5AG7A

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a benzomorpholine ligand
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Development of Small-Molecule Trypanosoma Brucei N-Myristoyltransferase Inhibitors: Discovery and Optimisation of a Novel Binding Mode.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 115
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ag7A00
4UFVA 4CGOA 4UCPA 3IU1A 5AGEA 4UCMA 4C68A 4CYNA 4A2ZA 2YNEA 4A30A 4CYPA 4CGNA 3IU2A 2YNCC 4UFWA 5G1ZA 4CGMA 4A33A 5G21A 4A32A 5A28A 3H5ZA 4A95A 4UFXA 5G22A 4C2ZA 4C7IA 5A27A 4A31A 4B13A 4CAEA 4CYOA 5G20A 4CGLA 4CAFA 5AG7A 3JTKA 4CGPA 2YNCA 4C7HA 2WSAA 5AG5A 4B12A 2YNDA 4UCNA 4BBHA 4C2YA 3IWEA 5AG4A 4B10A 4CYQA 4B11A 4B14A 4C2XA 2WUUA 5AG6A
chains in the Genus database with same CATH superfamily
5K8PA 4XPDC 4CYNA 2PJAA 5JQ4A 1DE4C 3K9UA 1GHEA 2H5MA 3VATA 3D8PA 1KUXA 4F9UA 5I0CA 4L89A 5LYLA 4LX9A 1P0HA 3FRMA 1VGYA 1X10A 1YQEA 1Z9UA 2F8HA 2NYQA 2Z0ZA 3EO4A 4KLWA 3TO6A 4ZY1A 4MFKA 1RO5A 2WYRA 4UEZA 2ZELA 5G22A 2OZUA 4E8OA 2PJ9A 2YGWA 1HDUA 1QSNA 3K2KA 2FSRA 4MMOA 1ARLA 3R1KA 4NGPA 3GB0A 1OZPA 3TT2A 1S60A 4MHNA 2PR1A 4MJ8A 1JQGA 3QNVA 2YNCA 1YMEA 2EK8A 4MY0A 4II9A 4KVME 2DPTA 4OKOA 3RZAA 4B6ZA 2PJCA 1PYTB 3D7DA 3KR5A 2XEFA 1N71A 4K30A 4E0AA 4P4DA 4CGOA 2V8GA 4PXDA 4H89A 4UIAA 3F0AA 3BXMA 4X8IA 3UY5A 1FY7A 1L0CA 3SXOA 3A9LA 1KZFA 4KOSA 2BL1A 2HV2A 3N5FA 2DF5A 3FEDA 4DJLA 2AFMA 2I00A 3FEEA 4C7IA 1FNOA 4AB7A 3ZZIA 2Z10A 5JGFA 4B5PA 3PZJA 5KTCA 2B5GA 2PC1A 3K9TA 4HNYB 2D4PA 1VHSA 4KOWA 4OC3A 4OC1A 5AG7A 1VHOA 4YU9A 3B3WA 3DR8A 4O23A 4MI4A 4C7HA 2ABZA 2WSAA 4MCSA 1TKHA 4FD5A 3V8IA 4B12A 1Y0YA 5JM6A 1XEBA 2V8HA 3DDDA 4E2AA 2IL4A 2FL4A 2ODFA 2GFQA 3NE7A 4MFQA 1NSLA 2GE3A 1KUVA 3JVNA 2RB7A 5JPHA 4CYPA 1Y9WA 4H6ZA 3TX8A 1CM0A 2POKA 2R1IA 3D7GA 4MCRA 3F5BA 5A28A 3PB9X 2PJBA 2PRBA 2NMTA 2PR8A 3FJUA 2C6GA 3I3GA 3EXNA 3PFOA 4CAEA 3NE8A 2REEA 4NF1A 5J1QA 3RO0A 2JBKA 1QSMA 4KUAA 3RNZA 4YGOA 2AFWA 3GYAA 4YRHA 4KLVA 1QSOA 3NFZA 2VI7A 1BPMA 5FVJA 4R6TA 2Z3MA 1BO4A 4UWIA 5AGEA 4A2ZA 4LQGA 8CPAA 1H8LA 2PJ8A 4YWYA 4BINA 4F8ZA 1CP6A 3NH8A 5IX3A 4MBUA 4A33A 4CS0B 4FD4A 2Y0MA 1M1DA 1ZG9A 5LYIA 4A95A 2CNSA 4UFXA 4BMHA 3MN8A 4NGMA 5F09A 2CF4A 2FVGA 3GLJA 2P6EA 4AVCA 5F48A 2PJ6A 2ZEHA 2Z11A 3SHPA 3SJGA 2BUEA 3KL9A 5DWMA 5GCNA 3TCVA 2ZOGA 1M44A 3FVLA 3T9YA 5EBVA 2OOTA 4P4FA 4B5OA 4BBHA 5IB0A 2Z3LA 3CZXA 4KORA 5LRJA 1XF8A 4UBRA 3TC8A 1AYEA 1CPSA 3IO1A 1K4JA 2GU2A 4A38A 1IU8A 4JXQA 4Q36A 4UEFA 1IY7A 2WZNA 4OC5A 2QJ8A 2CY2A 4A32A 4PXEA 1Q2CA 4C2ZA 2VZZA 5LYFA 3JUWA 1M4GA 1IYKA 4MFZA 3PB7X 2CIJA 3BI1A 2PVVA 4MHZA 3DR6A 3D7FA 2IQ6A 1ZLIA 2FIAA 4RS2A 3R95A 2HB6A 2ZPAA 3FNCA 2O4HA 3LODA 3GKRA 3H8GA 3PB6X 2AFUA 4JLYA 4PSWA 4HPSA 4R7MA 3PB4X 2D4OA 2PJ2A 3B3VA 4IAVA 4MFPA 1I21A 3BJ8A 4TWEA 2BEIA 1Z8WA 2GIVA 2X7BA 3OWCA 3LACA 3KHXA 2AFXA 2JEWA 4CGMA 2G9DA 3RAMA 4G1PA 4A94A 4ZX8A 1MJ9A 2FT0A 3LMSA 5DWNA 5E96A 3S6KA 4R9MA 2PVWA 4FAIA 2B4DA 4J3GA 1CBXA 4Q38A 5F46A 5DS0A 4ZBGA 5HVGA 4R8FA 4A39A 4MFLA 1CJWA 3PP9A 1IOFA 1Z5RA 1Z8XA 2VXKA 3PRTA 3WC5A 3BLNA 2AE6A 3KZWA 2B4BA 5LRGA 1HEEA 4CYQA 3W6SA 1R3NA 2VEZA 5HXDA 2C27A 2REFA 4ZYQA 2OZHA 4KS9A 2I79A 2ZEFA 2PJ7A 2C6CA 2DPSA 1A2ZA 4MHYA 3W91A 1NMTA 5LYDA 2ATRA 1Q2DA 3KGQA 2OR4A 3DGVA 4AG7A 4UIBA 1M4IA 3B35A 1KUYA 4NGRA 3CPAA 4UA3A 3C26A 2QYVA 2DEAA 1ZO0A 2JBJA 2QIRA 3NH5A 5KTAA 2FS5A 4UWJA 4EWTA 2Z3PA 4ZY2A 2V8VA 1XIXA 5C82A 3SI0A 5CPAA 1UFHA 3BI0A 3FYNA 3I9SA 2V77A 3PGPA 1YLOA 3JRUA 2CNMA 4MCPA 3PB8X 4L8AA 4ORFA 3P2FA 6CPAA 4P4IA 4RI1A 2Q7SA 1QQ9A 2KCWA 1PU9A 3B3CA 1P4NA 4AVBA 2FXFA 3PEIA 4KSAA 3KQZA 1ON0A 2GLJA 4R3LA 1LFWA 4U9YA 4BD9A 1Z8LA 3H5ZA 2WPWA 2P0WA 4NSQA 4PPZA 2PJ5A 1LAMA 4EMEA 1RXTA 5K8MA 3EY5A 2PJ4A 4Q7AA 4NEXA 1U6MA 1TF9A 4R57A 1BAVA 3BJ7A 5G20A 3B2YA 3L2NA 5EC4A 4P45A 4TNUA 4GM5A 4B5PB 5JH9A 2QMLA 4W9YA 1RTQA 1XMBA 1XMTA 1F2PA 2ZW6A 4OC4A 4UCNA 2BSWA 4F0YA 5IB9A 4H6UA 4NJQA 1BPNA 3VWEA 1IIDA 5BWAB 2J8NA 1YR0A 3DSBA 1XOVA 3IWGA 3FBUA 2YNEA 3CXQA 5K8OA 3S9LA 1Z8TA 4KSFA 5G1ZA 4M6GA 1IICA 2AFSA 4OLLA 4UF4A 3HUVA 2Q4ZA 3IJ3A 4CRZB 1BLLE 1QSRA 2NSMA 2HQYA 2PE3A 3D7HA 2PJ3A 2GLFA 1IB1E 4ONWA 3TO9A 4DNCA 3RBUA 3KHZA 1S3ZA 3PBBA 4JZ0A 5F49A 5CNPA 2QVPA 5ISVA 2OZGA 3F8KA 2R98A 5J8CA 3CT9A 3RYOA 4C2YA 5AG4A 2PIYA 2OU2A 1IOIA 4KOTA 1KWMA 3ISXA 3G8WA 4EFDA 1XJOA 4RUHA 3TO7A 4A30A 3S6GA 4CGNA 1Z4EA 4NGNA 2Z3KA 3E0KA 3R9GA 1CX8A 1V0CA 4UEEA 3V7ZA 3D3SA 3NH4A 4NGQA 1OBRA 3KR4A 1ELMP 2ZEGA 4LQ6A 1CPXA 1S7NA 3TTHA 4QVTA 2PCUA 3GIUA 3TOBA 2B3UA 5H84A 4HNXB 4NJRA 1ZLHA 5THWA 3BHXA 1JWQA 2J8RA 2XEGA 2CNTA 1B87A 1TKFA 2XEJA 5HH1A 3WC6A 5HVFA 1F57A 1PCAA 2G3AA 4PXBA 1S5KA 3DNSA 4M3SA 4XNHB 2YNDA 2Q04A 3D2MA 3IC1A 4JXRA 4P6YA 4C2XA 2EUIA 3SJXA 2AJ6A 2ZW4A 4UFVA 5F47A 1X12A 4C68A 4P44A 1Y9KA 4ONUA 3IGRA 4MHDA 1BOBA 4GS4A 1F2OA 1YW6A 4LUAA 3B7IA 5LRKA 4KSIA 3CXSA 3EFAA 5K8NA 4QBJA 5HVHA 4ZX9A 4PSXA 4A31A 2BCOA 2HUZA 3CDXA 3ZJ0A 3SJFA 3H8EA 3PBEA 2G0BA 3IWWA 4HNWB 2HC9A 4MY3A 4NCZA 2Z3NA 2EWBA 3FXTA 3JTKA 1HDQA 1ELLP 4FD7A 2ZEEA 2JDDA 2PRQA 3WT4A 1Z2LA 2BOAA 3S9MA 1YW4A 1DTDA 2ANPA 4XNHC 4NGSA 2ZEDA 2WUUA 5AG6A 2ZENA 1XFOA 3B3TA 4OC0A 1TKJA 2VBQA 3KKWA 4M6IA 2RFHA 4R76A 3P2HA 1NSAA 2EBJA 3SXNA 1IGBA 3D67A 1XBUA 3HLPA 4P10A 1J4JA 1R43A 2ZOFA 2ZEMA 1S7LA 3WC7A 2VL1A 1LOKA 5EMIA 1YGHA 4MHPA 1S7KA 4B13A 3FMCA 3KI9A 3D2PA 4FWUA 2Q43A 2DXQA 4OIDA 5IV0A 1YX0A 2R7HA 4F9VA 2B4DB 4MCQA 1TF8A 4CGPA 4AVAA 2C6PA 4PQAA 3KASA 3IWEA 1GYTA 5KTDA 1Q7LA 2PJ1A 1YK3A 2WPXA 4OIWA 2ZW5A 4KOYA 4ZGYB 2ZXVA 3N7ZA 2V8DA 1PUAA 3IEHA 3QAYA 4KOUA 4XPLA 4DUKA 2ZW7A 5J8FA 1SQHA 3KQXA 4JJXA 1XRYA 2OB0A 1CG2A 4P4JA 4ZI6A 3ISZA 4CRYB 2PIZA 4Y49B 3R96A 1LANA 1MK4A 2RC4A 3B8GA 3TE4A 1AMPA 4FUUA 2J9AA 4XPKA 1YLEA 4CYOA 4M6HA 4P4EA 1FT7A 2G3TA 2EK9A 2JEVA 1MJBA 1YVOA 2Q4YA 3CPXA 3FX6A 3NA6A 4WWVA 4U9ZA 1Y7RA 1IYLA 2PQ8A 3I1UA 4R87A 2B5GB 5AG5A 2ZEPA 4F0XA 2FCKA 3FF3A 4WJBA 3D66A 4K3NA 1NE9A 1WK4A 4MXUA 2Q44A 4B10A 4F6AA 2Q4VA 2C1CA 4UCPA 1TIQA 1YREA 4KUBA 4R3KA 1LCPA 2YNCC 4UFWA 1Q2YA 1YSJA 2FIWA 3LD2A 4KOVA 2Q0YA 1Z4RA 1LAPA 3FH4A 3QB8A 1VHEA 4KZTA 5G21A 2EVNA 3WABA 1R57A 4QUSA 2BO9A 4I49A 2Z3OA 4Y49C 4X3RA 3MGDA 2FE7A 3D68A 2J8MA 1B6BA 2JDCA 2I3CA 3TFYA 1S7FA 2F7VA 3FECA 1ZG7A 4CGLA 4CAFA 1UWYA 3FB3A 4HKFA 2VQYA 4DYOA 4PXCA 3T8WA 2F5IA 3SI1A 1ZG8A 4CAXA 4RN7A 1CP7A 4H2KA 4B11A 4PK3A 2CTBA 2GANA 4EVYA 3IIBA 4NXYA 3VH9A 2IMOA 2R8VA 4OP4A 4KOXA 2GREA 3IU1A 1M4DA 1MJAA 1AUGA 4JD6A 3V38A 2Q51A 3IU2A 4CPAA 1I1DA 3VWDA 2K5TA 4OC2A 3TOAA 1M4LA 2CXAA 4IHMA 3H4QA 3LWUA 3SI2A 1Y7EA 4OAEA 4PK2A 1QMUA 5D8NA 3CXPA 5D29A 2Q7BA 5A27A 3GY9A 4QB9A 2PSWA 3FIXA 1LRZA 3DLJA 2VZYA 2AFOA 4MRIA 4YFJA 3PFEA 2XEIA 3MRUA 4OADA 3SJEA 4P4BA 2P6GA 2CTCA 3GUXA 3WR7A 4AXVA 4IK2A 2QECA 4XPDB 3IFEA 4KVOE 4M85A 3G3SA 2OH1A 3S9NA 4JWPA 2P6FA 3EC4A 4A37A 4GXHA 4B14A 4NGTA 3D4UA 1VKCA 1EE3P 1TXRA 1XE4A 1ARMA 2PDOA 4UCMA 2IJZA 4FBEA 3S6FA 3S6HA 4U5YA 3W6XA 3T90A 4AG9A 2O53A 4MFJA 4OMEA 4IUSA 5ELYA 7CPAA 4X2TA 2AFZA 4KVXA 2B3VA 3QAHA 1Y0RA 4CAWA 5HMNA 5I4MA 2B58A 4FD6A 2O28A 4PV6A 3VARA 4ZY0A 2EO8A 4Z65A 5CBMA 3H8FA 1WWZA 2ARHA 2A4NA 5H86A 1I12A 4IF5A 3R9EA 4CAVA 5C88A 1VIXA 3R9FA 1QSTA 2PJ0A 3B3SA 2JLMA 2ZEOA 4QC6A 4JYWA 4NFRA 4X5KA 1YVKA
chains in the Genus database with same CATH topology
4XPDC 4CYNA 5JQ4A 3K9UA 1GHEA 2H5MA 5I0CA 3D8PA 1KUXA 4L89A 4LX9A 1P0HA 3FRMA 4KLWA 3EO4A 1Z9UA 3TO6A 2Z0ZA 4MFKA 1RO5A 5G22A 2OZUA 4E8OA 2YGWA 1QSNA 2FSRA 3R1KA 1OZPA 3TT2A 1S60A 2PR1A 4MJ8A 2YNCA 4MY0A 4II9A 4KVME 2DPTA 1N71A 4K30A 4E0AA 4CGOA 4H89A 3F0AA 3UY5A 1FY7A 1L0CA 3SXOA 3A9LA 1KZFA 4KOSA 2BL1A 2HV2A 2I00A 4C7IA 4AB7A 3ZZIA 2Z10A 5KTCA 4B5PA 3PZJA 2B5GA 2PC1A 4HNYB 2D4PA 1VHSA 4KOWA 5AG7A 3DR8A 4MI4A 4C7HA 4CS0B 2WSAA 4FD5A 3V8IA 4B12A 1XEBA 3DDDA 4E2AA 2IL4A 2FL4A 3NE7A 4MFQA 1NSLA 2GE3A 1KUVA 3JVNA 5JPHA 4CYPA 1Y9WA 4H6ZA 1CM0A 2R1IA 3F5BA 5A28A 2PRBA 2NMTA 2PR8A 3I3GA 3EXNA 4CAEA 2REEA 4NF1A 1QSMA 4KUAA 4YGOA 3GYAA 4YRHA 4KLVA 1QSOA 2VI7A 5FVJA 2Z3MA 1BO4A 4UWIA 5AGEA 4A2ZA 5IX3A 4MBUA 4A33A 4FD4A 2Y0MA 1M1DA 4A95A 2CNSA 4UFXA 4BMHA 2P6EA 4AVCA 5F48A 2Z11A 3SHPA 2BUEA 5DWMA 5GCNA 3TCVA 1M44A 3T9YA 5EBVA 4BBHA 4B5OA 5IB0A 2Z3LA 4KORA 1XF8A 4UBRA 1K4JA 4Q36A 4JXQA 2CY2A 4A32A 1Q2CA 4C2ZA 2VZZA 3JUWA 1M4GA 1IYKA 4MFZA 3DR6A 2FIAA 4RS2A 3R95A 2ZPAA 3FNCA 3LODA 3GKRA 4JLYA 4PSWA 2D4OA 4MFPA 1I21A 3BJ8A 2BEIA 2GIVA 2X7BA 3OWCA 4CGMA 1MJ9A 2FT0A 5DWNA 5E96A 3S6KA 4R9MA 2B4DA 4J3GA 4Q38A 5F46A 4ZBGA 4MFLA 1CJWA 3PP9A 2VXKA 3BLNA 2AE6A 2B4BA 4CYQA 3W6SA 2VEZA 2C27A 2REFA 2OZHA 4KS9A 2I79A 3W91A 2DPSA 1NMTA 2ATRA 1Q2DA 4AG7A 1M4IA 1KUYA 4UA3A 3C26A 1ZO0A 2QIRA 5KTAA 2FS5A 4UWJA 2Z3PA 1XIXA 5C82A 1UFHA 3I9SA 3FYNA 3PGPA 2CNMA 4L8AA 4ORFA 3P2FA 4RI1A 1PU9A 2KCWA 1P4NA 4AVBA 2FXFA 4KSAA 1ON0A 4R3LA 4U9YA 3H5ZA 2WPWA 2P0WA 4NSQA 1RXTA 3EY5A 4NEXA 1U6MA 4R57A 3BJ7A 5G20A 5EC4A 4B5PB 2QMLA 1XMTA 2ZW6A 4UCNA 2BSWA 4F0YA 4H6UA 3VWEA 1IIDA 5BWAB 2J8NA 3DSBA 1YR0A 3IWGA 3FBUA 2YNEA 3CXQA 4KSFA 5G1ZA 1IICA 4OLLA 4CRZB 1QSRA 2HQYA 1IB1E 3TO9A 4DNCA 1S3ZA 5F49A 5CNPA 5ISVA 2OZGA 3F8KA 2R98A 5J8CA 3RYOA 5AG4A 4C2YA 2OU2A 4KOTA 3G8WA 3TO7A 4A30A 3S6GA 4CGNA 1Z4EA 2Z3KA 3E0KA 3R9GA 1V0CA 3D3SA 3TTHA 1S7NA 4QVTA 3TOBA 2B3UA 5H84A 4HNXB 2J8RA 2CNTA 1B87A 5HH1A 2G3AA 1S5KA 3DNSA 4M3SA 4XNHB 2YNDA 2Q04A 3D2MA 4JXRA 4C2XA 2EUIA 2AJ6A 2ZW4A 4UFVA 5F47A 4C68A 1Y9KA 4ONUA 3IGRA 4MHDA 1BOBA 4GS4A 4LUAA 3CXSA 3EFAA 4QBJA 4A31A 4PSXA 2HUZA 3ZJ0A 2G0BA 4HNWB 4MY3A 4NCZA 2Z3NA 3FXTA 3JTKA 4FD7A 2JDDA 4XNHC 2WUUA 5AG6A 3KKWA 2VBQA 3P2HA 3SXNA 1J4JA 1S7LA 1YGHA 1S7KA 4B13A 3D2PA 2DXQA 5IV0A 1YX0A 2R7HA 2B4DB 4CGPA 4AVAA 3IWEA 5KTDA 2WPXA 1YK3A 2ZW5A 4KOYA 4ZGYB 2ZXVA 3N7ZA 1PUAA 4KOUA 4XPLA 2ZW7A 5J8FA 1SQHA 4JJXA 2OB0A 4CRYB 4Y49B 3R96A 3TE4A 1MK4A 2RC4A 3B8GA 4XPKA 1YLEA 4CYOA 2G3TA 2JEVA 2Q4YA 1MJBA 1YVOA 4U9ZA 1Y7RA 1IYLA 2PQ8A 4R87A 5AG5A 2B5GB 4F0XA 2FCKA 1NE9A 1WK4A 2Q44A 4B10A 4F6AA 2Q4VA 4UCPA 1TIQA 1YREA 4KUBA 4R3KA 2YNCC 4UFWA 1Q2YA 2FIWA 3LD2A 4KOVA 2Q0YA 1Z4RA 4KZTA 3QB8A 5G21A 2EVNA 1R57A 4QUSA 4I49A 2Z3OA 4Y49C 3MGDA 2FE7A 2J8MA 1B6BA 2JDCA 3TFYA 1S7FA 4CGLA 4CAFA 3FB3A 4HKFA 2VQYA 2F5IA 4CAXA 4B11A 4PK3A 2GANA 4EVYA 4NXYA 2R8VA 4KOXA 3IU1A 1M4DA 1MJAA 4JD6A 3IU2A 1I1DA 3VWDA 2K5TA 3TOAA 2CXAA 3H4QA 4OAEA 4PK2A 3CXPA 2Q7BA 5A27A 3GY9A 4QB9A 2PSWA 3FIXA 1LRZA 2VZYA 4YFJA 4OADA 2P6GA 3WR7A 2QECA 4XPDB 4KVOE 4M85A 3G3SA 2OH1A 4JWPA 2P6FA 3EC4A 4B14A 1VKCA 2PDOA 1XE4A 4UCMA 3S6FA 3S6HA 4U5YA 3W6XA 3T90A 4AG9A 4MFJA 4IUSA 4KVXA 2B3VA 3QAHA 4CAWA 5HMNA 2B58A 4FD6A 2O28A 4PV6A 1WWZA 2ARHA 2A4NA 5H86A 1I12A 4IF5A 3R9EA 4CAVA 5C88A 3R9FA 1QSTA 2JLMA 4QC6A 4X5KA 1YVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UFV A;  4CGO A;  4UCP A;  3IU1 A;  5AGE A;  4UCM A;  4C68 A;  4CYN A;  4A2Z A;  2YNE A;  4A30 A;  4CYP A;  4CGN A;  3IU2 A;  2YNC C;  4UFW A;  5G1Z A;  4CGM A;  4A33 A;  5G21 A;  4A32 A;  5A28 A;  3H5Z A;  4A95 A;  4UFX A;  5G22 A;  4C2Z A;  4C7I A;  5A27 A;  4A31 A;  4B13 A;  4CAE A;  4CYO A;  5G20 A;  4CGL A;  4CAF A;  5AG7 A;  3JTK A;  4CGP A;  2YNC A;  4C7H A;  2WSA A;  5AG5 A;  4B12 A;  2YND A;  4UCN A;  4BBH A;  4C2Y A;  3IWE A;  5AG4 A;  4B10 A;  4CYQ A;  4B11 A;  4B14 A;  4C2X A;  2WUU A;  5AG6 A; 
#chains in the Genus database with same CATH topology
 5K8P A;  4XPD C;  4CYN A;  2PJA A;  5JQ4 A;  1DE4 C;  3K9U A;  1GHE A;  2H5M A;  3VAT A;  3D8P A;  1KUX A;  4F9U A;  5I0C A;  4L89 A;  5LYL A;  4LX9 A;  1P0H A;  3FRM A;  1VGY A;  1X10 A;  1YQE A;  1Z9U A;  2F8H A;  2NYQ A;  2Z0Z A;  3EO4 A;  4KLW A;  3TO6 A;  4ZY1 A;  4MFK A;  1RO5 A;  2WYR A;  4UEZ A;  2ZEL A;  5G22 A;  2OZU A;  4E8O A;  2PJ9 A;  2YGW A;  1HDU A;  1QSN A;  3K2K A;  2FSR A;  4MMO A;  1ARL A;  3R1K A;  4NGP A;  3GB0 A;  1OZP A;  3TT2 A;  1S60 A;  4MHN A;  2PR1 A;  4MJ8 A;  1JQG A;  3QNV A;  2YNC A;  1YME A;  2EK8 A;  4MY0 A;  4II9 A;  4KVM E;  2DPT A;  4OKO A;  3RZA A;  4B6Z A;  2PJC A;  1PYT B;  3D7D A;  3KR5 A;  2XEF A;  1N71 A;  4K30 A;  4E0A A;  4P4D A;  4CGO A;  2V8G A;  4PXD A;  4H89 A;  4UIA A;  3F0A A;  3BXM A;  4X8I A;  3UY5 A;  1FY7 A;  1L0C A;  3SXO A;  3A9L A;  1KZF A;  4KOS A;  2BL1 A;  2HV2 A;  3N5F A;  2DF5 A;  3FED A;  4DJL A;  2AFM A;  2I00 A;  3FEE A;  4C7I A;  1FNO A;  4AB7 A;  3ZZI A;  2Z10 A;  5JGF A;  4B5P A;  3PZJ A;  5KTC A;  2B5G A;  2PC1 A;  3K9T A;  4HNY B;  2D4P A;  1VHS A;  4KOW A;  4OC3 A;  4OC1 A;  5AG7 A;  1VHO A;  4YU9 A;  3B3W A;  3DR8 A;  4O23 A;  4MI4 A;  4C7H A;  2ABZ A;  2WSA A;  4MCS A;  1TKH A;  4FD5 A;  3V8I A;  4B12 A;  1Y0Y A;  5JM6 A;  1XEB A;  2V8H A;  3DDD A;  4E2A A;  2IL4 A;  2FL4 A;  2ODF A;  2GFQ A;  3NE7 A;  4MFQ A;  1NSL A;  2GE3 A;  1KUV A;  3JVN A;  2RB7 A;  5JPH A;  4CYP A;  1Y9W A;  4H6Z A;  3TX8 A;  1CM0 A;  2POK A;  2R1I A;  3D7G A;  4MCR A;  3F5B A;  5A28 A;  3PB9 X;  2PJB A;  2PRB A;  2NMT A;  2PR8 A;  3FJU A;  2C6G A;  3I3G A;  3EXN A;  3PFO A;  4CAE A;  3NE8 A;  2REE A;  4NF1 A;  5J1Q A;  3RO0 A;  2JBK A;  1QSM A;  4KUA A;  3RNZ A;  4YGO A;  2AFW A;  3GYA A;  4YRH A;  4KLV A;  1QSO A;  3NFZ A;  2VI7 A;  1BPM A;  5FVJ A;  4R6T A;  2Z3M A;  1BO4 A;  4UWI A;  5AGE A;  4A2Z A;  4LQG A;  8CPA A;  1H8L A;  2PJ8 A;  4YWY A;  4BIN A;  4F8Z A;  1CP6 A;  3NH8 A;  5IX3 A;  4MBU A;  4A33 A;  4CS0 B;  4FD4 A;  2Y0M A;  1M1D A;  1ZG9 A;  5LYI A;  4A95 A;  2CNS A;  4UFX A;  4BMH A;  3MN8 A;  4NGM A;  5F09 A;  2CF4 A;  2FVG A;  3GLJ A;  2P6E A;  4AVC A;  5F48 A;  2PJ6 A;  2ZEH A;  2Z11 A;  3SHP A;  3SJG A;  2BUE A;  3KL9 A;  5DWM A;  5GCN A;  3TCV A;  2ZOG A;  1M44 A;  3FVL A;  3T9Y A;  5EBV A;  2OOT A;  4P4F A;  4B5O A;  4BBH A;  5IB0 A;  2Z3L A;  3CZX A;  4KOR A;  5LRJ A;  1XF8 A;  4UBR A;  3TC8 A;  1AYE A;  1CPS A;  3IO1 A;  1K4J A;  2GU2 A;  4A38 A;  1IU8 A;  4JXQ A;  4Q36 A;  4UEF A;  1IY7 A;  2WZN A;  4OC5 A;  2QJ8 A;  2CY2 A;  4A32 A;  4PXE A;  1Q2C A;  4C2Z A;  2VZZ A;  5LYF A;  3JUW A;  1M4G A;  1IYK A;  4MFZ A;  3PB7 X;  2CIJ A;  3BI1 A;  2PVV A;  4MHZ A;  3DR6 A;  3D7F A;  2IQ6 A;  1ZLI A;  2FIA A;  4RS2 A;  3R95 A;  2HB6 A;  2ZPA A;  3FNC A;  2O4H A;  3LOD A;  3GKR A;  3H8G A;  3PB6 X;  2AFU A;  4JLY A;  4PSW A;  4HPS A;  4R7M A;  3PB4 X;  2D4O A;  2PJ2 A;  3B3V A;  4IAV A;  4MFP A;  1I21 A;  3BJ8 A;  4TWE A;  2BEI A;  1Z8W A;  2GIV A;  2X7B A;  3OWC A;  3LAC A;  3KHX A;  2AFX A;  2JEW A;  4CGM A;  2G9D A;  3RAM A;  4G1P A;  4A94 A;  4ZX8 A;  1MJ9 A;  2FT0 A;  3LMS A;  5DWN A;  5E96 A;  3S6K A;  4R9M A;  2PVW A;  4FAI A;  2B4D A;  4J3G A;  1CBX A;  4Q38 A;  5F46 A;  5DS0 A;  4ZBG A;  5HVG A;  4R8F A;  4A39 A;  4MFL A;  1CJW A;  3PP9 A;  1IOF A;  1Z5R A;  1Z8X A;  2VXK A;  3PRT A;  3WC5 A;  3BLN A;  2AE6 A;  3KZW A;  2B4B A;  5LRG A;  1HEE A;  4CYQ A;  3W6S A;  1R3N A;  2VEZ A;  5HXD A;  2C27 A;  2REF A;  4ZYQ A;  2OZH A;  4KS9 A;  2I79 A;  2ZEF A;  2PJ7 A;  2C6C A;  2DPS A;  1A2Z A;  4MHY A;  3W91 A;  1NMT A;  5LYD A;  2ATR A;  1Q2D A;  3KGQ A;  2OR4 A;  3DGV A;  4AG7 A;  4UIB A;  1M4I A;  3B35 A;  1KUY A;  4NGR A;  3CPA A;  4UA3 A;  3C26 A;  2QYV A;  2DEA A;  1ZO0 A;  2JBJ A;  2QIR A;  3NH5 A;  5KTA A;  2FS5 A;  4UWJ A;  4EWT A;  2Z3P A;  4ZY2 A;  2V8V A;  1XIX A;  5C82 A;  3SI0 A;  5CPA A;  1UFH A;  3BI0 A;  3FYN A;  3I9S A;  2V77 A;  3PGP A;  1YLO A;  3JRU A;  2CNM A;  4MCP A;  3PB8 X;  4L8A A;  4ORF A;  3P2F A;  6CPA A;  4P4I A;  4RI1 A;  2Q7S A;  1QQ9 A;  2KCW A;  1PU9 A;  3B3C A;  1P4N A;  4AVB A;  2FXF A;  3PEI A;  4KSA A;  3KQZ A;  1ON0 A;  2GLJ A;  4R3L A;  1LFW A;  4U9Y A;  4BD9 A;  1Z8L A;  3H5Z A;  2WPW A;  2P0W A;  4NSQ A;  4PPZ A;  2PJ5 A;  1LAM A;  4EME A;  1RXT A;  5K8M A;  3EY5 A;  2PJ4 A;  4Q7A A;  4NEX A;  1U6M A;  1TF9 A;  4R57 A;  1BAV A;  3BJ7 A;  5G20 A;  3B2Y A;  3L2N A;  5EC4 A;  4P45 A;  4TNU A;  4GM5 A;  4B5P B;  5JH9 A;  2QML A;  4W9Y A;  1RTQ A;  1XMB A;  1XMT A;  1F2P A;  2ZW6 A;  4OC4 A;  4UCN A;  2BSW A;  4F0Y A;  5IB9 A;  4H6U A;  4NJQ A;  1BPN A;  3VWE A;  1IID A;  5BWA B;  2J8N A;  1YR0 A;  3DSB A;  1XOV A;  3IWG A;  3FBU A;  2YNE A;  3CXQ A;  5K8O A;  3S9L A;  1Z8T A;  4KSF A;  5G1Z A;  4M6G A;  1IIC A;  2AFS A;  4OLL A;  4UF4 A;  3HUV A;  2Q4Z A;  3IJ3 A;  4CRZ B;  1BLL E;  1QSR A;  2NSM A;  2HQY A;  2PE3 A;  3D7H A;  2PJ3 A;  2GLF A;  1IB1 E;  4ONW A;  3TO9 A;  4DNC A;  3RBU A;  3KHZ A;  1S3Z A;  3PBB A;  4JZ0 A;  5F49 A;  5CNP A;  2QVP A;  5ISV A;  2OZG A;  3F8K A;  2R98 A;  5J8C A;  3CT9 A;  3RYO A;  4C2Y A;  5AG4 A;  2PIY A;  2OU2 A;  1IOI A;  4KOT A;  1KWM A;  3ISX A;  3G8W A;  4EFD A;  1XJO A;  4RUH A;  3TO7 A;  4A30 A;  3S6G A;  4CGN A;  1Z4E A;  4NGN A;  2Z3K A;  3E0K A;  3R9G A;  1CX8 A;  1V0C A;  4UEE A;  3V7Z A;  3D3S A;  3NH4 A;  4NGQ A;  1OBR A;  3KR4 A;  1ELM P;  2ZEG A;  4LQ6 A;  1CPX A;  1S7N A;  3TTH A;  4QVT A;  2PCU A;  3GIU A;  3TOB A;  2B3U A;  5H84 A;  4HNX B;  4NJR A;  1ZLH A;  5THW A;  3BHX A;  1JWQ A;  2J8R A;  2XEG A;  2CNT A;  1B87 A;  1TKF A;  2XEJ A;  5HH1 A;  3WC6 A;  5HVF A;  1F57 A;  1PCA A;  2G3A A;  4PXB A;  1S5K A;  3DNS A;  4M3S A;  4XNH B;  2YND A;  2Q04 A;  3D2M A;  3IC1 A;  4JXR A;  4P6Y A;  4C2X A;  2EUI A;  3SJX A;  2AJ6 A;  2ZW4 A;  4UFV A;  5F47 A;  1X12 A;  4C68 A;  4P44 A;  1Y9K A;  4ONU A;  3IGR A;  4MHD A;  1BOB A;  4GS4 A;  1F2O A;  1YW6 A;  4LUA A;  3B7I A;  5LRK A;  4KSI A;  3CXS A;  3EFA A;  5K8N A;  4QBJ A;  5HVH A;  4ZX9 A;  4PSX A;  4A31 A;  2BCO A;  2HUZ A;  3CDX A;  3ZJ0 A;  3SJF A;  3H8E A;  3PBE A;  2G0B A;  3IWW A;  4HNW B;  2HC9 A;  4MY3 A;  4NCZ A;  2Z3N A;  2EWB A;  3FXT A;  3JTK A;  1HDQ A;  1ELL P;  4FD7 A;  2ZEE A;  2JDD A;  2PRQ A;  3WT4 A;  1Z2L A;  2BOA A;  3S9M A;  1YW4 A;  1DTD A;  2ANP A;  4XNH C;  4NGS A;  2ZED A;  2WUU A;  5AG6 A;  2ZEN A;  1XFO A;  3B3T A;  4OC0 A;  1TKJ A;  2VBQ A;  3KKW A;  4M6I A;  2RFH A;  4R76 A;  3P2H A;  1NSA A;  2EBJ A;  3SXN A;  1IGB A;  3D67 A;  1XBU A;  3HLP A;  4P10 A;  1J4J A;  1R43 A;  2ZOF A;  2ZEM A;  1S7L A;  3WC7 A;  2VL1 A;  1LOK A;  5EMI A;  1YGH A;  4MHP A;  1S7K A;  4B13 A;  3FMC A;  3KI9 A;  3D2P A;  4FWU A;  2Q43 A;  2DXQ A;  4OID A;  5IV0 A;  1YX0 A;  2R7H A;  4F9V A;  2B4D B;  4MCQ A;  1TF8 A;  4CGP A;  4AVA A;  2C6P A;  4PQA A;  3KAS A;  3IWE A;  1GYT A;  5KTD A;  1Q7L A;  2PJ1 A;  1YK3 A;  2WPX A;  4OIW A;  2ZW5 A;  4KOY A;  4ZGY B;  2ZXV A;  3N7Z A;  2V8D A;  1PUA A;  3IEH A;  3QAY A;  4KOU A;  4XPL A;  4DUK A;  2ZW7 A;  5J8F A;  1SQH A;  3KQX A;  4JJX A;  1XRY A;  2OB0 A;  1CG2 A;  4P4J A;  4ZI6 A;  3ISZ A;  4CRY B;  2PIZ A;  4Y49 B;  3R96 A;  1LAN A;  1MK4 A;  2RC4 A;  3B8G A;  3TE4 A;  1AMP A;  4FUU A;  2J9A A;  4XPK A;  1YLE A;  4CYO A;  4M6H A;  4P4E A;  1FT7 A;  2G3T A;  2EK9 A;  2JEV A;  1MJB A;  1YVO A;  2Q4Y A;  3CPX A;  3FX6 A;  3NA6 A;  4WWV A;  4U9Z A;  1Y7R A;  1IYL A;  2PQ8 A;  3I1U A;  4R87 A;  2B5G B;  5AG5 A;  2ZEP A;  4F0X A;  2FCK A;  3FF3 A;  4WJB A;  3D66 A;  4K3N A;  1NE9 A;  1WK4 A;  4MXU A;  2Q44 A;  4B10 A;  4F6A A;  2Q4V A;  2C1C A;  4UCP A;  1TIQ A;  1YRE A;  4KUB A;  4R3K A;  1LCP A;  2YNC C;  4UFW A;  1Q2Y A;  1YSJ A;  2FIW A;  3LD2 A;  4KOV A;  2Q0Y A;  1Z4R A;  1LAP A;  3FH4 A;  3QB8 A;  1VHE A;  4KZT A;  5G21 A;  2EVN A;  3WAB A;  1R57 A;  4QUS A;  2BO9 A;  4I49 A;  2Z3O A;  4Y49 C;  4X3R A;  3MGD A;  2FE7 A;  3D68 A;  2J8M A;  1B6B A;  2JDC A;  2I3C A;  3TFY A;  1S7F A;  2F7V A;  3FEC A;  1ZG7 A;  4CGL A;  4CAF A;  1UWY A;  3FB3 A;  4HKF A;  2VQY A;  4DYO A;  4PXC A;  3T8W A;  2F5I A;  3SI1 A;  1ZG8 A;  4CAX A;  4RN7 A;  1CP7 A;  4H2K A;  4B11 A;  4PK3 A;  2CTB A;  2GAN A;  4EVY A;  3IIB A;  4NXY A;  3VH9 A;  2IMO A;  2R8V A;  4OP4 A;  4KOX A;  2GRE A;  3IU1 A;  1M4D A;  1MJA A;  1AUG A;  4JD6 A;  3V38 A;  2Q51 A;  3IU2 A;  4CPA A;  1I1D A;  3VWD A;  2K5T A;  4OC2 A;  3TOA A;  1M4L A;  2CXA A;  4IHM A;  3H4Q A;  3LWU A;  3SI2 A;  1Y7E A;  4OAE A;  4PK2 A;  1QMU A;  5D8N A;  3CXP A;  5D29 A;  2Q7B A;  5A27 A;  3GY9 A;  4QB9 A;  2PSW A;  3FIX A;  1LRZ A;  3DLJ A;  2VZY A;  2AFO A;  4MRI A;  4YFJ A;  3PFE A;  2XEI A;  3MRU A;  4OAD A;  3SJE A;  4P4B A;  2P6G A;  2CTC A;  3GUX A;  3WR7 A;  4AXV A;  4IK2 A;  2QEC A;  4XPD B;  3IFE A;  4KVO E;  4M85 A;  3G3S A;  2OH1 A;  3S9N A;  4JWP A;  2P6F A;  3EC4 A;  4A37 A;  4GXH A;  4B14 A;  4NGT A;  3D4U A;  1VKC A;  1EE3 P;  1TXR A;  1XE4 A;  1ARM A;  2PDO A;  4UCM A;  2IJZ A;  4FBE A;  3S6F A;  3S6H A;  4U5Y A;  3W6X A;  3T90 A;  4AG9 A;  2O53 A;  4MFJ A;  4OME A;  4IUS A;  5ELY A;  7CPA A;  4X2T A;  2AFZ A;  4KVX A;  2B3V A;  3QAH A;  1Y0R A;  4CAW A;  5HMN A;  5I4M A;  2B58 A;  4FD6 A;  2O28 A;  4PV6 A;  3VAR A;  4ZY0 A;  2EO8 A;  4Z65 A;  5CBM A;  3H8F A;  1WWZ A;  2ARH A;  2A4N A;  5H86 A;  1I12 A;  4IF5 A;  3R9E A;  4CAV A;  5C88 A;  1VIX A;  3R9F A;  1QST A;  2PJ0 A;  3B3S A;  2JLM A;  2ZEO A;  4QC6 A;  4JYW A;  4NFR A;  4X5K A;  1YVK A; 
#chains in the Genus database with same CATH homology
 4XPD C;  4CYN A;  5JQ4 A;  3K9U A;  1GHE A;  2H5M A;  5I0C A;  3D8P A;  1KUX A;  4L89 A;  4LX9 A;  1P0H A;  3FRM A;  4KLW A;  3EO4 A;  1Z9U A;  3TO6 A;  2Z0Z A;  4MFK A;  1RO5 A;  5G22 A;  2OZU A;  4E8O A;  2YGW A;  1QSN A;  2FSR A;  3R1K A;  1OZP A;  3TT2 A;  1S60 A;  2PR1 A;  4MJ8 A;  2YNC A;  4MY0 A;  4II9 A;  4KVM E;  2DPT A;  1N71 A;  4K30 A;  4E0A A;  4CGO A;  4H89 A;  3F0A A;  3UY5 A;  1FY7 A;  1L0C A;  3SXO A;  3A9L A;  1KZF A;  4KOS A;  2BL1 A;  2HV2 A;  2I00 A;  4C7I A;  4AB7 A;  3ZZI A;  2Z10 A;  5KTC A;  4B5P A;  3PZJ A;  2B5G A;  2PC1 A;  4HNY B;  2D4P A;  1VHS A;  4KOW A;  5AG7 A;  3DR8 A;  4MI4 A;  4C7H A;  4CS0 B;  2WSA A;  4FD5 A;  3V8I A;  4B12 A;  1XEB A;  3DDD A;  4E2A A;  2IL4 A;  2FL4 A;  3NE7 A;  4MFQ A;  1NSL A;  2GE3 A;  1KUV A;  3JVN A;  5JPH A;  4CYP A;  1Y9W A;  4H6Z A;  1CM0 A;  2R1I A;  3F5B A;  5A28 A;  2PRB A;  2NMT A;  2PR8 A;  3I3G A;  3EXN A;  4CAE A;  2REE A;  4NF1 A;  1QSM A;  4KUA A;  4YGO A;  3GYA A;  4YRH A;  4KLV A;  1QSO A;  2VI7 A;  5FVJ A;  2Z3M A;  1BO4 A;  4UWI A;  5AGE A;  4A2Z A;  5IX3 A;  4MBU A;  4A33 A;  4FD4 A;  2Y0M A;  1M1D A;  4A95 A;  2CNS A;  4UFX A;  4BMH A;  2P6E A;  4AVC A;  5F48 A;  2Z11 A;  3SHP A;  2BUE A;  5DWM A;  5GCN A;  3TCV A;  1M44 A;  3T9Y A;  5EBV A;  4BBH A;  4B5O A;  5IB0 A;  2Z3L A;  4KOR A;  1XF8 A;  4UBR A;  1K4J A;  4Q36 A;  4JXQ A;  2CY2 A;  4A32 A;  1Q2C A;  4C2Z A;  2VZZ A;  3JUW A;  1M4G A;  1IYK A;  4MFZ A;  3DR6 A;  2FIA A;  4RS2 A;  3R95 A;  2ZPA A;  3FNC A;  3LOD A;  3GKR A;  4JLY A;  4PSW A;  2D4O A;  4MFP A;  1I21 A;  3BJ8 A;  2BEI A;  2GIV A;  2X7B A;  3OWC A;  4CGM A;  1MJ9 A;  2FT0 A;  5DWN A;  5E96 A;  3S6K A;  4R9M A;  2B4D A;  4J3G A;  4Q38 A;  5F46 A;  4ZBG A;  4MFL A;  1CJW A;  3PP9 A;  2VXK A;  3BLN A;  2AE6 A;  2B4B A;  4CYQ A;  3W6S A;  2VEZ A;  2C27 A;  2REF A;  2OZH A;  4KS9 A;  2I79 A;  3W91 A;  2DPS A;  1NMT A;  2ATR A;  1Q2D A;  4AG7 A;  1M4I A;  1KUY A;  4UA3 A;  3C26 A;  1ZO0 A;  2QIR A;  5KTA A;  2FS5 A;  4UWJ A;  2Z3P A;  1XIX A;  5C82 A;  1UFH A;  3I9S A;  3FYN A;  3PGP A;  2CNM A;  4L8A A;  4ORF A;  3P2F A;  4RI1 A;  1PU9 A;  2KCW A;  1P4N A;  4AVB A;  2FXF A;  4KSA A;  1ON0 A;  4R3L A;  4U9Y A;  3H5Z A;  2WPW A;  2P0W A;  4NSQ A;  1RXT A;  3EY5 A;  4NEX A;  1U6M A;  4R57 A;  3BJ7 A;  5G20 A;  5EC4 A;  4B5P B;  2QML A;  1XMT A;  2ZW6 A;  4UCN A;  2BSW A;  4F0Y A;  4H6U A;  3VWE A;  1IID A;  5BWA B;  2J8N A;  3DSB A;  1YR0 A;  3IWG A;  3FBU A;  2YNE A;  3CXQ A;  4KSF A;  5G1Z A;  1IIC A;  4OLL A;  4CRZ B;  1QSR A;  2HQY A;  1IB1 E;  3TO9 A;  4DNC A;  1S3Z A;  5F49 A;  5CNP A;  5ISV A;  2OZG A;  3F8K A;  2R98 A;  5J8C A;  3RYO A;  5AG4 A;  4C2Y A;  2OU2 A;  4KOT A;  3G8W A;  3TO7 A;  4A30 A;  3S6G A;  4CGN A;  1Z4E A;  2Z3K A;  3E0K A;  3R9G A;  1V0C A;  3D3S A;  3TTH A;  1S7N A;  4QVT A;  3TOB A;  2B3U A;  5H84 A;  4HNX B;  2J8R A;  2CNT A;  1B87 A;  5HH1 A;  2G3A A;  1S5K A;  3DNS A;  4M3S A;  4XNH B;  2YND A;  2Q04 A;  3D2M A;  4JXR A;  4C2X A;  2EUI A;  2AJ6 A;  2ZW4 A;  4UFV A;  5F47 A;  4C68 A;  1Y9K A;  4ONU A;  3IGR A;  4MHD A;  1BOB A;  4GS4 A;  4LUA A;  3CXS A;  3EFA A;  4QBJ A;  4A31 A;  4PSX A;  2HUZ A;  3ZJ0 A;  2G0B A;  4HNW B;  4MY3 A;  4NCZ A;  2Z3N A;  3FXT A;  3JTK A;  4FD7 A;  2JDD A;  4XNH C;  2WUU A;  5AG6 A;  3KKW A;  2VBQ A;  3P2H A;  3SXN A;  1J4J A;  1S7L A;  1YGH A;  1S7K A;  4B13 A;  3D2P A;  2DXQ A;  5IV0 A;  1YX0 A;  2R7H A;  2B4D B;  4CGP A;  4AVA A;  3IWE A;  5KTD A;  2WPX A;  1YK3 A;  2ZW5 A;  4KOY A;  4ZGY B;  2ZXV A;  3N7Z A;  1PUA A;  4KOU A;  4XPL A;  2ZW7 A;  5J8F A;  1SQH A;  4JJX A;  2OB0 A;  4CRY B;  4Y49 B;  3R96 A;  3TE4 A;  1MK4 A;  2RC4 A;  3B8G A;  4XPK A;  1YLE A;  4CYO A;  2G3T A;  2JEV A;  2Q4Y A;  1MJB A;  1YVO A;  4U9Z A;  1Y7R A;  1IYL A;  2PQ8 A;  4R87 A;  5AG5 A;  2B5G B;  4F0X A;  2FCK A;  1NE9 A;  1WK4 A;  2Q44 A;  4B10 A;  4F6A A;  2Q4V A;  4UCP A;  1TIQ A;  1YRE A;  4KUB A;  4R3K A;  2YNC C;  4UFW A;  1Q2Y A;  2FIW A;  3LD2 A;  4KOV A;  2Q0Y A;  1Z4R A;  4KZT A;  3QB8 A;  5G21 A;  2EVN A;  1R57 A;  4QUS A;  4I49 A;  2Z3O A;  4Y49 C;  3MGD A;  2FE7 A;  2J8M A;  1B6B A;  2JDC A;  3TFY A;  1S7F A;  4CGL A;  4CAF A;  3FB3 A;  4HKF A;  2VQY A;  2F5I A;  4CAX A;  4B11 A;  4PK3 A;  2GAN A;  4EVY A;  4NXY A;  2R8V A;  4KOX A;  3IU1 A;  1M4D A;  1MJA A;  4JD6 A;  3IU2 A;  1I1D A;  3VWD A;  2K5T A;  3TOA A;  2CXA A;  3H4Q A;  4OAE A;  4PK2 A;  3CXP A;  2Q7B A;  5A27 A;  3GY9 A;  4QB9 A;  2PSW A;  3FIX A;  1LRZ A;  2VZY A;  4YFJ A;  4OAD A;  2P6G A;  3WR7 A;  2QEC A;  4XPD B;  4KVO E;  4M85 A;  3G3S A;  2OH1 A;  4JWP A;  2P6F A;  3EC4 A;  4B14 A;  1VKC A;  2PDO A;  1XE4 A;  4UCM A;  3S6F A;  3S6H A;  4U5Y A;  3W6X A;  3T90 A;  4AG9 A;  4MFJ A;  4IUS A;  4KVX A;  2B3V A;  3QAH A;  4CAW A;  5HMN A;  2B58 A;  4FD6 A;  2O28 A;  4PV6 A;  1WWZ A;  2ARH A;  2A4N A;  5H86 A;  1I12 A;  4IF5 A;  3R9E A;  4CAV A;  5C88 A;  3R9F A;  1QST A;  2JLM A;  4QC6 A;  4X5K A;  1YVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...