5AG7A

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a benzomorpholine ligand
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development of Small-Molecule Trypanosoma Brucei N-Myristoyltransferase Inhibitors: Discovery and Optimisation of a Novel Binding Mode.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 115
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ag7A00
2YNCA 4UCPA 4B11A 3IWEA 4A32A 2YNDA 4CGNA 4CYQA 4UCNA 4CYPA 3H5ZA 4C2ZA 4CAFA 4B14A 4UFVA 4A33A 4CGLA 4UFXA 5G1ZA 4A31A 5AG7A 4A95A 4B10A 4B12A 4C7IA 4C7HA 5A27A 4CGPA 5AG4A 3IU1A 4CYNA 4C2YA 4CGMA 2YNEA 4A2ZA 5G21A 5G20A 4CAEA 4UFWA 4CYOA 2WSAA 4C68A 5AGEA 5AG6A 5G22A 3IU2A 4BBHA 4CGOA 2YNCC 5AG5A 2WUUA 4UCMA 4C2XA 3JTKA 5A28A 4A30A 4B13A
chains in the Genus database with same CATH superfamily
3T8WA 3TTHA 2DXQA 3WC6A 4KSFA 2C6CA 2Q7BA 4OADA 2R1IA 2RB7A 4A94A 5DWMA 1X10A 2ODFA 4Q7AA 1TF8A 1MJBA 4UFXA 5G1ZA 2VL1A 4A37A 4EFDA 2PJBA 4KLVA 1XE4A 4A30A 1KZFA 4ZBGA 1KUYA 3TO9A 5K8OA 1VHEA 1Q7LA 2O4HA 3D8PA 1WWZA 2PJ1A 3TC8A 4A39A 3DR6A 4ZI6A 3F5BA 4BMHA 2ZOGA 2WSAA 3CXPA 4X3RA 3WABA 4JLYA 1GYTA 1J4JA 2J8RA 2Q43A 2B3UA 4UBRA 5CNPA 3B35A 1XOVA 2ZEDA 2ZXVA 3IO1A 2WUUA 4J3GA 5KTDA 2F5IA 5HXDA 2ZEHA 2WPXA 1VKCA 3FNCA 5HVFA 4FD6A 4A32A 1XRYA 1F2OA 2J8MA 3C26A 1KUXA 2CF4A 2Z0ZA 3H5ZA 3MN8A 4UWJA 5GCNA 4CAWA 4PPZA 1AMPA 1FY7A 5JQ4A 4NSQA 5F47A 2GFQA 4MFZA 3DR8A 3NH4A 4MBUA 3FEDA 3LWUA 4YWYA 4CGPA 1P0HA 2QECA 3FYNA 4ONUA 2ABZA 3TFYA 5I0CA 4UFWA 1M4LA 2REFA 4IHMA 3B7IA 1VHOA 3NA6A 1YLOA 4CPAA 5HMNA 1ELMP 1R3NA 1YR0A 2ARHA 2D4PA 4FWUA 4AXVA 2Z3KA 2OH1A 4H2KA 2V77A 4UEZA 2OU2A 4P4IA 2FVGA 4HNXB 4XPLA 4AVAA 1QSMA 2AE6A 2IL4A 3FVLA 3TO6A 1BPNA 5A28A 1S7LA 2YNDA 1PYTB 2K5TA 3DDDA 4UCNA 4E0AA 2OZHA 1S60A 4KZTA 1CX8A 4OIWA 4EWTA 3K9TA 1M1DA 4A95A 2FE7A 3H8EA 2FIAA 4KVOE 4MRIA 2PJ9A 2P0WA 3RAMA 4DNCA 3JUWA 2IQ6A 4PQAA 4QC6A 4BINA 2NMTA 5LYIA 2OR4A 5IV0A 1OZPA 4AG9A 5AGEA 2JDDA 2Q7SA 2QMLA 3IU2A 1XMTA 3FJUA 2PC1A 3DGVA 4NXYA 5G22A 2V8VA 3RO0A 3SI1A 4CGOA 1Z5RA 2Q4VA 1XFOA 2QIRA 4WWVA 2I00A 5J1QA 4CGNA 1M44A 1U6MA 1XIXA 3PB7X 2PJCA 2BO9A 3BXMA 5K8PA 4MI4A 2AFMA 1S7FA 4R3KA 3IWWA 3QAYA 2CTBA 3R9GA 2Z3OA 3GKRA 4CGLA 1Z2LA 3GUXA 3WT4A 3D4UA 5D29A 5EC4A 3H4QA 3FRMA 2ZEOA 3IFEA 1IB1E 3KR4A 4OIDA 2P6GA 1B6BA 1Z4RA 2Q4ZA 2VQYA 3ISXA 3KR5A 3VARA 4AVBA 1NE9A 1RXTA 4MFPA 1GHEA 4A2ZA 2BOAA 4E8OA 4MFLA 3KZWA 4PXBA 2BSWA 2FT0A 3NH5A 3QB8A 2PJ0A 2JBKA 4M3SA 3UY5A 4JJXA 3BJ7A 4KOWA 4L8AA 4NCZA 1ELLP 4UWIA 3S9LA 5AG5A 4DUKA 2GIVA 2ZW5A 4H89A 2I3CA 1I1DA 2AFOA 2WZNA 3B2YA 2YNCA 4ZX8A 4B13A 3P2FA 1PU9A 1YVKA 3CT9A 3CXQA 4R8FA 4BD9A 4FAIA 4MHYA 3R9FA 4M6GA 2OOTA 3IEHA 3V8IA 2CXAA 2GLJA 2IMOA 6CPAA 1I21A 1YW4A 3FMCA 4AG7A 4C7IA 1XEBA 2P6EA 2PR8A 2ZELA 3B3SA 3PB8X 3PB4X 4NEXA 4C7HA 1LANA 1IICA 2O53A 4UIAA 3FH4A 4PSXA 4B5OA 4PXCA 2EWBA 5H86A 1S7NA 4XPDC 4CAXA 3PB9X 4CAVA 2VZYA 4OC2A 2AFUA 3R96A 4ONWA 3T9YA 3JVNA 1ARLA 1IU8A 2VXKA 4MJ8A 3TO7A 3PFOA 1ON0A 1BAVA 3WR7A 4PXEA 4TNUA 2AJ6A 2V8DA 2EK9A 1QSTA 3S9NA 3N5FA 4MCPA 2V8GA 1S7KA 1K4JA 2AFZA 5EMIA 4KOVA 3IGRA 4M85A 2VZZA 4G1PA 3FEEA 3GIUA 4NGTA 1HEEA 4JXRA 4MY0A 4UEFA 3B3VA 3D7DA 2BL1A 4MHNA 4CYNA 4ZY1A 4KOXA 4UIBA 3KHZA 1PUAA 3DSBA 2Y0MA 3D7HA 3D2MA 3S6FA 1JQGA 3PRTA 1I12A 4Y49C 4RS2A 4P10A 1M4DA 1YLEA 3GYAA 3PP9A 4IUSA 3ZJ0A 4ZY0A 1CP6A 2B58A 4M6IA 2J8NA 4H6UA 5CBMA 1XBUA 5J8FA 5LYLA 3KKWA 4OC4A 5KTAA 2KCWA 3MGDA 4U5YA 2EVNA 5ELYA 5I4MA 1CJWA 1YSJA 1JWQA 1Q2YA 3BLNA 3BHXA 3KHXA 2B5GA 3G8WA 5LYFA 4Q36A 4MFJA 3B3CA 4JYWA 4K30A 2PR1A 1X12A 4P4JA 1YGHA 4LQGA 4II9A 2CNSA 2B4BA 1VIXA 2C6GA 1LFWA 3CXSA 4W9YA 2PE3A 5IX3A 4F6AA 3H8FA 2Q51A 4UA3A 2DF5A 2C27A 3EO4A 3LACA 3SJFA 4F9VA 5KTCA 4NJRA 2Q0YA 4C2XA 2ANPA 2B5GB 2OZUA 2GE3A 2GANA 4P45A 4NFRA 4NGPA 1V0CA 2JEWA 4CYQA 1L0CA 3R95A 2VI7A 3CPXA 2XEIA 4KORA 4EMEA 4P4FA 4NGMA 4TWEA 5E96A 1QSOA 4UFVA 5C88A 2PJ3A 1R43A 1H8LA 4KS9A 2FSRA 1QSRA 5DWNA 4GXHA 4YFJA 1Z4EA 2VBQA 2EK8A 3GLJA 3WC7A 1A2ZA 1BOBA 4JZ0A 3IU1A 1KWMA 4NF1A 1S3ZA 2NYQA 4I49A 3E0KA 1EE3P 2PJ7A 2Z3PA 4X5KA 5G20A 1XF8A 4CAEA 3EC4A 1PCAA 3KI9A 2JEVA 3P2HA 2DPTA 1ZLIA 3IC1A 2X7BA 1NMTA 2ZENA 5THWA 2C6PA 4MCSA 3SI2A 5JPHA 4HPSA 3JTKA 4FBEA 4OMEA 3GB0A 4IK2A 4X8IA 3TOBA 1DTDA 3EFAA 2R8VA 3N7ZA 5DS0A 1KUVA 1TXRA 4CRYB 2QJ8A 1VGYA 4QBJA 3CDXA 1Q2DA 3D67A 3RBUA 5F49A 2Z10A 2AFSA 4B12A 3D68A 1S5KA 5HVHA 1HDUA 3R1KA 3IIBA 1LAPA 4UF4A 1Z8XA 2FCKA 1IGBA 2YNEA 1Y7RA 3NE7A 4FD4A 3SHPA 3W91A 1ZLHA 4MY3A 3W6XA 2B3VA 1AUGA 1RTQA 2Z3MA 2HV2A 5JGFA 1ARMA 2RC4A 3TCVA 2PJ8A 1FNOA 4XPKA 3SI0A 4B5PB 2O28A 1CPXA 4KVXA 1NSLA 2BCOA 2BUEA 1CBXA 2YGWA 3IWEA 4KOUA 3VH9A 1UFHA 4H6ZA 2ZEFA 3RNZA 1YVOA 4FD7A 3K9UA 4A33A 5LYDA 2D4OA 1F2PA 5H84A 3K2KA 3CZXA 4RN7A 2PDOA 3S6KA 2BEIA 4KVME 3IJ3A 4A38A 3EY5A 4KSAA 1NSAA 1VHSA 2V8HA 4MMOA 2RFHA 2ZW6A 4MHPA 5HH1A 2XEFA 3SJGA 3TOAA 1SQHA 2POKA 4C68A 5F09A 4R76A 5JH9A 1F57A 4X2TA 4PXDA 1MK4A 4U9ZA 2ZEGA 3SJEA 2Q04A 3D7GA 3L2NA 4HKFA 3SJXA 4OP4A 3V38A 3FB3A 4WJBA 4QUSA 1Y9WA 2JLMA 1Z8WA 2PJ5A 1IOFA 4Q38A 4XNHB 4ZYQA 1TKHA 2CNTA 4C2ZA 5FVJA 3A9LA 2CNMA 2A4NA 4UEEA 1RO5A 2CTCA 2DEAA 4B10A 3FECA 2GU2A 1YX0A 4F8ZA 3PZJA 4IF5A 5CPAA 1QMUA 5JM6A 2GLFA 2ZEPA 3WC5A 2FXFA 5HVGA 2ZOFA 4JD6A 3NE8A 4B5PA 2REEA 3F8KA 3D2PA 1YREA 4GM5A 5LRGA 3LMSA 2PJ4A 4BBHA 4RI1A 2PSWA 3NFZA 2EUIA 2PIZA 2PRQA 4IAVA 4MHDA 3FBUA 1QQ9A 1XMBA 2CY2A 2F7VA 2PJ2A 2XEGA 3QNVA 1IOIA 2F8HA 2Q44A 1IIDA 1IYKA 2EO8A 3GY9A 4XPDB 4YU9A 2GREA 2P6FA 4KUBA 2WPWA 2B4DA 1TF9A 1LCPA 2IJZA 2J9AA 2QYVA 3D66A 4NGQA 3DNSA 3I1UA 4Z65A 2DPSA 4NGNA 4OC0A 5LRJA 3KQZA 5EBVA 4KLWA 2ZW7A 1Y7EA 4P44A 2R98A 4K3NA 4OC5A 4OKOA 4OLLA 4MFKA 1Z9UA 1UWYA 1WK4A 3ISZA 3TT2A 3NH8A 4PSWA 2ZW4A 4B11A 4CRZB 3KGQA 4R3LA 4MCRA 1LAMA 4E2AA 4KSIA 4P4EA 5K8NA 1BO4A 3DLJA 2WYRA 3CPAA 5A27A 4OAEA 1TKFA 3D3SA 1Y0YA 1YMEA 3KL9A 4OC1A 1DE4C 4CGMA 1HDQA 1CG2A 2Q4YA 3B8GA 3V7ZA 7CPAA 3TE4A 3FXTA 4GS4A 4B6ZA 2Z11A 2G9DA 4R57A 3KASA 3HUVA 1ZG9A 5F46A 2PRBA 2H5MA 3G3SA 2JDCA 4ZX9A 4KOTA 2ZPAA 4DYOA 4F0YA 2QVPA 3B3TA 4QVTA 2HB6A 4LUAA 1BPMA 4CYPA 1R57A 2Z3NA 4R9MA 2R7HA 2XEJA 4CAFA 5IB0A 2G0BA 4YGOA 3RZAA 4HNYB 5J8CA 3FF3A 1CM0A 4FUUA 4A31A 5AG7A 2OB0A 1B87A 4NJQA 4R87A 4R6TA 2G3TA 2C1CA 3VATA 4C2YA 1M4GA 5G21A 8CPAA 4CYOA 5LRKA 2PCUA 3PGPA 3FX6A 4R7MA 1IY7A 3LD2A 4NGSA 3BI1A 1ZG7A 4MFQA 4Y49B 2HUZA 2HC9A 5AG6A 4KOSA 4KUAA 2YNCC 2JBJA 4OC3A 4ORFA 2ZEMA 3PB6X 4LQ6A 1Y0RA 4MHZA 1TKJA 2Z3LA 4UCPA 3QAHA 3R9EA 1XJOA 4O23A 4XNHC 5BWAB 2AFWA 2PJ6A 3I3GA 4NGRA 3PBBA 3HLPA 4B14A 1YW6A 2PQ8A 1FT7A 1YK3A 4FD5A 1OBRA 5K8MA 5C82A 4ZGYB 1ZG8A 1QSNA 3MRUA 4QB9A 2I79A 5AG4A 1P4NA 4P6YA 4DJLA 3PBEA 1CP7A 1MJ9A 3F0AA 3VWEA 2VEZA 1MJAA 4PK3A 4L89A 2EBJA 3PEIA 3S6GA 3SXOA 2ATRA 3W6SA 2FL4A 4EVYA 3BJ8A 4MXUA 2PJAA 3S6HA 4KOYA 3T90A 4PK2A 2PIYA 1AYEA 5IB9A 1ZO0A 1YQEA 2ZEEA 4M6HA 1LRZA 3TX8A 3FIXA 2G3AA 4LX9A 5F48A 3KQXA 2FS5A 2AFXA 4JWPA 1Q2CA 3JRUA 2B4DB 3S9MA 1N71A 3OWCA 3LODA 4HNWB 4PV6A 3IWGA 4JXQA 4ZY2A 4AB7A 1Z8TA 4F0XA 2FIWA 2NSMA 4P4BA 5D8NA 4U9YA 4P4DA 3VWDA 4CS0B 3BI0A 3H8GA 3ZZIA 3D7FA 3EXNA 4AVCA 2PVWA 3PFEA 1IYLA 2CIJA 1BLLE 4MCQA 4YRHA 3RYOA 3I9SA 4RUHA 5ISVA 1Y9KA 4F9UA 1Z8LA 1CPSA 1M4IA 4UCMA 1TIQA 2HQYA 3B3WA 1LOKA 2PVVA 3SXNA 2OZGA
chains in the Genus database with same CATH topology
3TTHA 2DXQA 4KSFA 2Q7BA 4OADA 2R1IA 5DWMA 1MJBA 4UFXA 5G1ZA 4KLVA 1XE4A 4A30A 1KZFA 4ZBGA 1KUYA 3TO9A 3D8PA 1WWZA 3DR6A 3F5BA 4BMHA 2WSAA 3CXPA 4JLYA 1J4JA 2J8RA 2B3UA 4UBRA 5CNPA 2ZXVA 5KTDA 2WUUA 4J3GA 2F5IA 2WPXA 1VKCA 3FNCA 4FD6A 4A32A 2J8MA 3C26A 1KUXA 2Z0ZA 4UWJA 3H5ZA 5GCNA 4CAWA 1FY7A 5JQ4A 4NSQA 5F47A 4MFZA 3DR8A 4MBUA 4CGPA 1P0HA 2QECA 3FYNA 4ONUA 3TFYA 5I0CA 4UFWA 2REFA 5HMNA 1YR0A 2ARHA 2D4PA 2Z3KA 2OH1A 2OU2A 4HNXB 4XPLA 4AVAA 1QSMA 2AE6A 2IL4A 3TO6A 5A28A 1S7LA 2YNDA 2K5TA 3DDDA 4UCNA 2OZHA 1S60A 4KZTA 4A95A 1M1DA 2FE7A 4KVOE 2FIAA 2P0WA 4DNCA 3JUWA 4QC6A 2NMTA 5IV0A 1OZPA 4AG9A 5AGEA 2JDDA 5G22A 2QMLA 3IU2A 1XMTA 4NXYA 2PC1A 4CGOA 4E0AA 2Q4VA 2QIRA 2I00A 4CGNA 1M44A 1U6MA 1XIXA 4MI4A 4R3KA 1S7FA 3R9GA 2Z3OA 3GKRA 4CGLA 5EC4A 3H4QA 3FRMA 1IB1E 2P6GA 1B6BA 1Z4RA 2VQYA 4AVBA 4MFPA 1NE9A 1RXTA 1GHEA 4A2ZA 4E8OA 4MFLA 2BSWA 2FT0A 3QB8A 4M3SA 3UY5A 4JJXA 3BJ7A 4KOWA 4L8AA 4NCZA 4UWIA 5AG5A 2ZW5A 4H89A 2GIVA 1I1DA 4B13A 2YNCA 3P2FA 1PU9A 1YVKA 3CXQA 3R9FA 3V8IA 2CXAA 1I21A 4AG7A 4C7IA 1XEBA 2P6EA 2PR8A 4C7HA 4NEXA 1IICA 4PSXA 4B5OA 5H86A 1S7NA 4XPDC 4CAXA 4CAVA 2VZYA 3R96A 3T9YA 3JVNA 3TO7A 2VXKA 4MJ8A 1ON0A 3WR7A 2AJ6A 1QSTA 1S7KA 1K4JA 4KOVA 3IGRA 4M85A 2VZZA 4JXRA 4MY0A 2BL1A 4CYNA 4KOXA 1PUAA 3DSBA 2Y0MA 3D2MA 3S6FA 1I12A 4Y49C 4RS2A 1M4DA 1YLEA 3GYAA 3PP9A 4IUSA 3ZJ0A 2B58A 2J8NA 4H6UA 5J8FA 3KKWA 5KTAA 2KCWA 3MGDA 4U5YA 2EVNA 1CJWA 1Q2YA 3BLNA 2B5GA 3G8WA 4Q36A 4MFJA 4K30A 2PR1A 1YGHA 4II9A 2CNSA 2B4BA 3CXSA 5IX3A 4F6AA 4UA3A 3EO4A 2C27A 5KTCA 2Q0YA 4C2XA 2OZUA 2B5GB 2GE3A 2GANA 1V0CA 4CYQA 1L0CA 3R95A 2VI7A 4KORA 5E96A 1QSOA 4UFVA 5C88A 4KS9A 2FSRA 1QSRA 5DWNA 4YFJA 1Z4EA 2VBQA 1BOBA 3IU1A 4NF1A 1S3ZA 4I49A 3E0KA 2Z3PA 4X5KA 5G20A 4CAEA 1XF8A 3EC4A 2JEVA 3P2HA 2DPTA 2X7BA 1NMTA 5JPHA 3JTKA 3TOBA 3EFAA 2R8VA 3N7ZA 4CRYB 1KUVA 4QBJA 1Q2DA 5F49A 2Z10A 4B12A 1S5KA 3R1KA 2FCKA 2YNEA 1Y7RA 3NE7A 4FD4A 3SHPA 3W91A 4MY3A 3W6XA 2B3VA 2Z3MA 2HV2A 2RC4A 3TCVA 4XPKA 4B5PB 2O28A 1NSLA 4KVXA 2BUEA 2YGWA 3IWEA 4KOUA 1UFHA 4H6ZA 1YVOA 4FD7A 3K9UA 4A33A 2D4OA 5H84A 2PDOA 3S6KA 2BEIA 4KVME 3EY5A 4KSAA 1VHSA 5HH1A 2ZW6A 3TOAA 1SQHA 4C68A 1MK4A 4U9ZA 2Q04A 4HKFA 3FB3A 4QUSA 1Y9WA 2JLMA 4Q38A 4XNHB 4C2ZA 2CNTA 5FVJA 3A9LA 2CNMA 2A4NA 1RO5A 4B10A 1YX0A 3PZJA 4IF5A 2FXFA 4JD6A 4B5PA 2REEA 3F8KA 3D2PA 1YREA 4BBHA 4RI1A 2PSWA 2EUIA 4MHDA 3FBUA 2CY2A 2Q44A 1IIDA 1IYKA 3GY9A 4XPDB 2P6FA 4KUBA 2WPWA 2B4DA 3DNSA 2DPSA 5EBVA 4KLWA 2ZW7A 2R98A 4OLLA 4MFKA 1Z9UA 1WK4A 3TT2A 4PSWA 2ZW4A 4B11A 4CRZB 4R3LA 4E2AA 1BO4A 5A27A 4OAEA 3D3SA 4CGMA 3B8GA 2Q4YA 3TE4A 3FXTA 4GS4A 2Z11A 4R57A 5F46A 2PRBA 2H5MA 3G3SA 2JDCA 4KOTA 2ZPAA 4F0YA 4QVTA 4LUAA 4CYPA 1R57A 2Z3NA 4R9MA 2R7HA 4CAFA 5IB0A 2G0BA 4YGOA 4HNYB 5J8CA 1CM0A 4A31A 5AG7A 2OB0A 1B87A 4R87A 2G3TA 4C2YA 1M4GA 5G21A 4CYOA 3PGPA 3LD2A 4Y49B 4MFQA 2HUZA 5AG6A 4KOSA 4KUAA 2YNCC 4ORFA 2Z3LA 4UCPA 3QAHA 3R9EA 5BWAB 4XNHC 3I3GA 4B14A 2PQ8A 1YK3A 4FD5A 5C82A 4ZGYB 1QSNA 4QB9A 2I79A 5AG4A 1P4NA 3F0AA 1MJ9A 3VWEA 2VEZA 1MJAA 4PK3A 4L89A 3S6GA 3SXOA 2ATRA 3W6SA 2FL4A 4EVYA 3BJ8A 3S6HA 4KOYA 3T90A 4PK2A 1ZO0A 1LRZA 3FIXA 2G3AA 4LX9A 5F48A 2FS5A 4JWPA 1Q2CA 2B4DB 1N71A 3OWCA 3LODA 4HNWB 4PV6A 3IWGA 4JXQA 4AB7A 4F0XA 2FIWA 4U9YA 3VWDA 4CS0B 3ZZIA 3EXNA 4AVCA 1IYLA 4YRHA 5ISVA 3RYOA 3I9SA 1Y9KA 1M4IA 4UCMA 1TIQA 2HQYA 3SXNA 2OZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNC A;  4UCP A;  4B11 A;  3IWE A;  4A32 A;  2YND A;  4CGN A;  4CYQ A;  4UCN A;  4CYP A;  3H5Z A;  4C2Z A;  4CAF A;  4B14 A;  4UFV A;  4A33 A;  4CGL A;  4UFX A;  5G1Z A;  4A31 A;  5AG7 A;  4A95 A;  4B10 A;  4B12 A;  4C7I A;  4C7H A;  5A27 A;  4CGP A;  5AG4 A;  3IU1 A;  4CYN A;  4C2Y A;  4CGM A;  2YNE A;  4A2Z A;  5G21 A;  5G20 A;  4CAE A;  4UFW A;  4CYO A;  2WSA A;  4C68 A;  5AGE A;  5AG6 A;  5G22 A;  3IU2 A;  4BBH A;  4CGO A;  2YNC C;  5AG5 A;  2WUU A;  4UCM A;  4C2X A;  3JTK A;  5A28 A;  4A30 A;  4B13 A; 
#chains in the Genus database with same CATH topology
 3T8W A;  3TTH A;  2DXQ A;  3WC6 A;  4KSF A;  2C6C A;  2Q7B A;  4OAD A;  2R1I A;  2RB7 A;  4A94 A;  5DWM A;  1X10 A;  2ODF A;  4Q7A A;  1TF8 A;  1MJB A;  4UFX A;  5G1Z A;  2VL1 A;  4A37 A;  4EFD A;  2PJB A;  4KLV A;  1XE4 A;  4A30 A;  1KZF A;  4ZBG A;  1KUY A;  3TO9 A;  5K8O A;  1VHE A;  1Q7L A;  2O4H A;  3D8P A;  1WWZ A;  2PJ1 A;  3TC8 A;  4A39 A;  3DR6 A;  4ZI6 A;  3F5B A;  4BMH A;  2ZOG A;  2WSA A;  3CXP A;  4X3R A;  3WAB A;  4JLY A;  1GYT A;  1J4J A;  2J8R A;  2Q43 A;  2B3U A;  4UBR A;  5CNP A;  3B35 A;  1XOV A;  2ZED A;  2ZXV A;  3IO1 A;  2WUU A;  4J3G A;  5KTD A;  2F5I A;  5HXD A;  2ZEH A;  2WPX A;  1VKC A;  3FNC A;  5HVF A;  4FD6 A;  4A32 A;  1XRY A;  1F2O A;  2J8M A;  3C26 A;  1KUX A;  2CF4 A;  2Z0Z A;  3H5Z A;  3MN8 A;  4UWJ A;  5GCN A;  4CAW A;  4PPZ A;  1AMP A;  1FY7 A;  5JQ4 A;  4NSQ A;  5F47 A;  2GFQ A;  4MFZ A;  3DR8 A;  3NH4 A;  4MBU A;  3FED A;  3LWU A;  4YWY A;  4CGP A;  1P0H A;  2QEC A;  3FYN A;  4ONU A;  2ABZ A;  3TFY A;  5I0C A;  4UFW A;  1M4L A;  2REF A;  4IHM A;  3B7I A;  1VHO A;  3NA6 A;  1YLO A;  4CPA A;  5HMN A;  1ELM P;  1R3N A;  1YR0 A;  2ARH A;  2D4P A;  4FWU A;  4AXV A;  2Z3K A;  2OH1 A;  4H2K A;  2V77 A;  4UEZ A;  2OU2 A;  4P4I A;  2FVG A;  4HNX B;  4XPL A;  4AVA A;  1QSM A;  2AE6 A;  2IL4 A;  3FVL A;  3TO6 A;  1BPN A;  5A28 A;  1S7L A;  2YND A;  1PYT B;  2K5T A;  3DDD A;  4UCN A;  4E0A A;  2OZH A;  1S60 A;  4KZT A;  1CX8 A;  4OIW A;  4EWT A;  3K9T A;  1M1D A;  4A95 A;  2FE7 A;  3H8E A;  2FIA A;  4KVO E;  4MRI A;  2PJ9 A;  2P0W A;  3RAM A;  4DNC A;  3JUW A;  2IQ6 A;  4PQA A;  4QC6 A;  4BIN A;  2NMT A;  5LYI A;  2OR4 A;  5IV0 A;  1OZP A;  4AG9 A;  5AGE A;  2JDD A;  2Q7S A;  2QML A;  3IU2 A;  1XMT A;  3FJU A;  2PC1 A;  3DGV A;  4NXY A;  5G22 A;  2V8V A;  3RO0 A;  3SI1 A;  4CGO A;  1Z5R A;  2Q4V A;  1XFO A;  2QIR A;  4WWV A;  2I00 A;  5J1Q A;  4CGN A;  1M44 A;  1U6M A;  1XIX A;  3PB7 X;  2PJC A;  2BO9 A;  3BXM A;  5K8P A;  4MI4 A;  2AFM A;  1S7F A;  4R3K A;  3IWW A;  3QAY A;  2CTB A;  3R9G A;  2Z3O A;  3GKR A;  4CGL A;  1Z2L A;  3GUX A;  3WT4 A;  3D4U A;  5D29 A;  5EC4 A;  3H4Q A;  3FRM A;  2ZEO A;  3IFE A;  1IB1 E;  3KR4 A;  4OID A;  2P6G A;  1B6B A;  1Z4R A;  2Q4Z A;  2VQY A;  3ISX A;  3KR5 A;  3VAR A;  4AVB A;  1NE9 A;  1RXT A;  4MFP A;  1GHE A;  4A2Z A;  2BOA A;  4E8O A;  4MFL A;  3KZW A;  4PXB A;  2BSW A;  2FT0 A;  3NH5 A;  3QB8 A;  2PJ0 A;  2JBK A;  4M3S A;  3UY5 A;  4JJX A;  3BJ7 A;  4KOW A;  4L8A A;  4NCZ A;  1ELL P;  4UWI A;  3S9L A;  5AG5 A;  4DUK A;  2GIV A;  2ZW5 A;  4H89 A;  2I3C A;  1I1D A;  2AFO A;  2WZN A;  3B2Y A;  2YNC A;  4ZX8 A;  4B13 A;  3P2F A;  1PU9 A;  1YVK A;  3CT9 A;  3CXQ A;  4R8F A;  4BD9 A;  4FAI A;  4MHY A;  3R9F A;  4M6G A;  2OOT A;  3IEH A;  3V8I A;  2CXA A;  2GLJ A;  2IMO A;  6CPA A;  1I21 A;  1YW4 A;  3FMC A;  4AG7 A;  4C7I A;  1XEB A;  2P6E A;  2PR8 A;  2ZEL A;  3B3S A;  3PB8 X;  3PB4 X;  4NEX A;  4C7H A;  1LAN A;  1IIC A;  2O53 A;  4UIA A;  3FH4 A;  4PSX A;  4B5O A;  4PXC A;  2EWB A;  5H86 A;  1S7N A;  4XPD C;  4CAX A;  3PB9 X;  4CAV A;  2VZY A;  4OC2 A;  2AFU A;  3R96 A;  4ONW A;  3T9Y A;  3JVN A;  1ARL A;  1IU8 A;  2VXK A;  4MJ8 A;  3TO7 A;  3PFO A;  1ON0 A;  1BAV A;  3WR7 A;  4PXE A;  4TNU A;  2AJ6 A;  2V8D A;  2EK9 A;  1QST A;  3S9N A;  3N5F A;  4MCP A;  2V8G A;  1S7K A;  1K4J A;  2AFZ A;  5EMI A;  4KOV A;  3IGR A;  4M85 A;  2VZZ A;  4G1P A;  3FEE A;  3GIU A;  4NGT A;  1HEE A;  4JXR A;  4MY0 A;  4UEF A;  3B3V A;  3D7D A;  2BL1 A;  4MHN A;  4CYN A;  4ZY1 A;  4KOX A;  4UIB A;  3KHZ A;  1PUA A;  3DSB A;  2Y0M A;  3D7H A;  3D2M A;  3S6F A;  1JQG A;  3PRT A;  1I12 A;  4Y49 C;  4RS2 A;  4P10 A;  1M4D A;  1YLE A;  3GYA A;  3PP9 A;  4IUS A;  3ZJ0 A;  4ZY0 A;  1CP6 A;  2B58 A;  4M6I A;  2J8N A;  4H6U A;  5CBM A;  1XBU A;  5J8F A;  5LYL A;  3KKW A;  4OC4 A;  5KTA A;  2KCW A;  3MGD A;  4U5Y A;  2EVN A;  5ELY A;  5I4M A;  1CJW A;  1YSJ A;  1JWQ A;  1Q2Y A;  3BLN A;  3BHX A;  3KHX A;  2B5G A;  3G8W A;  5LYF A;  4Q36 A;  4MFJ A;  3B3C A;  4JYW A;  4K30 A;  2PR1 A;  1X12 A;  4P4J A;  1YGH A;  4LQG A;  4II9 A;  2CNS A;  2B4B A;  1VIX A;  2C6G A;  1LFW A;  3CXS A;  4W9Y A;  2PE3 A;  5IX3 A;  4F6A A;  3H8F A;  2Q51 A;  4UA3 A;  2DF5 A;  2C27 A;  3EO4 A;  3LAC A;  3SJF A;  4F9V A;  5KTC A;  4NJR A;  2Q0Y A;  4C2X A;  2ANP A;  2B5G B;  2OZU A;  2GE3 A;  2GAN A;  4P45 A;  4NFR A;  4NGP A;  1V0C A;  2JEW A;  4CYQ A;  1L0C A;  3R95 A;  2VI7 A;  3CPX A;  2XEI A;  4KOR A;  4EME A;  4P4F A;  4NGM A;  4TWE A;  5E96 A;  1QSO A;  4UFV A;  5C88 A;  2PJ3 A;  1R43 A;  1H8L A;  4KS9 A;  2FSR A;  1QSR A;  5DWN A;  4GXH A;  4YFJ A;  1Z4E A;  2VBQ A;  2EK8 A;  3GLJ A;  3WC7 A;  1A2Z A;  1BOB A;  4JZ0 A;  3IU1 A;  1KWM A;  4NF1 A;  1S3Z A;  2NYQ A;  4I49 A;  3E0K A;  1EE3 P;  2PJ7 A;  2Z3P A;  4X5K A;  5G20 A;  1XF8 A;  4CAE A;  3EC4 A;  1PCA A;  3KI9 A;  2JEV A;  3P2H A;  2DPT A;  1ZLI A;  3IC1 A;  2X7B A;  1NMT A;  2ZEN A;  5THW A;  2C6P A;  4MCS A;  3SI2 A;  5JPH A;  4HPS A;  3JTK A;  4FBE A;  4OME A;  3GB0 A;  4IK2 A;  4X8I A;  3TOB A;  1DTD A;  3EFA A;  2R8V A;  3N7Z A;  5DS0 A;  1KUV A;  1TXR A;  4CRY B;  2QJ8 A;  1VGY A;  4QBJ A;  3CDX A;  1Q2D A;  3D67 A;  3RBU A;  5F49 A;  2Z10 A;  2AFS A;  4B12 A;  3D68 A;  1S5K A;  5HVH A;  1HDU A;  3R1K A;  3IIB A;  1LAP A;  4UF4 A;  1Z8X A;  2FCK A;  1IGB A;  2YNE A;  1Y7R A;  3NE7 A;  4FD4 A;  3SHP A;  3W91 A;  1ZLH A;  4MY3 A;  3W6X A;  2B3V A;  1AUG A;  1RTQ A;  2Z3M A;  2HV2 A;  5JGF A;  1ARM A;  2RC4 A;  3TCV A;  2PJ8 A;  1FNO A;  4XPK A;  3SI0 A;  4B5P B;  2O28 A;  1CPX A;  4KVX A;  1NSL A;  2BCO A;  2BUE A;  1CBX A;  2YGW A;  3IWE A;  4KOU A;  3VH9 A;  1UFH A;  4H6Z A;  2ZEF A;  3RNZ A;  1YVO A;  4FD7 A;  3K9U A;  4A33 A;  5LYD A;  2D4O A;  1F2P A;  5H84 A;  3K2K A;  3CZX A;  4RN7 A;  2PDO A;  3S6K A;  2BEI A;  4KVM E;  3IJ3 A;  4A38 A;  3EY5 A;  4KSA A;  1NSA A;  1VHS A;  2V8H A;  4MMO A;  2RFH A;  2ZW6 A;  4MHP A;  5HH1 A;  2XEF A;  3SJG A;  3TOA A;  1SQH A;  2POK A;  4C68 A;  5F09 A;  4R76 A;  5JH9 A;  1F57 A;  4X2T A;  4PXD A;  1MK4 A;  4U9Z A;  2ZEG A;  3SJE A;  2Q04 A;  3D7G A;  3L2N A;  4HKF A;  3SJX A;  4OP4 A;  3V38 A;  3FB3 A;  4WJB A;  4QUS A;  1Y9W A;  2JLM A;  1Z8W A;  2PJ5 A;  1IOF A;  4Q38 A;  4XNH B;  4ZYQ A;  1TKH A;  2CNT A;  4C2Z A;  5FVJ A;  3A9L A;  2CNM A;  2A4N A;  4UEE A;  1RO5 A;  2CTC A;  2DEA A;  4B10 A;  3FEC A;  2GU2 A;  1YX0 A;  4F8Z A;  3PZJ A;  4IF5 A;  5CPA A;  1QMU A;  5JM6 A;  2GLF A;  2ZEP A;  3WC5 A;  2FXF A;  5HVG A;  2ZOF A;  4JD6 A;  3NE8 A;  4B5P A;  2REE A;  3F8K A;  3D2P A;  1YRE A;  4GM5 A;  5LRG A;  3LMS A;  2PJ4 A;  4BBH A;  4RI1 A;  2PSW A;  3NFZ A;  2EUI A;  2PIZ A;  2PRQ A;  4IAV A;  4MHD A;  3FBU A;  1QQ9 A;  1XMB A;  2CY2 A;  2F7V A;  2PJ2 A;  2XEG A;  3QNV A;  1IOI A;  2F8H A;  2Q44 A;  1IID A;  1IYK A;  2EO8 A;  3GY9 A;  4XPD B;  4YU9 A;  2GRE A;  2P6F A;  4KUB A;  2WPW A;  2B4D A;  1TF9 A;  1LCP A;  2IJZ A;  2J9A A;  2QYV A;  3D66 A;  4NGQ A;  3DNS A;  3I1U A;  4Z65 A;  2DPS A;  4NGN A;  4OC0 A;  5LRJ A;  3KQZ A;  5EBV A;  4KLW A;  2ZW7 A;  1Y7E A;  4P44 A;  2R98 A;  4K3N A;  4OC5 A;  4OKO A;  4OLL A;  4MFK A;  1Z9U A;  1UWY A;  1WK4 A;  3ISZ A;  3TT2 A;  3NH8 A;  4PSW A;  2ZW4 A;  4B11 A;  4CRZ B;  3KGQ A;  4R3L A;  4MCR A;  1LAM A;  4E2A A;  4KSI A;  4P4E A;  5K8N A;  1BO4 A;  3DLJ A;  2WYR A;  3CPA A;  5A27 A;  4OAE A;  1TKF A;  3D3S A;  1Y0Y A;  1YME A;  3KL9 A;  4OC1 A;  1DE4 C;  4CGM A;  1HDQ A;  1CG2 A;  2Q4Y A;  3B8G A;  3V7Z A;  7CPA A;  3TE4 A;  3FXT A;  4GS4 A;  4B6Z A;  2Z11 A;  2G9D A;  4R57 A;  3KAS A;  3HUV A;  1ZG9 A;  5F46 A;  2PRB A;  2H5M A;  3G3S A;  2JDC A;  4ZX9 A;  4KOT A;  2ZPA A;  4DYO A;  4F0Y A;  2QVP A;  3B3T A;  4QVT A;  2HB6 A;  4LUA A;  1BPM A;  4CYP A;  1R57 A;  2Z3N A;  4R9M A;  2R7H A;  2XEJ A;  4CAF A;  5IB0 A;  2G0B A;  4YGO A;  3RZA A;  4HNY B;  5J8C A;  3FF3 A;  1CM0 A;  4FUU A;  4A31 A;  5AG7 A;  2OB0 A;  1B87 A;  4NJQ A;  4R87 A;  4R6T A;  2G3T A;  2C1C A;  3VAT A;  4C2Y A;  1M4G A;  5G21 A;  8CPA A;  4CYO A;  5LRK A;  2PCU A;  3PGP A;  3FX6 A;  4R7M A;  1IY7 A;  3LD2 A;  4NGS A;  3BI1 A;  1ZG7 A;  4MFQ A;  4Y49 B;  2HUZ A;  2HC9 A;  5AG6 A;  4KOS A;  4KUA A;  2YNC C;  2JBJ A;  4OC3 A;  4ORF A;  2ZEM A;  3PB6 X;  4LQ6 A;  1Y0R A;  4MHZ A;  1TKJ A;  2Z3L A;  4UCP A;  3QAH A;  3R9E A;  1XJO A;  4O23 A;  4XNH C;  5BWA B;  2AFW A;  2PJ6 A;  3I3G A;  4NGR A;  3PBB A;  3HLP A;  4B14 A;  1YW6 A;  2PQ8 A;  1FT7 A;  1YK3 A;  4FD5 A;  1OBR A;  5K8M A;  5C82 A;  4ZGY B;  1ZG8 A;  1QSN A;  3MRU A;  4QB9 A;  2I79 A;  5AG4 A;  1P4N A;  4P6Y A;  4DJL A;  3PBE A;  1CP7 A;  1MJ9 A;  3F0A A;  3VWE A;  2VEZ A;  1MJA A;  4PK3 A;  4L89 A;  2EBJ A;  3PEI A;  3S6G A;  3SXO A;  2ATR A;  3W6S A;  2FL4 A;  4EVY A;  3BJ8 A;  4MXU A;  2PJA A;  3S6H A;  4KOY A;  3T90 A;  4PK2 A;  2PIY A;  1AYE A;  5IB9 A;  1ZO0 A;  1YQE A;  2ZEE A;  4M6H A;  1LRZ A;  3TX8 A;  3FIX A;  2G3A A;  4LX9 A;  5F48 A;  3KQX A;  2FS5 A;  2AFX A;  4JWP A;  1Q2C A;  3JRU A;  2B4D B;  3S9M A;  1N71 A;  3OWC A;  3LOD A;  4HNW B;  4PV6 A;  3IWG A;  4JXQ A;  4ZY2 A;  4AB7 A;  1Z8T A;  4F0X A;  2FIW A;  2NSM A;  4P4B A;  5D8N A;  4U9Y A;  4P4D A;  3VWD A;  4CS0 B;  3BI0 A;  3H8G A;  3ZZI A;  3D7F A;  3EXN A;  4AVC A;  2PVW A;  3PFE A;  1IYL A;  2CIJ A;  1BLL E;  4MCQ A;  4YRH A;  3RYO A;  3I9S A;  4RUH A;  5ISV A;  1Y9K A;  4F9U A;  1Z8L A;  1CPS A;  1M4I A;  4UCM A;  1TIQ A;  2HQY A;  3B3W A;  1LOK A;  2PVV A;  3SXN A;  2OZG A; 
#chains in the Genus database with same CATH homology
 3TTH A;  2DXQ A;  4KSF A;  2Q7B A;  4OAD A;  2R1I A;  5DWM A;  1MJB A;  4UFX A;  5G1Z A;  4KLV A;  1XE4 A;  4A30 A;  1KZF A;  4ZBG A;  1KUY A;  3TO9 A;  3D8P A;  1WWZ A;  3DR6 A;  3F5B A;  4BMH A;  2WSA A;  3CXP A;  4JLY A;  1J4J A;  2J8R A;  2B3U A;  4UBR A;  5CNP A;  2ZXV A;  5KTD A;  2WUU A;  4J3G A;  2F5I A;  2WPX A;  1VKC A;  3FNC A;  4FD6 A;  4A32 A;  2J8M A;  3C26 A;  1KUX A;  2Z0Z A;  4UWJ A;  3H5Z A;  5GCN A;  4CAW A;  1FY7 A;  5JQ4 A;  4NSQ A;  5F47 A;  4MFZ A;  3DR8 A;  4MBU A;  4CGP A;  1P0H A;  2QEC A;  3FYN A;  4ONU A;  3TFY A;  5I0C A;  4UFW A;  2REF A;  5HMN A;  1YR0 A;  2ARH A;  2D4P A;  2Z3K A;  2OH1 A;  2OU2 A;  4HNX B;  4XPL A;  4AVA A;  1QSM A;  2AE6 A;  2IL4 A;  3TO6 A;  5A28 A;  1S7L A;  2YND A;  2K5T A;  3DDD A;  4UCN A;  2OZH A;  1S60 A;  4KZT A;  4A95 A;  1M1D A;  2FE7 A;  4KVO E;  2FIA A;  2P0W A;  4DNC A;  3JUW A;  4QC6 A;  2NMT A;  5IV0 A;  1OZP A;  4AG9 A;  5AGE A;  2JDD A;  5G22 A;  2QML A;  3IU2 A;  1XMT A;  4NXY A;  2PC1 A;  4CGO A;  4E0A A;  2Q4V A;  2QIR A;  2I00 A;  4CGN A;  1M44 A;  1U6M A;  1XIX A;  4MI4 A;  4R3K A;  1S7F A;  3R9G A;  2Z3O A;  3GKR A;  4CGL A;  5EC4 A;  3H4Q A;  3FRM A;  1IB1 E;  2P6G A;  1B6B A;  1Z4R A;  2VQY A;  4AVB A;  4MFP A;  1NE9 A;  1RXT A;  1GHE A;  4A2Z A;  4E8O A;  4MFL A;  2BSW A;  2FT0 A;  3QB8 A;  4M3S A;  3UY5 A;  4JJX A;  3BJ7 A;  4KOW A;  4L8A A;  4NCZ A;  4UWI A;  5AG5 A;  2ZW5 A;  4H89 A;  2GIV A;  1I1D A;  4B13 A;  2YNC A;  3P2F A;  1PU9 A;  1YVK A;  3CXQ A;  3R9F A;  3V8I A;  2CXA A;  1I21 A;  4AG7 A;  4C7I A;  1XEB A;  2P6E A;  2PR8 A;  4C7H A;  4NEX A;  1IIC A;  4PSX A;  4B5O A;  5H86 A;  1S7N A;  4XPD C;  4CAX A;  4CAV A;  2VZY A;  3R96 A;  3T9Y A;  3JVN A;  3TO7 A;  2VXK A;  4MJ8 A;  1ON0 A;  3WR7 A;  2AJ6 A;  1QST A;  1S7K A;  1K4J A;  4KOV A;  3IGR A;  4M85 A;  2VZZ A;  4JXR A;  4MY0 A;  2BL1 A;  4CYN A;  4KOX A;  1PUA A;  3DSB A;  2Y0M A;  3D2M A;  3S6F A;  1I12 A;  4Y49 C;  4RS2 A;  1M4D A;  1YLE A;  3GYA A;  3PP9 A;  4IUS A;  3ZJ0 A;  2B58 A;  2J8N A;  4H6U A;  5J8F A;  3KKW A;  5KTA A;  2KCW A;  3MGD A;  4U5Y A;  2EVN A;  1CJW A;  1Q2Y A;  3BLN A;  2B5G A;  3G8W A;  4Q36 A;  4MFJ A;  4K30 A;  2PR1 A;  1YGH A;  4II9 A;  2CNS A;  2B4B A;  3CXS A;  5IX3 A;  4F6A A;  4UA3 A;  3EO4 A;  2C27 A;  5KTC A;  2Q0Y A;  4C2X A;  2OZU A;  2B5G B;  2GE3 A;  2GAN A;  1V0C A;  4CYQ A;  1L0C A;  3R95 A;  2VI7 A;  4KOR A;  5E96 A;  1QSO A;  4UFV A;  5C88 A;  4KS9 A;  2FSR A;  1QSR A;  5DWN A;  4YFJ A;  1Z4E A;  2VBQ A;  1BOB A;  3IU1 A;  4NF1 A;  1S3Z A;  4I49 A;  3E0K A;  2Z3P A;  4X5K A;  5G20 A;  4CAE A;  1XF8 A;  3EC4 A;  2JEV A;  3P2H A;  2DPT A;  2X7B A;  1NMT A;  5JPH A;  3JTK A;  3TOB A;  3EFA A;  2R8V A;  3N7Z A;  4CRY B;  1KUV A;  4QBJ A;  1Q2D A;  5F49 A;  2Z10 A;  4B12 A;  1S5K A;  3R1K A;  2FCK A;  2YNE A;  1Y7R A;  3NE7 A;  4FD4 A;  3SHP A;  3W91 A;  4MY3 A;  3W6X A;  2B3V A;  2Z3M A;  2HV2 A;  2RC4 A;  3TCV A;  4XPK A;  4B5P B;  2O28 A;  1NSL A;  4KVX A;  2BUE A;  2YGW A;  3IWE A;  4KOU A;  1UFH A;  4H6Z A;  1YVO A;  4FD7 A;  3K9U A;  4A33 A;  2D4O A;  5H84 A;  2PDO A;  3S6K A;  2BEI A;  4KVM E;  3EY5 A;  4KSA A;  1VHS A;  5HH1 A;  2ZW6 A;  3TOA A;  1SQH A;  4C68 A;  1MK4 A;  4U9Z A;  2Q04 A;  4HKF A;  3FB3 A;  4QUS A;  1Y9W A;  2JLM A;  4Q38 A;  4XNH B;  4C2Z A;  2CNT A;  5FVJ A;  3A9L A;  2CNM A;  2A4N A;  1RO5 A;  4B10 A;  1YX0 A;  3PZJ A;  4IF5 A;  2FXF A;  4JD6 A;  4B5P A;  2REE A;  3F8K A;  3D2P A;  1YRE A;  4BBH A;  4RI1 A;  2PSW A;  2EUI A;  4MHD A;  3FBU A;  2CY2 A;  2Q44 A;  1IID A;  1IYK A;  3GY9 A;  4XPD B;  2P6F A;  4KUB A;  2WPW A;  2B4D A;  3DNS A;  2DPS A;  5EBV A;  4KLW A;  2ZW7 A;  2R98 A;  4OLL A;  4MFK A;  1Z9U A;  1WK4 A;  3TT2 A;  4PSW A;  2ZW4 A;  4B11 A;  4CRZ B;  4R3L A;  4E2A A;  1BO4 A;  5A27 A;  4OAE A;  3D3S A;  4CGM A;  3B8G A;  2Q4Y A;  3TE4 A;  3FXT A;  4GS4 A;  2Z11 A;  4R57 A;  5F46 A;  2PRB A;  2H5M A;  3G3S A;  2JDC A;  4KOT A;  2ZPA A;  4F0Y A;  4QVT A;  4LUA A;  4CYP A;  1R57 A;  2Z3N A;  4R9M A;  2R7H A;  4CAF A;  5IB0 A;  2G0B A;  4YGO A;  4HNY B;  5J8C A;  1CM0 A;  4A31 A;  5AG7 A;  2OB0 A;  1B87 A;  4R87 A;  2G3T A;  4C2Y A;  1M4G A;  5G21 A;  4CYO A;  3PGP A;  3LD2 A;  4Y49 B;  4MFQ A;  2HUZ A;  5AG6 A;  4KOS A;  4KUA A;  2YNC C;  4ORF A;  2Z3L A;  4UCP A;  3QAH A;  3R9E A;  5BWA B;  4XNH C;  3I3G A;  4B14 A;  2PQ8 A;  1YK3 A;  4FD5 A;  5C82 A;  4ZGY B;  1QSN A;  4QB9 A;  2I79 A;  5AG4 A;  1P4N A;  3F0A A;  1MJ9 A;  3VWE A;  2VEZ A;  1MJA A;  4PK3 A;  4L89 A;  3S6G A;  3SXO A;  2ATR A;  3W6S A;  2FL4 A;  4EVY A;  3BJ8 A;  3S6H A;  4KOY A;  3T90 A;  4PK2 A;  1ZO0 A;  1LRZ A;  3FIX A;  2G3A A;  4LX9 A;  5F48 A;  2FS5 A;  4JWP A;  1Q2C A;  2B4D B;  1N71 A;  3OWC A;  3LOD A;  4HNW B;  4PV6 A;  3IWG A;  4JXQ A;  4AB7 A;  4F0X A;  2FIW A;  4U9Y A;  3VWD A;  4CS0 B;  3ZZI A;  3EXN A;  4AVC A;  1IYL A;  4YRH A;  5ISV A;  3RYO A;  3I9S A;  1Y9K A;  1M4I A;  4UCM A;  1TIQ A;  2HQY A;  3SXN A;  2OZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...