1BOBA

Histone acetyltransferase hat1 from saccharomyces cerevisiae in complex with acetyl coenzyme a
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
315
structure length
306
Chain Sequence
FKPETWTSSANEALRVSIVGENAVQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDSVTFKPYVNVKYSAKLGDDNIVDVEKKLLSFLPKDDVIVRDEAKWVDCFAEERKTHNLSDVFEKVSEYSLNGEEFVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLLNKKTKELIGFVTTYKYWHYIDKKFRAKISQFLIFPPYQNKGHGSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKLGYDAVFQKHSDLSDEFLESSRKSLKLEERQFNRLVEMLLLLNNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acetyltransferase
molecule keywords HISTONE ACETYLTRANSFERASE
publication title Structure of the histone acetyltransferase Hat1: a paradigm for the GCN5-related N-acetyltransferase superfamily.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 92
structure length 306
sequence length 315
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 1998-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1bobA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1bobA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 1bobA01
3D8PA 2ZW5A 3TFYA 1S7LA 2CNMA 2OH1A 2PSWA 4E2AA 4JJXA 2EVNA 1YGHA 3JUWA 4QC6A 1NSLA 3S6HA 2Z0ZA 4JD6A 5CNPA 5H86A 4KVOE 2OB0A 1S7KA 3D2MA 4KORA 1MK4A 1XIXA 2OZUA 2OZGA 1SQHA 1S3ZA 3DR6A 4KOVA 3TOAA 3SXNA 2FSRA 3T90A 4AB7A 2BUEA 2ATRA 4KLVA 3N7ZA 4NCZA 5IX3A 4CAXA 4M3SA 1IIDA 3CXSA 4GS4A 2FE7A 1M4GA 4L89A 4U9ZA 4AVCA 2D4OA 4HKFA 4LX9A 3E0KA 2WPXA 2Q4YA 2B4DB 3B8GA 3R95A 1I12A 5H84A 2FT0A 2Q0YA 4XNHB 4KOUA 2FIWA 2K5TA 3K9UA 2J8RA 3EXNA 3R96A 3EFAA 4M85A 3G8WA 1ON0A 1WK4A 4NF1A 2QECA 5F46A 2A4NA 1P4NA 2OZHA 3S6KA 2BL1A 4I49A 4MY3A 1M4IA 3F8KA 4QBJA 1R57A 4MHDA 5DWNA 2J8NA 4Y49C 1QSTA 3GYAA 3S6FA 5IV0A 3TO9A 2ZW7A 3ZJ0A 2Z10A 1Y9WA 3RYOA 2HQYA 3DR8A 2B4BA 2HUZA 4H6ZA 4NXYA 3R9GA 3BJ7A 2FL4A 4XPLA 4B5PA 1OZPA 4YGOA 4R57A 3R1KA 5HH1A 1YVOA 3DDDA 1IB1E 4B5OA 4PV6A 3TT2A 1XE4A 3SXOA 3FXTA 1Z9UA 2FCKA 4MBUA 5J8CA 3BJ8A 1Q2DA 1V0CA 2B3VA 1QSOA 4UBRA 1YLEA 4IUSA 1IYLA 2CY2A 2Q44A 3F5BA 5J8FA 1M44A 1M1DA 3LODA 4QUSA 4BMHA 2JLMA 3GKRA 4HNXB 3KKWA 1RO5A 2ZW4A 1YR0A 4PK3A 2FIAA 2REEA 2RC4A 1N71A 4YFJA 4CAVA 1WWZA 2Y0MA 4UWJA 3MGDA 3C26A 4NSQA 4XPDB 3R9EA 4XNHC 1QSMA 5JQ4A 2PRBA 2IL4A 1XEBA 4OLLA 4AG9A 1Q2CA 2FXFA 2BEIA 4CRZB 4KLWA 4J3GA 1KZFA 2P6EA 5F49A 1B6BA 1NMTA 1TIQA 3QB8A 3SHPA 1MJAA 1IYKA 1P0HA 1UFHA 4CS0B 2P6FA 1Y7RA 1U6MA 2B58A 4UWIA 1S5KA 3D2PA 4EVYA 1I21A 2B5GA 2REFA 1GHEA 3FB3A 3PGPA 3QAHA 1L0CA 4JXQA 4MI4A 4AVAA 5FVJA 2VXKA 4IF5A 3TTHA 1RXTA 2Q04A 2Q4VA 4U9YA 3GY9A 3OWCA 1B87A 4KUAA 3NE7A 3FRMA 2ARHA 1PUAA 3EY5A 4AVBA 4QVTA 4F0YA 3EO4A 4E0AA 2JEVA 4ORFA 1Y9KA 3I9SA 1NE9A 2J8MA 4XPDC 3TO6A 4PSXA 1YX0A 3G3SA 3VWDA 3DSBA 2PR8A 3I3GA 1MJBA 4K30A 3CXQA 2P6GA 4R3LA 4MJ8A 4KUBA 5E96A 3P2FA 2BSWA 2D4PA 3S6GA 3V8IA 2JDCA 4FD7A 2FS5A 4RS2A 2Q7BA 1Q2YA 4U5YA 2O28A 3TO7A 3WR7A 3F0AA 4R87A 4NEXA 2B4DA 4KOTA 4OAEA 2B3UA 2PC1A 2VBQA 1VHSA 3DNSA 4E8OA 4HNYB 5GCNA 1IICA 5EBVA 5IB0A 1KUXA 4II9A 1XF8A 5F47A 5EC4A 5HMNA 4LUAA 3CXPA 1I1DA 2QIRA 2GANA 2AE6A 3UY5A 3ZZIA 4CRYB 3FIXA 4PK2A 2X7BA 4R3KA 3W6SA 3JVNA 4PSWA 2NMTA 1BOBA 2VZYA 2G3TA 4KVME 3H4QA 3IGRA 3P2HA 2EUIA 3T9YA 4H6UA 4H89A 3VWEA 3W6XA 3R9FA 4FD5A 2KCWA 1Z4EA 4ZBGA 2GE3A 2G3AA 4KOSA 4FD6A 4Y49B 4JLYA 2ZXVA 2R7HA 2PQ8A 1CJWA 5KTDA 1QSNA 1S60A 3TE4A 1KUYA 2R8VA 4R9MA 4FD4A 2PR1A 2DXQA 4HNWB 5JPHA 2VQYA 3PZJA 1Z4RA 4KOYA 4MY0A 1M4DA 4X5KA 4YRHA 4RI1A 4B5PB 3W91A 5C88A 4UA3A 4OADA 4KVXA 2C27A 2OU2A 4KZTA 2VZZA 5I0CA 5ISVA 1BO4A 5F48A 5DWMA 4QB9A 3D3SA 4F6AA 2ZPAA 2H5MA 2CNTA 2QMLA 2JDDA 3TCVA 1J4JA 1YK3A 1PU9A 5C82A 5KTAA 2HV2A 1S7FA 4AG7A 4DNCA 1S7NA 1KUVA 1FY7A 3FYNA 2AJ6A 2Z11A 4ONUA 2R1IA 2I00A 4XPKA 4L8AA 3FNCA 2G0BA 2VEZA 3FBUA 2P0WA 1VKCA 3LD2A 4KOWA 2ZW6A 3EC4A 2R98A 3PP9A 2WPWA 2PDOA 2F5IA 2GIVA 3IWGA 1QSRA 4JWPA 1YREA 1XMTA 5KTCA 4JXRA 2VI7A 1YVKA 2CNSA 2I79A 3TOBA 4KOXA 1MJ9A 3BLNA 1K4JA 2B5GB 4CAWA 1CM0A 1LRZA
chains in the Genus database with same CATH superfamily
1CPSA 2MFZA 3WABA 2ZW5A 4AIDA 2HFHA 3I5UA 4AVZA 4AYBN 2VBXA 2FBHA 1D5VA 4CDGA 4RS8A 3WODF 4JBAA 3GZ5A 4YELA 2K4BA 4EJTA 2BOAA 4A37A 4Y3OA 3QPTA 3KLOA 4MTEA 3O3KA 4BACA 2Z3PA 2QSHX 3S6HA 2IRFG 2E36A 1CBXA 3BR2A 5H86A 3TKYA 3GZNB 2OB0A 1G8XA 1YW8A 4EJWA 3IKTA 3H9JA 5F0CA 2V6EA 3RZAA 5LRJA 2FBIA 1JHFA 3FHZA 4MEXF 2ICWG 3B7IA 5A28A 1IRXA 3G1MA 3DLAA 2NAZA 5E79C 4CYCB 3GX4X 3PB7X 1NK2P 1TWCJ 2XAUA 5EZGA 1MK4A 4S05A 3ZMVA 2MW8A 3COAC 1XIXA 2OZGA 1A6IA 3TOAA 5CPAA 2LY2A 2VB6A 2Z3OA 5DDGA 5F64A 4A5MA 1UAAA 4HYEA 2VI6A 2BUEA 3T8RA 1XRYA 4BBRJ 2R7RA 2RGVA 5AIQA 2STTA 4KLVA 1TP4A 4GRIA 3WG9A 4PXEA 3FWEA 4S04A 2V8DA 3E97A 2OR4A 1TLHB 1HOMA 2NVYJ 3QP6A 1UJ8A 3ZQQA 2VJIA 1VQNI 2NS0A 4UVBA 3BJ6A 1YJNI 2L4MA 3BWGA 2FNPA 3CCYA 3OY9A 2G9DA 1M4GA 1Z0XA 2E7WA 4UVAA 3NWTA 4BJ6C 3CCLI 4FCYA 4UEFA 3LA3A 5DD4A 3WU1B 2K4JA 3QU6A 1XCVA 1XSXA 3KGQA 2WPXA 2J5OA 2PMZN 4K30A 1ETWA 3T0YA 1A35A 3PSFA 2L01A 3R95A 3SI1A 4ZY2A 4IKFA 2E35A 2EFWA 2ZEGA 3LMSA 3F8MA 4YWYA 2MABA 4IOAF 1U5TA 3BOQA 3ERED 5IP6A 4BH9A 1IAWA 2QVPA 1ZTRA 5FKKA 4XNHB 4KOUA 5K7ZA 1ZELA 2QM3A 2VASA 4P9FA 4PFOA 4A95A 3LWUA 3K9UA 4WF2A 2A69F 5D8LB 1VZ0A 4KISA 3OL3A 1R3NA 2JBJA 3EXNA 3J7YJ 4MFPA 5AG5A 5TJJA 3EUHA 3RJPA 4A30A 4HLXA 1FNNA 1ON0A 4XKVA 3IWWA 1WK4A 3WTZA 1K6OA 4QPQA 3A01B 5FFZA 3PO2J 1K78A 4LG3A 5M5WJ 2HVQA 4WCGA 4XN3A 3H9QA 3LSMA 2BV6A 2FBKA 4MIMA 3SJMA 2ZENA 2G0EA 2COMA 2IGMA 2DO7A 4XSZF 1Z8WA 4I49A 2KIUA 5DD8A 3F8KA 1I6XA 3KP2A 3RKWA 5LEKA 2XHKA 2ESHA 3EDPA 2E5NA 4PJJA 4B3AA 1QSTA 1QZZA 5IV0A 4QIWN 1PP7U 2B0LA 2R7SA 5EMIA 1I39A 1X1AA 2EBJA 5G21A 5IPAA 3RKQA 2B4BA 3N97A 1YFHA 2VBYA 2BVMA 3A0HC 1RR8C 1RETA 4PXBA 3LSKA 5LHGA 1FBQA 2H27A 4YGOA 1B72B 3R1KA 3FXLA 4LIUA 5HH1A 3MKYB 1Q1VA 3AKZA 1JTYA 2NRAC 1IB1E 4Q7AA 3KLNA 1R36A 1IRZA 1CPXA 3SXOA 2DOEA 3SHFA 3FXTA 2DA2A 4E6KG 3BY6A 3HDDA 5AG7A 2OAZA 2X1DA 2EINH 2Q7SA 3PB4X 1X4OA 2Z3NA 3BJ8A 3RTRA 2RVCA 1A6QA 2B3VA 1QSOA 4UBRA 4G6TB 4A33A 4BY1J 1YLEA 4IEJA 2XIGA 4UUSB 4G7HF 3QRFF 3J7AO 1MSFC 4YFKF 3OV8A 2DA3A 4IJAA 5TGTA 2HKXA 5FD6A 2BBYA 3LODA 2HVSA 4M6HA 2ANPA 3ML6A 1AHDP 3IO1A 1TT5B 1HA8A 3W2VA 1F2PA 3CTAA 4PK3A 4X0GA 2FU4A 5LRKA 1CF7A 1G3WA 2DA7A 2QQ9A 3GIUA 1TZLA 3KL9A 3HG9A 1FEXA 1WI9A 2Y0MA 1ETOA 3C26A 4CGNA 5FRNA 3MEXA 3R0AA 1VQ8I 4ZJZA 2Y75A 4LD5A 2VQCA 3I4PA 2KJBA 3LQRA 4XNHC 1QSMA 5ERIA 4KYWA 1I3QJ 3HOZJ 1ZKGA 1XEBA 1VGYA 1FMVA 3PNYA 4BE2A 2Y2ZA 2ELHA 2FXFA 3CD6I 3KI9A 2M30A 2W57A 1WH7A 1Y56A 3C2HA 2JPBA 1DQUA 2L54A 2R3SA 1MMNA 3IEHA 3QNVA 4W9YA 4PZJA 1ENHA 1YYVA 1G6NA 2DK8A 3WTYC 1YI2I 4X6AJ 1B6BA 1NMTA 1TIQA 5F49A 3DQVC 4EJUA 1MJAA 3BR3A 4UXNA 2ESNA 4MNUA 1P0HA 2JT1A 5CQGA 1ARMA 2O8XA 2A68F 2EIKH 5J47A 2L0KA 3GUXA 4OIWA 2Z5UA 4CZZA 2P6FA 2FRHA 2FMYA 5LRGA 4E7LA 3U1DA 1U6MA 2LREA 4NFRA 2IGOA 3HHGA 4B47A 2K5CA 3G1LA 3A1YA 3S9LA 5L3BA 2ZXWH 3P9KA 3DLLF 1C0WA 3E5UA 3D2PA 4EVYA 2B5GA 1ACIA 2OCEA 2QBYA 2M45A 1A2ZA 5DCMB 4BU2A 4N4NB 1Y6IA 2HOAA 1VQOI 3ABUA 4KNYA 4GM5A 3QAHA 3FXKA 4JXQA 4MI4A 1USTA 4G6QA 4CUGA 1MH3A 4XKCA 1UZCA 4IF5A 4LQGA 3KP4A 4U0WA 5LRRA 1KYWA 2Q4VA 3CCQI 4U9YA 3OWCA 2KZVA 4A93J 4QLCU 3ZN1A 3JW4A 1BC8C 3JSOA 3LFKA 1MSEC 2DJIA 3NE7A 3HGGA 1XD7A 4JX6A 4OAZA 1QHHD 2NVUB 2GM4A 2ARHA 4CGLA 2CUFA 4GDFA 1X19A 3WTTC 1PUAA 2Y0SA 1B1BA 2FNAA 1BR1A 1RNLA 5J6XA 4E0AA 3IH4A 3ECOA 3D67A 1IUYA 1TBXA 3RZDJ 3SJFA 4XNFA 4B1RA 5K5OA 4CYCA 3JRHA 3L2RA 2JPCA 1FLIA 3KEQA 1HW5A 1NE9A 3CJQB 3CF5F 1V5FA 4DZJA 4PSXA 1ZG5A 1OBRA 4NHJA 4XORA 2HDWA 5E3LA 1BR2A 2OCCH 3K10A 3G73A 1MBHA 3S1RJ 5KHDA 1ZR4A 5D8KB 1I1SA 2VJ4A 2PR8A 1SVLA 2WWYA 4IL6C 1FIPA 4FWUA 2GA2A 2Q2EA 1IY7A 4XSXF 2F7VA 4R3LA 2F4OB 5EEAA 1OQYA 4G1PA 3S3OA 4M3FA 5DS0A 3Q3SA 2M2EA 3F8BA 4OAYA 4II2A 3MKLA 1ELLP 1A5JA 2M1BA 4R76A 2DFIA 5J3LA 2Q1ZB 2PJ8A 2VE8A 4U5YA 3CCUI 3BG7A 3SDBA 2ZXHA 3C1DA 2R5ZB 4OIOF 1OR7C 2ABZA 3RDIA 3V42A 3B6CA 2UXNA 2AXTC 1M4LA 4X3RA 2XV4S 3V7SA 3A4CA 4M9XA 1OKRA 1OJLA 2RQQA 1IXCA 4OAEA 3GTQJ 4MHYA 3S17J 1LDKB 2B3UA 2PC1A 2VBQA 3ASNH 2E2JJ 1FBSA 1IICA 2VKVA 2GLFA 2DU9A 3WGHA 1MMSA 2QKLB 3VYRB 3OIPA 2QSFX 1U0JA 2MLKA 1ZRFA 2FOWA 1B4AA 3PSIA 3C2BA 2QIRA 3GVAA 5C4XJ 4KSAA 3BTIA 2OTLI 2EA2A 2O7OA 4UIBA 1EA3A 3IU1A 1PYVA 1IN7A 2YU9J 2ZMEB 1WVRA 2QEXI 4PXCA 2VC0A 2DJNA 1UHMA 3WC6A 5JLXA 3CUQB 2O53A 1ZLJA 4C9YA 2M0CA 2VQLA 1BAVA 2NMTA 1U9NA 2O6GE 2PJ2A 4WWVA 3RQ4A 4M3BA 1RTQA 5H6QA 5GAEJ 3V8KA 4ZTJA 1ZLKA 2DXIA 2DLLA 1XDSA 4ZGYB 2X4HA 4EMEA 1XMAA 4I7HA 3NEUA 1M1EB 1B6AA 3HUGB 3WTSC 5JGFA 4P9UA 3TEDA 3W6XA 3K69A 1Z4EA 1MBFA 4KOSA 4PK4A 4HNTA 1KWMA 2GREA 2YSRA 4A3JJ 4JLYA 4MCQA 4XM3A 4DUKA 2X6YA 3QOPA 2OV7A 1RZ4A 3LWFA 2CW8A 3CC4I 1FBUA 4UUTA 2CQXA 1LPQA 4IRIA 1ZLHA 4P45A 1HKTA 1BIBA 4WK8F 1IN5A 4FETA 4PFPA 5ICEA 3V7RA 2WSAA 2LBFB 4PDKA 5LYDA 3EUKL 1H9GA 3GFIA 4IQJA 2EFNA 1HCRA 1CG2A 2BHYA 2DA4A 5J1RA 1YW9A 2ACJA 3VFZA 1S7AA 5GADJ 3VWBA 2R7VA 3D7HA 3TE4A 4XOTA 4R9MA 5LGNA 4D5FA 1IGBA 1XFOA 3QQAA 4UUSA 1JI8A 5JPHA 2V6CA 1D1CA 1EH8A 4IXAA 1Z4RA 3GFJA 4X5KA 3SEQA 4RI1A 2MC3A 4YEJA 2X48A 3RYRA 5B3SH 2PI0A 1TF8A 4MXUA 3LSPA 4ENKA 4UNOA 5M5YJ 4OADA 4G9YA 4KZTA 2IS6A 5ISVA 1D0XA 1OYYA 3CCEI 1AU7A 3X2QH 3LFUA 3BXMA 1BA5A 1F43A 4GYGA 3BQZA 5H20A 2E1NA 3DU5A 4OC3A 1G59A 3WT4A 5EJCA 2B9SA 4MEYF 3GTLJ 2VJJA 3D1NI 2YNEA 1O7FA 1DTDA 3HOVJ 3WTWC 1F4KA 1K6YA 4FT8A 2ZPAA 1ZN2A 4RDUA 1DPRA 3UNGC 2KJCA 5C44J 2DEAA 1BL0A 4IHXA 1T38A 1V5GA 4A32A 2QMLA 2Y9YA 2CFXA 2HYFA 4H0EA 3FHNA 4II3A 3JAMK 3TCVA 2W4SA 1F36A 1VNDA 2HOSA 3K7AJ 1KQ0A 2CFOA 3IC1A 1S29A 4OC0A 3DEUA 5KTAA 1Z3YA 2AHQA 3AG4H 2V7FA 4DNCA 5LYIA 3CO7C 1KUVA 4BBSJ 1FY7A 1Z6TA 4P10A 3PIPF 1NTCA 4ABZA 2VXZA 5DCMA 5E20A 1X58A 4HW0A 4MQ9F 2VL1A 3SFZA 3FBNB 4HX8A 1SD7A 3VYSB 4L8AA 3DTEA 1NHAA 2P0WA 3KYCB 1R1TA 4EWTA 3LD2A 4KT6A 3PP9A 4OMZA 2XEJA 3NWSA 2GIVA 1IUFA 4LJZF 3H92A 4LGWA 4M9ZA 4QSHA 3G71I 4KA4A 3IWGA 2VT2A 2P6TA 4I2OA 3SJXA 1AYEA 2O8KA 4F55A 4H4KC 2L9NA 2WB1N 4Y15A 1ZG3A 3J80Z 2CNSA 4XLHA 3IWEA 5IT3A 3OOPA 4BQNA 3DP7A 4BDZA 1XOVA 2FOKA 4A0ZA 3ZP5A 3FX3A 2V26A 2ZELA 4QWQA 5AG4A 3F9KA 4NDLA 3E1SA 2JBKA 5CPRB 3S3NA 1V54H 4UB8C 1QZYA 4HA8A 2UZKA 3DPUA 4B43A 2YX7A 2IEKA 1CM0A 4P55A 3TBIA 4F93B 3I3LA 4XOPA 3CCSI 1QNTA 3DBLB 4JX4A 1WJEA 1X3UA 3HIFA 1TWHJ 4JYKA 5FO5A 1J7KA 2O9LA 5K8MA 3AAFA 2PSWA 3HL2A 3B73A 4E2AA 1HC8A 2W00A 3KP6A 2AO9A 4JOMA 3IHUA 3K6GA 4ON0A 4BUPA 1NSLA 2V1DA 2EWNA 2K9MA 3JTKA 5TRDA 4JD6A 4JYWA 3BR1A 2FE3A 3BZCA 1HEEA 1BI2A 2DQRA 2P7VB 1BIAA 5IY5H 5GPCA 3S2WA 3V38A 5FB2A 1WKMA 2UV1A 4L5JA 4BKXA 4IVNA 1FSHA 6PAXA 4KORA 5M3MJ 4JZ0A 3TW6A 2M34A 3DKXA 5L3GA 2GWRA 3F8FA 1W5SA 3ESWB 2CQQA 2ZSHB 2R5ZA 3ISPA 2EZLA 2OZUA 5J40A 1SQHA 1S3ZA 3FMCA 1HKQA 2W85A 1YW7A 3HC7A 1S72I 1PCAA 4RA2A 2Z3MA 4RN7A 3T90A 4AB7A 3WGIA 4AYBA 3BP8A 4Y17A 5D5WB 1EKEA 2VQHA 3F0CA 2LY9A 5D4SA 2VE9A 1UCRA 4X2TA 1XGNA 2XGDA 2E1MB 4D0PA 2AS5F 2HVRA 2P81A 3D4UA 5IX3A 4LFUA 3ZQCA 1CGPA 1BC7C 4CAXA 2XVCA 3UR3C 3S3MA 1H0MA 3IUOA 3PNVA 1BPMA 2PJPA 2HC9A 5J1YA 3SYTA 5FD5A 3BJOA 3FM5A 4N9IA 2W1OA 1P7JA 3OYIA 2PVVA 2PIZA 5E1ZB 4RLQA 3S8PA 1VFCA 4DGWB 1LEAA 2VBWA 4OMEA 1BI3A 1P6RA 5FROA 1R49A 2TRTA 4LX9A 2H8WA 2FQ4A 2Q8KA 1U3EM 5FLVA 3D7DA 2FVGA 2M0MA 2M8GX 1FC3A 3BZ6A 5F08A 3RIRA 3E0KA 4NC8A 4B10A 2ZMEA 1FNOA 2Q4YA 4ESJA 3CUQA 3I9V2 3WHBA 1JUSA 4Q5SF 4XQFA 1D1BA 2XRLA 2DYSH 1I12A 4UVCA 2E2HJ 1ON2A 4IOCF 2P6SA 1NSAA 1YMEA 2CQNA 2PN6A 3GTPJ 2HYJA 1WRJA 4A6EA 2FIWA 2J9AA 3HUGA 3HEFA 2K5TA 1Z5RA 2LC2A 3D5SC 3GO5A 4V19K 3R96A 2ZSIB 4DQ2A 1LEBA 3KHZA 4G7ZF 4U7DA 3LOCA 5FLXZ 2DOAA 2DA1A 4F3QA 1U5TC 3CMAI 2HQAA 2HKOA 2PFBA 5EEGA 5F46A 3TMOA 2AFWA 1VQ6I 5G20A 2GFQA 1P4NA 4EJVA 2IW5A 4C3JJ 4OP4A 2CSOA 2OZHA 1P9QC 3L9FA 4KUMA 2BXYA 2H94A 4AU7A 1KU7A 3SJEA 3M7GA 1QPMA 3JRCA 1POGA 2CG4A 2L02A 2PMZA 2DN0A 3EUHC 3VDXA 1SD6A 2CMPA 3KHXA 3PRTA 4IAVA 5E3MA 4Y49C 1TQIA 3CF2A 4ZDLA 2LD5A 4BJ5C 5THWA 4MHZA 3K1MA 4AC0A 5EF6A 3ZJ0A 1VQLI 1FTZA 4UCPA 1Y9WA 3S9NA 4UFXA 3DR8A 4P5OA 4KN7X 5JHUA 2X85A 3H5RA 4ZDPA 4XPLA 1ZG9A 2AFOA 1SFXA 2W82A 1MGTA 3ZN0A 2A3SA 4R57A 2NOGA 3FECA 2E1MC 2STWA 2BHZA 3DKYA 1YVOA 3DDDA 1ONVA 3TP3A 3M8JA 3TP0A 3AG2H 1G4DA 1IG7A 2MH9A 2FCKA 1BI0A 5JHFA 1JXSA 1DP7P 1OYIA 3O6BB 2QBYB 1Y0RA 3GWZA 3M8FA 2XAGA 1LOKA 5EDNA 2C6YA 2HZTA 4KMFA 1O3SA 2Q43A 1VI0A 1VQ9I 4B4CA 2WV1A 3LACA 4YG2F 5FGMA 4A0YA 1QU3A 1ETVA 4A3MJ 5JVTA 2PX9A 3F5BA 4PJNA 4OC2A 1M1DA 2LTPA 4QUSA 1FT9A 4KSFA 1TKJA 4R7MA 3LSIA 5M3FJ 5K1YA 4XONA 3RKYA 4HF1A 4G8XA 4MQVA 3OYBA 2FIAA 3CJNA 1OCTC 4YFJA 4CAVA 1EH7A 3VSKA 2LOOA 4IHTA 1WWZA 2EK9A 1IU8A 3WC5A 3MGDA 5DS9A 3KASA 2ZEPA 1R71A 1QVTA 2VKDA 4R8HA 3SZTA 5D5UB 1LAMA 3LL7A 2ZC2A 2PRQA 2ZEHA 3I4NJ 4WXDA 5IYDJ 5G1ZA 4CO8A 5ICCA 2IAIA 4DOZA 1HDQA 1GDTA 2IL4A 4I0BA 4PCQA 1YS6A 4OLLA 3TX8A 5J1QA 4AG9A 5BNGA 2JJ7A 4D9JA 2K02A 3K2KA 3CESA 1KONA 2W48A 1W5CC 2PJAA 3HPHA 5GTIC 1Z8XA 1U6GA 2L3DA 3H3ZA 4GCVA 3U1KA 1ZRCA 3MZHA 4OMYA 4J3GA 3IRQA 1R22A 2CUJA 3VYTB 3F3XA 2XSJC 3KFWX 2TCTA 3OYLA 2W7NA 3F21A 3V8JA 4LG0B 2XF7A 2HS5A 4IQ4A 2MD5A 3HZJA 1TWGJ 3RAMA 3P5JA 2OF7A 4NB5A 4NJRA 2Q2EB 4CS0B 1OFCX 3BG9A 3FF3A 2MBFA 3GUDA 3S15J 2CF4A 4AIJA 3MZYA 1Y7RA 4O3MA 1VTNC 2XEFA 4FAIA 1IZ1A 3W3CA 3CMYA 1JKOC 1WJCA 4XLEA 3CCJI 3W2WA 2BY2A 3LA2A 1I21A 1PVEA 4IPAA 2DT5A 2DCEA 2REFA 1J2XA 2ZEOA 3KZYA 2PJ6A 1R43A 1KZHA 3U9GA 4AVAA 4ZH4F 5FVJA 2AFXA 1IDYA 3LSRA 1T98A 2IGKA 3JRFA 1HW2A 3IWZA 4L9JA 3FMSA 1D3YA 3PO3J 5KAFC 3HKZA 4HAMA 1R23A 4CYPA 2IJLA 2ZB9A 3ISZA 4G94A 5CVIA 3FZVA 1R58A 3DF8A 4OOIA 4M6XA 3EY5A 4AVBA 4BBHA 4QVTA 1WI3A 3ZMDA 3HOXJ 4A12A 3HRSA 1HKSA 4HV6A 5FRMA 1JUMA 3M3YJ 3JCUC 1Y8RB 2XC7A 3E6BA 2HYGD 5AIPA 1T8IA 2JEVA 4UF4A 5HLGA 5JI6A 2VOPA 2MA3A 4TV7A 2MG4A 1T33A 3GLXA 3K70D 2UWMA 3H5ZA 2PCUA 2QZ8A 3BHXA 2IS1A 1XC5A 5IT9Z 4MFDA 2G7UA 4YRVA 2X0LA 1SAUA 2HQNA 4YIFA 3OYNA 2P7CB 1ETYA 2GLOA 2EV6A 3OOUA 4PJMA 4U7BA 3DSBA 1FMWA 1LFPA 1MDMB 4EGZA 3FMQA 2XEIA 2PMHA 3MKZA 3CDXA 2EJRA 2EO8A 2V79A 4U0VA 4E7JA 3S2HJ 3IC7A 2VKHA 2P4WA 2P6GA 4BGDA 4L9VA 2V1NA 1JKPC 1R5ID 2EIMH 3LQQA 4KUBA 5ED4A 3OSFA 2YUSA 1UG2A 5J4YA 1WJBA 2KKOA 5FLMJ 1H9TA 2C6CA 2BO9A 2D4PA 3RCOA 2HXIA 3OS0A 2GAUA 3S6GA 4CXFA 2FS5A 3IU2A 2XSDC 1QO0D 2GOXB 3REOA 5E17F 3HRTA 1EV7A 3IIBA 4CGPA 4FUUA 2EZHA 2VPRA 1SVMA 4XLCA 5EGOA 5CBMA 4FISA 4P96A 3ABMH 1P92A 2PJBA 2L7MP 3BG5A 2D5VA 1LFUP 2DPDA 4BXFA 4Y52J 1O3RA 1J59A 1ZG8A 4WXHA 2WYRA 2JUGA 3HXLA 1FZPB 1ZO0A 3EUAA 3ECHA 4JK1X 2DW4A 1VHSA 1WQ2A 3G2BA 3KPHA 4HZFA 4FE4A 5HNFA 4OU0A 4CSWA 4M9SA 2PJ1A 5CQEA 3SEZA 3B02A 1W36C 4Q48A 5HDGA 4BHCA 2K9NA 3ZQLA 1ERDA 2XKOA 1ZGWA 1FP1D 2CUZA 3MFKA 4LUAA 5HMNA 3RPUD 1FPQA 1TT0A 1MIJA 2CQ7A 4EQQA 1I1DA 2GU2A 2IJZA 3ZGKA 2V1XA 4D7NA 3UY5A 1A04A 1Z1DA 3OWTA 2PLYA 1QHGA 5A2QK 1LVKA 1LB2A 2DPTA 1ZLIA 4LLGF 1ETQA 4PSWA 5HLHA 4C2MJ 2DA6A 3J80K 1AA7A 4KN4X 4BXUA 3PUBA 1G3TA 2QYOA 3H5NA 3IGRA 3P2HA 2UXXA 4EV0A 4NBQA 4EGYA 1Y1WJ 4AWXB 2OUMA 2MGQA 4DYQA 1STZA 1UELB 2WY8Q 1P2FA 2KRHA 1SC7A 2CIJA 3KR5A 3J81Z 2HPMA 3QAYA 4B6ZA 1T56A 1TWFJ 1W0TA 3EPZA 2R92J 3FM3A 1XCBA 3BR6A 2XROA 2IPQX 2OA4A 3K1PA 5CKTA 4ZBGA 2G3AA 3GZ6A 2HXOA 1VHOA 2OQRA 1LFWA 1E2XA 3L2VA 3RNZA 4M3EA 1OCCH 2PQ8A 2R7HA 2EH3A 2I5UA 5KTDA 1RKWA 3DEEA 3HOTA 4WWCA 1BI1A 1IDZA 1QSNA 1KA8A 4KDPA 4P4IA 2H6CA 3FF5A 1KUYA 1ZYRF 5FKNA 4FD4A 3E6CC 2O03A 3I71A 2TDXA 2KISA 1JT0A 2JA6J 3PZJA 1RPWA 1QA6A 2XEGA 1Z3XA 2DK5A 5HLIA 4ONWA 4A3LJ 2ZNZA 3WE3A 3ZQGA 2C27A 4O5VA 5I0CA 2AQEA 4A2ZA 1BO4A 2VBZA 2YR2A 2FMLA 4IF4A 1YLOA 2OOTA 1FIAA 4KMUX 4B3XA 2VPLA 2IS2A 3ONQA 6CPAA 5LGTA 3CUOA 4M74A 5DWMA 2JMWA 3K4LA 1Q7LA 4MCRA 2Z3LA 2PEXA 5EZHA 1UHWA 2XAQA 2EFQA 3W6VA 3PBBA 2LSOA 1LKXA 4NGSA 2KRCA 2H5MA 2HQRA 1LDDA 1XMKA 1NH3A 1Z7LA 1JKQC 3NFZA 4C7IA 2X6OA 1JT6A 4UHTA 2H8RA 1FSEA 2KLOA 3A2KA 1Z8LA 2CNTA 4LG0A 4FBEA 3OYKA 3IFEA 3RSNA 2BCOA 2XPUA 2JWTA 3IP4B 3S1MJ 1NG7A 1J4JA 2AFMA 2ID6A 1R4MB 1W0UA 3C7JA 4CGOA 5BS6A 1F57A 1HSTA 3NQOA 4GGGA 1A36A 2HV2A 2ME6A 3SI0A 4HSRA 2ZJRF 1TXRA 3GLJA 3FMRA 2FD5A 4EEFG 1JUPA 4UCNA 2K7LA 3JRAA 2ELKA 3FEDA 1T2KA 3Q9SA 1Z6RA 1R7JA 1L0OC 2EBIA 2EB7A 2Z1DA 3HM5A 1Z9CA 4PJLA 1IV6A 3T8WA 1IN4A 3BTCA 2WAEA 5B1AH 1I3AA 3WC7A 2E34A 4L18B 1MNDA 1WJ5A 1ZG1A 2Z11A 2LH9A 3AL0B 3IH3A 3S1NJ 5EG0B 2GXBA 2D45A 4MTDA 3L2UA 5LYLA 2VEZA 1E3OC 3HSRA 3ZOBA 2ZOGA 2PJ9A 3BI1A 2EIJH 4MFEA 5FJ8J 1YJ9I 5AGEA 3CO6C 3BPVA 4CGMA 2WV0A 1SD4A 1ZH5A 2ZW6A 3HRMA 5FLXK 2QJ8A 2K27A 1UG0A 4RGSA 2PVWA 5L3CA 2PDOA 1QSRA 1F1ZA 2R7TA 4JWPA 2QKMB 4J01A 2F4MB 5BOXA 2M9HA 5JLWA 3O8GA 1EH6A 3HRUA 2VJ5A 2DI3A 3SFIA 5JFRA 1MBKA 1YVKA 3K4BA 1OYWA 2HEOA 2Z2SB 3TOBA 2HI3A 2I8DA 3FXJA 2HB6A 2VONA 3CPAA 2YGWA 3KETA 5CYVA 1W4MA 4E7IA 1R4NB 4W97A 1H89C 1LRZA 1USSA 4Y13A 4UB6C 3BCBA 3T5XA 1YOVB 2EV0A 2JA2A 5E8GA 1WJAA 4XRMA 4NGTA 3E7LA 2CNMA 3ISXA 3EETA 1N25A 2V1UA 4HOBA 2DBBA 4ZY1A 4XN0A 4JJXA 3QPSA 3IJ3A 1XJOA 2EVNA 1MDMA 2NYXA 4XKBA 1Z7UA 3QOEA 1YGHA 3PB9X 1VQPI 3JUWA 1GUUA 1X2MA 4CYDA 1XS9A 1IRFA 4U88A 3HB9A 2Z0ZA 3W2AA 1F5TA 3F6VA 5CNPA 2O61A 3L2QA 3PUFA 3H0DA 1SAXA 4MFQA 5IOYA 2ECCA 2ZJ2A 1SEUA 2WB1A 1S7KA 4A5NA 4HNVA 1A31A 1YS7A 2K85A 3DEWA 5ILUA 3ZMSA 4LK0F 3QYEA 3K4MA 4AIHA 1HDUA 4LB5A 4D1QA 2BY3A 2HDDA 1B8IB 3H0GJ 2WA0A 4A3GJ 2Z16A 1RUNA 2XF5A 5CLSA 3SXNA 2FF4A 4AM3A 3QU3A 5AONA 1DPUA 4ZYQA 4B11A 3PB6X 1T0FA 1D0ZA 1WGXA 4RB1A 4NUBA 4RUHA 5JH9A 1R1VA 3HPGA 4NCZA 3FKJA 4Y33A 4IZZA 4ESFA 4M3SA 1DUXC 1IIDA 1VQ4I 4DJLA 4M6YA 3ABKH 3L7WA 3QWLA 2QGUA 4GS4A 3I59B 4EM0B 4HQMA 2PBIA 3K9TA 2FE7A 3MCZA 2BXZA 3SJGA 1V5EA 4PPZA 1E3HA 3VYUB 2WBMA 4Q47A 4AVCA 4RGXA 5D29A 1WWXA 2D4OA 4HKFA 1MBEA 4UFVA 4RB2C 3K4CA 3CLOA 4MHGA 2OC6A 1KGSA 4U0YA 1Y0NA 2NNYA 1QZEA 3F8CA 1WH5A 2B4DB 2P6EA 1TW3A 2DODA 2K9QA 3DPLC 4H6UA 5E3NA 4BS9A 2JA7J 2QF7A 2R7ZJ 4UV9A 4F7ZA 2DMQA 4KFCA 3H36A 1HW1A 2ZMEC 3M1CA 2P5LC 4MLOA 3CUQC 1BOAA 1WJFA 1HDDC 5C3EJ 1EF4A 5E1WA 3BROA 2NNNA 2EPFA 3PL8A 2DAOA 1TNSA 3PQKA 3OL4A 3HOSA 2PJCA 1QRYA 2ZEDA 4NF1A 2QECA 3ZMZA 3PJRA 2WAQN 4JQFA 5BWAB 4MMOA 1OCPA 2F5CA 3S6KA 2XAFA 3VH9A 4LIVA 5LHHA 2BL1A 1K4SA 3HLPA 1S7OA 4ZYHA 2ZNYA 2E1OA 5D4RA 1M4IA 5HVHA 1R57A 3B3TA 5DWNA 2G9WA 4WX9A 1U2WA 3RZOJ 2PJ5A 4M72A 2DF5A 1IOFA 2O4HA 1TWAJ 3I56I 1SD5A 1H88C 2NSMA 2IA2A 2Z10A 2JVGA 3RKXA 1R9TJ 3F72A 3Q5FA 1VQMI 2HQYA 3RYOA 3BCAA 3I58A 4UV8A 2HUZA 5IT9K 4H6ZA 3ULQB 4NXYA 1XPXA 4JX5A 3ZMTA 2NXNB 2RFHA 7CPAA 4HDVA 4B5OA 4M6VA 4FHTA 4P1WA 1XE4A 4BAYA 2NOJB 4GO1A 2L7KA 4MBUA 5I4MA 3R4KA 2RDPA 3EQLF 1SMYF 4XKWA 1Q2DA 2BGCA 1V0CA 4A31A 3N4MA 4C2XA 3H3VK 4ZI6A 5C4JJ 3JR9A 2ZEMA 1XG1A 4IUSA 1WJDA 2KQRA 3U2RA 2ZBKA 4XRSG 1J75A 2CY2A 3PFOA 4B09A 1CP6A 1M44A 1X3ZB 1LAPA 1TKFA 2DA5A 4A3BJ 1RESA 2JLMA 2EFOA 3IAM2 5B1BH 3W6JB 1JQGA 3KKWA 3CJRB 1YR0A 1K7AA 3D5RC 1HBXG 2X9DA 2Y31A 1I50J 2RC4A 3RPUA 2LRDA 1ULYA 4ZYGA 5DUIA 1LE8A 1KU9A 1GLNA 2KFDA 2VKEA 1N78A 1ZGJA 1CX8A 4OIQF 5GPAA 3KYLA 2WC2A 3R9EA 2ZFWA 4DYRA 2HTJA 3GYHX 2DTZA 2RKHA 4ENNA 4F8ZA 5JQ4A 3AG1H 2OQGA 2IS4A 4L0ZB 2PRBA 2OZ6A 3MRUA 4EJOA 1DU6A 2XUBA 4D7MA 4DW6A 3E6DA 3GW2A 2IVMA 5EG0A 1JE8A 2CH0A 2BEIA 3FKIJ 3ABLH 3OSGA 2VN2A 3VB2A 1VQ5I 2XGXA 1DU0A 1KZFA 2EFPA 4Y7NJ 4HF0A 2H09A 3U21A 2XGCA 1XGMA 3D0SA 1JWQA 3QB8A 2WADA 4OKOA 1Y0YA 3SHPA 1AOYA 2W25A 4RAYA 3DU6A 1KQ9A 3OIQA 3RQIA 5J4VA 2B7EA 1UFHA 2MH2A 3LA7A 1TQPA 2D2WA 2JN6A 2AQFA 2W84A 3AFHA 3E5XA 4HPQA 2QQBA 4ITVA 5IOZA 3ZQIA 2R7XA 4P4JA 2CQKA 5DM7F 2P5VA 4EATA 2B58A 2POKA 3B3VA 4BEHB 4LITA 2LFBA 1JJ6C 3CZ6A 4UWIA 2WTEA 4RAFA 2DFEA 2RAEA 3JRDA 5CVRA 2EA4A 1GHEA 5EGOB 5BPIA 1YQAA 3FB3A 3PGPA 4DYCA 1L0CA 2HTSA 2KIQA 3H8GA 2DT6A 3FX6A 4KIGA 2CO5A 3V4GA 5IYBJ 3LAJA 2Q04A 4IHSA 4A3IJ 1QGPA 3GY9A 3GTKJ 4V2FA 4HF2A 4F9UA 2IP2A 1HSJA 2KIMA 5G22A 2ZKZA 1WCMJ 4KUAA 1MH4A 2KRFA 1Y0UA 4XLFA 1YO5C 3O8HA 4K2EA 4HLYA 5BMZA 1SFOJ 3NH4A 2J5PA 2CW0F 4RB0A 1H8AC 2V8HA 2PJRA 2YNCA 3ZRGA 3K4NA 2HU9A 4KSIA 1XX5A 3LAPA 2FJ1A 4F0YA 2DDBA 2Z9OA 3B3WA 3DBRB 2V9KA 3KP3A 5FKOA 4EFDA 4ORFA 1Y9KA 3I9SA 2LP0A 2RN7A 3LSTA 3C18A 2L2OA 3FXMA 4UCMA 1B8IA 3F8NA 1S7EA 2J8MA 3NE8A 1ZG7A 2N8GA 4OIDA 2VUMJ 2A5YB 1YX0A 3E6MA 4E4HA 3OYDA 2VXDA 4WXCA 5F1RA 2D1VA 1YX5A 3VWDA 1Y1VJ 3I3GA 1SFKA 1KYZA 1Z77A 2L9SA 4F0XA 4BE1A 1XB4A 4F9VA 3FK7A 1JTXA 3FK6A 5KK1A 3CXQA 1VIXA 3H8EA 5EEHA 1W5TA 4BXXJ 2V77A 2XGEA 2IQ6A 4MJ8A 2K40A 2F48A 1U8RA 4CYNA 4N9HA 1FOXA 3I59A 5E96A 1BR4A 3S93A 5D5VB 3H35A 3V8IA 3NRVA 4FD7A 1Y8QB 2JZYA 4L5EA 4RS2A 2V8VA 2Q7BA 2LG4A 2JTVA 2R7WA 2R5YB 1Q2YA 3TO7A 5JR3A 2ELJA 2NVTJ 2O28A 3DGVA 4MFLA 1S9HA 2ZO4A 2IT0A 3F0AA 2F5EA 3G6EI 2PMUA 4RGRA 2CW7A 5GAHJ 2B4DA 4KOTA 4OIRF 2CTBA 3MMYB 4WJBA 1BW5A 3DLJA 1FX7A 2DT7B 4I6ZA 4RM2A 4DIQA 3DNSA 4A2UA 3IWFA 2OPTA 4HNYB 5GCNA 2VL8A 3TGNA 5H6RA 2O3FA 5EBVA 1G3YA 1PDNC 2XRNA 3SQNA 4II9A 1V4RA 4IRHA 4AIKA 1AWCA 3A9LA 1Q1HA 2COBA 5H2FC 4NC6A 4B12A 5D6FA 1LANA 5EC4A 1ZHFA 4M3GA 3R0JA 5B66C 4CAEA 3A02A 2XF6A 1HQCA 2R0QC 3GF2A 2X1CA 2R4GA 3A0BC 3BT9A 3I64A 3WG7H 4BY7J 2Y69H 4A3CJ 3JTGA 2OBPA 2L7ZA 3ZZIA 4CRYB 2JUCA 3KE2A 1F2OA 5DV5A 5K7HA 2X7BA 3W6SA 2IBDA 2X1EA 2XAHA 4CCJA 3JVNA 1P4XA 3HSFA 4RBOA 1FTTA 2F4IA 4F92B 3JRIA 2YX4A 2QA4I 3M07A 1BPNA 2EK8A 3DV8A 4V2GA 2DFHA 1KQ8A 4KVME 3H4QA 5HLTA 4HG2A 1K79A 2MSYA 1BBYA 4Z2YA 2PJ4A 3P9IA 3MZ8A 5F27A 3FDYA 3T9YA 2RQPA 2QQ8A 2O0YA 1K4TA 1Z21A 3FVLA 1B9NA 5IP7J 3OS1A 1MNMC 3VWEA 3DWLE 4FD5A 3ELKA 2L9VA 4B48A 4HV5A 3H5AA 2GE3A 1I1GA 1IXSB 2ZJPF 4YIRX 2LKXA 2XPWA 4A69C 2QUFA 4RMNA 1RUOA 2D1HA 3W6KB 1CJWA 4Q38A 2XDVA 3QYBA 1CP7A 1GVDA 3B3CA 1D0YA 4Q36A 1QVUA 3ZR8X 4MO7A 1ETKA 1YITI 2R8VA 1XN7A 3D7FA 3D5LA 4HSTA 3ASOH 4KICA 2R7OA 1SMTA 4ZX8A 5ICGA 2JSPA 4L9NA 5CVVA 2GLJA 2MYSA 2FEZA 2QVOA 3BQYA 3UKGA 2H1KA 4YRHA 2ZXIA 4A39A 1FOYA 4OINF 2KDOA 1GXPA 1X1PA 4B5PB 1B59A 1MMGA 3W91A 3PFYA 2JK3A 2CTCA 3I53A 5LYFA 2OU2A 3CCVI 5L3DA 2KHMA 4YFNF 3GB0A 4YFXF 1P7IA 4ZX9A 2IXSA 3JAMZ 4ZYDA 3L2NA 3P7NA 1LUJB 4R1HA 4I76A 2DMUA 3D3SA 4XK4A 4Z65A 3Q0WA 3ZXSA 4L9TA 4NC7A 2QYVA 3L2CA 3E3VA 2I3CA 2OTJI 3IKVA 4KJZA 4RM3A 2FUG2 2A6HF 9ANTA 4E7HA 2AFZA 3M9AA 3KQXA 2DQLA 3Q9VA 3KEOA 2ZXJA 1FWZA 3BI0A 4A6DA 1X10A 2DMTA 4MRIA 2HQ5A 4G6DA 1SANA 2OJED 1H8LA 1LFBA 2QSGX 3NA6A 5FFXA 1AKHA 2QQAA 5IYCJ 5C82A 5HDKA 4ENJA 5JVGF 3GTJJ 2OD5A 3E0JB 1JGGA 4BEHA 4NGMA 1BJZA 3WU0A 4NQWA 3SZPA 3RI4A 1ZR2A 2E1CA 4M6GA 4OWRB 2MC4A 1UFMA 3CJTB 4ONUA 5HS7A 2PG4A 2H6BA 4R79A 1RRJA 4IHVA 4X1EA 5ILVA 4ENMA 1EE3P 3FBIB 3SXYA 3K4JA 4P4FA 2Z3YA 4I0AA 3LSGA 1P4AA 4IHWA 3B3SA 1VKCA 4KOWA 4A38A 5K8NA 1Y7EA 3GFLA 2R98A 2Z33A 1PYTB 3ZQ7A 2CS3A 2BY0A 2JA5J 2F5IA 3ZPLA 2WPWA 2KIFA 1X1CA 3C2GA 5DTDA 1XMTA 2LLKA 3CMEI 1FOKA 5KTCA 3BJAA 3PQJA 4CYOA 1O3TA 3JTHA 3S1QJ 5F0FA 2ISZA 4C2TA 2R7FA 4NNJA 3I55I 4O6JA 4HX4A 4KOXA 1MJ9A 3BLNA 4HPSA 3OYAA 4FX4A 4GXHA 3LNQA 5HNHA 2E71A 3H1CA 4IK2A 1UB9A 1YJWI 1P4WA 1LQ1A 3BLYA 3IL2A 2CV2A 1ELMP 3TC8A 2GZWA 3KZIC 1X2NA 1G2HA 3HSEA 3D8PA 2BVLA 1NK3P 3VODA 3VEPA 3JREA 3TFYA 4BHBA 1X3WB 1ZQ3P 1I27A 1S7LA 1W7PD 2BZTA 2OH1A 4XR6A 3ABTA 2K3PA 1ON1A 2R7UA 3CCMI 1FYMA 1PP8F 2KP6A 3HJEA 3MN2A 3R6SA 4A3DJ 3ZMUA 4QC6A 2V9VA 2YS9A 4L0YB 4E7KA 4YU9A 5D6EA 3GFMA 3GLLA 3G1OA 2FQ3A 2Q4ZA 3IH2A 1D1AA 1ARLA 2K9SA 4KVOE 2GBYA 5DCFA 5D8NA 4RAGA 5L3EA 1SFEA 2LY1A 1R00A 1UWYA 3D2MA 1T6SA 3Q0VA 4XL9A 4BL0B 2EQRA 4ETSA 1U78A 1W1WE 4LLLA 1CQTA 2XB5A 1IRGA 1ITYA 2R5YA 4J00A 2LYCA 4NGRA 3CMMA 2P5KA 4F52A 3CQZJ 2ZEFA 1J09A 2X51A 4P4EA 3DR6A 1BLLE 4KOVA 4DYOA 2E19A 3MVPA 3F23A 3RPQA 3OR2C 2FSRA 5AG6A 2K86A 1I5ZA 2ZFUA 3HKZN 1YTYA 4GYIA 3GTGJ 4P44A 1D8JA 4BINA 4PGGA 3CC7I 2FX0A 3E5QA 2ATRA 2R7QA 2DMPA 2ZCWA 3S32A 2QENA 4ZZLA 3TQNA 1PUFA 3N7ZA 2DFFA 4MFJA 4B44A 2WY7Q 4NGPA 4U87A 2I10A 1JGSA 2A6TA 3T8TA 5LEJA 2GA1A 3FIWA 3PB8X 4I09A 5F04A 2MLGA 4LLNA 1LVAA 3KEYA 3CXSA 3MKWB 2F5DA 4E7SA 4CHUA 1T0FC 2HWVA 1YRNA 5FKMA 3I54A 1VQKI 3GMEA 2YNDA 3S2DJ 3QPLA 4L89A 4U9ZA 4DBRA 3QYFA 4BDYA 1DGWY 3KZZA 4XRSA 2C1CA 1Z05A 2K9LA 3KX2A 3HBLA 2JEWA 2ECBA 4IX7A 3OIOA 2HPIA 3B8GA 1OCOH 2V4JC 4XIDA 5BPDA 1N77A 2KDZA 2F6CA 4C3IJ 3J7ZI 1IW7F 4W1UA 4C2UA 5L3FA 2XKPA 3D68A 1XTAA 1GV2A 1YE9A 2ETHA 5H84A 2VIXA 1S5LC 2FT0A 2Q0YA 4PUSA 1Z8TA 1IXRC 3GCMA 3HOUJ 3GTMJ 2J8RA 1WFXA 4R6TA 4ANJA 4X8IA 3HTUA 3EFAA 4M85A 1X4PA 2A6EF 3G8WA 1FOWA 4NJQA 8CPAA 3OS2A 2ID3A 3JSPA 1LE8B 2Z99A 2F5FA 1LDJA 1TW2A 4DZPA 2EZIA 5JM6A 3OYEA 2EV5A 2A4NA 1V55H 3OYGA 5ELYA 2LR8A 3OYFA 5KAIC 1W7PB 1E17A 4Y4RA 2DYRH 4AD9A 4GFBA 1XBUA 3K1NA 4CA0A 3PIOF 3ZCOA 4MY3A 1R5GA 2VC1A 4XLAA 4QBJA 4MHNA 1HF0A 4MHDA 3K70C 3C3WA 2J8NA 4UUVA 1QPIA 4XLPF 3GYAA 5E8IA 3HOYJ 3S6FA 2DTRA 3OMYA 3TO9A 3I4MJ 4HEA2 2ZW7A 2WAFA 1RI7A 2LMDA 3DFGA 3N05A 3TDZC 4BJTA 3MAJA 4ZYEA 3NARA 4MHPA 3L2WA 2A05A 1RC9A 3R9GA 3BJ7A 4NGNA 1OISA 2FL4A 4B5PA 4IHYA 2VQGA 1S6LA 3R61A 3WTXC 2NS8A 2M4GA 2LF7A 4A3EJ 3R60A 1OZPA 2GXGA 3EYYA 1LNWA 3GXOA 4ASNA 1IGNA 2QCOA 4M3DA 5DEQA 3JRBA 4HBLA 4RGUA 2PJ0A 3ZQFA 4PV6A 3TT2A 5IB9A 3KIOA 3T1BA 4MFKA 3H8FA 1FYLA 1XSDA 1Z9UA 5J8CA 1U9OA 2WAQA 4C30A 1SFUA 1DP3A 4BE0A 1GV5A 2EK5A 4RLFA 2LDUA 3IAS2 3V8LA 3DCFA 2A5WA 3KYDB 4KT5C 1PUEE 2VLAA 1KU2A 1S8NA 1TNTA 2L9RA 2YU3A 1D8KA 3WGGA 1BJAA 1TF9A 3FH4A 3QP5A 5LBQA 2Q0OA 3M8EA 2M7AA 1IYLA 1GXQA 3VARA 2ADUA 2Q44A 5J8FA 3FEEA 3G4SI 2LK2A 4G12A 4UY8I 1NG6A 3OR1C 3GKRA 4BMHA 4HNXB 2BYVE 2IA0A 4CCLA 1RO5A 2ZW4A 4MFZA 4MCSA 4I99C 2REEA 2M4KA 1N71A 4P4BA 3LSHA 1UMQA 5LLQA 2GXAA 2P8TA 3CLQA 2PJ7A 2HGCA 5B5EC 3OYCA 3A01A 2PJRB 4NSQA 4UWJA 3NH5A 3MQ0A 4KIBA 4XPDB 4C2ZA 4LB6B 4JP0A 1X12A 4CH7A 3B35A 5CJ9A 1OMIA 2KMUA 2A61A 3SDGA 1FP2A 2WUUA 4CCNA 2PE3A 4I01A 3QODA 5TISC 3A03A 4LQ6A 4BYYA 1DE4C 5K8OA 5BQTA 5F0HA 1I6HJ 1Q2CA 3ROUA 4K3NA 4IO9F 2AFUA 5ICFA 4CRZB 2JRTA 1R5HA 2CRGA 1HXDA 1G3SA 4KLWA 3GEZA 4A0XA 5FKLA 2ZEEA 1ODDA 5HVGA 4UEZA 4HQEA 1J9IA 3KQZA 3S16J 5HXDA 4ZYAA 4P6YA 4HX7A 5HS8A 1IYKA 1HLVA 1ZK8A 1X1BA 2NYQA 3AL0C 2Y0SN 5DUKA 4BHPA 2DMNA 4FASD 5LD2C 1B72A 1DGRM 2DDAA 1UHSA 3CPXA 1QQ9A 3PBEA 2XPVA 2BW3B 5LHIA 3DTKA 3HHHA 3VOEA 1YW6A 4HRIA 1S5KA 1XGOA 5IP9J 3Q0UA 1APLC 5HVQC 4Q4ZF 1Z67A 2JRMA 4EM2A 2RNGA 4C7HA 1R1UA 4XMYA 5F6FA 2F2EA 3K4KA 3NAUA 5M5XJ 1VF9A 3D7GA 1BW6A 5HDNA 4R8FA 4BD9A 3PFIA 3B2YA 2FSWA 4Z6YA 1IF1A 1ZGAA 5K7FA 2VXKA 3P9CA 3FXUA 2EWBA 2Y9ZA 2LKPA 2QWWA 3QPHA 1RXTA 3TTHA 2AXLA 1RIOH 3CT9A 3WU2C 4KIFA 5GTHC 3FXRA 2GOMA 2X6WA 5HS9A 2CGPA 3SZGA 2DPUA 2AFSA 1B87A 2CUEA 3ZQHA 1L3LA 2B63J 3FRMA 1MMAA 1Z91A 5KCMA 3I0TA 3WTVC 1O3QA 3VATA 4RAZA 3GTOJ 4KS9A 3DXJF 1YQEA 3EO4A 3MWMA 3BDDA 2IMOA 2BE5F 1YW4A 2VODA 2H1LA 5HODA 4BQAA 1R6RA 3PNTA 3K0LA 2HDCA 2WZNA 4QPOA 4E70A 2PJ3A 3HOWJ 4B13A 1BM9A 1WZ2A 3CC2I 1TQMA 4ZDOA 3TO6A 4CICA 2YNCC 4XPDC 4PJ0C 3CP8A 3AG3H 3BG6A 4LOCA 4HNUA 3G3SA 2ISYA 4UIAA 5ILSA 1YIJI 1MJBA 2CJJA 3V7CA 3BTLA 2G7HA 3LSJA 2L5QA 2C6GA 3JRUA 3NH8A 1GHCA 1S3JA 4AVPA 1XSVA 2KT0A 5K5RA 4AUXA 1OR7A 1O4XA 3JRGA 2CV0A 4EMSA 2JVHA 2CV1A 2V8GA 1IN6A 3P2FA 1LCPA 2BSWA 2L7FP 4EM1A 4L5IA 1T39A 2JDCA 2FA5A 2FXAA 2M8EA 1B9MA 1ETXA 3RYPA 1RR7A 2EZKA 4OIPF 5K8PA 4LMYA 3WR7A 2KL4A 3PFEA 2KZGA 5E3OA 4TNUA 1SVOA 1XMXA 3WTUC 1TL8A 4OC4A 4TWEA 1ZRDA 3FJUA 4R87A 4M73A 3GBGA 4FE7A 4NEXA 2R93J 4I98B 1PJRA 2W24A 3L1PA 1XDUA 1K83J 3O2PE 5A2QZ 2ZOFA 3F22A 4E8OA 4PGHA 3DBHB 3H3UA 3CDHA 2XAJA 2MD0A 2NVQJ 5IB0A 1REPC 3S14J 2BOLA 1KUXA 1O57A 1Y39A 1ZREA 4F91B 1XF8A 1IOIA 5F47A 3HYIA 4O23A 3FISA 4CCOA 1ZARA 1K61A 2BY1A 1FYKA 2F8HA 2ODFA 4NGQA 1MW7A 3CXPA 2X6XA 3CCRI 4UFWA 4UEEA 1D5YA 2HR3A 2KPMA 2AE6A 2GANA 4XRFA 3BG3A 2RV8A 3BR5A 3DKWA 3FIXA 3M1EA 2CYYA 1MD0A 2CXAA 4PK2A 4PQAA 4R3KA 1MBJA 1W7PA 1YLFA 3RO0A 2ZJQF 1HDPA 1LJ9A 4GXOA 1JJ8C 2CU7A 5F09A 4XBFA 2V9PA 3WE2A 4YIIA 1BOBA 2VZYA 2G3TA 2M3AA 5LFAA 2LVSA 3H9GA 4MGRA 1JKRC 1FJLA 1QMUA 1AUGA 2EUIA 5HOOA 1Z2LA 1U5TB 3K2AA 3FXQA 4XICA 5KNLA 4M71A 1VHEA 1YHQI 2M87A 5KVRA 5LGUA 1YX3A 4H89A 4IRGA 1N75A 5F1JA 2VT3A 1BN5A 4FTHA 2NVXJ 3R9FA 2KCWA 1XGSA 1AKHB 3OYJA 2HOEA 3WHCA 4FD6A 4Y49B 4AXVA 2Y48A 3CZXA 5A27A 2ZXVA 4DJAA 5CVUA 1K78B 4NQWB 4CPAA 4ZZDA 3CDIA 2E7XA 1U8BA 4N4OB 1RKTA 1MBGA 2JSCA 2RREA 1J0RA 3KP5A 1VQ7I 3PEIA 3N5FA 4BNCA 1QQIA 2NS7A 2R7DA 5EYRA 3MN8A 4EVIA 5DM6F 3KR4A 4P4DA 2LNBA 4FQGA 1S60A 2HOTA 3J81K 2Q51A 2E5ZA 2K3FA 2LF8A 4I02A 5J1UA 2PR1A 1OPCA 3DTIA 5D5XB 1YSJA 2DXQA 4HNWB 2GQQA 2VQYA 2L4AA 5K5QA 3K2ZA 4CAFA 4ZC3A 2C6PA 2RB7A 4KOYA 2Y30A 4ESBA 1XMBA 1M4DA 4MY0A 4CCMA 3VSLA 1DDNA 2CWEA 3BTJA 1IJWC 1OLTA 2RNJA 3OYHA 3LMMA 5C88A 2YPRA 3MD2A 4UA3A 4C2YA 4BQQA 3D66A 4PXDA 4KVXA 1GYTA 4QTRA 2VZZA 4B14A 1ZAOA 4DBQA 1IC8A 5F48A 4CGZA 2VOOA 1ORKA 2XB0X 4QB9A 3S9MA 3BPXA 4KITB 5LRSA 1E0EA 3G3ZA 1TTYA 4A3FJ 1E3PA 1OCRH 4H2KA 2A07F 1F9NA 3F6OA 5E1XA 5HVFA 4F6AA 1TC3C 1WHUA 3FXOA 1T95A 5DYMA 1T08B 1IV8A 3OYMA 4A3KJ 3CDLA 4C3HJ 3RBUA 1YIOA 4D5CA 3M4OJ 1MMDA 2F5VA 2EILH 1AMPA 1FT7A 2DPSA 2JDDA 1OCZH 5GP9A 3V7ZA 3ERMA 3TL4X 3TDUC 2IA1A 1YK3A 2IGNA 1WSUA 2E2IJ 1CF7B 2LKSA 1PU9A 3L09A 1S7FA 3KCCA 3KP7A 4FX0A 4CCKA 2M7BA 3TW7A 3HTSB 4AG7A 4XLNF 1IO2A 3HUVA 2BW3A 4HDUA 1S7NA 4J19A 2GIZA 4C68A 5CVJA 1V3FA 5E18F 4M6IA 1MNEA 2LBFA 2JA8J 4OC1A 3FYNA 1JHHA 2AJ6A 1GVJA 2DOFA 2R1IA 4RB3C 3PM1A 1GT0C 4IHMA 4MCPA 3IV5A 2I00A 4XPKA 3DPTA 2UUZA 2G0BA 3FNCA 2E60A 2JQ7A 3FBUA 1W36D 2HZDA 4BQOA 1IN8A 4G7OF 4CYQA 4CZCA 4OC5A 2QLZA 5GAGJ 3EC4A 3SI2A 1TKHA 2ME0A 3EYIA 3KZWA 1PUFB 1YREA 3IRRA 4A94A 3J7AY 1J5YA 3BZKA 4N0BA 4B8XA 2O5RA 4E7ZA 4JXRA 1QBJA 2VI7A 2HNHA 2BEOA 2Z3KA 4LK1F 2I79A 2XASA 1YG2A 3VPRA 4ZY0A 1O7LA 1MZBA 3BR0A 1YRNB 1K4JA 1KU3A 2B5GB 3BC8A 3B6AA 2PIYA 1X1DA 3I1UA 1EJ9A 4S0HB 4CAWA 3L00A 1WPKA 4ZTFA 2M5WA 3HGYA 3CP2A 1MKMA
chains in the Genus database with same CATH topology
4XOPA 3BCBA 3D8PA 2BVLA 2MFZA 1WJEA 2ZW5A 4AVZA 2JA2A 3TFYA 1WJAA 1S7LA 2CNMA 2OH1A 2PSWA 3HL2A 4E2AA 4XR6A 2R7UA 2K3PA 4YELA 4XN0A 4JJXA 2W00A 2EVNA 4JOMA 2KP6A 3K6GA 4XKBA 3QOEA 4Y3OA 4BUPA 1YGHA 3JUWA 4QC6A 1NSLA 4BACA 4E7KA 2Z3PA 2K9MA 3JTKA 2Z0ZA 3S6HA 3W2AA 4JD6A 5CNPA 5H86A 1D1AA 3L2QA 4KVOE 3H0DA 4MFQA 2OB0A 1G8XA 2WB1A 2LY1A 1S7KA 3D2MA 3H9JA 4BL0B 4XL9A 2UV1A 2V6EA 4KORA 5A28A 3DKXA 1IRXA 3QYEA 3DLAA 3K4MA 4J00A 2LYCA 3CMMA 4F52A 4D1QA 2ZSHB 2XAUA 2WA0A 1MK4A 1XIXA 2OZUA 1J09A 2OZGA 2X51A 2Z16A 1SQHA 1S3ZA 3DR6A 2XF5A 4KOVA 3TOAA 2LY2A 2VB6A 3HC7A 2FSRA 3OR2C 2Z3MA 2Z3OA 5AG6A 3SXNA 2ZFUA 3T90A 1UAAA 4AB7A 4AYBA 2BUEA 2ATRA 2VQHA 4B11A 2R7RA 4KLVA 1D0ZA 2R7QA 3S32A 4GRIA 4NUBA 3N7ZA 2E1MB 4MFJA 2HVRA 4B44A 4NCZA 2WY7Q 3HPGA 5IX3A 4CAXA 3FKJA 4Y33A 4U87A 3UR3C 4IZZA 2A6TA 3S3MA 3ZQQA 4M3SA 3IUOA 2VJIA 3PNVA 1IIDA 3KEYA 3SYTA 3CXSA 3MKWB 4GS4A 2W1OA 3OYIA 2FE7A 3OY9A 4E7SA 1T0FC 1V5EA 4RLQA 3S8PA 1M4GA 4DGWB 3VYUB 2WBMA 5FROA 2YNDA 4L89A 4U9ZA 4AVCA 4DBRA 2D4OA 4HKFA 3NWTA 3QYFA 4BJ6C 4BDYA 4LX9A 1DGWY 4UFVA 3K4CA 2M0MA 2OC6A 3E0KA 2K9LA 3KX2A 4NC8A 4B10A 4IX7A 2WPXA 2Q4YA 2HPIA 2B4DB 3B8GA 2V4JC 3I9V2 3PSFA 1N77A 3R95A 2F6CA 4IKFA 4XQFA 1D1BA 4C2UA 3DPLC 1I12A 2MABA 4BS9A 1YE9A 5H84A 2VIXA 2FT0A 2Q0YA 4XNHB 4KOUA 1ZELA 2FIWA 4PUSA 2VASA 4PFOA 3M1CA 4A95A 2K5TA 4MLOA 2J8RA 3K9UA 1WFXA 1VZ0A 4ANJA 2LC2A 1WJFA 3D5SC 3OL3A 4KISA 3EFAA 3EXNA 4M85A 4MFPA 5AG5A 1X4PA 3R96A 4A30A 2ZSIB 3G8WA 1ON0A 3PL8A 4XKVA 1WK4A 3OS2A 2DOAA 3OL4A 4QPQA 3HOSA 4F3QA 4NF1A 2QECA 3PJRA 2HQAA 4LG3A 5F46A 3OYEA 4JQFA 3TMOA 2HVQA 5G20A 5BWAB 2A4NA 4XN3A 3OYGA 3H9QA 3LSMA 1P4NA 3OYFA 2OZHA 3S6KA 1P9QC 4LIVA 4Y4RA 2BL1A 2IGMA 4CA0A 4AU7A 4I49A 3ZCOA 4MY3A 1M4IA 3F8KA 4XLAA 3VDXA 2PMZA 1R57A 3EUHC 3K70C 4MHDA 5DWNA 2CMPA 4QBJA 2J8NA 2E5NA 4PJJA 1QSTA 4Y49C 3CF2A 4ZDLA 3GYAA 4BJ5C 3S6FA 5IV0A 3OMYA 2ZW7A 3TO9A 4HEA2 3ZJ0A 2WAFA 2R7SA 3N05A 2Z10A 4UCPA 2JVGA 1Y9WA 1X1AA 4BJTA 4UFXA 5G21A 2HQYA 3RYOA 3DR8A 4F93B 3BCAA 4P5OA 3L2WA 2B4BA 2HUZA 4H6ZA 2BVMA 2X85A 3H5RA 4ZDPA 2FL4A 3BJ7A 2VQGA 3LSKA 4XPLA 4B5PA 2W82A 1OZPA 2M4GA 4YGOA 4R57A 3R1KA 4LIUA 5HH1A 2E1MC 3MKYB 3DKYA 1YVOA 3AKZA 1IB1E 3DDDA 4B5OA 4PV6A 3M8JA 3TT2A 4MFKA 4P1WA 1XE4A 3FXTA 3SXOA 4E6KG 2NOJB 1Z9UA 2FCKA 5JHFA 2L7KA 4MBUA 5AG7A 2WAQA 2X1DA 5J8CA 1X4OA 4C30A 1DP3A 2Z3NA 4XKWA 3RTRA 4BE0A 1Q2DA 3BJ8A 4RLFA 3IAS2 1V0CA 2A5WA 4A31A 4C2XA 2B3VA 1QSOA 2VLAA 4UBRA 4G6TB 4A33A 1YLEA 4IUSA 1QU3A 1WJDA 1IYLA 2KQRA 2M7AA 2CY2A 2Q44A 3F5BA 5J8FA 4PJNA 5TGTA 1M1DA 1M44A 3LODA 4QUSA 4BMHA 4KSFA 1NG6A 3OR1C 3LSIA 2HVSA 2JLMA 3GKRA 3IAM2 4CCLA 4HNXB 3KKWA 3CJRB 1HA8A 3W2VA 1RO5A 1YR0A 3D5RC 4XONA 2ZW4A 4MFZA 4PK3A 4X0GA 3OYBA 2FIAA 2REEA 2RC4A 2M4KA 1N71A 3LSHA 4YFJA 1TZLA 2LRDA 4CAVA 3HG9A 3VSKA 2LOOA 1WWZA 2Y0MA 3OYCA 4UWJA 2PJRB 1GLNA 1N78A 3C26A 5FRNA 3MGDA 4NSQA 4XPDB 4C2ZA 4CGNA 4ZJZA 4CH7A 2VQCA 2VKDA 3KYLA 2KMUA 4XNHC 1QSMA 3R9EA 3LL7A 2WUUA 4CCNA 5JQ4A 3QODA 2IS4A 5G1ZA 2PRBA 4DOZA 1XEBA 2IL4A 4OLLA 1FMVA 3PNYA 4BE2A 4AG9A 4D9JA 1Q2CA 2CH0A 2FXFA 2BEIA 3CESA 1KONA 4CRZB 3HPHA 1Y56A 3C2HA 4KLWA 1DQUA 4J3GA 1MMNA 1KZFA 2CUJA 3VYTB 2P6EA 5F49A 3U21A 2XSJC 3OYLA 2W7NA 1B6BA 1NMTA 1TIQA 2WADA 4ZYAA 3DQVC 3QB8A 3SHPA 2XF7A 1MJAA 4IQ4A 1IYKA 3DU6A 1P0HA 1X1BA 5CQGA 3OIQA 3AL0C 1UFHA 4ITVA 4FASD 2AQFA 2Q2EB 3AFHA 4HPQA 5LD2C 2R7XA 2P6FA 4CS0B 1DGRM 4EATA 4E7LA 1U6MA 2LREA 1Y7RA 2IGOA 2B58A 3W3CA 4B47A 2K5CA 4LITA 3A1YA 4BEHB 1WJCA 2BW3B 3CZ6A 4UWIA 4XLEA 3DTKA 3W2WA 4HRIA 1S5KA 3D2PA 4EVYA 1I21A 5HVQC 2B5GA 3DSBA 2DCEA 2REFA 2RNGA 1GHEA 4C7HA 4BU2A 4N4NB 1Y6IA 4XMYA 3K4KA 3FB3A 3PGPA 3QAHA 1L0CA 4JXQA 4MI4A 4AVAA 5FVJA 4CUGA 2DT6A 2VXKA 4XKCA 4IF5A 2IGKA 3TTHA 1RXTA 2Q04A 2Q4VA 4U9YA 3GY9A 3OWCA 2KZVA 3HKZA 4CYPA 2GOMA 2X6WA 5G22A 3SZGA 1B87A 2DJIA 4KUAA 3NE7A 4XLFA 4OAZA 1QHHD 2ARHA 3FRMA 4CGLA 1MMAA 5KCMA 1PUAA 1X19A 3EY5A 4AVBA 4BBHA 2Y0SA 4QVTA 2PJRA 2YNCA 3ZRGA 3K4NA 2HU9A 4KS9A 5FRMA 1BR1A 4F0YA 3EO4A 2XC7A 4E0AA 3FNCA 2JEVA 2V9KA 4ORFA 4XNFA 2UWMA 1Y9KA 3K70D 3L2RA 1R6RA 3PNTA 3H5ZA 3I9SA 2L2OA 4UCMA 4QPOA 2IS1A 1NE9A 3CJQB 4YRVA 2J8MA 4B13A 1SAUA 1V5FA 4ZDOA 4XPDC 3TO6A 2YNCC 4PSXA 1YX0A 3CP8A 4E4HA 1LRZA 3BG6A 3OYNA 4XORA 2VXDA 3OYDA 3G3SA 1YX5A 2HDWA 3OOUA 4PJMA 1BR2A 3K10A 1FMWA 4HNUA 1LFPA 4U7BA 5KHDA 1MJBA 1SFKA 2PR8A 2VJ4A 3I3GA 2L5QA 2L9SA 4BE1A 3MKZA 4K30A 4F0XA 3CXQA 4E7JA 2VKHA 2P6GA 4BGDA 4R3LA 2CV0A 4MJ8A 2V1NA 4KUBA 2JVHA 3S3OA 4CYNA 2CV1A 1WJBA 5E96A 4OAYA 4II2A 1BR4A 3P2FA 3S93A 3RCOA 3OS0A 3H35A 2BSWA 2D4PA 2JDCA 4FD7A 3S6GA 2FS5A 3IU2A 3V8IA 3VWDA 2GOXB 2Q1ZB 4RS2A 2Q7BA 2LG4A 1Q2YA 2R7WA 4U5YA 2O28A 3TO7A 4CGPA 2ELJA 4XLCA 3WR7A 3BG7A 3SDBA 2KL4A 2ZXHA 4MFLA 1OR7C 1S9HA 3V42A 3F0AA 4R87A 4BXFA 3GBGA 2CW7A 3A4CA 4NEXA 2B4DA 4KOTA 1PJRA 2JUGA 2RQQA 3MMYB 4OAEA 3HXLA 2DT7B 1ZO0A 1LDKB 3EUAA 4RM2A 4DIQA 1VHSA 2B3UA 3G2BA 2PC1A 2VBQA 5HNFA 3DNSA 2VL8A 4HNYB 5GCNA 1IICA 2MD0A 5EBVA 5IB0A 4CSWA 2BOLA 5CQEA 1KUXA 3SEZA 4II9A 2QKLB 3VYRB 1W36C 3A9LA 3OIPA 4F91B 1XF8A 5F47A 1ERDA 4B12A 5EC4A 4CAEA 1U0JA 2CUZA 4CCOA 4LUAA 5HMNA 2XF6A 3RPUD 1MW7A 3PSIA 2X6XA 1TT0A 2X1CA 2R4GA 1I1DA 2QIRA 3CXPA 4UFWA 4KSAA 3ZGKA 2KPMA 2GANA 2AE6A 3UY5A 3ZZIA 3OWTA 4CRYB 1QHGA 1LVKA 2DPTA 1EA3A 3FIXA 3IU1A 2X7BA 4PK2A 2X1EA 2CXAA 1PYVA 4R3KA 4CCJA 3JVNA 3W6SA 2F4IA 4PSWA 4F92B 3R9GA 4C9YA 2NMTA 2VQLA 1BOBA 1AA7A 2VZYA 2G3TA 2M3AA 3PUBA 5LFAA 3H9GA 4KVME 3RQ4A 3H5NA 3H4QA 5HLTA 4HG2A 3IGRA 3P2HA 4ZTJA 2EUIA 5HOOA 2DXIA 4ZGYB 2OUMA 3FDYA 5KNLA 3T9YA 4H6UA 1UELB 2WY8Q 2KRHA 1YX3A 2HPMA 4H89A 3HUGB 1N75A 1Z21A 3OS1A 3EPZA 3VWEA 3W6XA 3R9FA 3DWLE 4FD5A 2KCWA 1Z4EA 4B48A 5CKTA 3OYJA 3H5AA 2GE3A 4ZBGA 2G3AA 4KOSA 4PK4A 4HNTA 4FD6A 4JLYA 4Y49B 5A27A 2ZXVA 4XM3A 4DJAA 3L2VA 2X6YA 4RMNA 2PQ8A 2OV7A 4NQWB 2R7HA 2CW8A 4N4OB 1CJWA 4Q38A 2RREA 2XDVA 3DEEA 4FETA 3QYBA 4PFPA 3HOTA 5KTDA 1QSNA 2LBFB 2WSAA 3EUKL 1D0YA 4IQJA 4Q36A 1S60A 3ZR8X 3VWBA 3TE4A 2R7VA 1KUYA 2R8VA 2E5ZA 4XOTA 3D5LA 4R9MA 4HSTA 2R7OA 4FD4A 2PR1A 3DTIA 1JI8A 4NXYA 2DXQA 4HNWB 5JPHA 2VQYA 2JSPA 4CAFA 4ZC3A 3PZJA 1D1CA 2MYSA 1Z4RA 4KOYA 4MY0A 1M4DA 4X5KA 4YRHA 4CCMA 3VSLA 2ZXIA 3SEQA 2KDOA 4RI1A 4YEJA 1Z3XA 4B5PB 1MMGA 1OLTA 3OYHA 3PFYA 3LMMA 3W91A 5C88A 4UA3A 3MD2A 4C2YA 4BQQA 4OADA 4KVXA 2C27A 2OU2A 4KZTA 2KHMA 2AQEA 2IS6A 1BO4A 2VZZA 1D0XA 4A2ZA 4B14A 5I0CA 2IXSA 4DBQA 5F48A 3LFUA 4B3XA 2VPLA 2IS2A 3ONQA 3DU5A 5DWMA 1G59A 4QB9A 3K4LA 3D3SA 4KITB 3ZXSA 2Z3LA 1E0EA 4NC7A 2VJJA 2YNEA 1K6YA 4F6AA 2ZPAA 4KJZA 1LKXA 2FUG2 4RM3A 1T95A 3UNGC 4E7HA 2KRCA 3OYMA 2H5MA 4C7IA 1Z7LA 2CNTA 1MMDA 1V5GA 2F5VA 2KLOA 3A2KA 2DPSA 2QMLA 4A32A 2JDDA 3OYKA 3FHNA 3RSNA 3TL4X 4II3A 3TCVA 3IP4B 2W4SA 1J4JA 1NG7A 1YK3A 2CFOA 2IGNA 4CGOA 1PU9A 5C82A 5KTAA 1Z3YA 5ISVA 2HV2A 1S7FA 4HSRA 4CCKA 3E0JB 2M7BA 4AG7A 4BEHA 2V7FA 4UCNA 4DNCA 2BW3A 1S7NA 1KUVA 2Z1DA 1FY7A 4C68A 4PJLA 4OWRB 2WAEA 1MNEA 2LBFA 3FYNA 1MNDA 1WJ5A 2MC4A 2AJ6A 2Z11A 2VXZA 4ONUA 2R1IA 4R79A 2LH9A 3AL0B 2I00A 4XPKA 3FBNB 4L8AA 3DPTA 2UUZA 3DTEA 3FBIB 3K4JA 2E60A 3VYSB 3L2UA 2G0BA 2VEZA 3FBUA 2P0WA 3LSGA 1W36D 2HZDA 4BQOA 5AGEA 4CYQA 1VKCA 4CZCA 3LD2A 4KOWA 4KT6A 4CGMA 2ZW6A 4E8OA 3EC4A 2R98A 1UG0A 2WPWA 3PP9A 2PDOA 2CS3A 3NWSA 2F5IA 2GIVA 1QSRA 3IWGA 2R7TA 1X1CA 2QKMB 4J01A 1YREA 3C2GA 3J7AY 4JWPA 1XMTA 5KTCA 2O5RA 4F55A 4H4KC 2L9NA 2VJ5A 4E7ZA 4JXRA 4CYOA 2VI7A 1YVKA 2HNHA 3K4BA 4XLHA 2CNSA 2Z3KA 3IWEA 2I79A 2Z2SB 3TOBA 2I8DA 4BQNA 4C2TA 4BDZA 4NNJA 2YGWA 4KOXA 2V26A 5AG4A 1MJ9A 3BLNA 3F9KA 3E1SA 3OYAA 5CPRB 3S3NA 1K4JA 4E7IA 5HNHA 3BC8A 2B5GB 4CAWA 1X1DA 3BLYA 2CV2A 4ZTFA 3DPUA 4B43A 1CM0A 3TBIA 3CP2A 3I3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D8P A;  2ZW5 A;  3TFY A;  1S7L A;  2CNM A;  2OH1 A;  2PSW A;  4E2A A;  4JJX A;  2EVN A;  1YGH A;  3JUW A;  4QC6 A;  1NSL A;  3S6H A;  2Z0Z A;  4JD6 A;  5CNP A;  5H86 A;  4KVO E;  2OB0 A;  1S7K A;  3D2M A;  4KOR A;  1MK4 A;  1XIX A;  2OZU A;  2OZG A;  1SQH A;  1S3Z A;  3DR6 A;  4KOV A;  3TOA A;  3SXN A;  2FSR A;  3T90 A;  4AB7 A;  2BUE A;  2ATR A;  4KLV A;  3N7Z A;  4NCZ A;  5IX3 A;  4CAX A;  4M3S A;  1IID A;  3CXS A;  4GS4 A;  2FE7 A;  1M4G A;  4L89 A;  4U9Z A;  4AVC A;  2D4O A;  4HKF A;  4LX9 A;  3E0K A;  2WPX A;  2Q4Y A;  2B4D B;  3B8G A;  3R95 A;  1I12 A;  5H84 A;  2FT0 A;  2Q0Y A;  4XNH B;  4KOU A;  2FIW A;  2K5T A;  3K9U A;  2J8R A;  3EXN A;  3R96 A;  3EFA A;  4M85 A;  3G8W A;  1ON0 A;  1WK4 A;  4NF1 A;  2QEC A;  5F46 A;  2A4N A;  1P4N A;  2OZH A;  3S6K A;  2BL1 A;  4I49 A;  4MY3 A;  1M4I A;  3F8K A;  4QBJ A;  1R57 A;  4MHD A;  5DWN A;  2J8N A;  4Y49 C;  1QST A;  3GYA A;  3S6F A;  5IV0 A;  3TO9 A;  2ZW7 A;  3ZJ0 A;  2Z10 A;  1Y9W A;  3RYO A;  2HQY A;  3DR8 A;  2B4B A;  2HUZ A;  4H6Z A;  4NXY A;  3R9G A;  3BJ7 A;  2FL4 A;  4XPL A;  4B5P A;  1OZP A;  4YGO A;  4R57 A;  3R1K A;  5HH1 A;  1YVO A;  3DDD A;  1IB1 E;  4B5O A;  4PV6 A;  3TT2 A;  1XE4 A;  3SXO A;  3FXT A;  1Z9U A;  2FCK A;  4MBU A;  5J8C A;  3BJ8 A;  1Q2D A;  1V0C A;  2B3V A;  1QSO A;  4UBR A;  1YLE A;  4IUS A;  1IYL A;  2CY2 A;  2Q44 A;  3F5B A;  5J8F A;  1M44 A;  1M1D A;  3LOD A;  4QUS A;  4BMH A;  2JLM A;  3GKR A;  4HNX B;  3KKW A;  1RO5 A;  2ZW4 A;  1YR0 A;  4PK3 A;  2FIA A;  2REE A;  2RC4 A;  1N71 A;  4YFJ A;  4CAV A;  1WWZ A;  2Y0M A;  4UWJ A;  3MGD A;  3C26 A;  4NSQ A;  4XPD B;  3R9E A;  4XNH C;  1QSM A;  5JQ4 A;  2PRB A;  2IL4 A;  1XEB A;  4OLL A;  4AG9 A;  1Q2C A;  2FXF A;  2BEI A;  4CRZ B;  4KLW A;  4J3G A;  1KZF A;  2P6E A;  5F49 A;  1B6B A;  1NMT A;  1TIQ A;  3QB8 A;  3SHP A;  1MJA A;  1IYK A;  1P0H A;  1UFH A;  4CS0 B;  2P6F A;  1Y7R A;  1U6M A;  2B58 A;  4UWI A;  1S5K A;  3D2P A;  4EVY A;  1I21 A;  2B5G A;  2REF A;  1GHE A;  3FB3 A;  3PGP A;  3QAH A;  1L0C A;  4JXQ A;  4MI4 A;  4AVA A;  5FVJ A;  2VXK A;  4IF5 A;  3TTH A;  1RXT A;  2Q04 A;  2Q4V A;  4U9Y A;  3GY9 A;  3OWC A;  1B87 A;  4KUA A;  3NE7 A;  3FRM A;  2ARH A;  1PUA A;  3EY5 A;  4AVB A;  4QVT A;  4F0Y A;  3EO4 A;  4E0A A;  2JEV A;  4ORF A;  1Y9K A;  3I9S A;  1NE9 A;  2J8M A;  4XPD C;  3TO6 A;  4PSX A;  1YX0 A;  3G3S A;  3VWD A;  3DSB A;  2PR8 A;  3I3G A;  1MJB A;  4K30 A;  3CXQ A;  2P6G A;  4R3L A;  4MJ8 A;  4KUB A;  5E96 A;  3P2F A;  2BSW A;  2D4P A;  3S6G A;  3V8I A;  2JDC A;  4FD7 A;  2FS5 A;  4RS2 A;  2Q7B A;  1Q2Y A;  4U5Y A;  2O28 A;  3TO7 A;  3WR7 A;  3F0A A;  4R87 A;  4NEX A;  2B4D A;  4KOT A;  4OAE A;  2B3U A;  2PC1 A;  2VBQ A;  1VHS A;  3DNS A;  4E8O A;  4HNY B;  5GCN A;  1IIC A;  5EBV A;  5IB0 A;  1KUX A;  4II9 A;  1XF8 A;  5F47 A;  5EC4 A;  5HMN A;  4LUA A;  3CXP A;  1I1D A;  2QIR A;  2GAN A;  2AE6 A;  3UY5 A;  3ZZI A;  4CRY B;  3FIX A;  4PK2 A;  2X7B A;  4R3K A;  3W6S A;  3JVN A;  4PSW A;  2NMT A;  1BOB A;  2VZY A;  2G3T A;  4KVM E;  3H4Q A;  3IGR A;  3P2H A;  2EUI A;  3T9Y A;  4H6U A;  4H89 A;  3VWE A;  3W6X A;  3R9F A;  4FD5 A;  2KCW A;  1Z4E A;  4ZBG A;  2GE3 A;  2G3A A;  4KOS A;  4FD6 A;  4Y49 B;  4JLY A;  2ZXV A;  2R7H A;  2PQ8 A;  1CJW A;  5KTD A;  1QSN A;  1S60 A;  3TE4 A;  1KUY A;  2R8V A;  4R9M A;  4FD4 A;  2PR1 A;  2DXQ A;  4HNW B;  5JPH A;  2VQY A;  3PZJ A;  1Z4R A;  4KOY A;  4MY0 A;  1M4D A;  4X5K A;  4YRH A;  4RI1 A;  4B5P B;  3W91 A;  5C88 A;  4UA3 A;  4OAD A;  4KVX A;  2C27 A;  2OU2 A;  4KZT A;  2VZZ A;  5I0C A;  5ISV A;  1BO4 A;  5F48 A;  5DWM A;  4QB9 A;  3D3S A;  4F6A A;  2ZPA A;  2H5M A;  2CNT A;  2QML A;  2JDD A;  3TCV A;  1J4J A;  1YK3 A;  1PU9 A;  5C82 A;  5KTA A;  2HV2 A;  1S7F A;  4AG7 A;  4DNC A;  1S7N A;  1KUV A;  1FY7 A;  3FYN A;  2AJ6 A;  2Z11 A;  4ONU A;  2R1I A;  2I00 A;  4XPK A;  4L8A A;  3FNC A;  2G0B A;  2VEZ A;  3FBU A;  2P0W A;  1VKC A;  3LD2 A;  4KOW A;  2ZW6 A;  3EC4 A;  2R98 A;  3PP9 A;  2WPW A;  2PDO A;  2F5I A;  2GIV A;  3IWG A;  1QSR A;  4JWP A;  1YRE A;  1XMT A;  5KTC A;  4JXR A;  2VI7 A;  1YVK A;  2CNS A;  2I79 A;  3TOB A;  4KOX A;  1MJ9 A;  3BLN A;  1K4J A;  2B5G B;  4CAW A;  1CM0 A;  1LRZ A; 
#chains in the Genus database with same CATH topology
 1CPS A;  2MFZ A;  3WAB A;  2ZW5 A;  4AID A;  2HFH A;  3I5U A;  4AVZ A;  4AYB N;  2VBX A;  2FBH A;  1D5V A;  4CDG A;  4RS8 A;  3WOD F;  4JBA A;  3GZ5 A;  4YEL A;  2K4B A;  4EJT A;  2BOA A;  4A37 A;  4Y3O A;  3QPT A;  3KLO A;  4MTE A;  3O3K A;  4BAC A;  2Z3P A;  2QSH X;  3S6H A;  2IRF G;  2E36 A;  1CBX A;  3BR2 A;  5H86 A;  3TKY A;  3GZN B;  2OB0 A;  1G8X A;  1YW8 A;  4EJW A;  3IKT A;  3H9J A;  5F0C A;  2V6E A;  3RZA A;  5LRJ A;  2FBI A;  1JHF A;  3FHZ A;  4MEX F;  2ICW G;  3B7I A;  5A28 A;  1IRX A;  3G1M A;  3DLA A;  2NAZ A;  5E79 C;  4CYC B;  3GX4 X;  3PB7 X;  1NK2 P;  1TWC J;  2XAU A;  5EZG A;  1MK4 A;  4S05 A;  3ZMV A;  2MW8 A;  3COA C;  1XIX A;  2OZG A;  1A6I A;  3TOA A;  5CPA A;  2LY2 A;  2VB6 A;  2Z3O A;  5DDG A;  5F64 A;  4A5M A;  1UAA A;  4HYE A;  2VI6 A;  2BUE A;  3T8R A;  1XRY A;  4BBR J;  2R7R A;  2RGV A;  5AIQ A;  2STT A;  4KLV A;  1TP4 A;  4GRI A;  3WG9 A;  4PXE A;  3FWE A;  4S04 A;  2V8D A;  3E97 A;  2OR4 A;  1TLH B;  1HOM A;  2NVY J;  3QP6 A;  1UJ8 A;  3ZQQ A;  2VJI A;  1VQN I;  2NS0 A;  4UVB A;  3BJ6 A;  1YJN I;  2L4M A;  3BWG A;  2FNP A;  3CCY A;  3OY9 A;  2G9D A;  1M4G A;  1Z0X A;  2E7W A;  4UVA A;  3NWT A;  4BJ6 C;  3CCL I;  4FCY A;  4UEF A;  3LA3 A;  5DD4 A;  3WU1 B;  2K4J A;  3QU6 A;  1XCV A;  1XSX A;  3KGQ A;  2WPX A;  2J5O A;  2PMZ N;  4K30 A;  1ETW A;  3T0Y A;  1A35 A;  3PSF A;  2L01 A;  3R95 A;  3SI1 A;  4ZY2 A;  4IKF A;  2E35 A;  2EFW A;  2ZEG A;  3LMS A;  3F8M A;  4YWY A;  2MAB A;  4IOA F;  1U5T A;  3BOQ A;  3ERE D;  5IP6 A;  4BH9 A;  1IAW A;  2QVP A;  1ZTR A;  5FKK A;  4XNH B;  4KOU A;  5K7Z A;  1ZEL A;  2QM3 A;  2VAS A;  4P9F A;  4PFO A;  4A95 A;  3LWU A;  3K9U A;  4WF2 A;  2A69 F;  5D8L B;  1VZ0 A;  4KIS A;  3OL3 A;  1R3N A;  2JBJ A;  3EXN A;  3J7Y J;  4MFP A;  5AG5 A;  5TJJ A;  3EUH A;  3RJP A;  4A30 A;  4HLX A;  1FNN A;  1ON0 A;  4XKV A;  3IWW A;  1WK4 A;  3WTZ A;  1K6O A;  4QPQ A;  3A01 B;  5FFZ A;  3PO2 J;  1K78 A;  4LG3 A;  5M5W J;  2HVQ A;  4WCG A;  4XN3 A;  3H9Q A;  3LSM A;  2BV6 A;  2FBK A;  4MIM A;  3SJM A;  2ZEN A;  2G0E A;  2COM A;  2IGM A;  2DO7 A;  4XSZ F;  1Z8W A;  4I49 A;  2KIU A;  5DD8 A;  3F8K A;  1I6X A;  3KP2 A;  3RKW A;  5LEK A;  2XHK A;  2ESH A;  3EDP A;  2E5N A;  4PJJ A;  4B3A A;  1QST A;  1QZZ A;  5IV0 A;  4QIW N;  1PP7 U;  2B0L A;  2R7S A;  5EMI A;  1I39 A;  1X1A A;  2EBJ A;  5G21 A;  5IPA A;  3RKQ A;  2B4B A;  3N97 A;  1YFH A;  2VBY A;  2BVM A;  3A0H C;  1RR8 C;  1RET A;  4PXB A;  3LSK A;  5LHG A;  1FBQ A;  2H27 A;  4YGO A;  1B72 B;  3R1K A;  3FXL A;  4LIU A;  5HH1 A;  3MKY B;  1Q1V A;  3AKZ A;  1JTY A;  2NRA C;  1IB1 E;  4Q7A A;  3KLN A;  1R36 A;  1IRZ A;  1CPX A;  3SXO A;  2DOE A;  3SHF A;  3FXT A;  2DA2 A;  4E6K G;  3BY6 A;  3HDD A;  5AG7 A;  2OAZ A;  2X1D A;  2EIN H;  2Q7S A;  3PB4 X;  1X4O A;  2Z3N A;  3BJ8 A;  3RTR A;  2RVC A;  1A6Q A;  2B3V A;  1QSO A;  4UBR A;  4G6T B;  4A33 A;  4BY1 J;  1YLE A;  4IEJ A;  2XIG A;  4UUS B;  4G7H F;  3QRF F;  3J7A O;  1MSF C;  4YFK F;  3OV8 A;  2DA3 A;  4IJA A;  5TGT A;  2HKX A;  5FD6 A;  2BBY A;  3LOD A;  2HVS A;  4M6H A;  2ANP A;  3ML6 A;  1AHD P;  3IO1 A;  1TT5 B;  1HA8 A;  3W2V A;  1F2P A;  3CTA A;  4PK3 A;  4X0G A;  2FU4 A;  5LRK A;  1CF7 A;  1G3W A;  2DA7 A;  2QQ9 A;  3GIU A;  1TZL A;  3KL9 A;  3HG9 A;  1FEX A;  1WI9 A;  2Y0M A;  1ETO A;  3C26 A;  4CGN A;  5FRN A;  3MEX A;  3R0A A;  1VQ8 I;  4ZJZ A;  2Y75 A;  4LD5 A;  2VQC A;  3I4P A;  2KJB A;  3LQR A;  4XNH C;  1QSM A;  5ERI A;  4KYW A;  1I3Q J;  3HOZ J;  1ZKG A;  1XEB A;  1VGY A;  1FMV A;  3PNY A;  4BE2 A;  2Y2Z A;  2ELH A;  2FXF A;  3CD6 I;  3KI9 A;  2M30 A;  2W57 A;  1WH7 A;  1Y56 A;  3C2H A;  2JPB A;  1DQU A;  2L54 A;  2R3S A;  1MMN A;  3IEH A;  3QNV A;  4W9Y A;  4PZJ A;  1ENH A;  1YYV A;  1G6N A;  2DK8 A;  3WTY C;  1YI2 I;  4X6A J;  1B6B A;  1NMT A;  1TIQ A;  5F49 A;  3DQV C;  4EJU A;  1MJA A;  3BR3 A;  4UXN A;  2ESN A;  4MNU A;  1P0H A;  2JT1 A;  5CQG A;  1ARM A;  2O8X A;  2A68 F;  2EIK H;  5J47 A;  2L0K A;  3GUX A;  4OIW A;  2Z5U A;  4CZZ A;  2P6F A;  2FRH A;  2FMY A;  5LRG A;  4E7L A;  3U1D A;  1U6M A;  2LRE A;  4NFR A;  2IGO A;  3HHG A;  4B47 A;  2K5C A;  3G1L A;  3A1Y A;  3S9L A;  5L3B A;  2ZXW H;  3P9K A;  3DLL F;  1C0W A;  3E5U A;  3D2P A;  4EVY A;  2B5G A;  1ACI A;  2OCE A;  2QBY A;  2M45 A;  1A2Z A;  5DCM B;  4BU2 A;  4N4N B;  1Y6I A;  2HOA A;  1VQO I;  3ABU A;  4KNY A;  4GM5 A;  3QAH A;  3FXK A;  4JXQ A;  4MI4 A;  1UST A;  4G6Q A;  4CUG A;  1MH3 A;  4XKC A;  1UZC A;  4IF5 A;  4LQG A;  3KP4 A;  4U0W A;  5LRR A;  1KYW A;  2Q4V A;  3CCQ I;  4U9Y A;  3OWC A;  2KZV A;  4A93 J;  4QLC U;  3ZN1 A;  3JW4 A;  1BC8 C;  3JSO A;  3LFK A;  1MSE C;  2DJI A;  3NE7 A;  3HGG A;  1XD7 A;  4JX6 A;  4OAZ A;  1QHH D;  2NVU B;  2GM4 A;  2ARH A;  4CGL A;  2CUF A;  4GDF A;  1X19 A;  3WTT C;  1PUA A;  2Y0S A;  1B1B A;  2FNA A;  1BR1 A;  1RNL A;  5J6X A;  4E0A A;  3IH4 A;  3ECO A;  3D67 A;  1IUY A;  1TBX A;  3RZD J;  3SJF A;  4XNF A;  4B1R A;  5K5O A;  4CYC A;  3JRH A;  3L2R A;  2JPC A;  1FLI A;  3KEQ A;  1HW5 A;  1NE9 A;  3CJQ B;  3CF5 F;  1V5F A;  4DZJ A;  4PSX A;  1ZG5 A;  1OBR A;  4NHJ A;  4XOR A;  2HDW A;  5E3L A;  1BR2 A;  2OCC H;  3K10 A;  3G73 A;  1MBH A;  3S1R J;  5KHD A;  1ZR4 A;  5D8K B;  1I1S A;  2VJ4 A;  2PR8 A;  1SVL A;  2WWY A;  4IL6 C;  1FIP A;  4FWU A;  2GA2 A;  2Q2E A;  1IY7 A;  4XSX F;  2F7V A;  4R3L A;  2F4O B;  5EEA A;  1OQY A;  4G1P A;  3S3O A;  4M3F A;  5DS0 A;  3Q3S A;  2M2E A;  3F8B A;  4OAY A;  4II2 A;  3MKL A;  1ELL P;  1A5J A;  2M1B A;  4R76 A;  2DFI A;  5J3L A;  2Q1Z B;  2PJ8 A;  2VE8 A;  4U5Y A;  3CCU I;  3BG7 A;  3SDB A;  2ZXH A;  3C1D A;  2R5Z B;  4OIO F;  1OR7 C;  2ABZ A;  3RDI A;  3V42 A;  3B6C A;  2UXN A;  2AXT C;  1M4L A;  4X3R A;  2XV4 S;  3V7S A;  3A4C A;  4M9X A;  1OKR A;  1OJL A;  2RQQ A;  1IXC A;  4OAE A;  3GTQ J;  4MHY A;  3S17 J;  1LDK B;  2B3U A;  2PC1 A;  2VBQ A;  3ASN H;  2E2J J;  1FBS A;  1IIC A;  2VKV A;  2GLF A;  2DU9 A;  3WGH A;  1MMS A;  2QKL B;  3VYR B;  3OIP A;  2QSF X;  1U0J A;  2MLK A;  1ZRF A;  2FOW A;  1B4A A;  3PSI A;  3C2B A;  2QIR A;  3GVA A;  5C4X J;  4KSA A;  3BTI A;  2OTL I;  2EA2 A;  2O7O A;  4UIB A;  1EA3 A;  3IU1 A;  1PYV A;  1IN7 A;  2YU9 J;  2ZME B;  1WVR A;  2QEX I;  4PXC A;  2VC0 A;  2DJN A;  1UHM A;  3WC6 A;  5JLX A;  3CUQ B;  2O53 A;  1ZLJ A;  4C9Y A;  2M0C A;  2VQL A;  1BAV A;  2NMT A;  1U9N A;  2O6G E;  2PJ2 A;  4WWV A;  3RQ4 A;  4M3B A;  1RTQ A;  5H6Q A;  5GAE J;  3V8K A;  4ZTJ A;  1ZLK A;  2DXI A;  2DLL A;  1XDS A;  4ZGY B;  2X4H A;  4EME A;  1XMA A;  4I7H A;  3NEU A;  1M1E B;  1B6A A;  3HUG B;  3WTS C;  5JGF A;  4P9U A;  3TED A;  3W6X A;  3K69 A;  1Z4E A;  1MBF A;  4KOS A;  4PK4 A;  4HNT A;  1KWM A;  2GRE A;  2YSR A;  4A3J J;  4JLY A;  4MCQ A;  4XM3 A;  4DUK A;  2X6Y A;  3QOP A;  2OV7 A;  1RZ4 A;  3LWF A;  2CW8 A;  3CC4 I;  1FBU A;  4UUT A;  2CQX A;  1LPQ A;  4IRI A;  1ZLH A;  4P45 A;  1HKT A;  1BIB A;  4WK8 F;  1IN5 A;  4FET A;  4PFP A;  5ICE A;  3V7R A;  2WSA A;  2LBF B;  4PDK A;  5LYD A;  3EUK L;  1H9G A;  3GFI A;  4IQJ A;  2EFN A;  1HCR A;  1CG2 A;  2BHY A;  2DA4 A;  5J1R A;  1YW9 A;  2ACJ A;  3VFZ A;  1S7A A;  5GAD J;  3VWB A;  2R7V A;  3D7H A;  3TE4 A;  4XOT A;  4R9M A;  5LGN A;  4D5F A;  1IGB A;  1XFO A;  3QQA A;  4UUS A;  1JI8 A;  5JPH A;  2V6C A;  1D1C A;  1EH8 A;  4IXA A;  1Z4R A;  3GFJ A;  4X5K A;  3SEQ A;  4RI1 A;  2MC3 A;  4YEJ A;  2X48 A;  3RYR A;  5B3S H;  2PI0 A;  1TF8 A;  4MXU A;  3LSP A;  4ENK A;  4UNO A;  5M5Y J;  4OAD A;  4G9Y A;  4KZT A;  2IS6 A;  5ISV A;  1D0X A;  1OYY A;  3CCE I;  1AU7 A;  3X2Q H;  3LFU A;  3BXM A;  1BA5 A;  1F43 A;  4GYG A;  3BQZ A;  5H20 A;  2E1N A;  3DU5 A;  4OC3 A;  1G59 A;  3WT4 A;  5EJC A;  2B9S A;  4MEY F;  3GTL J;  2VJJ A;  3D1N I;  2YNE A;  1O7F A;  1DTD A;  3HOV J;  3WTW C;  1F4K A;  1K6Y A;  4FT8 A;  2ZPA A;  1ZN2 A;  4RDU A;  1DPR A;  3UNG C;  2KJC A;  5C44 J;  2DEA A;  1BL0 A;  4IHX A;  1T38 A;  1V5G A;  4A32 A;  2QML A;  2Y9Y A;  2CFX A;  2HYF A;  4H0E A;  3FHN A;  4II3 A;  3JAM K;  3TCV A;  2W4S A;  1F36 A;  1VND A;  2HOS A;  3K7A J;  1KQ0 A;  2CFO A;  3IC1 A;  1S29 A;  4OC0 A;  3DEU A;  5KTA A;  1Z3Y A;  2AHQ A;  3AG4 H;  2V7F A;  4DNC A;  5LYI A;  3CO7 C;  1KUV A;  4BBS J;  1FY7 A;  1Z6T A;  4P10 A;  3PIP F;  1NTC A;  4ABZ A;  2VXZ A;  5DCM A;  5E20 A;  1X58 A;  4HW0 A;  4MQ9 F;  2VL1 A;  3SFZ A;  3FBN B;  4HX8 A;  1SD7 A;  3VYS B;  4L8A A;  3DTE A;  1NHA A;  2P0W A;  3KYC B;  1R1T A;  4EWT A;  3LD2 A;  4KT6 A;  3PP9 A;  4OMZ A;  2XEJ A;  3NWS A;  2GIV A;  1IUF A;  4LJZ F;  3H92 A;  4LGW A;  4M9Z A;  4QSH A;  3G71 I;  4KA4 A;  3IWG A;  2VT2 A;  2P6T A;  4I2O A;  3SJX A;  1AYE A;  2O8K A;  4F55 A;  4H4K C;  2L9N A;  2WB1 N;  4Y15 A;  1ZG3 A;  3J80 Z;  2CNS A;  4XLH A;  3IWE A;  5IT3 A;  3OOP A;  4BQN A;  3DP7 A;  4BDZ A;  1XOV A;  2FOK A;  4A0Z A;  3ZP5 A;  3FX3 A;  2V26 A;  2ZEL A;  4QWQ A;  5AG4 A;  3F9K A;  4NDL A;  3E1S A;  2JBK A;  5CPR B;  3S3N A;  1V54 H;  4UB8 C;  1QZY A;  4HA8 A;  2UZK A;  3DPU A;  4B43 A;  2YX7 A;  2IEK A;  1CM0 A;  4P55 A;  3TBI A;  4F93 B;  3I3L A;  4XOP A;  3CCS I;  1QNT A;  3DBL B;  4JX4 A;  1WJE A;  1X3U A;  3HIF A;  1TWH J;  4JYK A;  5FO5 A;  1J7K A;  2O9L A;  5K8M A;  3AAF A;  2PSW A;  3HL2 A;  3B73 A;  4E2A A;  1HC8 A;  2W00 A;  3KP6 A;  2AO9 A;  4JOM A;  3IHU A;  3K6G A;  4ON0 A;  4BUP A;  1NSL A;  2V1D A;  2EWN A;  2K9M A;  3JTK A;  5TRD A;  4JD6 A;  4JYW A;  3BR1 A;  2FE3 A;  3BZC A;  1HEE A;  1BI2 A;  2DQR A;  2P7V B;  1BIA A;  5IY5 H;  5GPC A;  3S2W A;  3V38 A;  5FB2 A;  1WKM A;  2UV1 A;  4L5J A;  4BKX A;  4IVN A;  1FSH A;  6PAX A;  4KOR A;  5M3M J;  4JZ0 A;  3TW6 A;  2M34 A;  3DKX A;  5L3G A;  2GWR A;  3F8F A;  1W5S A;  3ESW B;  2CQQ A;  2ZSH B;  2R5Z A;  3ISP A;  2EZL A;  2OZU A;  5J40 A;  1SQH A;  1S3Z A;  3FMC A;  1HKQ A;  2W85 A;  1YW7 A;  3HC7 A;  1S72 I;  1PCA A;  4RA2 A;  2Z3M A;  4RN7 A;  3T90 A;  4AB7 A;  3WGI A;  4AYB A;  3BP8 A;  4Y17 A;  5D5W B;  1EKE A;  2VQH A;  3F0C A;  2LY9 A;  5D4S A;  2VE9 A;  1UCR A;  4X2T A;  1XGN A;  2XGD A;  2E1M B;  4D0P A;  2AS5 F;  2HVR A;  2P81 A;  3D4U A;  5IX3 A;  4LFU A;  3ZQC A;  1CGP A;  1BC7 C;  4CAX A;  2XVC A;  3UR3 C;  3S3M A;  1H0M A;  3IUO A;  3PNV A;  1BPM A;  2PJP A;  2HC9 A;  5J1Y A;  3SYT A;  5FD5 A;  3BJO A;  3FM5 A;  4N9I A;  2W1O A;  1P7J A;  3OYI A;  2PVV A;  2PIZ A;  5E1Z B;  4RLQ A;  3S8P A;  1VFC A;  4DGW B;  1LEA A;  2VBW A;  4OME A;  1BI3 A;  1P6R A;  5FRO A;  1R49 A;  2TRT A;  4LX9 A;  2H8W A;  2FQ4 A;  2Q8K A;  1U3E M;  5FLV A;  3D7D A;  2FVG A;  2M0M A;  2M8G X;  1FC3 A;  3BZ6 A;  5F08 A;  3RIR A;  3E0K A;  4NC8 A;  4B10 A;  2ZME A;  1FNO A;  2Q4Y A;  4ESJ A;  3CUQ A;  3I9V 2;  3WHB A;  1JUS A;  4Q5S F;  4XQF A;  1D1B A;  2XRL A;  2DYS H;  1I12 A;  4UVC A;  2E2H J;  1ON2 A;  4IOC F;  2P6S A;  1NSA A;  1YME A;  2CQN A;  2PN6 A;  3GTP J;  2HYJ A;  1WRJ A;  4A6E A;  2FIW A;  2J9A A;  3HUG A;  3HEF A;  2K5T A;  1Z5R A;  2LC2 A;  3D5S C;  3GO5 A;  4V19 K;  3R96 A;  2ZSI B;  4DQ2 A;  1LEB A;  3KHZ A;  4G7Z F;  4U7D A;  3LOC A;  5FLX Z;  2DOA A;  2DA1 A;  4F3Q A;  1U5T C;  3CMA I;  2HQA A;  2HKO A;  2PFB A;  5EEG A;  5F46 A;  3TMO A;  2AFW A;  1VQ6 I;  5G20 A;  2GFQ A;  1P4N A;  4EJV A;  2IW5 A;  4C3J J;  4OP4 A;  2CSO A;  2OZH A;  1P9Q C;  3L9F A;  4KUM A;  2BXY A;  2H94 A;  4AU7 A;  1KU7 A;  3SJE A;  3M7G A;  1QPM A;  3JRC A;  1POG A;  2CG4 A;  2L02 A;  2PMZ A;  2DN0 A;  3EUH C;  3VDX A;  1SD6 A;  2CMP A;  3KHX A;  3PRT A;  4IAV A;  5E3M A;  4Y49 C;  1TQI A;  3CF2 A;  4ZDL A;  2LD5 A;  4BJ5 C;  5THW A;  4MHZ A;  3K1M A;  4AC0 A;  5EF6 A;  3ZJ0 A;  1VQL I;  1FTZ A;  4UCP A;  1Y9W A;  3S9N A;  4UFX A;  3DR8 A;  4P5O A;  4KN7 X;  5JHU A;  2X85 A;  3H5R A;  4ZDP A;  4XPL A;  1ZG9 A;  2AFO A;  1SFX A;  2W82 A;  1MGT A;  3ZN0 A;  2A3S A;  4R57 A;  2NOG A;  3FEC A;  2E1M C;  2STW A;  2BHZ A;  3DKY A;  1YVO A;  3DDD A;  1ONV A;  3TP3 A;  3M8J A;  3TP0 A;  3AG2 H;  1G4D A;  1IG7 A;  2MH9 A;  2FCK A;  1BI0 A;  5JHF A;  1JXS A;  1DP7 P;  1OYI A;  3O6B B;  2QBY B;  1Y0R A;  3GWZ A;  3M8F A;  2XAG A;  1LOK A;  5EDN A;  2C6Y A;  2HZT A;  4KMF A;  1O3S A;  2Q43 A;  1VI0 A;  1VQ9 I;  4B4C A;  2WV1 A;  3LAC A;  4YG2 F;  5FGM A;  4A0Y A;  1QU3 A;  1ETV A;  4A3M J;  5JVT A;  2PX9 A;  3F5B A;  4PJN A;  4OC2 A;  1M1D A;  2LTP A;  4QUS A;  1FT9 A;  4KSF A;  1TKJ A;  4R7M A;  3LSI A;  5M3F J;  5K1Y A;  4XON A;  3RKY A;  4HF1 A;  4G8X A;  4MQV A;  3OYB A;  2FIA A;  3CJN A;  1OCT C;  4YFJ A;  4CAV A;  1EH7 A;  3VSK A;  2LOO A;  4IHT A;  1WWZ A;  2EK9 A;  1IU8 A;  3WC5 A;  3MGD A;  5DS9 A;  3KAS A;  2ZEP A;  1R71 A;  1QVT A;  2VKD A;  4R8H A;  3SZT A;  5D5U B;  1LAM A;  3LL7 A;  2ZC2 A;  2PRQ A;  2ZEH A;  3I4N J;  4WXD A;  5IYD J;  5G1Z A;  4CO8 A;  5ICC A;  2IAI A;  4DOZ A;  1HDQ A;  1GDT A;  2IL4 A;  4I0B A;  4PCQ A;  1YS6 A;  4OLL A;  3TX8 A;  5J1Q A;  4AG9 A;  5BNG A;  2JJ7 A;  4D9J A;  2K02 A;  3K2K A;  3CES A;  1KON A;  2W48 A;  1W5C C;  2PJA A;  3HPH A;  5GTI C;  1Z8X A;  1U6G A;  2L3D A;  3H3Z A;  4GCV A;  3U1K A;  1ZRC A;  3MZH A;  4OMY A;  4J3G A;  3IRQ A;  1R22 A;  2CUJ A;  3VYT B;  3F3X A;  2XSJ C;  3KFW X;  2TCT A;  3OYL A;  2W7N A;  3F21 A;  3V8J A;  4LG0 B;  2XF7 A;  2HS5 A;  4IQ4 A;  2MD5 A;  3HZJ A;  1TWG J;  3RAM A;  3P5J A;  2OF7 A;  4NB5 A;  4NJR A;  2Q2E B;  4CS0 B;  1OFC X;  3BG9 A;  3FF3 A;  2MBF A;  3GUD A;  3S15 J;  2CF4 A;  4AIJ A;  3MZY A;  1Y7R A;  4O3M A;  1VTN C;  2XEF A;  4FAI A;  1IZ1 A;  3W3C A;  3CMY A;  1JKO C;  1WJC A;  4XLE A;  3CCJ I;  3W2W A;  2BY2 A;  3LA2 A;  1I21 A;  1PVE A;  4IPA A;  2DT5 A;  2DCE A;  2REF A;  1J2X A;  2ZEO A;  3KZY A;  2PJ6 A;  1R43 A;  1KZH A;  3U9G A;  4AVA A;  4ZH4 F;  5FVJ A;  2AFX A;  1IDY A;  3LSR A;  1T98 A;  2IGK A;  3JRF A;  1HW2 A;  3IWZ A;  4L9J A;  3FMS A;  1D3Y A;  3PO3 J;  5KAF C;  3HKZ A;  4HAM A;  1R23 A;  4CYP A;  2IJL A;  2ZB9 A;  3ISZ A;  4G94 A;  5CVI A;  3FZV A;  1R58 A;  3DF8 A;  4OOI A;  4M6X A;  3EY5 A;  4AVB A;  4BBH A;  4QVT A;  1WI3 A;  3ZMD A;  3HOX J;  4A12 A;  3HRS A;  1HKS A;  4HV6 A;  5FRM A;  1JUM A;  3M3Y J;  3JCU C;  1Y8R B;  2XC7 A;  3E6B A;  2HYG D;  5AIP A;  1T8I A;  2JEV A;  4UF4 A;  5HLG A;  5JI6 A;  2VOP A;  2MA3 A;  4TV7 A;  2MG4 A;  1T33 A;  3GLX A;  3K70 D;  2UWM A;  3H5Z A;  2PCU A;  2QZ8 A;  3BHX A;  2IS1 A;  1XC5 A;  5IT9 Z;  4MFD A;  2G7U A;  4YRV A;  2X0L A;  1SAU A;  2HQN A;  4YIF A;  3OYN A;  2P7C B;  1ETY A;  2GLO A;  2EV6 A;  3OOU A;  4PJM A;  4U7B A;  3DSB A;  1FMW A;  1LFP A;  1MDM B;  4EGZ A;  3FMQ A;  2XEI A;  2PMH A;  3MKZ A;  3CDX A;  2EJR A;  2EO8 A;  2V79 A;  4U0V A;  4E7J A;  3S2H J;  3IC7 A;  2VKH A;  2P4W A;  2P6G A;  4BGD A;  4L9V A;  2V1N A;  1JKP C;  1R5I D;  2EIM H;  3LQQ A;  4KUB A;  5ED4 A;  3OSF A;  2YUS A;  1UG2 A;  5J4Y A;  1WJB A;  2KKO A;  5FLM J;  1H9T A;  2C6C A;  2BO9 A;  2D4P A;  3RCO A;  2HXI A;  3OS0 A;  2GAU A;  3S6G A;  4CXF A;  2FS5 A;  3IU2 A;  2XSD C;  1QO0 D;  2GOX B;  3REO A;  5E17 F;  3HRT A;  1EV7 A;  3IIB A;  4CGP A;  4FUU A;  2EZH A;  2VPR A;  1SVM A;  4XLC A;  5EGO A;  5CBM A;  4FIS A;  4P96 A;  3ABM H;  1P92 A;  2PJB A;  2L7M P;  3BG5 A;  2D5V A;  1LFU P;  2DPD A;  4BXF A;  4Y52 J;  1O3R A;  1J59 A;  1ZG8 A;  4WXH A;  2WYR A;  2JUG A;  3HXL A;  1FZP B;  1ZO0 A;  3EUA A;  3ECH A;  4JK1 X;  2DW4 A;  1VHS A;  1WQ2 A;  3G2B A;  3KPH A;  4HZF A;  4FE4 A;  5HNF A;  4OU0 A;  4CSW A;  4M9S A;  2PJ1 A;  5CQE A;  3SEZ A;  3B02 A;  1W36 C;  4Q48 A;  5HDG A;  4BHC A;  2K9N A;  3ZQL A;  1ERD A;  2XKO A;  1ZGW A;  1FP1 D;  2CUZ A;  3MFK A;  4LUA A;  5HMN A;  3RPU D;  1FPQ A;  1TT0 A;  1MIJ A;  2CQ7 A;  4EQQ A;  1I1D A;  2GU2 A;  2IJZ A;  3ZGK A;  2V1X A;  4D7N A;  3UY5 A;  1A04 A;  1Z1D A;  3OWT A;  2PLY A;  1QHG A;  5A2Q K;  1LVK A;  1LB2 A;  2DPT A;  1ZLI A;  4LLG F;  1ETQ A;  4PSW A;  5HLH A;  4C2M J;  2DA6 A;  3J80 K;  1AA7 A;  4KN4 X;  4BXU A;  3PUB A;  1G3T A;  2QYO A;  3H5N A;  3IGR A;  3P2H A;  2UXX A;  4EV0 A;  4NBQ A;  4EGY A;  1Y1W J;  4AWX B;  2OUM A;  2MGQ A;  4DYQ A;  1STZ A;  1UEL B;  2WY8 Q;  1P2F A;  2KRH A;  1SC7 A;  2CIJ A;  3KR5 A;  3J81 Z;  2HPM A;  3QAY A;  4B6Z A;  1T56 A;  1TWF J;  1W0T A;  3EPZ A;  2R92 J;  3FM3 A;  1XCB A;  3BR6 A;  2XRO A;  2IPQ X;  2OA4 A;  3K1P A;  5CKT A;  4ZBG A;  2G3A A;  3GZ6 A;  2HXO A;  1VHO A;  2OQR A;  1LFW A;  1E2X A;  3L2V A;  3RNZ A;  4M3E A;  1OCC H;  2PQ8 A;  2R7H A;  2EH3 A;  2I5U A;  5KTD A;  1RKW A;  3DEE A;  3HOT A;  4WWC A;  1BI1 A;  1IDZ A;  1QSN A;  1KA8 A;  4KDP A;  4P4I A;  2H6C A;  3FF5 A;  1KUY A;  1ZYR F;  5FKN A;  4FD4 A;  3E6C C;  2O03 A;  3I71 A;  2TDX A;  2KIS A;  1JT0 A;  2JA6 J;  3PZJ A;  1RPW A;  1QA6 A;  2XEG A;  1Z3X A;  2DK5 A;  5HLI A;  4ONW A;  4A3L J;  2ZNZ A;  3WE3 A;  3ZQG A;  2C27 A;  4O5V A;  5I0C A;  2AQE A;  4A2Z A;  1BO4 A;  2VBZ A;  2YR2 A;  2FML A;  4IF4 A;  1YLO A;  2OOT A;  1FIA A;  4KMU X;  4B3X A;  2VPL A;  2IS2 A;  3ONQ A;  6CPA A;  5LGT A;  3CUO A;  4M74 A;  5DWM A;  2JMW A;  3K4L A;  1Q7L A;  4MCR A;  2Z3L A;  2PEX A;  5EZH A;  1UHW A;  2XAQ A;  2EFQ A;  3W6V A;  3PBB A;  2LSO A;  1LKX A;  4NGS A;  2KRC A;  2H5M A;  2HQR A;  1LDD A;  1XMK A;  1NH3 A;  1Z7L A;  1JKQ C;  3NFZ A;  4C7I A;  2X6O A;  1JT6 A;  4UHT A;  2H8R A;  1FSE A;  2KLO A;  3A2K A;  1Z8L A;  2CNT A;  4LG0 A;  4FBE A;  3OYK A;  3IFE A;  3RSN A;  2BCO A;  2XPU A;  2JWT A;  3IP4 B;  3S1M J;  1NG7 A;  1J4J A;  2AFM A;  2ID6 A;  1R4M B;  1W0U A;  3C7J A;  4CGO A;  5BS6 A;  1F57 A;  1HST A;  3NQO A;  4GGG A;  1A36 A;  2HV2 A;  2ME6 A;  3SI0 A;  4HSR A;  2ZJR F;  1TXR A;  3GLJ A;  3FMR A;  2FD5 A;  4EEF G;  1JUP A;  4UCN A;  2K7L A;  3JRA A;  2ELK A;  3FED A;  1T2K A;  3Q9S A;  1Z6R A;  1R7J A;  1L0O C;  2EBI A;  2EB7 A;  2Z1D A;  3HM5 A;  1Z9C A;  4PJL A;  1IV6 A;  3T8W A;  1IN4 A;  3BTC A;  2WAE A;  5B1A H;  1I3A A;  3WC7 A;  2E34 A;  4L18 B;  1MND A;  1WJ5 A;  1ZG1 A;  2Z11 A;  2LH9 A;  3AL0 B;  3IH3 A;  3S1N J;  5EG0 B;  2GXB A;  2D45 A;  4MTD A;  3L2U A;  5LYL A;  2VEZ A;  1E3O C;  3HSR A;  3ZOB A;  2ZOG A;  2PJ9 A;  3BI1 A;  2EIJ H;  4MFE A;  5FJ8 J;  1YJ9 I;  5AGE A;  3CO6 C;  3BPV A;  4CGM A;  2WV0 A;  1SD4 A;  1ZH5 A;  2ZW6 A;  3HRM A;  5FLX K;  2QJ8 A;  2K27 A;  1UG0 A;  4RGS A;  2PVW A;  5L3C A;  2PDO A;  1QSR A;  1F1Z A;  2R7T A;  4JWP A;  2QKM B;  4J01 A;  2F4M B;  5BOX A;  2M9H A;  5JLW A;  3O8G A;  1EH6 A;  3HRU A;  2VJ5 A;  2DI3 A;  3SFI A;  5JFR A;  1MBK A;  1YVK A;  3K4B A;  1OYW A;  2HEO A;  2Z2S B;  3TOB A;  2HI3 A;  2I8D A;  3FXJ A;  2HB6 A;  2VON A;  3CPA A;  2YGW A;  3KET A;  5CYV A;  1W4M A;  4E7I A;  1R4N B;  4W97 A;  1H89 C;  1LRZ A;  1USS A;  4Y13 A;  4UB6 C;  3BCB A;  3T5X A;  1YOV B;  2EV0 A;  2JA2 A;  5E8G A;  1WJA A;  4XRM A;  4NGT A;  3E7L A;  2CNM A;  3ISX A;  3EET A;  1N25 A;  2V1U A;  4HOB A;  2DBB A;  4ZY1 A;  4XN0 A;  4JJX A;  3QPS A;  3IJ3 A;  1XJO A;  2EVN A;  1MDM A;  2NYX A;  4XKB A;  1Z7U A;  3QOE A;  1YGH A;  3PB9 X;  1VQP I;  3JUW A;  1GUU A;  1X2M A;  4CYD A;  1XS9 A;  1IRF A;  4U88 A;  3HB9 A;  2Z0Z A;  3W2A A;  1F5T A;  3F6V A;  5CNP A;  2O61 A;  3L2Q A;  3PUF A;  3H0D A;  1SAX A;  4MFQ A;  5IOY A;  2ECC A;  2ZJ2 A;  1SEU A;  2WB1 A;  1S7K A;  4A5N A;  4HNV A;  1A31 A;  1YS7 A;  2K85 A;  3DEW A;  5ILU A;  3ZMS A;  4LK0 F;  3QYE A;  3K4M A;  4AIH A;  1HDU A;  4LB5 A;  4D1Q A;  2BY3 A;  2HDD A;  1B8I B;  3H0G J;  2WA0 A;  4A3G J;  2Z16 A;  1RUN A;  2XF5 A;  5CLS A;  3SXN A;  2FF4 A;  4AM3 A;  3QU3 A;  5AON A;  1DPU A;  4ZYQ A;  4B11 A;  3PB6 X;  1T0F A;  1D0Z A;  1WGX A;  4RB1 A;  4NUB A;  4RUH A;  5JH9 A;  1R1V A;  3HPG A;  4NCZ A;  3FKJ A;  4Y33 A;  4IZZ A;  4ESF A;  4M3S A;  1DUX C;  1IID A;  1VQ4 I;  4DJL A;  4M6Y A;  3ABK H;  3L7W A;  3QWL A;  2QGU A;  4GS4 A;  3I59 B;  4EM0 B;  4HQM A;  2PBI A;  3K9T A;  2FE7 A;  3MCZ A;  2BXZ A;  3SJG A;  1V5E A;  4PPZ A;  1E3H A;  3VYU B;  2WBM A;  4Q47 A;  4AVC A;  4RGX A;  5D29 A;  1WWX A;  2D4O A;  4HKF A;  1MBE A;  4UFV A;  4RB2 C;  3K4C A;  3CLO A;  4MHG A;  2OC6 A;  1KGS A;  4U0Y A;  1Y0N A;  2NNY A;  1QZE A;  3F8C A;  1WH5 A;  2B4D B;  2P6E A;  1TW3 A;  2DOD A;  2K9Q A;  3DPL C;  4H6U A;  5E3N A;  4BS9 A;  2JA7 J;  2QF7 A;  2R7Z J;  4UV9 A;  4F7Z A;  2DMQ A;  4KFC A;  3H36 A;  1HW1 A;  2ZME C;  3M1C A;  2P5L C;  4MLO A;  3CUQ C;  1BOA A;  1WJF A;  1HDD C;  5C3E J;  1EF4 A;  5E1W A;  3BRO A;  2NNN A;  2EPF A;  3PL8 A;  2DAO A;  1TNS A;  3PQK A;  3OL4 A;  3HOS A;  2PJC A;  1QRY A;  2ZED A;  4NF1 A;  2QEC A;  3ZMZ A;  3PJR A;  2WAQ N;  4JQF A;  5BWA B;  4MMO A;  1OCP A;  2F5C A;  3S6K A;  2XAF A;  3VH9 A;  4LIV A;  5LHH A;  2BL1 A;  1K4S A;  3HLP A;  1S7O A;  4ZYH A;  2ZNY A;  2E1O A;  5D4R A;  1M4I A;  5HVH A;  1R57 A;  3B3T A;  5DWN A;  2G9W A;  4WX9 A;  1U2W A;  3RZO J;  2PJ5 A;  4M72 A;  2DF5 A;  1IOF A;  2O4H A;  1TWA J;  3I56 I;  1SD5 A;  1H88 C;  2NSM A;  2IA2 A;  2Z10 A;  2JVG A;  3RKX A;  1R9T J;  3F72 A;  3Q5F A;  1VQM I;  2HQY A;  3RYO A;  3BCA A;  3I58 A;  4UV8 A;  2HUZ A;  5IT9 K;  4H6Z A;  3ULQ B;  4NXY A;  1XPX A;  4JX5 A;  3ZMT A;  2NXN B;  2RFH A;  7CPA A;  4HDV A;  4B5O A;  4M6V A;  4FHT A;  4P1W A;  1XE4 A;  4BAY A;  2NOJ B;  4GO1 A;  2L7K A;  4MBU A;  5I4M A;  3R4K A;  2RDP A;  3EQL F;  1SMY F;  4XKW A;  1Q2D A;  2BGC A;  1V0C A;  4A31 A;  3N4M A;  4C2X A;  3H3V K;  4ZI6 A;  5C4J J;  3JR9 A;  2ZEM A;  1XG1 A;  4IUS A;  1WJD A;  2KQR A;  3U2R A;  2ZBK A;  4XRS G;  1J75 A;  2CY2 A;  3PFO A;  4B09 A;  1CP6 A;  1M44 A;  1X3Z B;  1LAP A;  1TKF A;  2DA5 A;  4A3B J;  1RES A;  2JLM A;  2EFO A;  3IAM 2;  5B1B H;  3W6J B;  1JQG A;  3KKW A;  3CJR B;  1YR0 A;  1K7A A;  3D5R C;  1HBX G;  2X9D A;  2Y31 A;  1I50 J;  2RC4 A;  3RPU A;  2LRD A;  1ULY A;  4ZYG A;  5DUI A;  1LE8 A;  1KU9 A;  1GLN A;  2KFD A;  2VKE A;  1N78 A;  1ZGJ A;  1CX8 A;  4OIQ F;  5GPA A;  3KYL A;  2WC2 A;  3R9E A;  2ZFW A;  4DYR A;  2HTJ A;  3GYH X;  2DTZ A;  2RKH A;  4ENN A;  4F8Z A;  5JQ4 A;  3AG1 H;  2OQG A;  2IS4 A;  4L0Z B;  2PRB A;  2OZ6 A;  3MRU A;  4EJO A;  1DU6 A;  2XUB A;  4D7M A;  4DW6 A;  3E6D A;  3GW2 A;  2IVM A;  5EG0 A;  1JE8 A;  2CH0 A;  2BEI A;  3FKI J;  3ABL H;  3OSG A;  2VN2 A;  3VB2 A;  1VQ5 I;  2XGX A;  1DU0 A;  1KZF A;  2EFP A;  4Y7N J;  4HF0 A;  2H09 A;  3U21 A;  2XGC A;  1XGM A;  3D0S A;  1JWQ A;  3QB8 A;  2WAD A;  4OKO A;  1Y0Y A;  3SHP A;  1AOY A;  2W25 A;  4RAY A;  3DU6 A;  1KQ9 A;  3OIQ A;  3RQI A;  5J4V A;  2B7E A;  1UFH A;  2MH2 A;  3LA7 A;  1TQP A;  2D2W A;  2JN6 A;  2AQF A;  2W84 A;  3AFH A;  3E5X A;  4HPQ A;  2QQB A;  4ITV A;  5IOZ A;  3ZQI A;  2R7X A;  4P4J A;  2CQK A;  5DM7 F;  2P5V A;  4EAT A;  2B58 A;  2POK A;  3B3V A;  4BEH B;  4LIT A;  2LFB A;  1JJ6 C;  3CZ6 A;  4UWI A;  2WTE A;  4RAF A;  2DFE A;  2RAE A;  3JRD A;  5CVR A;  2EA4 A;  1GHE A;  5EGO B;  5BPI A;  1YQA A;  3FB3 A;  3PGP A;  4DYC A;  1L0C A;  2HTS A;  2KIQ A;  3H8G A;  2DT6 A;  3FX6 A;  4KIG A;  2CO5 A;  3V4G A;  5IYB J;  3LAJ A;  2Q04 A;  4IHS A;  4A3I J;  1QGP A;  3GY9 A;  3GTK J;  4V2F A;  4HF2 A;  4F9U A;  2IP2 A;  1HSJ A;  2KIM A;  5G22 A;  2ZKZ A;  1WCM J;  4KUA A;  1MH4 A;  2KRF A;  1Y0U A;  4XLF A;  1YO5 C;  3O8H A;  4K2E A;  4HLY A;  5BMZ A;  1SFO J;  3NH4 A;  2J5P A;  2CW0 F;  4RB0 A;  1H8A C;  2V8H A;  2PJR A;  2YNC A;  3ZRG A;  3K4N A;  2HU9 A;  4KSI A;  1XX5 A;  3LAP A;  2FJ1 A;  4F0Y A;  2DDB A;  2Z9O A;  3B3W A;  3DBR B;  2V9K A;  3KP3 A;  5FKO A;  4EFD A;  4ORF A;  1Y9K A;  3I9S A;  2LP0 A;  2RN7 A;  3LST A;  3C18 A;  2L2O A;  3FXM A;  4UCM A;  1B8I A;  3F8N A;  1S7E A;  2J8M A;  3NE8 A;  1ZG7 A;  2N8G A;  4OID A;  2VUM J;  2A5Y B;  1YX0 A;  3E6M A;  4E4H A;  3OYD A;  2VXD A;  4WXC A;  5F1R A;  2D1V A;  1YX5 A;  3VWD A;  1Y1V J;  3I3G A;  1SFK A;  1KYZ A;  1Z77 A;  2L9S A;  4F0X A;  4BE1 A;  1XB4 A;  4F9V A;  3FK7 A;  1JTX A;  3FK6 A;  5KK1 A;  3CXQ A;  1VIX A;  3H8E A;  5EEH A;  1W5T A;  4BXX J;  2V77 A;  2XGE A;  2IQ6 A;  4MJ8 A;  2K40 A;  2F48 A;  1U8R A;  4CYN A;  4N9H A;  1FOX A;  3I59 A;  5E96 A;  1BR4 A;  3S93 A;  5D5V B;  3H35 A;  3V8I A;  3NRV A;  4FD7 A;  1Y8Q B;  2JZY A;  4L5E A;  4RS2 A;  2V8V A;  2Q7B A;  2LG4 A;  2JTV A;  2R7W A;  2R5Y B;  1Q2Y A;  3TO7 A;  5JR3 A;  2ELJ A;  2NVT J;  2O28 A;  3DGV A;  4MFL A;  1S9H A;  2ZO4 A;  2IT0 A;  3F0A A;  2F5E A;  3G6E I;  2PMU A;  4RGR A;  2CW7 A;  5GAH J;  2B4D A;  4KOT A;  4OIR F;  2CTB A;  3MMY B;  4WJB A;  1BW5 A;  3DLJ A;  1FX7 A;  2DT7 B;  4I6Z A;  4RM2 A;  4DIQ A;  3DNS A;  4A2U A;  3IWF A;  2OPT A;  4HNY B;  5GCN A;  2VL8 A;  3TGN A;  5H6R A;  2O3F A;  5EBV A;  1G3Y A;  1PDN C;  2XRN A;  3SQN A;  4II9 A;  1V4R A;  4IRH A;  4AIK A;  1AWC A;  3A9L A;  1Q1H A;  2COB A;  5H2F C;  4NC6 A;  4B12 A;  5D6F A;  1LAN A;  5EC4 A;  1ZHF A;  4M3G A;  3R0J A;  5B66 C;  4CAE A;  3A02 A;  2XF6 A;  1HQC A;  2R0Q C;  3GF2 A;  2X1C A;  2R4G A;  3A0B C;  3BT9 A;  3I64 A;  3WG7 H;  4BY7 J;  2Y69 H;  4A3C J;  3JTG A;  2OBP A;  2L7Z A;  3ZZI A;  4CRY B;  2JUC A;  3KE2 A;  1F2O A;  5DV5 A;  5K7H A;  2X7B A;  3W6S A;  2IBD A;  2X1E A;  2XAH A;  4CCJ A;  3JVN A;  1P4X A;  3HSF A;  4RBO A;  1FTT A;  2F4I A;  4F92 B;  3JRI A;  2YX4 A;  2QA4 I;  3M07 A;  1BPN A;  2EK8 A;  3DV8 A;  4V2G A;  2DFH A;  1KQ8 A;  4KVM E;  3H4Q A;  5HLT A;  4HG2 A;  1K79 A;  2MSY A;  1BBY A;  4Z2Y A;  2PJ4 A;  3P9I A;  3MZ8 A;  5F27 A;  3FDY A;  3T9Y A;  2RQP A;  2QQ8 A;  2O0Y A;  1K4T A;  1Z21 A;  3FVL A;  1B9N A;  5IP7 J;  3OS1 A;  1MNM C;  3VWE A;  3DWL E;  4FD5 A;  3ELK A;  2L9V A;  4B48 A;  4HV5 A;  3H5A A;  2GE3 A;  1I1G A;  1IXS B;  2ZJP F;  4YIR X;  2LKX A;  2XPW A;  4A69 C;  2QUF A;  4RMN A;  1RUO A;  2D1H A;  3W6K B;  1CJW A;  4Q38 A;  2XDV A;  3QYB A;  1CP7 A;  1GVD A;  3B3C A;  1D0Y A;  4Q36 A;  1QVU A;  3ZR8 X;  4MO7 A;  1ETK A;  1YIT I;  2R8V A;  1XN7 A;  3D7F A;  3D5L A;  4HST A;  3ASO H;  4KIC A;  2R7O A;  1SMT A;  4ZX8 A;  5ICG A;  2JSP A;  4L9N A;  5CVV A;  2GLJ A;  2MYS A;  2FEZ A;  2QVO A;  3BQY A;  3UKG A;  2H1K A;  4YRH A;  2ZXI A;  4A39 A;  1FOY A;  4OIN F;  2KDO A;  1GXP A;  1X1P A;  4B5P B;  1B59 A;  1MMG A;  3W91 A;  3PFY A;  2JK3 A;  2CTC A;  3I53 A;  5LYF A;  2OU2 A;  3CCV I;  5L3D A;  2KHM A;  4YFN F;  3GB0 A;  4YFX F;  1P7I A;  4ZX9 A;  2IXS A;  3JAM Z;  4ZYD A;  3L2N A;  3P7N A;  1LUJ B;  4R1H A;  4I76 A;  2DMU A;  3D3S A;  4XK4 A;  4Z65 A;  3Q0W A;  3ZXS A;  4L9T A;  4NC7 A;  2QYV A;  3L2C A;  3E3V A;  2I3C A;  2OTJ I;  3IKV A;  4KJZ A;  4RM3 A;  2FUG 2;  2A6H F;  9ANT A;  4E7H A;  2AFZ A;  3M9A A;  3KQX A;  2DQL A;  3Q9V A;  3KEO A;  2ZXJ A;  1FWZ A;  3BI0 A;  4A6D A;  1X10 A;  2DMT A;  4MRI A;  2HQ5 A;  4G6D A;  1SAN A;  2OJE D;  1H8L A;  1LFB A;  2QSG X;  3NA6 A;  5FFX A;  1AKH A;  2QQA A;  5IYC J;  5C82 A;  5HDK A;  4ENJ A;  5JVG F;  3GTJ J;  2OD5 A;  3E0J B;  1JGG A;  4BEH A;  4NGM A;  1BJZ A;  3WU0 A;  4NQW A;  3SZP A;  3RI4 A;  1ZR2 A;  2E1C A;  4M6G A;  4OWR B;  2MC4 A;  1UFM A;  3CJT B;  4ONU A;  5HS7 A;  2PG4 A;  2H6B A;  4R79 A;  1RRJ A;  4IHV A;  4X1E A;  5ILV A;  4ENM A;  1EE3 P;  3FBI B;  3SXY A;  3K4J A;  4P4F A;  2Z3Y A;  4I0A A;  3LSG A;  1P4A A;  4IHW A;  3B3S A;  1VKC A;  4KOW A;  4A38 A;  5K8N A;  1Y7E A;  3GFL A;  2R98 A;  2Z33 A;  1PYT B;  3ZQ7 A;  2CS3 A;  2BY0 A;  2JA5 J;  2F5I A;  3ZPL A;  2WPW A;  2KIF A;  1X1C A;  3C2G A;  5DTD A;  1XMT A;  2LLK A;  3CME I;  1FOK A;  5KTC A;  3BJA A;  3PQJ A;  4CYO A;  1O3T A;  3JTH A;  3S1Q J;  5F0F A;  2ISZ A;  4C2T A;  2R7F A;  4NNJ A;  3I55 I;  4O6J A;  4HX4 A;  4KOX A;  1MJ9 A;  3BLN A;  4HPS A;  3OYA A;  4FX4 A;  4GXH A;  3LNQ A;  5HNH A;  2E71 A;  3H1C A;  4IK2 A;  1UB9 A;  1YJW I;  1P4W A;  1LQ1 A;  3BLY A;  3IL2 A;  2CV2 A;  1ELM P;  3TC8 A;  2GZW A;  3KZI C;  1X2N A;  1G2H A;  3HSE A;  3D8P A;  2BVL A;  1NK3 P;  3VOD A;  3VEP A;  3JRE A;  3TFY A;  4BHB A;  1X3W B;  1ZQ3 P;  1I27 A;  1S7L A;  1W7P D;  2BZT A;  2OH1 A;  4XR6 A;  3ABT A;  2K3P A;  1ON1 A;  2R7U A;  3CCM I;  1FYM A;  1PP8 F;  2KP6 A;  3HJE A;  3MN2 A;  3R6S A;  4A3D J;  3ZMU A;  4QC6 A;  2V9V A;  2YS9 A;  4L0Y B;  4E7K A;  4YU9 A;  5D6E A;  3GFM A;  3GLL A;  3G1O A;  2FQ3 A;  2Q4Z A;  3IH2 A;  1D1A A;  1ARL A;  2K9S A;  4KVO E;  2GBY A;  5DCF A;  5D8N A;  4RAG A;  5L3E A;  1SFE A;  2LY1 A;  1R00 A;  1UWY A;  3D2M A;  1T6S A;  3Q0V A;  4XL9 A;  4BL0 B;  2EQR A;  4ETS A;  1U78 A;  1W1W E;  4LLL A;  1CQT A;  2XB5 A;  1IRG A;  1ITY A;  2R5Y A;  4J00 A;  2LYC A;  4NGR A;  3CMM A;  2P5K A;  4F52 A;  3CQZ J;  2ZEF A;  1J09 A;  2X51 A;  4P4E A;  3DR6 A;  1BLL E;  4KOV A;  4DYO A;  2E19 A;  3MVP A;  3F23 A;  3RPQ A;  3OR2 C;  2FSR A;  5AG6 A;  2K86 A;  1I5Z A;  2ZFU A;  3HKZ N;  1YTY A;  4GYI A;  3GTG J;  4P44 A;  1D8J A;  4BIN A;  4PGG A;  3CC7 I;  2FX0 A;  3E5Q A;  2ATR A;  2R7Q A;  2DMP A;  2ZCW A;  3S32 A;  2QEN A;  4ZZL A;  3TQN A;  1PUF A;  3N7Z A;  2DFF A;  4MFJ A;  4B44 A;  2WY7 Q;  4NGP A;  4U87 A;  2I10 A;  1JGS A;  2A6T A;  3T8T A;  5LEJ A;  2GA1 A;  3FIW A;  3PB8 X;  4I09 A;  5F04 A;  2MLG A;  4LLN A;  1LVA A;  3KEY A;  3CXS A;  3MKW B;  2F5D A;  4E7S A;  4CHU A;  1T0F C;  2HWV A;  1YRN A;  5FKM A;  3I54 A;  1VQK I;  3GME A;  2YND A;  3S2D J;  3QPL A;  4L89 A;  4U9Z A;  4DBR A;  3QYF A;  4BDY A;  1DGW Y;  3KZZ A;  4XRS A;  2C1C A;  1Z05 A;  2K9L A;  3KX2 A;  3HBL A;  2JEW A;  2ECB A;  4IX7 A;  3OIO A;  2HPI A;  3B8G A;  1OCO H;  2V4J C;  4XID A;  5BPD A;  1N77 A;  2KDZ A;  2F6C A;  4C3I J;  3J7Z I;  1IW7 F;  4W1U A;  4C2U A;  5L3F A;  2XKP A;  3D68 A;  1XTA A;  1GV2 A;  1YE9 A;  2ETH A;  5H84 A;  2VIX A;  1S5L C;  2FT0 A;  2Q0Y A;  4PUS A;  1Z8T A;  1IXR C;  3GCM A;  3HOU J;  3GTM J;  2J8R A;  1WFX A;  4R6T A;  4ANJ A;  4X8I A;  3HTU A;  3EFA A;  4M85 A;  1X4P A;  2A6E F;  3G8W A;  1FOW A;  4NJQ A;  8CPA A;  3OS2 A;  2ID3 A;  3JSP A;  1LE8 B;  2Z99 A;  2F5F A;  1LDJ A;  1TW2 A;  4DZP A;  2EZI A;  5JM6 A;  3OYE A;  2EV5 A;  2A4N A;  1V55 H;  3OYG A;  5ELY A;  2LR8 A;  3OYF A;  5KAI C;  1W7P B;  1E17 A;  4Y4R A;  2DYR H;  4AD9 A;  4GFB A;  1XBU A;  3K1N A;  4CA0 A;  3PIO F;  3ZCO A;  4MY3 A;  1R5G A;  2VC1 A;  4XLA A;  4QBJ A;  4MHN A;  1HF0 A;  4MHD A;  3K70 C;  3C3W A;  2J8N A;  4UUV A;  1QPI A;  4XLP F;  3GYA A;  5E8I A;  3HOY J;  3S6F A;  2DTR A;  3OMY A;  3TO9 A;  3I4M J;  4HEA 2;  2ZW7 A;  2WAF A;  1RI7 A;  2LMD A;  3DFG A;  3N05 A;  3TDZ C;  4BJT A;  3MAJ A;  4ZYE A;  3NAR A;  4MHP A;  3L2W A;  2A05 A;  1RC9 A;  3R9G A;  3BJ7 A;  4NGN A;  1OIS A;  2FL4 A;  4B5P A;  4IHY A;  2VQG A;  1S6L A;  3R61 A;  3WTX C;  2NS8 A;  2M4G A;  2LF7 A;  4A3E J;  3R60 A;  1OZP A;  2GXG A;  3EYY A;  1LNW A;  3GXO A;  4ASN A;  1IGN A;  2QCO A;  4M3D A;  5DEQ A;  3JRB A;  4HBL A;  4RGU A;  2PJ0 A;  3ZQF A;  4PV6 A;  3TT2 A;  5IB9 A;  3KIO A;  3T1B A;  4MFK A;  3H8F A;  1FYL A;  1XSD A;  1Z9U A;  5J8C A;  1U9O A;  2WAQ A;  4C30 A;  1SFU A;  1DP3 A;  4BE0 A;  1GV5 A;  2EK5 A;  4RLF A;  2LDU A;  3IAS 2;  3V8L A;  3DCF A;  2A5W A;  3KYD B;  4KT5 C;  1PUE E;  2VLA A;  1KU2 A;  1S8N A;  1TNT A;  2L9R A;  2YU3 A;  1D8K A;  3WGG A;  1BJA A;  1TF9 A;  3FH4 A;  3QP5 A;  5LBQ A;  2Q0O A;  3M8E A;  2M7A A;  1IYL A;  1GXQ A;  3VAR A;  2ADU A;  2Q44 A;  5J8F A;  3FEE A;  3G4S I;  2LK2 A;  4G12 A;  4UY8 I;  1NG6 A;  3OR1 C;  3GKR A;  4BMH A;  4HNX B;  2BYV E;  2IA0 A;  4CCL A;  1RO5 A;  2ZW4 A;  4MFZ A;  4MCS A;  4I99 C;  2REE A;  2M4K A;  1N71 A;  4P4B A;  3LSH A;  1UMQ A;  5LLQ A;  2GXA A;  2P8T A;  3CLQ A;  2PJ7 A;  2HGC A;  5B5E C;  3OYC A;  3A01 A;  2PJR B;  4NSQ A;  4UWJ A;  3NH5 A;  3MQ0 A;  4KIB A;  4XPD B;  4C2Z A;  4LB6 B;  4JP0 A;  1X12 A;  4CH7 A;  3B35 A;  5CJ9 A;  1OMI A;  2KMU A;  2A61 A;  3SDG A;  1FP2 A;  2WUU A;  4CCN A;  2PE3 A;  4I01 A;  3QOD A;  5TIS C;  3A03 A;  4LQ6 A;  4BYY A;  1DE4 C;  5K8O A;  5BQT A;  5F0H A;  1I6H J;  1Q2C A;  3ROU A;  4K3N A;  4IO9 F;  2AFU A;  5ICF A;  4CRZ B;  2JRT A;  1R5H A;  2CRG A;  1HXD A;  1G3S A;  4KLW A;  3GEZ A;  4A0X A;  5FKL A;  2ZEE A;  1ODD A;  5HVG A;  4UEZ A;  4HQE A;  1J9I A;  3KQZ A;  3S16 J;  5HXD A;  4ZYA A;  4P6Y A;  4HX7 A;  5HS8 A;  1IYK A;  1HLV A;  1ZK8 A;  1X1B A;  2NYQ A;  3AL0 C;  2Y0S N;  5DUK A;  4BHP A;  2DMN A;  4FAS D;  5LD2 C;  1B72 A;  1DGR M;  2DDA A;  1UHS A;  3CPX A;  1QQ9 A;  3PBE A;  2XPV A;  2BW3 B;  5LHI A;  3DTK A;  3HHH A;  3VOE A;  1YW6 A;  4HRI A;  1S5K A;  1XGO A;  5IP9 J;  3Q0U A;  1APL C;  5HVQ C;  4Q4Z F;  1Z67 A;  2JRM A;  4EM2 A;  2RNG A;  4C7H A;  1R1U A;  4XMY A;  5F6F A;  2F2E A;  3K4K A;  3NAU A;  5M5X J;  1VF9 A;  3D7G A;  1BW6 A;  5HDN A;  4R8F A;  4BD9 A;  3PFI A;  3B2Y A;  2FSW A;  4Z6Y A;  1IF1 A;  1ZGA A;  5K7F A;  2VXK A;  3P9C A;  3FXU A;  2EWB A;  2Y9Z A;  2LKP A;  2QWW A;  3QPH A;  1RXT A;  3TTH A;  2AXL A;  1RIO H;  3CT9 A;  3WU2 C;  4KIF A;  5GTH C;  3FXR A;  2GOM A;  2X6W A;  5HS9 A;  2CGP A;  3SZG A;  2DPU A;  2AFS A;  1B87 A;  2CUE A;  3ZQH A;  1L3L A;  2B63 J;  3FRM A;  1MMA A;  1Z91 A;  5KCM A;  3I0T A;  3WTV C;  1O3Q A;  3VAT A;  4RAZ A;  3GTO J;  4KS9 A;  3DXJ F;  1YQE A;  3EO4 A;  3MWM A;  3BDD A;  2IMO A;  2BE5 F;  1YW4 A;  2VOD A;  2H1L A;  5HOD A;  4BQA A;  1R6R A;  3PNT A;  3K0L A;  2HDC A;  2WZN A;  4QPO A;  4E70 A;  2PJ3 A;  3HOW J;  4B13 A;  1BM9 A;  1WZ2 A;  3CC2 I;  1TQM A;  4ZDO A;  3TO6 A;  4CIC A;  2YNC C;  4XPD C;  4PJ0 C;  3CP8 A;  3AG3 H;  3BG6 A;  4LOC A;  4HNU A;  3G3S A;  2ISY A;  4UIA A;  5ILS A;  1YIJ I;  1MJB A;  2CJJ A;  3V7C A;  3BTL A;  2G7H A;  3LSJ A;  2L5Q A;  2C6G A;  3JRU A;  3NH8 A;  1GHC A;  1S3J A;  4AVP A;  1XSV A;  2KT0 A;  5K5R A;  4AUX A;  1OR7 A;  1O4X A;  3JRG A;  2CV0 A;  4EMS A;  2JVH A;  2CV1 A;  2V8G A;  1IN6 A;  3P2F A;  1LCP A;  2BSW A;  2L7F P;  4EM1 A;  4L5I A;  1T39 A;  2JDC A;  2FA5 A;  2FXA A;  2M8E A;  1B9M A;  1ETX A;  3RYP A;  1RR7 A;  2EZK A;  4OIP F;  5K8P A;  4LMY A;  3WR7 A;  2KL4 A;  3PFE A;  2KZG A;  5E3O A;  4TNU A;  1SVO A;  1XMX A;  3WTU C;  1TL8 A;  4OC4 A;  4TWE A;  1ZRD A;  3FJU A;  4R87 A;  4M73 A;  3GBG A;  4FE7 A;  4NEX A;  2R93 J;  4I98 B;  1PJR A;  2W24 A;  3L1P A;  1XDU A;  1K83 J;  3O2P E;  5A2Q Z;  2ZOF A;  3F22 A;  4E8O A;  4PGH A;  3DBH B;  3H3U A;  3CDH A;  2XAJ A;  2MD0 A;  2NVQ J;  5IB0 A;  1REP C;  3S14 J;  2BOL A;  1KUX A;  1O57 A;  1Y39 A;  1ZRE A;  4F91 B;  1XF8 A;  1IOI A;  5F47 A;  3HYI A;  4O23 A;  3FIS A;  4CCO A;  1ZAR A;  1K61 A;  2BY1 A;  1FYK A;  2F8H A;  2ODF A;  4NGQ A;  1MW7 A;  3CXP A;  2X6X A;  3CCR I;  4UFW A;  4UEE A;  1D5Y A;  2HR3 A;  2KPM A;  2AE6 A;  2GAN A;  4XRF A;  3BG3 A;  2RV8 A;  3BR5 A;  3DKW A;  3FIX A;  3M1E A;  2CYY A;  1MD0 A;  2CXA A;  4PK2 A;  4PQA A;  4R3K A;  1MBJ A;  1W7P A;  1YLF A;  3RO0 A;  2ZJQ F;  1HDP A;  1LJ9 A;  4GXO A;  1JJ8 C;  2CU7 A;  5F09 A;  4XBF A;  2V9P A;  3WE2 A;  4YII A;  1BOB A;  2VZY A;  2G3T A;  2M3A A;  5LFA A;  2LVS A;  3H9G A;  4MGR A;  1JKR C;  1FJL A;  1QMU A;  1AUG A;  2EUI A;  5HOO A;  1Z2L A;  1U5T B;  3K2A A;  3FXQ A;  4XIC A;  5KNL A;  4M71 A;  1VHE A;  1YHQ I;  2M87 A;  5KVR A;  5LGU A;  1YX3 A;  4H89 A;  4IRG A;  1N75 A;  5F1J A;  2VT3 A;  1BN5 A;  4FTH A;  2NVX J;  3R9F A;  2KCW A;  1XGS A;  1AKH B;  3OYJ A;  2HOE A;  3WHC A;  4FD6 A;  4Y49 B;  4AXV A;  2Y48 A;  3CZX A;  5A27 A;  2ZXV A;  4DJA A;  5CVU A;  1K78 B;  4NQW B;  4CPA A;  4ZZD A;  3CDI A;  2E7X A;  1U8B A;  4N4O B;  1RKT A;  1MBG A;  2JSC A;  2RRE A;  1J0R A;  3KP5 A;  1VQ7 I;  3PEI A;  3N5F A;  4BNC A;  1QQI A;  2NS7 A;  2R7D A;  5EYR A;  3MN8 A;  4EVI A;  5DM6 F;  3KR4 A;  4P4D A;  2LNB A;  4FQG A;  1S60 A;  2HOT A;  3J81 K;  2Q51 A;  2E5Z A;  2K3F A;  2LF8 A;  4I02 A;  5J1U A;  2PR1 A;  1OPC A;  3DTI A;  5D5X B;  1YSJ A;  2DXQ A;  4HNW B;  2GQQ A;  2VQY A;  2L4A A;  5K5Q A;  3K2Z A;  4CAF A;  4ZC3 A;  2C6P A;  2RB7 A;  4KOY A;  2Y30 A;  4ESB A;  1XMB A;  1M4D A;  4MY0 A;  4CCM A;  3VSL A;  1DDN A;  2CWE A;  3BTJ A;  1IJW C;  1OLT A;  2RNJ A;  3OYH A;  3LMM A;  5C88 A;  2YPR A;  3MD2 A;  4UA3 A;  4C2Y A;  4BQQ A;  3D66 A;  4PXD A;  4KVX A;  1GYT A;  4QTR A;  2VZZ A;  4B14 A;  1ZAO A;  4DBQ A;  1IC8 A;  5F48 A;  4CGZ A;  2VOO A;  1ORK A;  2XB0 X;  4QB9 A;  3S9M A;  3BPX A;  4KIT B;  5LRS A;  1E0E A;  3G3Z A;  1TTY A;  4A3F J;  1E3P A;  1OCR H;  4H2K A;  2A07 F;  1F9N A;  3F6O A;  5E1X A;  5HVF A;  4F6A A;  1TC3 C;  1WHU A;  3FXO A;  1T95 A;  5DYM A;  1T08 B;  1IV8 A;  3OYM A;  4A3K J;  3CDL A;  4C3H J;  3RBU A;  1YIO A;  4D5C A;  3M4O J;  1MMD A;  2F5V A;  2EIL H;  1AMP A;  1FT7 A;  2DPS A;  2JDD A;  1OCZ H;  5GP9 A;  3V7Z A;  3ERM A;  3TL4 X;  3TDU C;  2IA1 A;  1YK3 A;  2IGN A;  1WSU A;  2E2I J;  1CF7 B;  2LKS A;  1PU9 A;  3L09 A;  1S7F A;  3KCC A;  3KP7 A;  4FX0 A;  4CCK A;  2M7B A;  3TW7 A;  3HTS B;  4AG7 A;  4XLN F;  1IO2 A;  3HUV A;  2BW3 A;  4HDU A;  1S7N A;  4J19 A;  2GIZ A;  4C68 A;  5CVJ A;  1V3F A;  5E18 F;  4M6I A;  1MNE A;  2LBF A;  2JA8 J;  4OC1 A;  3FYN A;  1JHH A;  2AJ6 A;  1GVJ A;  2DOF A;  2R1I A;  4RB3 C;  3PM1 A;  1GT0 C;  4IHM A;  4MCP A;  3IV5 A;  2I00 A;  4XPK A;  3DPT A;  2UUZ A;  2G0B A;  3FNC A;  2E60 A;  2JQ7 A;  3FBU A;  1W36 D;  2HZD A;  4BQO A;  1IN8 A;  4G7O F;  4CYQ A;  4CZC A;  4OC5 A;  2QLZ A;  5GAG J;  3EC4 A;  3SI2 A;  1TKH A;  2ME0 A;  3EYI A;  3KZW A;  1PUF B;  1YRE A;  3IRR A;  4A94 A;  3J7A Y;  1J5Y A;  3BZK A;  4N0B A;  4B8X A;  2O5R A;  4E7Z A;  4JXR A;  1QBJ A;  2VI7 A;  2HNH A;  2BEO A;  2Z3K A;  4LK1 F;  2I79 A;  2XAS A;  1YG2 A;  3VPR A;  4ZY0 A;  1O7L A;  1MZB A;  3BR0 A;  1YRN B;  1K4J A;  1KU3 A;  2B5G B;  3BC8 A;  3B6A A;  2PIY A;  1X1D A;  3I1U A;  1EJ9 A;  4S0H B;  4CAW A;  3L00 A;  1WPK A;  4ZTF A;  2M5W A;  3HGY A;  3CP2 A;  1MKM A; 
#chains in the Genus database with same CATH homology
 4XOP A;  3BCB A;  3D8P A;  2BVL A;  2MFZ A;  1WJE A;  2ZW5 A;  4AVZ A;  2JA2 A;  3TFY A;  1WJA A;  1S7L A;  2CNM A;  2OH1 A;  2PSW A;  3HL2 A;  4E2A A;  4XR6 A;  2R7U A;  2K3P A;  4YEL A;  4XN0 A;  4JJX A;  2W00 A;  2EVN A;  4JOM A;  2KP6 A;  3K6G A;  4XKB A;  3QOE A;  4Y3O A;  4BUP A;  1YGH A;  3JUW A;  4QC6 A;  1NSL A;  4BAC A;  4E7K A;  2Z3P A;  2K9M A;  3JTK A;  2Z0Z A;  3S6H A;  3W2A A;  4JD6 A;  5CNP A;  5H86 A;  1D1A A;  3L2Q A;  4KVO E;  3H0D A;  4MFQ A;  2OB0 A;  1G8X A;  2WB1 A;  2LY1 A;  1S7K A;  3D2M A;  3H9J A;  4BL0 B;  4XL9 A;  2UV1 A;  2V6E A;  4KOR A;  5A28 A;  3DKX A;  1IRX A;  3QYE A;  3DLA A;  3K4M A;  4J00 A;  2LYC A;  3CMM A;  4F52 A;  4D1Q A;  2ZSH B;  2XAU A;  2WA0 A;  1MK4 A;  1XIX A;  2OZU A;  1J09 A;  2OZG A;  2X51 A;  2Z16 A;  1SQH A;  1S3Z A;  3DR6 A;  2XF5 A;  4KOV A;  3TOA A;  2LY2 A;  2VB6 A;  3HC7 A;  2FSR A;  3OR2 C;  2Z3M A;  2Z3O A;  5AG6 A;  3SXN A;  2ZFU A;  3T90 A;  1UAA A;  4AB7 A;  4AYB A;  2BUE A;  2ATR A;  2VQH A;  4B11 A;  2R7R A;  4KLV A;  1D0Z A;  2R7Q A;  3S32 A;  4GRI A;  4NUB A;  3N7Z A;  2E1M B;  4MFJ A;  2HVR A;  4B44 A;  4NCZ A;  2WY7 Q;  3HPG A;  5IX3 A;  4CAX A;  3FKJ A;  4Y33 A;  4U87 A;  3UR3 C;  4IZZ A;  2A6T A;  3S3M A;  3ZQQ A;  4M3S A;  3IUO A;  2VJI A;  3PNV A;  1IID A;  3KEY A;  3SYT A;  3CXS A;  3MKW B;  4GS4 A;  2W1O A;  3OYI A;  2FE7 A;  3OY9 A;  4E7S A;  1T0F C;  1V5E A;  4RLQ A;  3S8P A;  1M4G A;  4DGW B;  3VYU B;  2WBM A;  5FRO A;  2YND A;  4L89 A;  4U9Z A;  4AVC A;  4DBR A;  2D4O A;  4HKF A;  3NWT A;  3QYF A;  4BJ6 C;  4BDY A;  4LX9 A;  1DGW Y;  4UFV A;  3K4C A;  2M0M A;  2OC6 A;  3E0K A;  2K9L A;  3KX2 A;  4NC8 A;  4B10 A;  4IX7 A;  2WPX A;  2Q4Y A;  2HPI A;  2B4D B;  3B8G A;  2V4J C;  3I9V 2;  3PSF A;  1N77 A;  3R95 A;  2F6C A;  4IKF A;  4XQF A;  1D1B A;  4C2U A;  3DPL C;  1I12 A;  2MAB A;  4BS9 A;  1YE9 A;  5H84 A;  2VIX A;  2FT0 A;  2Q0Y A;  4XNH B;  4KOU A;  1ZEL A;  2FIW A;  4PUS A;  2VAS A;  4PFO A;  3M1C A;  4A95 A;  2K5T A;  4MLO A;  2J8R A;  3K9U A;  1WFX A;  1VZ0 A;  4ANJ A;  2LC2 A;  1WJF A;  3D5S C;  3OL3 A;  4KIS A;  3EFA A;  3EXN A;  4M85 A;  4MFP A;  5AG5 A;  1X4P A;  3R96 A;  4A30 A;  2ZSI B;  3G8W A;  1ON0 A;  3PL8 A;  4XKV A;  1WK4 A;  3OS2 A;  2DOA A;  3OL4 A;  4QPQ A;  3HOS A;  4F3Q A;  4NF1 A;  2QEC A;  3PJR A;  2HQA A;  4LG3 A;  5F46 A;  3OYE A;  4JQF A;  3TMO A;  2HVQ A;  5G20 A;  5BWA B;  2A4N A;  4XN3 A;  3OYG A;  3H9Q A;  3LSM A;  1P4N A;  3OYF A;  2OZH A;  3S6K A;  1P9Q C;  4LIV A;  4Y4R A;  2BL1 A;  2IGM A;  4CA0 A;  4AU7 A;  4I49 A;  3ZCO A;  4MY3 A;  1M4I A;  3F8K A;  4XLA A;  3VDX A;  2PMZ A;  1R57 A;  3EUH C;  3K70 C;  4MHD A;  5DWN A;  2CMP A;  4QBJ A;  2J8N A;  2E5N A;  4PJJ A;  1QST A;  4Y49 C;  3CF2 A;  4ZDL A;  3GYA A;  4BJ5 C;  3S6F A;  5IV0 A;  3OMY A;  2ZW7 A;  3TO9 A;  4HEA 2;  3ZJ0 A;  2WAF A;  2R7S A;  3N05 A;  2Z10 A;  4UCP A;  2JVG A;  1Y9W A;  1X1A A;  4BJT A;  4UFX A;  5G21 A;  2HQY A;  3RYO A;  3DR8 A;  4F93 B;  3BCA A;  4P5O A;  3L2W A;  2B4B A;  2HUZ A;  4H6Z A;  2BVM A;  2X85 A;  3H5R A;  4ZDP A;  2FL4 A;  3BJ7 A;  2VQG A;  3LSK A;  4XPL A;  4B5P A;  2W82 A;  1OZP A;  2M4G A;  4YGO A;  4R57 A;  3R1K A;  4LIU A;  5HH1 A;  2E1M C;  3MKY B;  3DKY A;  1YVO A;  3AKZ A;  1IB1 E;  3DDD A;  4B5O A;  4PV6 A;  3M8J A;  3TT2 A;  4MFK A;  4P1W A;  1XE4 A;  3FXT A;  3SXO A;  4E6K G;  2NOJ B;  1Z9U A;  2FCK A;  5JHF A;  2L7K A;  4MBU A;  5AG7 A;  2WAQ A;  2X1D A;  5J8C A;  1X4O A;  4C30 A;  1DP3 A;  2Z3N A;  4XKW A;  3RTR A;  4BE0 A;  1Q2D A;  3BJ8 A;  4RLF A;  3IAS 2;  1V0C A;  2A5W A;  4A31 A;  4C2X A;  2B3V A;  1QSO A;  2VLA A;  4UBR A;  4G6T B;  4A33 A;  1YLE A;  4IUS A;  1QU3 A;  1WJD A;  1IYL A;  2KQR A;  2M7A A;  2CY2 A;  2Q44 A;  3F5B A;  5J8F A;  4PJN A;  5TGT A;  1M1D A;  1M44 A;  3LOD A;  4QUS A;  4BMH A;  4KSF A;  1NG6 A;  3OR1 C;  3LSI A;  2HVS A;  2JLM A;  3GKR A;  3IAM 2;  4CCL A;  4HNX B;  3KKW A;  3CJR B;  1HA8 A;  3W2V A;  1RO5 A;  1YR0 A;  3D5R C;  4XON A;  2ZW4 A;  4MFZ A;  4PK3 A;  4X0G A;  3OYB A;  2FIA A;  2REE A;  2RC4 A;  2M4K A;  1N71 A;  3LSH A;  4YFJ A;  1TZL A;  2LRD A;  4CAV A;  3HG9 A;  3VSK A;  2LOO A;  1WWZ A;  2Y0M A;  3OYC A;  4UWJ A;  2PJR B;  1GLN A;  1N78 A;  3C26 A;  5FRN A;  3MGD A;  4NSQ A;  4XPD B;  4C2Z A;  4CGN A;  4ZJZ A;  4CH7 A;  2VQC A;  2VKD A;  3KYL A;  2KMU A;  4XNH C;  1QSM A;  3R9E A;  3LL7 A;  2WUU A;  4CCN A;  5JQ4 A;  3QOD A;  2IS4 A;  5G1Z A;  2PRB A;  4DOZ A;  1XEB A;  2IL4 A;  4OLL A;  1FMV A;  3PNY A;  4BE2 A;  4AG9 A;  4D9J A;  1Q2C A;  2CH0 A;  2FXF A;  2BEI A;  3CES A;  1KON A;  4CRZ B;  3HPH A;  1Y56 A;  3C2H A;  4KLW A;  1DQU A;  4J3G A;  1MMN A;  1KZF A;  2CUJ A;  3VYT B;  2P6E A;  5F49 A;  3U21 A;  2XSJ C;  3OYL A;  2W7N A;  1B6B A;  1NMT A;  1TIQ A;  2WAD A;  4ZYA A;  3DQV C;  3QB8 A;  3SHP A;  2XF7 A;  1MJA A;  4IQ4 A;  1IYK A;  3DU6 A;  1P0H A;  1X1B A;  5CQG A;  3OIQ A;  3AL0 C;  1UFH A;  4ITV A;  4FAS D;  2AQF A;  2Q2E B;  3AFH A;  4HPQ A;  5LD2 C;  2R7X A;  2P6F A;  4CS0 B;  1DGR M;  4EAT A;  4E7L A;  1U6M A;  2LRE A;  1Y7R A;  2IGO A;  2B58 A;  3W3C A;  4B47 A;  2K5C A;  4LIT A;  3A1Y A;  4BEH B;  1WJC A;  2BW3 B;  3CZ6 A;  4UWI A;  4XLE A;  3DTK A;  3W2W A;  4HRI A;  1S5K A;  3D2P A;  4EVY A;  1I21 A;  5HVQ C;  2B5G A;  3DSB A;  2DCE A;  2REF A;  2RNG A;  1GHE A;  4C7H A;  4BU2 A;  4N4N B;  1Y6I A;  4XMY A;  3K4K A;  3FB3 A;  3PGP A;  3QAH A;  1L0C A;  4JXQ A;  4MI4 A;  4AVA A;  5FVJ A;  4CUG A;  2DT6 A;  2VXK A;  4XKC A;  4IF5 A;  2IGK A;  3TTH A;  1RXT A;  2Q04 A;  2Q4V A;  4U9Y A;  3GY9 A;  3OWC A;  2KZV A;  3HKZ A;  4CYP A;  2GOM A;  2X6W A;  5G22 A;  3SZG A;  1B87 A;  2DJI A;  4KUA A;  3NE7 A;  4XLF A;  4OAZ A;  1QHH D;  2ARH A;  3FRM A;  4CGL A;  1MMA A;  5KCM A;  1PUA A;  1X19 A;  3EY5 A;  4AVB A;  4BBH A;  2Y0S A;  4QVT A;  2PJR A;  2YNC A;  3ZRG A;  3K4N A;  2HU9 A;  4KS9 A;  5FRM A;  1BR1 A;  4F0Y A;  3EO4 A;  2XC7 A;  4E0A A;  3FNC A;  2JEV A;  2V9K A;  4ORF A;  4XNF A;  2UWM A;  1Y9K A;  3K70 D;  3L2R A;  1R6R A;  3PNT A;  3H5Z A;  3I9S A;  2L2O A;  4UCM A;  4QPO A;  2IS1 A;  1NE9 A;  3CJQ B;  4YRV A;  2J8M A;  4B13 A;  1SAU A;  1V5F A;  4ZDO A;  4XPD C;  3TO6 A;  2YNC C;  4PSX A;  1YX0 A;  3CP8 A;  4E4H A;  1LRZ A;  3BG6 A;  3OYN A;  4XOR A;  2VXD A;  3OYD A;  3G3S A;  1YX5 A;  2HDW A;  3OOU A;  4PJM A;  1BR2 A;  3K10 A;  1FMW A;  4HNU A;  1LFP A;  4U7B A;  5KHD A;  1MJB A;  1SFK A;  2PR8 A;  2VJ4 A;  3I3G A;  2L5Q A;  2L9S A;  4BE1 A;  3MKZ A;  4K30 A;  4F0X A;  3CXQ A;  4E7J A;  2VKH A;  2P6G A;  4BGD A;  4R3L A;  2CV0 A;  4MJ8 A;  2V1N A;  4KUB A;  2JVH A;  3S3O A;  4CYN A;  2CV1 A;  1WJB A;  5E96 A;  4OAY A;  4II2 A;  1BR4 A;  3P2F A;  3S93 A;  3RCO A;  3OS0 A;  3H35 A;  2BSW A;  2D4P A;  2JDC A;  4FD7 A;  3S6G A;  2FS5 A;  3IU2 A;  3V8I A;  3VWD A;  2GOX B;  2Q1Z B;  4RS2 A;  2Q7B A;  2LG4 A;  1Q2Y A;  2R7W A;  4U5Y A;  2O28 A;  3TO7 A;  4CGP A;  2ELJ A;  4XLC A;  3WR7 A;  3BG7 A;  3SDB A;  2KL4 A;  2ZXH A;  4MFL A;  1OR7 C;  1S9H A;  3V42 A;  3F0A A;  4R87 A;  4BXF A;  3GBG A;  2CW7 A;  3A4C A;  4NEX A;  2B4D A;  4KOT A;  1PJR A;  2JUG A;  2RQQ A;  3MMY B;  4OAE A;  3HXL A;  2DT7 B;  1ZO0 A;  1LDK B;  3EUA A;  4RM2 A;  4DIQ A;  1VHS A;  2B3U A;  3G2B A;  2PC1 A;  2VBQ A;  5HNF A;  3DNS A;  2VL8 A;  4HNY B;  5GCN A;  1IIC A;  2MD0 A;  5EBV A;  5IB0 A;  4CSW A;  2BOL A;  5CQE A;  1KUX A;  3SEZ A;  4II9 A;  2QKL B;  3VYR B;  1W36 C;  3A9L A;  3OIP A;  4F91 B;  1XF8 A;  5F47 A;  1ERD A;  4B12 A;  5EC4 A;  4CAE A;  1U0J A;  2CUZ A;  4CCO A;  4LUA A;  5HMN A;  2XF6 A;  3RPU D;  1MW7 A;  3PSI A;  2X6X A;  1TT0 A;  2X1C A;  2R4G A;  1I1D A;  2QIR A;  3CXP A;  4UFW A;  4KSA A;  3ZGK A;  2KPM A;  2GAN A;  2AE6 A;  3UY5 A;  3ZZI A;  3OWT A;  4CRY B;  1QHG A;  1LVK A;  2DPT A;  1EA3 A;  3FIX A;  3IU1 A;  2X7B A;  4PK2 A;  2X1E A;  2CXA A;  1PYV A;  4R3K A;  4CCJ A;  3JVN A;  3W6S A;  2F4I A;  4PSW A;  4F92 B;  3R9G A;  4C9Y A;  2NMT A;  2VQL A;  1BOB A;  1AA7 A;  2VZY A;  2G3T A;  2M3A A;  3PUB A;  5LFA A;  3H9G A;  4KVM E;  3RQ4 A;  3H5N A;  3H4Q A;  5HLT A;  4HG2 A;  3IGR A;  3P2H A;  4ZTJ A;  2EUI A;  5HOO A;  2DXI A;  4ZGY B;  2OUM A;  3FDY A;  5KNL A;  3T9Y A;  4H6U A;  1UEL B;  2WY8 Q;  2KRH A;  1YX3 A;  2HPM A;  4H89 A;  3HUG B;  1N75 A;  1Z21 A;  3OS1 A;  3EPZ A;  3VWE A;  3W6X A;  3R9F A;  3DWL E;  4FD5 A;  2KCW A;  1Z4E A;  4B48 A;  5CKT A;  3OYJ A;  3H5A A;  2GE3 A;  4ZBG A;  2G3A A;  4KOS A;  4PK4 A;  4HNT A;  4FD6 A;  4JLY A;  4Y49 B;  5A27 A;  2ZXV A;  4XM3 A;  4DJA A;  3L2V A;  2X6Y A;  4RMN A;  2PQ8 A;  2OV7 A;  4NQW B;  2R7H A;  2CW8 A;  4N4O B;  1CJW A;  4Q38 A;  2RRE A;  2XDV A;  3DEE A;  4FET A;  3QYB A;  4PFP A;  3HOT A;  5KTD A;  1QSN A;  2LBF B;  2WSA A;  3EUK L;  1D0Y A;  4IQJ A;  4Q36 A;  1S60 A;  3ZR8 X;  3VWB A;  3TE4 A;  2R7V A;  1KUY A;  2R8V A;  2E5Z A;  4XOT A;  3D5L A;  4R9M A;  4HST A;  2R7O A;  4FD4 A;  2PR1 A;  3DTI A;  1JI8 A;  4NXY A;  2DXQ A;  4HNW B;  5JPH A;  2VQY A;  2JSP A;  4CAF A;  4ZC3 A;  3PZJ A;  1D1C A;  2MYS A;  1Z4R A;  4KOY A;  4MY0 A;  1M4D A;  4X5K A;  4YRH A;  4CCM A;  3VSL A;  2ZXI A;  3SEQ A;  2KDO A;  4RI1 A;  4YEJ A;  1Z3X A;  4B5P B;  1MMG A;  1OLT A;  3OYH A;  3PFY A;  3LMM A;  3W91 A;  5C88 A;  4UA3 A;  3MD2 A;  4C2Y A;  4BQQ A;  4OAD A;  4KVX A;  2C27 A;  2OU2 A;  4KZT A;  2KHM A;  2AQE A;  2IS6 A;  1BO4 A;  2VZZ A;  1D0X A;  4A2Z A;  4B14 A;  5I0C A;  2IXS A;  4DBQ A;  5F48 A;  3LFU A;  4B3X A;  2VPL A;  2IS2 A;  3ONQ A;  3DU5 A;  5DWM A;  1G59 A;  4QB9 A;  3K4L A;  3D3S A;  4KIT B;  3ZXS A;  2Z3L A;  1E0E A;  4NC7 A;  2VJJ A;  2YNE A;  1K6Y A;  4F6A A;  2ZPA A;  4KJZ A;  1LKX A;  2FUG 2;  4RM3 A;  1T95 A;  3UNG C;  4E7H A;  2KRC A;  3OYM A;  2H5M A;  4C7I A;  1Z7L A;  2CNT A;  1MMD A;  1V5G A;  2F5V A;  2KLO A;  3A2K A;  2DPS A;  2QML A;  4A32 A;  2JDD A;  3OYK A;  3FHN A;  3RSN A;  3TL4 X;  4II3 A;  3TCV A;  3IP4 B;  2W4S A;  1J4J A;  1NG7 A;  1YK3 A;  2CFO A;  2IGN A;  4CGO A;  1PU9 A;  5C82 A;  5KTA A;  1Z3Y A;  5ISV A;  2HV2 A;  1S7F A;  4HSR A;  4CCK A;  3E0J B;  2M7B A;  4AG7 A;  4BEH A;  2V7F A;  4UCN A;  4DNC A;  2BW3 A;  1S7N A;  1KUV A;  2Z1D A;  1FY7 A;  4C68 A;  4PJL A;  4OWR B;  2WAE A;  1MNE A;  2LBF A;  3FYN A;  1MND A;  1WJ5 A;  2MC4 A;  2AJ6 A;  2Z11 A;  2VXZ A;  4ONU A;  2R1I A;  4R79 A;  2LH9 A;  3AL0 B;  2I00 A;  4XPK A;  3FBN B;  4L8A A;  3DPT A;  2UUZ A;  3DTE A;  3FBI B;  3K4J A;  2E60 A;  3VYS B;  3L2U A;  2G0B A;  2VEZ A;  3FBU A;  2P0W A;  3LSG A;  1W36 D;  2HZD A;  4BQO A;  5AGE A;  4CYQ A;  1VKC A;  4CZC A;  3LD2 A;  4KOW A;  4KT6 A;  4CGM A;  2ZW6 A;  4E8O A;  3EC4 A;  2R98 A;  1UG0 A;  2WPW A;  3PP9 A;  2PDO A;  2CS3 A;  3NWS A;  2F5I A;  2GIV A;  1QSR A;  3IWG A;  2R7T A;  1X1C A;  2QKM B;  4J01 A;  1YRE A;  3C2G A;  3J7A Y;  4JWP A;  1XMT A;  5KTC A;  2O5R A;  4F55 A;  4H4K C;  2L9N A;  2VJ5 A;  4E7Z A;  4JXR A;  4CYO A;  2VI7 A;  1YVK A;  2HNH A;  3K4B A;  4XLH A;  2CNS A;  2Z3K A;  3IWE A;  2I79 A;  2Z2S B;  3TOB A;  2I8D A;  4BQN A;  4C2T A;  4BDZ A;  4NNJ A;  2YGW A;  4KOX A;  2V26 A;  5AG4 A;  1MJ9 A;  3BLN A;  3F9K A;  3E1S A;  3OYA A;  5CPR B;  3S3N A;  1K4J A;  4E7I A;  5HNH A;  3BC8 A;  2B5G B;  4CAW A;  1X1D A;  3BLY A;  2CV2 A;  4ZTF A;  3DPU A;  4B43 A;  1CM0 A;  3TBI A;  3CP2 A;  3I3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...