5A27A

Leishmania major n-myristoyltransferase in complex with a chlorophenyl 1,2,4-oxadiazole inhibitor.
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of High Affinity Inhibitors of Leishmania Donovani N-Myristoyltransferase.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 130
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5a27A00
4CGMA 4A32A 4UFXA 5AGEA 4BBHA 4CGPA 5G21A 4A31A 4CGOA 5A27A 3IU2A 2WSAA 4CAFA 4C2ZA 4B11A 4UFWA 2YNEA 4C7IA 4CYOA 4UFVA 4A2ZA 4A30A 5AG4A 4B10A 2YNCA 4C68A 4CGLA 4C2XA 3H5ZA 4UCPA 5AG7A 2WUUA 4B12A 4UCNA 5AG6A 4CYNA 2YNDA 3IWEA 5AG5A 4CYPA 5G22A 2YNCC 4A95A 4C7HA 3IU1A 5G1ZA 4B14A 5A28A 5G20A 3JTKA 4CGNA 4A33A 4C2YA 4UCMA 4CYQA 4B13A 4CAEA
chains in the Genus database with same CATH superfamily
2GU2A 5CNPA 4YGOA 4R3LA 2R98A 4MJ8A 2XEIA 3PGPA 4FBEA 4C2ZA 3FYNA 3NH8A 4AG9A 2Z3NA 4P10A 4KZTA 2DXQA 4UIAA 2IMOA 3BJ8A 2B3VA 2PJAA 4NF1A 4R8FA 2P6EA 4KOWA 2PIYA 4PQAA 2CXAA 3K9TA 2FVGA 4ZY0A 3RAMA 2R7HA 3D2PA 1TF9A 5ISVA 4RUHA 2OZGA 1XOVA 2QMLA 3D66A 4GXHA 2C1CA 2EK8A 3FEDA 3B3TA 3TO6A 1TKFA 4OC4A 4KOXA 2ZELA 4M85A 1FT7A 2Q7SA 4IK2A 5HVGA 4F8ZA 1RXTA 2F8HA 3KHZA 1VHSA 4JJXA 1VHEA 2NSMA 3B8GA 4H6UA 3I1UA 2ZW4A 2IQ6A 4QBJA 1QSMA 1XRYA 1K4JA 4GS4A 1Z8WA 2PIZA 3LMSA 4CGLA 1Z4EA 4MFZA 4ZX9A 1Y9KA 2PJ1A 2JBJA 1Y0RA 5IX3A 2B58A 4UIBA 2FSRA 1CJWA 2PRBA 4R76A 2Q0YA 1TKHA 4CYPA 3MN8A 1I12A 1IGBA 3N5FA 4OIWA 5LRKA 2ODFA 4NJRA 2PSWA 3NE7A 2QECA 3BJ7A 4XPKA 1IB1E 2IL4A 4MFKA 3D2MA 3KASA 2PRQA 4QC6A 3DDDA 4MHYA 4BINA 2CNTA 4KOYA 1UFHA 2CNSA 4JXRA 3RNZA 1XE4A 3D8PA 1QQ9A 5EC4A 5C88A 1WWZA 2Z3OA 3WABA 3I9SA 4I49A 4NXYA 1BAVA 2D4PA 3H8GA 1YK3A 2FCKA 1XMBA 3D3SA 1M4DA 3S6FA 3F8KA 4OMEA 3CDXA 2G3TA 4UEEA 1CPSA 3R9EA 2WPXA 4KUAA 4KVME 4FAIA 3EC4A 3DLJA 3K2KA 5F47A 2YNCC 2I00A 4C7HA 2O28A 5G1ZA 2BSWA 1B87A 3KKWA 1HEEA 4G1PA 4AB7A 3P2FA 4P44A 1YLEA 4ONUA 4KSIA 4NGPA 3VWDA 4WJBA 2Z3KA 4B5PA 3HLPA 3SI2A 2DEAA 1Z8XA 4EWTA 2PR1A 1TF8A 2PJBA 3NA6A 5D29A 1NSAA 4MHPA 1GHEA 2BOAA 1GYTA 2PJ2A 4NGMA 1YVKA 2RB7A 5J8FA 2J8MA 3PB9X 2JBKA 1Y7EA 1YR0A 3TOAA 3PP9A 5J8CA 5LRGA 3DR6A 4RN7A 3ZZIA 2DF5A 1S7NA 1AYEA 4UA3A 1HDUA 1YREA 2PJ6A 5F48A 1JWQA 5JM6A 2REEA 1KZFA 3B3VA 1LANA 3IU1A 3LWUA 4PPZA 3VWEA 4HKFA 4DJLA 2OZUA 1M1DA 1TXRA 1V0CA 3GKRA 3LACA 4PXEA 3PB8X 4NGQA 4MHZA 5JH9A 3FX6A 2VL1A 1IY7A 5ELYA 3TE4A 1I21A 3FVLA 4IAVA 4UFXA 4DUKA 3TTHA 1ZLHA 3B3SA 3C26A 3D67A 5H84A 4CGPA 1ARLA 3CPXA 5A27A 1M44A 3BI1A 1R3NA 1JQGA 3OWCA 1IICA 1UWYA 2EVNA 4NGRA 4ZY2A 3S6KA 1Q2YA 1Q7LA 4OIDA 3S6HA 4KSAA 2C27A 4P4DA 1XBUA 4ONWA 5LYDA 4ZBGA 2PJ4A 2B5GA 4IUSA 2GANA 3JVNA 2PJCA 3S9MA 2IJZA 3KR5A 4P4FA 4B6ZA 4KSFA 4Q38A 2VXKA 3GB0A 2JDDA 1IOFA 1BLLE 3LD2A 2PDOA 1ZG7A 2EUIA 4QVTA 2CNMA 5C82A 4KOUA 4B13A 2EBJA 2ZW6A 1VIXA 2GE3A 4QUSA 3H8EA 2V8DA 3VATA 4CPAA 4KVOE 1DE4C 1VKCA 4II9A 1XMTA 4Q36A 1A2ZA 2Q04A 4FD7A 4ZY1A 1Z2LA 4KORA 3V38A 4BMHA 3B7IA 3ISXA 4ZYQA 2I3CA 1CM0A 2CIJA 3GLJA 3PB7X 3QAHA 5K8NA 4ZX8A 1L0CA 4NCZA 4NGNA 3K9UA 3BHXA 1ELMP 2FL4A 3E0KA 3FJUA 3CXPA 3IWGA 4KOVA 1S60A 4HNYB 4E8OA 2QIRA 5DWNA 1Z8TA 1XF8A 4OP4A 4WWVA 3F5BA 4CYQA 1MJBA 3LODA 2J9AA 2C6PA 3VH9A 3CXSA 2AFWA 1CP7A 2V8HA 3PBEA 4CGMA 1PUAA 2ZW5A 3F0AA 3UY5A 3R95A 2AFMA 3PBBA 2Z10A 2GREA 2Q7BA 1BOBA 2AFSA 2D4OA 4R9MA 4KS9A 3BLNA 2B4DA 3SJXA 2JEVA 1S7LA 3CZXA 1R57A 1Z4RA 1AUGA 3KQXA 2JDCA 4UCPA 3JRUA 2K5TA 4CAWA 3A9LA 1NE9A 2AFXA 5DS0A 2WPWA 1QMUA 2XEGA 3EFAA 3EXNA 5EBVA 4ZI6A 3CXQA 1WK4A 4P45A 1QSNA 2FE7A 3I3GA 4MBUA 1Q2CA 3B35A 1Y0YA 1B6BA 4CGNA 1Y7RA 3FRMA 4JXQA 4MY0A 2HB6A 4MFLA 2Z3PA 3L2NA 4UCMA 4U9ZA 5IB0A 3B2YA 4FWUA 1TKJA 2B3UA 3IGRA 3NH5A 3PZJA 1YGHA 4UFVA 4A2ZA 2NMTA 3FBUA 3IC1A 4MMOA 1LCPA 3IFEA 4Q7AA 4AVCA 4IHMA 1OBRA 2FIAA 2V8GA 3DNSA 4KOTA 2ZEPA 1HDQA 4UCNA 1ELLP 1DTDA 3W6XA 4CYNA 5H86A 1ARMA 2Q44A 3FB3A 2PCUA 4K3NA 3TCVA 3JUWA 3W91A 1LFWA 2YGWA 3FMCA 3SJFA 4PSWA 3R9FA 1IIDA 4HPSA 3WT4A 4Z65A 2CF4A 3SI1A 2OH1A 2PJ0A 3S6GA 1IYKA 4JZ0A 4P4IA 1BO4A 2B5GB 3D4UA 3KL9A 4CAEA 2JLMA 1FNOA 5AGEA 3FXTA 4H2KA 2R1IA 3P2HA 4IF5A 2WSAA 4A94A 2BL1A 4R7MA 2VQYA 7CPAA 4ORFA 1LRZA 5AG4A 2ATRA 4PXCA 1R43A 2CTBA 4B10A 4U9YA 4CAXA 3FIXA 2J8NA 4GM5A 4NJQA 2I79A 1YW4A 4B12A 3FH4A 2RC4A 2P6FA 2GFQA 2ZEFA 1U6MA 1P4NA 2ZEMA 5HH1A 4R87A 5G22A 5IB9A 3TT2A 2GLFA 4AXVA 4RI1A 3S9NA 5CPAA 3D7DA 5A28A 2PJ9A 2PJ3A 2ARHA 2PVVA 2VEZA 2Z0ZA 3JTKA 1OZPA 4A38A 2G9DA 2C6GA 3DGVA 4L89A 2HQYA 4C2YA 2VI7A 2F7VA 4FD6A 4R57A 8CPAA 4Y49C 3ISZA 2HV2A 4A39A 5JQ4A 4YU9A 3RZAA 4EMEA 2GIVA 5D8NA 2OOTA 2B4BA 5K8PA 4M6IA 1BPNA 5F09A 3T90A 2VZZA 1H8LA 2CTCA 2ABZA 5KTAA 3TX8A 2Y0MA 2J8RA 5HMNA 4H89A 3PEIA 1ON0A 2ZXVA 3QNVA 1F57A 2BO9A 3PB6X 4O23A 2PC1A 3PFEA 2FXFA 3NH4A 4UF4A 1IOIA 3PFOA 5THWA 2AFOA 4B11A 2QVPA 2EWBA 3KQZA 4JYWA 4MHDA 1MJ9A 1Q2DA 2FT0A 2FIWA 5LRJA 1F2PA 2XEJA 4AG7A 4CS0B 5BWAB 5K8MA 1VHOA 1MK4A 5HXDA 1KUXA 2AFUA 2REFA 3IWWA 4CGOA 4OC2A 3QAYA 4HNXB 5J1QA 4CAFA 1P0HA 5F49A 4X8IA 5DWMA 1ZLIA 3IEHA 4CRZB 4LX9A 1ZG9A 4LQ6A 4A30A 3V7ZA 1N71A 3H5ZA 5AG7A 2WUUA 3T9YA 3SHPA 3KI9A 4F9VA 2ZW7A 3SJGA 4DNCA 2PE3A 1J4JA 5FVJA 1LAMA 4KLWA 5I4MA 4MFQA 1Z5RA 3D7FA 4YRHA 3EO4A 2V77A 1RTQA 1YMEA 2PJ5A 4FUUA 4F6AA 2ZEEA 1IU8A 2X7BA 2HUZA 1M4LA 3KGQA 4BBHA 4KOSA 3TOBA 4A31A 1YQEA 2Z3LA 3DR8A 1YSJA 4Y49B 4JWPA 3GYAA 1M4IA 3W6SA 3GUXA 3WC7A 3RO0A 4P4EA 3SXNA 4A37A 1Y9WA 3SXOA 3TFYA 1RO5A 4EFDA 3KR4A 4C2XA 3H4QA 1FY7A 4AVAA 1CBXA 1BPMA 5AG6A 3SI0A 2AFZA 1S5KA 4OLLA 4B5PB 4U5YA 4E2AA 1S7FA 2VBQA 2KCWA 5CBMA 4UEZA 4A95A 4R6TA 4BD9A 4YFJA 3NFZA 4OKOA 3V8IA 5HVHA 5G20A 3ZJ0A 4CAVA 4XNHC 4XPDC 3SJEA 1S3ZA 5KTDA 4MXUA 4ZGYB 2QYVA 2BEIA 2BCOA 4W9YA 2P6GA 6CPAA 4PK2A 5G21A 3IU2A 2OU2A 2Q4VA 3B3CA 4PXDA 4M6HA 4MHNA 4JLYA 2WZNA 4UFWA 2OZHA 2DPTA 2ZPAA 3TC8A 4MY3A 4CYOA 3NE8A 1SQHA 2YNCA 2NYQA 4PSXA 2POKA 1YX0A 2VZYA 4R3KA 3H8FA 1S7KA 2PJ8A 3D7HA 2GLJA 3WC6A 2ZOFA 1PCAA 4F0XA 5HVFA 5JPHA 2ANPA 2EK9A 4F0YA 2ZEHA 5IV0A 3EY5A 3IO1A 4LQGA 2G3AA 3WR7A 1KUYA 4JD6A 4E0AA 1Z8LA 5K8OA 3S9LA 4NSQA 2Q43A 1CG2A 4MFJA 5JGFA 1NMTA 1QSOA 1YLOA 3GIUA 3PB4X 4P6YA 3HUVA 5LYIA 2PQ8A 4OAEA 4MRIA 3B3WA 3GY9A 1CX8A 4P4JA 1QSTA 3KZWA 3FECA 3IJ3A 5E96A 1EE3P 1F2OA 4QB9A 4C68A 3MRUA 2ZOGA 3R1KA 1X10A 4PK3A 1NSLA 3RBUA 3R96A 2RFHA 1MJAA 3CPAA 4NGSA 4MFPA 4YWYA 3G8WA 2ZEOA 2Z3MA 4AVBA 2O4HA 1QSRA 5KTCA 1ZO0A 1KWMA 2AE6A 3MGDA 2BUEA 4UWIA 4B14A 4P4BA 2ZENA 4UBRA 4UWJA 5F46A 2OB0A 4F9UA 2H5MA 1PU9A 4DYOA 1X12A 4NGTA 4XNHB 4XPDB 5I0CA 4X2TA 3FF3A 2PJ7A 2ZEGA 1XIXA 3T8WA 2A4NA 3IIBA 4KLVA 4C7IA 1Z9UA 1M4GA 4B5OA 1YW6A 2O53A 3N7ZA 3PRTA 1LOKA 4RS2A 4HNWB 3FEEA 1LAPA 4LUAA 1AMPA 4M3SA 1VGYA 4L8AA 3R9GA 4X3RA 4MI4A 2OR4A 3BXMA 4J3GA 4NFRA 4OC5A 2YNDA 1PYTB 2P0WA 2QJ8A 2PVWA 3KHXA 1XFOA 2FS5A 1XEBA 2PR8A 4OADA 2B4DB 2Z11A 4FD4A 4OC0A 2Q51A 3VARA 1CPXA 3FNCA 1YVOA 2AJ6A 2XEFA 4XPLA 2DPSA 2CY2A 2G0BA 2ZEDA 4FD5A 4MCRA 1XJOA 3D7GA 5LYFA 4A32A 4K30A 1I1DA 3D68A 3TO7A 2Q4ZA 3CT9A 1CP6A 4OC3A 4M6GA 5LYLA 1TIQA 4KVXA 4TWEA 2YNEA 4MCPA 4EVYA 4MCQA 3G3SA 4MCSA 1KUVA 2HC9A 1ZG8A 4NEXA 3IWEA 3TO9A 3QB8A 2WYRA 3BI0A 2JEWA 4UEFA 5AG5A 3RYOA 4PXBA 2EO8A 4H6ZA 2F5IA 5EMIA 2C6CA 3DSBA 4X5KA 3WC5A 2V8VA 1IYLA 4KUBA 4A33A 4PV6A 4TNUA 4CRYB 2R8VA 5GCNA 2Q4YA 4OC1A
chains in the Genus database with same CATH topology
4YGOA 4R3LA 2R98A 4MJ8A 3PGPA 4C2ZA 3FYNA 4AG9A 2Z3NA 4KZTA 2DXQA 3BJ8A 2B3VA 4NF1A 2P6EA 4KOWA 2CXAA 2R7HA 3D2PA 5ISVA 2OZGA 2QMLA 3TO6A 4KOXA 4M85A 1RXTA 1VHSA 4JJXA 3B8GA 4H6UA 4QBJA 2ZW4A 1QSMA 4GS4A 1K4JA 4CGLA 1Z4EA 4MFZA 1Y9KA 5IX3A 2B58A 2FSRA 1CJWA 2PRBA 2Q0YA 4CYPA 1I12A 2PSWA 3NE7A 2QECA 3BJ7A 4XPKA 1IB1E 2IL4A 4MFKA 3D2MA 4QC6A 3DDDA 2CNTA 4KOYA 1UFHA 2CNSA 4JXRA 1XE4A 3D8PA 5EC4A 5C88A 1WWZA 2Z3OA 3I9SA 4I49A 4NXYA 2D4PA 1YK3A 2FCKA 3D3SA 1M4DA 3S6FA 3F8KA 3R9EA 5KTCA 2G3TA 2WPXA 4KUAA 4KVME 3EC4A 5F47A 2YNCC 2I00A 4C7HA 2O28A 5G1ZA 2BSWA 1B87A 3KKWA 4AB7A 3P2FA 1YLEA 4ONUA 3VWDA 2Z3KA 4B5PA 2PR1A 1GHEA 1YVKA 5J8FA 2J8MA 1YR0A 3TOAA 3PP9A 5J8CA 3DR6A 3ZZIA 1S7NA 4UA3A 1YREA 5F48A 2REEA 1KZFA 3VWEA 3IU1A 4HKFA 2OZUA 1M1DA 1V0CA 3GKRA 3TE4A 1I21A 4UFXA 3TTHA 3C26A 5H84A 4CGPA 5A27A 1M44A 3OWCA 1IICA 4B11A 2EVNA 3S6KA 1Q2YA 3S6HA 4KSAA 2C27A 4ZBGA 4IUSA 2B5GA 2GANA 3JVNA 4KSFA 4Q38A 2VXKA 2JDDA 3LD2A 2PDOA 2EUIA 4QVTA 2CNMA 5C82A 4KOUA 4B13A 2ZW6A 2GE3A 4QUSA 4KVOE 1VKCA 4II9A 1XMTA 4Q36A 2Q04A 4FD7A 4KORA 4BMHA 1CM0A 3QAHA 1L0CA 4NCZA 3K9UA 2FL4A 3E0KA 3IWGA 3CXPA 4KOVA 1S60A 4HNYB 4E8OA 2QIRA 5DWNA 1XF8A 3F5BA 4CYQA 1MJBA 3LODA 3CXSA 4CGMA 1PUAA 2ZW5A 3F0AA 3UY5A 3R95A 2Z10A 2Q7BA 1BOBA 2D4OA 4R9MA 4KS9A 3BLNA 2B4DA 2JEVA 1S7LA 1R57A 1Z4RA 4UCPA 2JDCA 2K5TA 4CAWA 3A9LA 1NE9A 2WPWA 5EBVA 3EFAA 3EXNA 3CXQA 1WK4A 1QSNA 2FE7A 3I3GA 4MBUA 1Q2CA 1B6BA 4CGNA 1Y7RA 3FRMA 4JXQA 4MY0A 4UCMA 4MFLA 2Z3PA 4U9ZA 5IB0A 3IGRA 2B3UA 3PZJA 1YGHA 4UFVA 4A2ZA 2NMTA 3FBUA 4AVCA 2FIAA 3DNSA 4KOTA 4UCNA 5CNPA 3W6XA 4CYNA 5H86A 2Q44A 3FB3A 3TCVA 3JUWA 3W91A 2YGWA 4PSWA 3R9FA 1IIDA 2OH1A 3S6GA 1IYKA 1BO4A 2B5GB 4CAEA 2JLMA 5AGEA 3FXTA 2R1IA 3P2HA 4IF5A 2WSAA 2BL1A 2VQYA 4ORFA 1LRZA 5AG4A 2ATRA 4B10A 4U9YA 4CAXA 3FIXA 2J8NA 2I79A 4B12A 2RC4A 2P6FA 1U6MA 1P4NA 5HH1A 4R87A 5G22A 3TT2A 4RI1A 5A28A 2ARHA 2VEZA 2Z0ZA 3JTKA 1OZPA 4C2YA 4L89A 2HQYA 2VI7A 4FD6A 4R57A 4Y49C 5JQ4A 2HV2A 2GIVA 2B4BA 3T90A 2VZZA 5KTAA 2Y0MA 2J8RA 5HMNA 4H89A 1ON0A 2ZXVA 2PC1A 2FXFA 4MHDA 1MJ9A 1Q2DA 2FT0A 2FIWA 4AG7A 5BWAB 4CS0B 1MK4A 1KUXA 2REFA 4CGOA 4HNXB 4CAFA 1P0HA 5F49A 5DWMA 4CRZB 4LX9A 4A30A 1N71A 3H5ZA 5AG7A 2WUUA 3T9YA 3SHPA 2ZW7A 4DNCA 1J4JA 5FVJA 4KLWA 4MFQA 4YRHA 3EO4A 4F6AA 2X7BA 2HUZA 4BBHA 4KOSA 3TOBA 4A31A 2Z3LA 3DR8A 4Y49B 4JWPA 3GYAA 1M4IA 3W6SA 3SXNA 3TFYA 1Y9WA 3SXOA 1RO5A 4C2XA 3H4QA 1FY7A 4AVAA 5AG6A 1S5KA 4OLLA 4B5PB 4U5YA 4E2AA 1S7FA 2VBQA 2KCWA 4A95A 4YFJA 3V8IA 5G20A 3ZJ0A 4CAVA 4XNHC 4XPDC 1S3ZA 5KTDA 4ZGYB 2BEIA 2P6GA 4PK2A 5G21A 3IU2A 2OU2A 2Q4VA 4JLYA 4UFWA 2OZHA 2DPTA 2ZPAA 4CYOA 4MY3A 1SQHA 2YNCA 4PSXA 1YX0A 2VZYA 4R3KA 1S7KA 4F0XA 5JPHA 4F0YA 5IV0A 3EY5A 3WR7A 2G3AA 1KUYA 4JD6A 4E0AA 4NSQA 4MFJA 1NMTA 1QSOA 2PQ8A 4OAEA 3GY9A 1QSTA 5E96A 4QB9A 4C68A 3R1KA 1NSLA 4PK3A 3R96A 1MJAA 4MFPA 3G8WA 4AVBA 2Z3MA 1QSRA 1ZO0A 2AE6A 3MGDA 2BUEA 4UWIA 4B14A 4UBRA 4UWJA 5F46A 2OB0A 2H5MA 1PU9A 4XNHB 4XPDB 5I0CA 1XIXA 2A4NA 4KLVA 4C7IA 1Z9UA 1M4GA 4B5OA 3N7ZA 4RS2A 4HNWB 4LUAA 4M3SA 3R9GA 4L8AA 4MI4A 4J3GA 2YNDA 2P0WA 2FS5A 1XEBA 2PR8A 4OADA 2B4DB 2Z11A 4FD4A 3FNCA 1YVOA 2AJ6A 4XPLA 2DPSA 2CY2A 2G0BA 4FD5A 4A32A 4K30A 1I1DA 3TO7A 1TIQA 4KVXA 2YNEA 4EVYA 3G3SA 1KUVA 4NEXA 3IWEA 3TO9A 3QB8A 5AG5A 3RYOA 4H6ZA 2F5IA 3DSBA 4X5KA 1IYLA 4KUBA 4A33A 4PV6A 4CRYB 2R8VA 5GCNA 2Q4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGM A;  4A32 A;  4UFX A;  5AGE A;  4BBH A;  4CGP A;  5G21 A;  4A31 A;  4CGO A;  5A27 A;  3IU2 A;  2WSA A;  4CAF A;  4C2Z A;  4B11 A;  4UFW A;  2YNE A;  4C7I A;  4CYO A;  4UFV A;  4A2Z A;  4A30 A;  5AG4 A;  4B10 A;  2YNC A;  4C68 A;  4CGL A;  4C2X A;  3H5Z A;  4UCP A;  5AG7 A;  2WUU A;  4B12 A;  4UCN A;  5AG6 A;  4CYN A;  2YND A;  3IWE A;  5AG5 A;  4CYP A;  5G22 A;  2YNC C;  4A95 A;  4C7H A;  3IU1 A;  5G1Z A;  4B14 A;  5A28 A;  5G20 A;  3JTK A;  4CGN A;  4A33 A;  4C2Y A;  4UCM A;  4CYQ A;  4B13 A;  4CAE A; 
#chains in the Genus database with same CATH topology
 2GU2 A;  5CNP A;  4YGO A;  4R3L A;  2R98 A;  4MJ8 A;  2XEI A;  3PGP A;  4FBE A;  4C2Z A;  3FYN A;  3NH8 A;  4AG9 A;  2Z3N A;  4P10 A;  4KZT A;  2DXQ A;  4UIA A;  2IMO A;  3BJ8 A;  2B3V A;  2PJA A;  4NF1 A;  4R8F A;  2P6E A;  4KOW A;  2PIY A;  4PQA A;  2CXA A;  3K9T A;  2FVG A;  4ZY0 A;  3RAM A;  2R7H A;  3D2P A;  1TF9 A;  5ISV A;  4RUH A;  2OZG A;  1XOV A;  2QML A;  3D66 A;  4GXH A;  2C1C A;  2EK8 A;  3FED A;  3B3T A;  3TO6 A;  1TKF A;  4OC4 A;  4KOX A;  2ZEL A;  4M85 A;  1FT7 A;  2Q7S A;  4IK2 A;  5HVG A;  4F8Z A;  1RXT A;  2F8H A;  3KHZ A;  1VHS A;  4JJX A;  1VHE A;  2NSM A;  3B8G A;  4H6U A;  3I1U A;  2ZW4 A;  2IQ6 A;  4QBJ A;  1QSM A;  1XRY A;  1K4J A;  4GS4 A;  1Z8W A;  2PIZ A;  3LMS A;  4CGL A;  1Z4E A;  4MFZ A;  4ZX9 A;  1Y9K A;  2PJ1 A;  2JBJ A;  1Y0R A;  5IX3 A;  2B58 A;  4UIB A;  2FSR A;  1CJW A;  2PRB A;  4R76 A;  2Q0Y A;  1TKH A;  4CYP A;  3MN8 A;  1I12 A;  1IGB A;  3N5F A;  4OIW A;  5LRK A;  2ODF A;  4NJR A;  2PSW A;  3NE7 A;  2QEC A;  3BJ7 A;  4XPK A;  1IB1 E;  2IL4 A;  4MFK A;  3D2M A;  3KAS A;  2PRQ A;  4QC6 A;  3DDD A;  4MHY A;  4BIN A;  2CNT A;  4KOY A;  1UFH A;  2CNS A;  4JXR A;  3RNZ A;  1XE4 A;  3D8P A;  1QQ9 A;  5EC4 A;  5C88 A;  1WWZ A;  2Z3O A;  3WAB A;  3I9S A;  4I49 A;  4NXY A;  1BAV A;  2D4P A;  3H8G A;  1YK3 A;  2FCK A;  1XMB A;  3D3S A;  1M4D A;  3S6F A;  3F8K A;  4OME A;  3CDX A;  2G3T A;  4UEE A;  1CPS A;  3R9E A;  2WPX A;  4KUA A;  4KVM E;  4FAI A;  3EC4 A;  3DLJ A;  3K2K A;  5F47 A;  2YNC C;  2I00 A;  4C7H A;  2O28 A;  5G1Z A;  2BSW A;  1B87 A;  3KKW A;  1HEE A;  4G1P A;  4AB7 A;  3P2F A;  4P44 A;  1YLE A;  4ONU A;  4KSI A;  4NGP A;  3VWD A;  4WJB A;  2Z3K A;  4B5P A;  3HLP A;  3SI2 A;  2DEA A;  1Z8X A;  4EWT A;  2PR1 A;  1TF8 A;  2PJB A;  3NA6 A;  5D29 A;  1NSA A;  4MHP A;  1GHE A;  2BOA A;  1GYT A;  2PJ2 A;  4NGM A;  1YVK A;  2RB7 A;  5J8F A;  2J8M A;  3PB9 X;  2JBK A;  1Y7E A;  1YR0 A;  3TOA A;  3PP9 A;  5J8C A;  5LRG A;  3DR6 A;  4RN7 A;  3ZZI A;  2DF5 A;  1S7N A;  1AYE A;  4UA3 A;  1HDU A;  1YRE A;  2PJ6 A;  5F48 A;  1JWQ A;  5JM6 A;  2REE A;  1KZF A;  3B3V A;  1LAN A;  3IU1 A;  3LWU A;  4PPZ A;  3VWE A;  4HKF A;  4DJL A;  2OZU A;  1M1D A;  1TXR A;  1V0C A;  3GKR A;  3LAC A;  4PXE A;  3PB8 X;  4NGQ A;  4MHZ A;  5JH9 A;  3FX6 A;  2VL1 A;  1IY7 A;  5ELY A;  3TE4 A;  1I21 A;  3FVL A;  4IAV A;  4UFX A;  4DUK A;  3TTH A;  1ZLH A;  3B3S A;  3C26 A;  3D67 A;  5H84 A;  4CGP A;  1ARL A;  3CPX A;  5A27 A;  1M44 A;  3BI1 A;  1R3N A;  1JQG A;  3OWC A;  1IIC A;  1UWY A;  2EVN A;  4NGR A;  4ZY2 A;  3S6K A;  1Q2Y A;  1Q7L A;  4OID A;  3S6H A;  4KSA A;  2C27 A;  4P4D A;  1XBU A;  4ONW A;  5LYD A;  4ZBG A;  2PJ4 A;  2B5G A;  4IUS A;  2GAN A;  3JVN A;  2PJC A;  3S9M A;  2IJZ A;  3KR5 A;  4P4F A;  4B6Z A;  4KSF A;  4Q38 A;  2VXK A;  3GB0 A;  2JDD A;  1IOF A;  1BLL E;  3LD2 A;  2PDO A;  1ZG7 A;  2EUI A;  4QVT A;  2CNM A;  5C82 A;  4KOU A;  4B13 A;  2EBJ A;  2ZW6 A;  1VIX A;  2GE3 A;  4QUS A;  3H8E A;  2V8D A;  3VAT A;  4CPA A;  4KVO E;  1DE4 C;  1VKC A;  4II9 A;  1XMT A;  4Q36 A;  1A2Z A;  2Q04 A;  4FD7 A;  4ZY1 A;  1Z2L A;  4KOR A;  3V38 A;  4BMH A;  3B7I A;  3ISX A;  4ZYQ A;  2I3C A;  1CM0 A;  2CIJ A;  3GLJ A;  3PB7 X;  3QAH A;  5K8N A;  4ZX8 A;  1L0C A;  4NCZ A;  4NGN A;  3K9U A;  3BHX A;  1ELM P;  2FL4 A;  3E0K A;  3FJU A;  3CXP A;  3IWG A;  4KOV A;  1S60 A;  4HNY B;  4E8O A;  2QIR A;  5DWN A;  1Z8T A;  1XF8 A;  4OP4 A;  4WWV A;  3F5B A;  4CYQ A;  1MJB A;  3LOD A;  2J9A A;  2C6P A;  3VH9 A;  3CXS A;  2AFW A;  1CP7 A;  2V8H A;  3PBE A;  4CGM A;  1PUA A;  2ZW5 A;  3F0A A;  3UY5 A;  3R95 A;  2AFM A;  3PBB A;  2Z10 A;  2GRE A;  2Q7B A;  1BOB A;  2AFS A;  2D4O A;  4R9M A;  4KS9 A;  3BLN A;  2B4D A;  3SJX A;  2JEV A;  1S7L A;  3CZX A;  1R57 A;  1Z4R A;  1AUG A;  3KQX A;  2JDC A;  4UCP A;  3JRU A;  2K5T A;  4CAW A;  3A9L A;  1NE9 A;  2AFX A;  5DS0 A;  2WPW A;  1QMU A;  2XEG A;  3EFA A;  3EXN A;  5EBV A;  4ZI6 A;  3CXQ A;  1WK4 A;  4P45 A;  1QSN A;  2FE7 A;  3I3G A;  4MBU A;  1Q2C A;  3B35 A;  1Y0Y A;  1B6B A;  4CGN A;  1Y7R A;  3FRM A;  4JXQ A;  4MY0 A;  2HB6 A;  4MFL A;  2Z3P A;  3L2N A;  4UCM A;  4U9Z A;  5IB0 A;  3B2Y A;  4FWU A;  1TKJ A;  2B3U A;  3IGR A;  3NH5 A;  3PZJ A;  1YGH A;  4UFV A;  4A2Z A;  2NMT A;  3FBU A;  3IC1 A;  4MMO A;  1LCP A;  3IFE A;  4Q7A A;  4AVC A;  4IHM A;  1OBR A;  2FIA A;  2V8G A;  3DNS A;  4KOT A;  2ZEP A;  1HDQ A;  4UCN A;  1ELL P;  1DTD A;  3W6X A;  4CYN A;  5H86 A;  1ARM A;  2Q44 A;  3FB3 A;  2PCU A;  4K3N A;  3TCV A;  3JUW A;  3W91 A;  1LFW A;  2YGW A;  3FMC A;  3SJF A;  4PSW A;  3R9F A;  1IID A;  4HPS A;  3WT4 A;  4Z65 A;  2CF4 A;  3SI1 A;  2OH1 A;  2PJ0 A;  3S6G A;  1IYK A;  4JZ0 A;  4P4I A;  1BO4 A;  2B5G B;  3D4U A;  3KL9 A;  4CAE A;  2JLM A;  1FNO A;  5AGE A;  3FXT A;  4H2K A;  2R1I A;  3P2H A;  4IF5 A;  2WSA A;  4A94 A;  2BL1 A;  4R7M A;  2VQY A;  7CPA A;  4ORF A;  1LRZ A;  5AG4 A;  2ATR A;  4PXC A;  1R43 A;  2CTB A;  4B10 A;  4U9Y A;  4CAX A;  3FIX A;  2J8N A;  4GM5 A;  4NJQ A;  2I79 A;  1YW4 A;  4B12 A;  3FH4 A;  2RC4 A;  2P6F A;  2GFQ A;  2ZEF A;  1U6M A;  1P4N A;  2ZEM A;  5HH1 A;  4R87 A;  5G22 A;  5IB9 A;  3TT2 A;  2GLF A;  4AXV A;  4RI1 A;  3S9N A;  5CPA A;  3D7D A;  5A28 A;  2PJ9 A;  2PJ3 A;  2ARH A;  2PVV A;  2VEZ A;  2Z0Z A;  3JTK A;  1OZP A;  4A38 A;  2G9D A;  2C6G A;  3DGV A;  4L89 A;  2HQY A;  4C2Y A;  2VI7 A;  2F7V A;  4FD6 A;  4R57 A;  8CPA A;  4Y49 C;  3ISZ A;  2HV2 A;  4A39 A;  5JQ4 A;  4YU9 A;  3RZA A;  4EME A;  2GIV A;  5D8N A;  2OOT A;  2B4B A;  5K8P A;  4M6I A;  1BPN A;  5F09 A;  3T90 A;  2VZZ A;  1H8L A;  2CTC A;  2ABZ A;  5KTA A;  3TX8 A;  2Y0M A;  2J8R A;  5HMN A;  4H89 A;  3PEI A;  1ON0 A;  2ZXV A;  3QNV A;  1F57 A;  2BO9 A;  3PB6 X;  4O23 A;  2PC1 A;  3PFE A;  2FXF A;  3NH4 A;  4UF4 A;  1IOI A;  3PFO A;  5THW A;  2AFO A;  4B11 A;  2QVP A;  2EWB A;  3KQZ A;  4JYW A;  4MHD A;  1MJ9 A;  1Q2D A;  2FT0 A;  2FIW A;  5LRJ A;  1F2P A;  2XEJ A;  4AG7 A;  4CS0 B;  5BWA B;  5K8M A;  1VHO A;  1MK4 A;  5HXD A;  1KUX A;  2AFU A;  2REF A;  3IWW A;  4CGO A;  4OC2 A;  3QAY A;  4HNX B;  5J1Q A;  4CAF A;  1P0H A;  5F49 A;  4X8I A;  5DWM A;  1ZLI A;  3IEH A;  4CRZ B;  4LX9 A;  1ZG9 A;  4LQ6 A;  4A30 A;  3V7Z A;  1N71 A;  3H5Z A;  5AG7 A;  2WUU A;  3T9Y A;  3SHP A;  3KI9 A;  4F9V A;  2ZW7 A;  3SJG A;  4DNC A;  2PE3 A;  1J4J A;  5FVJ A;  1LAM A;  4KLW A;  5I4M A;  4MFQ A;  1Z5R A;  3D7F A;  4YRH A;  3EO4 A;  2V77 A;  1RTQ A;  1YME A;  2PJ5 A;  4FUU A;  4F6A A;  2ZEE A;  1IU8 A;  2X7B A;  2HUZ A;  1M4L A;  3KGQ A;  4BBH A;  4KOS A;  3TOB A;  4A31 A;  1YQE A;  2Z3L A;  3DR8 A;  1YSJ A;  4Y49 B;  4JWP A;  3GYA A;  1M4I A;  3W6S A;  3GUX A;  3WC7 A;  3RO0 A;  4P4E A;  3SXN A;  4A37 A;  1Y9W A;  3SXO A;  3TFY A;  1RO5 A;  4EFD A;  3KR4 A;  4C2X A;  3H4Q A;  1FY7 A;  4AVA A;  1CBX A;  1BPM A;  5AG6 A;  3SI0 A;  2AFZ A;  1S5K A;  4OLL A;  4B5P B;  4U5Y A;  4E2A A;  1S7F A;  2VBQ A;  2KCW A;  5CBM A;  4UEZ A;  4A95 A;  4R6T A;  4BD9 A;  4YFJ A;  3NFZ A;  4OKO A;  3V8I A;  5HVH A;  5G20 A;  3ZJ0 A;  4CAV A;  4XNH C;  4XPD C;  3SJE A;  1S3Z A;  5KTD A;  4MXU A;  4ZGY B;  2QYV A;  2BEI A;  2BCO A;  4W9Y A;  2P6G A;  6CPA A;  4PK2 A;  5G21 A;  3IU2 A;  2OU2 A;  2Q4V A;  3B3C A;  4PXD A;  4M6H A;  4MHN A;  4JLY A;  2WZN A;  4UFW A;  2OZH A;  2DPT A;  2ZPA A;  3TC8 A;  4MY3 A;  4CYO A;  3NE8 A;  1SQH A;  2YNC A;  2NYQ A;  4PSX A;  2POK A;  1YX0 A;  2VZY A;  4R3K A;  3H8F A;  1S7K A;  2PJ8 A;  3D7H A;  2GLJ A;  3WC6 A;  2ZOF A;  1PCA A;  4F0X A;  5HVF A;  5JPH A;  2ANP A;  2EK9 A;  4F0Y A;  2ZEH A;  5IV0 A;  3EY5 A;  3IO1 A;  4LQG A;  2G3A A;  3WR7 A;  1KUY A;  4JD6 A;  4E0A A;  1Z8L A;  5K8O A;  3S9L A;  4NSQ A;  2Q43 A;  1CG2 A;  4MFJ A;  5JGF A;  1NMT A;  1QSO A;  1YLO A;  3GIU A;  3PB4 X;  4P6Y A;  3HUV A;  5LYI A;  2PQ8 A;  4OAE A;  4MRI A;  3B3W A;  3GY9 A;  1CX8 A;  4P4J A;  1QST A;  3KZW A;  3FEC A;  3IJ3 A;  5E96 A;  1EE3 P;  1F2O A;  4QB9 A;  4C68 A;  3MRU A;  2ZOG A;  3R1K A;  1X10 A;  4PK3 A;  1NSL A;  3RBU A;  3R96 A;  2RFH A;  1MJA A;  3CPA A;  4NGS A;  4MFP A;  4YWY A;  3G8W A;  2ZEO A;  2Z3M A;  4AVB A;  2O4H A;  1QSR A;  5KTC A;  1ZO0 A;  1KWM A;  2AE6 A;  3MGD A;  2BUE A;  4UWI A;  4B14 A;  4P4B A;  2ZEN A;  4UBR A;  4UWJ A;  5F46 A;  2OB0 A;  4F9U A;  2H5M A;  1PU9 A;  4DYO A;  1X12 A;  4NGT A;  4XNH B;  4XPD B;  5I0C A;  4X2T A;  3FF3 A;  2PJ7 A;  2ZEG A;  1XIX A;  3T8W A;  2A4N A;  3IIB A;  4KLV A;  4C7I A;  1Z9U A;  1M4G A;  4B5O A;  1YW6 A;  2O53 A;  3N7Z A;  3PRT A;  1LOK A;  4RS2 A;  4HNW B;  3FEE A;  1LAP A;  4LUA A;  1AMP A;  4M3S A;  1VGY A;  4L8A A;  3R9G A;  4X3R A;  4MI4 A;  2OR4 A;  3BXM A;  4J3G A;  4NFR A;  4OC5 A;  2YND A;  1PYT B;  2P0W A;  2QJ8 A;  2PVW A;  3KHX A;  1XFO A;  2FS5 A;  1XEB A;  2PR8 A;  4OAD A;  2B4D B;  2Z11 A;  4FD4 A;  4OC0 A;  2Q51 A;  3VAR A;  1CPX A;  3FNC A;  1YVO A;  2AJ6 A;  2XEF A;  4XPL A;  2DPS A;  2CY2 A;  2G0B A;  2ZED A;  4FD5 A;  4MCR A;  1XJO A;  3D7G A;  5LYF A;  4A32 A;  4K30 A;  1I1D A;  3D68 A;  3TO7 A;  2Q4Z A;  3CT9 A;  1CP6 A;  4OC3 A;  4M6G A;  5LYL A;  1TIQ A;  4KVX A;  4TWE A;  2YNE A;  4MCP A;  4EVY A;  4MCQ A;  3G3S A;  4MCS A;  1KUV A;  2HC9 A;  1ZG8 A;  4NEX A;  3IWE A;  3TO9 A;  3QB8 A;  2WYR A;  3BI0 A;  2JEW A;  4UEF A;  5AG5 A;  3RYO A;  4PXB A;  2EO8 A;  4H6Z A;  2F5I A;  5EMI A;  2C6C A;  3DSB A;  4X5K A;  3WC5 A;  2V8V A;  1IYL A;  4KUB A;  4A33 A;  4PV6 A;  4TNU A;  4CRY B;  2R8V A;  5GCN A;  2Q4Y A;  4OC1 A; 
#chains in the Genus database with same CATH homology
 4YGO A;  4R3L A;  2R98 A;  4MJ8 A;  3PGP A;  4C2Z A;  3FYN A;  4AG9 A;  2Z3N A;  4KZT A;  2DXQ A;  3BJ8 A;  2B3V A;  4NF1 A;  2P6E A;  4KOW A;  2CXA A;  2R7H A;  3D2P A;  5ISV A;  2OZG A;  2QML A;  3TO6 A;  4KOX A;  4M85 A;  1RXT A;  1VHS A;  4JJX A;  3B8G A;  4H6U A;  4QBJ A;  2ZW4 A;  1QSM A;  4GS4 A;  1K4J A;  4CGL A;  1Z4E A;  4MFZ A;  1Y9K A;  5IX3 A;  2B58 A;  2FSR A;  1CJW A;  2PRB A;  2Q0Y A;  4CYP A;  1I12 A;  2PSW A;  3NE7 A;  2QEC A;  3BJ7 A;  4XPK A;  1IB1 E;  2IL4 A;  4MFK A;  3D2M A;  4QC6 A;  3DDD A;  2CNT A;  4KOY A;  1UFH A;  2CNS A;  4JXR A;  1XE4 A;  3D8P A;  5EC4 A;  5C88 A;  1WWZ A;  2Z3O A;  3I9S A;  4I49 A;  4NXY A;  2D4P A;  1YK3 A;  2FCK A;  3D3S A;  1M4D A;  3S6F A;  3F8K A;  3R9E A;  5KTC A;  2G3T A;  2WPX A;  4KUA A;  4KVM E;  3EC4 A;  5F47 A;  2YNC C;  2I00 A;  4C7H A;  2O28 A;  5G1Z A;  2BSW A;  1B87 A;  3KKW A;  4AB7 A;  3P2F A;  1YLE A;  4ONU A;  3VWD A;  2Z3K A;  4B5P A;  2PR1 A;  1GHE A;  1YVK A;  5J8F A;  2J8M A;  1YR0 A;  3TOA A;  3PP9 A;  5J8C A;  3DR6 A;  3ZZI A;  1S7N A;  4UA3 A;  1YRE A;  5F48 A;  2REE A;  1KZF A;  3VWE A;  3IU1 A;  4HKF A;  2OZU A;  1M1D A;  1V0C A;  3GKR A;  3TE4 A;  1I21 A;  4UFX A;  3TTH A;  3C26 A;  5H84 A;  4CGP A;  5A27 A;  1M44 A;  3OWC A;  1IIC A;  4B11 A;  2EVN A;  3S6K A;  1Q2Y A;  3S6H A;  4KSA A;  2C27 A;  4ZBG A;  4IUS A;  2B5G A;  2GAN A;  3JVN A;  4KSF A;  4Q38 A;  2VXK A;  2JDD A;  3LD2 A;  2PDO A;  2EUI A;  4QVT A;  2CNM A;  5C82 A;  4KOU A;  4B13 A;  2ZW6 A;  2GE3 A;  4QUS A;  4KVO E;  1VKC A;  4II9 A;  1XMT A;  4Q36 A;  2Q04 A;  4FD7 A;  4KOR A;  4BMH A;  1CM0 A;  3QAH A;  1L0C A;  4NCZ A;  3K9U A;  2FL4 A;  3E0K A;  3IWG A;  3CXP A;  4KOV A;  1S60 A;  4HNY B;  4E8O A;  2QIR A;  5DWN A;  1XF8 A;  3F5B A;  4CYQ A;  1MJB A;  3LOD A;  3CXS A;  4CGM A;  1PUA A;  2ZW5 A;  3F0A A;  3UY5 A;  3R95 A;  2Z10 A;  2Q7B A;  1BOB A;  2D4O A;  4R9M A;  4KS9 A;  3BLN A;  2B4D A;  2JEV A;  1S7L A;  1R57 A;  1Z4R A;  4UCP A;  2JDC A;  2K5T A;  4CAW A;  3A9L A;  1NE9 A;  2WPW A;  5EBV A;  3EFA A;  3EXN A;  3CXQ A;  1WK4 A;  1QSN A;  2FE7 A;  3I3G A;  4MBU A;  1Q2C A;  1B6B A;  4CGN A;  1Y7R A;  3FRM A;  4JXQ A;  4MY0 A;  4UCM A;  4MFL A;  2Z3P A;  4U9Z A;  5IB0 A;  3IGR A;  2B3U A;  3PZJ A;  1YGH A;  4UFV A;  4A2Z A;  2NMT A;  3FBU A;  4AVC A;  2FIA A;  3DNS A;  4KOT A;  4UCN A;  5CNP A;  3W6X A;  4CYN A;  5H86 A;  2Q44 A;  3FB3 A;  3TCV A;  3JUW A;  3W91 A;  2YGW A;  4PSW A;  3R9F A;  1IID A;  2OH1 A;  3S6G A;  1IYK A;  1BO4 A;  2B5G B;  4CAE A;  2JLM A;  5AGE A;  3FXT A;  2R1I A;  3P2H A;  4IF5 A;  2WSA A;  2BL1 A;  2VQY A;  4ORF A;  1LRZ A;  5AG4 A;  2ATR A;  4B10 A;  4U9Y A;  4CAX A;  3FIX A;  2J8N A;  2I79 A;  4B12 A;  2RC4 A;  2P6F A;  1U6M A;  1P4N A;  5HH1 A;  4R87 A;  5G22 A;  3TT2 A;  4RI1 A;  5A28 A;  2ARH A;  2VEZ A;  2Z0Z A;  3JTK A;  1OZP A;  4C2Y A;  4L89 A;  2HQY A;  2VI7 A;  4FD6 A;  4R57 A;  4Y49 C;  5JQ4 A;  2HV2 A;  2GIV A;  2B4B A;  3T90 A;  2VZZ A;  5KTA A;  2Y0M A;  2J8R A;  5HMN A;  4H89 A;  1ON0 A;  2ZXV A;  2PC1 A;  2FXF A;  4MHD A;  1MJ9 A;  1Q2D A;  2FT0 A;  2FIW A;  4AG7 A;  5BWA B;  4CS0 B;  1MK4 A;  1KUX A;  2REF A;  4CGO A;  4HNX B;  4CAF A;  1P0H A;  5F49 A;  5DWM A;  4CRZ B;  4LX9 A;  4A30 A;  1N71 A;  3H5Z A;  5AG7 A;  2WUU A;  3T9Y A;  3SHP A;  2ZW7 A;  4DNC A;  1J4J A;  5FVJ A;  4KLW A;  4MFQ A;  4YRH A;  3EO4 A;  4F6A A;  2X7B A;  2HUZ A;  4BBH A;  4KOS A;  3TOB A;  4A31 A;  2Z3L A;  3DR8 A;  4Y49 B;  4JWP A;  3GYA A;  1M4I A;  3W6S A;  3SXN A;  3TFY A;  1Y9W A;  3SXO A;  1RO5 A;  4C2X A;  3H4Q A;  1FY7 A;  4AVA A;  5AG6 A;  1S5K A;  4OLL A;  4B5P B;  4U5Y A;  4E2A A;  1S7F A;  2VBQ A;  2KCW A;  4A95 A;  4YFJ A;  3V8I A;  5G20 A;  3ZJ0 A;  4CAV A;  4XNH C;  4XPD C;  1S3Z A;  5KTD A;  4ZGY B;  2BEI A;  2P6G A;  4PK2 A;  5G21 A;  3IU2 A;  2OU2 A;  2Q4V A;  4JLY A;  4UFW A;  2OZH A;  2DPT A;  2ZPA A;  4CYO A;  4MY3 A;  1SQH A;  2YNC A;  4PSX A;  1YX0 A;  2VZY A;  4R3K A;  1S7K A;  4F0X A;  5JPH A;  4F0Y A;  5IV0 A;  3EY5 A;  3WR7 A;  2G3A A;  1KUY A;  4JD6 A;  4E0A A;  4NSQ A;  4MFJ A;  1NMT A;  1QSO A;  2PQ8 A;  4OAE A;  3GY9 A;  1QST A;  5E96 A;  4QB9 A;  4C68 A;  3R1K A;  1NSL A;  4PK3 A;  3R96 A;  1MJA A;  4MFP A;  3G8W A;  4AVB A;  2Z3M A;  1QSR A;  1ZO0 A;  2AE6 A;  3MGD A;  2BUE A;  4UWI A;  4B14 A;  4UBR A;  4UWJ A;  5F46 A;  2OB0 A;  2H5M A;  1PU9 A;  4XNH B;  4XPD B;  5I0C A;  1XIX A;  2A4N A;  4KLV A;  4C7I A;  1Z9U A;  1M4G A;  4B5O A;  3N7Z A;  4RS2 A;  4HNW B;  4LUA A;  4M3S A;  3R9G A;  4L8A A;  4MI4 A;  4J3G A;  2YND A;  2P0W A;  2FS5 A;  1XEB A;  2PR8 A;  4OAD A;  2B4D B;  2Z11 A;  4FD4 A;  3FNC A;  1YVO A;  2AJ6 A;  4XPL A;  2DPS A;  2CY2 A;  2G0B A;  4FD5 A;  4A32 A;  4K30 A;  1I1D A;  3TO7 A;  1TIQ A;  4KVX A;  2YNE A;  4EVY A;  3G3S A;  1KUV A;  4NEX A;  3IWE A;  3TO9 A;  3QB8 A;  5AG5 A;  3RYO A;  4H6Z A;  2F5I A;  3DSB A;  4X5K A;  1IYL A;  4KUB A;  4A33 A;  4PV6 A;  4CRY B;  2R8V A;  5GCN A;  2Q4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...