3K9UA

Crystal structure of paia acetyltransferase (ta0374) from thermoplasma acidophilum
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
159
structure length
159
Chain Sequence
MSIEIRKLSIEDLETLIEVARESWKWTYAGIYSEEYIESWIREKYSKEKLLNEIVRSQSNLDILFLGAFADSTLIGFIELKIIANKAELLRLYLKPEYTHKKIGKTLLLEAEKIMKKKGILECRLYVHRQNSVGFSFYYKNGFKVEDTDGSDFIMEKKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PaiA Acetyltransferase
publication title Crystal structure of the novel PaiA N-acetyltransferase from Thermoplasma acidophilum involved in the negative control of sporulation and degradative enzyme production.
pubmed doi rcsb
source organism Thermoplasma acidophilum
total genus 52
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3k9uA00
1KUXA 4HNWB 3T9YA 3SXOA 4KOUA 1KUVA 3ZJ0A 3TO7A 4HNYB 1XE4A 3I3GA 1MJAA 3FIXA 3D3SA 2FL4A 2VZYA 2Q44A 3E0KA 1B6BA 2CNMA 2HQYA 1M4GA 4XNHB 1VHSA 2QECA 5F48A 1MJ9A 1XEBA 2Q04A 5ISVA 4F6AA 2Q0YA 2BEIA 3F0AA 4II9A 1PUAA 4XPKA 3CXPA 1XIXA 2CNSA 2B4DB 2FSRA 2ZW4A 2B4DA 1MJBA 4JXQA 1FY7A 3LODA 3BLNA 3TOBA 2OB0A 4L8AA 1Q2DA 1YX0A 3W6SA 5JPHA 4KOTA 1IYKA 1Z4EA 3NE7A 4X5KA 2AJ6A 4RI1A 4JD6A 1R57A 4KLVA 2FIWA 2QMLA 2QIRA 4XPDC 2P0WA 4QBJA 2G0BA 3VWDA 5DWMA 1B87A 3R95A 4AVBA 3R9EA 2Q4VA 3S6GA 2VBQA 3JVNA 1S5KA 3TO9A 1ON0A 1XF8A 2PR1A 1RO5A 1M4DA 4CAVA 2G3AA 2B3VA 5H86A 1YR0A 3PGPA 5CNPA 4YFJA 4QUSA 2EUIA 5F49A 1M1DA 4KVXA 4ONUA 1Q2CA 4KOVA 2BL1A 2FT0A 2HUZA 5I0CA 2B3UA 2VZZA 3R9GA 2P6FA 2Q7BA 4NXYA 2J8MA 1GHEA 1IICA 2WPXA 3EY5A 4QVTA 2B58A 1QSRA 4OLLA 3W6XA 1I1DA 1Y9WA 4XPDB 2JDCA 3S6KA 3D2PA 2K5TA 3BJ7A 1L0CA 4R57A 1SQHA 4KUBA 3ZZIA 2FE7A 4OADA 2F5IA 4HNXB 1Y7RA 1BOBA 4FD5A 5EC4A 5IX3A 1LRZA 1YLEA 1S7FA 2DXQA 1M44A 4AB7A 3TFYA 2ZXVA 3D8PA 4YGOA 3EC4A 3IWGA 4E8OA 1N71A 4U9ZA 4KOXA 2B4BA 1VKCA 1QSTA 2OU2A 4ORFA 1YVOA 2JLMA 2PSWA 3G3SA 4F0YA 5JQ4A 4KLWA 2ATRA 2Q4YA 2Y0MA 2X7BA 2ZW5A 2OZHA 4CRZB 1V0CA 2A4NA 1Z4RA 3PZJA 4JWPA 3UY5A 1YGHA 4JJXA 4XPLA 2ZPAA 4MI4A 4KVME 3WR7A 3CXQA 4H6ZA 5IV0A 4KVOE 3TOAA 3MGDA 2IL4A 5HH1A 3OWCA 2I00A 1I21A 4MY0A 2EVNA 2FCKA 4KZTA 2R98A 1IYLA 3S6HA 2Z0ZA 3DNSA 4UA3A 4E0AA 1OZPA 3H4QA 1Q2YA 4CAXA 2AE6A 3DDDA 4FD7A 4MHDA 1P4NA 3F5BA 3FRMA 2P6EA 3PP9A 5H84A 4HKFA 1S7NA 1WK4A 1Y9KA 2JDDA 4NSQA 5FVJA 1TIQA 4I49A 4K30A 4R87A 2R1IA 1CJWA 4MBUA 4AVAA 3BJ8A 3R96A 4BMHA 3TE4A 2JEVA 2PC1A 4L89A 4LX9A 4IUSA 3FBUA 2BUEA 1YREA 4PV6A 2H5MA 1YK3A 1MK4A 4PK3A 2KCWA 4CRYB 4E2AA 1S7LA 3FXTA 2PRBA 2PDOA 3P2HA 4FD6A 1PU9A 2FS5A 4KORA 3B8GA 1UFHA 1BO4A 2B5GB 1QSMA 2D4OA 2B5GA 4PSXA 2GIVA 1RXTA 3DR6A 4B5OA 1K4JA 4GS4A 4KOWA 5F46A 2ZW7A 4Y49C 3R9FA 5E96A 3SXNA 5KTAA 5HMNA 3G8WA 1IB1E 2R8VA 4J3GA 3R1KA 4M85A 4UBRA 2CY2A 3GYAA 4OAEA 1P0HA 2G3TA 4KUAA 4MY3A 3JUWA 2O28A 2VXKA 4R9MA 3DR8A 2OH1A 4U9YA 4M3SA 2VI7A 2GE3A 4RS2A 3VWEA 5KTDA 3TT2A 2RC4A 3DSBA 1KUYA 4AVCA 3FYNA 1IIDA 3W91A 1I12A 4JXRA 4UWJA 4R3LA 2PR8A 2PQ8A 4NEXA 4Y49B 5KTCA 2Z11A 2I79A 2J8RA 1KZFA 4KOYA 3SHPA 2P6GA 5J8FA 3CXSA 1S60A 4CAWA 2VQYA 4PK2A 4UWIA 1Z9UA 1QSOA 5DWNA 2J8NA 1M4IA 1NSLA 2VEZA 4H6UA 4MJ8A 4AG9A 3TCVA 2REEA 2OZGA 2NMTA 3GKRA 3TO6A 3GY9A 5C82A 3F8KA 2BSWA 3S6FA 1NMTA 3FNCA 4DNCA 2CNTA 5C88A 1U6MA 4NCZA 4R3KA 5EBVA 4QB9A 4B5PB 5IB0A 4B5PA 2D4PA 4LUAA 2C27A 3EO4A 5F47A 2R7HA 4PSWA 3TTHA 2HV2A 3N7ZA 2Z10A 4H89A 4NF1A 1CM0A 4KOSA 4XNHC 4ZBGA 3T90A 1S7KA 5J8CA 4JLYA 1S3ZA 1YVKA 1J4JA 2REFA 3EXNA 4FD4A 3D2MA 3QAHA 1WWZA 3FB3A 1NE9A 3IGRA 3RYOA 3KKWA 2WPWA 3EFAA 4IF5A 3QB8A 3I9SA 4U5YA 2FIAA 3LD2A 2GANA 4YRHA 4CS0B 2FXFA 2ARHA 3V8IA 3P2FA 3K9UA 4EVYA 4AG7A 2OZUA 4QC6A 3C26A 5GCNA 1XMTA 1QSNA 2ZW6A
chains in the Genus database with same CATH superfamily
1KUXA 2G9DA 4P4EA 4P44A 4HNWB 3T9YA 3SXOA 4KOUA 1KUVA 3JTKA 3ZJ0A 3TO7A 1DTDA 4HNYB 3GLJA 1YW4A 1XE4A 3B2YA 3I3GA 4WJBA 1MJAA 2Z3PA 2Q51A 3SJFA 2O4HA 3H8FA 3PB6X 3FIXA 3D3SA 4FBEA 1LANA 4P45A 5AG6A 2FL4A 3H8GA 3PBBA 2VZYA 2Q44A 2V8DA 3E0KA 1B6BA 2CNMA 5LYIA 2HQYA 3SI1A 1M4GA 4M6GA 2ZENA 4XNHB 5K8OA 1VHSA 4ZI6A 2QECA 2PJ8A 2BO9A 2ZEEA 2ZOGA 5F48A 4ZYQA 5LYLA 1TF9A 1MJ9A 1XEBA 2Q04A 1XRYA 4NGMA 4CYNA 2PJCA 5ISVA 2CF4A 4F6AA 2PJ6A 1VIXA 5D8NA 2Q0YA 2V8HA 1HEEA 4C7IA 4A95A 2BEIA 3L2NA 3F0AA 4II9A 1PUAA 3FX6A 2NYQA 4XPKA 2QJ8A 4UCNA 3CXPA 4G1PA 5HVHA 1XIXA 3NE8A 2CNSA 4CYPA 2FSRA 2B4DB 2ZW4A 4OIWA 4A32A 2B4DA 1MJBA 2PIYA 2GREA 4JXQA 4CGOA 1FY7A 3LODA 3BLNA 4OMEA 4B11A 2YNCA 2XEIA 1AMPA 4GM5A 2OB0A 3TOBA 4L8AA 1Q2DA 4CGMA 5THWA 2PRQA 1YX0A 3W6SA 5JPHA 2ZEPA 4FWUA 1PCAA 4IK2A 1VHEA 4KOTA 2ZEDA 3B3TA 4PPZA 2OR4A 4Z65A 1IYKA 1Z4EA 3NE7A 4R8FA 2DPSA 4OC3A 2AJ6A 1BPNA 4RI1A 4X5KA 4JD6A 1R57A 5G21A 2O53A 4BBHA 3KQZA 4KLVA 4B6ZA 3GIUA 1ZLHA 2AFXA 1YQEA 3FEDA 1QMUA 3CDXA 2FIWA 2QMLA 5LRKA 2QIRA 4RN7A 4XPDC 3S9MA 4C2ZA 2P0WA 4CPAA 3PFEA 4P4JA 2JBJA 2PCUA 4W9YA 4QBJA 5JH9A 5J1QA 3KI9A 2G0BA 3NA6A 1IGBA 3QNVA 5HVFA 5LRGA 5DWMA 3VWDA 3WABA 1B87A 3R95A 4AVBA 3R9EA 4B14A 2Q4VA 3S6GA 2VBQA 3GUXA 3JVNA 4UFVA 1S5KA 2ODFA 3TO9A 1ON0A 1XF8A 4CGNA 2PR1A 1DE4C 1RO5A 1M4DA 3IEHA 3MN8A 4CAVA 4DJLA 3NH8A 1LFWA 4OP4A 3ISZA 1RTQA 2OOTA 2G3AA 2AFOA 8CPAA 2B3VA 4NFRA 5H86A 5AG5A 1YR0A 3K9TA 3FVLA 3PGPA 4NJRA 5CNPA 4YFJA 4OC2A 4MRIA 3I1UA 1Q7LA 2DF5A 4QUSA 4UFWA 4AXVA 2EUIA 5F49A 1M1DA 4KVXA 4ONUA 4UEZA 3B3VA 1IOIA 1Q2CA 4KOVA 2BL1A 2FT0A 2IMOA 1F2PA 2HUZA 2PJ3A 4MFZA 5I0CA 2B3UA 2AFWA 1ZLIA 2VZZA 2Z3MA 3WT4A 2ABZA 1TKHA 4NGSA 2V77A 4O23A 2P6FA 3R9GA 2Q7BA 4A38A 4NXYA 2J8MA 1GHEA 1IICA 2WPXA 2C6GA 3D7DA 4PXBA 3EY5A 3JRUA 4QVTA 2PE3A 2CTBA 2XEFA 2WZNA 1X12A 4KORA 7CPAA 2B58A 4GXHA 1QSRA 3SI0A 4OLLA 3W6XA 1I1DA 5BWAB 5AGEA 3CPXA 3KL9A 5LRJA 1Y9WA 1ARMA 4KS9A 4XPDB 4OC1A 2JDCA 3SJXA 1Z8XA 2CXAA 3IU1A 3S6KA 3D2PA 3D7GA 4WWVA 4C2XA 2K5TA 3BJ7A 4NGPA 4MHNA 1EE3P 3T8WA 3CT9A 1L0CA 4R57A 1SQHA 3KHZA 1BPMA 4KUBA 3VARA 4A33A 1BLLE 3ZZIA 2FE7A 4OADA 2F5IA 4HNXB 4MFKA 1Y7RA 2RFHA 4P4DA 3FECA 1BOBA 1VGYA 1UWYA 4FD5A 5EC4A 4HPSA 1X10A 4Q7AA 4M6IA 2PJ4A 1LRZA 1YLEA 5HXDA 1S7FA 2EWBA 5IX3A 2DPTA 2DXQA 4UEEA 1CP6A 4MHZA 1M44A 4AB7A 3TFYA 2ZXVA 4FAIA 4ZGYB 4CAEA 3D8PA 4YGOA 1IU8A 2AFSA 2PIZA 3EC4A 3IWGA 4E8OA 2JBKA 1GYTA 3PB4X 1Y0RA 1Z8LA 3GB0A 2PJ9A 1N71A 4U9ZA 4KOXA 2B4BA 2V8VA 3IC1A 1VKCA 3PB8X 1A2ZA 1QSTA 2OU2A 1PYTB 3KR5A 3BI0A 3FEEA 4ORFA 1YVOA 2JLMA 2PSWA 3PBEA 3G3SA 4F0YA 5JQ4A 3S9NA 4ZY2A 5LYFA 4KLWA 1ZG8A 2ATRA 4F9VA 1ZG7A 2Q4YA 2Y0MA 4ZY0A 2X7BA 1H8LA 2YNDA 4F9UA 1CP7A 3FF3A 2ZW5A 2OZHA 1CG2A 4CGLA 1V0CA 2A4NA 4CRZB 1Z4RA 3PZJA 4JWPA 4K3NA 3UY5A 3HLPA 3V38A 1YGHA 1XMBA 4JJXA 3IU2A 4XPLA 4C68A 4P4BA 3RO0A 2ZPAA 4MI4A 5G22A 5JM6A 3H5ZA 4KVME 3WR7A 3CXQA 4H6ZA 5IV0A 4KVOE 3TOAA 2EK8A 4CAFA 3B3WA 3MGDA 3B35A 2IL4A 1CBXA 3IWEA 3FH4A 4B10A 5HH1A 3OWCA 3NH4A 2I00A 1AYEA 1I21A 4MY0A 5DS0A 2EVNA 2FCKA 4UCPA 4KZTA 2R98A 5K8MA 3SJEA 4A37A 4X8IA 1IYLA 4MCPA 3S6HA 2Z0ZA 4OC4A 3DNSA 4MFQA 4F0XA 3NFZA 3CPAA 3NH5A 4UA3A 4UFXA 2C6PA 1OZPA 4E0AA 3H4QA 3D4UA 1Q2YA 4CYQA 5ELYA 2PJ2A 1CX8A 2PJ0A 4CAXA 2AE6A 2BCOA 2ZEOA 3DDDA 4FD7A 4JYWA 3VATA 4MHPA 1YSJA 4EMEA 4MHDA 1P4NA 2POKA 3F5BA 1F2OA 2P6EA 3FRMA 3PP9A 5H84A 3DGVA 3HUVA 2Z3LA 5G20A 1FNOA 3LWUA 4HKFA 4ONWA 2HB6A 1S7NA 1WK4A 1Y9KA 2JDDA 4NSQA 5FVJA 1TIQA 4C2YA 4DYOA 2WYRA 4I49A 4KSAA 4K30A 1Y7EA 3KASA 4R87A 2WUUA 1NSAA 2R1IA 1CJWA 4MBUA 3IIBA 4AVAA 3BJ8A 3R96A 5D29A 4BMHA 3TE4A 2JEVA 2PC1A 4L89A 4LX9A 4IUSA 4Q36A 4UIAA 3FBUA 2PJBA 3FJUA 2BUEA 4MFJA 1YREA 3SJGA 5LYDA 4PV6A 3BI1A 4A94A 3K2KA 2H5MA 1YK3A 4P4FA 1TXRA 1IY7A 4P6YA 1MK4A 2Z3NA 4PK3A 2ZEMA 2KCWA 4CRYB 4E2AA 1S7LA 3FXTA 2PJ5A 1TKJA 2PRBA 2PDOA 3D68A 2Z3OA 3P2HA 4FD6A 4Q38A 4ZX9A 1PU9A 4B12A 4PXEA 4EFDA 2FS5A 4MXUA 4R76A 1UFHA 3B8GA 2B5GB 1BO4A 2D4OA 1QSMA 2PVVA 2B5GA 3LMSA 3N5FA 2FVGA 5I4MA 1Y0YA 4A2ZA 4PSXA 2GIVA 1RXTA 3DR6A 4B5OA 4FUUA 1K4JA 1XJOA 2ZEFA 4GS4A 4KOWA 3WC7A 4B13A 2ZW7A 4Y49C 3RZAA 2RB7A 5F46A 1BAVA 1XOVA 5E96A 3R9FA 5CBMA 5HVGA 3SXNA 1OBRA 5KTAA 5HMNA 3BXMA 2I3CA 4MHYA 4IHMA 3G8WA 4BINA 1IB1E 2R8VA 1ZG9A 2NSMA 4LQ6A 4J3GA 2IQ6A 2ANPA 3R1KA 4M85A 4UBRA 2CY2A 4CGPA 3D7HA 3GYAA 4M6HA 4OAEA 1P0HA 3PB7X 2G3TA 3D66A 4KUAA 4YWYA 4MY3A 4RUHA 1TF8A 4OIDA 2C1CA 4PXCA 3JUWA 5G1ZA 1FT7A 1JQGA 4PQAA 2O28A 2VXKA 4R9MA 3DR8A 2OH1A 3A9LA 3CZXA 4U9YA 1Z2LA 1LAPA 4KSFA 4M3SA 3PEIA 2AFUA 1VHOA 2VI7A 5K8NA 1Z8WA 3BHXA 2GE3A 4MFPA 3RNZA 4TWEA 1LAMA 4RS2A 3VWEA 2DEAA 1JWQA 2Q4ZA 2XEGA 2V8GA 5KTDA 4OC0A 1LOKA 1XBUA 3TT2A 2RC4A 3DSBA 5F09A 1KUYA 4AVCA 3FYNA 1IIDA 4CYOA 3W91A 1I12A 3S9LA 2F8HA 4MMOA 4A39A 4JXRA 4NJQA 4UWJA 1ZO0A 2GLFA 2YGWA 4R3LA 2PR8A 2PQ8A 1KWMA 4NEXA 3KHXA 3WC6A 4Y49B 5KTCA 4R7MA 2IJZA 2ZEGA 2Z11A 3MRUA 2I79A 2J8RA 1KZFA 4KOYA 3SHPA 4TNUA 4UCMA 3KGQA 2P6GA 5J8FA 3CXSA 4MCSA 1HDUA 3LACA 4NGNA 2GU2A 3TX8A 2Z3KA 1S60A 4CAWA 2VQYA 2EBJA 3SI2A 3QAYA 2EO8A 4NGRA 4PK2A 4UWIA 1IOFA 4ZX8A 1Z9UA 4NGTA 4EWTA 1QSOA 4MFLA 5DWNA 2J8NA 3RBUA 1M4IA 1NSLA 2VEZA 5AG4A 4H6UA 4MJ8A 2AFZA 3KR4A 3TC8A 3WC5A 4AG9A 3TCVA 2REEA 2OZGA 5CPAA 2NMTA 4JZ0A 3GKRA 3TO6A 2CIJA 3KQXA 2YNEA 3GY9A 2AFMA 4OC5A 5C82A 1YMEA 3F8KA 4UIBA 3IJ3A 2BSWA 2BOAA 1NMTA 3S6FA 5JGFA 3FNCA 1Z5RA 4DNCA 2CNTA 5A28A 6CPAA 3H8EA 4ZY1A 5C88A 4UEFA 1QQ9A 4P10A 4YU9A 1U6MA 2CTCA 1YW6A 4NCZA 5K8PA 4R3KA 5EBVA 2EK9A 4QB9A 4B5PB 5IB0A 3FMCA 4B5PA 2F7VA 3B7IA 2D4PA 2XEJA 1ELLP 3DLJA 5EMIA 2PVWA 4LUAA 1F57A 2C27A 4NGQA 3EO4A 5IB9A 5F47A 2R7HA 3VH9A 4A31A 4H2KA 4PSWA 3TTHA 4LQGA 2HV2A 3N7ZA 2PJ1A 1LCPA 2Z10A 3IO1A 4H89A 4X2TA 2ZOFA 4NF1A 4P4IA 1CM0A 4KOSA 1R43A 3PFOA 4XNHC 4ZBGA 3T90A 1S7KA 2Q43A 4MCQA 4X3RA 5J8CA 4JLYA 1S3ZA 1M4LA 1YVKA 1J4JA 2REFA 3EXNA 5AG7A 2QVPA 4A30A 2JEWA 3B3CA 4FD4A 1Z8TA 3D2MA 1YLOA 2Q7SA 3QAHA 1WWZA 3FB3A 1NE9A 2C6CA 3PB9X 3IGRA 3RYOA 1CPSA 3D7FA 3KKWA 2WPWA 3EFAA 4IF5A 3QB8A 4C7HA 3I9SA 1TKFA 2GFQA 2FIAA 2J9AA 2GANA 3LD2A 4U5YA 4YRHA 4BD9A 4CS0B 4PXDA 3KZWA 2FXFA 2QYVA 2WSAA 2ARHA 3IFEA 3V8IA 3PRTA 3P2FA 4DUKA 5A27A 2PJAA 3RAMA 2YNCC 1R3NA 2HC9A 3K9UA 4OKOA 4F8ZA 4UF4A 1ELMP 4MCRA 1ARLA 3V7ZA 1HDQA 3B3SA 2ZEHA 4EVYA 2ZELA 4AG7A 2VL1A 2OZUA 4KSIA 1AUGA 4QC6A 4R6TA 1XFOA 3C26A 3IWWA 1CPXA 2GLJA 1XMTA 4IAVA 2PJ7A 5GCNA 1QSNA 2ZW6A 3D67A 3ISXA
chains in the Genus database with same CATH topology
1KUXA 4HNWB 3T9YA 3SXOA 4KOUA 1KUVA 3JTKA 3ZJ0A 3TO7A 4HNYB 1XE4A 3I3GA 1MJAA 2Z3PA 3FIXA 3D3SA 5AG6A 2FL4A 2VZYA 2Q44A 3E0KA 1B6BA 2CNMA 2HQYA 1M4GA 4XNHB 1VHSA 2QECA 5F48A 1MJ9A 1XEBA 2Q04A 4CYNA 5ISVA 4F6AA 2Q0YA 4C7IA 4A95A 2BEIA 3F0AA 4II9A 1PUAA 4XPKA 4UCNA 3CXPA 1XIXA 2CNSA 4CYPA 2B4DB 2FSRA 2ZW4A 4A32A 2B4DA 1MJBA 4JXQA 4CGOA 1FY7A 3LODA 3BLNA 4B11A 2YNCA 3TOBA 4CGMA 2OB0A 4L8AA 1Q2DA 1YX0A 3W6SA 5JPHA 4KOTA 1IYKA 1Z4EA 3NE7A 2DPSA 4X5KA 2AJ6A 4RI1A 4JD6A 1R57A 5G21A 4BBHA 4KLVA 2FIWA 2QMLA 2QIRA 4XPDC 4C2ZA 2P0WA 4QBJA 2G0BA 3VWDA 5DWMA 1B87A 3R95A 4AVBA 3R9EA 4B14A 2Q4VA 3S6GA 2VBQA 4UFVA 3JVNA 1S5KA 3TO9A 1ON0A 1XF8A 4CGNA 2PR1A 1RO5A 1M4DA 4CAVA 2G3AA 2B3VA 5H86A 5AG5A 1YR0A 3PGPA 5CNPA 4YFJA 4QUSA 4UFWA 2EUIA 5F49A 1M1DA 4KVXA 4ONUA 1Q2CA 4KOVA 2BL1A 2FT0A 2HUZA 4MFZA 5I0CA 2B3UA 2VZZA 2Z3MA 3R9GA 2P6FA 2Q7BA 4NXYA 2J8MA 1GHEA 1IICA 2WPXA 3EY5A 4QVTA 2B58A 1QSRA 4OLLA 3W6XA 1I1DA 5BWAB 5AGEA 1Y9WA 4KS9A 4XPDB 2JDCA 2CXAA 3IU1A 3S6KA 3D2PA 4C2XA 2K5TA 3BJ7A 1L0CA 4R57A 1SQHA 4KUBA 4A33A 3ZZIA 2FE7A 4OADA 2F5IA 4HNXB 4MFKA 1Y7RA 1BOBA 4FD5A 5EC4A 5IX3A 1LRZA 1YLEA 1S7FA 2DPTA 2DXQA 1M44A 4AB7A 3TFYA 2ZXVA 4ZGYB 4CAEA 3D8PA 4YGOA 3EC4A 3IWGA 4E8OA 1N71A 4U9ZA 4KOXA 2B4BA 1VKCA 1QSTA 2OU2A 4ORFA 1YVOA 2JLMA 2PSWA 3G3SA 4F0YA 5JQ4A 4KLWA 2ATRA 2Q4YA 2Y0MA 2X7BA 2YNDA 2ZW5A 2OZHA 4CGLA 4CRZB 1V0CA 2A4NA 1Z4RA 3PZJA 4JWPA 3UY5A 1YGHA 4JJXA 3IU2A 4XPLA 4C68A 2ZPAA 4MI4A 5G22A 3H5ZA 4KVME 3WR7A 3CXQA 4H6ZA 5IV0A 4KVOE 3TOAA 4CAFA 3MGDA 2IL4A 3IWEA 5HH1A 3OWCA 2I00A 1I21A 4MY0A 2EVNA 2FCKA 4UCPA 4KZTA 2R98A 1IYLA 3S6HA 2Z0ZA 3DNSA 4MFQA 4UA3A 4UFXA 4E0AA 1OZPA 3H4QA 4CYQA 1Q2YA 4CAXA 2AE6A 3DDDA 4FD7A 4MHDA 1P4NA 4B10A 3F5BA 3FRMA 2P6EA 3PP9A 5H84A 2Z3LA 5G20A 4HKFA 1S7NA 1WK4A 1Y9KA 2JDDA 4NSQA 5FVJA 1TIQA 4C2YA 4I49A 4KSAA 4K30A 4R87A 2WUUA 2R1IA 1CJWA 4MBUA 4AVAA 3BJ8A 3R96A 4BMHA 3TE4A 2JEVA 2PC1A 4L89A 4LX9A 4IUSA 4Q36A 3FBUA 2BUEA 4MFJA 1YREA 4PV6A 2H5MA 1YK3A 1MK4A 2Z3NA 4PK3A 2KCWA 4CRYB 4E2AA 1S7LA 3FXTA 2PRBA 2PDOA 3P2HA 2Z3OA 4FD6A 4Q38A 1PU9A 4B12A 2FS5A 3B8GA 1UFHA 2B5GB 1BO4A 2D4OA 1QSMA 4KORA 2B5GA 4A2ZA 4PSXA 2GIVA 1RXTA 3DR6A 4B5OA 1K4JA 4B13A 4GS4A 4KOWA 5F46A 2ZW7A 4Y49C 3R9FA 5E96A 3SXNA 5KTAA 5HMNA 3G8WA 1IB1E 2R8VA 4J3GA 3R1KA 4M85A 4UBRA 2CY2A 4CGPA 3GYAA 4OAEA 1P0HA 2G3TA 4KUAA 4MY3A 3JUWA 5G1ZA 2O28A 2VXKA 4R9MA 3DR8A 2OH1A 3A9LA 4U9YA 4KSFA 4M3SA 2VI7A 2GE3A 4MFPA 4RS2A 3VWEA 5KTDA 3TT2A 2RC4A 3DSBA 1KUYA 4AVCA 3FYNA 1IIDA 4CYOA 3W91A 1I12A 4JXRA 4UWJA 1ZO0A 4R3LA 2YGWA 2PR8A 2PQ8A 4NEXA 4Y49B 5KTCA 2Z11A 2I79A 2J8RA 1KZFA 4KOYA 3SHPA 4UCMA 2P6GA 5J8FA 3CXSA 2Z3KA 1S60A 4CAWA 2VQYA 4PK2A 4UWIA 1Z9UA 1QSOA 4MFLA 5DWNA 2J8NA 1M4IA 1NSLA 2VEZA 5AG4A 4H6UA 4MJ8A 4AG9A 3TCVA 2REEA 2OZGA 2NMTA 3GKRA 3TO6A 2YNEA 3GY9A 5C82A 3F8KA 2BSWA 3S6FA 1NMTA 3FNCA 4DNCA 2CNTA 5A28A 5C88A 1U6MA 4NCZA 4R3KA 5EBVA 4QB9A 4B5PB 5IB0A 4B5PA 2D4PA 4LUAA 2C27A 3EO4A 5F47A 2R7HA 4A31A 4PSWA 3TTHA 2HV2A 3N7ZA 2Z10A 4H89A 4NF1A 1CM0A 4KOSA 4XNHC 4ZBGA 3T90A 1S7KA 5J8CA 4JLYA 1S3ZA 1YVKA 1J4JA 2REFA 3EXNA 5AG7A 4A30A 4FD4A 3D2MA 3QAHA 1WWZA 3FB3A 1NE9A 3IGRA 3RYOA 3KKWA 2WPWA 3EFAA 4IF5A 3QB8A 4C7HA 3I9SA 4U5YA 2FIAA 3LD2A 2GANA 4YRHA 4CS0B 2FXFA 2WSAA 2ARHA 3V8IA 3P2FA 5A27A 2YNCC 3K9UA 4EVYA 4AG7A 2OZUA 4QC6A 3C26A 5GCNA 1XMTA 1QSNA 2ZW6A 4F0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KUX A;  4HNW B;  3T9Y A;  3SXO A;  4KOU A;  1KUV A;  3ZJ0 A;  3TO7 A;  4HNY B;  1XE4 A;  3I3G A;  1MJA A;  3FIX A;  3D3S A;  2FL4 A;  2VZY A;  2Q44 A;  3E0K A;  1B6B A;  2CNM A;  2HQY A;  1M4G A;  4XNH B;  1VHS A;  2QEC A;  5F48 A;  1MJ9 A;  1XEB A;  2Q04 A;  5ISV A;  4F6A A;  2Q0Y A;  2BEI A;  3F0A A;  4II9 A;  1PUA A;  4XPK A;  3CXP A;  1XIX A;  2CNS A;  2B4D B;  2FSR A;  2ZW4 A;  2B4D A;  1MJB A;  4JXQ A;  1FY7 A;  3LOD A;  3BLN A;  3TOB A;  2OB0 A;  4L8A A;  1Q2D A;  1YX0 A;  3W6S A;  5JPH A;  4KOT A;  1IYK A;  1Z4E A;  3NE7 A;  4X5K A;  2AJ6 A;  4RI1 A;  4JD6 A;  1R57 A;  4KLV A;  2FIW A;  2QML A;  2QIR A;  4XPD C;  2P0W A;  4QBJ A;  2G0B A;  3VWD A;  5DWM A;  1B87 A;  3R95 A;  4AVB A;  3R9E A;  2Q4V A;  3S6G A;  2VBQ A;  3JVN A;  1S5K A;  3TO9 A;  1ON0 A;  1XF8 A;  2PR1 A;  1RO5 A;  1M4D A;  4CAV A;  2G3A A;  2B3V A;  5H86 A;  1YR0 A;  3PGP A;  5CNP A;  4YFJ A;  4QUS A;  2EUI A;  5F49 A;  1M1D A;  4KVX A;  4ONU A;  1Q2C A;  4KOV A;  2BL1 A;  2FT0 A;  2HUZ A;  5I0C A;  2B3U A;  2VZZ A;  3R9G A;  2P6F A;  2Q7B A;  4NXY A;  2J8M A;  1GHE A;  1IIC A;  2WPX A;  3EY5 A;  4QVT A;  2B58 A;  1QSR A;  4OLL A;  3W6X A;  1I1D A;  1Y9W A;  4XPD B;  2JDC A;  3S6K A;  3D2P A;  2K5T A;  3BJ7 A;  1L0C A;  4R57 A;  1SQH A;  4KUB A;  3ZZI A;  2FE7 A;  4OAD A;  2F5I A;  4HNX B;  1Y7R A;  1BOB A;  4FD5 A;  5EC4 A;  5IX3 A;  1LRZ A;  1YLE A;  1S7F A;  2DXQ A;  1M44 A;  4AB7 A;  3TFY A;  2ZXV A;  3D8P A;  4YGO A;  3EC4 A;  3IWG A;  4E8O A;  1N71 A;  4U9Z A;  4KOX A;  2B4B A;  1VKC A;  1QST A;  2OU2 A;  4ORF A;  1YVO A;  2JLM A;  2PSW A;  3G3S A;  4F0Y A;  5JQ4 A;  4KLW A;  2ATR A;  2Q4Y A;  2Y0M A;  2X7B A;  2ZW5 A;  2OZH A;  4CRZ B;  1V0C A;  2A4N A;  1Z4R A;  3PZJ A;  4JWP A;  3UY5 A;  1YGH A;  4JJX A;  4XPL A;  2ZPA A;  4MI4 A;  4KVM E;  3WR7 A;  3CXQ A;  4H6Z A;  5IV0 A;  4KVO E;  3TOA A;  3MGD A;  2IL4 A;  5HH1 A;  3OWC A;  2I00 A;  1I21 A;  4MY0 A;  2EVN A;  2FCK A;  4KZT A;  2R98 A;  1IYL A;  3S6H A;  2Z0Z A;  3DNS A;  4UA3 A;  4E0A A;  1OZP A;  3H4Q A;  1Q2Y A;  4CAX A;  2AE6 A;  3DDD A;  4FD7 A;  4MHD A;  1P4N A;  3F5B A;  3FRM A;  2P6E A;  3PP9 A;  5H84 A;  4HKF A;  1S7N A;  1WK4 A;  1Y9K A;  2JDD A;  4NSQ A;  5FVJ A;  1TIQ A;  4I49 A;  4K30 A;  4R87 A;  2R1I A;  1CJW A;  4MBU A;  4AVA A;  3BJ8 A;  3R96 A;  4BMH A;  3TE4 A;  2JEV A;  2PC1 A;  4L89 A;  4LX9 A;  4IUS A;  3FBU A;  2BUE A;  1YRE A;  4PV6 A;  2H5M A;  1YK3 A;  1MK4 A;  4PK3 A;  2KCW A;  4CRY B;  4E2A A;  1S7L A;  3FXT A;  2PRB A;  2PDO A;  3P2H A;  4FD6 A;  1PU9 A;  2FS5 A;  4KOR A;  3B8G A;  1UFH A;  1BO4 A;  2B5G B;  1QSM A;  2D4O A;  2B5G A;  4PSX A;  2GIV A;  1RXT A;  3DR6 A;  4B5O A;  1K4J A;  4GS4 A;  4KOW A;  5F46 A;  2ZW7 A;  4Y49 C;  3R9F A;  5E96 A;  3SXN A;  5KTA A;  5HMN A;  3G8W A;  1IB1 E;  2R8V A;  4J3G A;  3R1K A;  4M85 A;  4UBR A;  2CY2 A;  3GYA A;  4OAE A;  1P0H A;  2G3T A;  4KUA A;  4MY3 A;  3JUW A;  2O28 A;  2VXK A;  4R9M A;  3DR8 A;  2OH1 A;  4U9Y A;  4M3S A;  2VI7 A;  2GE3 A;  4RS2 A;  3VWE A;  5KTD A;  3TT2 A;  2RC4 A;  3DSB A;  1KUY A;  4AVC A;  3FYN A;  1IID A;  3W91 A;  1I12 A;  4JXR A;  4UWJ A;  4R3L A;  2PR8 A;  2PQ8 A;  4NEX A;  4Y49 B;  5KTC A;  2Z11 A;  2I79 A;  2J8R A;  1KZF A;  4KOY A;  3SHP A;  2P6G A;  5J8F A;  3CXS A;  1S60 A;  4CAW A;  2VQY A;  4PK2 A;  4UWI A;  1Z9U A;  1QSO A;  5DWN A;  2J8N A;  1M4I A;  1NSL A;  2VEZ A;  4H6U A;  4MJ8 A;  4AG9 A;  3TCV A;  2REE A;  2OZG A;  2NMT A;  3GKR A;  3TO6 A;  3GY9 A;  5C82 A;  3F8K A;  2BSW A;  3S6F A;  1NMT A;  3FNC A;  4DNC A;  2CNT A;  5C88 A;  1U6M A;  4NCZ A;  4R3K A;  5EBV A;  4QB9 A;  4B5P B;  5IB0 A;  4B5P A;  2D4P A;  4LUA A;  2C27 A;  3EO4 A;  5F47 A;  2R7H A;  4PSW A;  3TTH A;  2HV2 A;  3N7Z A;  2Z10 A;  4H89 A;  4NF1 A;  1CM0 A;  4KOS A;  4XNH C;  4ZBG A;  3T90 A;  1S7K A;  5J8C A;  4JLY A;  1S3Z A;  1YVK A;  1J4J A;  2REF A;  3EXN A;  4FD4 A;  3D2M A;  3QAH A;  1WWZ A;  3FB3 A;  1NE9 A;  3IGR A;  3RYO A;  3KKW A;  2WPW A;  3EFA A;  4IF5 A;  3QB8 A;  3I9S A;  4U5Y A;  2FIA A;  3LD2 A;  2GAN A;  4YRH A;  4CS0 B;  2FXF A;  2ARH A;  3V8I A;  3P2F A;  3K9U A;  4EVY A;  4AG7 A;  2OZU A;  4QC6 A;  3C26 A;  5GCN A;  1XMT A;  1QSN A;  2ZW6 A; 
#chains in the Genus database with same CATH topology
 1KUX A;  2G9D A;  4P4E A;  4P44 A;  4HNW B;  3T9Y A;  3SXO A;  4KOU A;  1KUV A;  3JTK A;  3ZJ0 A;  3TO7 A;  1DTD A;  4HNY B;  3GLJ A;  1YW4 A;  1XE4 A;  3B2Y A;  3I3G A;  4WJB A;  1MJA A;  2Z3P A;  2Q51 A;  3SJF A;  2O4H A;  3H8F A;  3PB6 X;  3FIX A;  3D3S A;  4FBE A;  1LAN A;  4P45 A;  5AG6 A;  2FL4 A;  3H8G A;  3PBB A;  2VZY A;  2Q44 A;  2V8D A;  3E0K A;  1B6B A;  2CNM A;  5LYI A;  2HQY A;  3SI1 A;  1M4G A;  4M6G A;  2ZEN A;  4XNH B;  5K8O A;  1VHS A;  4ZI6 A;  2QEC A;  2PJ8 A;  2BO9 A;  2ZEE A;  2ZOG A;  5F48 A;  4ZYQ A;  5LYL A;  1TF9 A;  1MJ9 A;  1XEB A;  2Q04 A;  1XRY A;  4NGM A;  4CYN A;  2PJC A;  5ISV A;  2CF4 A;  4F6A A;  2PJ6 A;  1VIX A;  5D8N A;  2Q0Y A;  2V8H A;  1HEE A;  4C7I A;  4A95 A;  2BEI A;  3L2N A;  3F0A A;  4II9 A;  1PUA A;  3FX6 A;  2NYQ A;  4XPK A;  2QJ8 A;  4UCN A;  3CXP A;  4G1P A;  5HVH A;  1XIX A;  3NE8 A;  2CNS A;  4CYP A;  2FSR A;  2B4D B;  2ZW4 A;  4OIW A;  4A32 A;  2B4D A;  1MJB A;  2PIY A;  2GRE A;  4JXQ A;  4CGO A;  1FY7 A;  3LOD A;  3BLN A;  4OME A;  4B11 A;  2YNC A;  2XEI A;  1AMP A;  4GM5 A;  2OB0 A;  3TOB A;  4L8A A;  1Q2D A;  4CGM A;  5THW A;  2PRQ A;  1YX0 A;  3W6S A;  5JPH A;  2ZEP A;  4FWU A;  1PCA A;  4IK2 A;  1VHE A;  4KOT A;  2ZED A;  3B3T A;  4PPZ A;  2OR4 A;  4Z65 A;  1IYK A;  1Z4E A;  3NE7 A;  4R8F A;  2DPS A;  4OC3 A;  2AJ6 A;  1BPN A;  4RI1 A;  4X5K A;  4JD6 A;  1R57 A;  5G21 A;  2O53 A;  4BBH A;  3KQZ A;  4KLV A;  4B6Z A;  3GIU A;  1ZLH A;  2AFX A;  1YQE A;  3FED A;  1QMU A;  3CDX A;  2FIW A;  2QML A;  5LRK A;  2QIR A;  4RN7 A;  4XPD C;  3S9M A;  4C2Z A;  2P0W A;  4CPA A;  3PFE A;  4P4J A;  2JBJ A;  2PCU A;  4W9Y A;  4QBJ A;  5JH9 A;  5J1Q A;  3KI9 A;  2G0B A;  3NA6 A;  1IGB A;  3QNV A;  5HVF A;  5LRG A;  5DWM A;  3VWD A;  3WAB A;  1B87 A;  3R95 A;  4AVB A;  3R9E A;  4B14 A;  2Q4V A;  3S6G A;  2VBQ A;  3GUX A;  3JVN A;  4UFV A;  1S5K A;  2ODF A;  3TO9 A;  1ON0 A;  1XF8 A;  4CGN A;  2PR1 A;  1DE4 C;  1RO5 A;  1M4D A;  3IEH A;  3MN8 A;  4CAV A;  4DJL A;  3NH8 A;  1LFW A;  4OP4 A;  3ISZ A;  1RTQ A;  2OOT A;  2G3A A;  2AFO A;  8CPA A;  2B3V A;  4NFR A;  5H86 A;  5AG5 A;  1YR0 A;  3K9T A;  3FVL A;  3PGP A;  4NJR A;  5CNP A;  4YFJ A;  4OC2 A;  4MRI A;  3I1U A;  1Q7L A;  2DF5 A;  4QUS A;  4UFW A;  4AXV A;  2EUI A;  5F49 A;  1M1D A;  4KVX A;  4ONU A;  4UEZ A;  3B3V A;  1IOI A;  1Q2C A;  4KOV A;  2BL1 A;  2FT0 A;  2IMO A;  1F2P A;  2HUZ A;  2PJ3 A;  4MFZ A;  5I0C A;  2B3U A;  2AFW A;  1ZLI A;  2VZZ A;  2Z3M A;  3WT4 A;  2ABZ A;  1TKH A;  4NGS A;  2V77 A;  4O23 A;  2P6F A;  3R9G A;  2Q7B A;  4A38 A;  4NXY A;  2J8M A;  1GHE A;  1IIC A;  2WPX A;  2C6G A;  3D7D A;  4PXB A;  3EY5 A;  3JRU A;  4QVT A;  2PE3 A;  2CTB A;  2XEF A;  2WZN A;  1X12 A;  4KOR A;  7CPA A;  2B58 A;  4GXH A;  1QSR A;  3SI0 A;  4OLL A;  3W6X A;  1I1D A;  5BWA B;  5AGE A;  3CPX A;  3KL9 A;  5LRJ A;  1Y9W A;  1ARM A;  4KS9 A;  4XPD B;  4OC1 A;  2JDC A;  3SJX A;  1Z8X A;  2CXA A;  3IU1 A;  3S6K A;  3D2P A;  3D7G A;  4WWV A;  4C2X A;  2K5T A;  3BJ7 A;  4NGP A;  4MHN A;  1EE3 P;  3T8W A;  3CT9 A;  1L0C A;  4R57 A;  1SQH A;  3KHZ A;  1BPM A;  4KUB A;  3VAR A;  4A33 A;  1BLL E;  3ZZI A;  2FE7 A;  4OAD A;  2F5I A;  4HNX B;  4MFK A;  1Y7R A;  2RFH A;  4P4D A;  3FEC A;  1BOB A;  1VGY A;  1UWY A;  4FD5 A;  5EC4 A;  4HPS A;  1X10 A;  4Q7A A;  4M6I A;  2PJ4 A;  1LRZ A;  1YLE A;  5HXD A;  1S7F A;  2EWB A;  5IX3 A;  2DPT A;  2DXQ A;  4UEE A;  1CP6 A;  4MHZ A;  1M44 A;  4AB7 A;  3TFY A;  2ZXV A;  4FAI A;  4ZGY B;  4CAE A;  3D8P A;  4YGO A;  1IU8 A;  2AFS A;  2PIZ A;  3EC4 A;  3IWG A;  4E8O A;  2JBK A;  1GYT A;  3PB4 X;  1Y0R A;  1Z8L A;  3GB0 A;  2PJ9 A;  1N71 A;  4U9Z A;  4KOX A;  2B4B A;  2V8V A;  3IC1 A;  1VKC A;  3PB8 X;  1A2Z A;  1QST A;  2OU2 A;  1PYT B;  3KR5 A;  3BI0 A;  3FEE A;  4ORF A;  1YVO A;  2JLM A;  2PSW A;  3PBE A;  3G3S A;  4F0Y A;  5JQ4 A;  3S9N A;  4ZY2 A;  5LYF A;  4KLW A;  1ZG8 A;  2ATR A;  4F9V A;  1ZG7 A;  2Q4Y A;  2Y0M A;  4ZY0 A;  2X7B A;  1H8L A;  2YND A;  4F9U A;  1CP7 A;  3FF3 A;  2ZW5 A;  2OZH A;  1CG2 A;  4CGL A;  1V0C A;  2A4N A;  4CRZ B;  1Z4R A;  3PZJ A;  4JWP A;  4K3N A;  3UY5 A;  3HLP A;  3V38 A;  1YGH A;  1XMB A;  4JJX A;  3IU2 A;  4XPL A;  4C68 A;  4P4B A;  3RO0 A;  2ZPA A;  4MI4 A;  5G22 A;  5JM6 A;  3H5Z A;  4KVM E;  3WR7 A;  3CXQ A;  4H6Z A;  5IV0 A;  4KVO E;  3TOA A;  2EK8 A;  4CAF A;  3B3W A;  3MGD A;  3B35 A;  2IL4 A;  1CBX A;  3IWE A;  3FH4 A;  4B10 A;  5HH1 A;  3OWC A;  3NH4 A;  2I00 A;  1AYE A;  1I21 A;  4MY0 A;  5DS0 A;  2EVN A;  2FCK A;  4UCP A;  4KZT A;  2R98 A;  5K8M A;  3SJE A;  4A37 A;  4X8I A;  1IYL A;  4MCP A;  3S6H A;  2Z0Z A;  4OC4 A;  3DNS A;  4MFQ A;  4F0X A;  3NFZ A;  3CPA A;  3NH5 A;  4UA3 A;  4UFX A;  2C6P A;  1OZP A;  4E0A A;  3H4Q A;  3D4U A;  1Q2Y A;  4CYQ A;  5ELY A;  2PJ2 A;  1CX8 A;  2PJ0 A;  4CAX A;  2AE6 A;  2BCO A;  2ZEO A;  3DDD A;  4FD7 A;  4JYW A;  3VAT A;  4MHP A;  1YSJ A;  4EME A;  4MHD A;  1P4N A;  2POK A;  3F5B A;  1F2O A;  2P6E A;  3FRM A;  3PP9 A;  5H84 A;  3DGV A;  3HUV A;  2Z3L A;  5G20 A;  1FNO A;  3LWU A;  4HKF A;  4ONW A;  2HB6 A;  1S7N A;  1WK4 A;  1Y9K A;  2JDD A;  4NSQ A;  5FVJ A;  1TIQ A;  4C2Y A;  4DYO A;  2WYR A;  4I49 A;  4KSA A;  4K30 A;  1Y7E A;  3KAS A;  4R87 A;  2WUU A;  1NSA A;  2R1I A;  1CJW A;  4MBU A;  3IIB A;  4AVA A;  3BJ8 A;  3R96 A;  5D29 A;  4BMH A;  3TE4 A;  2JEV A;  2PC1 A;  4L89 A;  4LX9 A;  4IUS A;  4Q36 A;  4UIA A;  3FBU A;  2PJB A;  3FJU A;  2BUE A;  4MFJ A;  1YRE A;  3SJG A;  5LYD A;  4PV6 A;  3BI1 A;  4A94 A;  3K2K A;  2H5M A;  1YK3 A;  4P4F A;  1TXR A;  1IY7 A;  4P6Y A;  1MK4 A;  2Z3N A;  4PK3 A;  2ZEM A;  2KCW A;  4CRY B;  4E2A A;  1S7L A;  3FXT A;  2PJ5 A;  1TKJ A;  2PRB A;  2PDO A;  3D68 A;  2Z3O A;  3P2H A;  4FD6 A;  4Q38 A;  4ZX9 A;  1PU9 A;  4B12 A;  4PXE A;  4EFD A;  2FS5 A;  4MXU A;  4R76 A;  1UFH A;  3B8G A;  2B5G B;  1BO4 A;  2D4O A;  1QSM A;  2PVV A;  2B5G A;  3LMS A;  3N5F A;  2FVG A;  5I4M A;  1Y0Y A;  4A2Z A;  4PSX A;  2GIV A;  1RXT A;  3DR6 A;  4B5O A;  4FUU A;  1K4J A;  1XJO A;  2ZEF A;  4GS4 A;  4KOW A;  3WC7 A;  4B13 A;  2ZW7 A;  4Y49 C;  3RZA A;  2RB7 A;  5F46 A;  1BAV A;  1XOV A;  5E96 A;  3R9F A;  5CBM A;  5HVG A;  3SXN A;  1OBR A;  5KTA A;  5HMN A;  3BXM A;  2I3C A;  4MHY A;  4IHM A;  3G8W A;  4BIN A;  1IB1 E;  2R8V A;  1ZG9 A;  2NSM A;  4LQ6 A;  4J3G A;  2IQ6 A;  2ANP A;  3R1K A;  4M85 A;  4UBR A;  2CY2 A;  4CGP A;  3D7H A;  3GYA A;  4M6H A;  4OAE A;  1P0H A;  3PB7 X;  2G3T A;  3D66 A;  4KUA A;  4YWY A;  4MY3 A;  4RUH A;  1TF8 A;  4OID A;  2C1C A;  4PXC A;  3JUW A;  5G1Z A;  1FT7 A;  1JQG A;  4PQA A;  2O28 A;  2VXK A;  4R9M A;  3DR8 A;  2OH1 A;  3A9L A;  3CZX A;  4U9Y A;  1Z2L A;  1LAP A;  4KSF A;  4M3S A;  3PEI A;  2AFU A;  1VHO A;  2VI7 A;  5K8N A;  1Z8W A;  3BHX A;  2GE3 A;  4MFP A;  3RNZ A;  4TWE A;  1LAM A;  4RS2 A;  3VWE A;  2DEA A;  1JWQ A;  2Q4Z A;  2XEG A;  2V8G A;  5KTD A;  4OC0 A;  1LOK A;  1XBU A;  3TT2 A;  2RC4 A;  3DSB A;  5F09 A;  1KUY A;  4AVC A;  3FYN A;  1IID A;  4CYO A;  3W91 A;  1I12 A;  3S9L A;  2F8H A;  4MMO A;  4A39 A;  4JXR A;  4NJQ A;  4UWJ A;  1ZO0 A;  2GLF A;  2YGW A;  4R3L A;  2PR8 A;  2PQ8 A;  1KWM A;  4NEX A;  3KHX A;  3WC6 A;  4Y49 B;  5KTC A;  4R7M A;  2IJZ A;  2ZEG A;  2Z11 A;  3MRU A;  2I79 A;  2J8R A;  1KZF A;  4KOY A;  3SHP A;  4TNU A;  4UCM A;  3KGQ A;  2P6G A;  5J8F A;  3CXS A;  4MCS A;  1HDU A;  3LAC A;  4NGN A;  2GU2 A;  3TX8 A;  2Z3K A;  1S60 A;  4CAW A;  2VQY A;  2EBJ A;  3SI2 A;  3QAY A;  2EO8 A;  4NGR A;  4PK2 A;  4UWI A;  1IOF A;  4ZX8 A;  1Z9U A;  4NGT A;  4EWT A;  1QSO A;  4MFL A;  5DWN A;  2J8N A;  3RBU A;  1M4I A;  1NSL A;  2VEZ A;  5AG4 A;  4H6U A;  4MJ8 A;  2AFZ A;  3KR4 A;  3TC8 A;  3WC5 A;  4AG9 A;  3TCV A;  2REE A;  2OZG A;  5CPA A;  2NMT A;  4JZ0 A;  3GKR A;  3TO6 A;  2CIJ A;  3KQX A;  2YNE A;  3GY9 A;  2AFM A;  4OC5 A;  5C82 A;  1YME A;  3F8K A;  4UIB A;  3IJ3 A;  2BSW A;  2BOA A;  1NMT A;  3S6F A;  5JGF A;  3FNC A;  1Z5R A;  4DNC A;  2CNT A;  5A28 A;  6CPA A;  3H8E A;  4ZY1 A;  5C88 A;  4UEF A;  1QQ9 A;  4P10 A;  4YU9 A;  1U6M A;  2CTC A;  1YW6 A;  4NCZ A;  5K8P A;  4R3K A;  5EBV A;  2EK9 A;  4QB9 A;  4B5P B;  5IB0 A;  3FMC A;  4B5P A;  2F7V A;  3B7I A;  2D4P A;  2XEJ A;  1ELL P;  3DLJ A;  5EMI A;  2PVW A;  4LUA A;  1F57 A;  2C27 A;  4NGQ A;  3EO4 A;  5IB9 A;  5F47 A;  2R7H A;  3VH9 A;  4A31 A;  4H2K A;  4PSW A;  3TTH A;  4LQG A;  2HV2 A;  3N7Z A;  2PJ1 A;  1LCP A;  2Z10 A;  3IO1 A;  4H89 A;  4X2T A;  2ZOF A;  4NF1 A;  4P4I A;  1CM0 A;  4KOS A;  1R43 A;  3PFO A;  4XNH C;  4ZBG A;  3T90 A;  1S7K A;  2Q43 A;  4MCQ A;  4X3R A;  5J8C A;  4JLY A;  1S3Z A;  1M4L A;  1YVK A;  1J4J A;  2REF A;  3EXN A;  5AG7 A;  2QVP A;  4A30 A;  2JEW A;  3B3C A;  4FD4 A;  1Z8T A;  3D2M A;  1YLO A;  2Q7S A;  3QAH A;  1WWZ A;  3FB3 A;  1NE9 A;  2C6C A;  3PB9 X;  3IGR A;  3RYO A;  1CPS A;  3D7F A;  3KKW A;  2WPW A;  3EFA A;  4IF5 A;  3QB8 A;  4C7H A;  3I9S A;  1TKF A;  2GFQ A;  2FIA A;  2J9A A;  2GAN A;  3LD2 A;  4U5Y A;  4YRH A;  4BD9 A;  4CS0 B;  4PXD A;  3KZW A;  2FXF A;  2QYV A;  2WSA A;  2ARH A;  3IFE A;  3V8I A;  3PRT A;  3P2F A;  4DUK A;  5A27 A;  2PJA A;  3RAM A;  2YNC C;  1R3N A;  2HC9 A;  3K9U A;  4OKO A;  4F8Z A;  4UF4 A;  1ELM P;  4MCR A;  1ARL A;  3V7Z A;  1HDQ A;  3B3S A;  2ZEH A;  4EVY A;  2ZEL A;  4AG7 A;  2VL1 A;  2OZU A;  4KSI A;  1AUG A;  4QC6 A;  4R6T A;  1XFO A;  3C26 A;  3IWW A;  1CPX A;  2GLJ A;  1XMT A;  4IAV A;  2PJ7 A;  5GCN A;  1QSN A;  2ZW6 A;  3D67 A;  3ISX A; 
#chains in the Genus database with same CATH homology
 1KUX A;  4HNW B;  3T9Y A;  3SXO A;  4KOU A;  1KUV A;  3JTK A;  3ZJ0 A;  3TO7 A;  4HNY B;  1XE4 A;  3I3G A;  1MJA A;  2Z3P A;  3FIX A;  3D3S A;  5AG6 A;  2FL4 A;  2VZY A;  2Q44 A;  3E0K A;  1B6B A;  2CNM A;  2HQY A;  1M4G A;  4XNH B;  1VHS A;  2QEC A;  5F48 A;  1MJ9 A;  1XEB A;  2Q04 A;  4CYN A;  5ISV A;  4F6A A;  2Q0Y A;  4C7I A;  4A95 A;  2BEI A;  3F0A A;  4II9 A;  1PUA A;  4XPK A;  4UCN A;  3CXP A;  1XIX A;  2CNS A;  4CYP A;  2B4D B;  2FSR A;  2ZW4 A;  4A32 A;  2B4D A;  1MJB A;  4JXQ A;  4CGO A;  1FY7 A;  3LOD A;  3BLN A;  4B11 A;  2YNC A;  3TOB A;  4CGM A;  2OB0 A;  4L8A A;  1Q2D A;  1YX0 A;  3W6S A;  5JPH A;  4KOT A;  1IYK A;  1Z4E A;  3NE7 A;  2DPS A;  4X5K A;  2AJ6 A;  4RI1 A;  4JD6 A;  1R57 A;  5G21 A;  4BBH A;  4KLV A;  2FIW A;  2QML A;  2QIR A;  4XPD C;  4C2Z A;  2P0W A;  4QBJ A;  2G0B A;  3VWD A;  5DWM A;  1B87 A;  3R95 A;  4AVB A;  3R9E A;  4B14 A;  2Q4V A;  3S6G A;  2VBQ A;  4UFV A;  3JVN A;  1S5K A;  3TO9 A;  1ON0 A;  1XF8 A;  4CGN A;  2PR1 A;  1RO5 A;  1M4D A;  4CAV A;  2G3A A;  2B3V A;  5H86 A;  5AG5 A;  1YR0 A;  3PGP A;  5CNP A;  4YFJ A;  4QUS A;  4UFW A;  2EUI A;  5F49 A;  1M1D A;  4KVX A;  4ONU A;  1Q2C A;  4KOV A;  2BL1 A;  2FT0 A;  2HUZ A;  4MFZ A;  5I0C A;  2B3U A;  2VZZ A;  2Z3M A;  3R9G A;  2P6F A;  2Q7B A;  4NXY A;  2J8M A;  1GHE A;  1IIC A;  2WPX A;  3EY5 A;  4QVT A;  2B58 A;  1QSR A;  4OLL A;  3W6X A;  1I1D A;  5BWA B;  5AGE A;  1Y9W A;  4KS9 A;  4XPD B;  2JDC A;  2CXA A;  3IU1 A;  3S6K A;  3D2P A;  4C2X A;  2K5T A;  3BJ7 A;  1L0C A;  4R57 A;  1SQH A;  4KUB A;  4A33 A;  3ZZI A;  2FE7 A;  4OAD A;  2F5I A;  4HNX B;  4MFK A;  1Y7R A;  1BOB A;  4FD5 A;  5EC4 A;  5IX3 A;  1LRZ A;  1YLE A;  1S7F A;  2DPT A;  2DXQ A;  1M44 A;  4AB7 A;  3TFY A;  2ZXV A;  4ZGY B;  4CAE A;  3D8P A;  4YGO A;  3EC4 A;  3IWG A;  4E8O A;  1N71 A;  4U9Z A;  4KOX A;  2B4B A;  1VKC A;  1QST A;  2OU2 A;  4ORF A;  1YVO A;  2JLM A;  2PSW A;  3G3S A;  4F0Y A;  5JQ4 A;  4KLW A;  2ATR A;  2Q4Y A;  2Y0M A;  2X7B A;  2YND A;  2ZW5 A;  2OZH A;  4CGL A;  4CRZ B;  1V0C A;  2A4N A;  1Z4R A;  3PZJ A;  4JWP A;  3UY5 A;  1YGH A;  4JJX A;  3IU2 A;  4XPL A;  4C68 A;  2ZPA A;  4MI4 A;  5G22 A;  3H5Z A;  4KVM E;  3WR7 A;  3CXQ A;  4H6Z A;  5IV0 A;  4KVO E;  3TOA A;  4CAF A;  3MGD A;  2IL4 A;  3IWE A;  5HH1 A;  3OWC A;  2I00 A;  1I21 A;  4MY0 A;  2EVN A;  2FCK A;  4UCP A;  4KZT A;  2R98 A;  1IYL A;  3S6H A;  2Z0Z A;  3DNS A;  4MFQ A;  4UA3 A;  4UFX A;  4E0A A;  1OZP A;  3H4Q A;  4CYQ A;  1Q2Y A;  4CAX A;  2AE6 A;  3DDD A;  4FD7 A;  4MHD A;  1P4N A;  4B10 A;  3F5B A;  3FRM A;  2P6E A;  3PP9 A;  5H84 A;  2Z3L A;  5G20 A;  4HKF A;  1S7N A;  1WK4 A;  1Y9K A;  2JDD A;  4NSQ A;  5FVJ A;  1TIQ A;  4C2Y A;  4I49 A;  4KSA A;  4K30 A;  4R87 A;  2WUU A;  2R1I A;  1CJW A;  4MBU A;  4AVA A;  3BJ8 A;  3R96 A;  4BMH A;  3TE4 A;  2JEV A;  2PC1 A;  4L89 A;  4LX9 A;  4IUS A;  4Q36 A;  3FBU A;  2BUE A;  4MFJ A;  1YRE A;  4PV6 A;  2H5M A;  1YK3 A;  1MK4 A;  2Z3N A;  4PK3 A;  2KCW A;  4CRY B;  4E2A A;  1S7L A;  3FXT A;  2PRB A;  2PDO A;  3P2H A;  2Z3O A;  4FD6 A;  4Q38 A;  1PU9 A;  4B12 A;  2FS5 A;  3B8G A;  1UFH A;  2B5G B;  1BO4 A;  2D4O A;  1QSM A;  4KOR A;  2B5G A;  4A2Z A;  4PSX A;  2GIV A;  1RXT A;  3DR6 A;  4B5O A;  1K4J A;  4B13 A;  4GS4 A;  4KOW A;  5F46 A;  2ZW7 A;  4Y49 C;  3R9F A;  5E96 A;  3SXN A;  5KTA A;  5HMN A;  3G8W A;  1IB1 E;  2R8V A;  4J3G A;  3R1K A;  4M85 A;  4UBR A;  2CY2 A;  4CGP A;  3GYA A;  4OAE A;  1P0H A;  2G3T A;  4KUA A;  4MY3 A;  3JUW A;  5G1Z A;  2O28 A;  2VXK A;  4R9M A;  3DR8 A;  2OH1 A;  3A9L A;  4U9Y A;  4KSF A;  4M3S A;  2VI7 A;  2GE3 A;  4MFP A;  4RS2 A;  3VWE A;  5KTD A;  3TT2 A;  2RC4 A;  3DSB A;  1KUY A;  4AVC A;  3FYN A;  1IID A;  4CYO A;  3W91 A;  1I12 A;  4JXR A;  4UWJ A;  1ZO0 A;  4R3L A;  2YGW A;  2PR8 A;  2PQ8 A;  4NEX A;  4Y49 B;  5KTC A;  2Z11 A;  2I79 A;  2J8R A;  1KZF A;  4KOY A;  3SHP A;  4UCM A;  2P6G A;  5J8F A;  3CXS A;  2Z3K A;  1S60 A;  4CAW A;  2VQY A;  4PK2 A;  4UWI A;  1Z9U A;  1QSO A;  4MFL A;  5DWN A;  2J8N A;  1M4I A;  1NSL A;  2VEZ A;  5AG4 A;  4H6U A;  4MJ8 A;  4AG9 A;  3TCV A;  2REE A;  2OZG A;  2NMT A;  3GKR A;  3TO6 A;  2YNE A;  3GY9 A;  5C82 A;  3F8K A;  2BSW A;  3S6F A;  1NMT A;  3FNC A;  4DNC A;  2CNT A;  5A28 A;  5C88 A;  1U6M A;  4NCZ A;  4R3K A;  5EBV A;  4QB9 A;  4B5P B;  5IB0 A;  4B5P A;  2D4P A;  4LUA A;  2C27 A;  3EO4 A;  5F47 A;  2R7H A;  4A31 A;  4PSW A;  3TTH A;  2HV2 A;  3N7Z A;  2Z10 A;  4H89 A;  4NF1 A;  1CM0 A;  4KOS A;  4XNH C;  4ZBG A;  3T90 A;  1S7K A;  5J8C A;  4JLY A;  1S3Z A;  1YVK A;  1J4J A;  2REF A;  3EXN A;  5AG7 A;  4A30 A;  4FD4 A;  3D2M A;  3QAH A;  1WWZ A;  3FB3 A;  1NE9 A;  3IGR A;  3RYO A;  3KKW A;  2WPW A;  3EFA A;  4IF5 A;  3QB8 A;  4C7H A;  3I9S A;  4U5Y A;  2FIA A;  3LD2 A;  2GAN A;  4YRH A;  4CS0 B;  2FXF A;  2WSA A;  2ARH A;  3V8I A;  3P2F A;  5A27 A;  2YNC C;  3K9U A;  4EVY A;  4AG7 A;  2OZU A;  4QC6 A;  3C26 A;  5GCN A;  1XMT A;  1QSN A;  2ZW6 A;  4F0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...