5A27A

Leishmania major n-myristoyltransferase in complex with a chlorophenyl 1,2,4-oxadiazole inhibitor.
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
411
structure length
411
Chain Sequence
b'AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of High Affinity Inhibitors of Leishmania Donovani N-Myristoyltransferase.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 130
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5a27A00
4A31A 3IU2A 4C2XA 4B10A 4UFWA 4A2ZA 4CYNA 5A28A 2YNCC 2WUUA 4C68A 5A27A 4UCPA 4B11A 2YNDA 4A33A 4CGLA 4A30A 4A32A 3H5ZA 4CGPA 4CAFA 4CGOA 4CYQA 3JTKA 5G21A 4B14A 4B12A 4CAEA 5AG6A 5AG7A 4UFVA 2YNEA 5G20A 2WSAA 4C2YA 4C2ZA 4CYPA 4CGMA 5AGEA 5G22A 3IWEA 4UCNA 3IU1A 4A95A 4C7HA 5AG4A 2YNCA 5G1ZA 4UCMA 4C7IA 4CYOA 4UFXA 4B13A 4CGNA 5AG5A 4BBHA
chains in the Genus database with same CATH superfamily
3GB0A 4R76A 3B7IA 3CXPA 3D66A 1N71A 4EVYA 4F9VA 3E0KA 4P4FA 3PB4X 1OBRA 1QSRA 1TXRA 3KL9A 4EWTA 1IB1E 4A37A 4UEFA 4RS2A 3SJEA 1Y9WA 4K30A 1HDQA 4FD5A 1DE4C 4P4BA 1CX8A 3NH5A 1FNOA 5LYDA 3ZJ0A 4M6HA 3WT4A 1XRYA 4LUAA 1TKJA 2PCUA 4TNUA 2D4PA 3QAYA 2VZYA 4ZX8A 1M1DA 2O28A 1IYKA 3BI0A 3H8FA 4C7IA 4F9UA 4A31A 3FVLA 2DF5A 1LAPA 5HH1A 4B5OA 4MJ8A 3B3WA 3SI1A 2ZXVA 4GXHA 4MHZA 1CBXA 1PU9A 2QJ8A 4F0XA 1IGBA 1Y0YA 1L0CA 2JBJA 2Q4ZA 1CPSA 4JJXA 4F0YA 4AVBA 3EFAA 4XPDC 4FAIA 4X8IA 4Z65A 1KWMA 4QVTA 4CAFA 1FT7A 4JLYA 4CAXA 5ELYA 5K8NA 2EBJA 4H6UA 3GY9A 2Q4VA 5C82A 4WWVA 3W91A 5LYLA 2AFOA 1BPNA 1YK3A 3FMCA 4ORFA 3ISZA 1XBUA 2GLJA 3CT9A 1B87A 3IWGA 3RNZA 2FIWA 2ZEFA 3D4UA 3UY5A 3CXQA 5THWA 1CP6A 4YGOA 4O23A 1LRZA 1KUVA 3FXTA 3NA6A 2PRQA 4NJQA 4MFLA 1NSAA 1QSMA 2ZEHA 5JGFA 2RFHA 4FD7A 4KSAA 4P4JA 4MBUA 4X5KA 3DSBA 2Q43A 3FBUA 4CYQA 4MHNA 2OZUA 1A2ZA 4B14A 3R95A 2I00A 4CAEA 4A94A 4ZGYB 5AG7A 2BEIA 3VWDA 3PB7X 2B5GB 2VEZA 1CP7A 1IYLA 1YGHA 1AYEA 2R8VA 4NFRA 4K3NA 3SJGA 1EE3P 3IWEA 4R9MA 2ATRA 4RI1A 1CM0A 2PC1A 3D68A 2OR4A 3CXSA 2ZEOA 3I1UA 3IU1A 3K9UA 3D7HA 4PXCA 3LMSA 5IX3A 1QSOA 3D7DA 4M3SA 4RUHA 5E96A 4OC2A 4C2XA 8CPAA 2PVVA 1IOFA 1R3NA 2C6CA 3NFZA 3PGPA 1Z5RA 4MXUA 2EK9A 3EXNA 4JYWA 2RB7A 3VH9A 2ZOFA 3D7GA 4UCPA 5DWNA 2YNDA 2V8DA 4L8AA 2Z3OA 4CRYB 1F2OA 3LACA 4YWYA 1MJBA 3TO7A 3DDDA 3DR8A 1Y7RA 2YNEA 4C2YA 4UWJA 1H8LA 2FXFA 1LCPA 2EUIA 3D2PA 4PSXA 4JZ0A 2R1IA 5EBVA 3RO0A 1RXTA 3T9YA 2PJAA 3LWUA 3CDXA 4EFDA 1HDUA 3W6SA 3KQZA 4XNHC 2BOAA 3JUWA 2PIYA 3B35A 2AFXA 2F8HA 3TT2A 1Z4RA 1IY7A 4MCRA 4XPDB 4JWPA 4BBHA 2OZGA 4P44A 3TTHA 4OADA 1Z8LA 3H4QA 4OKOA 4H6ZA 1Z9UA 2CTCA 2WUUA 1Y0RA 4AB7A 3PB8X 3NE7A 2PJBA 2B4BA 2V8VA 3R9EA 1YQEA 3BHXA 2B3VA 3FIXA 3R96A 3TO9A 1ZG8A 1SQHA 4KOXA 1Y7EA 4R8FA 3S6FA 1U6MA 3QAHA 4UFVA 1MJ9A 1YVKA 1AMPA 2B5GA 5CPAA 1TF8A 5BWAB 1Z8WA 2OZHA 3S9LA 4CS0B 2HC9A 2Z11A 2VZZA 4PXEA 1OZPA 1X12A 4C7HA 2G9DA 2JEVA 2FT0A 2YNCA 2ZEGA 4PK2A 4FD6A 4P10A 4P4IA 4R57A 7CPAA 4FUUA 5IB9A 1UFHA 4R7MA 4MCSA 1Y9KA 3TCVA 4JXRA 5GCNA 2FE7A 3NH4A 4HNYB 3CZXA 5KTDA 2YNCC 3GUXA 3F5BA 3PZJA 1K4JA 1VKCA 5D29A 3IJ3A 2CNMA 2PJ9A 3S9MA 3SJXA 3VWEA 2OB0A 5K8MA 4NGMA 2GU2A 4A32A 5F49A 2BL1A 5J1QA 3WC5A 3JTKA 4OC5A 4X3RA 2DEAA 2AFMA 3IO1A 4HKFA 4QUSA 5F47A 5H84A 1S60A 2V8GA 5G20A 1QSNA 3B3TA 3PBBA 2Q4YA 2ZEPA 3SHPA 5LRGA 4KOUA 1YW6A 5HVHA 2GE3A 5HMNA 2FCKA 2NSMA 3BI1A 4NCZA 4UCNA 3T8WA 5K8PA 1ZG7A 3T90A 1NSLA 1Z4EA 2BUEA 1YLOA 2O4HA 1YLEA 4MCQA 2X7BA 1IIDA 4YFJA 3V7ZA 1M4IA 4KUAA 4KORA 1XOVA 4MY3A 4CYNA 3V8IA 3P2HA 2GREA 1LANA 1ZLHA 4MY0A 5KTCA 4QB9A 1XMTA 2IL4A 1M44A 4M6IA 1F2PA 3GKRA 2IMOA 4A39A 2CXAA 2J9AA 4ZYQA 2C6PA 3GYAA 4OAEA 3IWWA 4OC4A 1NMTA 4OIDA 1BAVA 4MFJA 4DJLA 2R98A 4XNHB 1QSTA 3OWCA 1F57A 4B5PB 1AUGA 2GIVA 3KR4A 4KOWA 5F48A 2VBQA 1VIXA 3GIUA 1I12A 2CIJA 2D4OA 1LFWA 2AFUA 1CJWA 1X10A 3KGQA 3LD2A 3EO4A 4NSQA 4PSWA 3FF3A 5JM6A 2Z3KA 4F8ZA 1Z8TA 2Y0MA 3TE4A 2ZOGA 1P4NA 2PIZA 2ZW6A 3KI9A 4P45A 3SJFA 1JWQA 4NJRA 1CG2A 1PUAA 4MRIA 3FYNA 2QYVA 1HEEA 3H8GA 2H5MA 2PJ8A 1S7KA 4TWEA 1ELLP 4GS4A 4II9A 2P6FA 4DNCA 2EK8A 3B8GA 3KHZA 2ARHA 2PJ7A 3G3SA 2Z10A 3BXMA 1ZG9A 2V77A 1M4GA 3SXNA 2XEIA 2WZNA 4KVME 2BO9A 2DPSA 2G3AA 1ELMP 4NF1A 4UBRA 2WYRA 1XEBA 3BLNA 4MHDA 4NGSA 3VATA 1JQGA 4LQGA 3H8EA 4CGPA 2HQYA 2PQ8A 1VHEA 4PV6A 2REEA 1IOIA 2B3UA 1XJOA 1IU8A 4F6AA 2VL1A 1YVOA 1BPMA 2CF4A 2PJ3A 2ZEDA 4MFKA 5IB0A 2AE6A 2A4NA 3FEEA 4R6TA 4AG9A 3NE8A 4ZY0A 4PPZA 2CTBA 4G1PA 3RAMA 5G22A 1WK4A 4B5PA 1I21A 1MJAA 1Q7LA 3CPAA 4IUSA 2G3TA 2Q44A 2J8RA 4LQ6A 1YW4A 2XEGA 1XMBA 3S6HA 4NGRA 4FD4A 2AFWA 4KSFA 2EVNA 4MHPA 5AG5A 5D8NA 4OLLA 1S7FA 3IU2A 1QMUA 3PRTA 1BO4A 2AJ6A 4A2ZA 5KTAA 2POKA 2QVPA 2GFQA 2PVWA 3PB9X 4HPSA 4UF4A 4ZI6A 2WPXA 3DNSA 3D3SA 3JRUA 4A30A 1M4DA 1S7LA 2B4DB 2PJ6A 2YGWA 4AVAA 2PE3A 4BINA 2P0WA 5ISVA 1KZFA 1KUYA 2ANPA 1YREA 2FIAA 4AVCA 2ZW4A 4IF5A 4B6ZA 2JLMA 2GANA 2I79A 3KKWA 1TKFA 4U9ZA 1PCAA 5LRJA 3KZWA 4NGNA 4DYOA 2FL4A 2QIRA 2Z3NA 2CNTA 4KOTA 2J8MA 4OIWA 4CAVA 2RC4A 2ZEEA 1KUXA 1PYTB 2VQYA 3TFYA 1M4LA 2XEFA 3BJ8A 4U9YA 3HLPA 4UIBA 3JVNA 4UFWA 4E8OA 3CPXA 5IV0A 1YR0A 4R3LA 2PDOA 5DS0A 2CY2A 4KOSA 2K5TA 3PFOA 1Q2CA 3SXOA 4Y49B 3FNCA 5DWMA 3F8KA 3D8PA 1Z8XA 3BJ7A 4NGQA 1XFOA 4Q7AA 5G21A 5J8FA 4R3KA 5EC4A 2PJ1A 4NXYA 1TKHA 4RN7A 5LYIA 2Z0ZA 4HNXB 4KOYA 1R57A 2C1CA 2JDDA 2HB6A 1XIXA 4UEZA 2Q7BA 4FBEA 1R43A 4KLVA 4UFXA 5CNPA 5J8CA 2DXQA 2VI7A 3TO6A 2VXKA 2NYQA 1LAMA 3K9TA 2ABZA 3WC6A 4A38A 3TC8A 1CPXA 2B58A 4LX9A 3VARA 2P6EA 3PEIA 4JD6A 2WPWA 4R87A 3B3VA 1VHSA 2B4DA 4Q38A 4CGOA 3R9FA 4ONUA 4IHMA 4ZX9A 4B12A 4ZY1A 2Z3PA 2Z3MA 3D67A 2FS5A 4OC3A 3N5FA 4C2ZA 1ARLA 1BOBA 3I9SA 4OMEA 4CYPA 1LOKA 4FWUA 2ZENA 1J4JA 4IAVA 4X2TA 3PP9A 3IEHA 3W6XA 2ZEMA 1ZLIA 5I4MA 4B13A 2HV2A 3RZAA 3FX6A 4CGNA 2JBKA 2REFA 4H2KA 4W9YA 4CGLA 2EO8A 3C26A 4DUKA 2F5IA 3FRMA 5HVFA 2BSWA 1RTQA 2Q04A 3IFEA 4UIAA 2ZPAA 4BMHA 5A28A 4UWIA 4XPKA 3FEDA 4MHYA 3WABA 5LRKA 2Q51A 1B6BA 4MFQA 1TIQA 2KCWA 1ON0A 3QB8A 5CBMA 4P6YA 4CRZB 2JDCA 1XE4A 5H86A 5I0CA 3B3CA 3WC7A 2JEWA 4AXVA 1RO5A 1VHOA 3PFEA 5HXDA 4ONWA 4Y49C 4XPLA 2OH1A 4PXDA 5AGEA 2DPTA 2EWBA 4I49A 2QMLA 3EY5A 2P6GA 3KR5A 4KLWA 3TX8A 1VGYA 5AG4A 5F46A 4OP4A 4UCMA 2Z3LA 1P0HA 2QECA 2C6GA 3MRUA 2O53A 4PQAA 4EMEA 3FJUA 4OC0A 2ODFA 2V8HA 3PBEA 4KUBA 4NGTA 3SI0A 3S9NA 2C27A 3D2MA 3QNVA 4NEXA 3B3SA 3IC1A 3K2KA 3H5ZA 2F7VA 1GYTA 4M6GA 3I3GA 4ZBGA 2I3CA 3S6GA 4YU9A 1S7NA 4NGPA 3G8WA 4KZTA 2ZW5A 1NE9A 1FY7A 3FECA 3WR7A 2PJCA 4PXBA 4CGMA 2Q0YA 5FVJA 4MFPA 1YMEA 2Q7SA 3B2YA 4CAWA 2AFSA 3PB6X 4H89A 4CYOA 4ZY2A 3R1KA 5EMIA 4GM5A 4P4EA 2PRBA 4B10A 1Z2LA 1YX0A 4P4DA 4JXQA 4OC1A 5JPHA 1GHEA 4KSIA 5A27A 1TF9A 5K8OA 1ARMA 3HUVA 3SI2A 3RBUA 4A33A 2GLFA 4L89A 3EC4A 4M85A 5C88A 3P2FA 4KS9A 4BD9A 5HVGA 4MCPA 4MI4A 2NMTA 2WSAA 2CNSA 4KVXA 2PR8A 3D7FA 4PK3A 2FVGA 1QQ9A 3ZZIA 3TOBA 4QBJA 1UWYA 3V38A 2OOTA 3F0AA 1V0CA 2IJZA 4IK2A 2PJ4A 4A95A 5F09A 2PJ0A 2G0BA 2R7HA 4UEEA 2IQ6A 3TOAA 5JQ4A 1DTDA 4HNWB 1S3ZA 2BCOA 3GLJA 3RYOA 1YSJA 2HUZA 3KQXA 2PR1A 5JH9A 3DLJA 4C68A 4KVOE 1Q2YA 4WJBA 4B11A 4QC6A 3LODA 3FH4A 1ZO0A 2AFZA 2FSRA 2XEJA 3DR6A 5LYFA 3FB3A 4YRHA 5AG6A 3KHXA 2OU2A 4AG7A 3S6KA 4Q36A 1MK4A 4CPAA 2PJ5A 4U5YA 4E2AA 6CPAA 2PSWA 3KASA 3MGDA 1IICA 3ISXA 1BLLE 1XF8A 3N7ZA 3DGVA 2ZELA 2ZW7A 3R9GA 3IIBA 4E0AA 3A9LA 4J3GA 4UA3A 1I1DA 1Q2DA 3NH8A 3IGRA 1S5KA 4MFZA 5G1ZA 4KOVA 4MMOA 2J8NA 1WWZA 3L2NA 2PJ2A 3MN8A
chains in the Genus database with same CATH topology
3CXPA 1N71A 4EVYA 3E0KA 1QSRA 1IB1E 4RS2A 1Y9WA 4K30A 4FD5A 3ZJ0A 4LUAA 2D4PA 2VZYA 1M1DA 2O28A 1IYKA 4C7IA 4A31A 4B5OA 5HH1A 4MJ8A 2ZXVA 1PU9A 4F0XA 4JJXA 1L0CA 4F0YA 4AVBA 3EFAA 4XPDC 4QVTA 4CAFA 4CAXA 4JLYA 4H6UA 3GY9A 2Q4VA 5C82A 3W91A 1YK3A 4ORFA 1B87A 3IWGA 2FIWA 3UY5A 3CXQA 4YGOA 1LRZA 1KUVA 3FXTA 4MFLA 1QSMA 4FD7A 2J8NA 4KSAA 4MBUA 4X5KA 3DSBA 3FBUA 4CYQA 2OZUA 4B14A 3R95A 2I00A 4CAEA 4ZGYB 5AG7A 2BEIA 3VWDA 2B5GB 2VEZA 1IYLA 1YGHA 2R8VA 3IWEA 4R9MA 2ATRA 4RI1A 1CM0A 2PC1A 3IU1A 3CXSA 3K9UA 5IX3A 1QSOA 4M3SA 5E96A 4C2XA 3PGPA 3EXNA 4UCPA 5DWNA 2YNDA 4L8AA 2Z3OA 4CRYB 1MJBA 3TO7A 3DDDA 3DR8A 1Y7RA 2YNEA 4C2YA 4UWJA 2FXFA 2EUIA 3D2PA 4PSXA 5EBVA 2R1IA 3T9YA 1RXTA 3W6SA 4XNHC 3JUWA 3TT2A 1Z4RA 4BBHA 4XPDB 4JWPA 2OZGA 3TTHA 4OADA 3H4QA 4H6ZA 1Z9UA 2WUUA 4AB7A 2B4BA 3R9EA 2B3VA 3FIXA 3R96A 3TO9A 3S6FA 1SQHA 4KOXA 1U6MA 3QAHA 4UFVA 1MJ9A 1YVKA 2B5GA 5BWAB 2OZHA 4CS0B 2Z11A 2VZZA 1OZPA 4C7HA 2JEVA 2FT0A 2YNCA 4PK2A 4FD6A 4R57A 1UFHA 1Y9KA 3TCVA 4JXRA 5GCNA 2FE7A 4HNYB 5KTDA 2YNCC 3F5BA 3PZJA 1K4JA 1VKCA 3VWEA 2CNMA 2OB0A 4A32A 5F49A 2BL1A 3JTKA 4HKFA 4QUSA 5F47A 5H84A 1S60A 5G20A 1QSNA 2Q4YA 3SHPA 4KOUA 2GE3A 5HMNA 2FCKA 4UCNA 4NCZA 3T90A 1NSLA 1Z4EA 2BUEA 4YFJA 1YLEA 2X7BA 1IIDA 1M4IA 4KUAA 4KORA 4MY3A 4CYNA 3V8IA 3P2HA 4MY0A 5KTCA 4QB9A 1XMTA 2IL4A 1M44A 3GKRA 2CXAA 3GYAA 4OAEA 1NMTA 4MFJA 2R98A 4XNHB 1QSTA 3OWCA 4B5PB 2GIVA 4KOWA 5F48A 2VBQA 1I12A 2D4OA 1CJWA 3LD2A 4PSWA 3EO4A 4NSQA 2Z3KA 2Y0MA 3TE4A 1P4NA 2ZW6A 1PUAA 3FYNA 2H5MA 1S7KA 4GS4A 4II9A 2P6FA 4DNCA 3B8GA 3SXNA 2ARHA 3G3SA 2Z10A 1M4GA 4KVME 2DPSA 2G3AA 4NF1A 4UBRA 1XEBA 3BLNA 4MHDA 4CGPA 2HQYA 2PQ8A 4PV6A 2REEA 2B3UA 4F6AA 1YVOA 4MFKA 5IB0A 2AE6A 2A4NA 4AG9A 5G22A 1WK4A 4B5PA 1I21A 1MJAA 4IUSA 2G3TA 2Q44A 2J8RA 3S6HA 4FD4A 4KSFA 2EVNA 5AG5A 4OLLA 1S7FA 3IU2A 1BO4A 2AJ6A 4A2ZA 5KTAA 2WPXA 3DNSA 3D3SA 4A30A 1M4DA 1S7LA 2B4DB 2YGWA 4AVAA 2P0WA 5ISVA 1KZFA 1KUYA 2FIAA 1YREA 4AVCA 2ZW4A 4IF5A 2JLMA 2GANA 2I79A 3KKWA 4U9ZA 2FL4A 2QIRA 2Z3NA 2CNTA 4KOTA 2J8MA 4CAVA 2RC4A 1KUXA 2VQYA 3TFYA 3BJ8A 4U9YA 3JVNA 4UFWA 4E8OA 5IV0A 1YR0A 4R3LA 2PDOA 2CY2A 4KOSA 2K5TA 1Q2CA 3SXOA 4Y49B 3FNCA 5DWMA 3F8KA 3D8PA 3BJ7A 5J8FA 5G21A 4R3KA 5EC4A 4NXYA 2Z0ZA 4HNXB 4KOYA 1R57A 2JDDA 1XIXA 2Q7BA 4KLVA 4UFXA 5CNPA 5J8CA 2DXQA 2VI7A 3TO6A 2VXKA 2B58A 4LX9A 2P6EA 4JD6A 2WPWA 4R87A 1VHSA 2B4DA 4Q38A 4CGOA 3R9FA 4ONUA 4B12A 2Z3PA 2Z3MA 2FS5A 4C2ZA 1BOBA 3I9SA 4CYPA 1J4JA 3PP9A 3W6XA 4B13A 2HV2A 4CGNA 4CGLA 2REFA 3C26A 2F5IA 3FRMA 2BSWA 4BMHA 2Q04A 5A28A 2ZPAA 4UWIA 4XPKA 1B6BA 4MFQA 1TIQA 2KCWA 1ON0A 3QB8A 4CRZB 2JDCA 1XE4A 5H86A 5I0CA 1RO5A 4Y49C 4XPLA 2OH1A 5AGEA 2DPTA 4I49A 2QMLA 3EY5A 2P6GA 5AG4A 4KLWA 5F46A 4UCMA 2Z3LA 1P0HA 2QECA 4KUBA 2C27A 3D2MA 4NEXA 3H5ZA 3I3GA 4ZBGA 3S6GA 1S7NA 3G8WA 4KZTA 2ZW5A 1NE9A 1FY7A 3WR7A 4CGMA 2Q0YA 5FVJA 4MFPA 4CAWA 4H89A 4CYOA 3R1KA 2PRBA 4B10A 1YX0A 4JXQA 5JPHA 1GHEA 5A27A 4A33A 4L89A 3EC4A 4M85A 5C88A 3P2FA 4KS9A 4MI4A 2NMTA 2WSAA 2CNSA 4KVXA 2PR8A 4PK3A 3ZZIA 3TOBA 4QBJA 3F0AA 1V0CA 4A95A 2G0BA 2R7HA 3TOAA 5JQ4A 4HNWB 1S3ZA 3RYOA 2HUZA 2PR1A 4C68A 4KVOE 1Q2YA 4B11A 4QC6A 3LODA 1ZO0A 2FSRA 3DR6A 3FB3A 4YRHA 5AG6A 2OU2A 4AG7A 3S6KA 4Q36A 1MK4A 4E2AA 4U5YA 2PSWA 3MGDA 1IICA 1XF8A 3N7ZA 2ZW7A 3R9GA 4E0AA 3A9LA 4J3GA 4UA3A 1I1DA 1Q2DA 3IGRA 1S5KA 4MFZA 5G1ZA 4KOVA 3NE7A 1WWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A31 A;  3IU2 A;  4C2X A;  4B10 A;  4UFW A;  4A2Z A;  4CYN A;  5A28 A;  2YNC C;  2WUU A;  4C68 A;  5A27 A;  4UCP A;  4B11 A;  2YND A;  4A33 A;  4CGL A;  4A30 A;  4A32 A;  3H5Z A;  4CGP A;  4CAF A;  4CGO A;  4CYQ A;  3JTK A;  5G21 A;  4B14 A;  4B12 A;  4CAE A;  5AG6 A;  5AG7 A;  4UFV A;  2YNE A;  5G20 A;  2WSA A;  4C2Y A;  4C2Z A;  4CYP A;  4CGM A;  5AGE A;  5G22 A;  3IWE A;  4UCN A;  3IU1 A;  4A95 A;  4C7H A;  5AG4 A;  2YNC A;  5G1Z A;  4UCM A;  4C7I A;  4CYO A;  4UFX A;  4B13 A;  4CGN A;  5AG5 A;  4BBH A; 
#chains in the Genus database with same CATH topology
 3GB0 A;  4R76 A;  3B7I A;  3CXP A;  3D66 A;  1N71 A;  4EVY A;  4F9V A;  3E0K A;  4P4F A;  3PB4 X;  1OBR A;  1QSR A;  1TXR A;  3KL9 A;  4EWT A;  1IB1 E;  4A37 A;  4UEF A;  4RS2 A;  3SJE A;  1Y9W A;  4K30 A;  1HDQ A;  4FD5 A;  1DE4 C;  4P4B A;  1CX8 A;  3NH5 A;  1FNO A;  5LYD A;  3ZJ0 A;  4M6H A;  3WT4 A;  1XRY A;  4LUA A;  1TKJ A;  2PCU A;  4TNU A;  2D4P A;  3QAY A;  2VZY A;  4ZX8 A;  1M1D A;  2O28 A;  1IYK A;  3BI0 A;  3H8F A;  4C7I A;  4F9U A;  4A31 A;  3FVL A;  2DF5 A;  1LAP A;  5HH1 A;  4B5O A;  4MJ8 A;  3B3W A;  3SI1 A;  2ZXV A;  4GXH A;  4MHZ A;  1CBX A;  1PU9 A;  2QJ8 A;  4F0X A;  1IGB A;  1Y0Y A;  1L0C A;  2JBJ A;  2Q4Z A;  1CPS A;  4JJX A;  4F0Y A;  4AVB A;  3EFA A;  4XPD C;  4FAI A;  4X8I A;  4Z65 A;  1KWM A;  4QVT A;  4CAF A;  1FT7 A;  4JLY A;  4CAX A;  5ELY A;  5K8N A;  2EBJ A;  4H6U A;  3GY9 A;  2Q4V A;  5C82 A;  4WWV A;  3W91 A;  5LYL A;  2AFO A;  1BPN A;  1YK3 A;  3FMC A;  4ORF A;  3ISZ A;  1XBU A;  2GLJ A;  3CT9 A;  1B87 A;  3IWG A;  3RNZ A;  2FIW A;  2ZEF A;  3D4U A;  3UY5 A;  3CXQ A;  5THW A;  1CP6 A;  4YGO A;  4O23 A;  1LRZ A;  1KUV A;  3FXT A;  3NA6 A;  2PRQ A;  4NJQ A;  4MFL A;  1NSA A;  1QSM A;  2ZEH A;  5JGF A;  2RFH A;  4FD7 A;  4KSA A;  4P4J A;  4MBU A;  4X5K A;  3DSB A;  2Q43 A;  3FBU A;  4CYQ A;  4MHN A;  2OZU A;  1A2Z A;  4B14 A;  3R95 A;  2I00 A;  4CAE A;  4A94 A;  4ZGY B;  5AG7 A;  2BEI A;  3VWD A;  3PB7 X;  2B5G B;  2VEZ A;  1CP7 A;  1IYL A;  1YGH A;  1AYE A;  2R8V A;  4NFR A;  4K3N A;  3SJG A;  1EE3 P;  3IWE A;  4R9M A;  2ATR A;  4RI1 A;  1CM0 A;  2PC1 A;  3D68 A;  2OR4 A;  3CXS A;  2ZEO A;  3I1U A;  3IU1 A;  3K9U A;  3D7H A;  4PXC A;  3LMS A;  5IX3 A;  1QSO A;  3D7D A;  4M3S A;  4RUH A;  5E96 A;  4OC2 A;  4C2X A;  8CPA A;  2PVV A;  1IOF A;  1R3N A;  2C6C A;  3NFZ A;  3PGP A;  1Z5R A;  4MXU A;  2EK9 A;  3EXN A;  4JYW A;  2RB7 A;  3VH9 A;  2ZOF A;  3D7G A;  4UCP A;  5DWN A;  2YND A;  2V8D A;  4L8A A;  2Z3O A;  4CRY B;  1F2O A;  3LAC A;  4YWY A;  1MJB A;  3TO7 A;  3DDD A;  3DR8 A;  1Y7R A;  2YNE A;  4C2Y A;  4UWJ A;  1H8L A;  2FXF A;  1LCP A;  2EUI A;  3D2P A;  4PSX A;  4JZ0 A;  2R1I A;  5EBV A;  3RO0 A;  1RXT A;  3T9Y A;  2PJA A;  3LWU A;  3CDX A;  4EFD A;  1HDU A;  3W6S A;  3KQZ A;  4XNH C;  2BOA A;  3JUW A;  2PIY A;  3B35 A;  2AFX A;  2F8H A;  3TT2 A;  1Z4R A;  1IY7 A;  4MCR A;  4XPD B;  4JWP A;  4BBH A;  2OZG A;  4P44 A;  3TTH A;  4OAD A;  1Z8L A;  3H4Q A;  4OKO A;  4H6Z A;  1Z9U A;  2CTC A;  2WUU A;  1Y0R A;  4AB7 A;  3PB8 X;  3NE7 A;  2PJB A;  2B4B A;  2V8V A;  3R9E A;  1YQE A;  3BHX A;  2B3V A;  3FIX A;  3R96 A;  3TO9 A;  1ZG8 A;  1SQH A;  4KOX A;  1Y7E A;  4R8F A;  3S6F A;  1U6M A;  3QAH A;  4UFV A;  1MJ9 A;  1YVK A;  1AMP A;  2B5G A;  5CPA A;  1TF8 A;  5BWA B;  1Z8W A;  2OZH A;  3S9L A;  4CS0 B;  2HC9 A;  2Z11 A;  2VZZ A;  4PXE A;  1OZP A;  1X12 A;  4C7H A;  2G9D A;  2JEV A;  2FT0 A;  2YNC A;  2ZEG A;  4PK2 A;  4FD6 A;  4P10 A;  4P4I A;  4R57 A;  7CPA A;  4FUU A;  5IB9 A;  1UFH A;  4R7M A;  4MCS A;  1Y9K A;  3TCV A;  4JXR A;  5GCN A;  2FE7 A;  3NH4 A;  4HNY B;  3CZX A;  5KTD A;  2YNC C;  3GUX A;  3F5B A;  3PZJ A;  1K4J A;  1VKC A;  5D29 A;  3IJ3 A;  2CNM A;  2PJ9 A;  3S9M A;  3SJX A;  3VWE A;  2OB0 A;  5K8M A;  4NGM A;  2GU2 A;  4A32 A;  5F49 A;  2BL1 A;  5J1Q A;  3WC5 A;  3JTK A;  4OC5 A;  4X3R A;  2DEA A;  2AFM A;  3IO1 A;  4HKF A;  4QUS A;  5F47 A;  5H84 A;  1S60 A;  2V8G A;  5G20 A;  1QSN A;  3B3T A;  3PBB A;  2Q4Y A;  2ZEP A;  3SHP A;  5LRG A;  4KOU A;  1YW6 A;  5HVH A;  2GE3 A;  5HMN A;  2FCK A;  2NSM A;  3BI1 A;  4NCZ A;  4UCN A;  3T8W A;  5K8P A;  1ZG7 A;  3T90 A;  1NSL A;  1Z4E A;  2BUE A;  1YLO A;  2O4H A;  1YLE A;  4MCQ A;  2X7B A;  1IID A;  4YFJ A;  3V7Z A;  1M4I A;  4KUA A;  4KOR A;  1XOV A;  4MY3 A;  4CYN A;  3V8I A;  3P2H A;  2GRE A;  1LAN A;  1ZLH A;  4MY0 A;  5KTC A;  4QB9 A;  1XMT A;  2IL4 A;  1M44 A;  4M6I A;  1F2P A;  3GKR A;  2IMO A;  4A39 A;  2CXA A;  2J9A A;  4ZYQ A;  2C6P A;  3GYA A;  4OAE A;  3IWW A;  4OC4 A;  1NMT A;  4OID A;  1BAV A;  4MFJ A;  4DJL A;  2R98 A;  4XNH B;  1QST A;  3OWC A;  1F57 A;  4B5P B;  1AUG A;  2GIV A;  3KR4 A;  4KOW A;  5F48 A;  2VBQ A;  1VIX A;  3GIU A;  1I12 A;  2CIJ A;  2D4O A;  1LFW A;  2AFU A;  1CJW A;  1X10 A;  3KGQ A;  3LD2 A;  3EO4 A;  4NSQ A;  4PSW A;  3FF3 A;  5JM6 A;  2Z3K A;  4F8Z A;  1Z8T A;  2Y0M A;  3TE4 A;  2ZOG A;  1P4N A;  2PIZ A;  2ZW6 A;  3KI9 A;  4P45 A;  3SJF A;  1JWQ A;  4NJR A;  1CG2 A;  1PUA A;  4MRI A;  3FYN A;  2QYV A;  1HEE A;  3H8G A;  2H5M A;  2PJ8 A;  1S7K A;  4TWE A;  1ELL P;  4GS4 A;  4II9 A;  2P6F A;  4DNC A;  2EK8 A;  3B8G A;  3KHZ A;  2ARH A;  2PJ7 A;  3G3S A;  2Z10 A;  3BXM A;  1ZG9 A;  2V77 A;  1M4G A;  3SXN A;  2XEI A;  2WZN A;  4KVM E;  2BO9 A;  2DPS A;  2G3A A;  1ELM P;  4NF1 A;  4UBR A;  2WYR A;  1XEB A;  3BLN A;  4MHD A;  4NGS A;  3VAT A;  1JQG A;  4LQG A;  3H8E A;  4CGP A;  2HQY A;  2PQ8 A;  1VHE A;  4PV6 A;  2REE A;  1IOI A;  2B3U A;  1XJO A;  1IU8 A;  4F6A A;  2VL1 A;  1YVO A;  1BPM A;  2CF4 A;  2PJ3 A;  2ZED A;  4MFK A;  5IB0 A;  2AE6 A;  2A4N A;  3FEE A;  4R6T A;  4AG9 A;  3NE8 A;  4ZY0 A;  4PPZ A;  2CTB A;  4G1P A;  3RAM A;  5G22 A;  1WK4 A;  4B5P A;  1I21 A;  1MJA A;  1Q7L A;  3CPA A;  4IUS A;  2G3T A;  2Q44 A;  2J8R A;  4LQ6 A;  1YW4 A;  2XEG A;  1XMB A;  3S6H A;  4NGR A;  4FD4 A;  2AFW A;  4KSF A;  2EVN A;  4MHP A;  5AG5 A;  5D8N A;  4OLL A;  1S7F A;  3IU2 A;  1QMU A;  3PRT A;  1BO4 A;  2AJ6 A;  4A2Z A;  5KTA A;  2POK A;  2QVP A;  2GFQ A;  2PVW A;  3PB9 X;  4HPS A;  4UF4 A;  4ZI6 A;  2WPX A;  3DNS A;  3D3S A;  3JRU A;  4A30 A;  1M4D A;  1S7L A;  2B4D B;  2PJ6 A;  2YGW A;  4AVA A;  2PE3 A;  4BIN A;  2P0W A;  5ISV A;  1KZF A;  1KUY A;  2ANP A;  1YRE A;  2FIA A;  4AVC A;  2ZW4 A;  4IF5 A;  4B6Z A;  2JLM A;  2GAN A;  2I79 A;  3KKW A;  1TKF A;  4U9Z A;  1PCA A;  5LRJ A;  3KZW A;  4NGN A;  4DYO A;  2FL4 A;  2QIR A;  2Z3N A;  2CNT A;  4KOT A;  2J8M A;  4OIW A;  4CAV A;  2RC4 A;  2ZEE A;  1KUX A;  1PYT B;  2VQY A;  3TFY A;  1M4L A;  2XEF A;  3BJ8 A;  4U9Y A;  3HLP A;  4UIB A;  3JVN A;  4UFW A;  4E8O A;  3CPX A;  5IV0 A;  1YR0 A;  4R3L A;  2PDO A;  5DS0 A;  2CY2 A;  4KOS A;  2K5T A;  3PFO A;  1Q2C A;  3SXO A;  4Y49 B;  3FNC A;  5DWM A;  3F8K A;  3D8P A;  1Z8X A;  3BJ7 A;  4NGQ A;  1XFO A;  4Q7A A;  5G21 A;  5J8F A;  4R3K A;  5EC4 A;  2PJ1 A;  4NXY A;  1TKH A;  4RN7 A;  5LYI A;  2Z0Z A;  4HNX B;  4KOY A;  1R57 A;  2C1C A;  2JDD A;  2HB6 A;  1XIX A;  4UEZ A;  2Q7B A;  4FBE A;  1R43 A;  4KLV A;  4UFX A;  5CNP A;  5J8C A;  2DXQ A;  2VI7 A;  3TO6 A;  2VXK A;  2NYQ A;  1LAM A;  3K9T A;  2ABZ A;  3WC6 A;  4A38 A;  3TC8 A;  1CPX A;  2B58 A;  4LX9 A;  3VAR A;  2P6E A;  3PEI A;  4JD6 A;  2WPW A;  4R87 A;  3B3V A;  1VHS A;  2B4D A;  4Q38 A;  4CGO A;  3R9F A;  4ONU A;  4IHM A;  4ZX9 A;  4B12 A;  4ZY1 A;  2Z3P A;  2Z3M A;  3D67 A;  2FS5 A;  4OC3 A;  3N5F A;  4C2Z A;  1ARL A;  1BOB A;  3I9S A;  4OME A;  4CYP A;  1LOK A;  4FWU A;  2ZEN A;  1J4J A;  4IAV A;  4X2T A;  3PP9 A;  3IEH A;  3W6X A;  2ZEM A;  1ZLI A;  5I4M A;  4B13 A;  2HV2 A;  3RZA A;  3FX6 A;  4CGN A;  2JBK A;  2REF A;  4H2K A;  4W9Y A;  4CGL A;  2EO8 A;  3C26 A;  4DUK A;  2F5I A;  3FRM A;  5HVF A;  2BSW A;  1RTQ A;  2Q04 A;  3IFE A;  4UIA A;  2ZPA A;  4BMH A;  5A28 A;  4UWI A;  4XPK A;  3FED A;  4MHY A;  3WAB A;  5LRK A;  2Q51 A;  1B6B A;  4MFQ A;  1TIQ A;  2KCW A;  1ON0 A;  3QB8 A;  5CBM A;  4P6Y A;  4CRZ B;  2JDC A;  1XE4 A;  5H86 A;  5I0C A;  3B3C A;  3WC7 A;  2JEW A;  4AXV A;  1RO5 A;  1VHO A;  3PFE A;  5HXD A;  4ONW A;  4Y49 C;  4XPL A;  2OH1 A;  4PXD A;  5AGE A;  2DPT A;  2EWB A;  4I49 A;  2QML A;  3EY5 A;  2P6G A;  3KR5 A;  4KLW A;  3TX8 A;  1VGY A;  5AG4 A;  5F46 A;  4OP4 A;  4UCM A;  2Z3L A;  1P0H A;  2QEC A;  2C6G A;  3MRU A;  2O53 A;  4PQA A;  4EME A;  3FJU A;  4OC0 A;  2ODF A;  2V8H A;  3PBE A;  4KUB A;  4NGT A;  3SI0 A;  3S9N A;  2C27 A;  3D2M A;  3QNV A;  4NEX A;  3B3S A;  3IC1 A;  3K2K A;  3H5Z A;  2F7V A;  1GYT A;  4M6G A;  3I3G A;  4ZBG A;  2I3C A;  3S6G A;  4YU9 A;  1S7N A;  4NGP A;  3G8W A;  4KZT A;  2ZW5 A;  1NE9 A;  1FY7 A;  3FEC A;  3WR7 A;  2PJC A;  4PXB A;  4CGM A;  2Q0Y A;  5FVJ A;  4MFP A;  1YME A;  2Q7S A;  3B2Y A;  4CAW A;  2AFS A;  3PB6 X;  4H89 A;  4CYO A;  4ZY2 A;  3R1K A;  5EMI A;  4GM5 A;  4P4E A;  2PRB A;  4B10 A;  1Z2L A;  1YX0 A;  4P4D A;  4JXQ A;  4OC1 A;  5JPH A;  1GHE A;  4KSI A;  5A27 A;  1TF9 A;  5K8O A;  1ARM A;  3HUV A;  3SI2 A;  3RBU A;  4A33 A;  2GLF A;  4L89 A;  3EC4 A;  4M85 A;  5C88 A;  3P2F A;  4KS9 A;  4BD9 A;  5HVG A;  4MCP A;  4MI4 A;  2NMT A;  2WSA A;  2CNS A;  4KVX A;  2PR8 A;  3D7F A;  4PK3 A;  2FVG A;  1QQ9 A;  3ZZI A;  3TOB A;  4QBJ A;  1UWY A;  3V38 A;  2OOT A;  3F0A A;  1V0C A;  2IJZ A;  4IK2 A;  2PJ4 A;  4A95 A;  5F09 A;  2PJ0 A;  2G0B A;  2R7H A;  4UEE A;  2IQ6 A;  3TOA A;  5JQ4 A;  1DTD A;  4HNW B;  1S3Z A;  2BCO A;  3GLJ A;  3RYO A;  1YSJ A;  2HUZ A;  3KQX A;  2PR1 A;  5JH9 A;  3DLJ A;  4C68 A;  4KVO E;  1Q2Y A;  4WJB A;  4B11 A;  4QC6 A;  3LOD A;  3FH4 A;  1ZO0 A;  2AFZ A;  2FSR A;  2XEJ A;  3DR6 A;  5LYF A;  3FB3 A;  4YRH A;  5AG6 A;  3KHX A;  2OU2 A;  4AG7 A;  3S6K A;  4Q36 A;  1MK4 A;  4CPA A;  2PJ5 A;  4U5Y A;  4E2A A;  6CPA A;  2PSW A;  3KAS A;  3MGD A;  1IIC A;  3ISX A;  1BLL E;  1XF8 A;  3N7Z A;  3DGV A;  2ZEL A;  2ZW7 A;  3R9G A;  3IIB A;  4E0A A;  3A9L A;  4J3G A;  4UA3 A;  1I1D A;  1Q2D A;  3NH8 A;  3IGR A;  1S5K A;  4MFZ A;  5G1Z A;  4KOV A;  4MMO A;  2J8N A;  1WWZ A;  3L2N A;  2PJ2 A;  3MN8 A; 
#chains in the Genus database with same CATH homology
 3CXP A;  1N71 A;  4EVY A;  3E0K A;  1QSR A;  1IB1 E;  4RS2 A;  1Y9W A;  4K30 A;  4FD5 A;  3ZJ0 A;  4LUA A;  2D4P A;  2VZY A;  1M1D A;  2O28 A;  1IYK A;  4C7I A;  4A31 A;  4B5O A;  5HH1 A;  4MJ8 A;  2ZXV A;  1PU9 A;  4F0X A;  4JJX A;  1L0C A;  4F0Y A;  4AVB A;  3EFA A;  4XPD C;  4QVT A;  4CAF A;  4CAX A;  4JLY A;  4H6U A;  3GY9 A;  2Q4V A;  5C82 A;  3W91 A;  1YK3 A;  4ORF A;  1B87 A;  3IWG A;  2FIW A;  3UY5 A;  3CXQ A;  4YGO A;  1LRZ A;  1KUV A;  3FXT A;  4MFL A;  1QSM A;  4FD7 A;  2J8N A;  4KSA A;  4MBU A;  4X5K A;  3DSB A;  3FBU A;  4CYQ A;  2OZU A;  4B14 A;  3R95 A;  2I00 A;  4CAE A;  4ZGY B;  5AG7 A;  2BEI A;  3VWD A;  2B5G B;  2VEZ A;  1IYL A;  1YGH A;  2R8V A;  3IWE A;  4R9M A;  2ATR A;  4RI1 A;  1CM0 A;  2PC1 A;  3IU1 A;  3CXS A;  3K9U A;  5IX3 A;  1QSO A;  4M3S A;  5E96 A;  4C2X A;  3PGP A;  3EXN A;  4UCP A;  5DWN A;  2YND A;  4L8A A;  2Z3O A;  4CRY B;  1MJB A;  3TO7 A;  3DDD A;  3DR8 A;  1Y7R A;  2YNE A;  4C2Y A;  4UWJ A;  2FXF A;  2EUI A;  3D2P A;  4PSX A;  5EBV A;  2R1I A;  3T9Y A;  1RXT A;  3W6S A;  4XNH C;  3JUW A;  3TT2 A;  1Z4R A;  4BBH A;  4XPD B;  4JWP A;  2OZG A;  3TTH A;  4OAD A;  3H4Q A;  4H6Z A;  1Z9U A;  2WUU A;  4AB7 A;  2B4B A;  3R9E A;  2B3V A;  3FIX A;  3R96 A;  3TO9 A;  3S6F A;  1SQH A;  4KOX A;  1U6M A;  3QAH A;  4UFV A;  1MJ9 A;  1YVK A;  2B5G A;  5BWA B;  2OZH A;  4CS0 B;  2Z11 A;  2VZZ A;  1OZP A;  4C7H A;  2JEV A;  2FT0 A;  2YNC A;  4PK2 A;  4FD6 A;  4R57 A;  1UFH A;  1Y9K A;  3TCV A;  4JXR A;  5GCN A;  2FE7 A;  4HNY B;  5KTD A;  2YNC C;  3F5B A;  3PZJ A;  1K4J A;  1VKC A;  3VWE A;  2CNM A;  2OB0 A;  4A32 A;  5F49 A;  2BL1 A;  3JTK A;  4HKF A;  4QUS A;  5F47 A;  5H84 A;  1S60 A;  5G20 A;  1QSN A;  2Q4Y A;  3SHP A;  4KOU A;  2GE3 A;  5HMN A;  2FCK A;  4UCN A;  4NCZ A;  3T90 A;  1NSL A;  1Z4E A;  2BUE A;  4YFJ A;  1YLE A;  2X7B A;  1IID A;  1M4I A;  4KUA A;  4KOR A;  4MY3 A;  4CYN A;  3V8I A;  3P2H A;  4MY0 A;  5KTC A;  4QB9 A;  1XMT A;  2IL4 A;  1M44 A;  3GKR A;  2CXA A;  3GYA A;  4OAE A;  1NMT A;  4MFJ A;  2R98 A;  4XNH B;  1QST A;  3OWC A;  4B5P B;  2GIV A;  4KOW A;  5F48 A;  2VBQ A;  1I12 A;  2D4O A;  1CJW A;  3LD2 A;  4PSW A;  3EO4 A;  4NSQ A;  2Z3K A;  2Y0M A;  3TE4 A;  1P4N A;  2ZW6 A;  1PUA A;  3FYN A;  2H5M A;  1S7K A;  4GS4 A;  4II9 A;  2P6F A;  4DNC A;  3B8G A;  3SXN A;  2ARH A;  3G3S A;  2Z10 A;  1M4G A;  4KVM E;  2DPS A;  2G3A A;  4NF1 A;  4UBR A;  1XEB A;  3BLN A;  4MHD A;  4CGP A;  2HQY A;  2PQ8 A;  4PV6 A;  2REE A;  2B3U A;  4F6A A;  1YVO A;  4MFK A;  5IB0 A;  2AE6 A;  2A4N A;  4AG9 A;  5G22 A;  1WK4 A;  4B5P A;  1I21 A;  1MJA A;  4IUS A;  2G3T A;  2Q44 A;  2J8R A;  3S6H A;  4FD4 A;  4KSF A;  2EVN A;  5AG5 A;  4OLL A;  1S7F A;  3IU2 A;  1BO4 A;  2AJ6 A;  4A2Z A;  5KTA A;  2WPX A;  3DNS A;  3D3S A;  4A30 A;  1M4D A;  1S7L A;  2B4D B;  2YGW A;  4AVA A;  2P0W A;  5ISV A;  1KZF A;  1KUY A;  2FIA A;  1YRE A;  4AVC A;  2ZW4 A;  4IF5 A;  2JLM A;  2GAN A;  2I79 A;  3KKW A;  4U9Z A;  2FL4 A;  2QIR A;  2Z3N A;  2CNT A;  4KOT A;  2J8M A;  4CAV A;  2RC4 A;  1KUX A;  2VQY A;  3TFY A;  3BJ8 A;  4U9Y A;  3JVN A;  4UFW A;  4E8O A;  5IV0 A;  1YR0 A;  4R3L A;  2PDO A;  2CY2 A;  4KOS A;  2K5T A;  1Q2C A;  3SXO A;  4Y49 B;  3FNC A;  5DWM A;  3F8K A;  3D8P A;  3BJ7 A;  5J8F A;  5G21 A;  4R3K A;  5EC4 A;  4NXY A;  2Z0Z A;  4HNX B;  4KOY A;  1R57 A;  2JDD A;  1XIX A;  2Q7B A;  4KLV A;  4UFX A;  5CNP A;  5J8C A;  2DXQ A;  2VI7 A;  3TO6 A;  2VXK A;  2B58 A;  4LX9 A;  2P6E A;  4JD6 A;  2WPW A;  4R87 A;  1VHS A;  2B4D A;  4Q38 A;  4CGO A;  3R9F A;  4ONU A;  4B12 A;  2Z3P A;  2Z3M A;  2FS5 A;  4C2Z A;  1BOB A;  3I9S A;  4CYP A;  1J4J A;  3PP9 A;  3W6X A;  4B13 A;  2HV2 A;  4CGN A;  4CGL A;  2REF A;  3C26 A;  2F5I A;  3FRM A;  2BSW A;  4BMH A;  2Q04 A;  5A28 A;  2ZPA A;  4UWI A;  4XPK A;  1B6B A;  4MFQ A;  1TIQ A;  2KCW A;  1ON0 A;  3QB8 A;  4CRZ B;  2JDC A;  1XE4 A;  5H86 A;  5I0C A;  1RO5 A;  4Y49 C;  4XPL A;  2OH1 A;  5AGE A;  2DPT A;  4I49 A;  2QML A;  3EY5 A;  2P6G A;  5AG4 A;  4KLW A;  5F46 A;  4UCM A;  2Z3L A;  1P0H A;  2QEC A;  4KUB A;  2C27 A;  3D2M A;  4NEX A;  3H5Z A;  3I3G A;  4ZBG A;  3S6G A;  1S7N A;  3G8W A;  4KZT A;  2ZW5 A;  1NE9 A;  1FY7 A;  3WR7 A;  4CGM A;  2Q0Y A;  5FVJ A;  4MFP A;  4CAW A;  4H89 A;  4CYO A;  3R1K A;  2PRB A;  4B10 A;  1YX0 A;  4JXQ A;  5JPH A;  1GHE A;  5A27 A;  4A33 A;  4L89 A;  3EC4 A;  4M85 A;  5C88 A;  3P2F A;  4KS9 A;  4MI4 A;  2NMT A;  2WSA A;  2CNS A;  4KVX A;  2PR8 A;  4PK3 A;  3ZZI A;  3TOB A;  4QBJ A;  3F0A A;  1V0C A;  4A95 A;  2G0B A;  2R7H A;  3TOA A;  5JQ4 A;  4HNW B;  1S3Z A;  3RYO A;  2HUZ A;  2PR1 A;  4C68 A;  4KVO E;  1Q2Y A;  4B11 A;  4QC6 A;  3LOD A;  1ZO0 A;  2FSR A;  3DR6 A;  3FB3 A;  4YRH A;  5AG6 A;  2OU2 A;  4AG7 A;  3S6K A;  4Q36 A;  1MK4 A;  4E2A A;  4U5Y A;  2PSW A;  3MGD A;  1IIC A;  1XF8 A;  3N7Z A;  2ZW7 A;  3R9G A;  4E0A A;  3A9L A;  4J3G A;  4UA3 A;  1I1D A;  1Q2D A;  3IGR A;  1S5K A;  4MFZ A;  5G1Z A;  4KOV A;  3NE7 A;  1WWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...