JWP A;  4C68 A;  1IO2 A;  1KUV A;  3CXS A;  4QC6 A;  4IHS A;  4MTE A;  4EQQ A;  4RGU A;  3A1Y A;  3LSM A;  4P55 A;  1WK4 A;  1S7O A;  3BTJ A;  1XDS A;  4M74 A;  4E7S A;  4YG2 F;  3E0J B;  4JZ0 A;  1WI3 A;  1RO5 A;  5TGT A;  2OZG A;  3S6H A;  1ARM A;  2CY2 A;  4LB5 A;  4KSA A;  4PJN A;  5EMI A;  3RIR A;  4ONW A;  2CTC A;  3WGH A;  3ML6 A;  2EFO A;  1I5Z A;  5LRS A;  1ZG5 A;  3IFE A;  3KIO A;  1B8I B;  4ONU A;  1SEU A;  2ZEM A;  5CBM A;  3M8F A;  4KUM A;  2PJ9 A;  2ESH A;  1EJ9 A;  3D7G A;  1NMT A;  2OAZ A;  3FM5 A;  4DBQ A;  1PDN C;  1Z4R A;  3OIO A;  2K5T A;  1Z0X A;  2M45 A;  1LDD A;  5DDG A;  1WJB A;  2NOJ B;  1RR7 A;  4XM3 A;  3LFK A;  5FJ8 J;  2JQ7 A;  3COA C;  1O57 A;  1QHG A;  5IT9 K;  4Y49 C;  4MFJ A;  1ZG7 A;  1MGT A;  2ZW4 A;  5EEG A;  1JKP C;  1DGR M;  2Q2E B;  3C7J A;  2Q8K A;  2V4J C;  2AE6 A;  2DQR A;  4DZJ A;  3M3Y J;  4FX0 A;  4UVC A;  5IB9 A;  2K5C A;  4BHP A;  4PXC A;  2A5Y B;  2TRT A;  1UMQ A;  4Y13 A;  3H5R A;  1H9G A;  2VKD A;  4CCK A;  2E1C A;  1TT0 A;  1X2N A;  4XN3 A;  2HR3 A;  1FYM A;  1OBR A;  2KIM A;  4EGY A;  3EDP A;  3HG9 A;  2J8R A;  5FKN A;  2EA4 A;  4ZDL A;  1RES A;  3WG7 H;  5IP6 A;  2AFZ A;  1VHE A;  1QHH D;  2EZK A;  2DFE A;  4IHV A;  3S9L A;  5JM6 A;  1R5I D;  5FLV A;  2FXA A;  1SQH A;  3EUH C;  3EUA A;  2H8W A;  2F5V A;  1YVK A;  2VI7 A;  2RC4 A;  2RV8 A;  1IV6 A;  2PJA A;  3I56 I;  2ZB9 A;  1YHQ I;  2DT5 A;  1BOA A;  1BI0 A;  1X10 A;  3NAR A;  4CS0 B;  2WC2 A;  3FKJ A;  4Y33 A;  2K02 A;  2HDW A;  5GAH J;  4QLC U;  2L01 A;  1T2K A;  2LVS A;  2OU2 A;  4RB1 A;  2PRQ A;  4NGN A;  4OKO A;  4OC0 A;  3HTS B;  2K85 A;  2REF A;  2EFQ A;  3B7I A;  3FXQ A;  2O0Y A;  4IZZ A;  2FXF A;  4LX9 A;  2STW A;  2PDO A;  3PNT A;  1HDD C;  2CTB A;  4B12 A;  3HPG A;  4I7H A;  3RCO A;  4KNY A;  3VB2 A;  5JLW A;  2RNJ A;  4KS9 A;  2KIQ A;  4U5Y A;  4IQ4 A;  3JRA A;  3QPS A;  2AS5 F;  2EQR A;  4CYP A;  5LGT A;  2DMT A;  1A31 A;  5HVG A;  1VQL I;  2ZSI B;  4UF4 A;  3B3S A;  2OQG A;  4PK4 A;  2UXX A;  1HC8 A;  3J80 K;  3KZW A;  1YRE A;  1ZYR F;  1S7F A;  3CJN A;  1X12 A;  4Q47 A;  3PB9 X;  1G3S A;  3B6A A;  1J7K A;  2EB7 A;  2MLG A;  1VQ8 I;  1VIX A;  3OYK A;  1ELM P;  1CP6 A;  3F8M A;  2FBK A;  3ZMD A;  3H9J A;  2ADU A;  3W3C A;  1D1C A;  2E1O A;  4HG2 A;  1Z7L A;  4XR6 A;  2NVX J;  3FK6 A;  4KIS A;  4J3G A;  5B66 C;  2M3A A;  5J6X A;  8CPA A;  4P96 A;  2K9Q A;  1R6R A;  3VFZ A;  1U3E M;  3WTX C;  5HVF A;  5M3M J;  1YX3 A;  1ITY A;  2M9H A;  4HX4 A;  1S3Z A;  2CXA A;  3D7F A;  3SEZ A;  3H8G A;  3ZN0 A;  4G7H F;  1FSE A;  2B7E A;  2W4S A;  3I3L A;  3K2K A;  3MGD A;  4XLC A;  2ZW7 A;  4C2Z A;  5KTA A;  5HVH A;  3BR0 A;  5AIQ A;  1LDJ A;  5ILU A;  2DU9 A;  4MCS A;  4F9V A;  4L89 A;  3BQZ A;  2G0E A;  4L9T A;  5D4S A;  2O5R A;  2Y0S A;  1X1C A;  4BH9 A;  3LL7 A;  3CMM A;  2CQK A;  5HDK A;  5CLS A;  1B72 B;  4V2F A;  1GDT A;  2V8H A;  3N7Z A;  2ZXV A;  3R6S A;  1V55 H;  1D3Y A;  3DXJ F;  4ZYE A;  5F1R A;  4P4J A;  3UR3 C;  1W5T A;  2HWV A;  2PN6 A;  3FXJ A;  3GX4 X;  2WUU A;  5CYV A;  1CF7 A;  3FRM A;  3M1C A;  4L9J A;  1PUA A;  1GT0 C;  4BUP A;  3RDI A;  2VQC A;  2XEJ A;  2LYC A;  4MIM A;  4L0Z B;  5CPR B;  3ZMT A;  5GTH C;  3GME A;  2XKO A;  4WX9 A;  3MKZ A;  2JRM A;  2O8X A;  5LD2 C;  1CG2 A;  5EZH A;  3ERE D;  2PI0 A;  1VKC A;  1S29 A;  2XPU A;  5CVI A;  3S2W A;  3TOA A;  3BWG A;  3HXL A;  3LQQ A;  4HLX A;  4Y17 A;  1FYK A;  2K9M A;  1AYE A;  4NCZ A;  4CAX A;  1HXD A;  2EV6 A;  5LEJ A;  1LUJ B;  2A5W A;  3RZO J;  1FNO A;  5FLX Z;  3PL8 A;  3PGP A;  2KIS A;  3V7R A;  1UJ8 A;  3BQY A;  4A30 A;  3KP7 A;  3DBR B;  4UWJ A;  2FE3 A;  4WXC A;  1XFO A;  5F0F A;  5HOD A;  2VQG A;  1XEB A;  5K8O A;  1X4P A;  4X0G A;  3FX3 A;  4ESJ A;  3OYA A;  4A3L J;  2Y0M A;  3LST A;  2IGK A;  4HEA 2;  1OIS A;  3WC7 A;  2R4G A;  5M5Y J;  3BJ7 A;  3D67 A;  5CQG A;  4ZGY B;  2CF4 A;  2ICW G;  1L3L A;  3BJ8 A;  2EH3 A;  3CCS I;  4L0Y B;  3H0D A;  2PMU A;  2R7X A;  3E6B A;  2BSW A;  4A5N A;  5E8G A;  2NNY A;  1YRN A;  1YFH A;  3PB7 X;  5CPA A;  3GCM A;  4IHX A;  2Q7S A;  1QSO A;  1KQ0 A;  2BY3 A;  4OC2 A;  2BOL A;  2IS6 A;  5C3E J;  5H2F C;  2E5Z A;  3FNC A;  3OIP A;  1F57 A;  2V9P A;  5J47 A;  4B8X A;  4X2T A;  1V5G A;  2XEF A;  4BBH A;  2R93 J;  3CDL A;  1YIO A;  3ZMV A;  1IZ1 A;  1ZTR A;  2EVN A;  1VTN C;  1Q7L A;  1PJR A;  2VBZ A;  2F5D A;  5IT3 A;  2KMU A;  5J40 A;  1NSA A;  5I4M A;  4IRI A;  1OCC H;  1K61 A;  2D2W A;  1TWF J;  2HVR A;  3BR3 A;  4CUG A;  2DA4 A;  2VQY A;  2W84 A;  3K4N A;  2KZG A;  1WWZ A;  1Z8W A;  2H09 A;  4YEJ A;  3DSB A;  2YUS A;  1QPM A;  4GYG A;  3BR2 A;  2XPW A;  1WPK A;  3MVP A;  3FB3 A;  1ZAR A;  1B87 A;  1ETQ A;  2M8G X;  2Q51 A;  2BBY A;  3WTU C;  1M44 A;  3KP6 A;  3BDD A;  2XRN A;  4II2 A;  2KKO A;  3WGG A;  3D5L A;  2CV0 A;  3A4C A;  4TWE A;  3GTG J;  4ZJZ A;  1XJO A;  2LKP A;  1VQK I;  1D5V A;  3DU6 A;  3PNV A;  4FTH A;  2D5V A;  2JWT A;  4A3C J;  4MHG A;  1GUU A;  3CZX A;  5LHH A;  4AVC A;  3ABU A;  4KIG A;  1LFB A;  2BVL A;  2A6E F;  1YOV B;  5ICF A;  1E3P A;  2K3F A;  2L2O A;  1MBG A;  1D1A A;  2X85 A;  4HNY B;  3K0L A;  2IT0 A;  4F93 B;  3QAH A;  1LFP A;  3IHU A;  2GM4 A;  3S16 J;  3B8G A;  3OWC A;  5AG7 A;  2FOW A;  3S6G A;  5DD4 A;  3AFH A;  1YW4 A;  4ZBG A;  3F23 A;  5FRM A;  2P81 A;  2HC9 A;  4CYN A;  4BE1 A;  1T56 A;  2VBQ A;  5EYR A;  2V79 A;  4MCP A;  4IHM A;  1TIQ A;  2LLK A;  3A03 A;  1P7I A;  3LSJ A;  1U6M A;  4AIK A;  1ZGW A;  3S1R J;  1G3W A;  5DEQ A;  4AIH A;  2AQE A;  2XRL A;  1JE8 A;  1PYT B;  1I6X A;  2DLL A;  3PBE A;  3TO6 A;  4HRI A;  3HBL A;  1B4A A;  2PJ4 A;  2Q43 A;  3W2A A;  4HV6 A;  3ELK A;  4AUX A;  1IGB A;  2PX9 A;  3TDZ C;  4ZX9 A;  4XKC A;  3FH4 A;  2XVC A;  1YGH A;  1USS A;  4W97 A;  3FBU A;  3RAM A;  3PNY A;  5D5U B;  2R5Y A;  2HS5 A;  1QMU A;  3KHZ A;  1QZY A;  2CQN A;  2EJR A;  4M6X A;  3A01 B;  4LQ6 A;  2K27 A;  3PUF A;  4GGG A;  3SXN A;  1U5T C;  2JA5 J;  2G3A A;  4BHB A;  2QBY B;  2KRH A;  2HU9 A;  3GVA A;  1TKJ A;  1N75 A;  3CXQ A;  3E5X A;  4HKF A;  2REE A;  1STZ A;  2BXZ A;  3GTJ J;  4I99 C;  1TWH J;  2W85 A;  4QWQ A;  4J00 A;  4PK3 A;  4BQA A;  3CXP A;  4OIQ F;  1JT6 A;  1XBU A;  2G3T A;  1SAU A;  3HOW J;  1Z3X A;  4M3S A;  2FML A;  2EFN A;  1CBX A;  1NK3 P;  2W57 A;  3JRB A;  2XSJ C;  2MD5 A;  4UCN A;  3HOU J;  3ZQF A;  2ZXI A;  3KE2 A;  1ZO0 A;  2YS9 A;  2VBW A;  4KSI A;  5C4J J;  1VQO I;  3PQK A;  4MJ8 A;  4B5P A;  2ELJ A;  4NGS A;  1C0W A;  1P7J A;  1HDQ A;  4ZZD A;  3Q0U A;  5E3L A;  4PGG A;  5LFA A;  1YO5 C;  4R7M A;  5JHU A;  2HPI A;  3DWL E;  4XLP F;  3JRD A;  3RPU A;  1ON2 A;  2OJE D;  2IA1 A;  4GYI A;  2JBJ A;  4RN7 A;  2EWN A;  2EZL A;  2RNG A;  2O03 A;  4CAF A;  4CGP A;  2R7R A;  2ZJP F;  4B3A A;  2QM3 A;  4JXQ A;  4CGM A;  3BCA A;  2KZV A;  1PUF B;  4RS8 A;  3I5U A;  4AVB A;  1S8N A;  1LPQ A;  1YE9 A;  1XGO A;  3RKX A;  4M6G A;  1IOI A;  1HDU A;  3F5B A;  3L2C A;  1UEL B;  2OTL I;  3V8L A;  1BAV A;  4KIT B;  2HVS A;  1YW7 A;  4I2O A;  1IN6 A;  2LP0 A;  2CW7 A;  4RAG A;  1OCR H;  1BI2 A;  5ELY A;  1KU9 A;  1QNT A;  1FTZ A;  3AG3 H;  4XOT A;  1CGP A;  2STT A;  3AAF A;  2R8V A;  3GFM A;  1KU7 A;  2DMU A;  2JEV A;  2V9V A;  1IXC A;  4B4C A;  1FOY A;  2YR2 A;  4FD7 A;  4C2X A;  1T39 A;  1YVO A;  3RZA A;  3P2H A;  2JT1 A;  4R57 A;  4JLY A;  3KYD B;  1NSL A;  4ITV A;  2NOG A;  2EIJ H;  1TLH B;  2DN0 A;  4M3D A;  4E70 A;  2QYO A;  2EZH A;  3PUB A;  1RET A;  2M4K A;  5DD8 A;  3ZCO A;  3K70 D;  2D4O A;  2KCW A;  3HIF A;  5F09 A;  2ZXH A;  3KGQ A;  2LBF B;  1A04 A;  4KOV A;  1XGS A;  1ZG8 A;  4IUS A;  2R7D A;  1H89 C;  5HH1 A;  3CUQ A;  2BOA A;  2QCO A;  4MFD A;  2DFI A;  3TGN A;  1KUY A;  4FE7 A;  1BJZ A;  1FZP B;  2P7C B;  3NQO A;  2IJL A;  2VON A;  2YSR A;  2BGC A;  1IN5 A;  1SMT A;  1MBF A;  2HQR A;  7CPA A;  2V1D A;  4G7Z F;  3HOS A;  1ON0 A;  2X4H A;  2K9N A;  1IRF A;  4M9X A;  4CGZ A;  1BPN A;  4WCG A;  3FZV A;  1DP3 A;  1FY7 A;  4D7M A;  3FIX A;  3S14 J;  4M3B A;  4Y15 A;  3K4M A;  2QQ9 A;  2HZD A;  3ZMS A;  4EVI A;  1BL0 A;  1MND A;  3H36 A;  1Z6T A;  2FBH A;  3WE2 A;  2V6C A;  5D5V B;  1SFX A;  2G7U A;  2V8V A;  2QSF X;  1IC8 A;  2R0Q C;  4EGZ A;  1OYI A;  3VSK A;  5DS0 A;  1IXR C;  1XSV A;  1TW2 A;  3BRO A;  3RPQ A;  2PJR A;  2L7Z A;  4C2M J;  2B4D A;  4PZJ A;  2MH2 A;  2PJ0 A;  4U9Y A;  4F7Z A;  4DZP A;  3FF5 A;  4AVP A;  4DJA A;  3BT9 A;  5G20 A;  3BZC A;  4P9F A;  2B5G A;  3K69 A;  5IOZ A;  5DV5 A;  1FPQ A;  1ON1 A;  3GYA A;  4F0Y A;  1NTC A;  2MAB A;  3FXM A;  4KMU X;  5BMZ A;  2OD5 A;  3K6G A;  1SVM A;  2HQ5 A;  3CCY A;  3JCU C;  3K1P A;  3K9T A;  4I01 A;  4DYQ A;  4BBS J;  3BP8 A;  3V8K A;  4MTD A;  2VC1 A;  2WB1 A;  2FSR A;  2CH0 A;  4CAE A;  4M9Z A;  4OIN F;  5LRG A;  4XRS G;  1KYW A;  4HDV A;  2R7V A;  5K8N A;  1D1B A;  5CNP A;  2Z10 A;  1QZE A;  1S6L A;  4Y3O A;  5BNG A;  2WY7 Q;  5HDN A;  2Y75 A;  3ZP5 A;  4IAV A;  3FXR A;  4R79 A;  3OR2 C;  1SD5 A;  2TCT A;  5M3F J;  3PFE A;  2F8H A;  2QVO A;  2V1N A;  3M9A A;  5B1B H;  4FD5 A;  5H84 A;  2VEZ A;  1F43 A;  2YU9 J;  2RGV A;  2H6B A;  4NB5 A;  2P6E A;  4BEH B;  2KHM A;  4UVB A;  4B11 A;  4PJM A;  5HNH A;  3CJQ B;  1FT7 A;  1R7J A;  1O7F A;  3D2P A;  1SFU A;  3SJX A;  3PM1 A;  2Q0O A;  4LD5 A;  1IOF A;  5LHI A;  4A39 A;  2M1B A;  4A0X A;  3DKY A;  4PGH A;  3D3S A;  2LKX A;  3E3V A;  2DTR A;  3RNZ A;  3ZQC A;  3PB6 X;  2OZH A;  1VQP I;  3M8J A;  4LFU A;  4B10 A;  3VOE A;  1JKQ C;  4KJZ A;  3T8R A;  2QYV A;  2RRE A;  2DQL A;  5JHF A;  1MJ9 A;  5F04 A;  3I4N J;  2DF5 A;  4TV7 A;  3CP2 A;  1Y7E A;  4Z2Y A;  2ZEG A;  1FC3 A;  1POG A;  1R23 A;  4RLF A;  1XD7 A;  2I10 A;  4HNU A;  2JA6 J;  3KEY A;  2Q4Z A;  2DPT A;  5DUK A;  4Z65 A;  2HYF A;  1RRJ A;  4ZH4 F;  1HW5 A;  4BBR J;  1J2X A;  1IN4 A;  2VPL A;  3CMA I;  2FF4 A;  1U9N A;  3EPZ A;  2LH9 A;  2XGE A;  2ZME B;  4R8F A;  2BVM A;  3H92 A;  3SI0 A;  1B8I A;  4LIT A;  3VH9 A;  2E71 A;  3IAM 2;  3D5R C;  3BG6 A;  3R9F A;  2DOA A;  1YLE A;  3KP5 A;  4ETS A;  4BAY A;  2R7T A;  2COM A;  2PCU A;  3DTE A;  3QOP A;  5GAG J;  3D1N I;  2QQA A;  2PJC A;  2DXI A;  4XLH A;  3E0K A;  4OIW A;  2HTS A;  3LNQ A;  1KU2 A;  3DTI A;  3QU6 A;  4EJU A;  3H9G A;  4N0B A;  1U0J A;  3T90 A;  2Q2E A;  2P5L C;  5EDN A;  4G9Y A;  2D4P A;  2M4G A;  3TP0 A;  3RZD J;  1DDN A;  3S9M A;  1UST A;  2E7X A;  4WF2 A;  4XK4 A;  1GVJ A;  2Y2Z A;  5EZG A;  2PJ5 A;  1QQ9 A;  3ZR8 X;  1Y1V J;  4BDY A;  2JEW A;  3HL2 A;  4A94 A;  3FXO A;  1KQ8 A;  1K79 A;  2ZC2 A;  2PMZ N;  3U9G A;  4F3Q A;  4XPD C;  1DE4 C;  3WR7 A;  5BS6 A;  1BIA A;  3V7C A;  2V26 A;  2JLM A;  3BZK A;  3FVL A;  1ETV A;  5J1Y A;  4KYW A;  1W0T A;  1TWG J;  5E17 F;  4KOW A;  1U6G A;  1W36 C;  2HYG D;  3VWB A;  2R1I A;  2IP2 A;  5ED4 A;  2E2H J;  3HOZ J;  4CYD A;  2BZT A;  4BU2 A;  1R9T J;  2NS7 A;  3B2Y A;  3FF3 A;  3KYC B;  3E1S A;  3MAJ A;  1M4I A;  3PFI A;  5D8L B;  4ZYD A;  2G9D A;  4OC1 A;  3SXO A;  1TZL A;  2H94 A;  2OBP A;  3HHG A;  1KON A;  2DJN A;  1WVR A;  3DPT A;  1F5T A;  3IJ3 A;  4XNH C;  1ZGA A;  2IS1 A;  1MK4 A;  1TF9 A;  5LYL A;  2QA4 I;  3DFG A;  1TTY A;  3KZZ A;  1KZH A;  1X58 A;  2EBJ A;  2RN7 A;  4M73 A;  2IGM A;  4Q5S F;  2VJJ A;  2Z2S B;  5DTD A;  2Y9Y A;  5FFX A;  4XOR A;  3S32 A;  1T08 B;  4X6A J;  1ULY A;  2KIU A;  4XSZ F;  4X5K A;  1I1S A;  5GPA A;  3GTP J;  3QOE A;  1X1A A;  2LDU A;  5B3S H;  1BA5 A;  1B9M A;  4FET A;  3C3W A;  1JI8 A;  1YYV A;  2X51 A;  4LG0 B;  2XAH A;  5BOX A;  4NC7 A;  2XRO A;  1UG2 A;  2KDO A;  1MZB A;  4A6E A;  1A5J A;  1X2M A;  4CYC B;  3ZQQ A;  4KVX A;  4FX4 A;  2RFH A;  4PV6 A;  1R1U A;  1XGM A;  5ERI A;  3T0Y A;  3DNS A;  4PUS A;  5LEK A;  4BXU A;  3ZMZ A;  4JD6 A;  4GXO A;  5H6R A;  4YWY A;  2C27 A;  4MQ9 F;  2H1L A;  3CME I;  2P4W A;  3HOT A;  1JHF A;  1JUP A;  2CW8 A;  3NE8 A;  1UZC A;  2EIK H;  1K78 B;  1F1Z A;  3EO4 A;  2BEI A;  4OWR B;  1Z1D A;  1D5Y A;  2ECC A;  5F6F A;  1KYZ A;  2L7M P;  2R3S A;  2VXD A;  3OL4 A;  3QU3 A;  4HST A;  4RM3 A;  3U21 A;  3I4M J;  4OC5 A;  5EG0 B;  4NGP A;  4UB6 C;  5LLQ A;  3LSI A;  3WU2 C;  3FXT A;  4KOY A;  1B72 A;  4JYW A;  1R3N A;  3JRH A;  3WC6 A;  1MIJ A;  1OCT C;  4NFR A;  2YU3 A;  3ABL H;  1MMA A;  2NVT J;  3CJT B;  1QPI A;  3ESW B;  4XL9 A;  1CPS A;  1Z8L A;  3RJP A;  5AG4 A;  2VL8 A;  4IQJ A;  5K7H A;  3ABM H;  1XMA A;  3L7W A;  3V38 A;  2MSY A;  3OS2 A;  4BJ5 C;  2FA5 A;  2M8E A;  4CIC A;  1VF9 A;  3SI2 A;  3PQJ A;  5GP9 A;  3LSH A;  1APL C;  2BW3 B;  2V1X A;  3SXY A;  2V9K A;  2KJC A;  3ASO H;  3ZRG A;  4M6I A;  3T8W A;  5J1Q A;  4U0W A;  3OYC A;  3CPA A;  1F2P A;  1YJW I;  2BO9 A;  3BG9 A;  1RUO A;  2FSW A;  3IKV A;  2CQ7 A;  3HYI A;  2L7F P;  3NA6 A;  3BOQ A;  4R6T A;  2Q4V A;  2M7B A;  1VI0 A;  4UBR A;  3PO2 J;  1BO4 A;  1M4L A;  5IYD J;  4P4I A;  4M3F A;  3OL3 A;  1FBQ A;  1LE8 B;  5F64 A;  1ZG9 A;  2RVC A;  3IKT A;  1XMT A;  1YK3 A;  3H3V K;  2YX7 A;  3ULQ B;  2HUZ A;  2QKM B;  2WWY A;  2L9R A;  3S3N A;  4ON0 A;  1FBU A;  1QU3 A;  5HLG A;  5FVJ A;  1KWM A;  1QVU A;  2A6H F;  1BI3 A;  2F7V A;  4KZT A;  2CQX A;  3CCR I;  2K9S A;  4RS2 A;  2QKL B;  1K4S A;  1FOW A;  5KAI C;  2PJB A;  2A61 A;  2QEC A;  4RB0 A;  5F0C A;  4PFP A;  3PBB A;  3BLN A;  3D7H A;  1XE4 A;  5IYC J;  2MW8 A;  2LY1 A;  2DJI A;  2DFH A;  3SZT A;  4UFX A;  4OME A;  3FKI J;  2EV0 A;  4BDZ A;  3GTM J;  4CCL A;  1K4T A;  1G8X A;  3LFU A;  4KUA A;  1TBX A;  5CVV A;  1JGG A;  1BIB A;  3ONQ A;  3X2Q H;  3CO7 C;  4RI1 A;  3MKW B;  4BHC A;  3IC7 A;  4GDF A;  1LEB A;  1G6N A;  1B1B A;  2MA3 A;  2ZXW H;  3E5U A;  3K4C A;  2DA6 A;  3G3Z A;  4OID A;  2CJJ A;  3DKX A;  2JSC A;  1IU8 A;  2POK A;  4A3E J;  3FMC A;  1IW7 F;  3S15 J;  1WH7 A;  5FB2 A;  4L5E A;  2VE9 A;  3BHX A;  4NJR A;  4C7H A;  4EM2 A;  1N25 A;  4CRY B;  4CGL A;  3E5Q A;  2DAO A;  5IT9 Z;  4C3H J;  1JJ8 C;  3I3G A;  2VZZ A;  5F48 A;  1BPM A;  3FEC A;  4HNW B;  3DP7 A;  3DCF A;  2F48 A;  2M0C A;  2R7F A;  4G6Q A;  2MYS A;  3ERM A;  1OR7 A;  4CAV A;  4P6Y A;  4A2Z A;  1OLT A;  2MGQ A;  3GLX A;  4MFE A;  2XAU A;  2ZJ2 A;  4EV0 A;  5D4R A;  1IGN A;  1GHC A;  1P0H A;  3W6X A;  3IU1 A;  2HYJ A;  2XIG A;  2E1N A;  3BTI A;  4H6Z A;  3KZI C;  2JTV A;  3JTK A;  2DYS H;  1LCP A;  5CVR A;  2LR8 A;  3H4Q A;  5BWA B;  1A6Q A;  2JA2 A;  2Z99 A;  3FMS A;  3HKZ N;  4S05 A;  3IAS 2;  3MEX A;  2QJ8 A;  3IEH A;  3SZP A;  3L2N A;  3MMY B;  3IWE A;  4FWU A;  3H8F A;  2EUI A;  3GY9 A;  4D5C A;  1G59 A;  2HTJ A;  1M4G A;  3GB0 A;  2VC0 A;  2K4J A;  4TNU A;  4B13 A;  3J81 Z;  2OH1 A;  4UFW A;  3TDU C;  2JBK A;  3HC7 A;  2H5M A;  1JKO C;  2R7Z J;  3MCZ A;  4A3M J;  4UEZ A;  4R3L A;  5LYI A;  2XGD A;  1VQ5 I;  2DPD A;  1UAA A;  5THW A;  3DEE A;  2VB6 A;  4ZX8 A;  1SFO J;  3SDG A;  3H3U A;  4IHT A;  5C88 A;  1FP2 A;  2A3S A;  4LK0 F;  4ZDO A;  1MMD A;  1MNE A;  1QSM A;  1Z67 A;  4EEF G;  4EJV A;  4ENN A;  3TOB A;  5M5X J;  3SQN A;  1YW8 A;  3JRU A;  3B3T A;  2QLZ A;  4QTR A;  5DM7 F;  4BY1 J;  2OQR A;  2D45 A;  3GXO A;  1PP8 F;  4JX6 A;  2FVG A;  4A37 A;  2DT7 B;  2AFU A;  5C44 J;  3CUO A;  3BG5 A;  3T1B A;  1IAW A;  5EF6 A;  5CVU A;  5JVG F;  1EKE A;  3J80 Z;  2Q7B A;  2BEO A;  2EA2 A;  5JFR A;  4G8X A;  2CNS A;  2E7W A;  3A01 A;  3B6C A;  3DR8 A;  1H8L A;  4JQF A;  1QRY A;  1V4R A;  3TKY A;  2QBY A;  3CC4 I;  4MHY A;  4Y52 J;  5FLX K;  4JJX A;  1XGN A;  3GF2 A;  4G12 A;  2PBI A;  3K2A A;  2HKO A;  3ZQ7 A;  2QVP A;  3L2R A;  3C26 A;  1Y8Q B;  1FTT A;  2HDC A;  3HUV A;  4M6H A;  3W6S A;  4FIS A;  1OCZ H;  1S5K A;  3HRT A;  1MJB A;  2Q0Y A;  4PQA A;  1QVT A;  2LC2 A;  4N4O B;  5LGU A;  2HOS A;  2EWB A;  2OF7 A;  3F21 A;  1O3S A;  2JA7 J;  1JUM A;  2F5C A;  3WTW C;  1H0M A;  2Q44 A;  4AYB N;  2Y30 A;  3FXU A;  3SFI A;  1IYK A;  5AIP A;  1L0O C;  3TC8 A;  3CDX A;  2I00 A;  1MBJ A;  3H35 A;  5B5E C;  1MH4 A;  2NXN B;  3B02 A;  2Z9O A;  1OCP A;  3FX6 A;  3V8I A;  4K3N A;  3HEF A;  1TKF A;  1EE3 P;  5HS8 A;  2XC7 A;  2ZNZ A;  2C6C A;  4UCP A;  5C4X J;  5ILS A;  3QNV A;  3TE4 A;  2IS4 A;  1TNT A;  4MFQ A;  1WFX A;  5FO5 A;  1WRJ A;  2BL1 A;  4HF2 A;  1WQ2 A;  2J9A A;  5DWN A;  2OCE A;  1PUF A;  4CCJ A;  3DLA A;  1Z77 A;  3KP3 A;  3PFO A;  2XAJ A;  4WXH A;  2B9S A;  1T95 A;  4L5J A;  4LMY A;  4U0V A;  2VOD A;  1ZLI A;  3CP8 A;  3HRS A;  4D0P A;  2LY9 A;  2LTP A;  4OLL A;  1SFE A;  3HZJ A;  1ZRE A;  1EH8 A;  1X19 A;  4RB3 C;  2ZW5 A;  1ETO A;  1LKX A;  4BIN A;  4KOR A;  2WAQ N;  2EFP A;  2VJ4 A;  2DOD A;  4B47 A;  3GZ6 A;  5FRN A;  1ZG1 A;  2M30 A;  4I0A A;  4KIF A;  4KOT A;  2DPS A;  2IA0 A;  4FHT A;  2OZU A;  3Q0V A;  1P4X A;  1YI2 I;  2J8N A;  5D29 A;  5E1W A;  3TW7 A;  3GLL A;  5E79 C;  2Y9Z A;  4A3G J;  1I12 A;  1M4D A;  2WAE A;  1QSR A;  1X1P A;  3A2K A;  3PB8 X;  4E7Z A;  3GZ5 A;  4BAC A;  1YLF A;  2KRC A;  2LOO A;  4CDG A;  3TQN A;  4MEX F;  2HV2 A;  1S3J A;  4B5O A;  5J1R A;  3OYG A;  2EIM H;  3VYT B;  2ISY A;  3K7A J;  5FKL A;  3WOD F;  5JPH A;  2LBF A;  2FE7 A;  1D0Y A;  4XPD B;  3KLO A;  2CSO A;  4A12 A;  3ABK H;  4CZC A;  5KNL A;  5GPC A;  1ZQ3 P;  4NGR A;  4RAZ A;  4FAI A;  1ZG3 A;  3CC2 I;  3OSG A;  1MSF C;  2DMN A;  1O3T A;  1E3H A;  5I0C A;  1P9Q C;  4R1H A;  3SEQ A;  3F8F A;  4UV9 A;  2FJ1 A;  1FX7 A;  2MC4 A;  5LYD A;  3LA3 A;  3AG2 H;  3VEP A;  2XAG A;  4P10 A;  1Z9C A;  2ANP A;  3BJO A;  3F3X A;  3T9Y A;  2VAS A;  2FRH A;  1REP C;  3D2M A;  2CRG A;  1YW6 A;  4E8O A;  1KGS A;  2ZBK A;  3IC1 A;  1KZF A;  3IV5 A;  2XUB A;  4KT6 A;  3F0C A;  1U78 A;  3VSL A;  2YNE A;  2F5I A;  3CJR B;  4X3R A;  4M3E A;  2XV4 S;  4GO1 A;  1IXS B;  1JHH A;  1LOK A;  3OOP A;  1VQ4 I;  1S7K A;  2GE3 A;  2CMP A;  4FD6 A;  3K1N A;  1JXS A;  4I76 A;  1SMY F;  4JYK A;  4A3K J;  2HI3 A;  3EQL F;  2NYX A;  1S5L C;  4OMY A;  4D9J A;  4XKV A;  3VYR B;  4MGR A;  3CCL I;  5D6F A;  3BC8 A;  3ZQI A;  3KYL A;  2R7Q A;  4KSF A;  2IRF G;  4A6D A;  5ICG A;  2FU4 A;  1XN7 A;  4I98 B;  4RGX A;  1Y9K A;  1CP7 A;  2IL4 A;  1LB2 A;  3K4J A;  4S04 A;  1FSH A;  1HW1 A;  2PJ3 A;  2DT6 A;  1LDK B;  1K6Y A;  1Z5R A;  3S6K A;  1BR2 A;  4RDU A;  2CNM A;  4KT5 C;  4PJL A;  2CYY A;  5E8I A;  2ZFW A;  4P4D A;  3DV8 A;  4MFZ A;  4E0A A;  3LAP A;  1I3Q J;  4IK2 A;  1RNL A;  2OCC H;  2YX4 A;  1P2F A;  3GEZ A;  3WGI A;  4XKW A;  4Q4Z F;  3BPV A;  3OYB A;  5LBQ A;  1TWC J;  1VFC A;  4HW0 A;  1DUX C;  4R9M A;  3RYP A;  2ELK A;  2I5U A;  2VE8 A;  1UHS A;  2LY2 A;  2QF7 A;  3W2W A;  1V54 H;  3OSF A;  3GKR A;  2WYR A;  4IF4 A;  2PJ7 A;  3BXM A;  2BV6 A;  3K4B A;  4BEH A;  4FBE A;  3ISZ A;  3WAB A;  4HV5 A;  4F52 A;  2FCK A;  3M07 A;  2VJI A;  3NAU A;  2C6Y A;  1Y39 A;  2ECB A;  3DGV A;  2Q04 A;  4CO8 A;  2PFB A;  3TL4 X;  5JR3 A;  1IUF A;  4ASN A;  4YFK F;  2O6G E;  3QB8 A;  4C7I A;  2HQA A;  4X1E A;  3HJE A;  1GHE A;  4ABZ A;  2JUC A;  1R5H A;  4C2Y A;  5CQE A;  2RB7 A;  3B3C A;  4AG7 A;  4ENJ A;  5J3L A;  4IVN A;  3TO9 A;  2BYV E;  4XRS A;  2CNT A;  4NQW B;  3RI4 A;  3I9V 2;  1EV7 A;  3Q9V A;  1RI7 A;  2P6S A;  1Y7R A;  4OAD A;  2PVW A;  4PSW A;  4WJB A;  1GXP A;  2DTZ A;  4LIU A;  4E7J A;  2EK5 A;  2X0L A;  3IL2 A;  1BBY A;  2IMO A;  3L2V A;  1E2X A;  1I1G A;  3MD2 A;  3B35 A;  4Q7A A;  3IRR A;  2JK3 A;  4B1R A;  1YJ9 I;  3D7D A;  4BJ6 C;  1YG2 A;  1XMB A;  5GAD J;  1FMW A;  1YSJ A;  3BG7 A;  2B0L A;  5KVR A;  9ANT A;  1GYT A;  4A3D J;  5G22 A;  1VQM I;  3CPX A;  3SDB A;  2ZME A;  4BD9 A;  4KIC A;  5E18 F;  4EAT A;  1W36 D;  2PVV A;  1MDM B;  3MRU A;  5GCN A;  1K6O A;  4KIB A;  2Z5U A;  2M87 A;  4B44 A;  2FNP A;  4MCR A;  1WJF A;  4ESF A;  1U5T B;  4OC3 A;  4WWC A;  3PIP F;  3BJ6 A;  4HX7 A;  4YEL A;  1V5F A;  3JW4 A;  4M6V A;  1ZH5 A;  1QBJ A;  3DU5 A;  2IXS A;  4RM2 A;  1FNN A;  2PG4 A;  4KDP A;  3PRT A;  2LMD A;  3CLO A;  2CUF A;  3F72 A;  3BZ6 A;  3GO5 A;  3OS0 A;  2PE3 A;  2PR1 A;  2A05 A;  2DMQ A;  2B3V A;  3TX8 A;  3M8E A;  1LAN A;  2F4O B;  2L02 A;  2WV0 A;  3QP6 A;  1DP7 P;  2DDA A;  4II3 A;  2RAE A;  4YU9 A;  1K83 J;  3KX2 A;  1MNM C;  1YIT I;  4JOM A;  1QA6 A;  5F1J A;  2LKS A;  3CDI A;  3BCB A;  4ZY0 A;  2DBB A;  3B73 A;  2LRE A;  1IV8 A;  4EM1 A;  5FRO A;  1ERD A;  3KKW A;  2FMY A;  3MN2 A;  2KDZ A;  4XSX F;  4BXX J;  2BY1 A;  3ROU A;  1EF4 A;  2DA7 A;  3LAJ A;  2BHY A;  1M1D A;  1YR0 A;  1F2O A;  2XDV A;  4NJQ A;  2NVY J;  1MH3 A;  1P4A A;  4KMF A;  2DA2 A;  1B59 A;  3A9L A;  4CGN A;  3OV8 A;  4Q48 A;  2YNC A;  4M85 A;  1FLI A;  4CYQ A;  3LQR A;  4AVA A;  4NF1 A;  1JJ6 C;  2KFD A;  2ZED A;  4MHD A;  2CGP A;  1ZLJ A;  3CTA A;  3KET A;  4XBF A;  3ZQH A;  2HB6 A;  4HPS A;  1Z6R A;  4L8A A;  3EUK L;  3AL0 C;  4C2T A;  3W6K B;  2YPR A;  3H5A A;  4MXU A;  1ETK A;  2Y0S N;  1BW5 A;  2KL4 A;  2MG4 A;  3BTL A;  4CHU A;  1TW3 A;  1SAN A;  1U9O A;  2FNA A;  3O6B B;  1Q2C A;  4MY3 A;  3CD6 I;  4HX8 A;  4DBR A;  4UEE A;  2CIJ A;  1IY7 A;  3GTK J;  3HGY A;  4LG0 A;  4Y7N J;  2PJ1 A;  2HGC A;  4A0Z A;  4LLN A;  1S7N A;  5CKT A;  2BHZ A;  4CYC A;  4ZYG A;  1DGW Y;  1RZ4 A;  2OUM A;  5JLX A;  3N4M A;  1ONV A;  1OYW A;  1R22 A;  4NGT A;  1XCV A;  1ZN2 A;  1LQ1 A;  2LG4 A;  3TED A;  3ZPL A;  3QYE A;  4LB6 B;  4B3X A;  2FL4 A;  5FGM A;  3D0S A;  1GV2 A;  1FMV A;  2K7L A;  3CUQ C;  1B6A A;  3TMO A;  4NSQ A;  5EC4 A;  4EFD A;  2UZK A;  4BQQ A;  2WAD A;  3ISX A;  3CF2 A;  2A6T A;  5L3C A;  1K78 A;  1FYL A;  1XG1 A;  4JX5 A;  1FOK A;  1LFW A;  3TT2 A;  3WT4 A;  1QZZ A;  4QBJ A;  4YFN F;  3FDY A;  3CF5 F;  3BJA A;  1HKT A;  1PYV A;  1VND A;  3TCV A;  4OOI A;  4ESB A;  5HS7 A;  4QSH A;  3FEE A;  5F27 A;  2P5K A;  2Y48 A;  5EG0 A;  1TC3 C;  5E1X A;  2MBF A;  5IYB J;  3BI0 A;  1KU3 A;  2FUG 2;  2NAZ A;  4MFK A;  3FXK A;  3K10 A;  2Z33 A;  1U8B A;  3LWF A;  1MD0 A;  3JRI A;  3HOV J;  2G9W A;  2HQN A;  3DTK A;  2CQQ A;  4IEJ A;  4QPQ A;  3GUX A;  1D8J A;  2CW0 F;  1YLO A;  4K30 A;  1XTA A;  1O7L A;  3I0T A;  3JSO A;  3TP3 A;  4BMH A;  2DCE A;  3QRF F;  3JRC A;  2OOT A;  1WJA A;  1ZR2 A;  2BW3 A;  5DS9 A;  1UG0 A;  1DQU A;  4UUV A;  1R57 A;  3DBL B;  1YQE A;  4JK1 X;  4IL6 C;  2QEX I;  2E1M B;  1ZR4 A;  3HSE A;  4DOZ A;  4KOU A;  2GLF A;  5J4V A;  2DK5 A;  5LRK A;  4B43 A;  4QUS A;  2YNC C;  4HBL A;  2VLA A;  3V8J A;  3FXL A;  1LE8 A;  1A36 A;  2H27 A;  3ZN1 A;  2P6F A;  4MBU A;  2BXY A;  4G1P A;  1BR4 A;  3JRG A;  3P2F A;  4KLV A;  2HXI A;  4FD4 A;  3KEQ A;  4ZYH A;  2AFW A;  4OMZ A;  5J8C A;  4PXB A;  1J09 A;  2E35 A;  1ELL P;  1XRY A;  1XPX A;  1OMI A;  2EBI A;  1J4J A;  4FUU A;  3O8H A;  2QQ8 A;  3OYM A;  3S1N J;  2ZPA A; 
#chains in the Genus database with same CATH homology
 2LY1 A;  2FS5 A;  4BBH A;  2KPM A;  2DJI A;  4BJT A;  2EVN A;  1I1D A;  1OZP A;  3VYS B;  4UFX A;  4BDZ A;  4CCL A;  1G8X A;  1PJR A;  3LFU A;  4BE0 A;  2KMU A;  2Z3O A;  3DDD A;  4H89 A;  3H5N A;  4KUA A;  3ONQ A;  2P6G A;  2E5N A;  4RI1 A;  3PSF A;  4EVY A;  3MKW B;  2X6X A;  3UNG C;  3DPU A;  2HVR A;  4YGO A;  4CUG A;  2FT0 A;  2VQY A;  1WWZ A;  3K4N A;  4XLA A;  3ZXS A;  2ARH A;  3DSB A;  2KP6 A;  3K4C A;  4YEJ A;  4AU7 A;  4E6K G;  3PP9 A;  4OAE A;  4KLW A;  3DKX A;  2L5Q A;  3FB3 A;  2V6E A;  3SZG A;  3CZ6 A;  4H4K C;  1B87 A;  2WPX A;  3IGR A;  5ISV A;  2XF7 A;  3K9U A;  4KVO E;  3TTH A;  2R7O A;  1IIC A;  4C7H A;  3IWG A;  3ZJ0 A;  1M44 A;  4CRY B;  3RTR A;  4CGL A;  4II2 A;  4BGD A;  2VJ5 A;  3D5L A;  4C9Y A;  1L0C A;  2CV0 A;  3A4C A;  1RXT A;  2VZZ A;  3I3G A;  4ZJZ A;  5F48 A;  3JVN A;  4HNW B;  3DU6 A;  3PNV A;  3I9S A;  2MYS A;  3PJR A;  3W2V A;  2CV1 A;  3PZJ A;  1Z3Y A;  4CAV A;  2WY8 Q;  4A2Z A;  1OLT A;  3S3O A;  4ZYA A;  4AVC A;  2XAU A;  4XOP A;  3W6X A;  1P0H A;  2BVL A;  3IU1 A;  4KOS A;  2L2O A;  2X85 A;  3PSI A;  4H6Z A;  1D1A A;  4F55 A;  4HNY B;  4II9 A;  3OWT A;  4F93 B;  2GIV A;  1LFP A;  3LMM A;  5KHD A;  1IRX A;  3OYE A;  3B8G A;  3JTK A;  3OWC A;  3QAH A;  5AG7 A;  5G1Z A;  3AFH A;  3C2G A;  3ZGK A;  4ZBG A;  5FRM A;  3K4L A;  3H4Q A;  5BWA B;  2JA2 A;  3DR6 A;  4BE1 A;  4E7H A;  3IAS 2;  4CYN A;  2VBQ A;  5F47 A;  1NE9 A;  2LRD A;  2VZY A;  3MMY B;  3BLY A;  3IWE A;  1V0C A;  4NEX A;  2EUI A;  3GY9 A;  4D1Q A;  1G59 A;  2GOM A;  1M4G A;  2IS2 A;  1TIQ A;  1U6M A;  3V42 A;  3L2U A;  2MFZ A;  4AG9 A;  4B13 A;  2OH1 A;  1Y9W A;  4UFW A;  2AQE A;  3K70 C;  3HC7 A;  2H5M A;  2I79 A;  3EC4 A;  4R3L A;  1PU9 A;  2R98 A;  2CV2 A;  1UAA A;  3DEE A;  2VB6 A;  2KQR A;  4HRI A;  2JVH A;  3IU2 A;  4H6U A;  3W2A A;  1NG6 A;  3DQV C;  5A27 A;  2HPM A;  5C88 A;  3G3S A;  1SFK A;  2E1M C;  2M7A A;  3S8P A;  4KOX A;  3HKZ A;  1MMD A;  1MNE A;  4XKC A;  4ZDO A;  1QSM A;  3EXN A;  1MMG A;  3TOB A;  1YGH A;  3FBU A;  2GOX B;  2X6W A;  2O28 A;  3G8W A;  3PNY A;  1Y56 A;  1Q2Y A;  2YGW A;  1MMN A;  3OYN A;  2CS3 A;  4BE2 A;  4RLQ A;  4CAW A;  4BL0 B;  4IKF A;  2DT7 B;  2Z16 A;  4ZC3 A;  2JDD A;  3S6G A;  2Q4Y A;  3R9E A;  3SXN A;  2A4N A;  2G3A A;  2Q7B A;  2KRH A;  2HU9 A;  1N75 A;  4AVZ A;  2CNS A;  3CXQ A;  3DR8 A;  4XLF A;  4MLO A;  4JQF A;  2FIA A;  4HKF A;  2REE A;  2Z11 A;  5KCM A;  4JJX A;  5G21 A;  1QST A;  1WJ5 A;  2DXQ A;  1EA3 A;  2XF5 A;  3DPL C;  4J00 A;  4PK3 A;  2WBM A;  2G3T A;  3CXP A;  4XN0 A;  1SAU A;  3L2R A;  3FHN A;  1Z3X A;  1S60 A;  3C26 A;  4JXR A;  4M3S A;  2Q0Y A;  4PK2 A;  1S5K A;  1MJB A;  1VHS A;  2XSJ C;  1N77 A;  4B5P B;  4XON A;  2LC2 A;  4UCN A;  2HNH A;  3IP4 B;  4N4O B;  2ZXI A;  1ZO0 A;  2Q44 A;  4OAZ A;  4MJ8 A;  2ELJ A;  4B5P A;  1IYK A;  2CUJ A;  1LVK A;  2I00 A;  3SHP A;  3QYF A;  3H35 A;  3W6S A;  5HMN A;  5LFA A;  2HPI A;  1AA7 A;  1D0X A;  3DWL E;  4HNX B;  3V8I A;  3RQ4 A;  2BUE A;  4XNH B;  4CAF A;  2RNG A;  4CGP A;  2K9L A;  3OS1 A;  2R7R A;  2XC7 A;  3OYL A;  3TBI A;  1UFH A;  3F0A A;  5H86 A;  4JXQ A;  4UCP A;  4CGM A;  3BCA A;  4UFV A;  2KZV A;  3NWT A;  4ANJ A;  4AVB A;  5HLT A;  3TE4 A;  2IS4 A;  5AG5 A;  4E2A A;  4MFQ A;  1YE9 A;  2I8D A;  1WFX A;  4CGO A;  4F6A A;  4DIQ A;  3AL0 B;  2BL1 A;  5DWN A;  3F5B A;  3TO6 A;  1UEL B;  4AYB A;  4CCJ A;  3DLA A;  2W1O A;  4F0X A;  4R3K A;  4E7L A;  3AKZ A;  1T95 A;  4KIT B;  4DNC A;  2HVS A;  3OYH A;  4F91 B;  2JUG A;  3CP8 A;  4PJJ A;  4OLL A;  2WPW A;  2CW7 A;  2XF6 A;  3L2W A;  2ZW5 A;  1X19 A;  1LKX A;  3IUO A;  4XOT A;  3OY9 A;  2GAN A;  4KOR A;  2R8V A;  2VJ4 A;  4B47 A;  5FRN A;  2JEV A;  3PFY A;  1N71 A;  2JVG A;  4KOT A;  3TO7 A;  4NUB A;  4LUA A;  2DPS A;  4FD7 A;  4C2X A;  1YVO A;  2E60 A;  2OZU A;  4CCN A;  2PC1 A;  2J8N A;  4R57 A;  3QOD A;  4CYO A;  4JLY A;  3R9G A;  1NSL A;  4CH7 A;  4ITV A;  5IB0 A;  1M4D A;  3R95 A;  1I12 A;  2WAE A;  3FYN A;  2PQ8 A;  1QSR A;  4CA0 A;  3A2K A;  3PUB A;  3K70 D;  2M4K A;  3ZCO A;  4E7Z A;  2D4O A;  2KCW A;  2VQL A;  2K3P A;  4BAC A;  2KRC A;  2LOO A;  2ZXH A;  2HV2 A;  4B5O A;  2VXZ A;  3S93 A;  3OR1 C;  2OC6 A;  2LBF B;  4KOV A;  3OYG A;  4IUS A;  1E0E A;  3VYT B;  5HH1 A;  2WAQ A;  3N05 A;  4IF5 A;  3UY5 A;  1KUY A;  1T0F C;  2X1E A;  5JPH A;  4YFJ A;  2CFO A;  4XPK A;  2LBF A;  1YX5 A;  1D0Y A;  2FE7 A;  4XPD B;  1BOB A;  4CZC A;  2WAF A;  5KNL A;  3J7A Y;  3MKY B;  3HOS A;  1ON0 A;  2Z3L A;  3EFA A;  4ZTF A;  1Q2D A;  3SYT A;  5I0C A;  2X6Y A;  1P9Q C;  3SEQ A;  2R7S A;  1DP3 A;  1S7L A;  2MC4 A;  1FY7 A;  4PFO A;  3FIX A;  2IGN A;  1WJE A;  2VKH A;  4Y4R A;  4B11 A;  2VQH A;  2UV1 A;  3CES A;  4A33 A;  1CJW A;  3K4M A;  2Z3K A;  2HZD A;  3T9Y A;  2VAS A;  1MND A;  2PJR B;  2B4D B;  3D2M A;  5E96 A;  3TFY A;  5AG6 A;  4E8O A;  4C2U A;  1KZF A;  4KT6 A;  3S6F A;  3VSK A;  3RYO A;  3VSL A;  2YNE A;  2PJR A;  2B4D A;  4U9Y A;  3VDX A;  2B5G B;  3CJR B;  2F5I A;  2ZFU A;  4DJA A;  4HSR A;  5G20 A;  1S7K A;  4F92 B;  2AJ6 A;  4Y49 B;  2GE3 A;  4YRH A;  1WJC A;  2CMP A;  2Z1D A;  4FD6 A;  5HVQ C;  2B5G A;  4E4H A;  4CSW A;  2R7U A;  4D9J A;  4XKV A;  3OIQ A;  3GYA A;  3VYR B;  4F0Y A;  2MAB A;  3K6G A;  4MFP A;  1IYL A;  1MJA A;  3BC8 A;  3KYL A;  2QIR A;  2R7Q A;  4KSF A;  1XIX A;  4R87 A;  2W7N A;  2WB1 A;  2FSR A;  2CH0 A;  2JSP A;  4CAE A;  2MD0 A;  5AGE A;  1S9H A;  4ZTJ A;  2R7V A;  1Y9K A;  2IL4 A;  1D1B A;  2FIW A;  2OV7 A;  3K4J A;  2PRB A;  5CNP A;  2DT6 A;  2Z10 A;  2AQF A;  3LSG A;  4Y3O A;  2WY7 Q;  1LDK B;  1K6Y A;  4MY0 A;  3S6K A;  4J01 A;  1BR2 A;  2W00 A;  5KTC A;  4R79 A;  2CNM A;  3OR2 C;  4RMN A;  4PJL A;  3ZZI A;  4HPQ A;  2JDC A;  4MFZ A;  4E0A A;  1LRZ A;  2OB0 A;  2QML A;  2V1N A;  2ZW6 A;  4FD5 A;  5H84 A;  3HUG B;  4XKW A;  3OYB A;  3OYD A;  1QSN A;  2VEZ A;  5DWM A;  4BQO A;  3EY5 A;  4U87 A;  4BS9 A;  4R9M A;  5J8F A;  2P6E A;  1X4O A;  1IID A;  2LY2 A;  4BEH B;  2KHM A;  2B58 A;  2L7K A;  3VYU B;  3W2W A;  4PJM A;  3GKR A;  4NXY A;  3LSK A;  5HNH A;  3CJQ B;  2YND A;  2W82 A;  2F4I A;  2CUZ A;  3D2P A;  4QVT A;  3K4B A;  2L9S A;  4BEH A;  4E7I A;  4XKB A;  4KUB A;  4Q38 A;  3OMY A;  4KVM E;  4QB9 A;  4F52 A;  2FCK A;  2IGO A;  4FAS D;  2VJI A;  3DKY A;  3D3S A;  2F6C A;  4U7B A;  5C82 A;  4QPO A;  2OZH A;  1OR7 C;  2J8M A;  3M8J A;  4B10 A;  4NNJ A;  2Q04 A;  4KJZ A;  3TL4 X;  3S3M A;  4C7I A;  3QB8 A;  1KUX A;  4C30 A;  2HQA A;  2RRE A;  5JHF A;  4DGW B;  1MJ9 A;  1MW7 A;  4JWP A;  4ZDP A;  4UCM A;  4C68 A;  1GHE A;  1KUV A;  3CXS A;  4QC6 A;  2L9N A;  3FBI B;  4C2Y A;  1WK4 A;  3CP2 A;  3A1Y A;  3LSM A;  5CQE A;  4AG7 A;  3TO9 A;  4E7S A;  4YRV A;  3E0J B;  4NQW B;  1RO5 A;  5TGT A;  3I9V 2;  2WA0 A;  2UWM A;  2OZG A;  3S6H A;  2CY2 A;  4RLF A;  4KSA A;  4PJN A;  3VWE A;  1Y7R A;  4OAD A;  3R96 A;  3G2B A;  4HNU A;  4AB7 A;  4PSW A;  3KEY A;  3H9Q A;  2DPT A;  4LIU A;  4E7J A;  4BXF A;  4ORF A;  1XF8 A;  4ONU A;  3L2V A;  3MD2 A;  2VPL A;  1NG7 A;  3EPZ A;  2LH9 A;  4BJ6 C;  1FMW A;  2BVM A;  1NMT A;  4DBQ A;  1Z4R A;  3BG7 A;  2Q1Z B;  4LIT A;  2K5T A;  3IAM 2;  1WJB A;  3OOU A;  3H5Z A;  2NOJ B;  2M0M A;  5G22 A;  4XM3 A;  3D5R C;  3BG6 A;  3SDB A;  2B3U A;  2DOA A;  1YLE A;  3R9F A;  3NWS A;  4Q36 A;  1VZ0 A;  1QHG A;  4EAT A;  1W36 D;  4Y49 C;  4MFJ A;  2R7T A;  5GCN A;  2ZW4 A;  3DTE A;  1DGR M;  1X1B A;  2Q2E B;  4B44 A;  2V4J C;  2AE6 A;  2DXI A;  4XLH A;  2HVQ A;  1WJF A;  3E0K A;  3D8P A;  3RPU D;  3DTI A;  2K5C A;  3H9G A;  3T90 A;  1U0J A;  1Z21 A;  5A28 A;  4YEL A;  3H5R A;  2VKD A;  4CCK A;  4G6T B;  1TT0 A;  1V5F A;  1Y6I A;  2M4G A;  2D4P A;  4XN3 A;  2J8R A;  1Z4E A;  3DU5 A;  2IXS A;  3HG9 A;  2PR8 A;  4RM2 A;  4ZDL A;  1QHH D;  4XLE A;  3OS0 A;  1IB1 E;  3EO4 A;  3ZR8 X;  3D5S C;  3HPH A;  2PR1 A;  4BDY A;  1SQH A;  3EUH C;  3EUA A;  3HL2 A;  2F5V A;  1I21 A;  1YVK A;  2B3V A;  2B4B A;  2RC4 A;  3OYI A;  4F3Q A;  3FBN B;  4II3 A;  4XPD C;  4IX7 A;  3WR7 A;  2VI7 A;  4CRZ B;  4CS0 B;  3FKJ A;  4Y33 A;  2V26 A;  2HDW A;  2VIX A;  3KX2 A;  2WSA A;  2OU2 A;  4I49 A;  2JLM A;  4JOM A;  3NE7 A;  4LG3 A;  3C2H A;  2RQQ A;  4XQF A;  4XMY A;  4IZZ A;  1P4N A;  1HA8 A;  2FXF A;  3BCB A;  1W36 C;  4KOW A;  4UA3 A;  4LX9 A;  3VWB A;  2R1I A;  4U9Z A;  2PDO A;  3LD2 A;  4XPL A;  3PNT A;  4B12 A;  2LRE A;  3HPG A;  4GS4 A;  4MI4 A;  4CCO A;  5FRO A;  1ERD A;  3KKW A;  3RCO A;  4BU2 A;  4U5Y A;  4KS9 A;  4A32 A;  3E1S A;  4IQ4 A;  4NC8 A;  2Z3N A;  2PMZ A;  5HOO A;  1M4I A;  4OAY A;  1M1D A;  1TZL A;  1YR0 A;  2Z3M A;  3SXO A;  4CYP A;  2XDV A;  1KON A;  2ZSI B;  3GBG A;  3DPT A;  4PK4 A;  4A31 A;  3QYB A;  3A9L A;  4CGN A;  4XNH C;  2IS1 A;  1MK4 A;  3OYJ A;  1YRE A;  2YNC A;  4M85 A;  4P1W A;  1S7F A;  4AVA A;  4CYQ A;  4NF1 A;  4MHD A;  1D0Z A;  4HNT A;  3JUW A;  3OYK A;  5F49 A;  2PSW A;  4L8A A;  2IGM A;  4A95 A;  3EUK L;  3H9J A;  2VJJ A;  2Z2S B;  3AL0 C;  2VXK A;  3W3C A;  4C2T A;  1D1C A;  4HG2 A;  4XR6 A;  1Z7L A;  4XOR A;  3S32 A;  4KIS A;  4J3G A;  3H5A A;  2M3A A;  2X1D A;  4P5O A;  1N78 A;  4X5K A;  1R6R A;  2KL4 A;  3K4K A;  3QOE A;  1X1A A;  2ZSH B;  4FET A;  1Q2C A;  1JI8 A;  4MY3 A;  2X51 A;  1YX3 A;  4BQN A;  1GLN A;  4DBR A;  4NC7 A;  1S3Z A;  2CXA A;  2KDO A;  3SEZ A;  5IV0 A;  4KVX A;  3RSN A;  3ZQQ A;  3MGD A;  2W4S A;  3I3L A;  3OYF A;  3DNS A;  4XLC A;  2ZW7 A;  2X7B A;  4PUS A;  4PV6 A;  4C2Z A;  5KTA A;  1K4J A;  4JD6 A;  1S7N A;  5CKT A;  2G0B A;  2C27 A;  1CM0 A;  4L89 A;  1DGW Y;  2KLO A;  2OUM A;  4N4N B;  3HOT A;  2O5R A;  3W91 A;  2CW8 A;  2Y0S A;  1X1C A;  2LG4 A;  1B6B A;  3LL7 A;  3QYE A;  3CMM A;  1WJD A;  4PSX A;  4B3X A;  2R7W A;  2FL4 A;  1FMV A;  4OWR B;  3TMO A;  2BEI A;  2ZXV A;  3N7Z A;  4NSQ A;  5EC4 A;  2VXD A;  2REF A;  3OL4 A;  4BQQ A;  4HST A;  5HNF A;  4RM3 A;  3U21 A;  3UR3 C;  2WAD A;  3CF2 A;  2A6T A;  2WUU A;  4UWI A;  3LSI A;  4KOY A;  3FXT A;  3TT2 A;  4QBJ A;  1X1D A;  3FDY A;  3FRM A;  3M1C A;  1ZEL A;  1PYV A;  1PUA A;  1MMA A;  2HQY A;  3TCV A;  4BUP A;  4XL9 A;  2VQC A;  5AG4 A;  2LYC A;  2VL8 A;  4IQJ A;  2FUG 2;  5CPR B;  3MKZ A;  3L2Q A;  3P2H A;  2V7F A;  3K10 A;  5LD2 C;  2P0W A;  1VKC A;  2CNT A;  4MFK A;  3VWD A;  4B14 A;  3OS2 A;  5EBV A;  4BJ5 C;  3TOA A;  3DTK A;  1V5E A;  3HXL A;  4NCZ A;  3LSH A;  2K9M A;  4QPQ A;  2BW3 B;  3F8K A;  1Z9U A;  2V9K A;  4K30 A;  4CAX A;  2X1C A;  2ATR A;  4CCM A;  2A5W A;  3ZRG A;  3PL8 A;  3OYC A;  2DCE A;  3PGP A;  4BMH A;  3R1K A;  4A30 A;  1WJA A;  2BW3 A;  2UUZ A;  1YX0 A;  3LOD A;  4UWJ A;  1UG0 A;  1DQU A;  1R57 A;  1XEB A;  2VQG A;  2Q4V A;  2M7B A;  1X4P A;  2Z3P A;  4UBR A;  4X0G A;  2Z0Z A;  1BO4 A;  2E1M B;  3OYA A;  3OL3 A;  4HEA 2;  2NMT A;  2IGK A;  4DOZ A;  1XMT A;  1YK3 A;  2Y0M A;  2R4G A;  3BJ7 A;  4KOU A;  2HUZ A;  5CQG A;  2QKM B;  4ZGY B;  4GRI A;  4B43 A;  5JQ4 A;  4QUS A;  3S3N A;  2YNC C;  3F9K A;  1BR1 A;  2VLA A;  1QU3 A;  2BSW A;  3BJ8 A;  3H0D A;  2R7X A;  4MFL A;  5FVJ A;  5KTD A;  4MBU A;  2P6F A;  4XNF A;  1BR4 A;  3P2F A;  4KLV A;  4KZT A;  4E7K A;  4FD4 A;  5IX3 A;  1QSO A;  4RS2 A;  5J8C A;  2QKL B;  4B48 A;  2QEC A;  1J09 A;  2BOL A;  2IS6 A;  5F46 A;  2E5Z A;  3FNC A;  3OIP A;  4PFP A;  1J4J A;  4LIV A;  3BLN A;  1XE4 A;  3OYM A;  1V5G A;  2R7H A;  2ZPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...