5A27A

Leishmania major n-myristoyltransferase in complex with a chlorophenyl 1,2,4-oxadiazole inhibitor.
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of High Affinity Inhibitors of Leishmania Donovani N-Myristoyltransferase.
pubmed doi rcsb
source organism Leishmania major
total genus 130
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5a27A00
2YNCC 5AG5A 4B10A 4CGNA 4C2YA 3IU2A 4CGMA 3JTKA 4C68A 4CYPA 5AG7A 3IU1A 4BBHA 2WSAA 4A31A 4CYOA 3IWEA 5A28A 4CYNA 4A95A 2YNCA 4C2XA 5G1ZA 4UFWA 4CAEA 5G22A 4B11A 4UCNA 4UCMA 4B13A 5G21A 4B14A 4UFXA 4CAFA 5G20A 2YNDA 5AGEA 4B12A 4CGLA 2YNEA 4C7IA 4A33A 4CGPA 4CGOA 4CYQA 4A2ZA 5AG6A 4UCPA 5A27A 4C2ZA 3H5ZA 4C7HA 2WUUA 4A30A 4UFVA 5AG4A 4A32A
chains in the Genus database with same CATH superfamily
1PU9A 4WWVA 3H8GA 2CNMA 4R76A 3RYOA 2J8NA 2PR1A 4KUBA 3IU2A 3GIUA 5LYLA 2GLJA 6CPAA 1EE3P 3DR8A 4BBHA 3I1UA 2VBQA 3D68A 3VATA 5I4MA 4MCRA 2Z0ZA 5AG4A 3B7IA 4PV6A 2Q4VA 1IYKA 3DDDA 1ZG7A 2B58A 4MHPA 2IJZA 4HNXB 3LODA 3KASA 5LYIA 4CAFA 1CJWA 1X10A 2VEZA 1YR0A 1I21A 2PJ4A 3D7HA 2XEFA 1BPNA 4R9MA 3EFAA 4CGPA 3W91A 5AG6A 4UCPA 4HNWB 5LRJA 1IOFA 2Q44A 5GCNA 4F9VA 2Z3OA 1R57A 2PC1A 2KCWA 3BJ8A 2VI7A 2IQ6A 3GUXA 2A4NA 3IJ3A 2PIYA 1ARMA 1LAMA 4DJLA 5JH9A 2WSAA 4KSFA 2GIVA 2DF5A 2ZW7A 3EY5A 3QAYA 2WPWA 2IL4A 4KOTA 4NJQA 4MFKA 4Y49B 2CIJA 4NEXA 4ZX8A 4KSIA 5DWNA 3D4UA 1X12A 4MFZA 1NSAA 4CPAA 3D7DA 2PIZA 2J8MA 2PRBA 1VHOA 4GXHA 4OC0A 7CPAA 4OAEA 4MCQA 1XIXA 2ARHA 2ZEPA 5A27A 5IB0A 5F47A 4C2ZA 1K4JA 2NSMA 1MJBA 2AJ6A 3SJEA 3LACA 3BLNA 4GS4A 4CRZB 4CAWA 2ZENA 4NGMA 1YVKA 3CPAA 2EK8A 2BL1A 4M85A 4XPKA 2Z3LA 5JQ4A 2PJ6A 3UY5A 3G8WA 2OZHA 1OZPA 3IIBA 4JLYA 2FIAA 1GHEA 1Q2DA 3F8KA 1S7LA 1RTQA 3OWCA 2ATRA 4B13A 3GKRA 2G3TA 1KWMA 2AFUA 3EO4A 4NXYA 5LRKA 4KUAA 5EC4A 3BI0A 3V8IA 4ZYQA 1Z8XA 1ELMP 2QMLA 2ZEEA 4RS2A 1IY7A 3NE7A 4AG9A 1JWQA 4Y49C 5K8MA 1Z4EA 4CAXA 2OR4A 4H6ZA 4F0YA 2NMTA 5AG5A 2VZZA 1B87A 1MK4A 1LFWA 4FD4A 4NJRA 2FT0A 1BPMA 4MHYA 2QVPA 5KTAA 3R9FA 2PJ0A 5C88A 4P4JA 2DPSA 4EFDA 2ZW5A 4FAIA 1BOBA 3DR6A 4Q36A 3SXNA 3KR5A 3FIXA 3PP9A 5K8NA 1L0CA 3TOBA 1Q2CA 4B5OA 5G22A 2R7HA 3GY9A 1LCPA 3WABA 4UFXA 5JPHA 1U6MA 4FBEA 5HVGA 4NGRA 2RFHA 1IU8A 1S7KA 3FJUA 4Q7AA 2AFSA 1NSLA 3KQZA 3FH4A 2V77A 3PRTA 2GANA 4UEZA 4UWJA 1Y0RA 3FEDA 3FYNA 4MY0A 1MJAA 1ZLIA 3CXPA 4II9A 5IB9A 3D66A 1XMBA 4R3KA 1SQHA 4ZY2A 1YQEA 4ORFA 3JUWA 3K9TA 1GYTA 3T8WA 3S6FA 1XOVA 3CXQA 2AFWA 3PBBA 4MFLA 3RAMA 2EK9A 4KORA 3VWEA 1UFHA 1CP7A 3P2HA 4CYOA 5A28A 1Y9WA 2GLFA 5BWAB 2C6GA 2AFOA 2YNCA 3BXMA 2BUEA 4A95A 2CTCA 1R3NA 3WC5A 2C1CA 2G0BA 2WZNA 3D7FA 2ZEGA 2PJ9A 2EBJA 4UCNA 1WWZA 2D4OA 2Z3MA 4R57A 4UCMA 3D2MA 3MGDA 5DWMA 3PB7X 3I3GA 5DS0A 4F6AA 2FE7A 2IMOA 4LQ6A 4AG7A 4R6TA 1ON0A 4NCZA 4CGLA 2EUIA 1A2ZA 3EXNA 4CAVA 1TF9A 2ZXVA 2VZYA 4CYQA 2AFMA 2JDCA 1Y9KA 5JGFA 1LAPA 3BJ7A 3PB8X 3QAHA 4PSWA 2YNCC 3TTHA 3B3TA 4L89A 1R43A 4KSAA 4RN7A 4UIBA 4KS9A 3JVNA 2GREA 4OC5A 3SXOA 3CDXA 2XEJA 1NE9A 2Z3KA 4A38A 4X3RA 3HLPA 4CAEA 4AB7A 4B11A 1M4DA 2PJBA 3QB8A 4QUSA 4CS0B 3PBEA 2Z10A 5HVFA 3IFEA 3C26A 4WJBA 2HV2A 2PDOA 2QECA 4B12A 1P0HA 3FEEA 2K5TA 4MHDA 3KQXA 1UWYA 4P4FA 2DEAA 3KL9A 4MMOA 3RZAA 2ZEMA 3LD2A 4PQAA 2REFA 4F8ZA 4A30A 4UFVA 4NGSA 2V8VA 1QSMA 4JWPA 4JXQA 2Q4YA 2FL4A 5J1QA 1J4JA 3KGQA 3F5BA 1M44A 2P0WA 1TKFA 2PJ5A 2XEIA 4P4BA 1TF8A 4UEEA 4OMEA 4XPDC 3SJXA 3PZJA 4QB9A 3FNCA 4KLVA 2Q7BA 1Z8WA 3R95A 2OZUA 1FY7A 4R7MA 3VARA 2OZGA 1AUGA 4FD7A 4B14A 1TXRA 3TO7A 2HB6A 2AE6A 2P6EA 1CP6A 4AVAA 4BD9A 2P6FA 4IUSA 1S7FA 3B3CA 4OLLA 3TE4A 2C27A 3QNVA 4AVCA 3B3WA 3WT4A 4MXUA 5C82A 5EMIA 1VHSA 2NYQA 2BEIA 3H8FA 3JRUA 2P6GA 4NGQA 2I00A 2VXKA 1ZG8A 2FXFA 3KI9A 2I79A 4B6ZA 3NE8A 2GFQA 3IU1A 4L8AA 3F0AA 4PXBA 1Y7EA 1Z2LA 2PE3A 3D67A 2F8HA 3S9MA 1OBRA 3CZXA 5D8NA 2CF4A 4P6YA 4E8OA 1V0CA 4UIAA 4B5PB 2Q7SA 5K8OA 4KOUA 3CT9A 2J8RA 2ZW6A 4MFJA 4M6IA 4A37A 3SI1A 2WYRA 3IGRA 2JDDA 3PFOA 5K8PA 4OKOA 4A33A 4OC4A 4PK3A 4YWYA 4DUKA 5CNPA 4MY3A 2ANPA 4KOWA 4PXDA 2PVVA 3S6KA 2Z11A 5JM6A 3RNZA 2GE3A 1Z4RA 4F9UA 1XRYA 1LRZA 3JTKA 4P44A 3G3SA 4K30A 1XBUA 4YU9A 3IWEA 1Q7LA 3K2KA 4R3LA 4UWIA 4C2XA 2WPXA 2Z3PA 3HUVA 1XEBA 1B6BA 2OB0A 3B3VA 3N7ZA 1NMTA 2O4HA 4QC6A 4B5PA 4W9YA 4NF1A 4U9YA 3NH4A 2ZELA 1LOKA 2B3VA 1KUVA 2HUZA 5AGEA 5KTCA 8CPAA 4KOVA 2DXQA 2FCKA 1QSRA 2DPTA 3RBUA 2B4BA 1JQGA 2PJ8A 2QYVA 2CNTA 2WUUA 4JJXA 3TX8A 5KTDA 1TIQA 3ISXA 1F57A 5HVHA 1YSJA 2B5GB 3S9NA 3FMCA 4EVYA 3FX6A 3PB9X 4X5KA 2I3CA 4EWTA 4ZI6A 4ZY1A 5HMNA 4R8FA 1CPXA 2JEVA 3DLJA 3D8PA 1Z9UA 1QQ9A 3DSBA 1Z8TA 2OOTA 5EBVA 3H8EA 4XPLA 3VH9A 1ZO0A 4J3GA 3VWDA 4GM5A 4BMHA 1YW6A 4CRYB 2PJCA 4P4EA 3RO0A 4MRIA 4H89A 4FD6A 3SJFA 1BLLE 3R9GA 3N5FA 1Z5RA 4M6HA 4MI4A 3NH8A 2Q4ZA 3A9LA 2CTBA 4PXEA 5I0CA 2R8VA 3PEIA 2ZOFA 4MBUA 4EMEA 1DTDA 2V8GA 4B10A 1S60A 2B5GA 3K9UA 1HEEA 4OADA 1I12A 2EWBA 2J9AA 3D7GA 4M3SA 5F09A 2H5MA 4A39A 1DE4C 4CYNA 3GLJA 1YLEA 5IX3A 1TKJA 1YLOA 4P4IA 3PFEA 3PGPA 5H84A 2JBKA 3R1KA 1Y0YA 4KOYA 4NSQA 3FECA 2AFZA 4UFWA 3E0KA 4M6GA 4O23A 4H6UA 4NGPA 2B3UA 5H86A 1XE4A 1YW4A 4AXVA 5IV0A 1AYEA 3R9EA 3B2YA 2GU2A 2HQYA 4KOXA 3TC8A 1Y7RA 2HC9A 2JEWA 1YX0A 1ZG9A 2REEA 1KUYA 5J8FA 1RO5A 5FVJA 1M1DA 3KR4A 2ZOGA 2PJAA 3EC4A 4ONWA 4ZX9A 3ISZA 3S6HA 3SI0A 3W6XA 4NGTA 2VQYA 4CGNA 3IO1A 1TKHA 1IICA 2PJ2A 1IIDA 5F49A 2ZEOA 3B8GA 2ZEDA 1YK3A 5F48A 3MRUA 2Q0YA 4ZGYB 1ARLA 3CXSA 4MJ8A 2PJ3A 2Q51A 4NFRA 2PSWA 2EVNA 2FSRA 4TNUA 3FRMA 1QSNA 3P2FA 1F2PA 2B4DB 4Z65A 3FVLA 3TO9A 4ZY0A 2V8HA 5G20A 3WC7A 2OU2A 3IWGA 5LYFA 4U5YA 4ZBGA 1IOIA 4LUAA 1AMPA 1FT7A 1LANA 1M4IA 1VHEA 3FBUA 3R96A 4F0XA 2PVWA 1PYTB 3V7ZA 4MCSA 2AFXA 1KUXA 3BHXA 3SJGA 5HXDA 3KHXA 2Y0MA 1XMTA 3T90A 4CGMA 1M4LA 3GB0A 3I9SA 1S3ZA 1Z8LA 2FS5A 3WC6A 1PUAA 2Z3NA 4YFJA 3TFYA 4KVXA 3S6GA 4AVBA 3S9LA 4UA3A 4K3NA 5HH1A 3ZZIA 5G1ZA 1WK4A 2D4PA 2ZPAA 2B4DA 4JYWA 4ONUA 4RI1A 2RC4A 3L2NA 2PR8A 2Q43A 4XNHB 4YRHA 4MFQA 4JZ0A 2JLMA 3WR7A 2F7VA 3NA6A 2JBJA 1F2OA 5ELYA 1QSTA 3D3SA 3IC1A 4H2KA 2PRQA 2ZEHA 5LRGA 5F46A 4Q38A 4OP4A 4UEFA 1YVOA 1YREA 4LQGA 2C6PA 3FB3A 2C6CA 4R87A 5CPAA 1H8LA 4C2YA 1HDUA 5D29A 4A94A 1KZFA 2Q04A 3PB6X 1VGYA 2O53A 4A31A 1CG2A 2R1IA 4IHMA 3BI1A 1IB1E 4QVTA 2PQ8A 2YGWA 1QSOA 1M4GA 4HKFA 2XEGA 3DNSA 1S5KA 4MHNA 2BSWA 4DNCA 1YMEA 3B3SA 4P4DA 4IF5A 1CM0A 4PPZA 2YNEA 5E96A 3ZJ0A 4CGOA 2FIWA 1XFOA 2FVGA 4A2ZA 1YGHA 3GYAA 4PSXA 2ODFA 4KZTA 4OC3A 3TO6A 1BO4A 2BO9A 1ELLP 1PCAA 4HPSA 4X2TA 4A32A 1CBXA 2QIRA 2OH1A 3TT2A 3W6SA 1Q2YA 3SI2A 4OC2A 4C68A 2RB7A 1S7NA 4KLWA 4MFPA 3IEHA 4XNHC 4FUUA 4G1PA 4P10A 4RUHA 4LX9A 1XF8A 5J8CA 4X8IA 2V8DA 2BOAA 4P45A 3B35A 5CBMA 1MJ9A 2POKA 4IK2A 4DYOA 4QBJA 4TWEA 3FF3A 1P4NA 3H4QA 2PJ7A 2CXAA 3KZWA 3TCVA 1XJOA 4FD5A 3D2PA 4BINA 3NH5A 1QMUA 3SHPA 4MHZA 3NFZA 4C7HA 4KVME 4OC1A 2CY2A 4OIWA 3FXTA 4FWUA 1RXTA 2F5IA 4JD6A 2QJ8A 2CNSA 2X7BA 3IWWA 1I1DA 4U9ZA 4IAVA 4CYPA 5AG7A 1ZLHA 4KOSA 5THWA 3PB4X 4UF4A 3TOAA 2G3AA 2VL1A 4JXRA 2ZEFA 4OIDA 4I49A 1VIXA 4MCPA 2ZW4A 1FNOA 3KHZA 4YGOA 1N71A 4PXCA 2ABZA 5ISVA 4E2AA 1IGBA 4NGNA 5G21A 4UBRA 1VKCA 2G9DA 4HNYB 4KVOE 4XPDB 2YNDA 3KKWA 3LWUA 3MN8A 3V38A 3LMSA 2R98A 1CX8A 3DGVA 4C7IA 4PK2A 1IYLA 2BCOA 1BAVA 3T9YA 4E0AA 2O28A 1CPSA 3H5ZA 2PJ1A 1HDQA 5LYDA 2EO8A 3CPXA 2PCUA
chains in the Genus database with same CATH topology
1PU9A 2CNMA 3RYOA 2J8NA 2PR1A 4KUBA 3IU2A 4BBHA 3DR8A 2VBQA 2Z0ZA 4PV6A 2Q4VA 1IYKA 3DDDA 2B58A 4HNXB 3LODA 4CAFA 1CJWA 2VEZA 1YR0A 1I21A 4R9MA 3EFAA 4CGPA 3W91A 5AG6A 4UCPA 4HNWB 2Q44A 5GCNA 2Z3OA 1R57A 2PC1A 2KCWA 3BJ8A 2VI7A 2A4NA 2WSAA 4KSFA 2GIVA 2ZW7A 3EY5A 4KOTA 2WPWA 2IL4A 4Y49B 4MFKA 4NEXA 5DWNA 4MFZA 2J8MA 2PRBA 4OAEA 1XIXA 2ARHA 5A27A 5IB0A 5F47A 4C2ZA 1K4JA 1MJBA 2AJ6A 3BLNA 4GS4A 4CRZB 4CAWA 1YVKA 2BL1A 4M85A 4XPKA 5JQ4A 3UY5A 3G8WA 2OZHA 1OZPA 4JLYA 2FIAA 1GHEA 1Q2DA 3F8KA 1S7LA 3OWCA 2ATRA 4B13A 3GKRA 2G3TA 4NXYA 3EO4A 4KUAA 5EC4A 3V8IA 2QMLA 4RS2A 3NE7A 4AG9A 4Y49C 1Z4EA 4CAXA 4H6ZA 4F0YA 2NMTA 5AG5A 2VZZA 1B87A 1MK4A 4FD4A 2FT0A 5KTAA 3R9FA 5C88A 2DPSA 2ZW5A 1BOBA 3DR6A 4Q36A 3SXNA 3FIXA 3PP9A 1L0CA 3TOBA 1Q2CA 4B5OA 5G22A 2R7HA 3GY9A 4UFXA 5JPHA 1U6MA 1S7KA 1NSLA 2GANA 4UWJA 3FYNA 4MY0A 1MJAA 3CXPA 4II9A 4R3KA 1SQHA 4ORFA 3JUWA 3CXQA 4MFLA 4KORA 3VWEA 1UFHA 3P2HA 4CYOA 5A28A 1Y9WA 5BWAB 4A95A 2YNCA 2BUEA 2G0BA 3S6FA 4UCNA 1WWZA 2D4OA 2Z3MA 4R57A 4UCMA 3D2MA 3MGDA 5DWMA 4F6AA 3I3GA 2FE7A 4AG7A 1ON0A 4NCZA 4CGLA 2EUIA 3EXNA 4CAVA 4CYQA 2ZXVA 2VZYA 2JDCA 1Y9KA 3BJ7A 3QAHA 4PSWA 2YNCC 3TTHA 4L89A 4KSAA 4KS9A 3JVNA 3SXOA 1NE9A 2Z3KA 4CAEA 4AB7A 4B11A 1M4DA 4QUSA 3QB8A 4CS0B 2Z10A 3C26A 2HV2A 2PDOA 2QECA 4B12A 1P0HA 2K5TA 4MHDA 3LD2A 2REFA 4A30A 4UFVA 1QSMA 4JWPA 4JXQA 2Q4YA 2FL4A 1J4JA 3F5BA 1M44A 2P0WA 4XPDC 3PZJA 4QB9A 3FNCA 4KLVA 2Q7BA 3R95A 2OZUA 1FY7A 2OZGA 4FD7A 4B14A 3TO7A 2P6EA 2AE6A 4AVAA 2P6FA 4IUSA 1S7FA 4OLLA 3TE4A 2C27A 4AVCA 5C82A 1VHSA 2BEIA 2P6GA 2I00A 2VXKA 2FXFA 2I79A 3IU1A 4L8AA 3F0AA 4E8OA 1V0CA 4B5PB 4KOUA 4MFJA 2J8RA 2ZW6A 3IGRA 2JDDA 4A33A 4PK3A 5CNPA 4MY3A 4KOWA 3S6KA 2Z11A 2GE3A 1Z4RA 1LRZA 3JTKA 3G3SA 4K30A 3IWEA 4R3LA 4UWIA 4C2XA 2WPXA 2Z3PA 1XEBA 1B6BA 2OB0A 3N7ZA 1NMTA 4QC6A 4B5PA 4NF1A 4U9YA 2B3VA 1KUVA 2HUZA 5AGEA 5KTCA 4KOVA 2DXQA 2FCKA 1QSRA 2DPTA 2B4BA 2CNTA 2WUUA 4JJXA 5KTDA 1TIQA 2B5GB 4EVYA 4X5KA 5HMNA 2JEVA 3D8PA 1Z9UA 3DSBA 5EBVA 4XPLA 3VWDA 1ZO0A 4J3GA 4BMHA 4CRYB 4H89A 4FD6A 3R9GA 4MI4A 3A9LA 5I0CA 2R8VA 4MBUA 4B10A 1S60A 2B5GA 3K9UA 4OADA 1I12A 4M3SA 2H5MA 4CYNA 1YLEA 5IX3A 5H84A 3PGPA 3R1KA 4KOYA 4NSQA 4UFWA 3E0KA 4H6UA 5H86A 2B3UA 1XE4A 5IV0A 3R9EA 2HQYA 4KOXA 1Y7RA 1YX0A 2REEA 1KUYA 5J8FA 1RO5A 5FVJA 1M1DA 3EC4A 3W6XA 3S6HA 2VQYA 4CGNA 1IICA 1IIDA 5F49A 3B8GA 1YK3A 5F48A 4ZGYB 2Q0YA 3CXSA 4MJ8A 2PSWA 2EVNA 2FSRA 3FRMA 1QSNA 3P2FA 2B4DB 3TO9A 5G20A 2OU2A 3IWGA 4U5YA 4ZBGA 4LUAA 4F0XA 1M4IA 3FBUA 3R96A 1KUXA 2Y0MA 1XMTA 3T90A 4CGMA 3I9SA 1S3ZA 2FS5A 4YFJA 1PUAA 2Z3NA 3TFYA 4KVXA 3S6GA 4AVBA 4UA3A 5HH1A 3ZZIA 5G1ZA 1WK4A 2D4PA 2ZPAA 2B4DA 4ONUA 4RI1A 2RC4A 2PR8A 4XNHB 4YRHA 4MFQA 2JLMA 3WR7A 1QSTA 3D3SA 5F46A 4Q38A 5AG4A 1YVOA 1YREA 3FB3A 4R87A 4C2YA 1KZFA 2Q04A 4A31A 2R1IA 1IB1E 4QVTA 2PQ8A 2YGWA 1QSOA 1M4GA 4HKFA 3DNSA 1S5KA 2BSWA 4DNCA 4IF5A 1CM0A 2YNEA 5E96A 3ZJ0A 4CGOA 2FIWA 4A2ZA 1YGHA 3GYAA 4PSXA 4KZTA 3TO6A 1BO4A 4A32A 2QIRA 2OH1A 3TT2A 3W6SA 1Q2YA 4C68A 4KLWA 1S7NA 4MFPA 4XNHC 4LX9A 1XF8A 5J8CA 1MJ9A 4QBJA 1P4NA 3H4QA 2CXAA 3TCVA 4FD5A 3D2PA 3SHPA 4C7HA 4KVME 2CY2A 3FXTA 1RXTA 2F5IA 4JD6A 2CNSA 2X7BA 1I1DA 4U9ZA 4CYPA 5AG7A 4KOSA 3TOAA 2G3AA 4JXRA 4I49A 4YGOA 2ZW4A 1N71A 5ISVA 4E2AA 5G21A 4UBRA 1VKCA 4HNYB 4KVOE 4XPDB 2YNDA 3KKWA 2R98A 4C7IA 4PK2A 1IYLA 3T9YA 4E0AA 2O28A 3H5ZA 2Z3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNC C;  5AG5 A;  4B10 A;  4CGN A;  4C2Y A;  3IU2 A;  4CGM A;  3JTK A;  4C68 A;  4CYP A;  5AG7 A;  3IU1 A;  4BBH A;  2WSA A;  4A31 A;  4CYO A;  3IWE A;  5A28 A;  4CYN A;  4A95 A;  2YNC A;  4C2X A;  5G1Z A;  4UFW A;  4CAE A;  5G22 A;  4B11 A;  4UCN A;  4UCM A;  4B13 A;  5G21 A;  4B14 A;  4UFX A;  4CAF A;  5G20 A;  2YND A;  5AGE A;  4B12 A;  4CGL A;  2YNE A;  4C7I A;  4A33 A;  4CGP A;  4CGO A;  4CYQ A;  4A2Z A;  5AG6 A;  4UCP A;  5A27 A;  4C2Z A;  3H5Z A;  4C7H A;  2WUU A;  4A30 A;  4UFV A;  5AG4 A;  4A32 A; 
#chains in the Genus database with same CATH topology
 1PU9 A;  4WWV A;  3H8G A;  2CNM A;  4R76 A;  3RYO A;  2J8N A;  2PR1 A;  4KUB A;  3IU2 A;  3GIU A;  5LYL A;  2GLJ A;  6CPA A;  1EE3 P;  3DR8 A;  4BBH A;  3I1U A;  2VBQ A;  3D68 A;  3VAT A;  5I4M A;  4MCR A;  2Z0Z A;  5AG4 A;  3B7I A;  4PV6 A;  2Q4V A;  1IYK A;  3DDD A;  1ZG7 A;  2B58 A;  4MHP A;  2IJZ A;  4HNX B;  3LOD A;  3KAS A;  5LYI A;  4CAF A;  1CJW A;  1X10 A;  2VEZ A;  1YR0 A;  1I21 A;  2PJ4 A;  3D7H A;  2XEF A;  1BPN A;  4R9M A;  3EFA A;  4CGP A;  3W91 A;  5AG6 A;  4UCP A;  4HNW B;  5LRJ A;  1IOF A;  2Q44 A;  5GCN A;  4F9V A;  2Z3O A;  1R57 A;  2PC1 A;  2KCW A;  3BJ8 A;  2VI7 A;  2IQ6 A;  3GUX A;  2A4N A;  3IJ3 A;  2PIY A;  1ARM A;  1LAM A;  4DJL A;  5JH9 A;  2WSA A;  4KSF A;  2GIV A;  2DF5 A;  2ZW7 A;  3EY5 A;  3QAY A;  2WPW A;  2IL4 A;  4KOT A;  4NJQ A;  4MFK A;  4Y49 B;  2CIJ A;  4NEX A;  4ZX8 A;  4KSI A;  5DWN A;  3D4U A;  1X12 A;  4MFZ A;  1NSA A;  4CPA A;  3D7D A;  2PIZ A;  2J8M A;  2PRB A;  1VHO A;  4GXH A;  4OC0 A;  7CPA A;  4OAE A;  4MCQ A;  1XIX A;  2ARH A;  2ZEP A;  5A27 A;  5IB0 A;  5F47 A;  4C2Z A;  1K4J A;  2NSM A;  1MJB A;  2AJ6 A;  3SJE A;  3LAC A;  3BLN A;  4GS4 A;  4CRZ B;  4CAW A;  2ZEN A;  4NGM A;  1YVK A;  3CPA A;  2EK8 A;  2BL1 A;  4M85 A;  4XPK A;  2Z3L A;  5JQ4 A;  2PJ6 A;  3UY5 A;  3G8W A;  2OZH A;  1OZP A;  3IIB A;  4JLY A;  2FIA A;  1GHE A;  1Q2D A;  3F8K A;  1S7L A;  1RTQ A;  3OWC A;  2ATR A;  4B13 A;  3GKR A;  2G3T A;  1KWM A;  2AFU A;  3EO4 A;  4NXY A;  5LRK A;  4KUA A;  5EC4 A;  3BI0 A;  3V8I A;  4ZYQ A;  1Z8X A;  1ELM P;  2QML A;  2ZEE A;  4RS2 A;  1IY7 A;  3NE7 A;  4AG9 A;  1JWQ A;  4Y49 C;  5K8M A;  1Z4E A;  4CAX A;  2OR4 A;  4H6Z A;  4F0Y A;  2NMT A;  5AG5 A;  2VZZ A;  1B87 A;  1MK4 A;  1LFW A;  4FD4 A;  4NJR A;  2FT0 A;  1BPM A;  4MHY A;  2QVP A;  5KTA A;  3R9F A;  2PJ0 A;  5C88 A;  4P4J A;  2DPS A;  4EFD A;  2ZW5 A;  4FAI A;  1BOB A;  3DR6 A;  4Q36 A;  3SXN A;  3KR5 A;  3FIX A;  3PP9 A;  5K8N A;  1L0C A;  3TOB A;  1Q2C A;  4B5O A;  5G22 A;  2R7H A;  3GY9 A;  1LCP A;  3WAB A;  4UFX A;  5JPH A;  1U6M A;  4FBE A;  5HVG A;  4NGR A;  2RFH A;  1IU8 A;  1S7K A;  3FJU A;  4Q7A A;  2AFS A;  1NSL A;  3KQZ A;  3FH4 A;  2V77 A;  3PRT A;  2GAN A;  4UEZ A;  4UWJ A;  1Y0R A;  3FED A;  3FYN A;  4MY0 A;  1MJA A;  1ZLI A;  3CXP A;  4II9 A;  5IB9 A;  3D66 A;  1XMB A;  4R3K A;  1SQH A;  4ZY2 A;  1YQE A;  4ORF A;  3JUW A;  3K9T A;  1GYT A;  3T8W A;  3S6F A;  1XOV A;  3CXQ A;  2AFW A;  3PBB A;  4MFL A;  3RAM A;  2EK9 A;  4KOR A;  3VWE A;  1UFH A;  1CP7 A;  3P2H A;  4CYO A;  5A28 A;  1Y9W A;  2GLF A;  5BWA B;  2C6G A;  2AFO A;  2YNC A;  3BXM A;  2BUE A;  4A95 A;  2CTC A;  1R3N A;  3WC5 A;  2C1C A;  2G0B A;  2WZN A;  3D7F A;  2ZEG A;  2PJ9 A;  2EBJ A;  4UCN A;  1WWZ A;  2D4O A;  2Z3M A;  4R57 A;  4UCM A;  3D2M A;  3MGD A;  5DWM A;  3PB7 X;  3I3G A;  5DS0 A;  4F6A A;  2FE7 A;  2IMO A;  4LQ6 A;  4AG7 A;  4R6T A;  1ON0 A;  4NCZ A;  4CGL A;  2EUI A;  1A2Z A;  3EXN A;  4CAV A;  1TF9 A;  2ZXV A;  2VZY A;  4CYQ A;  2AFM A;  2JDC A;  1Y9K A;  5JGF A;  1LAP A;  3BJ7 A;  3PB8 X;  3QAH A;  4PSW A;  2YNC C;  3TTH A;  3B3T A;  4L89 A;  1R43 A;  4KSA A;  4RN7 A;  4UIB A;  4KS9 A;  3JVN A;  2GRE A;  4OC5 A;  3SXO A;  3CDX A;  2XEJ A;  1NE9 A;  2Z3K A;  4A38 A;  4X3R A;  3HLP A;  4CAE A;  4AB7 A;  4B11 A;  1M4D A;  2PJB A;  3QB8 A;  4QUS A;  4CS0 B;  3PBE A;  2Z10 A;  5HVF A;  3IFE A;  3C26 A;  4WJB A;  2HV2 A;  2PDO A;  2QEC A;  4B12 A;  1P0H A;  3FEE A;  2K5T A;  4MHD A;  3KQX A;  1UWY A;  4P4F A;  2DEA A;  3KL9 A;  4MMO A;  3RZA A;  2ZEM A;  3LD2 A;  4PQA A;  2REF A;  4F8Z A;  4A30 A;  4UFV A;  4NGS A;  2V8V A;  1QSM A;  4JWP A;  4JXQ A;  2Q4Y A;  2FL4 A;  5J1Q A;  1J4J A;  3KGQ A;  3F5B A;  1M44 A;  2P0W A;  1TKF A;  2PJ5 A;  2XEI A;  4P4B A;  1TF8 A;  4UEE A;  4OME A;  4XPD C;  3SJX A;  3PZJ A;  4QB9 A;  3FNC A;  4KLV A;  2Q7B A;  1Z8W A;  3R95 A;  2OZU A;  1FY7 A;  4R7M A;  3VAR A;  2OZG A;  1AUG A;  4FD7 A;  4B14 A;  1TXR A;  3TO7 A;  2HB6 A;  2AE6 A;  2P6E A;  1CP6 A;  4AVA A;  4BD9 A;  2P6F A;  4IUS A;  1S7F A;  3B3C A;  4OLL A;  3TE4 A;  2C27 A;  3QNV A;  4AVC A;  3B3W A;  3WT4 A;  4MXU A;  5C82 A;  5EMI A;  1VHS A;  2NYQ A;  2BEI A;  3H8F A;  3JRU A;  2P6G A;  4NGQ A;  2I00 A;  2VXK A;  1ZG8 A;  2FXF A;  3KI9 A;  2I79 A;  4B6Z A;  3NE8 A;  2GFQ A;  3IU1 A;  4L8A A;  3F0A A;  4PXB A;  1Y7E A;  1Z2L A;  2PE3 A;  3D67 A;  2F8H A;  3S9M A;  1OBR A;  3CZX A;  5D8N A;  2CF4 A;  4P6Y A;  4E8O A;  1V0C A;  4UIA A;  4B5P B;  2Q7S A;  5K8O A;  4KOU A;  3CT9 A;  2J8R A;  2ZW6 A;  4MFJ A;  4M6I A;  4A37 A;  3SI1 A;  2WYR A;  3IGR A;  2JDD A;  3PFO A;  5K8P A;  4OKO A;  4A33 A;  4OC4 A;  4PK3 A;  4YWY A;  4DUK A;  5CNP A;  4MY3 A;  2ANP A;  4KOW A;  4PXD A;  2PVV A;  3S6K A;  2Z11 A;  5JM6 A;  3RNZ A;  2GE3 A;  1Z4R A;  4F9U A;  1XRY A;  1LRZ A;  3JTK A;  4P44 A;  3G3S A;  4K30 A;  1XBU A;  4YU9 A;  3IWE A;  1Q7L A;  3K2K A;  4R3L A;  4UWI A;  4C2X A;  2WPX A;  2Z3P A;  3HUV A;  1XEB A;  1B6B A;  2OB0 A;  3B3V A;  3N7Z A;  1NMT A;  2O4H A;  4QC6 A;  4B5P A;  4W9Y A;  4NF1 A;  4U9Y A;  3NH4 A;  2ZEL A;  1LOK A;  2B3V A;  1KUV A;  2HUZ A;  5AGE A;  5KTC A;  8CPA A;  4KOV A;  2DXQ A;  2FCK A;  1QSR A;  2DPT A;  3RBU A;  2B4B A;  1JQG A;  2PJ8 A;  2QYV A;  2CNT A;  2WUU A;  4JJX A;  3TX8 A;  5KTD A;  1TIQ A;  3ISX A;  1F57 A;  5HVH A;  1YSJ A;  2B5G B;  3S9N A;  3FMC A;  4EVY A;  3FX6 A;  3PB9 X;  4X5K A;  2I3C A;  4EWT A;  4ZI6 A;  4ZY1 A;  5HMN A;  4R8F A;  1CPX A;  2JEV A;  3DLJ A;  3D8P A;  1Z9U A;  1QQ9 A;  3DSB A;  1Z8T A;  2OOT A;  5EBV A;  3H8E A;  4XPL A;  3VH9 A;  1ZO0 A;  4J3G A;  3VWD A;  4GM5 A;  4BMH A;  1YW6 A;  4CRY B;  2PJC A;  4P4E A;  3RO0 A;  4MRI A;  4H89 A;  4FD6 A;  3SJF A;  1BLL E;  3R9G A;  3N5F A;  1Z5R A;  4M6H A;  4MI4 A;  3NH8 A;  2Q4Z A;  3A9L A;  2CTB A;  4PXE A;  5I0C A;  2R8V A;  3PEI A;  2ZOF A;  4MBU A;  4EME A;  1DTD A;  2V8G A;  4B10 A;  1S60 A;  2B5G A;  3K9U A;  1HEE A;  4OAD A;  1I12 A;  2EWB A;  2J9A A;  3D7G A;  4M3S A;  5F09 A;  2H5M A;  4A39 A;  1DE4 C;  4CYN A;  3GLJ A;  1YLE A;  5IX3 A;  1TKJ A;  1YLO A;  4P4I A;  3PFE A;  3PGP A;  5H84 A;  2JBK A;  3R1K A;  1Y0Y A;  4KOY A;  4NSQ A;  3FEC A;  2AFZ A;  4UFW A;  3E0K A;  4M6G A;  4O23 A;  4H6U A;  4NGP A;  2B3U A;  5H86 A;  1XE4 A;  1YW4 A;  4AXV A;  5IV0 A;  1AYE A;  3R9E A;  3B2Y A;  2GU2 A;  2HQY A;  4KOX A;  3TC8 A;  1Y7R A;  2HC9 A;  2JEW A;  1YX0 A;  1ZG9 A;  2REE A;  1KUY A;  5J8F A;  1RO5 A;  5FVJ A;  1M1D A;  3KR4 A;  2ZOG A;  2PJA A;  3EC4 A;  4ONW A;  4ZX9 A;  3ISZ A;  3S6H A;  3SI0 A;  3W6X A;  4NGT A;  2VQY A;  4CGN A;  3IO1 A;  1TKH A;  1IIC A;  2PJ2 A;  1IID A;  5F49 A;  2ZEO A;  3B8G A;  2ZED A;  1YK3 A;  5F48 A;  3MRU A;  2Q0Y A;  4ZGY B;  1ARL A;  3CXS A;  4MJ8 A;  2PJ3 A;  2Q51 A;  4NFR A;  2PSW A;  2EVN A;  2FSR A;  4TNU A;  3FRM A;  1QSN A;  3P2F A;  1F2P A;  2B4D B;  4Z65 A;  3FVL A;  3TO9 A;  4ZY0 A;  2V8H A;  5G20 A;  3WC7 A;  2OU2 A;  3IWG A;  5LYF A;  4U5Y A;  4ZBG A;  1IOI A;  4LUA A;  1AMP A;  1FT7 A;  1LAN A;  1M4I A;  1VHE A;  3FBU A;  3R96 A;  4F0X A;  2PVW A;  1PYT B;  3V7Z A;  4MCS A;  2AFX A;  1KUX A;  3BHX A;  3SJG A;  5HXD A;  3KHX A;  2Y0M A;  1XMT A;  3T90 A;  4CGM A;  1M4L A;  3GB0 A;  3I9S A;  1S3Z A;  1Z8L A;  2FS5 A;  3WC6 A;  1PUA A;  2Z3N A;  4YFJ A;  3TFY A;  4KVX A;  3S6G A;  4AVB A;  3S9L A;  4UA3 A;  4K3N A;  5HH1 A;  3ZZI A;  5G1Z A;  1WK4 A;  2D4P A;  2ZPA A;  2B4D A;  4JYW A;  4ONU A;  4RI1 A;  2RC4 A;  3L2N A;  2PR8 A;  2Q43 A;  4XNH B;  4YRH A;  4MFQ A;  4JZ0 A;  2JLM A;  3WR7 A;  2F7V A;  3NA6 A;  2JBJ A;  1F2O A;  5ELY A;  1QST A;  3D3S A;  3IC1 A;  4H2K A;  2PRQ A;  2ZEH A;  5LRG A;  5F46 A;  4Q38 A;  4OP4 A;  4UEF A;  1YVO A;  1YRE A;  4LQG A;  2C6P A;  3FB3 A;  2C6C A;  4R87 A;  5CPA A;  1H8L A;  4C2Y A;  1HDU A;  5D29 A;  4A94 A;  1KZF A;  2Q04 A;  3PB6 X;  1VGY A;  2O53 A;  4A31 A;  1CG2 A;  2R1I A;  4IHM A;  3BI1 A;  1IB1 E;  4QVT A;  2PQ8 A;  2YGW A;  1QSO A;  1M4G A;  4HKF A;  2XEG A;  3DNS A;  1S5K A;  4MHN A;  2BSW A;  4DNC A;  1YME A;  3B3S A;  4P4D A;  4IF5 A;  1CM0 A;  4PPZ A;  2YNE A;  5E96 A;  3ZJ0 A;  4CGO A;  2FIW A;  1XFO A;  2FVG A;  4A2Z A;  1YGH A;  3GYA A;  4PSX A;  2ODF A;  4KZT A;  4OC3 A;  3TO6 A;  1BO4 A;  2BO9 A;  1ELL P;  1PCA A;  4HPS A;  4X2T A;  4A32 A;  1CBX A;  2QIR A;  2OH1 A;  3TT2 A;  3W6S A;  1Q2Y A;  3SI2 A;  4OC2 A;  4C68 A;  2RB7 A;  1S7N A;  4KLW A;  4MFP A;  3IEH A;  4XNH C;  4FUU A;  4G1P A;  4P10 A;  4RUH A;  4LX9 A;  1XF8 A;  5J8C A;  4X8I A;  2V8D A;  2BOA A;  4P45 A;  3B35 A;  5CBM A;  1MJ9 A;  2POK A;  4IK2 A;  4DYO A;  4QBJ A;  4TWE A;  3FF3 A;  1P4N A;  3H4Q A;  2PJ7 A;  2CXA A;  3KZW A;  3TCV A;  1XJO A;  4FD5 A;  3D2P A;  4BIN A;  3NH5 A;  1QMU A;  3SHP A;  4MHZ A;  3NFZ A;  4C7H A;  4KVM E;  4OC1 A;  2CY2 A;  4OIW A;  3FXT A;  4FWU A;  1RXT A;  2F5I A;  4JD6 A;  2QJ8 A;  2CNS A;  2X7B A;  3IWW A;  1I1D A;  4U9Z A;  4IAV A;  4CYP A;  5AG7 A;  1ZLH A;  4KOS A;  5THW A;  3PB4 X;  4UF4 A;  3TOA A;  2G3A A;  2VL1 A;  4JXR A;  2ZEF A;  4OID A;  4I49 A;  1VIX A;  4MCP A;  2ZW4 A;  1FNO A;  3KHZ A;  4YGO A;  1N71 A;  4PXC A;  2ABZ A;  5ISV A;  4E2A A;  1IGB A;  4NGN A;  5G21 A;  4UBR A;  1VKC A;  2G9D A;  4HNY B;  4KVO E;  4XPD B;  2YND A;  3KKW A;  3LWU A;  3MN8 A;  3V38 A;  3LMS A;  2R98 A;  1CX8 A;  3DGV A;  4C7I A;  4PK2 A;  1IYL A;  2BCO A;  1BAV A;  3T9Y A;  4E0A A;  2O28 A;  1CPS A;  3H5Z A;  2PJ1 A;  1HDQ A;  5LYD A;  2EO8 A;  3CPX A;  2PCU A; 
#chains in the Genus database with same CATH homology
 1PU9 A;  2CNM A;  3RYO A;  2J8N A;  2PR1 A;  4KUB A;  3IU2 A;  4BBH A;  3DR8 A;  2VBQ A;  2Z0Z A;  4PV6 A;  2Q4V A;  1IYK A;  3DDD A;  2B58 A;  4HNX B;  3LOD A;  4CAF A;  1CJW A;  2VEZ A;  1YR0 A;  1I21 A;  4R9M A;  3EFA A;  4CGP A;  3W91 A;  5AG6 A;  4UCP A;  4HNW B;  2Q44 A;  5GCN A;  2Z3O A;  1R57 A;  2PC1 A;  2KCW A;  3BJ8 A;  2VI7 A;  2A4N A;  2WSA A;  4KSF A;  2GIV A;  2ZW7 A;  3EY5 A;  4KOT A;  2WPW A;  2IL4 A;  4Y49 B;  4MFK A;  4NEX A;  5DWN A;  4MFZ A;  2J8M A;  2PRB A;  4OAE A;  1XIX A;  2ARH A;  5A27 A;  5IB0 A;  5F47 A;  4C2Z A;  1K4J A;  1MJB A;  2AJ6 A;  3BLN A;  4GS4 A;  4CRZ B;  4CAW A;  1YVK A;  2BL1 A;  4M85 A;  4XPK A;  5JQ4 A;  3UY5 A;  3G8W A;  2OZH A;  1OZP A;  4JLY A;  2FIA A;  1GHE A;  1Q2D A;  3F8K A;  1S7L A;  3OWC A;  2ATR A;  4B13 A;  3GKR A;  2G3T A;  4NXY A;  3EO4 A;  4KUA A;  5EC4 A;  3V8I A;  2QML A;  4RS2 A;  3NE7 A;  4AG9 A;  4Y49 C;  1Z4E A;  4CAX A;  4H6Z A;  4F0Y A;  2NMT A;  5AG5 A;  2VZZ A;  1B87 A;  1MK4 A;  4FD4 A;  2FT0 A;  5KTA A;  3R9F A;  5C88 A;  2DPS A;  2ZW5 A;  1BOB A;  3DR6 A;  4Q36 A;  3SXN A;  3FIX A;  3PP9 A;  1L0C A;  3TOB A;  1Q2C A;  4B5O A;  5G22 A;  2R7H A;  3GY9 A;  4UFX A;  5JPH A;  1U6M A;  1S7K A;  1NSL A;  2GAN A;  4UWJ A;  3FYN A;  4MY0 A;  1MJA A;  3CXP A;  4II9 A;  4R3K A;  1SQH A;  4ORF A;  3JUW A;  3CXQ A;  4MFL A;  4KOR A;  3VWE A;  1UFH A;  3P2H A;  4CYO A;  5A28 A;  1Y9W A;  5BWA B;  4A95 A;  2YNC A;  2BUE A;  2G0B A;  3S6F A;  4UCN A;  1WWZ A;  2D4O A;  2Z3M A;  4R57 A;  4UCM A;  3D2M A;  3MGD A;  5DWM A;  4F6A A;  3I3G A;  2FE7 A;  4AG7 A;  1ON0 A;  4NCZ A;  4CGL A;  2EUI A;  3EXN A;  4CAV A;  4CYQ A;  2ZXV A;  2VZY A;  2JDC A;  1Y9K A;  3BJ7 A;  3QAH A;  4PSW A;  2YNC C;  3TTH A;  4L89 A;  4KSA A;  4KS9 A;  3JVN A;  3SXO A;  1NE9 A;  2Z3K A;  4CAE A;  4AB7 A;  4B11 A;  1M4D A;  4QUS A;  3QB8 A;  4CS0 B;  2Z10 A;  3C26 A;  2HV2 A;  2PDO A;  2QEC A;  4B12 A;  1P0H A;  2K5T A;  4MHD A;  3LD2 A;  2REF A;  4A30 A;  4UFV A;  1QSM A;  4JWP A;  4JXQ A;  2Q4Y A;  2FL4 A;  1J4J A;  3F5B A;  1M44 A;  2P0W A;  4XPD C;  3PZJ A;  4QB9 A;  3FNC A;  4KLV A;  2Q7B A;  3R95 A;  2OZU A;  1FY7 A;  2OZG A;  4FD7 A;  4B14 A;  3TO7 A;  2P6E A;  2AE6 A;  4AVA A;  2P6F A;  4IUS A;  1S7F A;  4OLL A;  3TE4 A;  2C27 A;  4AVC A;  5C82 A;  1VHS A;  2BEI A;  2P6G A;  2I00 A;  2VXK A;  2FXF A;  2I79 A;  3IU1 A;  4L8A A;  3F0A A;  4E8O A;  1V0C A;  4B5P B;  4KOU A;  4MFJ A;  2J8R A;  2ZW6 A;  3IGR A;  2JDD A;  4A33 A;  4PK3 A;  5CNP A;  4MY3 A;  4KOW A;  3S6K A;  2Z11 A;  2GE3 A;  1Z4R A;  1LRZ A;  3JTK A;  3G3S A;  4K30 A;  3IWE A;  4R3L A;  4UWI A;  4C2X A;  2WPX A;  2Z3P A;  1XEB A;  1B6B A;  2OB0 A;  3N7Z A;  1NMT A;  4QC6 A;  4B5P A;  4NF1 A;  4U9Y A;  2B3V A;  1KUV A;  2HUZ A;  5AGE A;  5KTC A;  4KOV A;  2DXQ A;  2FCK A;  1QSR A;  2DPT A;  2B4B A;  2CNT A;  2WUU A;  4JJX A;  5KTD A;  1TIQ A;  2B5G B;  4EVY A;  4X5K A;  5HMN A;  2JEV A;  3D8P A;  1Z9U A;  3DSB A;  5EBV A;  4XPL A;  3VWD A;  1ZO0 A;  4J3G A;  4BMH A;  4CRY B;  4H89 A;  4FD6 A;  3R9G A;  4MI4 A;  3A9L A;  5I0C A;  2R8V A;  4MBU A;  4B10 A;  1S60 A;  2B5G A;  3K9U A;  4OAD A;  1I12 A;  4M3S A;  2H5M A;  4CYN A;  1YLE A;  5IX3 A;  5H84 A;  3PGP A;  3R1K A;  4KOY A;  4NSQ A;  4UFW A;  3E0K A;  4H6U A;  5H86 A;  2B3U A;  1XE4 A;  5IV0 A;  3R9E A;  2HQY A;  4KOX A;  1Y7R A;  1YX0 A;  2REE A;  1KUY A;  5J8F A;  1RO5 A;  5FVJ A;  1M1D A;  3EC4 A;  3W6X A;  3S6H A;  2VQY A;  4CGN A;  1IIC A;  1IID A;  5F49 A;  3B8G A;  1YK3 A;  5F48 A;  4ZGY B;  2Q0Y A;  3CXS A;  4MJ8 A;  2PSW A;  2EVN A;  2FSR A;  3FRM A;  1QSN A;  3P2F A;  2B4D B;  3TO9 A;  5G20 A;  2OU2 A;  3IWG A;  4U5Y A;  4ZBG A;  4LUA A;  4F0X A;  1M4I A;  3FBU A;  3R96 A;  1KUX A;  2Y0M A;  1XMT A;  3T90 A;  4CGM A;  3I9S A;  1S3Z A;  2FS5 A;  4YFJ A;  1PUA A;  2Z3N A;  3TFY A;  4KVX A;  3S6G A;  4AVB A;  4UA3 A;  5HH1 A;  3ZZI A;  5G1Z A;  1WK4 A;  2D4P A;  2ZPA A;  2B4D A;  4ONU A;  4RI1 A;  2RC4 A;  2PR8 A;  4XNH B;  4YRH A;  4MFQ A;  2JLM A;  3WR7 A;  1QST A;  3D3S A;  5F46 A;  4Q38 A;  5AG4 A;  1YVO A;  1YRE A;  3FB3 A;  4R87 A;  4C2Y A;  1KZF A;  2Q04 A;  4A31 A;  2R1I A;  1IB1 E;  4QVT A;  2PQ8 A;  2YGW A;  1QSO A;  1M4G A;  4HKF A;  3DNS A;  1S5K A;  2BSW A;  4DNC A;  4IF5 A;  1CM0 A;  2YNE A;  5E96 A;  3ZJ0 A;  4CGO A;  2FIW A;  4A2Z A;  1YGH A;  3GYA A;  4PSX A;  4KZT A;  3TO6 A;  1BO4 A;  4A32 A;  2QIR A;  2OH1 A;  3TT2 A;  3W6S A;  1Q2Y A;  4C68 A;  4KLW A;  1S7N A;  4MFP A;  4XNH C;  4LX9 A;  1XF8 A;  5J8C A;  1MJ9 A;  4QBJ A;  1P4N A;  3H4Q A;  2CXA A;  3TCV A;  4FD5 A;  3D2P A;  3SHP A;  4C7H A;  4KVM E;  2CY2 A;  3FXT A;  1RXT A;  2F5I A;  4JD6 A;  2CNS A;  2X7B A;  1I1D A;  4U9Z A;  4CYP A;  5AG7 A;  4KOS A;  3TOA A;  2G3A A;  4JXR A;  4I49 A;  4YGO A;  2ZW4 A;  1N71 A;  5ISV A;  4E2A A;  5G21 A;  4UBR A;  1VKC A;  4HNY B;  4KVO E;  4XPD B;  2YND A;  3KKW A;  2R98 A;  4C7I A;  4PK2 A;  1IYL A;  3T9Y A;  4E0A A;  2O28 A;  3H5Z A;  2Z3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...