2G9DA

Crystal structure of succinylglutamate desuccinylase from vibrio cholerae, northeast structural genomics target vcr20
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
340
structure length
340
Chain Sequence
KSLFRQSFLFDSLDLDHPMVAQTVRTEQGVTLKLHQRGVLEVIPAQTDAATKNMVISCGIHGDETAPMELLDKWIDDIVSGFQPVAERCLFIMAHPQATVRHVRFIEQNLNRLFDDKPHTPSTELAIADNLKVLLRQFFANTDEHSRWHLDLHCAIRGSKHYSFAVSPKARHPVRSRSLMQFIEQAHIEAVMLSNAPSSTFSWYSAEHYAAQALTLELGQVARLGENLLDRLLAFDLAMRDLISRHKPEHLPRKSVMYRVSRTIVRLHDDFDFRFSDDVENFTAFMHGEVFGHDGDKPLMAKNEGEAIVFPNRKVAIGQRAALMVCKVNTRYEDDQLVYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Succinylglutamate desuccinylase from Vibrio cholerae, Northeast Structural Genomics Target VcR20.
rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
molecule keywords Succinylglutamate desuccinylase
total genus 71
structure length 340
sequence length 340
ec nomenclature ec 3.5.1.96: Succinylglutamate desuccinylase.
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.630 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2g9dA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2g9dA01
4GM5A 2PIZA 1CX8A 3H8EA 2RFHA 3K2KA 2I3CA 4A38A 3RBUA 1BPMA 4NJQA 1ZG7A 2V8VA 1HDQA 3ISZA 3D7GA 3KHXA 3TX8A 4H2KA 4WJBA 3HUVA 4DUKA 2PE3A 4PXDA 3B35A 2NYQA 5LRKA 1ELMP 4ZY2A 4R6TA 1QQ9A 1YW6A 1TF9A 3MRUA 3D7DA 4TNUA 2PJ4A 4PXBA 3B3TA 4B6ZA 1ELLP 2WZNA 5HVGA 4F9UA 4ZYQA 3SI0A 3KR4A 4P45A 1IGBA 2IJZA 1DTDA 3PB7X 3IC1A 3PRTA 3KZWA 4W9YA 2Q43A 4NJRA 4KSIA 3T8WA 3SJEA 2GLFA 2O4HA 2IQ6A 4F8ZA 4CPAA 2PJ2A 4EWTA 1LOKA 1Y0YA 3B3VA 1PCAA 1R3NA 2C6GA 3FJUA 2AFUA 3NFZA 1XBUA 1CBXA 4JYWA 2ZEEA 1EE3P 1YMEA 3IWWA 1Z2LA 2HC9A 3PEIA 4EFDA 5JGFA 4UIBA 2IMOA 4Q7AA 2CIJA 5JM6A 1VHEA 1TKJA 2AFZA 4WWVA 3B7IA 4UF4A 3WABA 4NGQA 4FAIA 3VARA 1CP6A 1ARLA 1XRYA 3VH9A 1Q7LA 3H8GA 2ZOFA 1ZLHA 4MHNA 4O23A 4JZ0A 4DYOA 2JBKA 3WC5A 4P44A 2Q51A 2OR4A 2PJAA 2AFWA 2PVVA 4YWYA 1AYEA 2ZEFA 4NFRA 5CPAA 1OBRA 3B3SA 3MN8A 3SI1A 1JQGA 2EK8A 4AXVA 2PJ1A 3IO1A 4ZI6A 4Z65A 3FX6A 4IK2A 7CPAA 1H8LA 3DGVA 2XEJA 3B3CA 4MHPA 3H8FA 4NGTA 1VHOA 2O53A 2CTBA 4R76A 2C1CA 3WC7A 2GREA 2PJCA 2V8DA 4UEZA 3PFOA 5JH9A 3FVLA 2ZEMA 5HVFA 5K8PA 1TXRA 1PYTB 2ZEPA 3BI0A 2OOTA 2V8HA 1Z5RA 2PJ6A 1CG2A 4P4DA 3N5FA 3VATA 1XMBA 2DEAA 1M4LA 2ABZA 2PJ3A 4MHYA 4YU9A 1DE4C 4P4FA 3KI9A 4F9VA 1F2PA 1F2OA 2EK9A 3D67A 2ZOGA 5LYLA 1ZLIA 3B2YA 3V38A 1FNOA 4ZY0A 4OC4A 5J1QA 1LANA 2F7VA 3KR5A 4NGRA 1XJOA 3GLJA 3BXMA 2QJ8A 3SJXA 3QNVA 1IY7A 3PB4X 3FH4A 5K8MA 4OMEA 1LAPA 3KQXA 2BCOA 1GYTA 2HB6A 3BHXA 4ZX8A 4OC0A 5THWA 3D68A 4PQAA 3IFEA 4P10A 4MRIA 5I4MA 3PFEA 1R43A 4P4IA 2ZEHA 5D8NA 1CP7A 1RTQA 1TKFA 2PJBA 4ZX9A 3LMSA 2PJ7A 2PRQA 1F57A 2V77A 1VGYA 3S9NA 1AMPA 1TKHA 4X2TA 1ZG8A 3NA6A 3FMCA 2PJ0A 4P6YA 2XEIA 3SJGA 3TC8A 2QVPA 1YW4A 2J9AA 2ZEOA 3PBEA 4P4BA 1NSAA 4A94A 1VIXA 5HVHA 2ZEDA 3DLJA 8CPAA 6CPAA 5DS0A 1HEEA 2NSMA 3GUXA 4LQGA 2FVGA 4X3RA 4A37A 3S9MA 4MCSA 4R8FA 1TF8A 3KASA 3D7FA 4OKOA 4RUHA 5LRJA 4FWUA 4OC3A 5D29A 3PBBA 3FF3A 4MXUA 3S9LA 2VL1A 4G1PA 4FBEA 2QYVA 4A39A 1LCPA 1FT7A 2XEFA 4FUUA 5K8NA 2GLJA 3JRUA 4NGMA 4OC5A 2PJ5A 3CT9A 2JBJA 4TWEA 3PB8X 1ZG9A 4IHMA 3K9TA 2JEWA 4X8IA 4MCQA 4MCRA 2ZENA 3IJ3A 4NGNA 4OC2A 4OC1A 3KQZA 1LFWA 5ELYA 3KHZA 3L2NA 1Y7EA 2GU2A 5HXDA 1BAVA 3FEEA 4EMEA 2BO9A 3KGQA 4K3NA 3KL9A 4ZY1A 2V8GA 2ZELA 3I1UA 2PJ9A 2PIYA 3LWUA 1LAMA 4NGPA 5LRGA 2PVWA 1KWMA 3SJFA 4P4EA 2PCUA 4UIAA 5LYDA 1Z8LA 3SI2A 4BD9A 4ONWA 3B3WA 3WT4A 2ANPA 4DJLA 3D4UA 5LYIA 4P4JA 2XEGA 3FEDA 2AFSA 3GB0A 2AFMA 2EWBA 1HDUA 3IIBA 3PB9X 3HLPA 4NGSA 1YSJA 1Y0RA 1YLOA 5CBMA 4MCPA 1BPNA 2F8HA 1XFOA 4PPZA 2AFXA 1CPSA 2PJ8A 3IEHA 3D7HA 1UWYA 4R7MA 3ISXA 5F09A 3BI1A 5IB9A 2RB7A 1QMUA 4UEFA 3NH5A 4MHZA 2AFOA 4UEEA 2POKA 3D66A 2BOAA 2CTCA 2G9DA 3V7ZA 1BLLE 4OP4A 3FECA 3NH8A 4OIDA 4OIWA 3RAMA 2CF4A 3RZAA 3WC6A 3NH4A 3CDXA 2C6CA 2Q4ZA 5LYFA 2WYRA 4PXCA 2C6PA 5K8OA 2ZEGA 4PXEA 3CPAA 3CPXA 4IAVA 1CPXA 3PB6X 1ARMA 4MMOA
chains in the Genus database with same CATH superfamily
1WD0A 5IYCG 4EGVA 2VQFQ 1AH9A 4A3MB 2P5ZX 2NVTB 1EU4A 4DV6Q 3GTLB 3HOUG 2RFHA 1LRZA 2NVYB 1ICWA 2P6FA 3KLSA 2YNCA 2Q2UA 3KKWA 4JI8Q 4C56C 1EEFD 4Q5VA 2X7BA 3C26A 2PRBA 3H15A 2IX1A 2AQ1B 3WOEA 4RCOA 4WORA 1I6HH 3TX8A 5J8FA 2B63H 2QGQA 3NENA 4HTHA 1N33Q 2IY5B 4H2KA 1D7QA 4WJBA 4A33A 4QMGA 4DUKA 4E2AA 1B44D 1HTLD 3CC4A 3FYNA 1L0XB 2VB3X 3MWYW 3P75A 2WFWA 3KFUA 3OIPA 4QIWB 2VY3A 5CV4A 2I5MX 4LF6L 1QUQA 4BINA 3EJIA 3HOWG 4DAYB 1LTSD 2CHBD 4R87A 5KNBA 1O7LA 2WZNA 5HVGA 4R4IA 2NWGA 1DGSA 2YNEA 2WPXA 4HR7B 1NNXA 4MTNA 1S40A 3CHBD 3FRPB 1DTDA 3PB7X 5JPMC 1NBWA 3KZWA 2VW9A 4FF1A 5J8CA 4W9YA 4NJRA 1V1OA 2F0NA 4LQ6A 3T8WA 1Y9KA 2JA5H 2VBQA 2J0TD 2B2TA 3A8JE 5IYBH 4GS4A 2NYZD 2R98A 4UP7A 1IBLL 2DUDA 2D9UA 3HOVH 1VQEA 1ZO0A 3MXGA 4IN3A 4KVOE 1M44A 5CBAE 5KGUA 1V43A 3B3VA 4IALA 2YTXA 2VQEL 2Q2TA 2AFUA 4BBRB 1IL8A 4H7BA 1CQVA 4OXPA 1ONLA 4XQQA 2WSAA 3QAYA 4Q0FA 1JC7A 2RBMA 1CBXA 1ICFB 1F9PA 3EN2A 2LY7A 3VA5A 2EXDA 4AVAA 2JYOA 3S6KA 2PR8A 4YWLA 3RZDH 2HC9A 1JWQA 4XT1B 1G8ZD 2XN9C 5JGFA 1WOCA 1Z47A 2OZGA 3RO0A 2ZW4A 4KVME 3H6MA 4Q7AA 3KLSX 3FP9A 1PFSA 1F2YA 4FNFA 1QE6A 2DY7A 2O4XA 3I70A 5LMNQ 5GCNA 1K83H 1PH9A 4WFN3 3H0GB 3PIPA 4WWVA 2B4DA 2AUKA 3N52A 2K33A 2VNUD 3NBIA 1EY7A 4FAIA 2E75C 2DJFC 2YGWA 1TWFH 2EE1A 1XRYA 1Q7LA 1JE4A 1M4GA 2ES2A 3GTPB 4V190 4JI5Q 3GQBA 3MXNA 4WJ4A 1H9RA 2IW3A 2L11A 1K3BC 1A8VA 2SDFA 2E2DC 4JI8L 4ONUA 1ZXTA 3FKIH 4KORA 1SNDA 3C1FA 1G6ZA 3BJ8A 1RL2A 1BOSA 2WP8J 2YV5A 5KNCA 3F5BA 4J3GA 3OW7A 3UE1A 2FFKB 4XYOA 2F3IA 2HIXA 4YWYA 2QDBA 4KLVA 1EQVA 4X62L 1VQIA 1QUQB 3SK8A 4KOYA 1EWHA 2QECA 1HZCA 4IZ8A 4K8JA 3TS0A 1BDOA 4KUAA 1EY5A 2Z3LA 3K5OA 1YHAA 1JORA 1STNA 3GTOB 1H95A 2AUJD 3SGIA 1IHZA 4AXVA 4V0BA 2VXKA 5JEAJ 3H0GH 3DXJC 1MSGA 3RN2A 2RSOA 4OELB 1H8LA 3DGVA 1S5DD 4B11A 4CYQA 3B3CA 4DR6Q 4NGTA 5C4HA 1RHPA 1A0IA 2AWOA 5FO9B 2RDHA 3GTJH 4HJ9A 2B2VA 5J3BA 4X64Q 4A3JB 4R76A 2F0GA 3N7ZA 4A95A 5FO8B 4H6UA 3CXQA 4KOVA 5EPKA 1MSHA 3STBC 2PJCA 1V9PA 1IBKQ 3FNCA 4A3FG 2R1IA 3FVLA 3VDYA 3J7AV 3TBIB 4QQBX 2N3SA 2JA7B 2ZEPA 4R57A 2V8HA 2MPMA 1TU2B 1KAAA 4L5QA 4LF9Q 3HEJA 3S2HH 1C7YA 1CG2A 1K4JA 5IWAQ 1CI3M 3R2IA 4KOUA 2VQFL 1SDFA 3TSSA 4Y52H 2F0DA 4ZYSA 2DPSA 2PJ3A 1I94L 2B29A 2V4DA 1PFBA 2JA5B 3PZJA 2YU9B 1EY9A 4YU9A 4P4FA 1PVOA 3QWNA 2JA8G 2WKDA 4OL7A 2Q2HA 3E9HA 5GAHC 1Z8XA 4AQYQ 1IYLA 3PF4A 2UXDQ 3BVGA 4I7ZC 1VKCA 3EC4A 2K04A 4S3SA 2CNMA 2ZOGA 3LWEA 1EWIA 4MY3A 3S1QH 1KRSA 3DNSA 3T56B 4I49A 5DWMA 1I5FA 4PZ6A 2HHHQ 4F6AA 4Q36A 3IAYA 4RCNA 3T4AC 1EY6A 4BBHA 1RCVD 1CA6A 2UU9Q 4B3SL 1NMFA 1RTNA 3QOLA 3J81c 4NXMQ 3GV3A 5BN5A 4HIMA 3OWCA 1LM0A 1CK1A 4HKFA 1GVPA 3VYRA 3QNVA 4CAFA 4FXDA 3PB4X 3FH4A 4FD4A 1XTDA 1AUGA 4A3IH 2NBFA 1C48A 2KCMA 3GDEA 3S15B 2ZXRA 1VQNA 4LF7L 1S5BD 4JBKA 2Z4IA 2HB6A 5DM63 1N36L 1CSQA 1EFID 2E8GA 4OC0A 3CMAA 1EIGA 4DV1Q 2NVTH 1KABA 3LACA 1NMGA 1UEBA 2CY2A 1WTPA 3NSWA 5I4MA 4IFDJ 2ZEHA 1UE1A 4KOTA 1H9JA 2QF7A 3K58A 2GVBA 4DK6C 1RTQA 1Q86C 2CW0C 3LMSA 1K8GA 1PZJD 2A1AA 1F57A 5DAUA 5EAYA 3GTPH 2QEJC 1KUYA 1ZG8A 4M85A 2I79A 2VUMH 3ITPA 3NK9A 4P6YA 3CC7A 4A3DB 4DR3Q 2XEIA 1GKHA 1PLFA 1KLUD 2ZW7A 1KDBA 5KTDA 3CXPA 4J8QA 2F03A 4EVYA 3S6GA 2WAQG 3UDFA 4DR5Q 3HOWB 2R7ZH 1MGSA 1WTOA 2GE3A 4XPLA 3J81j 4B12A 3DLJA 1PTOC 5DS0A 1HEEA 3ONAB 2XRQD 2F0MA 3I4LA 3IKJA 2NSMA 3GUXA 1S5ED 4QUFA 2Y0SB 4A93B 3S9MA 2B3UA 4J6HA 1VQ4A 1QJOA 3K80C 3D7FA 3ZJ0A 2O28A 1T5EA 5FLXc 1GD7A 1TWGB 4L6TB 4O2DA 1LT3D 4LUZA 3BZDB 1A2ZA 3A74A 2Z1CA 4POGA 2B2UC 3GTGB 4OC3A 1Y1VG 3DWQA 1D6EC 4JBMA 1X12A 4GS3A 1OO9B 4L5RC 4MXUA 4A75A 3KDFB 5FK9C 1BBUA 3HOZG 3K81C 3PGZA 4GNXA 1EIYB 1ESRA 2FIAA 2JXMB 5M3FH 2ZTCA 4HNYB 2QYVA 2UUBL 3D6WA 4EQPA 4A39A 3HZXA 3MRUA 4M8AA 5C0XI 3FKIG 1WFQA 1VQOA 1J5EQ 3JRUA 3K9UA 1BXTA 5M3MH 4KJNA 2UUAL 1PU9A 1Z6HA 1TIID 3U4ZA 4OLLA 2JBJA 2A73B 4CDDC 2WAQB 4DR1Q 2EY2A 2KENA 4I7AA 1V1PB 2R8VA 1GUGA 5C0XG 4X8IA 1NE9A 4JI6Q 1W6JA 4X3SA 3CC2A 1RF2D 4NGNA 2EY5A 1HA5A 5AFWA 5EMIA 4AG9A 1VMPA 1QSNA 5G3LD 1EEID 3U50C 1I1DA 4ODGA 5IGDA 4KV6A 5AG6A 3KHZA 3B8GA 1Y7EA 4IO9A 2GU2A 1DOLA 1Q1BA 1BBWA 1AEXA 1R4QB 1I21A 1BAVA 1TY0A 2J8NA 3TCVA 1KDAA 4C2MH 1CZWA 4MFJA 2JA8H 4DXFA 2KUMA 3MHBA 2BO9A 5E96A 4KI0A 4EMEA 4ME3A 2Z9HA 1SROA 4HJAA 2ATWA 3OMGA 2F0HA 4B08A 1DONA 3TREA 2UUCL 3BJ7A 2SNSA 3I1UA 3ND9A 2PJ9A 2JDDA 4NXML 4PK3A 4NGPA 1GM5A 5LRGA 2PVWA 3D0FA 2GIVA 1XTCD 2B39A 3R2TA 3C3LA 4UCNA 2PDOA 1A6XA 2ZXVA 3SXOA 1FGBD 1WK4A 1YVOA 2ZXOA 3QR8A 4C2ZA 1M1KC 1KIXA 3R9FA 4IF5A 2KOLA 2RVLA 3A55A 1XJVA 5FLXL 1JJGA 2AHOB 3K6OA 1KXLA 1Z8LA 4BD9A 2CH4W 4A3FH 1IU8A 2K5HA 4UWJA 2CWAA 5JPNC 2B2YA 2CVRA 3S9WA 3CXCA 3I9SA 2C35B 4DJLA 3L9AX 3WR7A 3D4UA 2XRSD 3E0KA 4DK3C 4KN7C 2DXQA 4FF4A 5LYIA 2I46A 1CKMA 3SDZA 3SK5A 1L0CA 4LW1A 1Q3LA 1WTQA 2RDGA 2QMLA 4P4JA 4ZGYB 4Z9CB 2XWBB 3G6EA 1NSLA 4M6GA 1EZ8A 3MA2B 2Z3OA 3IIBA 3PB9X 2PW5A 4NGSA 1K83B 1VQ7A 3GTOH 5IX3A 2FINB 1PZKD 4CJ2C 3G3SA 4BY1G 2NN6G 4UFWA 4MCPA 4ULLA 1BPNA 4A3BB 2F8HA 1XFOA 3G4SA 3T9YA 1E22A 1X3FA 2KA7A 3K8AA 4CGMA 3IEHA 3GV6A 4A3BH 2F0EA 1KD1C 4BS9A 3VWDA 2WKCA 4HIKA 3AEVA 3ISXA 5I4DA 2B3GA 4UEFA 4A3FB 5CYUA 1T9HA 2AFOA 1HR0Q 3CCEA 1WTWA 2DF5A 3DEPA 3S1RH 1EU3A 1TT2A 2CTCA 2VL6A 3VR5A 1ML0D 1PFNA 5IY0A 2A69D 2F0PA 3FEWX 1XNQQ 5NUCA 2PZTA 5LMUL 1TWAB 1EZ6A 2ZTEA 3RAMA 5F47A 4RHSA 1YX0A 3MVVA 1A3TA 2F0IA 3W1GA 3I7FA 2IJ0A 4GLAC 1TIQA 3K5MA 2ZJQA 4DV1L 5LYFA 2WYRA 4LUVA 1SNMA 1Q8IA 2GFQA 4JI3L 3GD7A 4GOPA 4IUVA 4PV6A 2NZOA 4PXCA 3A5UA 5C44B 3MAQA 5I2YA 4IOAA 4WJ3M 5IE8A 5C3EH 2EDGA 2WB1E 1YITA 5E7NA 1E1OA 4PXEA 1JCKB 4YHHQ 2VZAA 4IAVA 2NVQB 1YQEA 3S1QB 2EYMA 4AIMA 3T1YQ 3R93A 4DR4L 1I12A 3W91A 2PIZA 5G3LF 4BBRH 3E0JA 3H8EA 4B5PA 2UUCQ 1N71A 1SYDA 2FMCA 4HSVA 1U4MA 1KC8C 4A38A 1BPMA 2F3VA 2VEZA 4NJQA 1D1KA 1B2TA 2V8VA 4XT3B 4PMCA 1I4GA 3CCSA 3U4VA 4LFBQ 3F0AA 2UXDL 4TQUS 2PW7A 3HUVA 1BKBA 3WWVA 2K01A 5ELNA 4O0AA 3PUYA 2WINB 3TP6A 4PXDA 4AG7A 3B35A 2D5DA 2Q2IA 5A27A 4IPDA 2N49A 3CCUA 3Q8DA 3HOYG 3F2UA 1YW6A 1TF9A 5M9OA 4K6LA 2F0QA 2PJ4A 5EPJA 3GP7A 2L9HA 1HA6A 4QL5A 3SI0A 4P45A 1X6OA 5CR3A 5C44G 1OZPA 4OWTB 4GKJL 1IW7C 4EQOA 2VS1A 5A35A 3A8KE 3MXNB 1A2TA 3PRTA 4DNCA 1UNSA 3IU2A 4CKEA 4ZLTF 1FJGL 2YTVA 4G7ZC 2Q43A 2IHEA 4IJLA 1X55A 3D31A 4KSIA 4UFVA 4RHRA 1XF8A 1PXUA 1E1TA 2GLFA 1KUXA 1STYA 1TVXA 4R4OA 3OWFA 4EQ5A 1Q12A 2A4NA 2IQ6A 5F48A 3KBXA 2PJ2A 3OMCA 5C0XH 3J80E 1D5XC 2QEXA 3QB8A 2IHFA 4AYBE 1JICA 2FMMA 5C4XH 3E9IA 5FJ8G 3S17H 4UDUC 2ZM6Q 3P2HA 3CF5A 1Q82C 5I2XA 2DNCA 2C6GA 4F0XA 1EUJA 2K5TA 2FIWA 3HKZB 4BXXG 4OAEA 1D5ZC 2KEDA 4KHVA 4JYWA 3CKIB 2ZEEA 2B2YC 2LMCB 2ICEC 1VF5C 3KLWA 4DR3L 1CJWA 1EE3P 3PO3B 1Z2LA 1S5KA 2B63B 4DV5L 4JK1C 1FYCA 3W1BA 4QY7A 3RLNA 4MHEA 4A3BG 3PEIA 4A3DG 1SBBB 1R9TH 3OPOA 4EFDA 3G7LA 4BY1B 2AJ6A 2H5MA 1I4RA 3S6FA 5ELDA 2K5NA 3V05A 5M5YH 2YNDA 4BY1H 2MJ8A 2L1BA 1VHEA 4CRYB 1NTGA 5DLQE 2Z6KC 1TKJA 2AFZA 3ZJYC 4YCUA 1FNWA 2CH4A 4JW0A 1ENAA 1R57A 4KKTA 4MZ9A 3E0EA 4RGOS 1W2BA 3MFYA 3B7IA 1B87A 3WABA 4F0YA 1VQCA 2HCCA 4LF4L 3AYHB 2PPBC 2JEAI 4OWWB 1HNWL 1LABA 3S1NH 2ZOFA 4NKLA 1H9SA 1YEZA 4LFAQ 4YCWA 4JZ0A 2ZJRA 1NR2A 1S5FD 1IYJB 1EWCA 4FVMA 1OXXK 1WYDA 4NW2A 4FYDA 1PH2A 5IB0A 3N6RA 2Q51A 4RKBA 2PJAA 3BDLA 2H4OA 1PH7A 2D0OA 5IYDG 3D8PA 2Z10A 4DV7Q 1U4RA 3TS2A 1RD9D 1Q90A 5DM73 1E24A 2G3AA 4C2MB 2LXKA 1KUVA 1Y9WA 2ZEFA 1B1ZA 1PRTB 3BYTB 4LFCL 4FD7A 2DY8A 1OBRA 4GN3B 3B3SA 3SI1A 3EIVA 1WJJA 4MY0A 4CYNA 5E3FA 1PH3A 3K5LA 3FXTA 4Z65A 4JD6A 3MZ5A 4EVOA 2KHIA 4Y7NB 5C82A 1VQBA 1IYVA 2XTIA 4XPDB 5T1IA 1U6MA 2KCTA 2XEJA 3RNUA 1SYEA 1VHOA 3IWGA 3HKSA 2O53A 2L12A 2CTBA 4PSXA 4P75A 3D2MA 2F52A 3TOBA 4K6DA 1HZ9A 4XDXA 4XIGS 3WC7A 2MP1A 3ND8A 2Z3PA 4X3TA 3J80i 1HPCA 2K05A 2WACA 3I3CA 2V8DA 4UEZA 2E2JH 4DV4L 5CV6A 1YVCA 3IFDA 3VR6A 5K8PA 5HVFA 5EBDA 1PYTB 2ZTDA 1OXSC 5M5XH 1ENFA 5DNFA 2JA7G 1Z5RA 2Z8LA 2B5GB 5I0CA 2UXBQ 1NAPA 4P4DA 2AMCB 4PV1C 3N5FA 4CDEC 3M7NA 3VATA 2VQEQ 3T1YL 2HQEA 4ZKBB 3F2DA 1XMBA 2UXCL 3FKIB 5IGGA 5M3MB 4IUSA 4A3CH 1QG7A 1LTID 4EX5A 4A3JG 1E7ZA 4JI4L 1NUCA 1PYSB 1U4LA 3KF6A 3GTMB 3ERSX 3KI9A 1L1OC 4DK0A 1I50B 2LFNA 2TSSA 1A15A 4K5VA 2L55A 4DUZQ 2RC4A 5C4XB 3I4MB 1F2LA 2R6GA 2MQHA 1KHIA 2HQLA 1XX8A 4RH6A 4X64L 3B2YA 4E8OA 2RDFA 1VCIA 2R7ZB 2JK8A 1O78A 3PMFA 1FNOA 5CV7A 2WUUA 4OC4A 1R4PB 2BA1A 3TFYA 3HRZC 1H9SB 1LANA 4RG1A 1FVIA 1XMOQ 5DEHA 2F7VA 3KR5A 5CC4A 1XJOA 4NMZA 3BXMA 2QJ8A 1VQHA 1PRTF 2CFMA 3SJXA 1R9TB 3PO3G 1IY7A 1MJBA 5K8MA 4UWIA 5EBVA 3PO3H 4LFAL 1HXYD 3HKZG 3LGJA 4X65Q 1GYTA 3M7GA 2X69A 4IJHA 3I2ZA 4ABNA 1FR3A 2Q44A 1N33L 3D68A 3BJUA 3C46A 2TMPA 3IFEA 1KL9A 4P10A 5F46A 1STBA 1BBXC 1XIXA 5A2QE 4JBJA 3BU2A 2P6EA 1BF4A 1CP7A 4DV6L 5EBCA 4E6IA 2D0PA 2NTTA 2PJBA 4CGOA 1SNCA 1IOFA 4ZX9A 2BA0A 3EFAA 2PJ7A 2L15A 2V77A 2PSWA 4NP5A 2BE5C 1TKHA 3NA6A 1B4OA 5FVJA 5M3MG 3M3YB 2C27A 4MJ8A 1K73C 3STBD 2QVPA 3CCQA 1YW4A 2F0VA 1XMQQ 1K3RA 3U58A 1B8AA 1BCPB 3QB3A 4DN4M 3RZOH 1JT8A 1P8LA 3KF6B 3RUZA 3FDTA 1VQGA 5M3FG 4A3IG 1VQLA 3J7A5 2GA4B 2O5JC 1IIDA 2OXPA 2LKVA 5IP9H 1VIXA 2ZEDA 1BCPD 3I55A 1NY4A 1JMCA 2JDCA 4B13A 1K8MA 4R9MA 4ALPA 1W3SA 1AE2A 2K4KA 1I4PA 4KOWA 4MCSA 3HOYB 1E0BA 2WV6D 1DYQA 4XNHC 1Z9FA 2B2UA 4OKOA 3HOXG 4A2ZA 4RUHA 4II9A 4OEMB 1L2FA 4XXEA 4DV3L 4DR4Q 1W6KA 5D29A 4B5OA 1K0RA 1EOTA 4NF1A 1B53A 4RFBA 1ILPA 1EYDA 4A3EB 2ARHA 2G5DA 2JJQA 5IGEA 2K5WA 1C4QA 2R3ZA 4A3EG 3HOXH 1BOBA 3JVNA 1JJCB 4DNIA 4DU9A 1PH1A 3CCRA 1MJEA 1YREA 2VL1A 4ZUJA 1QVFA 1VQ8A 3MEFA 4A4IA 3HOXB 1IBLQ 1LCPA 3ERQA 3J80c 1SAPA 3S14B 2XEFA 5C88A 3HP3A 4KY5A 5K8NA 2PNRC 2Y0SE 2OU2A 1L1OA 1Z8TA 1V1PA 1LACA 1QCBD 1HNXL 3CT9A 2BDOA 4NDXA 2NMTA 3AB9A 4DR2Q 4A3GB 3PSIA 3T1HQ 2JLMA 1EYAA 1Q1EA 1QVGA 3PB8X 4TWEA 3A0JA 3DR8A 1ZG9A 4IHMA 4JLYA 5FLMG 5M3FB 4A3JH 3H94A 3T16A 1IZ6A 2JA6H 4MCRA 4DAMA 4CDFC 2ZENA 1ENCA 3H3VH 3NQIA 5C3XA 1QB5D 3ULLA 3NE7A 3H91A 3V96A 4C7HA 2KJXA 4OC1A 3GO5A 4OWXB 4XYQA 3GIUA 3TT2A 3VYSA 1IXRA 2K5DA 2EYOA 1V0CA 1F2ZA 1N9WA 4LUOA 4P73A 3A8IE 3FEEA 3NE5B 5M5YB 5M5WH 2HHHL 1I3QH 3NBHB 3FVQA 4YHHL 2QCPX 5GAGC 3R3OA 4L8JA 2EYLA 1SFOH 1VQFA 4ID6A 3CPWA 3KL9A 1ESFA 1UFHA 2V8GA 3GTGH 4WRDA 3PF5A 3LWUA 5COYA 4RAUC 4GKKL 4FP5D 4J1MA 2Z3KA 4NSQA 4IOCA 2XVSA 2B63G 1HR0L 4N9PA 4R4QA 4K2LA 4NB3A 5GAEC 1HNXQ 3LNNA 4DR7Q 2VZYA 4P72A 3HOUH 2IT1A 5AG5A 2H5XA 3WT4A 3NEMA 2ANPA 3HGBA 1XMOL 3CCJA 3CP0A 4P2CB 3TDQA 2K14A 1E3PA 4CJ0B 5E4XA 2NVXB 4DFAA 2PR1A 3S2DH 1XWEA 1XXGA 4A30A 1U0LA 5C4XG 3Q0AA 2XNAC 3PUWA 4HCSA 3SE0A 1D5MC 1FNUA 3A54A 4BA2I 4B5PB 4B10A 3JTKA 1UE6A 1YSJA 3ZZIA 2OQKA 5E4WC 4X65L 4CAVA 4H44C 3D2PA 1I3QB 3L2PA 3ER0A 2CNSA 1ET9A 3UY5A 1CHQD 4KKUA 1VQJA 3PCOB 1QZGA 3AFQA 1YNJC 1SYCA 2KCNA 5EPLA 1PV4A 2FT0A 4A3KG 1CPSA 2PJ8A 1D2BA 1T5XD 3RZDB 4C2XA 1O7YA 3X3MA 1SEBD 2BH2A 4K0KL 3D7HA 4R7MA 1M4IA 4C7IA 1Q2DA 3G48A 1Y8NB 2HIVA 5F09A 5IB9A 4PNYA 1C0AA 1QMUA 1KLGD 4DR2L 5I9OA 1V1QA 3D66A 1SMYD 4LNQA 5LL6S 1WCMB 2E2HB 5F49A 3PIOA 3IGRA 1VQDA 1PTOH 2R7HA 4QC6A 2G9DA 3C2PA 3TO9A 1PRTD 5D3IB 2PMZB 3Q22A 5BR8L 4B3TQ 1BLLE 2CXAA 4X3KA 3HOVG 3E3XA 3F1ZA 4KS9A 3S15H 2Z6KA 3NH8A 4OIDA 2NVQH 4GZYC 5IYBG 2CF4A 1ILQA 4MFZA 3RZAA 2K75A 2E74C 2KHJA 3CRLC 1PH8A 1JOOA 1LT6D 2Z0SA 1A3UA 1V8QA 4PG3A 4ZK9B 4C3JH 2C9OA 3OTOQ 3VR3A 4K0KQ 5FJ8H 5JJLA 3X3NA 3VYUA 3T13A 4DNTB 4GOPC 2C6PA 2YU9H 3VR4A 1VDZA 5J22A 2A8VA 4HJ5A 3I4OA 2R92H 1CPXA 1TWHB 5CGKA 4LX9A 1BO0A 1YJWA 4RA8A 1XNRL 2EBJA 2HQYA 2SOBA 1CX8A 3DM3A 4K8IA 2YNCC 3SHLA 1KZFA 2Z3MA 1CTMA 5C44H 2I3CA 2PQAB 2EVBA 3L7ZC 4NEXA 3GTLH 3RR5A 4KD4A 4FF3A 4DAPA 1STGA 2I07B 2HT1A 3KHXA 2JQOA 1IKMA 4K2KA 2BL1A 3CW2C 3OIQA 3TMEA 4OO1G 2FJ2A 2HV2A 2PE3A 2Y0SG 3F8TA 2NYQA 2CKZB 4U5YA 2F0TA 3HS0C 1ELMP 3ULPA 1VQKA 4F8MA 4R6TA 4F88A 1QQ9A 2R7FA 1TXYA 4IQZA 3S1RB 4XQJA 1NCVA 1TWCH 1SSOA 2K03A 1GO3E 3QO2A 4J15A 4G57A 3S24A 4DAVA 4JI0L 4PXBA 3I4NB 3J81E 4OADA 1Q46A 3MEHA 1Y14B 1G6PA 4F9UA 4LMQD 3TOAA 1Q2CA 4HNXB 1IGBA 1IOIA 1YJNA 3H4QA 4OONA 4R1JA 3IC1A 4BXXH 1OXTA 2IL8A 4IUUA 4DV5Q 3BS1A 3LX0A 1HQRD 3SJEA 4ZKCB 3KBGA 4JI2Q 2MHVA 3A56A 1OXUA 4F8ZA 3NTIA 1TY2A 3I8ZA 1SMXA 2B2TC 4EWTA 2CW0D 3SXNA 5FO7B 4RGNA 3U9SA 5LHY1 1Y0YA 1YNXA 1EYGA 2GVAA 2R93H 1KDCA 2A69C 4N8X1 1R3NA 4C2YA 2Q04A 4GN4B 1SN8A 2QA4A 3NFZA 2ID0A 5HGTA 3IL8A 1XBUA 3K0YA 4QF4A 5KYIA 1O80A 3T53B 1PYBA 5KIXA 4A3IB 3RYOA 2EUIA 1DCZA 2R92G 2I5LX 3IWWA 1PHJA 2ENBA 4F87A 1EQQA 2FXFA 4JI4Q 1M4DA 1SNPA 1YBYA 3SK4A 4C3IB 4HNWB 2F4IA 2EJGC 3OYYA 5HURA 4B3RQ 5EKIA 2ZPAA 1B3AA 1VQPA 2IPKD 2F0SA 5JM6A 2IX3A 3EFXD 2NUCA 2A74C 4C3JB 4BY7G 4KK7A 4DPGA 4JWPA 4LF8Q 3DUZA 1I4HA 3KOJA 3RZOB 4UF4A 1I4QA 2DNEA 5IYDH 4JXQA 3VARA 5I9PA 4DV4Q 2F0JA 5KTCA 2NN6H 2O2LD 1ARLA 2F0KA 3TO6A 3VH9A 5IWAL 2F3WA 3H8GA 1G2SA 2RHSB 3UI2A 1LTRD 1WCMH 3URYA 4JV5L 3UDXA 3BZKA 4DV0Q 5J39A 2OWOA 4MHNA 4BBSB 2JN4A 4DYOA 1SYBA 2JEBI 2JBKA 3I56A 1A62A 3WC5A 3UDGA 1AW7A 2VZZA 5BN4A 1GUTA 1BQQT 2Q0YA 1L0WA 2Z6BA 4P44A 1WWZA 2R93G 3FPUB 2AFWA 4YWKA 2PVVA 4I65A 5FKAC 3J7AF 3P20A 4MIUA 2ZM6L 3GYAA 1NR4A 1DD2A 1HFGA 2KVMA 3NELA 1QSOA 3VYTA 1ZEQX 3DMUA 2RHQB 1CT1D 4M6IA 4B14A 5H86A 4QVTA 1JQGA 2A6ED 1TWHH 2NB0A 3IO1A 3K57A 4ZI6A 5FLMH 1G91A 4FD5A 4A3DH 3JUWA 4IK2A 7CPAA 4H13C 1D1IA 3A9LA 3GTJB 1STAA 2HUGA 3ICEA 4AVBA 4MHPA 1SE3A 4HMIA 3F2BA 1TS4A 3H8FA 5GADC 4AYBB 3PQIA 2GN5A 3TN2A 2EYJA 5TSSA 2PO4A 1HUNA 4GNXB 1I6HB 4CYOA 3SVMA 4NCZA 4DUZL 2OTLA 1B70B 4C3HG 3T1HL 4QBJA 2RSNA 3M4OB 1G2TA 4M3SA 4IFDI 4KTAA 4JI0Q 1TXRA 1KQSA 5KNDA 1LT5D 4CGPA 1PYWD 4X6AH 1J6QA 3BI0A 1BR9A 3M85A 2UXCQ 4RMFA 2R93B 2NVXH 2FSRA 3RLOA 1N32Q 5CORA 1SNQA 3BG3A 2BE5D 3KJPA 2Y0MA 4OHJA 4B9XA 4YCVA 2DEAA 2A68D 3OOCA 4HSPA 3TP5A 1M4LA 2ABZA 2CQAA 4DK1A 1Q81C 1SFOB 5GROA 4BBSG 3D7DA 5EC4A 1J4JA 3DLLA 3CU7A 1M4VA 2SNMA 2B8GA 4Y49B 1F2PA 1F2OA 2EIFA 1BCPC 1H9KA 3D67A 4JC0A 1LTTD 3HG9A 5FOBB 4OX9L 3R1KA 5G20A 1TS2A 1ASYA 2Q7SA 2B2WC 4Q38A 4C3JG 2MFIA 5LMNW 1YJ9A 3K0XA 3GTKB 3WDNA 5J1QA 2RF4A 3MXPA 5EKKA 3GLJA 2Q8IB 3FRMA 1CM9A 2K28A 1VF7A 1X3PA 4GN5A 1YIJA 1Z4RA 3NE8A 5K36G 2L5TA 1MJCA 4O1NA 1LYLA 2K1BA 3NWTA 1HNZQ 1LAPA 2RA4A 1XOVA 2LXJA 3KQXA 1GXDC 1CFMA 4X66L 1JQYD 2MNAA 2BCOA 1GUSA 2R92B 4QJFA 2MO1A 4B3ML 2HD3A 1ZYRD 3EVQA 4LFBL 4ZX8A 4JI2L 2IL4A 5D14A 3OHXC 4PQAA 2N88A 5JOBA 4XQNA 4CHTB 1UWVA 3TQYA 3D4RA 3PFEA 1R43A 2BSWA 1TWFB 5D8NA 2VI7A 2WB1B 1F9QA 1TQOA 1TKFA 5C3EB 4RGMA 2CNTA 1ZYRC 2JA8B 1MJ9A 2PRQA 2I5HA 2R61A 1VGYA 1PTOD 4R3KA 4JI7Q 4RI1A 2F1MA 3FMCA 4OO1I 2PZUA 2N55A 3GTKH 3SJGA 4RS2A 2J9AA 3PBEA 4L5TA 1SRUA 1RODA 4MHDA 4PK2A 1L0YB 4ZCKA 1B9NA 1Z7TA 3J7YW 3TRZA 1ET6A 5AJ3Q 3QOJA 1NSAA 5G22A 4A94A 4Y49C 2AQ3B 1OXVA 1IBKL 2ATRA 1O7IA 5CV5A 3I4NG 2BUEA 1HCZA 1YVKA 4QUSA 3D3RA 3M4PA 4MBUA 1BVSA 8CPAA 6CPAA 3GKRA 4LQGA 4CKCA 2FVGA 3TZUA 4X3RA 1QZHA 4A37A 3M3YH 2FCKA 4X62Q 4A3MH 3S14H 4IFDG 3SXHA 1HQMC 3FB3A 1S60A 5LMUQ 1TF8A 3OWEB 1I4XA 2MO0A 1A63A 1RIPA 1GJXA 1QSMA 4FWUA 4P71A 4GLXA 3I4MG 3PBBA 1VQ9A 1KTKA 2X6GA 3FF3A 1CQFA 2P6GA 3KJOA 1PH5A 3S9LA 4M1UB 3PIP3 2PQ8A 2KEEA 1S7LA 4K30A 4FBEA 4APVA 4KD3A 2A6EC 1LTLA 2DN8A 3EROA 4GNXC 1FT7A 3I73A 4FUUA 2E76C 5BWAB 2GLJA 1EY8A 3FHWA 4NGMA 3TEHB 4A93G 2E2IB 4OC5A 2FHTA 3I90A 4KHPQ 1QILA 2PJ5A 4YY3L 3QAHA 3DWAA 3SK6A 1X10A 2RCNA 2E2IH 3LODA 4TVAB 1QSRA 2HCIA 3DM1A 4O42A 5ISRA 4MFKA 1SR3A 1VS0A 1X32A 2PYKA 3K9TA 3NP8A 2FE7A 2JEWA 3OW2A 2JEVA 4QB9A 3BDCA 2F0WA 2EYFA 4RWSC 2VUMG 4PZ7A 5FLXE 3IJ3A 3FPPA 4OC2A 3KF8A 4QUCA 5G1ZA 2XWJB 2Q4VA 4DR6L 4HIDA 2OZUA 1EL0A 1C9OA 1E2ZA 4JXRA 4R4TA 1LFWA 5IGBA 5H84A 5ELYA 2DJGC 3L2NA 4JG2A 4OIKA 1SNOA 1QWYA 2QKIC 1O7ZA 4B3MQ 4HIOA 1N32L 3RLFA 2N8NA 4CYPA 1K0SA 3G71A 2J8RA 2HDMA 4IPCA 2H1EA 2E2JB 1Y8OB 2D2CC 3KGQA 2VQYA 4DV7L 3S1MB 4K3NA 1PA6A 5EQ0A 4DGZA 1VHSA 3J7ZC 4L63B 1LAMA 4DV3Q 4A3KB 4E0AA 2CCZA 1B3QA 4DR7L 2WAQE 4CGLA 1RO5A 2NTSA 1KWMA 2EYPA 1MHWC 4IUQA 1GHJA 2REFA 2PCUA 4U68A 2V1CC 5JJKA 5LYDA 1PDQA 1K8AC 4YY3Q 4FO2A 1FD7D 4C3HH 2JA9A 3PGPA 3W6XA 4ONWA 2EXZA 4JI3Q 3B3WA 1CSPA 3SHPA 4PMBA 4AH6A 4F7XA 1BO4A 1HUMA 1EQTA 1P0HA 1H9MA 3KK7A 4CKBA 1B9MA 1SQHA 3CAMA 5IP9G 3A7AB 3O13A 4HJ8A 1GUWA 2ODFA 2XEGA 1DJRD 4C3IH 2L0CA 4LF8L 2AFMA 1VQ6A 4JJXA 2EWBA 2JA6B 1K9MC 4OX9Q 3F2CA 3I91A 5K36H 4DF7A 1HDUA 1RDPD 1GOZA 3J81i 3HLPA 5EJWA 2RCFA 2Q7BA 2Z4HA 1CA5A 1X56A 5ELFA 1K8OA 1QOHA 1Y0RA 3UE0A 3EY5A 4OIJA 3C1EA 2JA5G 5CBMA 4RN7A 1M8AA 4XPDC 1SLJA 3CD6A 1Q8KA 3KF8B 1PH4A 5IT9E 4PPZA 1I94Q 5IIFA 3P1HA 1QNUA 4JI5L 2LSSA 1LLRD 2F0LA 1YZ6A 1MBYA 4Y7NH 1SYFA 1UWYA 1LTAD 4MFQA 3W2DA 4IUNA 4FXKC 3Q24A 1KAWA 3BI1A 2RB7A 4GLVB 1HH2P 1FNVA 1Z4EA 4JI7L 3G8WA 4HCEA 2POKA 4MTKA 2I00A 2R7ZG 4EQNA 2J7ZA 4KJOA 1LUZA 2BOAA 2FS5A 4ILWA 4GKKQ 4LJZC 3QJYA 2JE6I 4AYBG 3PP9A 2B58A 3R96A 2MGSA 1CM0A 3V7ZA 1HNZL 2B2WA 2REEA 4OIWA 4FDBA 5ELCA 5C5LA 5T1GA 2Q4YA 4KMUC 1TWAH 1OTCA 3SEBA 2AE6A 3NH4A 1ZKOA 4BY7H 4MI4A 3CDXA 3E5SA 1S5CD 4DR5L 2PZWA 1YNJD 2Z0ZA 1TR5A 2ZW6A 3Q6SA 3Q23A 3S2DB 1EY0A 4LFCQ 2D4OA 4LUAA 1S3OA 2ZEGA 3CZXA 2PI2E 3PO2B 2EO8A 3CPXA 1B7YB 4L89A 3PB6X 4CDCC 3BDOA 4MMOA 4LF5Q 1B50A 1IBML 1HHVA 4WJWA 4GM5A 3GTQB 2UXBL 4DKAC 2B3VA 5A2QL 2CQOA 4HMJA 5C4JH 3K2KA 3M9BA 2QILA 3R9EA 3RBUA 1PRTC 3NXWA 3G6JB 4UP8A 4G7HC 1ZG7A 5KTAA 3J80L 1HDQA 2K5QA 3D7GA 5C3EG 5KEEA 3ISZA 2BDNA 2YTYA 1WD1A 3U9OA 2D62A 5BN3A 3H3VC 1HTPA 2G3TA 1XMTA 2WB1G 4UCPA 4A31A 4X66Q 4CJ1B 5JJZA 1PTOF 5LRKA 4IPHA 1TKWB 3LD2A 2MUYA 1J9OA 4ZY2A 1CKNB 4BY7B 4TNUA 2FL4A 1Y1WH 3K59A 3B3TA 3DHQA 4R3LA 4B6ZA 1ELLP 4ZYQA 3KR4A 3CCMA 1FY7A 3NBHA 1XE4A 5CNPA 2IJZA 3BYYB 4B9WA 1UE5A 1SYGA 3J81L 4UP9A 4LK1C 3CQZB 1WVLA 4L5SA 3EO4A 5IYCH 3EA6A 1VQAA 3AFPA 2FXQA 4JVZA 4HAEA 1SE4A 5JVG3 3PUVA 1IB1E 2O4HA 4A32A 5EKLA 1VQ5A 1CHPD 4N9TA 2B8FA 2K5VA 1MJAA 1JWUD 1Y1VB 3VWEA 1FL0A 4BWGB 4CPAA 4UA3A 5CV9A 3JAMi 3T90A 1M90C 5IT9c 4ME5A 1LOKA 3RN5A 5ELEA 1MK4A 4H6ZA 2G9HD 3TO7A 1PCAA 1X3GA 1TS3A 3TP8A 1LV9A 5HGQA 3FJUA 4TKOB 2ICIA 3L3OC 4QIWE 1XNQL 5KYLA 1DOKA 1EY4A 2DPTA 3VA7A 3K7UC 1SE2A 3H09A 2F4VL 1UEAB 3AU7A 2EOTA 1YMEA 1DXMA 3DEOA 4NXNL 2KQ3A 1YGHA 1XPRA 1YNND 2Z3NA 4R9WA 5BR8Q 4UIBA 4GKJQ 2QW7A 2AWNA 3CRKC 3KUPA 4A76A 2KECA 3JAMc 4A3LH 2IMOA 1G291 3HOYH 2CIJA 5D65A 1AZPA 1MI2A 4C1NI 4X5KA 2M00A 1JE5A 3EBEA 2OEOA 1BNZA 4R4CA 4C3HB 4YWMA 4UPAA 2N78A 2JA6G 2OB0A 1YNNC 2RKSA 3KYHC 4HN7A 3DWPA 1A2UA 4NGQA 2M9VA 3IWEA 1AFPA 1CP6A 4FF2A 2P0WA 4K5WA 4RKLA 2L4NA 1Y8PB 1ZLHA 5K5PA 4TSSA 3NHHA 5IGCA 4O23A 1RTOA 2EY6A 4NXNQ 4C68A 4GOPB 3HOUB 1XPOA 1VMCA 3I3GA 5LL6X 1K28A 2EPBA 1TWGH 3HFZB 4KN4C 4N8FA 1S7NA 4UHVA 2OR4A 1EIFA 1F77A 2NVYH 2XGTA 4CGYB 4OO1H 1YI2A 1AYEA 2SEBD 3DDDA 4MFLA 2F5IA 2PI2A 1RKNA 4GXHA 2D4PA 4NFRA 1HZBA 4LWCA 2C5CA 1JWSD 3PO2H 4M6HA 5CPAA 2OZHA 3BZCA 3MN8A 1G51A 2EK8A 2KHSA 1RJTA 2PJ1A 4H89A 2OF1A 2UU9L 4B3SQ 4U9ZA 2E5LQ 2IWHA 4CAXA 3W5OA 3OTOL 3FX6A 1TS5A 4JBWA 5IOCA 4IURA 4CBVA 4DV2Q 1VQMA 4JI1Q 2C1CA 2ZT9C 5C0XJ 3IFTA 3B6YA 3P2FA 4ZRZA 1N36Q 2J8MA 2PQAA 3JAME 4P74A 2GREA 3P7JA 2B5GA 3EXNA 3PFOA 1NMTA 4CRZB 2OQ0A 1WI5A 4JI1L 1YHBA 5JH9A 1MIUA 2B4DB 4CAWA 2B4BA 5GQOA 2RQXA 1JOQA 1Y1WB 2ZEMA 1M1DA 3T51B 3K7AB 3JAML 4XPKA 3VR2A 1Y69U 1E2WA 2XIWA 2OOTA 2ZJPA 3BVMA 1AE3A 3S17B 2PJ6A 5JPHA 1WTHA 4G4KA 4A3GH 4YGOA 5C6AA 4XNHB 4C3IG 4LF5L 2K52A 1QVCA 1IBMQ 3TTHA 1SE8A 4C1NK 3W6SA 1PMRA 3MXUA 2OT2A 4MHYA 1X3QA 5G21A 4POFA 1DE4C 2E2HH 3HOZB 1AZQA 2UUAQ 1TWCB 4BMHA 4F9VA 1JR0D 1IW7D 1F9RA 4NXYA 4A3EH 2EK9A 3CCLA 3M4YA 3GTQH 3DSBA 4L8AA 4HEDA 4U9YA 3WOFA 3TP7A 5LYLA 1U5KA 4PQXA 2Q8TA 1ZLIA 3RNZA 3V38A 5A28A 4PSWA 2B2VC 2A5HA 3PV0A 5IT9L 2EJMA 4ZY0A 4TRDA 3A7LA 4KSFA 4ORFA 4YFJA 2WPWA 3DR6A 3H5ZA 5ELOA 4CGNA 1B6BA 5F2DA 2ALYB 4NGRA 1F9SA 1AP0A 3SR1A 2GANA 1HJPA 4LAAA 2HDLA 2OCEA 2A6HC 2QDLA 1IYKA 1XPUA 5EGTA 5CBEE 5H1SE 2A68C 2OTJA 2EY1A 4OMEA 4DV0L 2VB2X 4KLWA 2X6LA 1UAPA 3NUCA 1ASZA 1S3ZA 3BLNA 4IPGA 3BHXA 2BEIA 1WTRA 5E1FA 5THWA 1WTXA 2KCCA 1C8CA 2A6HD 1GUNA 4MRIA 1STEA 1Z8WA 4P4IA 1QSTA 3D4DA 3CXSA 5LMNL 4AB7A 1MKHA 1Y1VH 5C3WA 5JEAH 4CS0B 4JV5Q 1X65A 1N34L 5J1ZA 3S2HB 3NWSA 1YLEA 2UUBQ 1S72A 3S9NA 1AMPA 3NTHA 1HR0W 1YR0A 4X2TA 4A93H 2PQEA 3I72A 2PJ0A 4QCLA 3HKZE 3JC66 3TC8A 1SJED 2ZEOA 4P4BA 4UBRA 4KOXA 1IICA 3V8IA 1S7KA 1X9NA 4BA1I 1EYCA 2PC1A 2QIRA 4FD6A 3S6HA 4DXGA 4PZ8A 1U4PA 5JAVA 2KCWA 1A3VA 3IRBA 5IP7H 4A3GG 1EFWA 5HVHA 3NPPA 2M2LA 5AGEA 4ZAIA 1EQRA 3ULJA 1XYIA 4IUPA 4DUYL 4R8FA 5HY6A 4B3TL 3KASA 3K7AH 3HOZH 5LRJA 1I6VC 1N8RC 1PFMA 5AG4A 2OH1A 4MNOA 2F0OA 4DUYQ 4JPBW 3PUXA 4X3UA 1GUOA 1II3A 1CUKA 3RD4A 5IGFA 4KLKA 5I6YA 1XEBA 3I4NH 1X3EA 5M5WB 4G1PA 4YRHA 3GY9A 3KLRA 4K14A 5I6WA 3M4QA 4UCMA 2R7DA 4JYAQ 4AQYL 1FGUA 3MTSA 1JB7A 2VXWA 4B3RL 4G7OC 5ISVA 1Q7YC 1XMQL 4A3CG 3NTKA 3PO2G 2J4XA 2JSOA 2XSCA 1EOVA 2G0BA 1QNKA 4KOSA 1JJ2A 2NZHA 3E6ZX 4DNRB 1HZAA 4KY6A 1J8IA 1MD2D 3F8KA 4NPSA 3A5ZB 1NE3A 1ON0A 4MCQA 3CMEA 3R95A 4LF4Q 4LF9L 1SXTA 2AKWB 3CPFA 5ELBA 4DR1L 4QGUA 3UDIA 4ZUIA 4LF6Q 2BOSA 3V2TA 5IV0A 2O5IC 5JEAG 3KQZA 1LTGD 4ZBGA 4CAEA 1LT4D 4KHZA 3I4MH 3R9GA 5JVH3 1PTOB 2PMZE 5L37A 3D8GA 5HXDA 1JB3A 1J5EL 1DOMA 3MC0B 4JCVE 1DZ1A 4DAYA 1I50H 3D6CA 4IFDH 5C5MA 4A3MG 5D3DA 1NJIC 5AG7A 2CWPA 4U673 4UFXA 1JWMD 1PUAA 4MFPA 4ZY1A 2HUZA 2ZXPA 2ZELA 4FXGC 3OSOA 1CKOA 1LO5D 4H0LC 5KRUA 1HRJA 2PIYA 4IUTA 3FBUA 4JYAL 2K50A 5HH1A 1DM0B 1UUPA 2F0FA 3NQTA 5HMNA 1LTBD 1RXTA 1UE7A 5M5XB 4UY8C 4KUBA 4P4EA 1EIHA 4UIAA 3SJFA 1YHQA 1Q2YA 3SI2A 2WIIB 2I0QA 5JJIA 1KNEA 3HOVB 1L1OB 2NZ1D 4JOIC 5JQ4A 1Y7RA 1CZGA 2LS01 4OGQC 4BBSH 4MN3A 1NSNS 1BCPF 5AJ3L 2K7VA 4KZTA 4HPSA 3ZYYX 1SJHD 1WCMG 5CMDA 3FEDA 3R8BA 2AFSA 3GB0A 4DA2A 2Z11A 1STHA 3CQZH 3AQQA 2PNHA 1GHKA 3FIXA 3H0GG 1YK3A 4QB4A 3CCVA 3MGDA 4ZQ3A 1XNRQ 2NN6I 2Q8RE 4KSAA 3L0OA 1KNAA 1YLOA 3IU1A 3W3AA 5C4JB 3QG1A 4PMWA 1S7FA 1SMYC 3D4WA 5CV8A 2PCFB 2AFXA 3RMHA 4KKSA 5DWNA 1BUVT 2EVNA 1GHEA 4YIJA 3AMUA 4LF7Q 4KVXA 1P4NA 2IX0A 3S1MH 1Y1WG 2EJFC 1KRTA 3PIO3 4BBRG 1PZID 2EQSA 4A3LG 3NH5A 2K6AA 4MHZA 1CKNA 5C4ZA 4UEEA 3BVZA 4JOIA 4KHPL 5IP7G 2ZW5A 2E5LL 3PUZA 4JI6L 1X54A 4K5XA 3KDFA 1E2VA 3TZDA 3M4OH 2EZVA 3HOWH 4UAIA 1WTVA 2JA7H 4OP4A 4A3KH 1Z9UA 2EYHA 2DGYA 4R8IA 1IL2A 3S16H 4DV2L 3FECA 1D8LA 4HJ7A 2JP1A 4AVCA 4H02A 1FJGQ 1S4ZA 4KY7A 2F4VQ 3WC6A 3S16B 1HFNA 1P16A 2C6CA 1IYUA 5IODA 3MFGA 1IKLA 1AN8A 1JOKA 1U9RA 2VUMB 2Q4ZA 2BH8A 2KBNA 2F0UA 3GTMH 2A19A 2YYZA 3D3SA 3QIAA 1F2MA 2K32A 4XTCS 3EQLC 1HNWQ 5K8OA 3S1NB 2AQ2B 4R8NA 2ASBA 3TE4A 3CPAA 3H3VI 1PH6A 1ARMA 3K5NA 4RGTA 1N34Q
chains in the Genus database with same CATH topology
1WD0A 4EGVA 4A3MB 2NVTB 1EU4A 3GTLB 2RFHA 2NVYB 1ICWA 3KLSA 4C56C 1EEFD 4Q5VA 2IX1A 2AQ1B 3WOEA 4RCOA 4WORA 3TX8A 4HTHA 4H2KA 4WJBA 4QMGA 4DUKA 1B44D 1HTLD 1L0XB 2VB3X 3MWYW 3P75A 3OIPA 4QIWB 5CV4A 3EJIA 1LTSD 2CHBD 5KNBA 1O7LA 2WZNA 5HVGA 2NWGA 4HR7B 1DTDA 3CHBD 3FRPB 3PB7X 5JPMC 3KZWA 4FF1A 4W9YA 4NJRA 1V1OA 2F0NA 3T8WA 2J0TD 2B2TA 3A8JE 2NYZD 2D9UA 3MXGA 4IN3A 5CBAE 5KGUA 1V43A 3B3VA 4IALA 2AFUA 4BBRB 1IL8A 4H7BA 1CQVA 1ONLA 4XQQA 4Q0FA 1JC7A 2RBMA 1CBXA 1F9PA 3VA5A 2LY7A 2JYOA 2HC9A 4XT1B 1G8ZD 2XN9C 5JGFA 1Z47A 4Q7AA 3H6MA 3KLSX 1F2YA 4FNFA 1QE6A 2DY7A 2O4XA 3I70A 4WFN3 3H0GB 4WWVA 2AUKA 3N52A 2K33A 2VNUD 3NBIA 1EY7A 4FAIA 2E75C 2EE1A 1XRYA 1Q7LA 1JE4A 3GTPB 4V190 3GQBA 3MXNA 1H9RA 2IW3A 2L11A 2SDFA 2E2DC 1ZXTA 1SNDA 3C1FA 1G6ZA 2WP8J 1BOSA 5KNCA 3OW7A 2FFKB 4XYOA 4YWYA 2QDBA 1EQVA 3SK8A 1EWHA 4IZ8A 4K8JA 1BDOA 1EY5A 3K5OA 1JORA 1STNA 3GTOB 2AUJD 4AXVA 1IHZA 4V0BA 5JEAJ 3DXJC 1MSGA 2RSOA 1H8LA 3DGVA 1S5DD 3B3CA 4NGTA 5C4HA 1RHPA 2AWOA 5FO9B 4R76A 2RDHA 4A3JB 2B2VA 2F0GA 5FO8B 5EPKA 1MSHA 2PJCA 3FVLA 3J7AV 3TBIB 2JA7B 2ZEPA 2V8HA 2MPMA 1TU2B 1KAAA 3HEJA 1CG2A 1CI3M 3R2IA 1SDFA 3TSSA 2F0DA 4ZYSA 2PJ3A 2V4DA 1PFBA 2JA5B 4YU9A 2YU9B 1EY9A 4P4FA 3QWNA 2WKDA 4OL7A 3BVGA 4I7ZC 2K04A 4S3SA 2ZOGA 3LWEA 3T56B 3IAYA 4RCNA 3T4AC 1EY6A 1RCVD 1CA6A 1RTNA 3QOLA 3GV3A 5BN5A 1CK1A 3VYRA 3QNVA 4FXDA 3PB4X 3FH4A 2NBFA 1C48A 3S15B 2ZXRA 1S5BD 2Z4IA 2HB6A 5DM63 1EFID 4OC0A 1EIGA 1KABA 1WTPA 3NSWA 5I4MA 4IFDJ 2ZEHA 1H9JA 2QF7A 3K58A 1RTQA 2CW0C 3LMSA 1PZJD 1F57A 5DAUA 2QEJC 1ZG8A 3ITPA 3NK9A 4P6YA 2XEIA 4A3DB 1PLFA 1KLUD 1KDBA 4J8QA 2F03A 3HOWB 1MGSA 1WTOA 3DLJA 1PTOC 5DS0A 1HEEA 3ONAB 2XRQD 2F0MA 3I4LA 3IKJA 2NSMA 3GUXA 1S5ED 4QUFA 2Y0SB 4A93B 3S9MA 4J6HA 1QJOA 3D7FA 1T5EA 1TWGB 4L6TB 1LT3D 3BZDB 2Z1CA 4OC3A 2B2UC 3GTGB 3DWQA 1D6EC 1OO9B 4MXUA 5FK9C 1ESRA 2JXMB 2QYVA 4A39A 3D6WA 4EQPA 3HZXA 4M8AA 5C0XI 3JRUA 1BXTA 4KJNA 1Z6HA 1TIID 2JBJA 2A73B 2WAQB 2EY2A 1V1PB 1GUGA 5C0XG 4X8IA 1W6JA 4X3SA 1RF2D 4NGNA 2EY5A 1HA5A 5AFWA 1VMPA 5G3LD 1EEID 4ODGA 5IGDA 4KV6A 3KHZA 1Y7EA 2GU2A 1DOLA 1Q1BA 1AEXA 1R4QB 1BAVA 1TY0A 1KDAA 1CZWA 4DXFA 2KUMA 3MHBA 2BO9A 4EMEA 4KI0A 3OMGA 2F0HA 4B08A 1DONA 2SNSA 3I1UA 3ND9A 2PJ9A 4NGPA 5LRGA 2PVWA 1XTCD 2B39A 3R2TA 3C3LA 1A6XA 1FGBD 2ZXOA 2KOLA 2RVLA 3A55A 5FLXL 1Z8LA 3K6OA 4BD9A 5JPNC 2B2YA 2CVRA 3S9WA 4DJLA 3L9AX 3D4UA 2XRSD 4KN7C 5LYIA 4FF4A 2I46A 3SK5A 3SDZA 4P4JA 1Q3LA 1WTQA 2RDGA 4Z9CB 2XWBB 1EZ8A 3MA2B 3IIBA 3PB9X 2PW5A 4NGSA 1K83B 2FINB 1PZKD 4CJ2C 2NN6G 4MCPA 4ULLA 1BPNA 4A3BB 2F8HA 1XFOA 2KA7A 3IEHA 3GV6A 2F0EA 4BS9A 2WKCA 3ISXA 5I4DA 4UEFA 4A3FB 5CYUA 2AFOA 1WTWA 3DEPA 1EU3A 1TT2A 2CTCA 3VR5A 1ML0D 1PFNA 2A69D 2F0PA 3FEWX 5NUCA 2PZTA 1TWAB 1EZ6A 3RAMA 4RHSA 3MVVA 1A3TA 2F0IA 2IJ0A 3K5MA 5LYFA 2WYRA 1SNMA 1Q8IA 3GD7A 4PXCA 4IUVA 5C44B 3MAQA 5I2YA 2EDGA 4PXEA 1JCKB 4IAVA 2NVQB 3S1QB 2EYMA 3R93A 2PIZA 5G3LF 3E0JA 3H8EA 1SYDA 2FMCA 4HSVA 1U4MA 4A38A 1BPMA 2F3VA 4NJQA 1D1KA 1B2TA 2V8VA 4XT3B 4PMCA 1I4GA 4TQUS 2PW7A 3HUVA 2K01A 3PUYA 2WINB 3TP6A 4PXDA 3B35A 2D5DA 3F2UA 1YW6A 1TF9A 5M9OA 4K6LA 2F0QA 2PJ4A 5EPJA 3GP7A 2L9HA 1HA6A 3SI0A 4P45A 5CR3A 1IW7C 4EQOA 5A35A 3A8KE 1A2TA 3PRTA 1UNSA 4CKEA 4ZLTF 4G7ZC 2Q43A 3D31A 4KSIA 4RHRA 1PXUA 2GLFA 1STYA 1TVXA 3OWFA 1Q12A 2IQ6A 3KBXA 2PJ2A 3OMCA 5C0XH 3J80E 1D5XC 1JICA 2FMMA 4UDUC 5I2XA 2DNCA 2C6GA 3HKZB 1D5ZC 2KEDA 4KHVA 4JYWA 3CKIB 2ZEEA 2B2YC 2LMCB 2ICEC 1VF5C 1EE3P 3PO3B 1Z2LA 2B63B 4JK1C 1FYCA 4MHEA 3PEIA 1SBBB 4EFDA 3OPOA 3G7LA 4BY1B 1I4RA 5ELDA 3V05A 2MJ8A 2L1BA 1VHEA 1TKJA 2AFZA 1FNWA 1ENAA 4KKTA 4RGOS 3MFYA 3B7IA 3WABA 2HCCA 2PPBC 2JEAI 1LABA 2ZOFA 4NKLA 1H9SA 4JZ0A 1NR2A 1S5FD 1EWCA 4FVMA 1OXXK 4NW2A 4FYDA 3N6RA 2Q51A 4RKBA 2PJAA 3BDLA 2H4OA 1U4RA 1RD9D 1Q90A 5DM73 4C2MB 2ZEFA 1B1ZA 1PRTB 3BYTB 2DY8A 1OBRA 3B3SA 3SI1A 5E3FA 4Z65A 3K5LA 3MZ5A 4EVOA 4Y7NB 1IYVA 5T1IA 2XEJA 1SYEA 1VHOA 2O53A 2L12A 2CTBA 4K6DA 4XDXA 4XIGS 3WC7A 2MP1A 3ND8A 4X3TA 1HPCA 2K05A 2WACA 3I3CA 2V8DA 4UEZA 5CV6A 3IFDA 3VR6A 5K8PA 5HVFA 5EBDA 1PYTB 1OXSC 1ENFA 5DNFA 1Z5RA 2Z8LA 1NAPA 4P4DA 4PV1C 3N5FA 3M7NA 3VATA 2HQEA 4ZKBB 1XMBA 3FKIB 5IGGA 5M3MB 1QG7A 1LTID 1NUCA 1U4LA 3GTMB 3KI9A 4DK0A 1I50B 2LFNA 2TSSA 1A15A 4K5VA 2L55A 5C4XB 3I4MB 1F2LA 2R6GA 1XX8A 4RH6A 3B2YA 2RDFA 1VCIA 2R7ZB 1O78A 3PMFA 1FNOA 5CV7A 4OC4A 1R4PB 2BA1A 3HRZC 1H9SB 1LANA 5DEHA 2F7VA 3KR5A 5CC4A 1XJOA 4NMZA 3BXMA 2QJ8A 1PRTF 3SJXA 1R9TB 1IY7A 5K8MA 1HXYD 1GYTA 3M7GA 2X69A 4ABNA 1FR3A 3D68A 3C46A 2TMPA 3IFEA 4P10A 1STBA 1BBXC 5A2QE 1BF4A 1CP7A 5EBCA 4E6IA 2NTTA 2PJBA 1SNCA 4ZX9A 2BA0A 2PJ7A 2V77A 4NP5A 2BE5C 1TKHA 3NA6A 1B4OA 3M3YB 2QVPA 1YW4A 2F0VA 1BCPB 3QB3A 4DN4M 3RUZA 3FDTA 2O5JC 2GA4B 2OXPA 2LKVA 1VIXA 2ZEDA 1BCPD 1K8MA 1I4PA 4MCSA 3HOYB 1E0BA 2WV6D 1DYQA 2B2UA 4OKOA 4RUHA 4XXEA 1W6KA 5D29A 1EOTA 1B53A 4RFBA 1ILPA 1EYDA 4A3EB 5IGEA 2K5WA 1C4QA 2R3ZA 4DU9A 2VL1A 4ZUJA 3HOXB 1LCPA 3ERQA 3S14B 1SAPA 2XEFA 3HP3A 4KY5A 5K8NA 2PNRC 1V1PA 1LACA 1QCBD 3CT9A 2BDOA 4NDXA 3AB9A 4A3GB 1EYAA 1Q1EA 4TWEA 3PB8X 1ZG9A 4IHMA 5M3FB 3H94A 3T16A 4MCRA 2ZENA 1ENCA 3NQIA 5C3XA 1QB5D 3H91A 3V96A 2KJXA 4OC1A 3GO5A 4XYQA 3VYSA 2K5DA 2EYOA 1F2ZA 3A8IE 3FEEA 3NE5B 5M5YB 3FVQA 2QCPX 3R3OA 4L8JA 2EYLA 3KL9A 4ID6A 1ESFA 2V8GA 4WRDA 3LWUA 5COYA 4RAUC 4FP5D 4J1MA 2XVSA 4N9PA 4K2LA 3LNNA 2IT1A 3WT4A 2ANPA 3HGBA 4P2CB 3TDQA 4CJ0B 5E4XA 2NVXB 4DFAA 1XWEA 1XXGA 3Q0AA 2XNAC 3PUWA 4HCSA 3SE0A 1D5MC 1FNUA 3A54A 4BA2I 1YSJA 5E4WC 4H44C 1I3QB 1ET9A 1CHQD 4KKUA 1YNJC 1SYCA 2KCNA 5EPLA 1CPSA 2PJ8A 1D2BA 1T5XD 3RZDB 1O7YA 3X3MA 1SEBD 3D7HA 4R7MA 1Y8NB 5F09A 5IB9A 4PNYA 1QMUA 1KLGD 5I9OA 3D66A 1SMYD 5LL6S 1WCMB 2E2HB 1PTOH 2G9DA 3C2PA 1PRTD 5D3IB 2PMZB 3Q22A 1BLLE 4X3KA 3NH8A 4OIDA 4GZYC 2CF4A 1ILQA 3RZAA 2E74C 3CRLC 1JOOA 1LT6D 1V8QA 1A3UA 4ZK9B 2C9OA 3VR3A 3X3NA 3VYUA 3T13A 4DNTB 2C6PA 3VR4A 1VDZA 5J22A 1CPXA 1TWHB 5CGKA 1BO0A 4RA8A 2SOBA 1CX8A 4K8IA 3SHLA 1CTMA 2I3CA 3L7ZC 2EVBA 4KD4A 4FF3A 4DAPA 1STGA 2I07B 3KHXA 1IKMA 4K2KA 3OIQA 3TMEA 4OO1G 2FJ2A 2PE3A 2NYQA 2F0TA 3HS0C 1ELMP 4F8MA 4R6TA 4F88A 1QQ9A 3S1RB 4IQZA 3MRUA 4XQJA 1NCVA 2K03A 1SSOA 3QO2A 3D7DA 4G57A 4DAVA 4PXBA 3I4NB 3J81E 3MEHA 4F9UA 4LMQD 1IGBA 3IC1A 1OXTA 2IL8A 4IUUA 3BS1A 3LX0A 1HQRD 3SJEA 4ZKCB 3KBGA 2MHVA 3A56A 1OXUA 4F8ZA 3NTIA 1TY2A 3I8ZA 2B2TC 4EWTA 2CW0D 5FO7B 4RGNA 3U9SA 5LHY1 1Y0YA 1KDCA 2A69C 1R3NA 3NFZA 2ID0A 5HGTA 3IL8A 1XBUA 3K0YA 4QF4A 5KYIA 1O80A 3T53B 5KIXA 4A3IB 1DCZA 3IWWA 2ENBA 4F87A 1SNPA 3SK4A 4C3IB 2F4IA 2EJGC 5HURA 5EKIA 1B3AA 2IPKD 2F0SA 5JM6A 2IX3A 3EFXD 2NUCA 2A74C 4C3JB 4KK7A 3DUZA 1I4HA 3RZOB 4UF4A 1I4QA 2DNEA 3VARA 5I9PA 2F0JA 2NN6H 2O2LD 1ARLA 2F0KA 3VH9A 2F3WA 3H8GA 1G2SA 3UI2A 3URYA 1LTRD 5J39A 4MHNA 4BBSB 4DYOA 1SYBA 2JEBI 2JBKA 3WC5A 1AW7A 5BN4A 1GUTA 1BQQT 4P44A 3FPUB 2AFWA 2PVVA 4I65A 5FKAC 3J7AF 3P20A 4MIUA 1NR4A 1DD2A 1HFGA 2KVMA 3VYTA 1ZEQX 3DMUA 1CT1D 1JQGA 2A6ED 2NB0A 3IO1A 3K57A 4ZI6A 1G91A 4IK2A 7CPAA 4H13C 1D1IA 3GTJB 1STAA 2HUGA 4MHPA 1SE3A 4HMIA 3H8FA 1TS4A 4AYBB 3TN2A 2EYJA 5TSSA 2PO4A 1HUNA 1I6HB 3SVMA 4C3HG 2RSNA 3M4OB 1G2TA 4IFDI 4KTAA 1TXRA 5KNDA 1LT5D 1PYWD 3BI0A 1BR9A 3M85A 2R93B 5CORA 1SNQA 3BG3A 2BE5D 4OHJA 4B9XA 2DEAA 2A68D 3OOCA 4HSPA 3TP5A 1M4LA 2ABZA 2CQAA 4DK1A 1SFOB 3CU7A 1M4VA 2SNMA 2B8GA 1F2PA 1F2OA 1BCPC 1H9KA 3D67A 1LTTD 3HG9A 5FOBB 1TS2A 2B2WC 4C3JG 3GTKB 3WDNA 5J1QA 3MXPA 5EKKA 3GLJA 2Q8IB 1CM9A 2K28A 1VF7A 1X3PA 5K36G 2L5TA 4O1NA 2K1BA 3NWTA 1LAPA 2RA4A 3KQXA 1GXDC 1CFMA 2R92B 1JQYD 2BCOA 1GUSA 4ZX8A 1ZYRD 3EVQA 5D14A 3OHXC 4PQAA 2N88A 5JOBA 4XQNA 4CHTB 3D4RA 3PFEA 1R43A 5D8NA 1TWFB 2WB1B 1F9QA 1TQOA 1TKFA 5C3EB 4RGMA 1ZYRC 2JA8B 2PRQA 2R61A 1VGYA 1PTOD 2F1MA 3FMCA 4OO1I 2PZUA 2N55A 3SJGA 2J9AA 3PBEA 1RODA 1L0YB 3J7YW 1B9NA 1Z7TA 1NSAA 4A94A 1ET6A 3QOJA 2AQ3B 1OXVA 5CV5A 1HCZA 3D3RA 8CPAA 6CPAA 4LQGA 4CKCA 2FVGA 3TZUA 4X3RA 4A37A 4IFDG 3SXHA 1HQMC 1TF8A 3OWEB 1I4XA 1GJXA 4FWUA 3PBBA 1KTKA 2X6GA 3FF3A 1CQFA 3S9LA 4M1UB 3PIP3 2KEEA 4FBEA 4KD3A 2A6EC 2DN8A 3EROA 1FT7A 3I73A 4FUUA 2E76C 2GLJA 1EY8A 4NGMA 2E2IB 4OC5A 2FHTA 3I90A 2PJ5A 1QILA 3DWAA 3SK6A 2HCIA 3DM1A 4O42A 5ISRA 1X32A 2PYKA 3K9TA 3NP8A 2JEWA 3BDCA 2F0WA 2EYFA 4RWSC 5FLXE 3IJ3A 3FPPA 4OC2A 3KF8A 4QUCA 2XWJB 1EL0A 1E2ZA 1LFWA 5IGBA 5ELYA 3L2NA 4OIKA 1SNOA 1QWYA 2QKIC 1O7ZA 3RLFA 2HDMA 2H1EA 2E2JB 1Y8OB 2D2CC 3KGQA 4K3NA 3S1MB 5EQ0A 4DGZA 4L63B 1LAMA 4A3KB 2NTSA 1KWMA 2EYPA 4IUQA 1GHJA 2PCUA 4U68A 5LYDA 1PDQA 4FO2A 1FD7D 4ONWA 2EXZA 3B3WA 4PMBA 4F7XA 1HUMA 1EQTA 1H9MA 3KK7A 4CKBA 1B9MA 3A7AB 3O13A 1GUWA 2XEGA 1DJRD 2L0CA 2AFMA 2EWBA 2JA6B 3I91A 5K36H 4DF7A 1HDUA 1RDPD 1GOZA 3HLPA 5EJWA 2Z4HA 1CA5A 5ELFA 1K8OA 1QOHA 1Y0RA 4OIJA 3C1EA 5CBMA 1M8AA 5IT9E 4PPZA 5IIFA 3P1HA 1QNUA 1LLRD 2F0LA 1MBYA 1SYFA 1UWYA 1LTAD 3W2DA 4IUNA 4FXKC 3Q24A 3BI1A 2RB7A 1FNVA 4HCEA 2POKA 4EQNA 2J7ZA 4KJOA 2BOAA 4ILWA 3QJYA 4LJZC 2JE6I 2MGSA 3V7ZA 2B2WA 4OIWA 5ELCA 5C5LA 5T1GA 4KMUC 3SEBA 3NH4A 1ZKOA 3CDXA 3E5SA 1S5CD 2PZWA 1YNJD 1TR5A 3Q6SA 3Q23A 3S2DB 1EY0A 2ZEGA 3PO2B 3CPXA 3PB6X 3BDOA 4MMOA 1B50A 1HHVA 4WJWA 4GM5A 3GTQB 5A2QL 4HMJA 3K2KA 2QILA 3RBUA 1PRTC 3NXWA 3G6JB 4G7HC 1ZG7A 3J80L 1HDQA 2K5QA 3D7GA 3ISZA 5KEEA 2BDNA 1WD1A 3U9OA 2D62A 5BN3A 3H3VC 1HTPA 4CJ1B 5JJZA 1PTOF 5LRKA 1TKWB 2MUYA 1J9OA 4ZY2A 4BY7B 4TNUA 3K59A 3B3TA 3DHQA 4B6ZA 1ELLP 4ZYQA 3KR4A 3NBHA 2IJZA 3BYYB 4B9WA 1SYGA 3J81L 4LK1C 3CQZB 1WVLA 3EA6A 4HAEA 1SE4A 5JVG3 3PUVA 2O4HA 5EKLA 1CHPD 4N9TA 2B8FA 1JWUD 1Y1VB 4CPAA 4BWGB 5CV9A 4ME5A 1LOKA 5ELEA 2G9HD 1PCAA 1TS3A 3TP8A 1LV9A 3FJUA 4TKOB 2ICIA 3L3OC 5KYLA 1DOKA 1EY4A 3VA7A 1SE2A 3H09A 1UEAB 3AU7A 2EOTA 1YMEA 1DXMA 3DEOA 2KQ3A 1YNND 4R9WA 4UIBA 2AWNA 3CRKC 3KUPA 2KECA 2IMOA 1G291 2CIJA 5D65A 1AZPA 1MI2A 4C1NI 2M00A 2OEOA 1BNZA 4C3HB 1YNNC 2RKSA 4HN7A 4NGQA 3DWPA 1A2UA 2M9VA 1AFPA 1CP6A 4FF2A 4K5WA 4RKLA 2L4NA 1Y8PB 1ZLHA 5K5PA 4TSSA 3NHHA 5IGCA 4O23A 1RTOA 2EY6A 3HOUB 1VMCA 5LL6X 2EPBA 4KN4C 2OR4A 4CGYB 1F77A 4OO1H 1AYEA 2SEBD 1RKNA 4NFRA 2C5CA 1JWSD 5CPAA 3MN8A 2EK8A 2KHSA 1RJTA 2PJ1A 2OF1A 2IWHA 3FX6A 1TS5A 4JBWA 5IOCA 4IURA 4CBVA 2C1CA 2ZT9C 5C0XJ 3IFTA 4ZRZA 3JAME 2GREA 3P7JA 3PFOA 5JH9A 2RQXA 1JOQA 1Y1WB 2ZEMA 3T51B 3K7AB 3JAML 3VR2A 1Y69U 1E2WA 2XIWA 2OOTA 3BVMA 2PJ6A 3S17B 4G4KA 5C6AA 4C3IG 4C1NK 1PMRA 3MXUA 2OT2A 4MHYA 1X3QA 1DE4C 3HOZB 1AZQA 1TWCB 4F9VA 1JR0D 1IW7D 1F9RA 2EK9A 3M4YA 4HEDA 3WOFA 3TP7A 5LYLA 4PQXA 1ZLIA 2Q8TA 3V38A 2B2VC 2A5HA 3PV0A 5IT9L 2EJMA 4ZY0A 4TRDA 3A7LA 5F2DA 4NGRA 1F9SA 1AP0A 3SR1A 4LAAA 2HDLA 2A6HC 5EGTA 5CBEE 2A68C 2EY1A 4OMEA 2VB2X 2X6LA 1UAPA 3NUCA 3BHXA 1WTRA 5E1FA 5THWA 1WTXA 2KCCA 1C8CA 2A6HD 1GUNA 4MRIA 1STEA 4P4IA 3D4DA 5C3WA 5JEAH 5J1ZA 3S2HB 3NWSA 3S9NA 1AMPA 3NTHA 4X2TA 2PQEA 3I72A 2PJ0A 4QCLA 3TC8A 1SJED 2ZEOA 4P4BA 4BA1I 1EYCA 4DXGA 5JAVA 1U4PA 1A3VA 5HVHA 3NPPA 2M2LA 4ZAIA 1XYIA 4IUPA 4R8FA 3KASA 5LRJA 1I6VC 1PFMA 2F0OA 3PUXA 4X3UA 1GUOA 1II3A 3RD4A 5IGFA 5I6YA 5M5WB 4G1PA 3KLRA 4K14A 5I6WA 3MTSA 2VXWA 4G7OC 3NTKA 2J4XA 2JSOA 2XSCA 1QNKA 3E6ZX 4DNRB 4KY6A 1J8IA 1MD2D 4MCQA 1SXTA 5ELBA 4ZUIA 2BOSA 3V2TA 2O5IC 5JEAG 3KQZA 1LTGD 1LT4D 4KHZA 5JVH3 1PTOB 3D8GA 5HXDA 1JB3A 1DOMA 3MC0B 1DZ1A 4DAYA 3D6CA 4IFDH 5C5MA 5D3DA 4U673 1JWMD 4ZY1A 2ZXPA 2ZELA 4FXGC 3OSOA 4H0LC 1LO5D 5KRUA 2PIYA 1HRJA 4IUTA 1DM0B 1UUPA 2F0FA 3NQTA 1LTBD 5M5XB 4P4EA 3SJFA 1EIHA 4UIAA 3SI2A 2WIIB 1KNEA 3HOVB 2NZ1D 1CZGA 2LS01 4OGQC 4MN3A 1NSNS 1BCPF 2K7VA 3ZYYX 1SJHD 5CMDA 3FEDA 3R8BA 2AFSA 3GB0A 4DA2A 1STHA 1GHKA 4QB4A 4ZQ3A 2NN6I 2Q8RE 1KNAA 1YLOA 3W3AA 5C4JB 3QG1A 4PMWA 1SMYC 3D4WA 5CV8A 2PCFB 2AFXA 3RMHA 4KKSA 1BUVT 4YIJA 3AMUA 2IX0A 2EJFC 3PIO3 1PZID 3NH5A 2K6AA 4MHZA 5C4ZA 4UEEA 3BVZA 3PUZA 4K5XA 1E2VA 3TZDA 2EZVA 4UAIA 1WTVA 4OP4A 2EYHA 4R8IA 3FECA 2JP1A 1S4ZA 4KY7A 3WC6A 3S16B 1HFNA 2C6CA 1IYUA 5IODA 3MFGA 1IKLA 1AN8A 1U9RA 1JOKA 2VUMB 2Q4ZA 2F0UA 2YYZA 3QIAA 1F2MA 2K32A 4XTCS 3EQLC 5K8OA 3S1NB 2AQ2B 4R8NA 3CPAA 1ARMA 3K5NA 4RGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GM5 A;  2PIZ A;  1CX8 A;  3H8E A;  2RFH A;  3K2K A;  2I3C A;  4A38 A;  3RBU A;  1BPM A;  4NJQ A;  1ZG7 A;  2V8V A;  1HDQ A;  3ISZ A;  3D7G A;  3KHX A;  3TX8 A;  4H2K A;  4WJB A;  3HUV A;  4DUK A;  2PE3 A;  4PXD A;  3B35 A;  2NYQ A;  5LRK A;  1ELM P;  4ZY2 A;  4R6T A;  1QQ9 A;  1YW6 A;  1TF9 A;  3MRU A;  3D7D A;  4TNU A;  2PJ4 A;  4PXB A;  3B3T A;  4B6Z A;  1ELL P;  2WZN A;  5HVG A;  4F9U A;  4ZYQ A;  3SI0 A;  3KR4 A;  4P45 A;  1IGB A;  2IJZ A;  1DTD A;  3PB7 X;  3IC1 A;  3PRT A;  3KZW A;  4W9Y A;  2Q43 A;  4NJR A;  4KSI A;  3T8W A;  3SJE A;  2GLF A;  2O4H A;  2IQ6 A;  4F8Z A;  4CPA A;  2PJ2 A;  4EWT A;  1LOK A;  1Y0Y A;  3B3V A;  1PCA A;  1R3N A;  2C6G A;  3FJU A;  2AFU A;  3NFZ A;  1XBU A;  1CBX A;  4JYW A;  2ZEE A;  1EE3 P;  1YME A;  3IWW A;  1Z2L A;  2HC9 A;  3PEI A;  4EFD A;  5JGF A;  4UIB A;  2IMO A;  4Q7A A;  2CIJ A;  5JM6 A;  1VHE A;  1TKJ A;  2AFZ A;  4WWV A;  3B7I A;  4UF4 A;  3WAB A;  4NGQ A;  4FAI A;  3VAR A;  1CP6 A;  1ARL A;  1XRY A;  3VH9 A;  1Q7L A;  3H8G A;  2ZOF A;  1ZLH A;  4MHN A;  4O23 A;  4JZ0 A;  4DYO A;  2JBK A;  3WC5 A;  4P44 A;  2Q51 A;  2OR4 A;  2PJA A;  2AFW A;  2PVV A;  4YWY A;  1AYE A;  2ZEF A;  4NFR A;  5CPA A;  1OBR A;  3B3S A;  3MN8 A;  3SI1 A;  1JQG A;  2EK8 A;  4AXV A;  2PJ1 A;  3IO1 A;  4ZI6 A;  4Z65 A;  3FX6 A;  4IK2 A;  7CPA A;  1H8L A;  3DGV A;  2XEJ A;  3B3C A;  4MHP A;  3H8F A;  4NGT A;  1VHO A;  2O53 A;  2CTB A;  4R76 A;  2C1C A;  3WC7 A;  2GRE A;  2PJC A;  2V8D A;  4UEZ A;  3PFO A;  5JH9 A;  3FVL A;  2ZEM A;  5HVF A;  5K8P A;  1TXR A;  1PYT B;  2ZEP A;  3BI0 A;  2OOT A;  2V8H A;  1Z5R A;  2PJ6 A;  1CG2 A;  4P4D A;  3N5F A;  3VAT A;  1XMB A;  2DEA A;  1M4L A;  2ABZ A;  2PJ3 A;  4MHY A;  4YU9 A;  1DE4 C;  4P4F A;  3KI9 A;  4F9V A;  1F2P A;  1F2O A;  2EK9 A;  3D67 A;  2ZOG A;  5LYL A;  1ZLI A;  3B2Y A;  3V38 A;  1FNO A;  4ZY0 A;  4OC4 A;  5J1Q A;  1LAN A;  2F7V A;  3KR5 A;  4NGR A;  1XJO A;  3GLJ A;  3BXM A;  2QJ8 A;  3SJX A;  3QNV A;  1IY7 A;  3PB4 X;  3FH4 A;  5K8M A;  4OME A;  1LAP A;  3KQX A;  2BCO A;  1GYT A;  2HB6 A;  3BHX A;  4ZX8 A;  4OC0 A;  5THW A;  3D68 A;  4PQA A;  3IFE A;  4P10 A;  4MRI A;  5I4M A;  3PFE A;  1R43 A;  4P4I A;  2ZEH A;  5D8N A;  1CP7 A;  1RTQ A;  1TKF A;  2PJB A;  4ZX9 A;  3LMS A;  2PJ7 A;  2PRQ A;  1F57 A;  2V77 A;  1VGY A;  3S9N A;  1AMP A;  1TKH A;  4X2T A;  1ZG8 A;  3NA6 A;  3FMC A;  2PJ0 A;  4P6Y A;  2XEI A;  3SJG A;  3TC8 A;  2QVP A;  1YW4 A;  2J9A A;  2ZEO A;  3PBE A;  4P4B A;  1NSA A;  4A94 A;  1VIX A;  5HVH A;  2ZED A;  3DLJ A;  8CPA A;  6CPA A;  5DS0 A;  1HEE A;  2NSM A;  3GUX A;  4LQG A;  2FVG A;  4X3R A;  4A37 A;  3S9M A;  4MCS A;  4R8F A;  1TF8 A;  3KAS A;  3D7F A;  4OKO A;  4RUH A;  5LRJ A;  4FWU A;  4OC3 A;  5D29 A;  3PBB A;  3FF3 A;  4MXU A;  3S9L A;  2VL1 A;  4G1P A;  4FBE A;  2QYV A;  4A39 A;  1LCP A;  1FT7 A;  2XEF A;  4FUU A;  5K8N A;  2GLJ A;  3JRU A;  4NGM A;  4OC5 A;  2PJ5 A;  3CT9 A;  2JBJ A;  4TWE A;  3PB8 X;  1ZG9 A;  4IHM A;  3K9T A;  2JEW A;  4X8I A;  4MCQ A;  4MCR A;  2ZEN A;  3IJ3 A;  4NGN A;  4OC2 A;  4OC1 A;  3KQZ A;  1LFW A;  5ELY A;  3KHZ A;  3L2N A;  1Y7E A;  2GU2 A;  5HXD A;  1BAV A;  3FEE A;  4EME A;  2BO9 A;  3KGQ A;  4K3N A;  3KL9 A;  4ZY1 A;  2V8G A;  2ZEL A;  3I1U A;  2PJ9 A;  2PIY A;  3LWU A;  1LAM A;  4NGP A;  5LRG A;  2PVW A;  1KWM A;  3SJF A;  4P4E A;  2PCU A;  4UIA A;  5LYD A;  1Z8L A;  3SI2 A;  4BD9 A;  4ONW A;  3B3W A;  3WT4 A;  2ANP A;  4DJL A;  3D4U A;  5LYI A;  4P4J A;  2XEG A;  3FED A;  2AFS A;  3GB0 A;  2AFM A;  2EWB A;  1HDU A;  3IIB A;  3PB9 X;  3HLP A;  4NGS A;  1YSJ A;  1Y0R A;  1YLO A;  5CBM A;  4MCP A;  1BPN A;  2F8H A;  1XFO A;  4PPZ A;  2AFX A;  1CPS A;  2PJ8 A;  3IEH A;  3D7H A;  1UWY A;  4R7M A;  3ISX A;  5F09 A;  3BI1 A;  5IB9 A;  2RB7 A;  1QMU A;  4UEF A;  3NH5 A;  4MHZ A;  2AFO A;  4UEE A;  2POK A;  3D66 A;  2BOA A;  2CTC A;  2G9D A;  3V7Z A;  1BLL E;  4OP4 A;  3FEC A;  3NH8 A;  4OID A;  4OIW A;  3RAM A;  2CF4 A;  3RZA A;  3WC6 A;  3NH4 A;  3CDX A;  2C6C A;  2Q4Z A;  5LYF A;  2WYR A;  4PXC A;  2C6P A;  5K8O A;  2ZEG A;  4PXE A;  3CPA A;  3CPX A;  4IAV A;  1CPX A;  3PB6 X;  1ARM A;  4MMO A; 
#chains in the Genus database with same CATH topology
 1WD0 A;  5IYC G;  4EGV A;  2VQF Q;  1AH9 A;  4A3M B;  2P5Z X;  2NVT B;  1EU4 A;  4DV6 Q;  3GTL B;  3HOU G;  2RFH A;  1LRZ A;  2NVY B;  1ICW A;  2P6F A;  3KLS A;  2YNC A;  2Q2U A;  3KKW A;  4JI8 Q;  4C56 C;  1EEF D;  4Q5V A;  2X7B A;  3C26 A;  2PRB A;  3H15 A;  2IX1 A;  2AQ1 B;  3WOE A;  4RCO A;  4WOR A;  1I6H H;  3TX8 A;  5J8F A;  2B63 H;  2QGQ A;  3NEN A;  4HTH A;  1N33 Q;  2IY5 B;  4H2K A;  1D7Q A;  4WJB A;  4A33 A;  4QMG A;  4DUK A;  4E2A A;  1B44 D;  1HTL D;  3CC4 A;  3FYN A;  1L0X B;  2VB3 X;  3MWY W;  3P75 A;  2WFW A;  3KFU A;  3OIP A;  4QIW B;  2VY3 A;  5CV4 A;  2I5M X;  4LF6 L;  1QUQ A;  4BIN A;  3EJI A;  3HOW G;  4DAY B;  1LTS D;  2CHB D;  4R87 A;  5KNB A;  1O7L A;  2WZN A;  5HVG A;  4R4I A;  2NWG A;  1DGS A;  2YNE A;  2WPX A;  4HR7 B;  1NNX A;  4MTN A;  1S40 A;  3CHB D;  3FRP B;  1DTD A;  3PB7 X;  5JPM C;  1NBW A;  3KZW A;  2VW9 A;  4FF1 A;  5J8C A;  4W9Y A;  4NJR A;  1V1O A;  2F0N A;  4LQ6 A;  3T8W A;  1Y9K A;  2JA5 H;  2VBQ A;  2J0T D;  2B2T A;  3A8J E;  5IYB H;  4GS4 A;  2NYZ D;  2R98 A;  4UP7 A;  1IBL L;  2DUD A;  2D9U A;  3HOV H;  1VQE A;  1ZO0 A;  3MXG A;  4IN3 A;  4KVO E;  1M44 A;  5CBA E;  5KGU A;  1V43 A;  3B3V A;  4IAL A;  2YTX A;  2VQE L;  2Q2T A;  2AFU A;  4BBR B;  1IL8 A;  4H7B A;  1CQV A;  4OXP A;  1ONL A;  4XQQ A;  2WSA A;  3QAY A;  4Q0F A;  1JC7 A;  2RBM A;  1CBX A;  1ICF B;  1F9P A;  3EN2 A;  2LY7 A;  3VA5 A;  2EXD A;  4AVA A;  2JYO A;  3S6K A;  2PR8 A;  4YWL A;  3RZD H;  2HC9 A;  1JWQ A;  4XT1 B;  1G8Z D;  2XN9 C;  5JGF A;  1WOC A;  1Z47 A;  2OZG A;  3RO0 A;  2ZW4 A;  4KVM E;  3H6M A;  4Q7A A;  3KLS X;  3FP9 A;  1PFS A;  1F2Y A;  4FNF A;  1QE6 A;  2DY7 A;  2O4X A;  3I70 A;  5LMN Q;  5GCN A;  1K83 H;  1PH9 A;  4WFN 3;  3H0G B;  3PIP A;  4WWV A;  2B4D A;  2AUK A;  3N52 A;  2K33 A;  2VNU D;  3NBI A;  1EY7 A;  4FAI A;  2E75 C;  2DJF C;  2YGW A;  1TWF H;  2EE1 A;  1XRY A;  1Q7L A;  1JE4 A;  1M4G A;  2ES2 A;  3GTP B;  4V19 0;  4JI5 Q;  3GQB A;  3MXN A;  4WJ4 A;  1H9R A;  2IW3 A;  2L11 A;  1K3B C;  1A8V A;  2SDF A;  2E2D C;  4JI8 L;  4ONU A;  1ZXT A;  3FKI H;  4KOR A;  1SND A;  3C1F A;  1G6Z A;  3BJ8 A;  1RL2 A;  1BOS A;  2WP8 J;  2YV5 A;  5KNC A;  3F5B A;  4J3G A;  3OW7 A;  3UE1 A;  2FFK B;  4XYO A;  2F3I A;  2HIX A;  4YWY A;  2QDB A;  4KLV A;  1EQV A;  4X62 L;  1VQI A;  1QUQ B;  3SK8 A;  4KOY A;  1EWH A;  2QEC A;  1HZC A;  4IZ8 A;  4K8J A;  3TS0 A;  1BDO A;  4KUA A;  1EY5 A;  2Z3L A;  3K5O A;  1YHA A;  1JOR A;  1STN A;  3GTO B;  1H95 A;  2AUJ D;  3SGI A;  1IHZ A;  4AXV A;  4V0B A;  2VXK A;  5JEA J;  3H0G H;  3DXJ C;  1MSG A;  3RN2 A;  2RSO A;  4OEL B;  1H8L A;  3DGV A;  1S5D D;  4B11 A;  4CYQ A;  3B3C A;  4DR6 Q;  4NGT A;  5C4H A;  1RHP A;  1A0I A;  2AWO A;  5FO9 B;  2RDH A;  3GTJ H;  4HJ9 A;  2B2V A;  5J3B A;  4X64 Q;  4A3J B;  4R76 A;  2F0G A;  3N7Z A;  4A95 A;  5FO8 B;  4H6U A;  3CXQ A;  4KOV A;  5EPK A;  1MSH A;  3STB C;  2PJC A;  1V9P A;  1IBK Q;  3FNC A;  4A3F G;  2R1I A;  3FVL A;  3VDY A;  3J7A V;  3TBI B;  4QQB X;  2N3S A;  2JA7 B;  2ZEP A;  4R57 A;  2V8H A;  2MPM A;  1TU2 B;  1KAA A;  4L5Q A;  4LF9 Q;  3HEJ A;  3S2H H;  1C7Y A;  1CG2 A;  1K4J A;  5IWA Q;  1CI3 M;  3R2I A;  4KOU A;  2VQF L;  1SDF A;  3TSS A;  4Y52 H;  2F0D A;  4ZYS A;  2DPS A;  2PJ3 A;  1I94 L;  2B29 A;  2V4D A;  1PFB A;  2JA5 B;  3PZJ A;  2YU9 B;  1EY9 A;  4YU9 A;  4P4F A;  1PVO A;  3QWN A;  2JA8 G;  2WKD A;  4OL7 A;  2Q2H A;  3E9H A;  5GAH C;  1Z8X A;  4AQY Q;  1IYL A;  3PF4 A;  2UXD Q;  3BVG A;  4I7Z C;  1VKC A;  3EC4 A;  2K04 A;  4S3S A;  2CNM A;  2ZOG A;  3LWE A;  1EWI A;  4MY3 A;  3S1Q H;  1KRS A;  3DNS A;  3T56 B;  4I49 A;  5DWM A;  1I5F A;  4PZ6 A;  2HHH Q;  4F6A A;  4Q36 A;  3IAY A;  4RCN A;  3T4A C;  1EY6 A;  4BBH A;  1RCV D;  1CA6 A;  2UU9 Q;  4B3S L;  1NMF A;  1RTN A;  3QOL A;  3J81 c;  4NXM Q;  3GV3 A;  5BN5 A;  4HIM A;  3OWC A;  1LM0 A;  1CK1 A;  4HKF A;  1GVP A;  3VYR A;  3QNV A;  4CAF A;  4FXD A;  3PB4 X;  3FH4 A;  4FD4 A;  1XTD A;  1AUG A;  4A3I H;  2NBF A;  1C48 A;  2KCM A;  3GDE A;  3S15 B;  2ZXR A;  1VQN A;  4LF7 L;  1S5B D;  4JBK A;  2Z4I A;  2HB6 A;  5DM6 3;  1N36 L;  1CSQ A;  1EFI D;  2E8G A;  4OC0 A;  3CMA A;  1EIG A;  4DV1 Q;  2NVT H;  1KAB A;  3LAC A;  1NMG A;  1UEB A;  2CY2 A;  1WTP A;  3NSW A;  5I4M A;  4IFD J;  2ZEH A;  1UE1 A;  4KOT A;  1H9J A;  2QF7 A;  3K58 A;  2GVB A;  4DK6 C;  1RTQ A;  1Q86 C;  2CW0 C;  3LMS A;  1K8G A;  1PZJ D;  2A1A A;  1F57 A;  5DAU A;  5EAY A;  3GTP H;  2QEJ C;  1KUY A;  1ZG8 A;  4M85 A;  2I79 A;  2VUM H;  3ITP A;  3NK9 A;  4P6Y A;  3CC7 A;  4A3D B;  4DR3 Q;  2XEI A;  1GKH A;  1PLF A;  1KLU D;  2ZW7 A;  1KDB A;  5KTD A;  3CXP A;  4J8Q A;  2F03 A;  4EVY A;  3S6G A;  2WAQ G;  3UDF A;  4DR5 Q;  3HOW B;  2R7Z H;  1MGS A;  1WTO A;  2GE3 A;  4XPL A;  3J81 j;  4B12 A;  3DLJ A;  1PTO C;  5DS0 A;  1HEE A;  3ONA B;  2XRQ D;  2F0M A;  3I4L A;  3IKJ A;  2NSM A;  3GUX A;  1S5E D;  4QUF A;  2Y0S B;  4A93 B;  3S9M A;  2B3U A;  4J6H A;  1VQ4 A;  1QJO A;  3K80 C;  3D7F A;  3ZJ0 A;  2O28 A;  1T5E A;  5FLX c;  1GD7 A;  1TWG B;  4L6T B;  4O2D A;  1LT3 D;  4LUZ A;  3BZD B;  1A2Z A;  3A74 A;  2Z1C A;  4POG A;  2B2U C;  3GTG B;  4OC3 A;  1Y1V G;  3DWQ A;  1D6E C;  4JBM A;  1X12 A;  4GS3 A;  1OO9 B;  4L5R C;  4MXU A;  4A75 A;  3KDF B;  5FK9 C;  1BBU A;  3HOZ G;  3K81 C;  3PGZ A;  4GNX A;  1EIY B;  1ESR A;  2FIA A;  2JXM B;  5M3F H;  2ZTC A;  4HNY B;  2QYV A;  2UUB L;  3D6W A;  4EQP A;  4A39 A;  3HZX A;  3MRU A;  4M8A A;  5C0X I;  3FKI G;  1WFQ A;  1VQO A;  1J5E Q;  3JRU A;  3K9U A;  1BXT A;  5M3M H;  4KJN A;  2UUA L;  1PU9 A;  1Z6H A;  1TII D;  3U4Z A;  4OLL A;  2JBJ A;  2A73 B;  4CDD C;  2WAQ B;  4DR1 Q;  2EY2 A;  2KEN A;  4I7A A;  1V1P B;  2R8V A;  1GUG A;  5C0X G;  4X8I A;  1NE9 A;  4JI6 Q;  1W6J A;  4X3S A;  3CC2 A;  1RF2 D;  4NGN A;  2EY5 A;  1HA5 A;  5AFW A;  5EMI A;  4AG9 A;  1VMP A;  1QSN A;  5G3L D;  1EEI D;  3U50 C;  1I1D A;  4ODG A;  5IGD A;  4KV6 A;  5AG6 A;  3KHZ A;  3B8G A;  1Y7E A;  4IO9 A;  2GU2 A;  1DOL A;  1Q1B A;  1BBW A;  1AEX A;  1R4Q B;  1I21 A;  1BAV A;  1TY0 A;  2J8N A;  3TCV A;  1KDA A;  4C2M H;  1CZW A;  4MFJ A;  2JA8 H;  4DXF A;  2KUM A;  3MHB A;  2BO9 A;  5E96 A;  4KI0 A;  4EME A;  4ME3 A;  2Z9H A;  1SRO A;  4HJA A;  2ATW A;  3OMG A;  2F0H A;  4B08 A;  1DON A;  3TRE A;  2UUC L;  3BJ7 A;  2SNS A;  3I1U A;  3ND9 A;  2PJ9 A;  2JDD A;  4NXM L;  4PK3 A;  4NGP A;  1GM5 A;  5LRG A;  2PVW A;  3D0F A;  2GIV A;  1XTC D;  2B39 A;  3R2T A;  3C3L A;  4UCN A;  2PDO A;  1A6X A;  2ZXV A;  3SXO A;  1FGB D;  1WK4 A;  1YVO A;  2ZXO A;  3QR8 A;  4C2Z A;  1M1K C;  1KIX A;  3R9F A;  4IF5 A;  2KOL A;  2RVL A;  3A55 A;  1XJV A;  5FLX L;  1JJG A;  2AHO B;  3K6O A;  1KXL A;  1Z8L A;  4BD9 A;  2CH4 W;  4A3F H;  1IU8 A;  2K5H A;  4UWJ A;  2CWA A;  5JPN C;  2B2Y A;  2CVR A;  3S9W A;  3CXC A;  3I9S A;  2C35 B;  4DJL A;  3L9A X;  3WR7 A;  3D4U A;  2XRS D;  3E0K A;  4DK3 C;  4KN7 C;  2DXQ A;  4FF4 A;  5LYI A;  2I46 A;  1CKM A;  3SDZ A;  3SK5 A;  1L0C A;  4LW1 A;  1Q3L A;  1WTQ A;  2RDG A;  2QML A;  4P4J A;  4ZGY B;  4Z9C B;  2XWB B;  3G6E A;  1NSL A;  4M6G A;  1EZ8 A;  3MA2 B;  2Z3O A;  3IIB A;  3PB9 X;  2PW5 A;  4NGS A;  1K83 B;  1VQ7 A;  3GTO H;  5IX3 A;  2FIN B;  1PZK D;  4CJ2 C;  3G3S A;  4BY1 G;  2NN6 G;  4UFW A;  4MCP A;  4ULL A;  1BPN A;  4A3B B;  2F8H A;  1XFO A;  3G4S A;  3T9Y A;  1E22 A;  1X3F A;  2KA7 A;  3K8A A;  4CGM A;  3IEH A;  3GV6 A;  4A3B H;  2F0E A;  1KD1 C;  4BS9 A;  3VWD A;  2WKC A;  4HIK A;  3AEV A;  3ISX A;  5I4D A;  2B3G A;  4UEF A;  4A3F B;  5CYU A;  1T9H A;  2AFO A;  1HR0 Q;  3CCE A;  1WTW A;  2DF5 A;  3DEP A;  3S1R H;  1EU3 A;  1TT2 A;  2CTC A;  2VL6 A;  3VR5 A;  1ML0 D;  1PFN A;  5IY0 A;  2A69 D;  2F0P A;  3FEW X;  1XNQ Q;  5NUC A;  2PZT A;  5LMU L;  1TWA B;  1EZ6 A;  2ZTE A;  3RAM A;  5F47 A;  4RHS A;  1YX0 A;  3MVV A;  1A3T A;  2F0I A;  3W1G A;  3I7F A;  2IJ0 A;  4GLA C;  1TIQ A;  3K5M A;  2ZJQ A;  4DV1 L;  5LYF A;  2WYR A;  4LUV A;  1SNM A;  1Q8I A;  2GFQ A;  4JI3 L;  3GD7 A;  4GOP A;  4IUV A;  4PV6 A;  2NZO A;  4PXC A;  3A5U A;  5C44 B;  3MAQ A;  5I2Y A;  4IOA A;  4WJ3 M;  5IE8 A;  5C3E H;  2EDG A;  2WB1 E;  1YIT A;  5E7N A;  1E1O A;  4PXE A;  1JCK B;  4YHH Q;  2VZA A;  4IAV A;  2NVQ B;  1YQE A;  3S1Q B;  2EYM A;  4AIM A;  3T1Y Q;  3R93 A;  4DR4 L;  1I12 A;  3W91 A;  2PIZ A;  5G3L F;  4BBR H;  3E0J A;  3H8E A;  4B5P A;  2UUC Q;  1N71 A;  1SYD A;  2FMC A;  4HSV A;  1U4M A;  1KC8 C;  4A38 A;  1BPM A;  2F3V A;  2VEZ A;  4NJQ A;  1D1K A;  1B2T A;  2V8V A;  4XT3 B;  4PMC A;  1I4G A;  3CCS A;  3U4V A;  4LFB Q;  3F0A A;  2UXD L;  4TQU S;  2PW7 A;  3HUV A;  1BKB A;  3WWV A;  2K01 A;  5ELN A;  4O0A A;  3PUY A;  2WIN B;  3TP6 A;  4PXD A;  4AG7 A;  3B35 A;  2D5D A;  2Q2I A;  5A27 A;  4IPD A;  2N49 A;  3CCU A;  3Q8D A;  3HOY G;  3F2U A;  1YW6 A;  1TF9 A;  5M9O A;  4K6L A;  2F0Q A;  2PJ4 A;  5EPJ A;  3GP7 A;  2L9H A;  1HA6 A;  4QL5 A;  3SI0 A;  4P45 A;  1X6O A;  5CR3 A;  5C44 G;  1OZP A;  4OWT B;  4GKJ L;  1IW7 C;  4EQO A;  2VS1 A;  5A35 A;  3A8K E;  3MXN B;  1A2T A;  3PRT A;  4DNC A;  1UNS A;  3IU2 A;  4CKE A;  4ZLT F;  1FJG L;  2YTV A;  4G7Z C;  2Q43 A;  2IHE A;  4IJL A;  1X55 A;  3D31 A;  4KSI A;  4UFV A;  4RHR A;  1XF8 A;  1PXU A;  1E1T A;  2GLF A;  1KUX A;  1STY A;  1TVX A;  4R4O A;  3OWF A;  4EQ5 A;  1Q12 A;  2A4N A;  2IQ6 A;  5F48 A;  3KBX A;  2PJ2 A;  3OMC A;  5C0X H;  3J80 E;  1D5X C;  2QEX A;  3QB8 A;  2IHF A;  4AYB E;  1JIC A;  2FMM A;  5C4X H;  3E9I A;  5FJ8 G;  3S17 H;  4UDU C;  2ZM6 Q;  3P2H A;  3CF5 A;  1Q82 C;  5I2X A;  2DNC A;  2C6G A;  4F0X A;  1EUJ A;  2K5T A;  2FIW A;  3HKZ B;  4BXX G;  4OAE A;  1D5Z C;  2KED A;  4KHV A;  4JYW A;  3CKI B;  2ZEE A;  2B2Y C;  2LMC B;  2ICE C;  1VF5 C;  3KLW A;  4DR3 L;  1CJW A;  1EE3 P;  3PO3 B;  1Z2L A;  1S5K A;  2B63 B;  4DV5 L;  4JK1 C;  1FYC A;  3W1B A;  4QY7 A;  3RLN A;  4MHE A;  4A3B G;  3PEI A;  4A3D G;  1SBB B;  1R9T H;  3OPO A;  4EFD A;  3G7L A;  4BY1 B;  2AJ6 A;  2H5M A;  1I4R A;  3S6F A;  5ELD A;  2K5N A;  3V05 A;  5M5Y H;  2YND A;  4BY1 H;  2MJ8 A;  2L1B A;  1VHE A;  4CRY B;  1NTG A;  5DLQ E;  2Z6K C;  1TKJ A;  2AFZ A;  3ZJY C;  4YCU A;  1FNW A;  2CH4 A;  4JW0 A;  1ENA A;  1R57 A;  4KKT A;  4MZ9 A;  3E0E A;  4RGO S;  1W2B A;  3MFY A;  3B7I A;  1B87 A;  3WAB A;  4F0Y A;  1VQC A;  2HCC A;  4LF4 L;  3AYH B;  2PPB C;  2JEA I;  4OWW B;  1HNW L;  1LAB A;  3S1N H;  2ZOF A;  4NKL A;  1H9S A;  1YEZ A;  4LFA Q;  4YCW A;  4JZ0 A;  2ZJR A;  1NR2 A;  1S5F D;  1IYJ B;  1EWC A;  4FVM A;  1OXX K;  1WYD A;  4NW2 A;  4FYD A;  1PH2 A;  5IB0 A;  3N6R A;  2Q51 A;  4RKB A;  2PJA A;  3BDL A;  2H4O A;  1PH7 A;  2D0O A;  5IYD G;  3D8P A;  2Z10 A;  4DV7 Q;  1U4R A;  3TS2 A;  1RD9 D;  1Q90 A;  5DM7 3;  1E24 A;  2G3A A;  4C2M B;  2LXK A;  1KUV A;  1Y9W A;  2ZEF A;  1B1Z A;  1PRT B;  3BYT B;  4LFC L;  4FD7 A;  2DY8 A;  1OBR A;  4GN3 B;  3B3S A;  3SI1 A;  3EIV A;  1WJJ A;  4MY0 A;  4CYN A;  5E3F A;  1PH3 A;  3K5L A;  3FXT A;  4Z65 A;  4JD6 A;  3MZ5 A;  4EVO A;  2KHI A;  4Y7N B;  5C82 A;  1VQB A;  1IYV A;  2XTI A;  4XPD B;  5T1I A;  1U6M A;  2KCT A;  2XEJ A;  3RNU A;  1SYE A;  1VHO A;  3IWG A;  3HKS A;  2O53 A;  2L12 A;  2CTB A;  4PSX A;  4P75 A;  3D2M A;  2F52 A;  3TOB A;  4K6D A;  1HZ9 A;  4XDX A;  4XIG S;  3WC7 A;  2MP1 A;  3ND8 A;  2Z3P A;  4X3T A;  3J80 i;  1HPC A;  2K05 A;  2WAC A;  3I3C A;  2V8D A;  4UEZ A;  2E2J H;  4DV4 L;  5CV6 A;  1YVC A;  3IFD A;  3VR6 A;  5K8P A;  5HVF A;  5EBD A;  1PYT B;  2ZTD A;  1OXS C;  5M5X H;  1ENF A;  5DNF A;  2JA7 G;  1Z5R A;  2Z8L A;  2B5G B;  5I0C A;  2UXB Q;  1NAP A;  4P4D A;  2AMC B;  4PV1 C;  3N5F A;  4CDE C;  3M7N A;  3VAT A;  2VQE Q;  3T1Y L;  2HQE A;  4ZKB B;  3F2D A;  1XMB A;  2UXC L;  3FKI B;  5IGG A;  5M3M B;  4IUS A;  4A3C H;  1QG7 A;  1LTI D;  4EX5 A;  4A3J G;  1E7Z A;  4JI4 L;  1NUC A;  1PYS B;  1U4L A;  3KF6 A;  3GTM B;  3ERS X;  3KI9 A;  1L1O C;  4DK0 A;  1I50 B;  2LFN A;  2TSS A;  1A15 A;  4K5V A;  2L55 A;  4DUZ Q;  2RC4 A;  5C4X B;  3I4M B;  1F2L A;  2R6G A;  2MQH A;  1KHI A;  2HQL A;  1XX8 A;  4RH6 A;  4X64 L;  3B2Y A;  4E8O A;  2RDF A;  1VCI A;  2R7Z B;  2JK8 A;  1O78 A;  3PMF A;  1FNO A;  5CV7 A;  2WUU A;  4OC4 A;  1R4P B;  2BA1 A;  3TFY A;  3HRZ C;  1H9S B;  1LAN A;  4RG1 A;  1FVI A;  1XMO Q;  5DEH A;  2F7V A;  3KR5 A;  5CC4 A;  1XJO A;  4NMZ A;  3BXM A;  2QJ8 A;  1VQH A;  1PRT F;  2CFM A;  3SJX A;  1R9T B;  3PO3 G;  1IY7 A;  1MJB A;  5K8M A;  4UWI A;  5EBV A;  3PO3 H;  4LFA L;  1HXY D;  3HKZ G;  3LGJ A;  4X65 Q;  1GYT A;  3M7G A;  2X69 A;  4IJH A;  3I2Z A;  4ABN A;  1FR3 A;  2Q44 A;  1N33 L;  3D68 A;  3BJU A;  3C46 A;  2TMP A;  3IFE A;  1KL9 A;  4P10 A;  5F46 A;  1STB A;  1BBX C;  1XIX A;  5A2Q E;  4JBJ A;  3BU2 A;  2P6E A;  1BF4 A;  1CP7 A;  4DV6 L;  5EBC A;  4E6I A;  2D0P A;  2NTT A;  2PJB A;  4CGO A;  1SNC A;  1IOF A;  4ZX9 A;  2BA0 A;  3EFA A;  2PJ7 A;  2L15 A;  2V77 A;  2PSW A;  4NP5 A;  2BE5 C;  1TKH A;  3NA6 A;  1B4O A;  5FVJ A;  5M3M G;  3M3Y B;  2C27 A;  4MJ8 A;  1K73 C;  3STB D;  2QVP A;  3CCQ A;  1YW4 A;  2F0V A;  1XMQ Q;  1K3R A;  3U58 A;  1B8A A;  1BCP B;  3QB3 A;  4DN4 M;  3RZO H;  1JT8 A;  1P8L A;  3KF6 B;  3RUZ A;  3FDT A;  1VQG A;  5M3F G;  4A3I G;  1VQL A;  3J7A 5;  2GA4 B;  2O5J C;  1IID A;  2OXP A;  2LKV A;  5IP9 H;  1VIX A;  2ZED A;  1BCP D;  3I55 A;  1NY4 A;  1JMC A;  2JDC A;  4B13 A;  1K8M A;  4R9M A;  4ALP A;  1W3S A;  1AE2 A;  2K4K A;  1I4P A;  4KOW A;  4MCS A;  3HOY B;  1E0B A;  2WV6 D;  1DYQ A;  4XNH C;  1Z9F A;  2B2U A;  4OKO A;  3HOX G;  4A2Z A;  4RUH A;  4II9 A;  4OEM B;  1L2F A;  4XXE A;  4DV3 L;  4DR4 Q;  1W6K A;  5D29 A;  4B5O A;  1K0R A;  1EOT A;  4NF1 A;  1B53 A;  4RFB A;  1ILP A;  1EYD A;  4A3E B;  2ARH A;  2G5D A;  2JJQ A;  5IGE A;  2K5W A;  1C4Q A;  2R3Z A;  4A3E G;  3HOX H;  1BOB A;  3JVN A;  1JJC B;  4DNI A;  4DU9 A;  1PH1 A;  3CCR A;  1MJE A;  1YRE A;  2VL1 A;  4ZUJ A;  1QVF A;  1VQ8 A;  3MEF A;  4A4I A;  3HOX B;  1IBL Q;  1LCP A;  3ERQ A;  3J80 c;  1SAP A;  3S14 B;  2XEF A;  5C88 A;  3HP3 A;  4KY5 A;  5K8N A;  2PNR C;  2Y0S E;  2OU2 A;  1L1O A;  1Z8T A;  1V1P A;  1LAC A;  1QCB D;  1HNX L;  3CT9 A;  2BDO A;  4NDX A;  2NMT A;  3AB9 A;  4DR2 Q;  4A3G B;  3PSI A;  3T1H Q;  2JLM A;  1EYA A;  1Q1E A;  1QVG A;  3PB8 X;  4TWE A;  3A0J A;  3DR8 A;  1ZG9 A;  4IHM A;  4JLY A;  5FLM G;  5M3F B;  4A3J H;  3H94 A;  3T16 A;  1IZ6 A;  2JA6 H;  4MCR A;  4DAM A;  4CDF C;  2ZEN A;  1ENC A;  3H3V H;  3NQI A;  5C3X A;  1QB5 D;  3ULL A;  3NE7 A;  3H91 A;  3V96 A;  4C7H A;  2KJX A;  4OC1 A;  3GO5 A;  4OWX B;  4XYQ A;  3GIU A;  3TT2 A;  3VYS A;  1IXR A;  2K5D A;  2EYO A;  1V0C A;  1F2Z A;  1N9W A;  4LUO A;  4P73 A;  3A8I E;  3FEE A;  3NE5 B;  5M5Y B;  5M5W H;  2HHH L;  1I3Q H;  3NBH B;  3FVQ A;  4YHH L;  2QCP X;  5GAG C;  3R3O A;  4L8J A;  2EYL A;  1SFO H;  1VQF A;  4ID6 A;  3CPW A;  3KL9 A;  1ESF A;  1UFH A;  2V8G A;  3GTG H;  4WRD A;  3PF5 A;  3LWU A;  5COY A;  4RAU C;  4GKK L;  4FP5 D;  4J1M A;  2Z3K A;  4NSQ A;  4IOC A;  2XVS A;  2B63 G;  1HR0 L;  4N9P A;  4R4Q A;  4K2L A;  4NB3 A;  5GAE C;  1HNX Q;  3LNN A;  4DR7 Q;  2VZY A;  4P72 A;  3HOU H;  2IT1 A;  5AG5 A;  2H5X A;  3WT4 A;  3NEM A;  2ANP A;  3HGB A;  1XMO L;  3CCJ A;  3CP0 A;  4P2C B;  3TDQ A;  2K14 A;  1E3P A;  4CJ0 B;  5E4X A;  2NVX B;  4DFA A;  2PR1 A;  3S2D H;  1XWE A;  1XXG A;  4A30 A;  1U0L A;  5C4X G;  3Q0A A;  2XNA C;  3PUW A;  4HCS A;  3SE0 A;  1D5M C;  1FNU A;  3A54 A;  4BA2 I;  4B5P B;  4B10 A;  3JTK A;  1UE6 A;  1YSJ A;  3ZZI A;  2OQK A;  5E4W C;  4X65 L;  4CAV A;  4H44 C;  3D2P A;  1I3Q B;  3L2P A;  3ER0 A;  2CNS A;  1ET9 A;  3UY5 A;  1CHQ D;  4KKU A;  1VQJ A;  3PCO B;  1QZG A;  3AFQ A;  1YNJ C;  1SYC A;  2KCN A;  5EPL A;  1PV4 A;  2FT0 A;  4A3K G;  1CPS A;  2PJ8 A;  1D2B A;  1T5X D;  3RZD B;  4C2X A;  1O7Y A;  3X3M A;  1SEB D;  2BH2 A;  4K0K L;  3D7H A;  4R7M A;  1M4I A;  4C7I A;  1Q2D A;  3G48 A;  1Y8N B;  2HIV A;  5F09 A;  5IB9 A;  4PNY A;  1C0A A;  1QMU A;  1KLG D;  4DR2 L;  5I9O A;  1V1Q A;  3D66 A;  1SMY D;  4LNQ A;  5LL6 S;  1WCM B;  2E2H B;  5F49 A;  3PIO A;  3IGR A;  1VQD A;  1PTO H;  2R7H A;  4QC6 A;  2G9D A;  3C2P A;  3TO9 A;  1PRT D;  5D3I B;  2PMZ B;  3Q22 A;  5BR8 L;  4B3T Q;  1BLL E;  2CXA A;  4X3K A;  3HOV G;  3E3X A;  3F1Z A;  4KS9 A;  3S15 H;  2Z6K A;  3NH8 A;  4OID A;  2NVQ H;  4GZY C;  5IYB G;  2CF4 A;  1ILQ A;  4MFZ A;  3RZA A;  2K75 A;  2E74 C;  2KHJ A;  3CRL C;  1PH8 A;  1JOO A;  1LT6 D;  2Z0S A;  1A3U A;  1V8Q A;  4PG3 A;  4ZK9 B;  4C3J H;  2C9O A;  3OTO Q;  3VR3 A;  4K0K Q;  5FJ8 H;  5JJL A;  3X3N A;  3VYU A;  3T13 A;  4DNT B;  4GOP C;  2C6P A;  2YU9 H;  3VR4 A;  1VDZ A;  5J22 A;  2A8V A;  4HJ5 A;  3I4O A;  2R92 H;  1CPX A;  1TWH B;  5CGK A;  4LX9 A;  1BO0 A;  1YJW A;  4RA8 A;  1XNR L;  2EBJ A;  2HQY A;  2SOB A;  1CX8 A;  3DM3 A;  4K8I A;  2YNC C;  3SHL A;  1KZF A;  2Z3M A;  1CTM A;  5C44 H;  2I3C A;  2PQA B;  2EVB A;  3L7Z C;  4NEX A;  3GTL H;  3RR5 A;  4KD4 A;  4FF3 A;  4DAP A;  1STG A;  2I07 B;  2HT1 A;  3KHX A;  2JQO A;  1IKM A;  4K2K A;  2BL1 A;  3CW2 C;  3OIQ A;  3TME A;  4OO1 G;  2FJ2 A;  2HV2 A;  2PE3 A;  2Y0S G;  3F8T A;  2NYQ A;  2CKZ B;  4U5Y A;  2F0T A;  3HS0 C;  1ELM P;  3ULP A;  1VQK A;  4F8M A;  4R6T A;  4F88 A;  1QQ9 A;  2R7F A;  1TXY A;  4IQZ A;  3S1R B;  4XQJ A;  1NCV A;  1TWC H;  1SSO A;  2K03 A;  1GO3 E;  3QO2 A;  4J15 A;  4G57 A;  3S24 A;  4DAV A;  4JI0 L;  4PXB A;  3I4N B;  3J81 E;  4OAD A;  1Q46 A;  3MEH A;  1Y14 B;  1G6P A;  4F9U A;  4LMQ D;  3TOA A;  1Q2C A;  4HNX B;  1IGB A;  1IOI A;  1YJN A;  3H4Q A;  4OON A;  4R1J A;  3IC1 A;  4BXX H;  1OXT A;  2IL8 A;  4IUU A;  4DV5 Q;  3BS1 A;  3LX0 A;  1HQR D;  3SJE A;  4ZKC B;  3KBG A;  4JI2 Q;  2MHV A;  3A56 A;  1OXU A;  4F8Z A;  3NTI A;  1TY2 A;  3I8Z A;  1SMX A;  2B2T C;  4EWT A;  2CW0 D;  3SXN A;  5FO7 B;  4RGN A;  3U9S A;  5LHY 1;  1Y0Y A;  1YNX A;  1EYG A;  2GVA A;  2R93 H;  1KDC A;  2A69 C;  4N8X 1;  1R3N A;  4C2Y A;  2Q04 A;  4GN4 B;  1SN8 A;  2QA4 A;  3NFZ A;  2ID0 A;  5HGT A;  3IL8 A;  1XBU A;  3K0Y A;  4QF4 A;  5KYI A;  1O80 A;  3T53 B;  1PYB A;  5KIX A;  4A3I B;  3RYO A;  2EUI A;  1DCZ A;  2R92 G;  2I5L X;  3IWW A;  1PHJ A;  2ENB A;  4F87 A;  1EQQ A;  2FXF A;  4JI4 Q;  1M4D A;  1SNP A;  1YBY A;  3SK4 A;  4C3I B;  4HNW B;  2F4I A;  2EJG C;  3OYY A;  5HUR A;  4B3R Q;  5EKI A;  2ZPA A;  1B3A A;  1VQP A;  2IPK D;  2F0S A;  5JM6 A;  2IX3 A;  3EFX D;  2NUC A;  2A74 C;  4C3J B;  4BY7 G;  4KK7 A;  4DPG A;  4JWP A;  4LF8 Q;  3DUZ A;  1I4H A;  3KOJ A;  3RZO B;  4UF4 A;  1I4Q A;  2DNE A;  5IYD H;  4JXQ A;  3VAR A;  5I9P A;  4DV4 Q;  2F0J A;  5KTC A;  2NN6 H;  2O2L D;  1ARL A;  2F0K A;  3TO6 A;  3VH9 A;  5IWA L;  2F3W A;  3H8G A;  1G2S A;  2RHS B;  3UI2 A;  1LTR D;  1WCM H;  3URY A;  4JV5 L;  3UDX A;  3BZK A;  4DV0 Q;  5J39 A;  2OWO A;  4MHN A;  4BBS B;  2JN4 A;  4DYO A;  1SYB A;  2JEB I;  2JBK A;  3I56 A;  1A62 A;  3WC5 A;  3UDG A;  1AW7 A;  2VZZ A;  5BN4 A;  1GUT A;  1BQQ T;  2Q0Y A;  1L0W A;  2Z6B A;  4P44 A;  1WWZ A;  2R93 G;  3FPU B;  2AFW A;  4YWK A;  2PVV A;  4I65 A;  5FKA C;  3J7A F;  3P20 A;  4MIU A;  2ZM6 L;  3GYA A;  1NR4 A;  1DD2 A;  1HFG A;  2KVM A;  3NEL A;  1QSO A;  3VYT A;  1ZEQ X;  3DMU A;  2RHQ B;  1CT1 D;  4M6I A;  4B14 A;  5H86 A;  4QVT A;  1JQG A;  2A6E D;  1TWH H;  2NB0 A;  3IO1 A;  3K57 A;  4ZI6 A;  5FLM H;  1G91 A;  4FD5 A;  4A3D H;  3JUW A;  4IK2 A;  7CPA A;  4H13 C;  1D1I A;  3A9L A;  3GTJ B;  1STA A;  2HUG A;  3ICE A;  4AVB A;  4MHP A;  1SE3 A;  4HMI A;  3F2B A;  1TS4 A;  3H8F A;  5GAD C;  4AYB B;  3PQI A;  2GN5 A;  3TN2 A;  2EYJ A;  5TSS A;  2PO4 A;  1HUN A;  4GNX B;  1I6H B;  4CYO A;  3SVM A;  4NCZ A;  4DUZ L;  2OTL A;  1B70 B;  4C3H G;  3T1H L;  4QBJ A;  2RSN A;  3M4O B;  1G2T A;  4M3S A;  4IFD I;  4KTA A;  4JI0 Q;  1TXR A;  1KQS A;  5KND A;  1LT5 D;  4CGP A;  1PYW D;  4X6A H;  1J6Q A;  3BI0 A;  1BR9 A;  3M85 A;  2UXC Q;  4RMF A;  2R93 B;  2NVX H;  2FSR A;  3RLO A;  1N32 Q;  5COR A;  1SNQ A;  3BG3 A;  2BE5 D;  3KJP A;  2Y0M A;  4OHJ A;  4B9X A;  4YCV A;  2DEA A;  2A68 D;  3OOC A;  4HSP A;  3TP5 A;  1M4L A;  2ABZ A;  2CQA A;  4DK1 A;  1Q81 C;  1SFO B;  5GRO A;  4BBS G;  3D7D A;  5EC4 A;  1J4J A;  3DLL A;  3CU7 A;  1M4V A;  2SNM A;  2B8G A;  4Y49 B;  1F2P A;  1F2O A;  2EIF A;  1BCP C;  1H9K A;  3D67 A;  4JC0 A;  1LTT D;  3HG9 A;  5FOB B;  4OX9 L;  3R1K A;  5G20 A;  1TS2 A;  1ASY A;  2Q7S A;  2B2W C;  4Q38 A;  4C3J G;  2MFI A;  5LMN W;  1YJ9 A;  3K0X A;  3GTK B;  3WDN A;  5J1Q A;  2RF4 A;  3MXP A;  5EKK A;  3GLJ A;  2Q8I B;  3FRM A;  1CM9 A;  2K28 A;  1VF7 A;  1X3P A;  4GN5 A;  1YIJ A;  1Z4R A;  3NE8 A;  5K36 G;  2L5T A;  1MJC A;  4O1N A;  1LYL A;  2K1B A;  3NWT A;  1HNZ Q;  1LAP A;  2RA4 A;  1XOV A;  2LXJ A;  3KQX A;  1GXD C;  1CFM A;  4X66 L;  1JQY D;  2MNA A;  2BCO A;  1GUS A;  2R92 B;  4QJF A;  2MO1 A;  4B3M L;  2HD3 A;  1ZYR D;  3EVQ A;  4LFB L;  4ZX8 A;  4JI2 L;  2IL4 A;  5D14 A;  3OHX C;  4PQA A;  2N88 A;  5JOB A;  4XQN A;  4CHT B;  1UWV A;  3TQY A;  3D4R A;  3PFE A;  1R43 A;  2BSW A;  1TWF B;  5D8N A;  2VI7 A;  2WB1 B;  1F9Q A;  1TQO A;  1TKF A;  5C3E B;  4RGM A;  2CNT A;  1ZYR C;  2JA8 B;  1MJ9 A;  2PRQ A;  2I5H A;  2R61 A;  1VGY A;  1PTO D;  4R3K A;  4JI7 Q;  4RI1 A;  2F1M A;  3FMC A;  4OO1 I;  2PZU A;  2N55 A;  3GTK H;  3SJG A;  4RS2 A;  2J9A A;  3PBE A;  4L5T A;  1SRU A;  1ROD A;  4MHD A;  4PK2 A;  1L0Y B;  4ZCK A;  1B9N A;  1Z7T A;  3J7Y W;  3TRZ A;  1ET6 A;  5AJ3 Q;  3QOJ A;  1NSA A;  5G22 A;  4A94 A;  4Y49 C;  2AQ3 B;  1OXV A;  1IBK L;  2ATR A;  1O7I A;  5CV5 A;  3I4N G;  2BUE A;  1HCZ A;  1YVK A;  4QUS A;  3D3R A;  3M4P A;  4MBU A;  1BVS A;  8CPA A;  6CPA A;  3GKR A;  4LQG A;  4CKC A;  2FVG A;  3TZU A;  4X3R A;  1QZH A;  4A37 A;  3M3Y H;  2FCK A;  4X62 Q;  4A3M H;  3S14 H;  4IFD G;  3SXH A;  1HQM C;  3FB3 A;  1S60 A;  5LMU Q;  1TF8 A;  3OWE B;  1I4X A;  2MO0 A;  1A63 A;  1RIP A;  1GJX A;  1QSM A;  4FWU A;  4P71 A;  4GLX A;  3I4M G;  3PBB A;  1VQ9 A;  1KTK A;  2X6G A;  3FF3 A;  1CQF A;  2P6G A;  3KJO A;  1PH5 A;  3S9L A;  4M1U B;  3PIP 3;  2PQ8 A;  2KEE A;  1S7L A;  4K30 A;  4FBE A;  4APV A;  4KD3 A;  2A6E C;  1LTL A;  2DN8 A;  3ERO A;  4GNX C;  1FT7 A;  3I73 A;  4FUU A;  2E76 C;  5BWA B;  2GLJ A;  1EY8 A;  3FHW A;  4NGM A;  3TEH B;  4A93 G;  2E2I B;  4OC5 A;  2FHT A;  3I90 A;  4KHP Q;  1QIL A;  2PJ5 A;  4YY3 L;  3QAH A;  3DWA A;  3SK6 A;  1X10 A;  2RCN A;  2E2I H;  3LOD A;  4TVA B;  1QSR A;  2HCI A;  3DM1 A;  4O42 A;  5ISR A;  4MFK A;  1SR3 A;  1VS0 A;  1X32 A;  2PYK A;  3K9T A;  3NP8 A;  2FE7 A;  2JEW A;  3OW2 A;  2JEV A;  4QB9 A;  3BDC A;  2F0W A;  2EYF A;  4RWS C;  2VUM G;  4PZ7 A;  5FLX E;  3IJ3 A;  3FPP A;  4OC2 A;  3KF8 A;  4QUC A;  5G1Z A;  2XWJ B;  2Q4V A;  4DR6 L;  4HID A;  2OZU A;  1EL0 A;  1C9O A;  1E2Z A;  4JXR A;  4R4T A;  1LFW A;  5IGB A;  5H84 A;  5ELY A;  2DJG C;  3L2N A;  4JG2 A;  4OIK A;  1SNO A;  1QWY A;  2QKI C;  1O7Z A;  4B3M Q;  4HIO A;  1N32 L;  3RLF A;  2N8N A;  4CYP A;  1K0S A;  3G71 A;  2J8R A;  2HDM A;  4IPC A;  2H1E A;  2E2J B;  1Y8O B;  2D2C C;  3KGQ A;  2VQY A;  4DV7 L;  3S1M B;  4K3N A;  1PA6 A;  5EQ0 A;  4DGZ A;  1VHS A;  3J7Z C;  4L63 B;  1LAM A;  4DV3 Q;  4A3K B;  4E0A A;  2CCZ A;  1B3Q A;  4DR7 L;  2WAQ E;  4CGL A;  1RO5 A;  2NTS A;  1KWM A;  2EYP A;  1MHW C;  4IUQ A;  1GHJ A;  2REF A;  2PCU A;  4U68 A;  2V1C C;  5JJK A;  5LYD A;  1PDQ A;  1K8A C;  4YY3 Q;  4FO2 A;  1FD7 D;  4C3H H;  2JA9 A;  3PGP A;  3W6X A;  4ONW A;  2EXZ A;  4JI3 Q;  3B3W A;  1CSP A;  3SHP A;  4PMB A;  4AH6 A;  4F7X A;  1BO4 A;  1HUM A;  1EQT A;  1P0H A;  1H9M A;  3KK7 A;  4CKB A;  1B9M A;  1SQH A;  3CAM A;  5IP9 G;  3A7A B;  3O13 A;  4HJ8 A;  1GUW A;  2ODF A;  2XEG A;  1DJR D;  4C3I H;  2L0C A;  4LF8 L;  2AFM A;  1VQ6 A;  4JJX A;  2EWB A;  2JA6 B;  1K9M C;  4OX9 Q;  3F2C A;  3I91 A;  5K36 H;  4DF7 A;  1HDU A;  1RDP D;  1GOZ A;  3J81 i;  3HLP A;  5EJW A;  2RCF A;  2Q7B A;  2Z4H A;  1CA5 A;  1X56 A;  5ELF A;  1K8O A;  1QOH A;  1Y0R A;  3UE0 A;  3EY5 A;  4OIJ A;  3C1E A;  2JA5 G;  5CBM A;  4RN7 A;  1M8A A;  4XPD C;  1SLJ A;  3CD6 A;  1Q8K A;  3KF8 B;  1PH4 A;  5IT9 E;  4PPZ A;  1I94 Q;  5IIF A;  3P1H A;  1QNU A;  4JI5 L;  2LSS A;  1LLR D;  2F0L A;  1YZ6 A;  1MBY A;  4Y7N H;  1SYF A;  1UWY A;  1LTA D;  4MFQ A;  3W2D A;  4IUN A;  4FXK C;  3Q24 A;  1KAW A;  3BI1 A;  2RB7 A;  4GLV B;  1HH2 P;  1FNV A;  1Z4E A;  4JI7 L;  3G8W A;  4HCE A;  2POK A;  4MTK A;  2I00 A;  2R7Z G;  4EQN A;  2J7Z A;  4KJO A;  1LUZ A;  2BOA A;  2FS5 A;  4ILW A;  4GKK Q;  4LJZ C;  3QJY A;  2JE6 I;  4AYB G;  3PP9 A;  2B58 A;  3R96 A;  2MGS A;  1CM0 A;  3V7Z A;  1HNZ L;  2B2W A;  2REE A;  4OIW A;  4FDB A;  5ELC A;  5C5L A;  5T1G A;  2Q4Y A;  4KMU C;  1TWA H;  1OTC A;  3SEB A;  2AE6 A;  3NH4 A;  1ZKO A;  4BY7 H;  4MI4 A;  3CDX A;  3E5S A;  1S5C D;  4DR5 L;  2PZW A;  1YNJ D;  2Z0Z A;  1TR5 A;  2ZW6 A;  3Q6S A;  3Q23 A;  3S2D B;  1EY0 A;  4LFC Q;  2D4O A;  4LUA A;  1S3O A;  2ZEG A;  3CZX A;  2PI2 E;  3PO2 B;  2EO8 A;  3CPX A;  1B7Y B;  4L89 A;  3PB6 X;  4CDC C;  3BDO A;  4MMO A;  4LF5 Q;  1B50 A;  1IBM L;  1HHV A;  4WJW A;  4GM5 A;  3GTQ B;  2UXB L;  4DKA C;  2B3V A;  5A2Q L;  2CQO A;  4HMJ A;  5C4J H;  3K2K A;  3M9B A;  2QIL A;  3R9E A;  3RBU A;  1PRT C;  3NXW A;  3G6J B;  4UP8 A;  4G7H C;  1ZG7 A;  5KTA A;  3J80 L;  1HDQ A;  2K5Q A;  3D7G A;  5C3E G;  5KEE A;  3ISZ A;  2BDN A;  2YTY A;  1WD1 A;  3U9O A;  2D62 A;  5BN3 A;  3H3V C;  1HTP A;  2G3T A;  1XMT A;  2WB1 G;  4UCP A;  4A31 A;  4X66 Q;  4CJ1 B;  5JJZ A;  1PTO F;  5LRK A;  4IPH A;  1TKW B;  3LD2 A;  2MUY A;  1J9O A;  4ZY2 A;  1CKN B;  4BY7 B;  4TNU A;  2FL4 A;  1Y1W H;  3K59 A;  3B3T A;  3DHQ A;  4R3L A;  4B6Z A;  1ELL P;  4ZYQ A;  3KR4 A;  3CCM A;  1FY7 A;  3NBH A;  1XE4 A;  5CNP A;  2IJZ A;  3BYY B;  4B9W A;  1UE5 A;  1SYG A;  3J81 L;  4UP9 A;  4LK1 C;  3CQZ B;  1WVL A;  4L5S A;  3EO4 A;  5IYC H;  3EA6 A;  1VQA A;  3AFP A;  2FXQ A;  4JVZ A;  4HAE A;  1SE4 A;  5JVG 3;  3PUV A;  1IB1 E;  2O4H A;  4A32 A;  5EKL A;  1VQ5 A;  1CHP D;  4N9T A;  2B8F A;  2K5V A;  1MJA A;  1JWU D;  1Y1V B;  3VWE A;  1FL0 A;  4BWG B;  4CPA A;  4UA3 A;  5CV9 A;  3JAM i;  3T90 A;  1M90 C;  5IT9 c;  4ME5 A;  1LOK A;  3RN5 A;  5ELE A;  1MK4 A;  4H6Z A;  2G9H D;  3TO7 A;  1PCA A;  1X3G A;  1TS3 A;  3TP8 A;  1LV9 A;  5HGQ A;  3FJU A;  4TKO B;  2ICI A;  3L3O C;  4QIW E;  1XNQ L;  5KYL A;  1DOK A;  1EY4 A;  2DPT A;  3VA7 A;  3K7U C;  1SE2 A;  3H09 A;  2F4V L;  1UEA B;  3AU7 A;  2EOT A;  1YME A;  1DXM A;  3DEO A;  4NXN L;  2KQ3 A;  1YGH A;  1XPR A;  1YNN D;  2Z3N A;  4R9W A;  5BR8 Q;  4UIB A;  4GKJ Q;  2QW7 A;  2AWN A;  3CRK C;  3KUP A;  4A76 A;  2KEC A;  3JAM c;  4A3L H;  2IMO A;  1G29 1;  3HOY H;  2CIJ A;  5D65 A;  1AZP A;  1MI2 A;  4C1N I;  4X5K A;  2M00 A;  1JE5 A;  3EBE A;  2OEO A;  1BNZ A;  4R4C A;  4C3H B;  4YWM A;  4UPA A;  2N78 A;  2JA6 G;  2OB0 A;  1YNN C;  2RKS A;  3KYH C;  4HN7 A;  3DWP A;  1A2U A;  4NGQ A;  2M9V A;  3IWE A;  1AFP A;  1CP6 A;  4FF2 A;  2P0W A;  4K5W A;  4RKL A;  2L4N A;  1Y8P B;  1ZLH A;  5K5P A;  4TSS A;  3NHH A;  5IGC A;  4O23 A;  1RTO A;  2EY6 A;  4NXN Q;  4C68 A;  4GOP B;  3HOU B;  1XPO A;  1VMC A;  3I3G A;  5LL6 X;  1K28 A;  2EPB A;  1TWG H;  3HFZ B;  4KN4 C;  4N8F A;  1S7N A;  4UHV A;  2OR4 A;  1EIF A;  1F77 A;  2NVY H;  2XGT A;  4CGY B;  4OO1 H;  1YI2 A;  1AYE A;  2SEB D;  3DDD A;  4MFL A;  2F5I A;  2PI2 A;  1RKN A;  4GXH A;  2D4P A;  4NFR A;  1HZB A;  4LWC A;  2C5C A;  1JWS D;  3PO2 H;  4M6H A;  5CPA A;  2OZH A;  3BZC A;  3MN8 A;  1G51 A;  2EK8 A;  2KHS A;  1RJT A;  2PJ1 A;  4H89 A;  2OF1 A;  2UU9 L;  4B3S Q;  4U9Z A;  2E5L Q;  2IWH A;  4CAX A;  3W5O A;  3OTO L;  3FX6 A;  1TS5 A;  4JBW A;  5IOC A;  4IUR A;  4CBV A;  4DV2 Q;  1VQM A;  4JI1 Q;  2C1C A;  2ZT9 C;  5C0X J;  3IFT A;  3B6Y A;  3P2F A;  4ZRZ A;  1N36 Q;  2J8M A;  2PQA A;  3JAM E;  4P74 A;  2GRE A;  3P7J A;  2B5G A;  3EXN A;  3PFO A;  1NMT A;  4CRZ B;  2OQ0 A;  1WI5 A;  4JI1 L;  1YHB A;  5JH9 A;  1MIU A;  2B4D B;  4CAW A;  2B4B A;  5GQO A;  2RQX A;  1JOQ A;  1Y1W B;  2ZEM A;  1M1D A;  3T51 B;  3K7A B;  3JAM L;  4XPK A;  3VR2 A;  1Y69 U;  1E2W A;  2XIW A;  2OOT A;  2ZJP A;  3BVM A;  1AE3 A;  3S17 B;  2PJ6 A;  5JPH A;  1WTH A;  4G4K A;  4A3G H;  4YGO A;  5C6A A;  4XNH B;  4C3I G;  4LF5 L;  2K52 A;  1QVC A;  1IBM Q;  3TTH A;  1SE8 A;  4C1N K;  3W6S A;  1PMR A;  3MXU A;  2OT2 A;  4MHY A;  1X3Q A;  5G21 A;  4POF A;  1DE4 C;  2E2H H;  3HOZ B;  1AZQ A;  2UUA Q;  1TWC B;  4BMH A;  4F9V A;  1JR0 D;  1IW7 D;  1F9R A;  4NXY A;  4A3E H;  2EK9 A;  3CCL A;  3M4Y A;  3GTQ H;  3DSB A;  4L8A A;  4HED A;  4U9Y A;  3WOF A;  3TP7 A;  5LYL A;  1U5K A;  4PQX A;  2Q8T A;  1ZLI A;  3RNZ A;  3V38 A;  5A28 A;  4PSW A;  2B2V C;  2A5H A;  3PV0 A;  5IT9 L;  2EJM A;  4ZY0 A;  4TRD A;  3A7L A;  4KSF A;  4ORF A;  4YFJ A;  2WPW A;  3DR6 A;  3H5Z A;  5ELO A;  4CGN A;  1B6B A;  5F2D A;  2ALY B;  4NGR A;  1F9S A;  1AP0 A;  3SR1 A;  2GAN A;  1HJP A;  4LAA A;  2HDL A;  2OCE A;  2A6H C;  2QDL A;  1IYK A;  1XPU A;  5EGT A;  5CBE E;  5H1S E;  2A68 C;  2OTJ A;  2EY1 A;  4OME A;  4DV0 L;  2VB2 X;  4KLW A;  2X6L A;  1UAP A;  3NUC A;  1ASZ A;  1S3Z A;  3BLN A;  4IPG A;  3BHX A;  2BEI A;  1WTR A;  5E1F A;  5THW A;  1WTX A;  2KCC A;  1C8C A;  2A6H D;  1GUN A;  4MRI A;  1STE A;  1Z8W A;  4P4I A;  1QST A;  3D4D A;  3CXS A;  5LMN L;  4AB7 A;  1MKH A;  1Y1V H;  5C3W A;  5JEA H;  4CS0 B;  4JV5 Q;  1X65 A;  1N34 L;  5J1Z A;  3S2H B;  3NWS A;  1YLE A;  2UUB Q;  1S72 A;  3S9N A;  1AMP A;  3NTH A;  1HR0 W;  1YR0 A;  4X2T A;  4A93 H;  2PQE A;  3I72 A;  2PJ0 A;  4QCL A;  3HKZ E;  3JC6 6;  3TC8 A;  1SJE D;  2ZEO A;  4P4B A;  4UBR A;  4KOX A;  1IIC A;  3V8I A;  1S7K A;  1X9N A;  4BA1 I;  1EYC A;  2PC1 A;  2QIR A;  4FD6 A;  3S6H A;  4DXG A;  4PZ8 A;  1U4P A;  5JAV A;  2KCW A;  1A3V A;  3IRB A;  5IP7 H;  4A3G G;  1EFW A;  5HVH A;  3NPP A;  2M2L A;  5AGE A;  4ZAI A;  1EQR A;  3ULJ A;  1XYI A;  4IUP A;  4DUY L;  4R8F A;  5HY6 A;  4B3T L;  3KAS A;  3K7A H;  3HOZ H;  5LRJ A;  1I6V C;  1N8R C;  1PFM A;  5AG4 A;  2OH1 A;  4MNO A;  2F0O A;  4DUY Q;  4JPB W;  3PUX A;  4X3U A;  1GUO A;  1II3 A;  1CUK A;  3RD4 A;  5IGF A;  4KLK A;  5I6Y A;  1XEB A;  3I4N H;  1X3E A;  5M5W B;  4G1P A;  4YRH A;  3GY9 A;  3KLR A;  4K14 A;  5I6W A;  3M4Q A;  4UCM A;  2R7D A;  4JYA Q;  4AQY L;  1FGU A;  3MTS A;  1JB7 A;  2VXW A;  4B3R L;  4G7O C;  5ISV A;  1Q7Y C;  1XMQ L;  4A3C G;  3NTK A;  3PO2 G;  2J4X A;  2JSO A;  2XSC A;  1EOV A;  2G0B A;  1QNK A;  4KOS A;  1JJ2 A;  2NZH A;  3E6Z X;  4DNR B;  1HZA A;  4KY6 A;  1J8I A;  1MD2 D;  3F8K A;  4NPS A;  3A5Z B;  1NE3 A;  1ON0 A;  4MCQ A;  3CME A;  3R95 A;  4LF4 Q;  4LF9 L;  1SXT A;  2AKW B;  3CPF A;  5ELB A;  4DR1 L;  4QGU A;  3UDI A;  4ZUI A;  4LF6 Q;  2BOS A;  3V2T A;  5IV0 A;  2O5I C;  5JEA G;  3KQZ A;  1LTG D;  4ZBG A;  4CAE A;  1LT4 D;  4KHZ A;  3I4M H;  3R9G A;  5JVH 3;  1PTO B;  2PMZ E;  5L37 A;  3D8G A;  5HXD A;  1JB3 A;  1J5E L;  1DOM A;  3MC0 B;  4JCV E;  1DZ1 A;  4DAY A;  1I50 H;  3D6C A;  4IFD H;  5C5M A;  4A3M G;  5D3D A;  1NJI C;  5AG7 A;  2CWP A;  4U67 3;  4UFX A;  1JWM D;  1PUA A;  4MFP A;  4ZY1 A;  2HUZ A;  2ZXP A;  2ZEL A;  4FXG C;  3OSO A;  1CKO A;  1LO5 D;  4H0L C;  5KRU A;  1HRJ A;  2PIY A;  4IUT A;  3FBU A;  4JYA L;  2K50 A;  5HH1 A;  1DM0 B;  1UUP A;  2F0F A;  3NQT A;  5HMN A;  1LTB D;  1RXT A;  1UE7 A;  5M5X B;  4UY8 C;  4KUB A;  4P4E A;  1EIH A;  4UIA A;  3SJF A;  1YHQ A;  1Q2Y A;  3SI2 A;  2WII B;  2I0Q A;  5JJI A;  1KNE A;  3HOV B;  1L1O B;  2NZ1 D;  4JOI C;  5JQ4 A;  1Y7R A;  1CZG A;  2LS0 1;  4OGQ C;  4BBS H;  4MN3 A;  1NSN S;  1BCP F;  5AJ3 L;  2K7V A;  4KZT A;  4HPS A;  3ZYY X;  1SJH D;  1WCM G;  5CMD A;  3FED A;  3R8B A;  2AFS A;  3GB0 A;  4DA2 A;  2Z11 A;  1STH A;  3CQZ H;  3AQQ A;  2PNH A;  1GHK A;  3FIX A;  3H0G G;  1YK3 A;  4QB4 A;  3CCV A;  3MGD A;  4ZQ3 A;  1XNR Q;  2NN6 I;  2Q8R E;  4KSA A;  3L0O A;  1KNA A;  1YLO A;  3IU1 A;  3W3A A;  5C4J B;  3QG1 A;  4PMW A;  1S7F A;  1SMY C;  3D4W A;  5CV8 A;  2PCF B;  2AFX A;  3RMH A;  4KKS A;  5DWN A;  1BUV T;  2EVN A;  1GHE A;  4YIJ A;  3AMU A;  4LF7 Q;  4KVX A;  1P4N A;  2IX0 A;  3S1M H;  1Y1W G;  2EJF C;  1KRT A;  3PIO 3;  4BBR G;  1PZI D;  2EQS A;  4A3L G;  3NH5 A;  2K6A A;  4MHZ A;  1CKN A;  5C4Z A;  4UEE A;  3BVZ A;  4JOI A;  4KHP L;  5IP7 G;  2ZW5 A;  2E5L L;  3PUZ A;  4JI6 L;  1X54 A;  4K5X A;  3KDF A;  1E2V A;  3TZD A;  3M4O H;  2EZV A;  3HOW H;  4UAI A;  1WTV A;  2JA7 H;  4OP4 A;  4A3K H;  1Z9U A;  2EYH A;  2DGY A;  4R8I A;  1IL2 A;  3S16 H;  4DV2 L;  3FEC A;  1D8L A;  4HJ7 A;  2JP1 A;  4AVC A;  4H02 A;  1FJG Q;  1S4Z A;  4KY7 A;  2F4V Q;  3WC6 A;  3S16 B;  1HFN A;  1P16 A;  2C6C A;  1IYU A;  5IOD A;  3MFG A;  1IKL A;  1AN8 A;  1JOK A;  1U9R A;  2VUM B;  2Q4Z A;  2BH8 A;  2KBN A;  2F0U A;  3GTM H;  2A19 A;  2YYZ A;  3D3S A;  3QIA A;  1F2M A;  2K32 A;  4XTC S;  3EQL C;  1HNW Q;  5K8O A;  3S1N B;  2AQ2 B;  4R8N A;  2ASB A;  3TE4 A;  3CPA A;  3H3V I;  1PH6 A;  1ARM A;  3K5N A;  4RGT A;  1N34 Q; 
#chains in the Genus database with same CATH homology
 1WD0 A;  4EGV A;  4A3M B;  2NVT B;  1EU4 A;  3GTL B;  2RFH A;  2NVY B;  1ICW A;  3KLS A;  4C56 C;  1EEF D;  4Q5V A;  2IX1 A;  2AQ1 B;  3WOE A;  4RCO A;  4WOR A;  3TX8 A;  4HTH A;  4H2K A;  4WJB A;  4QMG A;  4DUK A;  1B44 D;  1HTL D;  1L0X B;  2VB3 X;  3MWY W;  3P75 A;  3OIP A;  4QIW B;  5CV4 A;  3EJI A;  1LTS D;  2CHB D;  5KNB A;  1O7L A;  2WZN A;  5HVG A;  2NWG A;  4HR7 B;  1DTD A;  3CHB D;  3FRP B;  3PB7 X;  5JPM C;  3KZW A;  4FF1 A;  4W9Y A;  4NJR A;  1V1O A;  2F0N A;  3T8W A;  2J0T D;  2B2T A;  3A8J E;  2NYZ D;  2D9U A;  3MXG A;  4IN3 A;  5CBA E;  5KGU A;  1V43 A;  3B3V A;  4IAL A;  2AFU A;  4BBR B;  1IL8 A;  4H7B A;  1CQV A;  1ONL A;  4XQQ A;  4Q0F A;  1JC7 A;  2RBM A;  1CBX A;  1F9P A;  3VA5 A;  2LY7 A;  2JYO A;  2HC9 A;  4XT1 B;  1G8Z D;  2XN9 C;  5JGF A;  1Z47 A;  4Q7A A;  3H6M A;  3KLS X;  1F2Y A;  4FNF A;  1QE6 A;  2DY7 A;  2O4X A;  3I70 A;  4WFN 3;  3H0G B;  4WWV A;  2AUK A;  3N52 A;  2K33 A;  2VNU D;  3NBI A;  1EY7 A;  4FAI A;  2E75 C;  2EE1 A;  1XRY A;  1Q7L A;  1JE4 A;  3GTP B;  4V19 0;  3GQB A;  3MXN A;  1H9R A;  2IW3 A;  2L11 A;  2SDF A;  2E2D C;  1ZXT A;  1SND A;  3C1F A;  1G6Z A;  2WP8 J;  1BOS A;  5KNC A;  3OW7 A;  2FFK B;  4XYO A;  4YWY A;  2QDB A;  1EQV A;  3SK8 A;  1EWH A;  4IZ8 A;  4K8J A;  1BDO A;  1EY5 A;  3K5O A;  1JOR A;  1STN A;  3GTO B;  2AUJ D;  4AXV A;  1IHZ A;  4V0B A;  5JEA J;  3DXJ C;  1MSG A;  2RSO A;  1H8L A;  3DGV A;  1S5D D;  3B3C A;  4NGT A;  5C4H A;  1RHP A;  2AWO A;  5FO9 B;  4R76 A;  2RDH A;  4A3J B;  2B2V A;  2F0G A;  5FO8 B;  5EPK A;  1MSH A;  2PJC A;  3FVL A;  3J7A V;  3TBI B;  2JA7 B;  2ZEP A;  2V8H A;  2MPM A;  1TU2 B;  1KAA A;  3HEJ A;  1CG2 A;  1CI3 M;  3R2I A;  1SDF A;  3TSS A;  2F0D A;  4ZYS A;  2PJ3 A;  2V4D A;  1PFB A;  2JA5 B;  4YU9 A;  2YU9 B;  1EY9 A;  4P4F A;  3QWN A;  2WKD A;  4OL7 A;  3BVG A;  4I7Z C;  2K04 A;  4S3S A;  2ZOG A;  3LWE A;  3T56 B;  3IAY A;  4RCN A;  3T4A C;  1EY6 A;  1RCV D;  1CA6 A;  1RTN A;  3QOL A;  3GV3 A;  5BN5 A;  1CK1 A;  3VYR A;  3QNV A;  4FXD A;  3PB4 X;  3FH4 A;  2NBF A;  1C48 A;  3S15 B;  2ZXR A;  1S5B D;  2Z4I A;  2HB6 A;  5DM6 3;  1EFI D;  4OC0 A;  1EIG A;  1KAB A;  1WTP A;  3NSW A;  5I4M A;  4IFD J;  2ZEH A;  1H9J A;  2QF7 A;  3K58 A;  1RTQ A;  2CW0 C;  3LMS A;  1PZJ D;  1F57 A;  5DAU A;  2QEJ C;  1ZG8 A;  3ITP A;  3NK9 A;  4P6Y A;  2XEI A;  4A3D B;  1PLF A;  1KLU D;  1KDB A;  4J8Q A;  2F03 A;  3HOW B;  1MGS A;  1WTO A;  3DLJ A;  1PTO C;  5DS0 A;  1HEE A;  3ONA B;  2XRQ D;  2F0M A;  3I4L A;  3IKJ A;  2NSM A;  3GUX A;  1S5E D;  4QUF A;  2Y0S B;  4A93 B;  3S9M A;  4J6H A;  1QJO A;  3D7F A;  1T5E A;  1TWG B;  4L6T B;  1LT3 D;  3BZD B;  2Z1C A;  4OC3 A;  2B2U C;  3GTG B;  3DWQ A;  1D6E C;  1OO9 B;  4MXU A;  5FK9 C;  1ESR A;  2JXM B;  2QYV A;  4A39 A;  3D6W A;  4EQP A;  3HZX A;  4M8A A;  5C0X I;  3JRU A;  1BXT A;  4KJN A;  1Z6H A;  1TII D;  2JBJ A;  2A73 B;  2WAQ B;  2EY2 A;  1V1P B;  1GUG A;  5C0X G;  4X8I A;  1W6J A;  4X3S A;  1RF2 D;  4NGN A;  2EY5 A;  1HA5 A;  5AFW A;  1VMP A;  5G3L D;  1EEI D;  4ODG A;  5IGD A;  4KV6 A;  3KHZ A;  1Y7E A;  2GU2 A;  1DOL A;  1Q1B A;  1AEX A;  1R4Q B;  1BAV A;  1TY0 A;  1KDA A;  1CZW A;  4DXF A;  2KUM A;  3MHB A;  2BO9 A;  4EME A;  4KI0 A;  3OMG A;  2F0H A;  4B08 A;  1DON A;  2SNS A;  3I1U A;  3ND9 A;  2PJ9 A;  4NGP A;  5LRG A;  2PVW A;  1XTC D;  2B39 A;  3R2T A;  3C3L A;  1A6X A;  1FGB D;  2ZXO A;  2KOL A;  2RVL A;  3A55 A;  5FLX L;  1Z8L A;  3K6O A;  4BD9 A;  5JPN C;  2B2Y A;  2CVR A;  3S9W A;  4DJL A;  3L9A X;  3D4U A;  2XRS D;  4KN7 C;  5LYI A;  4FF4 A;  2I46 A;  3SK5 A;  3SDZ A;  4P4J A;  1Q3L A;  1WTQ A;  2RDG A;  4Z9C B;  2XWB B;  1EZ8 A;  3MA2 B;  3IIB A;  3PB9 X;  2PW5 A;  4NGS A;  1K83 B;  2FIN B;  1PZK D;  4CJ2 C;  2NN6 G;  4MCP A;  4ULL A;  1BPN A;  4A3B B;  2F8H A;  1XFO A;  2KA7 A;  3IEH A;  3GV6 A;  2F0E A;  4BS9 A;  2WKC A;  3ISX A;  5I4D A;  4UEF A;  4A3F B;  5CYU A;  2AFO A;  1WTW A;  3DEP A;  1EU3 A;  1TT2 A;  2CTC A;  3VR5 A;  1ML0 D;  1PFN A;  2A69 D;  2F0P A;  3FEW X;  5NUC A;  2PZT A;  1TWA B;  1EZ6 A;  3RAM A;  4RHS A;  3MVV A;  1A3T A;  2F0I A;  2IJ0 A;  3K5M A;  5LYF A;  2WYR A;  1SNM A;  1Q8I A;  3GD7 A;  4PXC A;  4IUV A;  5C44 B;  3MAQ A;  5I2Y A;  2EDG A;  4PXE A;  1JCK B;  4IAV A;  2NVQ B;  3S1Q B;  2EYM A;  3R93 A;  2PIZ A;  5G3L F;  3E0J A;  3H8E A;  1SYD A;  2FMC A;  4HSV A;  1U4M A;  4A38 A;  1BPM A;  2F3V A;  4NJQ A;  1D1K A;  1B2T A;  2V8V A;  4XT3 B;  4PMC A;  1I4G A;  4TQU S;  2PW7 A;  3HUV A;  2K01 A;  3PUY A;  2WIN B;  3TP6 A;  4PXD A;  3B35 A;  2D5D A;  3F2U A;  1YW6 A;  1TF9 A;  5M9O A;  4K6L A;  2F0Q A;  2PJ4 A;  5EPJ A;  3GP7 A;  2L9H A;  1HA6 A;  3SI0 A;  4P45 A;  5CR3 A;  1IW7 C;  4EQO A;  5A35 A;  3A8K E;  1A2T A;  3PRT A;  1UNS A;  4CKE A;  4ZLT F;  4G7Z C;  2Q43 A;  3D31 A;  4KSI A;  4RHR A;  1PXU A;  2GLF A;  1STY A;  1TVX A;  3OWF A;  1Q12 A;  2IQ6 A;  3KBX A;  2PJ2 A;  3OMC A;  5C0X H;  3J80 E;  1D5X C;  1JIC A;  2FMM A;  4UDU C;  5I2X A;  2DNC A;  2C6G A;  3HKZ B;  1D5Z C;  2KED A;  4KHV A;  4JYW A;  3CKI B;  2ZEE A;  2B2Y C;  2LMC B;  2ICE C;  1VF5 C;  1EE3 P;  3PO3 B;  1Z2L A;  2B63 B;  4JK1 C;  1FYC A;  4MHE A;  3PEI A;  1SBB B;  4EFD A;  3OPO A;  3G7L A;  4BY1 B;  1I4R A;  5ELD A;  3V05 A;  2MJ8 A;  2L1B A;  1VHE A;  1TKJ A;  2AFZ A;  1FNW A;  1ENA A;  4KKT A;  4RGO S;  3MFY A;  3B7I A;  3WAB A;  2HCC A;  2PPB C;  2JEA I;  1LAB A;  2ZOF A;  4NKL A;  1H9S A;  4JZ0 A;  1NR2 A;  1S5F D;  1EWC A;  4FVM A;  1OXX K;  4NW2 A;  4FYD A;  3N6R A;  2Q51 A;  4RKB A;  2PJA A;  3BDL A;  2H4O A;  1U4R A;  1RD9 D;  1Q90 A;  5DM7 3;  4C2M B;  2ZEF A;  1B1Z A;  1PRT B;  3BYT B;  2DY8 A;  1OBR A;  3B3S A;  3SI1 A;  5E3F A;  4Z65 A;  3K5L A;  3MZ5 A;  4EVO A;  4Y7N B;  1IYV A;  5T1I A;  2XEJ A;  1SYE A;  1VHO A;  2O53 A;  2L12 A;  2CTB A;  4K6D A;  4XDX A;  4XIG S;  3WC7 A;  2MP1 A;  3ND8 A;  4X3T A;  1HPC A;  2K05 A;  2WAC A;  3I3C A;  2V8D A;  4UEZ A;  5CV6 A;  3IFD A;  3VR6 A;  5K8P A;  5HVF A;  5EBD A;  1PYT B;  1OXS C;  1ENF A;  5DNF A;  1Z5R A;  2Z8L A;  1NAP A;  4P4D A;  4PV1 C;  3N5F A;  3M7N A;  3VAT A;  2HQE A;  4ZKB B;  1XMB A;  3FKI B;  5IGG A;  5M3M B;  1QG7 A;  1LTI D;  1NUC A;  1U4L A;  3GTM B;  3KI9 A;  4DK0 A;  1I50 B;  2LFN A;  2TSS A;  1A15 A;  4K5V A;  2L55 A;  5C4X B;  3I4M B;  1F2L A;  2R6G A;  1XX8 A;  4RH6 A;  3B2Y A;  2RDF A;  1VCI A;  2R7Z B;  1O78 A;  3PMF A;  1FNO A;  5CV7 A;  4OC4 A;  1R4P B;  2BA1 A;  3HRZ C;  1H9S B;  1LAN A;  5DEH A;  2F7V A;  3KR5 A;  5CC4 A;  1XJO A;  4NMZ A;  3BXM A;  2QJ8 A;  1PRT F;  3SJX A;  1R9T B;  1IY7 A;  5K8M A;  1HXY D;  1GYT A;  3M7G A;  2X69 A;  4ABN A;  1FR3 A;  3D68 A;  3C46 A;  2TMP A;  3IFE A;  4P10 A;  1STB A;  1BBX C;  5A2Q E;  1BF4 A;  1CP7 A;  5EBC A;  4E6I A;  2NTT A;  2PJB A;  1SNC A;  4ZX9 A;  2BA0 A;  2PJ7 A;  2V77 A;  4NP5 A;  2BE5 C;  1TKH A;  3NA6 A;  1B4O A;  3M3Y B;  2QVP A;  1YW4 A;  2F0V A;  1BCP B;  3QB3 A;  4DN4 M;  3RUZ A;  3FDT A;  2O5J C;  2GA4 B;  2OXP A;  2LKV A;  1VIX A;  2ZED A;  1BCP D;  1K8M A;  1I4P A;  4MCS A;  3HOY B;  1E0B A;  2WV6 D;  1DYQ A;  2B2U A;  4OKO A;  4RUH A;  4XXE A;  1W6K A;  5D29 A;  1EOT A;  1B53 A;  4RFB A;  1ILP A;  1EYD A;  4A3E B;  5IGE A;  2K5W A;  1C4Q A;  2R3Z A;  4DU9 A;  2VL1 A;  4ZUJ A;  3HOX B;  1LCP A;  3ERQ A;  3S14 B;  1SAP A;  2XEF A;  3HP3 A;  4KY5 A;  5K8N A;  2PNR C;  1V1P A;  1LAC A;  1QCB D;  3CT9 A;  2BDO A;  4NDX A;  3AB9 A;  4A3G B;  1EYA A;  1Q1E A;  4TWE A;  3PB8 X;  1ZG9 A;  4IHM A;  5M3F B;  3H94 A;  3T16 A;  4MCR A;  2ZEN A;  1ENC A;  3NQI A;  5C3X A;  1QB5 D;  3H91 A;  3V96 A;  2KJX A;  4OC1 A;  3GO5 A;  4XYQ A;  3VYS A;  2K5D A;  2EYO A;  1F2Z A;  3A8I E;  3FEE A;  3NE5 B;  5M5Y B;  3FVQ A;  2QCP X;  3R3O A;  4L8J A;  2EYL A;  3KL9 A;  4ID6 A;  1ESF A;  2V8G A;  4WRD A;  3LWU A;  5COY A;  4RAU C;  4FP5 D;  4J1M A;  2XVS A;  4N9P A;  4K2L A;  3LNN A;  2IT1 A;  3WT4 A;  2ANP A;  3HGB A;  4P2C B;  3TDQ A;  4CJ0 B;  5E4X A;  2NVX B;  4DFA A;  1XWE A;  1XXG A;  3Q0A A;  2XNA C;  3PUW A;  4HCS A;  3SE0 A;  1D5M C;  1FNU A;  3A54 A;  4BA2 I;  1YSJ A;  5E4W C;  4H44 C;  1I3Q B;  1ET9 A;  1CHQ D;  4KKU A;  1YNJ C;  1SYC A;  2KCN A;  5EPL A;  1CPS A;  2PJ8 A;  1D2B A;  1T5X D;  3RZD B;  1O7Y A;  3X3M A;  1SEB D;  3D7H A;  4R7M A;  1Y8N B;  5F09 A;  5IB9 A;  4PNY A;  1QMU A;  1KLG D;  5I9O A;  3D66 A;  1SMY D;  5LL6 S;  1WCM B;  2E2H B;  1PTO H;  2G9D A;  3C2P A;  1PRT D;  5D3I B;  2PMZ B;  3Q22 A;  1BLL E;  4X3K A;  3NH8 A;  4OID A;  4GZY C;  2CF4 A;  1ILQ A;  3RZA A;  2E74 C;  3CRL C;  1JOO A;  1LT6 D;  1V8Q A;  1A3U A;  4ZK9 B;  2C9O A;  3VR3 A;  3X3N A;  3VYU A;  3T13 A;  4DNT B;  2C6P A;  3VR4 A;  1VDZ A;  5J22 A;  1CPX A;  1TWH B;  5CGK A;  1BO0 A;  4RA8 A;  2SOB A;  1CX8 A;  4K8I A;  3SHL A;  1CTM A;  2I3C A;  3L7Z C;  2EVB A;  4KD4 A;  4FF3 A;  4DAP A;  1STG A;  2I07 B;  3KHX A;  1IKM A;  4K2K A;  3OIQ A;  3TME A;  4OO1 G;  2FJ2 A;  2PE3 A;  2NYQ A;  2F0T A;  3HS0 C;  1ELM P;  4F8M A;  4R6T A;  4F88 A;  1QQ9 A;  3S1R B;  4IQZ A;  3MRU A;  4XQJ A;  1NCV A;  2K03 A;  1SSO A;  3QO2 A;  3D7D A;  4G57 A;  4DAV A;  4PXB A;  3I4N B;  3J81 E;  3MEH A;  4F9U A;  4LMQ D;  1IGB A;  3IC1 A;  1OXT A;  2IL8 A;  4IUU A;  3BS1 A;  3LX0 A;  1HQR D;  3SJE A;  4ZKC B;  3KBG A;  2MHV A;  3A56 A;  1OXU A;  4F8Z A;  3NTI A;  1TY2 A;  3I8Z A;  2B2T C;  4EWT A;  2CW0 D;  5FO7 B;  4RGN A;  3U9S A;  5LHY 1;  1Y0Y A;  1KDC A;  2A69 C;  1R3N A;  3NFZ A;  2ID0 A;  5HGT A;  3IL8 A;  1XBU A;  3K0Y A;  4QF4 A;  5KYI A;  1O80 A;  3T53 B;  5KIX A;  4A3I B;  1DCZ A;  3IWW A;  2ENB A;  4F87 A;  1SNP A;  3SK4 A;  4C3I B;  2F4I A;  2EJG C;  5HUR A;  5EKI A;  1B3A A;  2IPK D;  2F0S A;  5JM6 A;  2IX3 A;  3EFX D;  2NUC A;  2A74 C;  4C3J B;  4KK7 A;  3DUZ A;  1I4H A;  3RZO B;  4UF4 A;  1I4Q A;  2DNE A;  3VAR A;  5I9P A;  2F0J A;  2NN6 H;  2O2L D;  1ARL A;  2F0K A;  3VH9 A;  2F3W A;  3H8G A;  1G2S A;  3UI2 A;  3URY A;  1LTR D;  5J39 A;  4MHN A;  4BBS B;  4DYO A;  1SYB A;  2JEB I;  2JBK A;  3WC5 A;  1AW7 A;  5BN4 A;  1GUT A;  1BQQ T;  4P44 A;  3FPU B;  2AFW A;  2PVV A;  4I65 A;  5FKA C;  3J7A F;  3P20 A;  4MIU A;  1NR4 A;  1DD2 A;  1HFG A;  2KVM A;  3VYT A;  1ZEQ X;  3DMU A;  1CT1 D;  1JQG A;  2A6E D;  2NB0 A;  3IO1 A;  3K57 A;  4ZI6 A;  1G91 A;  4IK2 A;  7CPA A;  4H13 C;  1D1I A;  3GTJ B;  1STA A;  2HUG A;  4MHP A;  1SE3 A;  4HMI A;  3H8F A;  1TS4 A;  4AYB B;  3TN2 A;  2EYJ A;  5TSS A;  2PO4 A;  1HUN A;  1I6H B;  3SVM A;  4C3H G;  2RSN A;  3M4O B;  1G2T A;  4IFD I;  4KTA A;  1TXR A;  5KND A;  1LT5 D;  1PYW D;  3BI0 A;  1BR9 A;  3M85 A;  2R93 B;  5COR A;  1SNQ A;  3BG3 A;  2BE5 D;  4OHJ A;  4B9X A;  2DEA A;  2A68 D;  3OOC A;  4HSP A;  3TP5 A;  1M4L A;  2ABZ A;  2CQA A;  4DK1 A;  1SFO B;  3CU7 A;  1M4V A;  2SNM A;  2B8G A;  1F2P A;  1F2O A;  1BCP C;  1H9K A;  3D67 A;  1LTT D;  3HG9 A;  5FOB B;  1TS2 A;  2B2W C;  4C3J G;  3GTK B;  3WDN A;  5J1Q A;  3MXP A;  5EKK A;  3GLJ A;  2Q8I B;  1CM9 A;  2K28 A;  1VF7 A;  1X3P A;  5K36 G;  2L5T A;  4O1N A;  2K1B A;  3NWT A;  1LAP A;  2RA4 A;  3KQX A;  1GXD C;  1CFM A;  2R92 B;  1JQY D;  2BCO A;  1GUS A;  4ZX8 A;  1ZYR D;  3EVQ A;  5D14 A;  3OHX C;  4PQA A;  2N88 A;  5JOB A;  4XQN A;  4CHT B;  3D4R A;  3PFE A;  1R43 A;  5D8N A;  1TWF B;  2WB1 B;  1F9Q A;  1TQO A;  1TKF A;  5C3E B;  4RGM A;  1ZYR C;  2JA8 B;  2PRQ A;  2R61 A;  1VGY A;  1PTO D;  2F1M A;  3FMC A;  4OO1 I;  2PZU A;  2N55 A;  3SJG A;  2J9A A;  3PBE A;  1ROD A;  1L0Y B;  3J7Y W;  1B9N A;  1Z7T A;  1NSA A;  4A94 A;  1ET6 A;  3QOJ A;  2AQ3 B;  1OXV A;  5CV5 A;  1HCZ A;  3D3R A;  8CPA A;  6CPA A;  4LQG A;  4CKC A;  2FVG A;  3TZU A;  4X3R A;  4A37 A;  4IFD G;  3SXH A;  1HQM C;  1TF8 A;  3OWE B;  1I4X A;  1GJX A;  4FWU A;  3PBB A;  1KTK A;  2X6G A;  3FF3 A;  1CQF A;  3S9L A;  4M1U B;  3PIP 3;  2KEE A;  4FBE A;  4KD3 A;  2A6E C;  2DN8 A;  3ERO A;  1FT7 A;  3I73 A;  4FUU A;  2E76 C;  2GLJ A;  1EY8 A;  4NGM A;  2E2I B;  4OC5 A;  2FHT A;  3I90 A;  2PJ5 A;  1QIL A;  3DWA A;  3SK6 A;  2HCI A;  3DM1 A;  4O42 A;  5ISR A;  1X32 A;  2PYK A;  3K9T A;  3NP8 A;  2JEW A;  3BDC A;  2F0W A;  2EYF A;  4RWS C;  5FLX E;  3IJ3 A;  3FPP A;  4OC2 A;  3KF8 A;  4QUC A;  2XWJ B;  1EL0 A;  1E2Z A;  1LFW A;  5IGB A;  5ELY A;  3L2N A;  4OIK A;  1SNO A;  1QWY A;  2QKI C;  1O7Z A;  3RLF A;  2HDM A;  2H1E A;  2E2J B;  1Y8O B;  2D2C C;  3KGQ A;  4K3N A;  3S1M B;  5EQ0 A;  4DGZ A;  4L63 B;  1LAM A;  4A3K B;  2NTS A;  1KWM A;  2EYP A;  4IUQ A;  1GHJ A;  2PCU A;  4U68 A;  5LYD A;  1PDQ A;  4FO2 A;  1FD7 D;  4ONW A;  2EXZ A;  3B3W A;  4PMB A;  4F7X A;  1HUM A;  1EQT A;  1H9M A;  3KK7 A;  4CKB A;  1B9M A;  3A7A B;  3O13 A;  1GUW A;  2XEG A;  1DJR D;  2L0C A;  2AFM A;  2EWB A;  2JA6 B;  3I91 A;  5K36 H;  4DF7 A;  1HDU A;  1RDP D;  1GOZ A;  3HLP A;  5EJW A;  2Z4H A;  1CA5 A;  5ELF A;  1K8O A;  1QOH A;  1Y0R A;  4OIJ A;  3C1E A;  5CBM A;  1M8A A;  5IT9 E;  4PPZ A;  5IIF A;  3P1H A;  1QNU A;  1LLR D;  2F0L A;  1MBY A;  1SYF A;  1UWY A;  1LTA D;  3W2D A;  4IUN A;  4FXK C;  3Q24 A;  3BI1 A;  2RB7 A;  1FNV A;  4HCE A;  2POK A;  4EQN A;  2J7Z A;  4KJO A;  2BOA A;  4ILW A;  3QJY A;  4LJZ C;  2JE6 I;  2MGS A;  3V7Z A;  2B2W A;  4OIW A;  5ELC A;  5C5L A;  5T1G A;  4KMU C;  3SEB A;  3NH4 A;  1ZKO A;  3CDX A;  3E5S A;  1S5C D;  2PZW A;  1YNJ D;  1TR5 A;  3Q6S A;  3Q23 A;  3S2D B;  1EY0 A;  2ZEG A;  3PO2 B;  3CPX A;  3PB6 X;  3BDO A;  4MMO A;  1B50 A;  1HHV A;  4WJW A;  4GM5 A;  3GTQ B;  5A2Q L;  4HMJ A;  3K2K A;  2QIL A;  3RBU A;  1PRT C;  3NXW A;  3G6J B;  4G7H C;  1ZG7 A;  3J80 L;  1HDQ A;  2K5Q A;  3D7G A;  3ISZ A;  5KEE A;  2BDN A;  1WD1 A;  3U9O A;  2D62 A;  5BN3 A;  3H3V C;  1HTP A;  4CJ1 B;  5JJZ A;  1PTO F;  5LRK A;  1TKW B;  2MUY A;  1J9O A;  4ZY2 A;  4BY7 B;  4TNU A;  3K59 A;  3B3T A;  3DHQ A;  4B6Z A;  1ELL P;  4ZYQ A;  3KR4 A;  3NBH A;  2IJZ A;  3BYY B;  4B9W A;  1SYG A;  3J81 L;  4LK1 C;  3CQZ B;  1WVL A;  3EA6 A;  4HAE A;  1SE4 A;  5JVG 3;  3PUV A;  2O4H A;  5EKL A;  1CHP D;  4N9T A;  2B8F A;  1JWU D;  1Y1V B;  4CPA A;  4BWG B;  5CV9 A;  4ME5 A;  1LOK A;  5ELE A;  2G9H D;  1PCA A;  1TS3 A;  3TP8 A;  1LV9 A;  3FJU A;  4TKO B;  2ICI A;  3L3O C;  5KYL A;  1DOK A;  1EY4 A;  3VA7 A;  1SE2 A;  3H09 A;  1UEA B;  3AU7 A;  2EOT A;  1YME A;  1DXM A;  3DEO A;  2KQ3 A;  1YNN D;  4R9W A;  4UIB A;  2AWN A;  3CRK C;  3KUP A;  2KEC A;  2IMO A;  1G29 1;  2CIJ A;  5D65 A;  1AZP A;  1MI2 A;  4C1N I;  2M00 A;  2OEO A;  1BNZ A;  4C3H B;  1YNN C;  2RKS A;  4HN7 A;  4NGQ A;  3DWP A;  1A2U A;  2M9V A;  1AFP A;  1CP6 A;  4FF2 A;  4K5W A;  4RKL A;  2L4N A;  1Y8P B;  1ZLH A;  5K5P A;  4TSS A;  3NHH A;  5IGC A;  4O23 A;  1RTO A;  2EY6 A;  3HOU B;  1VMC A;  5LL6 X;  2EPB A;  4KN4 C;  2OR4 A;  4CGY B;  1F77 A;  4OO1 H;  1AYE A;  2SEB D;  1RKN A;  4NFR A;  2C5C A;  1JWS D;  5CPA A;  3MN8 A;  2EK8 A;  2KHS A;  1RJT A;  2PJ1 A;  2OF1 A;  2IWH A;  3FX6 A;  1TS5 A;  4JBW A;  5IOC A;  4IUR A;  4CBV A;  2C1C A;  2ZT9 C;  5C0X J;  3IFT A;  4ZRZ A;  3JAM E;  2GRE A;  3P7J A;  3PFO A;  5JH9 A;  2RQX A;  1JOQ A;  1Y1W B;  2ZEM A;  3T51 B;  3K7A B;  3JAM L;  3VR2 A;  1Y69 U;  1E2W A;  2XIW A;  2OOT A;  3BVM A;  2PJ6 A;  3S17 B;  4G4K A;  5C6A A;  4C3I G;  4C1N K;  1PMR A;  3MXU A;  2OT2 A;  4MHY A;  1X3Q A;  1DE4 C;  3HOZ B;  1AZQ A;  1TWC B;  4F9V A;  1JR0 D;  1IW7 D;  1F9R A;  2EK9 A;  3M4Y A;  4HED A;  3WOF A;  3TP7 A;  5LYL A;  4PQX A;  1ZLI A;  2Q8T A;  3V38 A;  2B2V C;  2A5H A;  3PV0 A;  5IT9 L;  2EJM A;  4ZY0 A;  4TRD A;  3A7L A;  5F2D A;  4NGR A;  1F9S A;  1AP0 A;  3SR1 A;  4LAA A;  2HDL A;  2A6H C;  5EGT A;  5CBE E;  2A68 C;  2EY1 A;  4OME A;  2VB2 X;  2X6L A;  1UAP A;  3NUC A;  3BHX A;  1WTR A;  5E1F A;  5THW A;  1WTX A;  2KCC A;  1C8C A;  2A6H D;  1GUN A;  4MRI A;  1STE A;  4P4I A;  3D4D A;  5C3W A;  5JEA H;  5J1Z A;  3S2H B;  3NWS A;  3S9N A;  1AMP A;  3NTH A;  4X2T A;  2PQE A;  3I72 A;  2PJ0 A;  4QCL A;  3TC8 A;  1SJE D;  2ZEO A;  4P4B A;  4BA1 I;  1EYC A;  4DXG A;  5JAV A;  1U4P A;  1A3V A;  5HVH A;  3NPP A;  2M2L A;  4ZAI A;  1XYI A;  4IUP A;  4R8F A;  3KAS A;  5LRJ A;  1I6V C;  1PFM A;  2F0O A;  3PUX A;  4X3U A;  1GUO A;  1II3 A;  3RD4 A;  5IGF A;  5I6Y A;  5M5W B;  4G1P A;  3KLR A;  4K14 A;  5I6W A;  3MTS A;  2VXW A;  4G7O C;  3NTK A;  2J4X A;  2JSO A;  2XSC A;  1QNK A;  3E6Z X;  4DNR B;  4KY6 A;  1J8I A;  1MD2 D;  4MCQ A;  1SXT A;  5ELB A;  4ZUI A;  2BOS A;  3V2T A;  2O5I C;  5JEA G;  3KQZ A;  1LTG D;  1LT4 D;  4KHZ A;  5JVH 3;  1PTO B;  3D8G A;  5HXD A;  1JB3 A;  1DOM A;  3MC0 B;  1DZ1 A;  4DAY A;  3D6C A;  4IFD H;  5C5M A;  5D3D A;  4U67 3;  1JWM D;  4ZY1 A;  2ZXP A;  2ZEL A;  4FXG C;  3OSO A;  4H0L C;  1LO5 D;  5KRU A;  2PIY A;  1HRJ A;  4IUT A;  1DM0 B;  1UUP A;  2F0F A;  3NQT A;  1LTB D;  5M5X B;  4P4E A;  3SJF A;  1EIH A;  4UIA A;  3SI2 A;  2WII B;  1KNE A;  3HOV B;  2NZ1 D;  1CZG A;  2LS0 1;  4OGQ C;  4MN3 A;  1NSN S;  1BCP F;  2K7V A;  3ZYY X;  1SJH D;  5CMD A;  3FED A;  3R8B A;  2AFS A;  3GB0 A;  4DA2 A;  1STH A;  1GHK A;  4QB4 A;  4ZQ3 A;  2NN6 I;  2Q8R E;  1KNA A;  1YLO A;  3W3A A;  5C4J B;  3QG1 A;  4PMW A;  1SMY C;  3D4W A;  5CV8 A;  2PCF B;  2AFX A;  3RMH A;  4KKS A;  1BUV T;  4YIJ A;  3AMU A;  2IX0 A;  2EJF C;  3PIO 3;  1PZI D;  3NH5 A;  2K6A A;  4MHZ A;  5C4Z A;  4UEE A;  3BVZ A;  3PUZ A;  4K5X A;  1E2V A;  3TZD A;  2EZV A;  4UAI A;  1WTV A;  4OP4 A;  2EYH A;  4R8I A;  3FEC A;  2JP1 A;  1S4Z A;  4KY7 A;  3WC6 A;  3S16 B;  1HFN A;  2C6C A;  1IYU A;  5IOD A;  3MFG A;  1IKL A;  1AN8 A;  1U9R A;  1JOK A;  2VUM B;  2Q4Z A;  2F0U A;  2YYZ A;  3QIA A;  1F2M A;  2K32 A;  4XTC S;  3EQL C;  5K8O A;  3S1N B;  2AQ2 B;  4R8N A;  3CPA A;  1ARM A;  3K5N A;  4RGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...