2G9DA

Crystal structure of succinylglutamate desuccinylase from vibrio cholerae, northeast structural genomics target vcr20
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
340
structure length
340
Chain Sequence
KSLFRQSFLFDSLDLDHPMVAQTVRTEQGVTLKLHQRGVLEVIPAQTDAATKNMVISCGIHGDETAPMELLDKWIDDIVSGFQPVAERCLFIMAHPQATVRHVRFIEQNLNRLFDDKPHTPSTELAIADNLKVLLRQFFANTDEHSRWHLDLHCAIRGSKHYSFAVSPKARHPVRSRSLMQFIEQAHIEAVMLSNAPSSTFSWYSAEHYAAQALTLELGQVARLGENLLDRLLAFDLAMRDLISRHKPEHLPRKSVMYRVSRTIVRLHDDFDFRFSDDVENFTAFMHGEVFGHDGDKPLMAKNEGEAIVFPNRKVAIGQRAALMVCKVNTRYEDDQLVYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Succinylglutamate desuccinylase from Vibrio cholerae, Northeast Structural Genomics Target VcR20.
rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
molecule keywords Succinylglutamate desuccinylase
total genus 71
structure length 340
sequence length 340
ec nomenclature ec 3.5.1.96: Succinylglutamate desuccinylase.
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.630 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2g9dA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2g9dA01
4NJQA 3H8FA 3VATA 4MCQA 4A39A 3GLJA 4UEZA 5JH9A 4MCRA 1FNOA 3B3CA 2GLFA 5IB9A 1BPNA 2CF4A 2CTCA 3FJUA 3IIBA 3KHXA 4NGMA 3PFEA 5LYLA 2XEFA 4MHPA 4TWEA 5LRKA 2F8HA 3SI1A 2XEJA 3CPAA 2JEWA 1YW6A 2I3CA 2PJ0A 2QYVA 1Y0RA 2VL1A 2WYRA 5K8NA 3GB0A 4ZX9A 1TXRA 2ZEOA 3KR5A 1BAVA 1KWMA 1BLLE 2G9DA 3HUVA 1CX8A 2GREA 3L2NA 1R43A 4R8FA 2PJCA 4DJLA 1HEEA 2V77A 1Z2LA 4MRIA 3H8GA 2ZEDA 4ZY2A 5J1QA 2PVWA 4A94A 3GUXA 1TF8A 1Z8LA 4JYWA 4G1PA 4OKOA 2ZEMA 3RBUA 3VH9A 2FVGA 3PBEA 3S9MA 4AXVA 3FEEA 2ZENA 3NH4A 5LRJA 3CDXA 3WABA 2CIJA 4OC1A 4FWUA 2ZEPA 3B3WA 3CT9A 1BPMA 2QVPA 2V8GA 1LCPA 4NFRA 1ZG8A 4A37A 3WC5A 2V8HA 1VHOA 3B3TA 5K8PA 4ZYQA 4ZX8A 3NH8A 4IAVA 5HXDA 2Q43A 1F2PA 2NYQA 3WC6A 3FVLA 2PRQA 1YSJA 5F09A 3VARA 1VGYA 3PB8X 4P44A 1PYTB 2BO9A 2Q4ZA 5I4MA 3CPXA 4R6TA 4UIAA 2EK9A 1M4LA 3FX6A 1RTQA 1LANA 2GLJA 5JGFA 4OP4A 5CPAA 4B6ZA 4K3NA 3S9NA 3HLPA 4O23A 5LYDA 3KZWA 2PJ5A 2IJZA 2DEAA 4WJBA 2PVVA 2AFXA 3D67A 4YU9A 5LYIA 3MRUA 1CP6A 2RFHA 3JRUA 3FEDA 1LAMA 3IO1A 4NGQA 3KGQA 1LOKA 3ISZA 2BCOA 4BD9A 2PJ7A 4P6YA 4NGNA 3KQZA 1YLOA 3V7ZA 7CPAA 5THWA 3D7GA 5CBMA 2C1CA 2V8VA 2XEIA 2ZEFA 3IC1A 4MCPA 4F9VA 2O4HA 2EWBA 1ELMP 2PJ6A 1ZG9A 4KSIA 3D7DA 4MMOA 4DYOA 2BOAA 4R76A 1HDUA 2POKA 2ZELA 2ZEEA 4NGRA 4WWVA 5JM6A 3NFZA 1EE3P 3PEIA 2C6CA 1OBRA 2PJAA 2PJ4A 5HVGA 1ARMA 2EK8A 1DE4C 1DTDA 1IGBA 5HVHA 4Q7AA 3RAMA 2AFOA 3MN8A 3KL9A 4ZI6A 1PCAA 1TKJA 3WT4A 1VHEA 4X3RA 8CPAA 3B35A 2OR4A 2WZNA 4P4FA 4UF4A 3KR4A 3BHXA 3NH5A 3D7HA 4P4JA 3SI0A 3KQXA 1AMPA 1HDQA 3IWWA 3SI2A 2OOTA 3SJEA 1LFWA 4PXEA 3IFEA 1Z5RA 2C6PA 4W9YA 3TX8A 2HB6A 5HVFA 3KI9A 3B2YA 2ANPA 2AFZA 1TKFA 1GYTA 3D7FA 2PJ3A 4R7MA 2ZOGA 2ZEHA 4OC3A 4TNUA 1CP7A 2ABZA 2C6GA 4PPZA 1YW4A 2ZOFA 4UIBA 3DLJA 4P4DA 3B7IA 1XMBA 3N5FA 2PJ8A 4IHMA 2PCUA 2F7VA 2XEGA 2AFMA 4P4BA 4PXBA 3IEHA 3LWUA 4FAIA 4YWYA 2PJ2A 3V38A 1ELLP 3D66A 1XBUA 4ONWA 4P4IA 3WC7A 1F57A 1XFOA 2PE3A 3KASA 2QJ8A 5LYFA 1XRYA 3FF3A 1XJOA 5LRGA 4P10A 1AYEA 5K8OA 5D8NA 2J9AA 4OMEA 4DUKA 3SJFA 4Z65A 1ZLHA 1ZLIA 4UEFA 3K9TA 4EFDA 3BI0A 2GU2A 1UWYA 4JZ0A 2O53A 4PXCA 3PB9X 4MXUA 3T8WA 4RUHA 1R3NA 3IJ3A 2PIYA 4OC0A 3TC8A 4IK2A 1NSAA 1Y0YA 3D68A 1Q7LA 4MHYA 1Y7EA 1IY7A 3I1UA 3PFOA 1F2OA 4A38A 4NGPA 2HC9A 4PXDA 3LMSA 3BXMA 1CPSA 2AFUA 4EMEA 4FBEA 2ZEGA 6CPAA 5D29A 3B3SA 2CTBA 2Q51A 3DGVA 1TKHA 4MCSA 3S9LA 4ZY1A 1CBXA 5K8MA 4H2KA 4ZY0A 1JQGA 4F8ZA 5DS0A 4OC5A 4NGTA 4OC2A 5ELYA 2PIZA 1H8LA 1QMUA 3FH4A 2JBKA 4EWTA 1FT7A 4FUUA 4F9UA 2NSMA 3SJGA 3FECA 2IQ6A 2V8DA 2PJ1A 1VIXA 3ISXA 1TF9A 4NGSA 4X8IA 3FMCA 3SJXA 4CPAA 1CG2A 3H8EA 3PBBA 2PJBA 3KHZA 2AFWA 1CPXA 2IMOA 3D4UA 4OIWA 2AFSA 4UEEA 2JBJA 4NJRA 3QNVA 4P4EA 3PB7X 2RB7A 3B3VA 3PRTA 3RZAA 3PB6X 1QQ9A 4PQAA 2PJ9A 3BI1A 4X2TA 4MHZA 1ZG7A 3K2KA 4OIDA 4MHNA 1YMEA 3NA6A 4P45A 4OC4A 1LAPA 4GM5A 3PB4X 4LQGA 1ARLA
chains in the Genus database with same CATH superfamily
3W91A 4ZCKA 1NNXA 1B4OA 5DM73 1AN8A 1UNSA 4HTHA 2G3TA 1H9RA 2L11A 2WV6D 2E5LL 4B3RQ 4MCRA 2NVXH 2UXDQ 1U4RA 1F2ZA 1H9KA 2GLFA 5IB9A 1YI2A 3T1YQ 5EQ0A 1R4QB 1SMYC 5M3MH 2F5IA 3R8BA 2JA5G 1NBWA 3D4DA 4BINA 2GFQA 3R9EA 4JG2A 4M3SA 2R92B 1HJPA 4R3KA 4MFZA 5LYLA 5I9PA 3I4NB 4TWEA 5G1ZA 2K04A 5LMNQ 2XEJA 4A3EG 5F48A 3F2CA 3V96A 2EIFA 3IGRA 3GTMH 2HD3A 2I3CA 3CXPA 4K5WA 5FKAC 1JORA 2H4OA 1ICWA 4L63B 3DLLA 2R92G 4JYAQ 4HJ5A 4Y49C 5I4DA 3G6EA 4M8AA 1S5FD 1EYCA 2ES2A 3HOUH 3FIXA 5IY0A 3D3RA 5CR3A 1TXRA 1CT1D 3H09A 1I4GA 1YLEA 1JCKB 1YNJD 4WFN3 1XTCD 1ZO0A 2NN6H 3MTSA 2PMZE 1J9OA 1BO4A 3GIUA 3SXOA 1VQGA 1LTTD 2K75A 2LY7A 3K9UA 5GROA 2A6HD 1NE9A 3L2NA 4B5PB 3HKZE 1SXTA 3KF8B 2RKSA 1TQOA 5ELOA 4A3MG 1FJGQ 1A63A 3H8GA 4ZY2A 3J81E 4JI4Q 5J1QA 2PVWA 3WOFA 4DGZA 1XPRA 4A94A 2B2TC 1C8CA 3GTPB 4A93B 1HR0Q 1TF8A 1Z8LA 3VA5A 3ITPA 5C3EH 5H86A 3S1QB 3VH9A 3EY5A 3PBEA 4C2ZA 4AXVA 5G3LD 2OWOA 3FEEA 1Z7TA 5JOBA 3N52A 1VMPA 2F0IA 4EGVA 4K2KA 2JEBI 3WABA 1VQ4A 2YU9B 5IWAQ 2J8MA 4OC1A 3TO9A 4BY7B 4V190 2DUDA 1STGA 1RXTA 4U9YA 2ICEC 3CT9A 3S14H 5JPMC 4A3FG 4L5TA 2ZXRA 1XMQL 5JPNC 2ZM6Q 4BBSH 1L0XB 2QVPA 5EPJA 2YV5A 1DONA 1U5KA 5CV7A 3M4YA 2HUZA 1GD7A 2B4DA 3KKWA 1V1PB 4PMCA 3QWNA 1G91A 2NZOA 1VQPA 1M1DA 2WAQE 4WJ3M 1I4XA 3B3TA 1E22A 3MXPA 5E4WC 3GV3A 2YGWA 3WC6A 5F09A 1YSJA 3NEMA 4RI1A 1ASZA 4KVOE 1GVPA 5CV9A 1PH1A 3P2FA 5M3FG 4B9XA 2OF1A 2WAQB 3DHQA 3VR6A 2RHQB 2EXDA 2IX3A 1FNVA 4DXFA 4P44A 4TVAB 2BO9A 4BY7G 1L1OA 1TS4A 4MI4A 5I4MA 4UIAA 4MNOA 2EK9A 1M4LA 1WWZA 2SNSA 3A9LA 5KTAA 1EY8A 1JE5A 4DUZL 3FX6A 1RTQA 4A2ZA 1LANA 5JGFA 4GZYC 2RC4A 1F2MA 1C0AA 3DXJC 3KLRA 2GVAA 1XF8A 3H91A 1XYIA 1HA6A 4EQ5A 3F2BA 4JBKA 1L0CA 3Q23A 4JV5L 2CY2A 4YCVA 3HLPA 4O23A 4ORFA 2MP1A 3PO2H 1CTMA 4DV3L 2DNCA 2VQFL 2DEAA 4FD6A 4WJBA 1PFNA 3B8GA 1OXUA 5LYIA 3A5ZB 2FHTA 1S4ZA 4LUZA 3JRUA 1LAMA 3ND9A 3KGQA 1X65A 4KOXA 2UXBL 4RAUC 4CGPA 4U68A 1FD7D 2B63G 2GIVA 3GTJH 1CKOA 2BA1A 4MHEA 1Q86C 3PIPA 1TS2A 1RIPA 3F2DA 2WPXA 1AFPA 1YLOA 7CPAA 3KBXA 4NCZA 4DR2L 4LF4Q 1IL8A 2PMZB 1B9MA 4LMQD 5THWA 3PF5A 4KOSA 4X5KA 2F0KA 4DV6Q 1LUZA 3QG1A 2VZZA 1PTOC 2ZEFA 4I7ZC 1YNNC 2NVQH 1VQDA 4A3LG 3ULLA 4DUYQ 1YREA 4DU9A 3S16H 2Z3PA 3DWAA 4LF6Q 4XQJA 1KAWA 2PJ6A 4HIKA 3U4ZA 5FLXL 3MGDA 2BOAA 4DNTB 4C2MB 3NFZA 4BY7H 4DNRB 1M4GA 4HNYB 2ZJRA 4MFJA 2C6CA 3HOXH 3E0EA 4KD3A 3AFQA 4XNHB 4KOVA 3J80E 2AFOA 3MN8A 1QNKA 3KL9A 5CC4A 2HDLA 4FYDA 3I2ZA 4AG9A 2Q04A 1QSRA 4XT1B 2BSWA 3I4MG 2EXZA 4F88A 4JWPA 4J3GA 1AP0A 4R4IA 1LRZA 1Q90A 1Y7RA 2JA8G 2CFMA 1BBXC 2OR4A 3R9GA 1GXDC 4UF4A 4IUNA 3JAMc 3BHXA 1PYBA 1WTRA 2B2TA 2MFIA 1SFOH 4F8MA 1PHJA 2PCFB 3D7HA 4P4JA 1HDQA 1BR9A 4OONA 3CCJA 1I4PA 2K4KA 3MEFA 2F03A 2H5XA 2FXQA 2K33A 1NMTA 4XNHC 3SJEA 3KUPA 1MKHA 1DCZA 3M3YH 1S5ED 4K6LA 1ICFB 2XN9C 4DR5L 3IFEA 2B4BA 4W9YA 1VQBA 4GOPA 1HTLD 3TX8A 5M5YH 4HIDA 4R87A 4N9TA 1X55A 1RKNA 5JJZA 1SN8A 4IUTA 1L1OC 1JJCB 1IL2A 2VNUD 2K05A 3A74A 1HNWL 3IU1A 3MFGA 1K9MC 1Q8IA 1Y1VG 2IHFA 1WCMG 2HT1A 2PQEA 4QCLA 3BZCA 1E7ZA 1PH3A 3GTMB 2A6EC 5I2XA 4H0LC 1GYTA 1KABA 3AEVA 4X64L 1Y1WH 1QVGA 1HZ9A 2P6EA 4OC3A 1D8LA 2N3SA 1TVXA 2YNEA 4GOPC 4F7XA 3GTOB 3QOLA 2OQKA 1M44A 1Y9KA 3GY9A 4PG3A 4EX5A 2QMLA 2R92H 3X3NA 3KF6A 3J7ZC 3I8ZA 4P4DA 1G6ZA 1XMBA 2HV2A 1UUPA 2R7ZB 4OADA 4A3DG 4IOCA 1KZFA 4JBWA 4CAVA 4GLVB 4FD5A 3OWEB 2NVXB 1XOVA 2SEBD 4JI8L 2XEGA 2ZXVA 5DWMA 4RFBA 4MFLA 1KLUD 1DJRD 4RKLA 3DDDA 4R4QA 4KK7A 2R61A 3S9WA 3LODA 2AE6A 4P4BA 4PXBA 4R4CA 2WFWA 1SAPA 3IFDA 2X7BA 4PZ8A 3MFYA 3BJ7A 4LFAQ 1WOCA 3UE0A 3JAMi 1JJ2A 3V38A 2LXJA 2NN6G 1HA5A 4BBSG 1W6JA 4ONWA 4P4IA 3OPOA 3DM3A 3HKZB 3WC7A 4DR6L 3A0JA 1WCMB 2WKCA 1J5EL 1ILPA 2L12A 4DK6C 4RG1A 1EYDA 5FJ8G 1BNZA 4JI5Q 1SNCA 2R93H 2VL6A 2GA4B 2JA8B 2NTSA 1LTBD 4P10A 4CAXA 3R96A 2CW0D 3TSSA 5IYDH 5H84A 5IB0A 4J8QA 4HMIA 1TY2A 2QIRA 5AFWA 1AE3A 1RTOA 3NPPA 4QUCA 1VQJA 2K14A 1I94L 3C3LA 4ME3A 2UXCQ 3NK9A 4ZGYB 2DJFC 4JXQA 3P1HA 4E0AA 1CSQA 2Z4IA 3UDXA 1Y69U 2B2UC 1U4PA 2EE1A 4MXUA 3T8WA 5IGDA 3IJ3A 3GDEA 2Z1CA 4KOTA 4Y49B 3H3VI 1PFBA 1IW7D 4DNIA 1EYAA 4UCNA 1I50B 3PIP3 2RCFA 3TC8A 5J8CA 2FMMA 1NSAA 3PGZA 1D7QA 1Q7LA 4MHYA 1OXVA 3QIAA 5IV0A 1F2YA 1EY7A 3I1UA 2E2JH 2CH4W 1UE7A 1K4JA 2G3AA 3J7AV 5C0XH 4KY5A 2VB3X 4RGOS 4Y7NH 3A7AB 4QUSA 1B87A 3K5LA 4DUYL 4PXDA 5G20A 1YEZA 4DV6L 3LMSA 4EMEA 4HSPA 5KNBA 2PZTA 3DGVA 2HDMA 2KVMA 2PI2A 3GO5A 2A4NA 4CYNA 1JC7A 1TXYA 1F9SA 4POFA 4MCSA 4OAEA 5KNDA 1HTPA 3TP7A 4DV4L 4ZY1A 2O5JC 4JC0A 1UAPA 4KD4A 5AG4A 1G6PA 2ICIA 5HGQA 4QJFA 5K8MA 4QQBX 4IUSA 5DS0A 4IURA 1VQOA 1B50A 2E2HB 4BS9A 5ELYA 1SNDA 3CHBD 1JWMD 1VF7A 3TBIB 1LLRD 1B3QA 5JVH3 4KHPL 2B8GA 3L3OC 3CCVA 2RDFA 5BR8L 1NAPA 4EWTA 4OWTB 2R6GA 4QY7A 4L89A 3U50C 2KJXA 5F47A 1CM9A 5CNPA 1PH5A 1DD2A 2V8DA 4LF7L 3DSBA 4GS3A 2EZVA 1VQCA 4J15A 1S60A 4HNWB 2BH2A 3SJXA 2IX0A 4KHVA 3T13A 5IYCH 1X3EA 4A95A 2FXFA 1N8RC 4CKCA 1I6HH 1IYUA 2P5ZX 4ODGA 4HSVA 2B63B 4HCEA 1EYGA 1CPXA 4OIWA 1Q7YC 1KUVA 3H4QA 4UEEA 2Y0SB 3QOJA 4HKFA 4A3MB 3GTKH 2QCPX 1Q2DA 3DNSA 4NJRA 1KL9A 2F0OA 3PB7X 4MFQA 5JPHA 4DK0A 2JEVA 4DV4Q 2O5IC 3PUVA 4C3HG 4DV7Q 1GUSA 2IW3A 1PYSB 2Z3NA 2ZXOA 3RZAA 1EWIA 1TWCH 5JJKA 4PQAA 4KN4C 4XIGS 3D6WA 1NMGA 1PV4A 1SNPA 4MTKA 3K2KA 4OIDA 3GTLB 3Q8DA 2ALYB 4TQUS 5J3BA 5BR8Q 5KNCA 3EA6A 4OC4A 1LAPA 2HHHQ 5KTCA 3NTKA 3VR3A 5E7NA 4UY8C 3K57A 5F49A 3R1KA 4NJQA 1EEID 1SLJA 1XX8A 4XQQA 1EY6A 4C3HB 5M5XH 3D3SA 4MCQA 3BVMA 1PYWD 4UEZA 1QCBD 5JH9A 2EY2A 5EPKA 4ZUJA 3IRBA 4C3JB 1FNOA 2J4XA 4XQNA 1WK4A 1KUYA 1LABA 3AYHB 3MA2B 3I7FA 4YHHL 2WINB 3NENA 1SYBA 3PFEA 1CK1A 2XEFA 4APVA 4S3SA 2KHIA 4XYQA 1QILA 4A3BG 1M4IA 3G48A 1CQFA 2F8HA 1JOKA 1OTCA 3CPAA 1UEBA 2VQFQ 5A2QE 1PFMA 1L0WA 3PIO3 3S1RH 2B2VA 1N32L 1Q82C 2PJ0A 5G21A 3HZXA 5LMUQ 4BY1B 3NP8A 4TKOB 1Y0RA 4ONUA 2VL1A 2FT0A 3L9AX 4CDDC 3BU2A 2R7HA 3N7ZA 2DNEA 3E9HA 1M90C 2UU9L 3GB0A 4G7HC 5K8NA 1LTLA 2JQOA 3F8TA 4ZX9A 2ZW5A 2EYLA 2K5TA 3HOWB 1JWQA 1XIXA 2UUCL 3HKSA 4AQYQ 5K36H 1KWMA 1RDPD 1EZ6A 2B29A 2EWBA 3CZXA 1PTOD 3HUVA 3CMEA 2GREA 1O7ZA 1RHPA 4V0BA 3MXNA 4H02A 5C44H 4R8FA 2IHEA 1QSTA 4B14A 2O28A 4AYBG 2PJCA 2LKVA 1PRTB 4I49A 5GAHC 4DJLA 4R9MA 1HEEA 3FRPB 4IJHA 2P0WA 2QECA 2V77A 3J80L 1HR0W 4QMGA 1CSPA 4BY1H 4ZRZA 1IOFA 3KK7A 1D5MC 5ELNA 1SQHA 4AIMA 3GUXA 3QJYA 4K8IA 4PSWA 1N36Q 4OKOA 3OWCA 4XPLA 5D3DA 4LFCL 4PMWA 1MJEA 2N88A 3QB3A 2FVGA 3KLSX 4K0KL 4KJOA 4A3DB 4YCWA 5C0XJ 4MZ9A 3HGBA 1U6MA 2ZENA 1PUAA 3NH4A 1STHA 1Q81C 4AVBA 3CDXA 2CIJA 4M1UB 1Z9UA 5DLQE 4IUQA 1W2BA 4JCVE 4ALPA 4A3CG 5C4ZA 3HOUB 3HOWG 1M1KC 4K0KQ 2Z9HA 1R4PB 1QWYA 3CCLA 5C3WA 3C46A 2F0TA 1FNUA 5CV4A 2UXDL 2JA6G 3D6CA 1PMRA 2REEA 3B6YA 2JA5B 3VDYA 3H5ZA 4A76A 3R2TA 4CDEC 3WC5A 5CGKA 4DNCA 1ENAA 3D4WA 1GOZA 2CW0C 1K83H 3RD4A 3A8IE 3HOUG 2B5GB 1X3QA 3RZDB 4ZYQA 1YHBA 3HOYH 1L1OB 3I4NH 5HXDA 2O4XA 2NYQA 1Z47A 4LF8Q 1GHEA 5TSSA 1B8AA 1K83B 5I2YA 1HNXL 3H0GH 4NPSA 5ELCA 4B3SQ 1I3QH 1LT4D 1BCPC 1EY0A 3CRKC 3VARA 5M3MB 4BWGB 2JA5H 2R7ZG 1IYVA 2JK8A 3TZDA 4KY6A 4OX9Q 4FXDA 4ABNA 4HIMA 2WKDA 3K81C 4XXEA 2NN6I 5L37A 3WWVA 1AEXA 2F0EA 5IGCA 3J81i 1XXGA 2Z11A 2B3VA 1KXLA 4A3MH 4KTAA 2K5DA 2WB1B 2Q4ZA 2CNMA 2MNAA 2MHVA 3CPXA 4R6TA 2ASBA 2B63H 2YNCA 3T4AC 3EO4A 1TWHB 4CAWA 2N55A 2JLMA 3DEOA 5FOBB 2GLJA 5C4XH 2LMCB 4X62L 2MO0A 4OP4A 5CPAA 4X66L 3K5OA 2IX1A 1ENCA 5C0XG 4FF1A 4DAMA 1XMOQ 4G7OC 2F0MA 3H0GG 2KECA 2ZXPA 2RBMA 1IOIA 2B2VC 1SROA 4RKBA 1VQ9A 2JDDA 1CKNA 2B5GA 4LJZC 3BZKA 3ULJA 2J8RA 1JR0D 4IJLA 2YNCC 1YVOA 1E24A 2Q8TA 4CJ2C 3F8KA 3MRUA 1QG7A 2EYFA 1Q8KA 4QB4A 5C44B 3EFAA 3PUZA 3G8WA 4NDXA 3FEDA 1FNWA 4QUFA 4NGQA 1SBBB 3RNZA 2Y0SG 3AB9A 3ISZA 5M5WB 2VB2X 5FK9C 3OHXC 5NUCA 4GLXA 2HHHL 4RWSC 1HPCA 3J7AF 3STBD 2PJ7A 1CKNB 3E0KA 2TMPA 4B3MQ 4NGNA 4A3IG 3KQZA 1D5XC 1SNMA 2B2WA 1HUNA 1YNXA 3SK6A 3RYOA 4IPHA 2L1BA 3G6JB 4UHVA 3J7A5 2N8NA 1TU2B 3NTIA 1C7YA 3H3VH 2XEIA 4RN7A 1H95A 5I0CA 1EL0A 1LTAD 4MCPA 4F9VA 1GKHA 3EROA 3E5SA 4B3TQ 2X69A 4CGLA 3BYTB 1K8MA 4K2LA 3D7DA 3CRLC 3HOZH 4A3EH 2PQAA 1K8OA 4R76A 2DY7A 2Q8RE 4X3SA 2POKA 2EUIA 4DV2Q 5JM6A 1VQFA 1FVIA 1WTXA 2Q2TA 3JC66 5C88A 4LQ6A 4DV7L 1S7NA 3FXTA 1CM0A 3V05A 4HMJA 2XSCA 3KDFA 2DJGC 1HRJA 2R3ZA 3NBHA 1JT8A 2B39A 1DE4C 3TO6A 1IGBA 3RAMA 4LF7Q 1VQ8A 1C4QA 3BDCA 3RLOA 1WTWA 4RCNA 2R98A 2KHJA 4IF5A 1SNOA 4RHRA 2VZAA 4K30A 1X6OA 2PPBC 4CRZB 4KOWA 2K5NA 4LF9Q 4OIJA 2WPWA 2CQOA 4KKUA 5FLMG 3OTOL 5A27A 3FEWX 2A5HA 8CPAA 1EOVA 1SMYD 1FY7A 2WZNA 2MO1A 3PO3G 3KR4A 4P2CB 1TWFB 1CHQD 3K0XA 3SI0A 2F0FA 5EKLA 2R93B 1WTQA 2O2LD 3UY5A 1P16A 3I9SA 1G2TA 2VQYA 4CAFA 3GTGB 2Q4VA 4UP9A 4KHZA 4A31A 2HIVA 1Z5RA 1ZEQX 3PO3B 2VUMG 1IIDA 1SYDA 1Z9FA 2K52A 2K03A 3LX0A 3TP6A 4A30A 3KI9A 3B2YA 2ANPA 4KKSA 2HIXA 2NYZD 5C0XI 1KQSA 4X64Q 2ZTDA 3D4RA 5ELFA 3R93A 3ZZIA 3D7FA 2K5VA 3RMHA 2MPMA 2Y0SE 4JD6A 4CGOA 2G0BA 4DR2Q 4TNUA 4LF9L 1CP7A 2ABZA 2VI7A 1ESRA 3PCOB 4QF4A 1YW4A 5JQ4A 2A6HC 1Q2CA 3DLJA 2F0DA 3B7IA 3J80i 4CDFC 1VQKA 1SSOA 5CYUA 3T1HL 2VXWA 4R8NA 2PJ8A 3VR2A 3GQBA 2F7VA 1SYGA 4KKTA 1Y8NB 2EY1A 2PQAB 3WR7A 5GQOA 2MJ8A 3DEPA 5J1ZA 4DKAC 2FSRA 1GUWA 1X32A 3WDNA 4LFBQ 4GXHA 1JWSD 2PJ2A 3HEJA 5JJIA 2A69C 5IWAL 1ELLP 4B11A 2Z3KA 5BN4A 5C44G 1XBUA 4ZUIA 4FD7A 1IYLA 1DGSA 4JK1C 1XFOA 1BOSA 3KASA 3CAMA 3LD2A 1ASYA 1M4VA 4H6UA 4Z9CB 4QIWB 1X3PA 4E8OA 3CMAA 3BDLA 5LYFA 1PZID 4IZ8A 4NF1A 4C3IB 3PUYA 4JI5L 1XJOA 4KV6A 1A8VA 3NE8A 1AYEA 5K8OA 4OGQC 3URYA 5D8NA 1J6QA 3RO0A 4QL5A 4DUKA 3K7UC 1KNEA 1Y8OB 3K7AB 2XTIA 1S7KA 2LSSA 2HQLA 1RF2D 2RDGA 3HOWH 1QZHA 4FXKC 4MTNA 4LF6L 3DWPA 1SRUA 4C3IG 1GJXA 3U58A 1BVSA 1KNAA 3S6FA 4EFDA 4JZ0A 4YHHQ 2OEOA 1Y1WG 1RD9D 5HGTA 1R3NA 3HOXB 2TSSA 1EUJA 3A5UA 1MD2D 3MWYW 2Z6KA 1WD0A 3FB3A 4WJ4A 4DAYA 4GKJL 3ZJ0A 4C2MH 1GHKA 4IK2A 2NTTA 3I55A 1Y0YA 2OU2A 4F6AA 3D8PA 3VR4A 1Y7EA 1IY7A 3KF6B 1SE4A 1M8AA 2HQEA 2I46A 4L8JA 4GNXA 1F2OA 1XEBA 4A38A 1ET6A 5M3MG 5C4JH 3CC7A 2HC9A 4ULLA 1HNZL 3HG9A 1WTPA 1EU3A 2XRSD 5G3LF 1K73C 2JEAI 1EQRA 1XMQQ 5D3IB 6CPAA 2ZEGA 5KYIA 1ESFA 1MGSA 1WCMH 1KDAA 5GADC 1PRTC 4C3JH 2J7ZA 4HJAA 4DR3L 4HPSA 4X66Q 3CF5A 4I7AA 4KMUC 2K7VA 5DEHA 2JA9A 2KCCA 1SE2A 1II3A 3S9LA 4R3LA 3TQYA 3GTJB 1IKLA 4B3SL 1VQ7A 2NBFA 2OQ0A 1QVFA 3BJ8A 2WP8J 4LX9A 1F2LA 4F8ZA 4A3BB 3E6ZX 4C7HA 4ZKCB 3RZDH 2KHSA 1KC8C 5C4HA 3GKRA 4L5RC 2VBQA 4FVMA 1PH4A 2XNAC 1H8LA 2CNSA 4HCSA 2I5HA 4LFBL 3IU2A 4CKBA 1I5FA 1K8GA 1R57A 5FO9B 4BA2I 4UWIA 3SXNA 4O42A 1DOLA 3DUZA 3PO2B 2XRQD 5DM63 4NEXA 2PJ1A 1VIXA 4DV1L 2D0OA 1AH9A 4KS9A 2WACA 1EFID 1EY5A 2F0QA 3FBUA 2Q2HA 2EJFC 2L0CA 4CPAA 4C1NK 4BMHA 3H8EA 1HFNA 2I5MX 3KHZA 1ILQA 4PK2A 2A68D 1YX0A 4UFWA 2IMOA 5C5LA 1Z4EA 4A3IH 5JEAH 2KCWA 2RB7A 1BCPB 3FDTA 3FKIG 1TWAH 4HIOA 3OW2A 2R8VA 4NKLA 4XYOA 4JI0L 3I73A 3KJPA 2PJ9A 2FE7A 3SXHA 5CBAE 1C48A 3AFPA 1MK4A 2F0PA 1EIYB 1MSGA 1ZG7A 4IPDA 2E2IH 1CKMA 4FD4A 1YK3A 1YMEA 4NMZA 2UUCQ 2EYJA 4X65L 4GM5A 3PB4X 4IN3A 5FO7B 4LQGA 3VR5A 3H8FA 3VATA 2AQ3B 3P20A 3I72A 3W5OA 4JPBW 1F9PA 3J7YW 1XTDA 3D2MA 4BBSB 2MQHA 3UI2A 2K5HA 2DXQA 1YHAA 1BPNA 1S3OA 4PQXA 2CTCA 3VA7A 4XDXA 3VYUA 4GKKQ 2WSAA 3KYHC 2K28A 4FDBA 3QR8A 4DV5Q 1X56A 5EC4A 4MHPA 5J8FA 5FLMH 2R7DA 3SEBA 1JOQA 4U5YA 4OHJA 3W6SA 4F0YA 3W1BA 5LRKA 2Q44A 2UXCL 1H9SA 1SE3A 2E2IB 2KENA 1IW7C 2JEWA 1YW6A 3OMGA 3ER0A 2A6ED 2PSWA 3RLFA 5JVG3 1S40A 1Q46A 2NVQB 1YZ6A 1GHJA 4YY3Q 1LACA 2B2YA 3DM1A 2KCMA 5LMUL 4JBMA 4L8AA 3TOAA 1B2TA 3S2HH 3CD6A 3KJOA 2YNDA 2IWHA 1B70B 2PYKA 1MJCA 2F0SA 2N78A 1TS3A 2AHOB 3C1FA 1BCPF 3ND8A 4G57A 3STBC 1J5EQ 4KY7A 1SE8A 4C3HH 2F0WA 3CCQA 1IYKA 1A15A 2ZEOA 4OO1H 3LGJA 3P2HA 3ERSX 3KR5A 1BAVA 1VQEA 4BA1I 2G9DA 5GAGC 3EBEA 3GTQH 1HUMA 4C2YA 1HQMC 1S72A 1LTGD 5IOCA 3UDIA 4A3GG 1XE4A 1G2SA 1R43A 4IFDI 1N33L 1VHSA 4OO1I 4E6IA 4IFDH 1I4HA 1TWGB 2D5DA 3RNUA 3NWTA 4AG7A 2RF4A 2ZEDA 2A74C 2Q0YA 5EJWA 1TWCB 4GKJQ 4JI1L 1D6EC 2QILA 4NXMQ 4JYWA 1TS5A 2ZEMA 1N9WA 4Q36A 5EBDA 4JJXA 1ET9A 1X12A 1D2BA 3S9MA 2A69D 2K32A 4HJ7A 5LRJA 1OXTA 1X3FA 5FO8B 2P6GA 5J22A 1VDZA 1PH8A 1WYDA 5J39A 2ZEPA 4CYQA 2Y0MA 2ZW7A 2VUMB 2D4PA 1I4QA 2JSOA 4OIKA 2B2WC 3PV0A 3U9OA 2JDCA 3OIPA 5LMNW 2V8GA 1B3AA 1M4DA 4CGNA 2I0QA 3CKIB 4H13C 3U9SA 4B13A 1O7IA 1EIHA 2YTXA 2ZW6A 2V8HA 3NSWA 4I65A 2UUBQ 2NUCA 2D62A 3TO7A 2R93G 4F0XA 1EZ8A 2DPTA 4QGUA 3R9FA 3L0OA 1GO3E 2AUKA 2AKWB 5K8PA 4IUPA 1HR0L 3NH8A 4IAVA 1B7YB 2KEEA 3FKIB 2F52A 4DV2L 1EY4A 3I4MH 3FVLA 1SYEA 2PRQA 1PA6A 2F0JA 4BXXH 5IYBG 4G4KA 1XPUA 4OX9L 4MFKA 3K58A 4Q38A 2XWJB 5BN5A 1A0IA 3EQLC 2Z3OA 1QUQB 2VS1A 1WJJA 4UBRA 2F4IA 3M7GA 1KIXA 2I5LX 4LAAA 1CA6A 3S14B 5IP9H 2H5MA 4KLWA 5IYCG 1PYTB 2OZHA 4JYAL 3K0YA 1E0BA 4CAEA 1CZGA 2OH1A 1PH2A 2KBNA 1KDCA 3T1HQ 3RUZA 3HOXG 1D5ZC 4DR7L 1SFOB 1KTKA 3IAYA 5DAUA 4A3GB 4B6ZA 3M4OB 3CPWA 1F9RA 2K1BA 4K3NA 5FLXc 4YGOA 4IPCA 3GTPH 2B2YC 2X6LA 2RSOA 3S2DB 5LYDA 1TKWB 4GLAC 2PJ5A 3F1ZA 4J1MA 3S15B 4P72A 4A3CH 5IIFA 1CHPD 1WVLA 4IPGA 2PVVA 2AFXA 3D67A 1PZKD 4YU9A 1MSHA 4KOUA 1YITA 1JE4A 2RFHA 3VWEA 1WI5A 1E2WA 4C3JG 5LHY1 3IO1A 2PR8A 1VKCA 3S6HA 1IXRA 3OW7A 1PDQA 3ULPA 4YRHA 1HQRD 1S5DD 1NSNS 5D65A 1HNWQ 2H1EA 2IT1A 3RR5A 2BA0A 2BCOA 2FMCA 2B3GA 2UU9Q 1QSMA 1I12A 3CW2C 4P6YA 5IP7H 1V9PA 4TSSA 3I4MB 1P8LA 1FR3A 3FKIH 2B2UA 3CXCA 3V7ZA 1SEBD 5C5MA 3JAML 4DV0Q 3S16B 2PNRC 3D0FA 1S7FA 2C1CA 2EVNA 5CBMA 2V8VA 4K14A 4AQYL 1DM0B 3I4LA 3N6RA 4ZK9B 4RH6A 5HMNA 3HRZC 1N34L 1G8ZD 5IYBH 1KUXA 2AJ6A 2O4HA 3FHWA 4ILWA 1VQNA 3SVMA 3T16A 2HCCA 2JE6I 2KEDA 4A3FH 3MXUA 2E76C 4DV5L 3CCRA 1XPOA 1ELMP 4JV5Q 1ZG9A 4KORA 4KSIA 4LFAL 4IUUA 4DYOA 2ZT9C 2ZELA 4NGRA 4AVCA 2X6GA 4B5PA 2LS01 1EWHA 2PJAA 2EJMA 3PUWA 1A3UA 5HURA 4MN3A 1VQAA 4C2XA 3AU7A 2KUMA 1FGUA 4F87A 4HR7B 3J81j 4AH6A 5IYDG 5HVHA 4Q7AA 1JOOA 4A4IA 1UWVA 5A2QL 3I90A 1VQMA 1LM0A 2DN8A 4LUOA 1NMFA 4OXPA 1YJWA 1HXYD 1BF4A 5HY6A 3GTGH 4JXRA 5EPLA 4ZI6A 1IBML 3GTOH 3T56B 1TIID 4X3RA 2BE5D 4PMBA 1X54A 5IODA 3B35A 3FP9A 3KDFB 2NZHA 3FYNA 2OXPA 1JJGA 1T5XD 1XNQL 1U4MA 3NH5A 1A6XA 1O7LA 2PW7A 3KQXA 1VQHA 2F0GA 2EYOA 2ZTEA 2L5TA 1E1TA 5EKIA 3IWWA 3SI2A 1E2VA 3TRZA 4UDUC 4JI1Q 3I56A 4IO9A 2V4DA 1TWGH 3T1YL 2ATWA 4DR7Q 1O80A 1W6KA 3EXNA 5C82A 1X9NA 2D9UA 4OEMB 4DAVA 3PUXA 3BS1A 1IICA 3K59A 2WUUA 1ZKOA 2HB6A 3D8GA 2AUJD 4C1NI 1X3GA 2PZWA 3S2HB 4PV6A 4JLYA 1LT6D 2PI2E 4A3KB 2CWAA 3GP7A 2AFZA 2K5QA 1STNA 2WB1G 4L6TB 4ZQ3A 4LF5Q 1V0CA 3O13A 4R7MA 4FP5D 1GUGA 2ZOGA 2QDLA 1QE6A 4DV0L 1IZ6A 2CNTA 2ZEHA 5F46A 4OWWB 4H6ZA 4PPZA 2OB0A 1NCVA 2B8FA 4A75A 5E3FA 2L4NA 4CDCC 1DYQA 5KIXA 5AGEA 3N5FA 2UUBL 2QF7A 3J81L 3NE7A 2YTYA 1HZCA 2IPKD 4P74A 2AFMA 4N8FA 2JA7B 2YU9H 2DPSA 1UEAB 2ZTCA 4DN4M 3VWDA 1DOKA 3IEHA 3LWUA 4C68A 5CBEE 2ATRA 5EMIA 4EQOA 5M5WH 1Z6HA 2JA6B 3BG3A 3D66A 1U0LA 3EIVA 1PXUA 3A56A 4TRDA 4JI8Q 3IKJA 5LL6S 4NP5A 1PTOF 1Y8PB 4LF5L 1J8IA 4POGA 3SR1A 3Q24A 2PE3A 1VQIA 4B3ML 4UAIA 4A93H 2R1IA 4MY3A 3CC2A 5AJ3L 1MJBA 4A32A 3U4VA 2L9HA 3K6OA 3NXWA 1VS0A 2VW9A 1XRYA 1U4LA 4MJ8A 4YWLA 3BYYB 2F4VL 3OMCA 4DXGA 5JEAG 5JJLA 4JI2Q 3UE1A 1SYCA 4RCOA 4YIJA 2J9AA 1YJNA 2EY5A 1NTGA 1V1QA 1Y1VH 3CP0A 4Z65A 3QAYA 3HFZB 3SGIA 1ZLIA 4UEFA 3K9TA 2MGSA 1XNQQ 1K0RA 3TE4A 1TIQA 3I3GA 1D1KA 1F9QA 2QKIC 2ZM6L 1BCPD 4WJWA 1CQVA 3C2PA 3G3SA 5LMNL 3PF4A 1Z8TA 3SHPA 1QB5D 1UWYA 2ENBA 1YHQA 3DR6A 1PTOH 1SR3A 1BBWA 2V1CC 4RUHA 4UWJA 1NE3A 3GYAA 2Q2UA 1QUQA 1QZGA 4CGYB 1GUOA 1A2UA 4YWKA 4ZYSA 2B4DB 3V2TA 2BEIA 1OO9B 3ONAB 3T90A 2Q7BA 1Z4RA 3H0GB 1Y14B 3QO2A 4YY3L 1N36L 1IHZA 3AMUA 4UCMA 3PFOA 3HOYB 1A3TA 5IE8A 1Y9WA 2EQSA 1K8AC 1XWEA 1P4NA 4O1NA 4NGPA 5FLXE 1V1PA 5KTDA 4FBEA 4HAEA 3MVVA 3B3SA 1BO0A 2G5DA 5EKKA 2Q51A 2BH8A 3SK4A 2PQ8A 3M9BA 4GKKL 5IGBA 1LTID 4KUAA 1TKHA 5DNFA 3DMUA 4MHDA 3KOJA 2RCNA 2ZJPA 4GN5A 5C4JB 5T1IA 4AVAA 1JQGA 2RQXA 4L5SA 1UE1A 4A3FB 1XNRQ 4NGTA 4OC5A 4OC2A 2NZ1D 3GD7A 1PVOA 3SK5A 4KSFA 3RN5A 3FH4A 2UUAL 1IBMQ 1I1DA 2JBKA 2EYHA 3R3OA 4OO1G 4A3KG 1PU9A 3G4SA 1EIFA 1HH2P 4KVXA 4F9UA 5I9OA 4WORA 1H9MA 2NSMA 1MIUA 4ID6A 3T9YA 3ISXA 1BXTA 1TF9A 4NGSA 3MXGA 2F3IA 4IALA 2UUAQ 3FMCA 4Y52H 4UCPA 4QBJA 1AW7A 1KRTA 4II9A 1CG2A 4MIUA 3PBBA 1PRTF 2J0TD 4NB3A 1ENFA 1NUCA 4X3KA 4JI7Q 2VXKA 5C3EG 1HFGA 5AG6A 3J81c 3JTKA 2EJGC 2JBJA 4R4OA 4K8JA 4P4EA 4ZBGA 2NVYH 3B3VA 4CRYB 5COYA 1FYCA 1V1OA 3TREA 3S15H 4K5XA 2IY5B 3PRTA 1MBYA 5KRUA 3K7AH 3PB6X 3A55A 4ZLTF 3CC4A 1QQ9A 4XPDB 4HEDA 4X2TA 1I94Q 1NSLA 4CKEA 2G9HD 3PMFA 3M4OH 5K36G 1WTHA 2WIIB 1YIJA 3R95A 1E1OA 4KHPQ 4MHNA 4A3JH 3HKZG 4AYBE 1QNUA 1LO5D 4P45A 5AG5A 2FL4A 2YTVA 1WTOA 3M7NA 3DWQA 4KLVA 4QIWE 1B9NA 1ARLA 3PEIA 5EGTA 1E2ZA 1K28A 4YWMA 4AB7A 3PZJA 1WFQA 3OWFA 2HQYA 4A39A 3HOVG 3GLJA 2KCTA 2VQEL 3M4QA 3CQZB 2Z4HA 2YYZA 3B3CA 2CF4A 2EBJA 4DR3Q 3A8JE 1SJHD 1FJGL 3FJUA 2Q4YA 5GCNA 3CXQA 3IIBA 1N71A 3KHXA 2IJ0A 4FF4A 4NGMA 2PRBA 1OXXK 2I07B 3M4PA 3Q22A 2BOSA 4DK1A 4GN3B 1UFHA 1DXMA 4LUAA 3SI1A 1GM5A 1V43A 1ZYRC 2EY6A 3I91A 4HJ8A 1ONLA 4IFDG 5DWNA 4ZAIA 5GAEC 1NR4A 3S6GA 1YVCA 2KOLA 4EQPA 4JBJA 2QYVA 2C35B 3W2DA 2KCNA 2L15A 2CKZB 3KLWA 1UE5A 2QA4A 2WYRA 1SNQA 5H1SE 1OZPA 2DF5A 4M6HA 1HZAA 4CS0B 1I21A 2PW5A 4QB9A 2VUMH 1U9RA 4RHSA 3H15A 2NMTA 3HOYG 3PIOA 3PO2G 2BDNA 2RDHA 5CMDA 3GTKB 1SJED 2ARHA 3K80C 2A8VA 4NSQA 4X3TA 1PRTD 1XMTA 1BLLE 1IKMA 3NBHB 1R9TH 3OIQA 2ZW4A 3I70A 4RMFA 1I6HB 1CX8A 3PO3H 4DAYB 1ML0D 3SHLA 1YNND 1RO5A 5IGEA 4DR5Q 3TFYA 1QVCA 2RVLA 3FVQA 2Q7SA 5CV8A 2Z3MA 4QVTA 1QOHA 2JXMB 5I6YA 4MRIA 3W1GA 1Z2LA 4R4TA 3EVQA 4IOAA 5A28A 1B44D 4M85A 3BZDB 2B3UA 1YR0A 4XT3B 4G1PA 1JB3A 3RBUA 2A73B 2R7FA 5C4XG 4CJ0B 3GTQB 5E1FA 4P73A 2UXBQ 1NR2A 3VYTA 4GN4B 2PDOA 2GVBA 3BVZA 5D14A 1FL0A 4FWUA 2Z3LA 3TS0A 2FIWA 3T51B 3P7JA 1SDFA 3B3WA 4Q0FA 2ID0A 3CCUA 1EOTA 3CCEA 4A3EB 3CQZH 1MI2A 1BPMA 5ELEA 3S6KA 2FIAA 1CA5A 1LCPA 3MHBA 1QSNA 4DV3Q 4NFRA 1ZG8A 4LF8L 3S17B 4A37A 2C27A 2EO8A 3ICEA 4N8X1 2E75C 4H89A 4M6IA 1VHOA 4OELB 3NTHA 3HOZB 1S5CD 1AUGA 1Q2YA 4M6GA 3P75A 3TP8A 2CVRA 2E2JB 4ZX8A 2Q43A 2FCKA 1F2PA 2MUYA 3FPPA 2QEXA 4JI6Q 1YGHA 4R8IA 1I6VC 3LNNA 3A54A 4CGMA 3OYYA 3J80c 1N33Q 1K3BC 1N32Q 4HNXB 2Q2IA 1VGYA 5E4XA 2PC1A 1HCZA 1LTSD 1TT2A 2K5WA 1G291 4JI6L 1QJOA 2F0NA 1EQQA 3PB8X 4KSAA 4UPAA 4MFPA 3MEHA 1KDBA 1GUNA 3WOEA 3JAME 3GV6A 3HOZG 1H9JA 1ON0A 2JA7G 3RN2A 2F3WA 4K5VA 4O0AA 1BOBA 1BUVT 2J8NA 2HCIA 1LYLA 5IT9c 3H3VC 2EYPA 3QB8A 1A62A 4FXGC 4YFJA 2E5LQ 4B3RL 4PNYA 4KLKA 1MHWC 4WRDA 5JAVA 1VF5C 5CV5A 1V8QA 4KJNA 2CH4A 1S5BD 1Q1EA 4X3UA 4PZ7A 5KEEA 5M3FB 1EWCA 3CCMA 5C6AA 3KZWA 2QGQA 1TWAB 3EFXD 3RZOB 2IJZA 3W3AA 4HN7A 2WB1E 4C7IA 4DA2A 2QDBA 1CP6A 2I00A 3IWEA 4IQZA 3G71A 1BDOA 4BBRG 4A3IB 3KFUA 2AQ1B 5C4XB 1EEFD 5IX3A 3CPFA 2RHSB 2DGYA 2XGTA 5ELBA 1LOKA 1PZJD 4R9WA 5EAYA 4BY1G 3TZUA 2FJ2A 1MJ9A 4BD9A 1I3QB 3I4NG 1VCIA 4JW0A 1TY0A 4LK1C 5ELDA 1IBLQ 4G7ZC 3S1NB 2F0LA 3IFTA 3KF8A 2A68C 4X65Q 2OZGA 1NJIC 5KGUA 3D2PA 1NY4A 3D7GA 1KRSA 1EQTA 4KI0A 2R7ZH 4FF2A 3IC1A 1STEA 1E3PA 3K5NA 4BXXG 3KBGA 2AMCB 2VZYA 4RS2A 1N34Q 1LT3D 4HJ9A 1DOMA 1KLGD 4A3BH 1X10A 1T5EA 2JP1A 3TEHB 2IL4A 4BBRH 4UP7A 2M2LA 3TOBA 4MMOA 2SDFA 3PSIA 3L7ZC 1Y1WB 1HDUA 1STBA 1JQYD 4PZ6A 5IP9G 1HNXQ 2ZEEA 1VQ6A 4WWVA 2FFKB 5FJ8H 1B6BA 1EQVA 2B58A 2A1AA 1EE3P 2D4OA 3MXNB 3I3CA 3R2IA 1OBRA 1IU8A 5AG7A 4NXML 2PJ4A 2SNMA 1F77A 3BJUA 4CJ1B 5HVGA 1O78A 4DPGA 3UDGA 3NWSA 4FO2A 2WAQG 4KN7C 3TP5A 4A3DH 1K0SA 1ARMA 1DTDA 2CXAA 2EK8A 5M5YB 1CI3M 3E9IA 4ZKBB 1GUTA 2EOTA 1EY9A 5AJ3Q 1YVKA 5M9OA 1PH6A 3SDZA 3RZOH 4UFVA 5HH1A 3M3YB 3EC4A 3D31A 3G7LA 1PCAA 5IGFA 1TKJA 3WT4A 3S1MH 1S5KA 2Z0ZA 1VHEA 1Q12A 5M3FH 3T53B 4P4FA 4CYOA 4RGNA 2NWGA 2P6FA 5LL6X 2D0PA 1L0YB 1P0HA 4EVYA 4DAPA 1XMOL 1AMPA 3CXSA 1STYA 2Z6BA 2NVTB 4JVZA 2CHBD 3BVGA 4X62Q 5CORA 3QAHA 1EIGA 1AZQA 5EBVA 2OOTA 3IL8A 1STAA 2VQEQ 1D1IA 1LFWA 3HOVH 4MY0A 3UDFA 2BL1A 5FVJA 4PXEA 1XNRL 1QSOA 1EU4A 4DR6Q 2C6PA 2E2DC 1JICA 2F3VA 5ISVA 4K6DA 3HOVB 5HVFA 4OL7A 3PP9A 2RSNA 5T1GA 2XVSA 4XPKA 4DR4Q 2NVTH 2L55A 1ZYRD 3TCVA 4OLLA 1PLFA 3H6MA 4KZTA 1TKFA 4CYPA 5K5PA 4KUBA 1YBYA 2VY3A 1HNZQ 2PJ3A 4C3IH 1PFSA 2PNHA 1YNJC 3Q6SA 3OSOA 2GANA 1XJVA 3S1MB 4A93G 2C9OA 2C6GA 3VYSA 3LACA 3MAQA 5C3XA 1RODA 4GS4A 2ZOFA 3EJIA 3S1RB 3NE5B 4UIBA 2AWOA 3S17H 2F0VA 3NBIA 1HZBA 1KAAA 4UA3A 4JI7L 4FF3A 3NELA 4DK3C 1Z8WA 4IHMA 4FNFA 3NHHA 2PCUA 1BQQT 3HP3A 3CCSA 5IP7G 4PSXA 2NB0A 2Z8LA 4XPDC 1C9OA 3F2UA 3ZJYC 1YJ9A 3SK8A 4PV1C 4X6AH 4B3TL 5M5XB 3PGPA 2IL8A 2Z6KC 4A3KH 1G51A 4A3LH 4YCUA 4FAIA 4YWYA 4UP8A 3F0AA 3DR8A 4BBRB 3MC0B 4L5QA 1PH7A 2OT2A 4LNQA 3SE0A 2PR1A 1SYFA 2K01A 1Q1BA 3GTLH 1K3RA 1F57A 1KHIA 3M85A 4LFCQ 2ZPAA 2QJ8A 4DR1L 1S7LA 3FNCA 2I79A 3C1EA 2F4VQ 1MJAA 2Z10A 5IGGA 2K6AA 3Q0AA 4JI2L 2VEZA 2SOBA 1A2TA 1VMCA 3FF3A 1RCVD 2KQ3A 2N49A 3EN2A 3S1NH 3JUWA 5LRGA 4XTCS 1OXSC 1UE6A 4RGMA 1CJWA 4DFAA 5CV6A 4BBHA 1ZXTA 3TN2A 3F5BA 1RL2A 2C5CA 4OMEA 2ODFA 1T9HA 4B08A 1CFMA 3VYRA 3SJFA 1R9TB 3X3MA 1O7YA 2FINB 1ZLHA 1H9SB 3H94A 2JJQA 3C26A 1PTOB 2D2CC 4B9WA 2F0HA 1TR5A 4Q5VA 4O2DA 4NXNL 3W6XA 2E74C 4B12A 1CUKA 3KLSA 1WTVA 4JI3Q 2GU2A 3BI0A 5E96A 5BWAB 3A8KE 2O53A 4PXCA 4LW1A 1B53A 3PB9X 1JB7A 4IFDJ 1B1ZA 4UFXA 4CBVA 1SMXA 2PIYA 2OTLA 2BUEA 1Y1VB 4OC0A 3I4OA 5F2DA 3E0JA 1VQLA 4JI4L 1TWFH 4LWCA 4EQNA 4QC6A 1BBUA 5IT9E 3NQIA 3D68A 2REFA 2DY8A 3AQQA 4PK3A 4DR1Q 3V8IA 4B5OA 3TDQA 4P71A 4P75A 3S9NA 4MBUA 1RJTA 3BDOA 4JOIC 5JEAJ 4U9ZA 1RTNA 3JVNA 1WD1A 2EPBA 3BXMA 1CPSA 2AFUA 5D29A 1Q3LA 2E2HH 4H44C 2CTBA 3RLNA 4LF4L 2FS5A 1A2ZA 3ZYYX 4N9PA 2Q8IB 1IB1E 5G22A 3MZ5A 2JA6H 1LV9A 2PZUA 2EDGA 2E8GA 1S3ZA 3K8AA 2RA4A 1CBXA 2JA7H 5BN3A 4JI0Q 4EVOA 4AYBB 4H2KA 3TT2A 1KD1C 2XWBB 5EBCA 4ZY0A 4KOYA 1HHVA 2QEJC 1EFWA 4A3JB 1YQEA 3HS0C 4U673 3S1QH 2PIZA 4J6HA 3K5MA 4DV1Q 1VQ5A 5C3EB 1QMUA 3LWEA 4IUVA 1AZPA 3OTOQ 2EYMA 4Y7NB 1I50H 4NXYA 1FT7A 4FUUA 2ZJQA 2GN5A 3S2DH 1JWUD 4ME5A 3SJGA 3FECA 1I4RA 2IQ6A 2AQ2B 2NVYB 5I6WA 3BLNA 4A3JG 4R1JA 4A3GH 4X8IA 2HUGA 4H7BA 2LFNA 1LT5D 3S24A 1BKBA 3OOCA 1AE2A 1IYJB 2EVBA 3FRMA 2OCEA 4DUZQ 2QW7A 1DZ1A 2LXKA 5IT9L 4JOIA 2PJBA 4GOPB 4E2AA 2KA7A 2M9VA 4GNXC 1FGBD 1JMCA 2AFWA 1A3VA 4NW2A 5KYLA 1IBLL 3D4UA 3NQTA 2AFSA 2OZUA 4OWXB 2Z0SA 4DF7A 3QNVA 4JI3L 3FPUB 4RGTA 4KVME 4A33A 2CQAA 2BDOA 2PO4A 4R57A 2F1MA 4CHTB 3L2PA 3IWGA 3NUCA 2XIWA 3BI1A 4MHZA 4NXNQ 4LUVA 1J4JA 1IBKQ 2CCZA 1L2FA 1CZWA 4B10A 1W3SA 2GE3A 3ERQA 2A19A 1PH9A 5A35A 4DR4L 2K50A 4C56C 3A7LA 2JA8H 1LTRD 5ISRA 2AWNA 3E3XA 1Z8XA 3PQIA 3CU7A 1TWHH 3TTHA 2JYOA 3NA6A 2CWPA 2JN4A 2BE5C 2M00A 4RA8A 2F0UA 2OTJA 1IBKL 4GNXB 3TMEA 3TS2A
chains in the Genus database with same CATH topology
1B4OA 5DM73 1AN8A 1UNSA 4HTHA 1H9RA 2L11A 2WV6D 4MCRA 1U4RA 1F2ZA 1H9KA 2GLFA 5IB9A 5EQ0A 1R4QB 1SMYC 3R8BA 3D4DA 2R92B 5LYLA 5I9PA 3I4NB 4TWEA 2K04A 2XEJA 3V96A 2I3CA 4K5WA 5FKAC 1JORA 2H4OA 1ICWA 4L63B 5I4DA 4M8AA 1S5FD 1EYCA 3D3RA 5CR3A 1TXRA 1CT1D 3H09A 1I4GA 1JCKB 1YNJD 4WFN3 1XTCD 2NN6H 3MTSA 1J9OA 1LTTD 2LY7A 2A6HD 3L2NA 1SXTA 2RKSA 1TQOA 3H8GA 4ZY2A 3J81E 5J1QA 2PVWA 3WOFA 4DGZA 4A94A 2B2TC 1C8CA 3GTPB 4A93B 1TF8A 1Z8LA 3VA5A 3ITPA 3S1QB 3VH9A 3PBEA 4AXVA 5G3LD 3FEEA 1Z7TA 5JOBA 3N52A 1VMPA 2F0IA 4EGVA 4K2KA 2JEBI 3WABA 2YU9B 4OC1A 4BY7B 4V190 1STGA 2ICEC 3CT9A 5JPMC 2ZXRA 5JPNC 1L0XB 2QVPA 5EPJA 1DONA 5CV7A 3M4YA 1V1PB 4PMCA 3QWNA 1G91A 3B3TA 1I4XA 3MXPA 5E4WC 3GV3A 3WC6A 5F09A 1YSJA 5CV9A 4B9XA 2OF1A 2WAQB 3DHQA 3VR6A 2IX3A 1FNVA 4DXFA 4P44A 2BO9A 1TS4A 5I4MA 4UIAA 2EK9A 1M4LA 2SNSA 1EY8A 3FX6A 1RTQA 1LANA 5JGFA 4GZYC 1F2MA 3DXJC 3KLRA 3H91A 1XYIA 1HA6A 3S9NA 3Q23A 3HLPA 4O23A 2MP1A 1CTMA 2DNCA 2DEAA 4WJBA 1PFNA 1OXUA 5LYIA 2FHTA 1S4ZA 3JRUA 1LAMA 3ND9A 3KGQA 4RAUC 4U68A 1FD7D 2BA1A 4MHEA 1TS2A 1AFPA 1YLOA 7CPAA 3KBXA 1IL8A 2PMZB 1B9MA 4LMQD 5THWA 2F0KA 3QG1A 1PTOC 2ZEFA 4I7ZC 1YNNC 4DU9A 3DWAA 4XQJA 2PJ6A 5FLXL 2BOAA 4DNTB 4C2MB 3NFZA 4DNRB 2C6CA 4KD3A 3J80E 2AFOA 3MN8A 1QNKA 3KL9A 5CC4A 2HDLA 4FYDA 4XT1B 2EXZA 4F88A 1AP0A 1Q90A 1BBXC 2OR4A 1GXDC 4UF4A 4IUNA 3BHXA 1WTRA 2B2TA 4F8MA 3D7HA 2PCFB 4P4JA 1HDQA 1BR9A 1I4PA 2F03A 2K33A 3SJEA 3KUPA 1DCZA 1S5ED 4K6LA 2XN9C 3IFEA 4W9YA 1HTLD 3TX8A 4N9TA 1RKNA 5JJZA 4IUTA 2VNUD 2K05A 3MFGA 1Q8IA 2PQEA 4QCLA 3GTMB 2A6EC 5I2XA 4H0LC 1GYTA 1KABA 4OC3A 1TVXA 4F7XA 3GTOB 3QOLA 3X3NA 4P4DA 3I8ZA 1G6ZA 1XMBA 1UUPA 2R7ZB 4JBWA 3OWEB 2NVXB 2SEBD 2XEGA 4RFBA 1KLUD 1DJRD 4RKLA 4P4BA 3S9WA 4KK7A 2R61A 4PXBA 1SAPA 3IFDA 3MFYA 3V38A 2NN6G 1HA5A 1W6JA 4ONWA 4P4IA 3OPOA 3HKZB 3WC7A 1WCMB 2WKCA 1ILPA 2L12A 1EYDA 1BNZA 1SNCA 2JA8B 2GA4B 2NTSA 1LTBD 4P10A 2CW0D 3TSSA 4J8QA 4HMIA 1TY2A 5AFWA 1RTOA 3NPPA 4QUCA 3C3LA 3NK9A 3P1HA 2Z4IA 1Y69U 2B2UC 1U4PA 2EE1A 4MXUA 3T8WA 5IGDA 3IJ3A 2Z1CA 1PFBA 1IW7D 1EYAA 1I50B 3PIP3 3TC8A 2FMMA 1NSAA 1Q7LA 4MHYA 1OXVA 3QIAA 1F2YA 1EY7A 3I1UA 3J7AV 5C0XH 4KY5A 2VB3X 4RGOS 3A7AB 3K5LA 4PXDA 3LMSA 4EMEA 4HSPA 5KNBA 2PZTA 3DGVA 2HDMA 2KVMA 3GO5A 1JC7A 1F9SA 4MCSA 5KNDA 1HTPA 3TP7A 4ZY1A 2O5JC 4KD4A 1UAPA 2ICIA 5K8MA 5DS0A 4IURA 1B50A 2E2HB 4BS9A 5ELYA 1SNDA 3CHBD 1JWMD 1VF7A 3TBIB 1LLRD 5JVH3 2B8GA 3L3OC 2RDFA 1NAPA 4EWTA 2R6GA 2KJXA 1CM9A 1DD2A 2V8DA 2EZVA 3SJXA 2IX0A 4KHVA 3T13A 4CKCA 1IYUA 4ODGA 4HSVA 2B63B 4HCEA 1CPXA 4OIWA 4UEEA 2Y0SB 3QOJA 4A3MB 2QCPX 4NJRA 2F0OA 3PB7X 4DK0A 2O5IC 3PUVA 4C3HG 1GUSA 2IW3A 3RZAA 2ZXOA 4PQAA 4KN4C 4XIGS 3D6WA 1SNPA 3K2KA 4OIDA 3GTLB 4TQUS 5KNCA 3EA6A 4OC4A 1LAPA 3NTKA 3VR3A 3K57A 4NJQA 1EEID 4XQQA 1XX8A 1EY6A 4C3HB 4MCQA 3BVMA 1PYWD 4UEZA 1QCBD 5JH9A 2EY2A 5EPKA 4ZUJA 4C3JB 1FNOA 2J4XA 4XQNA 1LABA 3MA2B 2WINB 1SYBA 3PFEA 1CK1A 2XEFA 4S3SA 4XYQA 1QILA 1CQFA 2F8HA 1JOKA 3CPAA 5A2QE 1PFMA 3PIO3 2B2VA 2PJ0A 3HZXA 4BY1B 3NP8A 4TKOB 1Y0RA 2VL1A 3L9AX 2DNEA 5K8NA 3GB0A 4G7HC 4ZX9A 2EYLA 3HOWB 1KWMA 5K36H 1RDPD 1EZ6A 1PTOD 3HUVA 2GREA 1O7ZA 1RHPA 4V0BA 3MXNA 4R8FA 2PJCA 2LKVA 1PRTB 4DJLA 1HEEA 3FRPB 2V77A 3J80L 4QMGA 4ZRZA 3KK7A 1D5MC 3GUXA 3QJYA 4K8IA 4OKOA 5D3DA 4PMWA 2N88A 3QB3A 2FVGA 3KLSX 4KJOA 4A3DB 5C0XJ 3HGBA 2ZENA 3NH4A 1STHA 3CDXA 2CIJA 4M1UB 4IUQA 5C4ZA 3HOUB 1R4PB 1QWYA 5C3WA 3C46A 2F0TA 1FNUA 5CV4A 3D6CA 1PMRA 2JA5B 3R2TA 3WC5A 5CGKA 1ENAA 3D4WA 1GOZA 2CW0C 3RD4A 3A8IE 1X3QA 3RZDB 4ZYQA 5HXDA 2O4XA 2NYQA 1Z47A 5TSSA 1K83B 5I2YA 5ELCA 1LT4D 1BCPC 1EY0A 3CRKC 3VARA 5M3MB 4BWGB 1IYVA 3TZDA 4KY6A 4FXDA 4ABNA 2WKDA 4XXEA 2NN6I 5IGCA 1AEXA 2F0EA 1XXGA 4KTAA 2K5DA 2WB1B 2Q4ZA 2MHVA 3CPXA 4R6TA 3T4AC 1TWHB 2N55A 3DEOA 5FOBB 2GLJA 2LMCB 4OP4A 5CPAA 3K5OA 2IX1A 1ENCA 5C0XG 4FF1A 4G7OC 2F0MA 2KECA 2ZXPA 2RBMA 2B2VC 4RKBA 4LJZC 1JR0D 3MRUA 2Q8TA 4CJ2C 1QG7A 2EYFA 4QB4A 5C44B 3PUZA 4NDXA 3FEDA 1FNWA 4QUFA 4NGQA 1SBBB 3AB9A 3ISZA 5M5WB 2VB2X 5FK9C 3OHXC 5NUCA 4RWSC 1HPCA 3J7AF 2PJ7A 2TMPA 4NGNA 3KQZA 1D5XC 1SNMA 2B2WA 1HUNA 3SK6A 2L1BA 3G6JB 1TU2B 3NTIA 2XEIA 1EL0A 1LTAD 4MCPA 4F9VA 3EROA 3E5SA 2X69A 3BYTB 1K8MA 4K2LA 3D7DA 3CRLC 1K8OA 4R76A 2DY7A 2Q8RE 4X3SA 2POKA 5JM6A 1WTXA 3V05A 4HMJA 2XSCA 1HRJA 2R3ZA 3NBHA 2B39A 1DE4C 1IGBA 3RAMA 1C4QA 3BDCA 1WTWA 4RCNA 1SNOA 4RHRA 2PPBC 4OIJA 4KKUA 3FEWX 2A5HA 8CPAA 1SMYD 2WZNA 3KR4A 4P2CB 1TWFB 1CHQD 3SI0A 2F0FA 5EKLA 2R93B 1WTQA 2O2LD 1G2TA 3GTGB 4KHZA 1Z5RA 1ZEQX 3PO3B 1SYDA 2K03A 3LX0A 3TP6A 3KI9A 3B2YA 2ANPA 4KKSA 2NYZD 5C0XI 3D4RA 5ELFA 3R93A 3D7FA 3RMHA 2MPMA 4TNUA 1CP7A 2ABZA 1ESRA 4QF4A 1YW4A 2A6HC 3DLJA 2F0DA 3B7IA 1SSOA 5CYUA 2VXWA 4R8NA 2PJ8A 3VR2A 3GQBA 2F7VA 1SYGA 4KKTA 1Y8NB 2EY1A 2MJ8A 3DEPA 5J1ZA 1GUWA 1X32A 3WDNA 1JWSD 2PJ2A 3HEJA 2A69C 1ELLP 5BN4A 1XBUA 4ZUIA 4JK1C 1XFOA 1BOSA 3KASA 1M4VA 4Z9CB 4QIWB 1X3PA 3BDLA 5LYFA 1PZID 4IZ8A 4C3IB 3PUYA 1XJOA 4KV6A 1AYEA 5K8OA 4OGQC 3URYA 5D8NA 4DUKA 1KNEA 1Y8OB 3K7AB 1RF2D 2RDGA 4FXKC 1GJXA 3DWPA 4C3IG 1KNAA 4EFDA 4JZ0A 2OEOA 1RD9D 5HGTA 1R3NA 3HOXB 2TSSA 1MD2D 3MWYW 1WD0A 4DAYA 1GHKA 4IK2A 2NTTA 1Y0YA 3VR4A 1Y7EA 1IY7A 1SE4A 1M8AA 2HQEA 2I46A 4L8JA 1F2OA 4A38A 1ET6A 2HC9A 4ULLA 3HG9A 1WTPA 1EU3A 2XRSD 5G3LF 2JEAI 5D3IB 6CPAA 2ZEGA 5KYIA 1ESFA 1MGSA 1KDAA 1PRTC 2J7ZA 4KMUC 2K7VA 5DEHA 2KCCA 1SE2A 1II3A 3S9LA 3GTJB 1IKLA 2NBFA 2WP8J 1F2LA 4F8ZA 4A3BB 3E6ZX 4ZKCB 2KHSA 5C4HA 4FVMA 2XNAC 1H8LA 4HCSA 4CKBA 5FO9B 4BA2I 4O42A 1DOLA 3DUZA 3PO2B 2XRQD 5DM63 2PJ1A 1VIXA 2WACA 1EFID 1EY5A 2F0QA 4CPAA 2EJFC 2L0CA 4C1NK 3H8EA 1HFNA 3KHZA 1ILQA 2A68D 2IMOA 5C5LA 5JEAH 2RB7A 1BCPB 3FDTA 4NKLA 4XYOA 3I73A 2PJ9A 3SXHA 5CBAE 1C48A 2F0PA 1MSGA 1ZG7A 1YMEA 4NMZA 2EYJA 4GM5A 3PB4X 4IN3A 5FO7B 4LQGA 3VR5A 3H8FA 3VATA 2AQ3B 3P20A 3I72A 3J7YW 1F9PA 4BBSB 3UI2A 1BPNA 4PQXA 2CTCA 3VA7A 4XDXA 3VYUA 2K28A 4MHPA 3SEBA 1JOQA 4OHJA 5LRKA 1H9SA 1SE3A 2E2IB 1IW7C 2JEWA 1YW6A 3OMGA 2A6ED 3RLFA 5JVG3 2NVQB 1GHJA 1LACA 2B2YA 3DM1A 1B2TA 2IWHA 2PYKA 3ND8A 2F0SA 4G57A 1TS3A 3C1FA 1BCPF 4KY7A 2ZEOA 2F0WA 1A15A 4OO1H 3KR5A 1BAVA 4BA1I 2G9DA 1HUMA 1HQMC 1LTGD 5IOCA 1G2SA 1R43A 4IFDI 4OO1I 4E6IA 4IFDH 1I4HA 1TWGB 2D5DA 3NWTA 2ZEDA 2A74C 5EJWA 1TWCB 1D6EC 2QILA 4JYWA 1TS5A 2ZEMA 5EBDA 1ET9A 1D2BA 3S9MA 2A69D 2K32A 5LRJA 1OXTA 5FO8B 5J22A 1VDZA 2ZEPA 5J39A 2VUMB 1I4QA 2JSOA 4OIKA 2B2WC 3PV0A 3U9OA 3OIPA 2V8GA 1B3AA 3CKIB 4H13C 3U9SA 1EIHA 2V8HA 3NSWA 4I65A 2NUCA 2D62A 1EZ8A 2AUKA 5K8PA 4IUPA 3NH8A 4IAVA 2KEEA 3FKIB 1EY4A 3FVLA 1SYEA 2PRQA 2F0JA 4G4KA 3K58A 2XWJB 5BN5A 3EQLC 2F4IA 3M7GA 4LAAA 1CA6A 3S14B 1PYTB 3K0YA 1E0BA 1CZGA 1KDCA 3RUZA 1D5ZC 1SFOB 1KTKA 3IAYA 5DAUA 4A3GB 4B6ZA 3M4OB 1F9RA 2K1BA 4K3NA 2B2YC 2X6LA 2RSOA 3S2DB 5LYDA 1TKWB 2PJ5A 4J1MA 3S15B 5IIFA 1CHPD 1WVLA 2PVVA 2AFXA 3D67A 1PZKD 4YU9A 1MSHA 1JE4A 2RFHA 1E2WA 4C3JG 5LHY1 3IO1A 3OW7A 1PDQA 1HQRD 1S5DD 1NSNS 5D65A 2H1EA 2IT1A 2BA0A 2BCOA 2FMCA 4P6YA 4TSSA 3I4MB 1FR3A 3V7ZA 2B2UA 1SEBD 5C5MA 3JAML 3S16B 2PNRC 5CBMA 2C1CA 2V8VA 4K14A 1DM0B 3I4LA 3N6RA 4ZK9B 4RH6A 3HRZC 1G8ZD 2O4HA 4ILWA 3SVMA 3T16A 2HCCA 2JE6I 2KEDA 2EWBA 3MXUA 2E76C 1ELMP 1ZG9A 4KSIA 4IUUA 4DYOA 2ZT9C 2ZELA 4NGRA 2X6GA 2LS01 1EWHA 2PJAA 2EJMA 3PUWA 1A3UA 5HURA 4MN3A 3AU7A 2KUMA 4F87A 4HR7B 5HVHA 4Q7AA 1JOOA 5A2QL 3I90A 2DN8A 1HXYD 1BF4A 5EPLA 4ZI6A 3T56B 1TIID 4X3RA 2BE5D 4PMBA 5IODA 3B35A 2OXPA 1T5XD 1U4MA 3NH5A 1A6XA 1O7LA 2PW7A 3KQXA 2F0GA 2EYOA 5EKIA 2L5TA 3IWWA 3SI2A 1E2VA 4UDUC 2V4DA 1O80A 1W6KA 2D9UA 4DAVA 3PUXA 3BS1A 3K59A 1ZKOA 2HB6A 3D8GA 2AUJD 4C1NI 2PZWA 3S2HB 1LT6D 4A3KB 3GP7A 2AFZA 2K5QA 1STNA 4ZQ3A 4L6TB 3O13A 4R7MA 4FP5D 1GUGA 2ZOGA 1QE6A 2ZEHA 4PPZA 1NCVA 2B8FA 5E3FA 2L4NA 1DYQA 5KIXA 3N5FA 2QF7A 3J81L 2IPKD 2AFMA 2JA7B 1UEAB 4DN4M 1DOKA 3IEHA 3LWUA 5CBEE 4EQOA 1Z6HA 2JA6B 3BG3A 3D66A 1PXUA 4TRDA 3A56A 3IKJA 5LL6S 1PTOF 4NP5A 1Y8PB 1J8IA 3SR1A 3Q24A 2PE3A 4UAIA 2L9HA 3K6OA 3NXWA 1XRYA 1U4LA 3BYYB 3OMCA 4DXGA 5JEAG 1SYCA 4RCOA 4YIJA 2J9AA 2EY5A 4Z65A 1ZLIA 4UEFA 3K9TA 2MGSA 1D1KA 3C2PA 1F9QA 2QKIC 1BCPD 4WJWA 1CQVA 1QB5D 1UWYA 2ENBA 1PTOH 4RUHA 4CGYB 1GUOA 1A2UA 4ZYSA 3V2TA 1OO9B 3ONAB 3H0GB 3QO2A 1IHZA 3AMUA 3PFOA 3HOYB 1A3TA 1XWEA 4NGPA 4O1NA 5FLXE 1V1PA 4FBEA 3MVVA 4HAEA 3B3SA 1BO0A 5EKKA 2Q51A 3SK4A 5IGBA 1LTID 1TKHA 5DNFA 3DMUA 5C4JB 5T1IA 1JQGA 2RQXA 4A3FB 4OC5A 4NGTA 4OC2A 2NZ1D 3GD7A 3SK5A 3FH4A 2JBKA 2EYHA 3R3OA 4OO1G 4F9UA 5I9OA 4WORA 1H9MA 2NSMA 4ID6A 3ISXA 1BXTA 1TF9A 4NGSA 3MXGA 4IALA 3FMCA 1AW7A 1CG2A 4MIUA 3PBBA 1PRTF 2J0TD 1ENFA 1NUCA 4X3KA 1HFGA 2EJGC 2JBJA 4K8JA 4P4EA 3B3VA 5COYA 1FYCA 1V1OA 3PRTA 4K5XA 1MBYA 5KRUA 3PB6X 3A55A 4ZLTF 1QQ9A 4HEDA 4X2TA 4CKEA 2G9HD 3PMFA 5K36G 2WIIB 4MHNA 1QNUA 1LO5D 4P45A 1WTOA 3M7NA 3DWQA 1B9NA 1ARLA 3PEIA 5EGTA 1E2ZA 3OWFA 4A39A 3GLJA 3CQZB 2Z4HA 2YYZA 3B3CA 2CF4A 3A8JE 1SJHD 3FJUA 3IIBA 3KHXA 2IJ0A 4FF4A 4NGMA 1OXXK 2I07B 3Q22A 2BOSA 4DK1A 3SI1A 1DXMA 1V43A 1ZYRC 2EY6A 3I91A 1ONLA 4IFDG 4ZAIA 1NR4A 2KOLA 4EQPA 2QYVA 3W2DA 2KCNA 2WYRA 1SNQA 2PW5A 1U9RA 4RHSA 2BDNA 2RDHA 5CMDA 3GTKB 1SJED 4X3TA 1PRTD 1BLLE 1IKMA 3OIQA 3I70A 1I6HB 1CX8A 1ML0D 3SHLA 1YNND 5IGEA 2RVLA 3FVQA 5CV8A 1QOHA 2JXMB 5I6YA 4MRIA 1Z2LA 3EVQA 1B44D 3BZDB 4XT3B 4G1PA 1JB3A 3RBUA 2A73B 4CJ0B 3GTQB 5E1FA 1NR2A 3VYTA 3BVZA 5D14A 4FWUA 3T51B 3P7JA 1SDFA 3B3WA 4Q0FA 2ID0A 1EOTA 4A3EB 1MI2A 1BPMA 5ELEA 4NFRA 1CA5A 1LCPA 3MHBA 1ZG8A 3S17B 4A37A 2E75C 1VHOA 3NTHA 3HOZB 1S5CD 3P75A 3TP8A 2CVRA 2E2JB 4ZX8A 2Q43A 1F2PA 2MUYA 3FPPA 4R8IA 1I6VC 3LNNA 3A54A 1VGYA 5E4XA 1HCZA 1LTSD 1TT2A 2K5WA 1G291 1QJOA 2F0NA 3PB8X 3MEHA 1KDBA 1GUNA 3WOEA 3JAME 3GV6A 1H9JA 2F3WA 4K5VA 1BUVT 2HCIA 3H3VC 2EYPA 4FXGC 4PNYA 4WRDA 5JAVA 1VF5C 5CV5A 1V8QA 4KJNA 1S5BD 1Q1EA 4X3UA 5KEEA 5M3FB 1EWCA 5C6AA 3KZWA 1TWAB 3EFXD 3RZOB 2IJZA 3W3AA 4HN7A 4DA2A 2QDBA 1CP6A 4IQZA 1BDOA 4A3IB 2AQ1B 5C4XB 1EEFD 5ELBA 1LOKA 1PZJD 4R9WA 3TZUA 2FJ2A 4BD9A 1I3QB 1VCIA 1TY0A 4LK1C 5ELDA 4G7ZC 3S1NB 2F0LA 3IFTA 3KF8A 2A68C 5KGUA 3D7GA 1EQTA 4KI0A 4FF2A 3IC1A 1STEA 3K5NA 3KBGA 1LT3D 1DOMA 1KLGD 1T5EA 2JP1A 2M2LA 4MMOA 2SDFA 3L7ZC 1Y1WB 1HDUA 1STBA 1JQYD 2ZEEA 4WWVA 2FFKB 1EQVA 1EE3P 3I3CA 3R2IA 1OBRA 2PJ4A 2SNMA 1F77A 4CJ1B 5HVGA 1O78A 3NWSA 4FO2A 4KN7C 3TP5A 1ARMA 2EK8A 1DTDA 5M5YB 1CI3M 4ZKBB 1GUTA 2EOTA 1EY9A 5M9OA 3SDZA 3M3YB 3D31A 3G7LA 1PCAA 5IGFA 1TKJA 3WT4A 1VHEA 1Q12A 3T53B 4P4FA 4RGNA 2NWGA 5LL6X 1L0YB 4DAPA 1AMPA 1STYA 2NVTB 2CHBD 3BVGA 5CORA 1EIGA 1AZQA 2OOTA 3IL8A 1STAA 1D1IA 1LFWA 4PXEA 1EU4A 2C6PA 2E2DC 1JICA 2F3VA 4K6DA 3HOVB 5HVFA 4OL7A 2RSNA 5T1GA 2XVSA 2L55A 1ZYRD 1PLFA 3H6MA 1TKFA 5K5PA 2PJ3A 1YNJC 3Q6SA 3OSOA 3S1MB 2C9OA 2C6GA 3VYSA 3MAQA 5C3XA 1RODA 2ZOFA 3EJIA 3S1RB 3NE5B 4UIBA 2AWOA 2F0VA 3NBIA 1KAAA 4FF3A 4IHMA 4FNFA 3NHHA 2PCUA 1BQQT 3HP3A 2NB0A 2Z8LA 3F2UA 3SK8A 4PV1C 5M5XB 2IL8A 4FAIA 4YWYA 4BBRB 3MC0B 2OT2A 3SE0A 1SYFA 2K01A 1Q1BA 1F57A 3M85A 2QJ8A 3C1EA 5IGGA 2K6AA 3Q0AA 2SOBA 1A2TA 1VMCA 3FF3A 1RCVD 2KQ3A 5LRGA 4XTCS 1OXSC 4RGMA 4DFAA 5CV6A 1ZXTA 3TN2A 2C5CA 4OMEA 4B08A 1CFMA 3VYRA 3SJFA 1R9TB 3X3MA 1O7YA 2FINB 1ZLHA 1H9SB 3H94A 1PTOB 2D2CC 4B9WA 2F0HA 1TR5A 4Q5VA 2E74C 3KLSA 1WTVA 2GU2A 3BI0A 3A8KE 2O53A 4PXCA 1B53A 3PB9X 4IFDJ 1B1ZA 4CBVA 2PIYA 1Y1VB 4OC0A 5F2DA 3E0JA 4EQNA 5IT9E 3NQIA 3D68A 2DY8A 3TDQA 1RJTA 3BDOA 5JEAJ 1RTNA 1WD1A 2EPBA 3BXMA 1CPSA 2AFUA 5D29A 1Q3LA 4H44C 2CTBA 3ZYYX 4N9PA 2Q8IB 3MZ5A 1LV9A 2PZUA 2EDGA 2RA4A 1CBXA 5BN3A 4EVOA 4AYBB 4H2KA 2XWBB 5EBCA 4ZY0A 1HHVA 2QEJC 4A3JB 3HS0C 4U673 2PIZA 4J6HA 3K5MA 5C3EB 1QMUA 3LWEA 4IUVA 1AZPA 2EYMA 4Y7NB 1FT7A 4FUUA 1JWUD 4ME5A 3SJGA 3FECA 1I4RA 2IQ6A 2AQ2B 2NVYB 5I6WA 4X8IA 2HUGA 4H7BA 2LFNA 1LT5D 3OOCA 2EVBA 1DZ1A 5IT9L 2PJBA 2KA7A 2M9VA 2AFWA 1FGBD 1A3VA 4NW2A 5KYLA 3D4UA 3NQTA 2AFSA 4DF7A 3QNVA 3FPUB 4RGTA 2CQAA 2BDOA 2PO4A 2F1MA 4CHTB 3NUCA 2XIWA 3BI1A 4MHZA 1CZWA 3ERQA 5A35A 4C56C 3A7LA 1LTRD 5ISRA 2AWNA 3CU7A 2JYOA 3NA6A 2M00A 2BE5C 4RA8A 2F0UA 3TMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJQ A;  3H8F A;  3VAT A;  4MCQ A;  4A39 A;  3GLJ A;  4UEZ A;  5JH9 A;  4MCR A;  1FNO A;  3B3C A;  2GLF A;  5IB9 A;  1BPN A;  2CF4 A;  2CTC A;  3FJU A;  3IIB A;  3KHX A;  4NGM A;  3PFE A;  5LYL A;  2XEF A;  4MHP A;  4TWE A;  5LRK A;  2F8H A;  3SI1 A;  2XEJ A;  3CPA A;  2JEW A;  1YW6 A;  2I3C A;  2PJ0 A;  2QYV A;  1Y0R A;  2VL1 A;  2WYR A;  5K8N A;  3GB0 A;  4ZX9 A;  1TXR A;  2ZEO A;  3KR5 A;  1BAV A;  1KWM A;  1BLL E;  2G9D A;  3HUV A;  1CX8 A;  2GRE A;  3L2N A;  1R43 A;  4R8F A;  2PJC A;  4DJL A;  1HEE A;  2V77 A;  1Z2L A;  4MRI A;  3H8G A;  2ZED A;  4ZY2 A;  5J1Q A;  2PVW A;  4A94 A;  3GUX A;  1TF8 A;  1Z8L A;  4JYW A;  4G1P A;  4OKO A;  2ZEM A;  3RBU A;  3VH9 A;  2FVG A;  3PBE A;  3S9M A;  4AXV A;  3FEE A;  2ZEN A;  3NH4 A;  5LRJ A;  3CDX A;  3WAB A;  2CIJ A;  4OC1 A;  4FWU A;  2ZEP A;  3B3W A;  3CT9 A;  1BPM A;  2QVP A;  2V8G A;  1LCP A;  4NFR A;  1ZG8 A;  4A37 A;  3WC5 A;  2V8H A;  1VHO A;  3B3T A;  5K8P A;  4ZYQ A;  4ZX8 A;  3NH8 A;  4IAV A;  5HXD A;  2Q43 A;  1F2P A;  2NYQ A;  3WC6 A;  3FVL A;  2PRQ A;  1YSJ A;  5F09 A;  3VAR A;  1VGY A;  3PB8 X;  4P44 A;  1PYT B;  2BO9 A;  2Q4Z A;  5I4M A;  3CPX A;  4R6T A;  4UIA A;  2EK9 A;  1M4L A;  3FX6 A;  1RTQ A;  1LAN A;  2GLJ A;  5JGF A;  4OP4 A;  5CPA A;  4B6Z A;  4K3N A;  3S9N A;  3HLP A;  4O23 A;  5LYD A;  3KZW A;  2PJ5 A;  2IJZ A;  2DEA A;  4WJB A;  2PVV A;  2AFX A;  3D67 A;  4YU9 A;  5LYI A;  3MRU A;  1CP6 A;  2RFH A;  3JRU A;  3FED A;  1LAM A;  3IO1 A;  4NGQ A;  3KGQ A;  1LOK A;  3ISZ A;  2BCO A;  4BD9 A;  2PJ7 A;  4P6Y A;  4NGN A;  3KQZ A;  1YLO A;  3V7Z A;  7CPA A;  5THW A;  3D7G A;  5CBM A;  2C1C A;  2V8V A;  2XEI A;  2ZEF A;  3IC1 A;  4MCP A;  4F9V A;  2O4H A;  2EWB A;  1ELM P;  2PJ6 A;  1ZG9 A;  4KSI A;  3D7D A;  4MMO A;  4DYO A;  2BOA A;  4R76 A;  1HDU A;  2POK A;  2ZEL A;  2ZEE A;  4NGR A;  4WWV A;  5JM6 A;  3NFZ A;  1EE3 P;  3PEI A;  2C6C A;  1OBR A;  2PJA A;  2PJ4 A;  5HVG A;  1ARM A;  2EK8 A;  1DE4 C;  1DTD A;  1IGB A;  5HVH A;  4Q7A A;  3RAM A;  2AFO A;  3MN8 A;  3KL9 A;  4ZI6 A;  1PCA A;  1TKJ A;  3WT4 A;  1VHE A;  4X3R A;  8CPA A;  3B35 A;  2OR4 A;  2WZN A;  4P4F A;  4UF4 A;  3KR4 A;  3BHX A;  3NH5 A;  3D7H A;  4P4J A;  3SI0 A;  3KQX A;  1AMP A;  1HDQ A;  3IWW A;  3SI2 A;  2OOT A;  3SJE A;  1LFW A;  4PXE A;  3IFE A;  1Z5R A;  2C6P A;  4W9Y A;  3TX8 A;  2HB6 A;  5HVF A;  3KI9 A;  3B2Y A;  2ANP A;  2AFZ A;  1TKF A;  1GYT A;  3D7F A;  2PJ3 A;  4R7M A;  2ZOG A;  2ZEH A;  4OC3 A;  4TNU A;  1CP7 A;  2ABZ A;  2C6G A;  4PPZ A;  1YW4 A;  2ZOF A;  4UIB A;  3DLJ A;  4P4D A;  3B7I A;  1XMB A;  3N5F A;  2PJ8 A;  4IHM A;  2PCU A;  2F7V A;  2XEG A;  2AFM A;  4P4B A;  4PXB A;  3IEH A;  3LWU A;  4FAI A;  4YWY A;  2PJ2 A;  3V38 A;  1ELL P;  3D66 A;  1XBU A;  4ONW A;  4P4I A;  3WC7 A;  1F57 A;  1XFO A;  2PE3 A;  3KAS A;  2QJ8 A;  5LYF A;  1XRY A;  3FF3 A;  1XJO A;  5LRG A;  4P10 A;  1AYE A;  5K8O A;  5D8N A;  2J9A A;  4OME A;  4DUK A;  3SJF A;  4Z65 A;  1ZLH A;  1ZLI A;  4UEF A;  3K9T A;  4EFD A;  3BI0 A;  2GU2 A;  1UWY A;  4JZ0 A;  2O53 A;  4PXC A;  3PB9 X;  4MXU A;  3T8W A;  4RUH A;  1R3N A;  3IJ3 A;  2PIY A;  4OC0 A;  3TC8 A;  4IK2 A;  1NSA A;  1Y0Y A;  3D68 A;  1Q7L A;  4MHY A;  1Y7E A;  1IY7 A;  3I1U A;  3PFO A;  1F2O A;  4A38 A;  4NGP A;  2HC9 A;  4PXD A;  3LMS A;  3BXM A;  1CPS A;  2AFU A;  4EME A;  4FBE A;  2ZEG A;  6CPA A;  5D29 A;  3B3S A;  2CTB A;  2Q51 A;  3DGV A;  1TKH A;  4MCS A;  3S9L A;  4ZY1 A;  1CBX A;  5K8M A;  4H2K A;  4ZY0 A;  1JQG A;  4F8Z A;  5DS0 A;  4OC5 A;  4NGT A;  4OC2 A;  5ELY A;  2PIZ A;  1H8L A;  1QMU A;  3FH4 A;  2JBK A;  4EWT A;  1FT7 A;  4FUU A;  4F9U A;  2NSM A;  3SJG A;  3FEC A;  2IQ6 A;  2V8D A;  2PJ1 A;  1VIX A;  3ISX A;  1TF9 A;  4NGS A;  4X8I A;  3FMC A;  3SJX A;  4CPA A;  1CG2 A;  3H8E A;  3PBB A;  2PJB A;  3KHZ A;  2AFW A;  1CPX A;  2IMO A;  3D4U A;  4OIW A;  2AFS A;  4UEE A;  2JBJ A;  4NJR A;  3QNV A;  4P4E A;  3PB7 X;  2RB7 A;  3B3V A;  3PRT A;  3RZA A;  3PB6 X;  1QQ9 A;  4PQA A;  2PJ9 A;  3BI1 A;  4X2T A;  4MHZ A;  1ZG7 A;  3K2K A;  4OID A;  4MHN A;  1YME A;  3NA6 A;  4P45 A;  4OC4 A;  1LAP A;  4GM5 A;  3PB4 X;  4LQG A;  1ARL A; 
#chains in the Genus database with same CATH topology
 3W91 A;  4ZCK A;  1NNX A;  1B4O A;  5DM7 3;  1AN8 A;  1UNS A;  4HTH A;  2G3T A;  1H9R A;  2L11 A;  2WV6 D;  2E5L L;  4B3R Q;  4MCR A;  2NVX H;  2UXD Q;  1U4R A;  1F2Z A;  1H9K A;  2GLF A;  5IB9 A;  1YI2 A;  3T1Y Q;  5EQ0 A;  1R4Q B;  1SMY C;  5M3M H;  2F5I A;  3R8B A;  2JA5 G;  1NBW A;  3D4D A;  4BIN A;  2GFQ A;  3R9E A;  4JG2 A;  4M3S A;  2R92 B;  1HJP A;  4R3K A;  4MFZ A;  5LYL A;  5I9P A;  3I4N B;  4TWE A;  5G1Z A;  2K04 A;  5LMN Q;  2XEJ A;  4A3E G;  5F48 A;  3F2C A;  3V96 A;  2EIF A;  3IGR A;  3GTM H;  2HD3 A;  2I3C A;  3CXP A;  4K5W A;  5FKA C;  1JOR A;  2H4O A;  1ICW A;  4L63 B;  3DLL A;  2R92 G;  4JYA Q;  4HJ5 A;  4Y49 C;  5I4D A;  3G6E A;  4M8A A;  1S5F D;  1EYC A;  2ES2 A;  3HOU H;  3FIX A;  5IY0 A;  3D3R A;  5CR3 A;  1TXR A;  1CT1 D;  3H09 A;  1I4G A;  1YLE A;  1JCK B;  1YNJ D;  4WFN 3;  1XTC D;  1ZO0 A;  2NN6 H;  3MTS A;  2PMZ E;  1J9O A;  1BO4 A;  3GIU A;  3SXO A;  1VQG A;  1LTT D;  2K75 A;  2LY7 A;  3K9U A;  5GRO A;  2A6H D;  1NE9 A;  3L2N A;  4B5P B;  3HKZ E;  1SXT A;  3KF8 B;  2RKS A;  1TQO A;  5ELO A;  4A3M G;  1FJG Q;  1A63 A;  3H8G A;  4ZY2 A;  3J81 E;  4JI4 Q;  5J1Q A;  2PVW A;  3WOF A;  4DGZ A;  1XPR A;  4A94 A;  2B2T C;  1C8C A;  3GTP B;  4A93 B;  1HR0 Q;  1TF8 A;  1Z8L A;  3VA5 A;  3ITP A;  5C3E H;  5H86 A;  3S1Q B;  3VH9 A;  3EY5 A;  3PBE A;  4C2Z A;  4AXV A;  5G3L D;  2OWO A;  3FEE A;  1Z7T A;  5JOB A;  3N52 A;  1VMP A;  2F0I A;  4EGV A;  4K2K A;  2JEB I;  3WAB A;  1VQ4 A;  2YU9 B;  5IWA Q;  2J8M A;  4OC1 A;  3TO9 A;  4BY7 B;  4V19 0;  2DUD A;  1STG A;  1RXT A;  4U9Y A;  2ICE C;  3CT9 A;  3S14 H;  5JPM C;  4A3F G;  4L5T A;  2ZXR A;  1XMQ L;  5JPN C;  2ZM6 Q;  4BBS H;  1L0X B;  2QVP A;  5EPJ A;  2YV5 A;  1DON A;  1U5K A;  5CV7 A;  3M4Y A;  2HUZ A;  1GD7 A;  2B4D A;  3KKW A;  1V1P B;  4PMC A;  3QWN A;  1G91 A;  2NZO A;  1VQP A;  1M1D A;  2WAQ E;  4WJ3 M;  1I4X A;  3B3T A;  1E22 A;  3MXP A;  5E4W C;  3GV3 A;  2YGW A;  3WC6 A;  5F09 A;  1YSJ A;  3NEM A;  4RI1 A;  1ASZ A;  4KVO E;  1GVP A;  5CV9 A;  1PH1 A;  3P2F A;  5M3F G;  4B9X A;  2OF1 A;  2WAQ B;  3DHQ A;  3VR6 A;  2RHQ B;  2EXD A;  2IX3 A;  1FNV A;  4DXF A;  4P44 A;  4TVA B;  2BO9 A;  4BY7 G;  1L1O A;  1TS4 A;  4MI4 A;  5I4M A;  4UIA A;  4MNO A;  2EK9 A;  1M4L A;  1WWZ A;  2SNS A;  3A9L A;  5KTA A;  1EY8 A;  1JE5 A;  4DUZ L;  3FX6 A;  1RTQ A;  4A2Z A;  1LAN A;  5JGF A;  4GZY C;  2RC4 A;  1F2M A;  1C0A A;  3DXJ C;  3KLR A;  2GVA A;  1XF8 A;  3H91 A;  1XYI A;  1HA6 A;  4EQ5 A;  3F2B A;  4JBK A;  1L0C A;  3Q23 A;  4JV5 L;  2CY2 A;  4YCV A;  3HLP A;  4O23 A;  4ORF A;  2MP1 A;  3PO2 H;  1CTM A;  4DV3 L;  2DNC A;  2VQF L;  2DEA A;  4FD6 A;  4WJB A;  1PFN A;  3B8G A;  1OXU A;  5LYI A;  3A5Z B;  2FHT A;  1S4Z A;  4LUZ A;  3JRU A;  1LAM A;  3ND9 A;  3KGQ A;  1X65 A;  4KOX A;  2UXB L;  4RAU C;  4CGP A;  4U68 A;  1FD7 D;  2B63 G;  2GIV A;  3GTJ H;  1CKO A;  2BA1 A;  4MHE A;  1Q86 C;  3PIP A;  1TS2 A;  1RIP A;  3F2D A;  2WPX A;  1AFP A;  1YLO A;  7CPA A;  3KBX A;  4NCZ A;  4DR2 L;  4LF4 Q;  1IL8 A;  2PMZ B;  1B9M A;  4LMQ D;  5THW A;  3PF5 A;  4KOS A;  4X5K A;  2F0K A;  4DV6 Q;  1LUZ A;  3QG1 A;  2VZZ A;  1PTO C;  2ZEF A;  4I7Z C;  1YNN C;  2NVQ H;  1VQD A;  4A3L G;  3ULL A;  4DUY Q;  1YRE A;  4DU9 A;  3S16 H;  2Z3P A;  3DWA A;  4LF6 Q;  4XQJ A;  1KAW A;  2PJ6 A;  4HIK A;  3U4Z A;  5FLX L;  3MGD A;  2BOA A;  4DNT B;  4C2M B;  3NFZ A;  4BY7 H;  4DNR B;  1M4G A;  4HNY B;  2ZJR A;  4MFJ A;  2C6C A;  3HOX H;  3E0E A;  4KD3 A;  3AFQ A;  4XNH B;  4KOV A;  3J80 E;  2AFO A;  3MN8 A;  1QNK A;  3KL9 A;  5CC4 A;  2HDL A;  4FYD A;  3I2Z A;  4AG9 A;  2Q04 A;  1QSR A;  4XT1 B;  2BSW A;  3I4M G;  2EXZ A;  4F88 A;  4JWP A;  4J3G A;  1AP0 A;  4R4I A;  1LRZ A;  1Q90 A;  1Y7R A;  2JA8 G;  2CFM A;  1BBX C;  2OR4 A;  3R9G A;  1GXD C;  4UF4 A;  4IUN A;  3JAM c;  3BHX A;  1PYB A;  1WTR A;  2B2T A;  2MFI A;  1SFO H;  4F8M A;  1PHJ A;  2PCF B;  3D7H A;  4P4J A;  1HDQ A;  1BR9 A;  4OON A;  3CCJ A;  1I4P A;  2K4K A;  3MEF A;  2F03 A;  2H5X A;  2FXQ A;  2K33 A;  1NMT A;  4XNH C;  3SJE A;  3KUP A;  1MKH A;  1DCZ A;  3M3Y H;  1S5E D;  4K6L A;  1ICF B;  2XN9 C;  4DR5 L;  3IFE A;  2B4B A;  4W9Y A;  1VQB A;  4GOP A;  1HTL D;  3TX8 A;  5M5Y H;  4HID A;  4R87 A;  4N9T A;  1X55 A;  1RKN A;  5JJZ A;  1SN8 A;  4IUT A;  1L1O C;  1JJC B;  1IL2 A;  2VNU D;  2K05 A;  3A74 A;  1HNW L;  3IU1 A;  3MFG A;  1K9M C;  1Q8I A;  1Y1V G;  2IHF A;  1WCM G;  2HT1 A;  2PQE A;  4QCL A;  3BZC A;  1E7Z A;  1PH3 A;  3GTM B;  2A6E C;  5I2X A;  4H0L C;  1GYT A;  1KAB A;  3AEV A;  4X64 L;  1Y1W H;  1QVG A;  1HZ9 A;  2P6E A;  4OC3 A;  1D8L A;  2N3S A;  1TVX A;  2YNE A;  4GOP C;  4F7X A;  3GTO B;  3QOL A;  2OQK A;  1M44 A;  1Y9K A;  3GY9 A;  4PG3 A;  4EX5 A;  2QML A;  2R92 H;  3X3N A;  3KF6 A;  3J7Z C;  3I8Z A;  4P4D A;  1G6Z A;  1XMB A;  2HV2 A;  1UUP A;  2R7Z B;  4OAD A;  4A3D G;  4IOC A;  1KZF A;  4JBW A;  4CAV A;  4GLV B;  4FD5 A;  3OWE B;  2NVX B;  1XOV A;  2SEB D;  4JI8 L;  2XEG A;  2ZXV A;  5DWM A;  4RFB A;  4MFL A;  1KLU D;  1DJR D;  4RKL A;  3DDD A;  4R4Q A;  4KK7 A;  2R61 A;  3S9W A;  3LOD A;  2AE6 A;  4P4B A;  4PXB A;  4R4C A;  2WFW A;  1SAP A;  3IFD A;  2X7B A;  4PZ8 A;  3MFY A;  3BJ7 A;  4LFA Q;  1WOC A;  3UE0 A;  3JAM i;  1JJ2 A;  3V38 A;  2LXJ A;  2NN6 G;  1HA5 A;  4BBS G;  1W6J A;  4ONW A;  4P4I A;  3OPO A;  3DM3 A;  3HKZ B;  3WC7 A;  4DR6 L;  3A0J A;  1WCM B;  2WKC A;  1J5E L;  1ILP A;  2L12 A;  4DK6 C;  4RG1 A;  1EYD A;  5FJ8 G;  1BNZ A;  4JI5 Q;  1SNC A;  2R93 H;  2VL6 A;  2GA4 B;  2JA8 B;  2NTS A;  1LTB D;  4P10 A;  4CAX A;  3R96 A;  2CW0 D;  3TSS A;  5IYD H;  5H84 A;  5IB0 A;  4J8Q A;  4HMI A;  1TY2 A;  2QIR A;  5AFW A;  1AE3 A;  1RTO A;  3NPP A;  4QUC A;  1VQJ A;  2K14 A;  1I94 L;  3C3L A;  4ME3 A;  2UXC Q;  3NK9 A;  4ZGY B;  2DJF C;  4JXQ A;  3P1H A;  4E0A A;  1CSQ A;  2Z4I A;  3UDX A;  1Y69 U;  2B2U C;  1U4P A;  2EE1 A;  4MXU A;  3T8W A;  5IGD A;  3IJ3 A;  3GDE A;  2Z1C A;  4KOT A;  4Y49 B;  3H3V I;  1PFB A;  1IW7 D;  4DNI A;  1EYA A;  4UCN A;  1I50 B;  3PIP 3;  2RCF A;  3TC8 A;  5J8C A;  2FMM A;  1NSA A;  3PGZ A;  1D7Q A;  1Q7L A;  4MHY A;  1OXV A;  3QIA A;  5IV0 A;  1F2Y A;  1EY7 A;  3I1U A;  2E2J H;  2CH4 W;  1UE7 A;  1K4J A;  2G3A A;  3J7A V;  5C0X H;  4KY5 A;  2VB3 X;  4RGO S;  4Y7N H;  3A7A B;  4QUS A;  1B87 A;  3K5L A;  4DUY L;  4PXD A;  5G20 A;  1YEZ A;  4DV6 L;  3LMS A;  4EME A;  4HSP A;  5KNB A;  2PZT A;  3DGV A;  2HDM A;  2KVM A;  2PI2 A;  3GO5 A;  2A4N A;  4CYN A;  1JC7 A;  1TXY A;  1F9S A;  4POF A;  4MCS A;  4OAE A;  5KND A;  1HTP A;  3TP7 A;  4DV4 L;  4ZY1 A;  2O5J C;  4JC0 A;  1UAP A;  4KD4 A;  5AG4 A;  1G6P A;  2ICI A;  5HGQ A;  4QJF A;  5K8M A;  4QQB X;  4IUS A;  5DS0 A;  4IUR A;  1VQO A;  1B50 A;  2E2H B;  4BS9 A;  5ELY A;  1SND A;  3CHB D;  1JWM D;  1VF7 A;  3TBI B;  1LLR D;  1B3Q A;  5JVH 3;  4KHP L;  2B8G A;  3L3O C;  3CCV A;  2RDF A;  5BR8 L;  1NAP A;  4EWT A;  4OWT B;  2R6G A;  4QY7 A;  4L89 A;  3U50 C;  2KJX A;  5F47 A;  1CM9 A;  5CNP A;  1PH5 A;  1DD2 A;  2V8D A;  4LF7 L;  3DSB A;  4GS3 A;  2EZV A;  1VQC A;  4J15 A;  1S60 A;  4HNW B;  2BH2 A;  3SJX A;  2IX0 A;  4KHV A;  3T13 A;  5IYC H;  1X3E A;  4A95 A;  2FXF A;  1N8R C;  4CKC A;  1I6H H;  1IYU A;  2P5Z X;  4ODG A;  4HSV A;  2B63 B;  4HCE A;  1EYG A;  1CPX A;  4OIW A;  1Q7Y C;  1KUV A;  3H4Q A;  4UEE A;  2Y0S B;  3QOJ A;  4HKF A;  4A3M B;  3GTK H;  2QCP X;  1Q2D A;  3DNS A;  4NJR A;  1KL9 A;  2F0O A;  3PB7 X;  4MFQ A;  5JPH A;  4DK0 A;  2JEV A;  4DV4 Q;  2O5I C;  3PUV A;  4C3H G;  4DV7 Q;  1GUS A;  2IW3 A;  1PYS B;  2Z3N A;  2ZXO A;  3RZA A;  1EWI A;  1TWC H;  5JJK A;  4PQA A;  4KN4 C;  4XIG S;  3D6W A;  1NMG A;  1PV4 A;  1SNP A;  4MTK A;  3K2K A;  4OID A;  3GTL B;  3Q8D A;  2ALY B;  4TQU S;  5J3B A;  5BR8 Q;  5KNC A;  3EA6 A;  4OC4 A;  1LAP A;  2HHH Q;  5KTC A;  3NTK A;  3VR3 A;  5E7N A;  4UY8 C;  3K57 A;  5F49 A;  3R1K A;  4NJQ A;  1EEI D;  1SLJ A;  1XX8 A;  4XQQ A;  1EY6 A;  4C3H B;  5M5X H;  3D3S A;  4MCQ A;  3BVM A;  1PYW D;  4UEZ A;  1QCB D;  5JH9 A;  2EY2 A;  5EPK A;  4ZUJ A;  3IRB A;  4C3J B;  1FNO A;  2J4X A;  4XQN A;  1WK4 A;  1KUY A;  1LAB A;  3AYH B;  3MA2 B;  3I7F A;  4YHH L;  2WIN B;  3NEN A;  1SYB A;  3PFE A;  1CK1 A;  2XEF A;  4APV A;  4S3S A;  2KHI A;  4XYQ A;  1QIL A;  4A3B G;  1M4I A;  3G48 A;  1CQF A;  2F8H A;  1JOK A;  1OTC A;  3CPA A;  1UEB A;  2VQF Q;  5A2Q E;  1PFM A;  1L0W A;  3PIO 3;  3S1R H;  2B2V A;  1N32 L;  1Q82 C;  2PJ0 A;  5G21 A;  3HZX A;  5LMU Q;  4BY1 B;  3NP8 A;  4TKO B;  1Y0R A;  4ONU A;  2VL1 A;  2FT0 A;  3L9A X;  4CDD C;  3BU2 A;  2R7H A;  3N7Z A;  2DNE A;  3E9H A;  1M90 C;  2UU9 L;  3GB0 A;  4G7H C;  5K8N A;  1LTL A;  2JQO A;  3F8T A;  4ZX9 A;  2ZW5 A;  2EYL A;  2K5T A;  3HOW B;  1JWQ A;  1XIX A;  2UUC L;  3HKS A;  4AQY Q;  5K36 H;  1KWM A;  1RDP D;  1EZ6 A;  2B29 A;  2EWB A;  3CZX A;  1PTO D;  3HUV A;  3CME A;  2GRE A;  1O7Z A;  1RHP A;  4V0B A;  3MXN A;  4H02 A;  5C44 H;  4R8F A;  2IHE A;  1QST A;  4B14 A;  2O28 A;  4AYB G;  2PJC A;  2LKV A;  1PRT B;  4I49 A;  5GAH C;  4DJL A;  4R9M A;  1HEE A;  3FRP B;  4IJH A;  2P0W A;  2QEC A;  2V77 A;  3J80 L;  1HR0 W;  4QMG A;  1CSP A;  4BY1 H;  4ZRZ A;  1IOF A;  3KK7 A;  1D5M C;  5ELN A;  1SQH A;  4AIM A;  3GUX A;  3QJY A;  4K8I A;  4PSW A;  1N36 Q;  4OKO A;  3OWC A;  4XPL A;  5D3D A;  4LFC L;  4PMW A;  1MJE A;  2N88 A;  3QB3 A;  2FVG A;  3KLS X;  4K0K L;  4KJO A;  4A3D B;  4YCW A;  5C0X J;  4MZ9 A;  3HGB A;  1U6M A;  2ZEN A;  1PUA A;  3NH4 A;  1STH A;  1Q81 C;  4AVB A;  3CDX A;  2CIJ A;  4M1U B;  1Z9U A;  5DLQ E;  4IUQ A;  1W2B A;  4JCV E;  4ALP A;  4A3C G;  5C4Z A;  3HOU B;  3HOW G;  1M1K C;  4K0K Q;  2Z9H A;  1R4P B;  1QWY A;  3CCL A;  5C3W A;  3C46 A;  2F0T A;  1FNU A;  5CV4 A;  2UXD L;  2JA6 G;  3D6C A;  1PMR A;  2REE A;  3B6Y A;  2JA5 B;  3VDY A;  3H5Z A;  4A76 A;  3R2T A;  4CDE C;  3WC5 A;  5CGK A;  4DNC A;  1ENA A;  3D4W A;  1GOZ A;  2CW0 C;  1K83 H;  3RD4 A;  3A8I E;  3HOU G;  2B5G B;  1X3Q A;  3RZD B;  4ZYQ A;  1YHB A;  3HOY H;  1L1O B;  3I4N H;  5HXD A;  2O4X A;  2NYQ A;  1Z47 A;  4LF8 Q;  1GHE A;  5TSS A;  1B8A A;  1K83 B;  5I2Y A;  1HNX L;  3H0G H;  4NPS A;  5ELC A;  4B3S Q;  1I3Q H;  1LT4 D;  1BCP C;  1EY0 A;  3CRK C;  3VAR A;  5M3M B;  4BWG B;  2JA5 H;  2R7Z G;  1IYV A;  2JK8 A;  3TZD A;  4KY6 A;  4OX9 Q;  4FXD A;  4ABN A;  4HIM A;  2WKD A;  3K81 C;  4XXE A;  2NN6 I;  5L37 A;  3WWV A;  1AEX A;  2F0E A;  5IGC A;  3J81 i;  1XXG A;  2Z11 A;  2B3V A;  1KXL A;  4A3M H;  4KTA A;  2K5D A;  2WB1 B;  2Q4Z A;  2CNM A;  2MNA A;  2MHV A;  3CPX A;  4R6T A;  2ASB A;  2B63 H;  2YNC A;  3T4A C;  3EO4 A;  1TWH B;  4CAW A;  2N55 A;  2JLM A;  3DEO A;  5FOB B;  2GLJ A;  5C4X H;  2LMC B;  4X62 L;  2MO0 A;  4OP4 A;  5CPA A;  4X66 L;  3K5O A;  2IX1 A;  1ENC A;  5C0X G;  4FF1 A;  4DAM A;  1XMO Q;  4G7O C;  2F0M A;  3H0G G;  2KEC A;  2ZXP A;  2RBM A;  1IOI A;  2B2V C;  1SRO A;  4RKB A;  1VQ9 A;  2JDD A;  1CKN A;  2B5G A;  4LJZ C;  3BZK A;  3ULJ A;  2J8R A;  1JR0 D;  4IJL A;  2YNC C;  1YVO A;  1E24 A;  2Q8T A;  4CJ2 C;  3F8K A;  3MRU A;  1QG7 A;  2EYF A;  1Q8K A;  4QB4 A;  5C44 B;  3EFA A;  3PUZ A;  3G8W A;  4NDX A;  3FED A;  1FNW A;  4QUF A;  4NGQ A;  1SBB B;  3RNZ A;  2Y0S G;  3AB9 A;  3ISZ A;  5M5W B;  2VB2 X;  5FK9 C;  3OHX C;  5NUC A;  4GLX A;  2HHH L;  4RWS C;  1HPC A;  3J7A F;  3STB D;  2PJ7 A;  1CKN B;  3E0K A;  2TMP A;  4B3M Q;  4NGN A;  4A3I G;  3KQZ A;  1D5X C;  1SNM A;  2B2W A;  1HUN A;  1YNX A;  3SK6 A;  3RYO A;  4IPH A;  2L1B A;  3G6J B;  4UHV A;  3J7A 5;  2N8N A;  1TU2 B;  3NTI A;  1C7Y A;  3H3V H;  2XEI A;  4RN7 A;  1H95 A;  5I0C A;  1EL0 A;  1LTA D;  4MCP A;  4F9V A;  1GKH A;  3ERO A;  3E5S A;  4B3T Q;  2X69 A;  4CGL A;  3BYT B;  1K8M A;  4K2L A;  3D7D A;  3CRL C;  3HOZ H;  4A3E H;  2PQA A;  1K8O A;  4R76 A;  2DY7 A;  2Q8R E;  4X3S A;  2POK A;  2EUI A;  4DV2 Q;  5JM6 A;  1VQF A;  1FVI A;  1WTX A;  2Q2T A;  3JC6 6;  5C88 A;  4LQ6 A;  4DV7 L;  1S7N A;  3FXT A;  1CM0 A;  3V05 A;  4HMJ A;  2XSC A;  3KDF A;  2DJG C;  1HRJ A;  2R3Z A;  3NBH A;  1JT8 A;  2B39 A;  1DE4 C;  3TO6 A;  1IGB A;  3RAM A;  4LF7 Q;  1VQ8 A;  1C4Q A;  3BDC A;  3RLO A;  1WTW A;  4RCN A;  2R98 A;  2KHJ A;  4IF5 A;  1SNO A;  4RHR A;  2VZA A;  4K30 A;  1X6O A;  2PPB C;  4CRZ B;  4KOW A;  2K5N A;  4LF9 Q;  4OIJ A;  2WPW A;  2CQO A;  4KKU A;  5FLM G;  3OTO L;  5A27 A;  3FEW X;  2A5H A;  8CPA A;  1EOV A;  1SMY D;  1FY7 A;  2WZN A;  2MO1 A;  3PO3 G;  3KR4 A;  4P2C B;  1TWF B;  1CHQ D;  3K0X A;  3SI0 A;  2F0F A;  5EKL A;  2R93 B;  1WTQ A;  2O2L D;  3UY5 A;  1P16 A;  3I9S A;  1G2T A;  2VQY A;  4CAF A;  3GTG B;  2Q4V A;  4UP9 A;  4KHZ A;  4A31 A;  2HIV A;  1Z5R A;  1ZEQ X;  3PO3 B;  2VUM G;  1IID A;  1SYD A;  1Z9F A;  2K52 A;  2K03 A;  3LX0 A;  3TP6 A;  4A30 A;  3KI9 A;  3B2Y A;  2ANP A;  4KKS A;  2HIX A;  2NYZ D;  5C0X I;  1KQS A;  4X64 Q;  2ZTD A;  3D4R A;  5ELF A;  3R93 A;  3ZZI A;  3D7F A;  2K5V A;  3RMH A;  2MPM A;  2Y0S E;  4JD6 A;  4CGO A;  2G0B A;  4DR2 Q;  4TNU A;  4LF9 L;  1CP7 A;  2ABZ A;  2VI7 A;  1ESR A;  3PCO B;  4QF4 A;  1YW4 A;  5JQ4 A;  2A6H C;  1Q2C A;  3DLJ A;  2F0D A;  3B7I A;  3J80 i;  4CDF C;  1VQK A;  1SSO A;  5CYU A;  3T1H L;  2VXW A;  4R8N A;  2PJ8 A;  3VR2 A;  3GQB A;  2F7V A;  1SYG A;  4KKT A;  1Y8N B;  2EY1 A;  2PQA B;  3WR7 A;  5GQO A;  2MJ8 A;  3DEP A;  5J1Z A;  4DKA C;  2FSR A;  1GUW A;  1X32 A;  3WDN A;  4LFB Q;  4GXH A;  1JWS D;  2PJ2 A;  3HEJ A;  5JJI A;  2A69 C;  5IWA L;  1ELL P;  4B11 A;  2Z3K A;  5BN4 A;  5C44 G;  1XBU A;  4ZUI A;  4FD7 A;  1IYL A;  1DGS A;  4JK1 C;  1XFO A;  1BOS A;  3KAS A;  3CAM A;  3LD2 A;  1ASY A;  1M4V A;  4H6U A;  4Z9C B;  4QIW B;  1X3P A;  4E8O A;  3CMA A;  3BDL A;  5LYF A;  1PZI D;  4IZ8 A;  4NF1 A;  4C3I B;  3PUY A;  4JI5 L;  1XJO A;  4KV6 A;  1A8V A;  3NE8 A;  1AYE A;  5K8O A;  4OGQ C;  3URY A;  5D8N A;  1J6Q A;  3RO0 A;  4QL5 A;  4DUK A;  3K7U C;  1KNE A;  1Y8O B;  3K7A B;  2XTI A;  1S7K A;  2LSS A;  2HQL A;  1RF2 D;  2RDG A;  3HOW H;  1QZH A;  4FXK C;  4MTN A;  4LF6 L;  3DWP A;  1SRU A;  4C3I G;  1GJX A;  3U58 A;  1BVS A;  1KNA A;  3S6F A;  4EFD A;  4JZ0 A;  4YHH Q;  2OEO A;  1Y1W G;  1RD9 D;  5HGT A;  1R3N A;  3HOX B;  2TSS A;  1EUJ A;  3A5U A;  1MD2 D;  3MWY W;  2Z6K A;  1WD0 A;  3FB3 A;  4WJ4 A;  4DAY A;  4GKJ L;  3ZJ0 A;  4C2M H;  1GHK A;  4IK2 A;  2NTT A;  3I55 A;  1Y0Y A;  2OU2 A;  4F6A A;  3D8P A;  3VR4 A;  1Y7E A;  1IY7 A;  3KF6 B;  1SE4 A;  1M8A A;  2HQE A;  2I46 A;  4L8J A;  4GNX A;  1F2O A;  1XEB A;  4A38 A;  1ET6 A;  5M3M G;  5C4J H;  3CC7 A;  2HC9 A;  4ULL A;  1HNZ L;  3HG9 A;  1WTP A;  1EU3 A;  2XRS D;  5G3L F;  1K73 C;  2JEA I;  1EQR A;  1XMQ Q;  5D3I B;  6CPA A;  2ZEG A;  5KYI A;  1ESF A;  1MGS A;  1WCM H;  1KDA A;  5GAD C;  1PRT C;  4C3J H;  2J7Z A;  4HJA A;  4DR3 L;  4HPS A;  4X66 Q;  3CF5 A;  4I7A A;  4KMU C;  2K7V A;  5DEH A;  2JA9 A;  2KCC A;  1SE2 A;  1II3 A;  3S9L A;  4R3L A;  3TQY A;  3GTJ B;  1IKL A;  4B3S L;  1VQ7 A;  2NBF A;  2OQ0 A;  1QVF A;  3BJ8 A;  2WP8 J;  4LX9 A;  1F2L A;  4F8Z A;  4A3B B;  3E6Z X;  4C7H A;  4ZKC B;  3RZD H;  2KHS A;  1KC8 C;  5C4H A;  3GKR A;  4L5R C;  2VBQ A;  4FVM A;  1PH4 A;  2XNA C;  1H8L A;  2CNS A;  4HCS A;  2I5H A;  4LFB L;  3IU2 A;  4CKB A;  1I5F A;  1K8G A;  1R57 A;  5FO9 B;  4BA2 I;  4UWI A;  3SXN A;  4O42 A;  1DOL A;  3DUZ A;  3PO2 B;  2XRQ D;  5DM6 3;  4NEX A;  2PJ1 A;  1VIX A;  4DV1 L;  2D0O A;  1AH9 A;  4KS9 A;  2WAC A;  1EFI D;  1EY5 A;  2F0Q A;  3FBU A;  2Q2H A;  2EJF C;  2L0C A;  4CPA A;  4C1N K;  4BMH A;  3H8E A;  1HFN A;  2I5M X;  3KHZ A;  1ILQ A;  4PK2 A;  2A68 D;  1YX0 A;  4UFW A;  2IMO A;  5C5L A;  1Z4E A;  4A3I H;  5JEA H;  2KCW A;  2RB7 A;  1BCP B;  3FDT A;  3FKI G;  1TWA H;  4HIO A;  3OW2 A;  2R8V A;  4NKL A;  4XYO A;  4JI0 L;  3I73 A;  3KJP A;  2PJ9 A;  2FE7 A;  3SXH A;  5CBA E;  1C48 A;  3AFP A;  1MK4 A;  2F0P A;  1EIY B;  1MSG A;  1ZG7 A;  4IPD A;  2E2I H;  1CKM A;  4FD4 A;  1YK3 A;  1YME A;  4NMZ A;  2UUC Q;  2EYJ A;  4X65 L;  4GM5 A;  3PB4 X;  4IN3 A;  5FO7 B;  4LQG A;  3VR5 A;  3H8F A;  3VAT A;  2AQ3 B;  3P20 A;  3I72 A;  3W5O A;  4JPB W;  1F9P A;  3J7Y W;  1XTD A;  3D2M A;  4BBS B;  2MQH A;  3UI2 A;  2K5H A;  2DXQ A;  1YHA A;  1BPN A;  1S3O A;  4PQX A;  2CTC A;  3VA7 A;  4XDX A;  3VYU A;  4GKK Q;  2WSA A;  3KYH C;  2K28 A;  4FDB A;  3QR8 A;  4DV5 Q;  1X56 A;  5EC4 A;  4MHP A;  5J8F A;  5FLM H;  2R7D A;  3SEB A;  1JOQ A;  4U5Y A;  4OHJ A;  3W6S A;  4F0Y A;  3W1B A;  5LRK A;  2Q44 A;  2UXC L;  1H9S A;  1SE3 A;  2E2I B;  2KEN A;  1IW7 C;  2JEW A;  1YW6 A;  3OMG A;  3ER0 A;  2A6E D;  2PSW A;  3RLF A;  5JVG 3;  1S40 A;  1Q46 A;  2NVQ B;  1YZ6 A;  1GHJ A;  4YY3 Q;  1LAC A;  2B2Y A;  3DM1 A;  2KCM A;  5LMU L;  4JBM A;  4L8A A;  3TOA A;  1B2T A;  3S2H H;  3CD6 A;  3KJO A;  2YND A;  2IWH A;  1B70 B;  2PYK A;  1MJC A;  2F0S A;  2N78 A;  1TS3 A;  2AHO B;  3C1F A;  1BCP F;  3ND8 A;  4G57 A;  3STB C;  1J5E Q;  4KY7 A;  1SE8 A;  4C3H H;  2F0W A;  3CCQ A;  1IYK A;  1A15 A;  2ZEO A;  4OO1 H;  3LGJ A;  3P2H A;  3ERS X;  3KR5 A;  1BAV A;  1VQE A;  4BA1 I;  2G9D A;  5GAG C;  3EBE A;  3GTQ H;  1HUM A;  4C2Y A;  1HQM C;  1S72 A;  1LTG D;  5IOC A;  3UDI A;  4A3G G;  1XE4 A;  1G2S A;  1R43 A;  4IFD I;  1N33 L;  1VHS A;  4OO1 I;  4E6I A;  4IFD H;  1I4H A;  1TWG B;  2D5D A;  3RNU A;  3NWT A;  4AG7 A;  2RF4 A;  2ZED A;  2A74 C;  2Q0Y A;  5EJW A;  1TWC B;  4GKJ Q;  4JI1 L;  1D6E C;  2QIL A;  4NXM Q;  4JYW A;  1TS5 A;  2ZEM A;  1N9W A;  4Q36 A;  5EBD A;  4JJX A;  1ET9 A;  1X12 A;  1D2B A;  3S9M A;  2A69 D;  2K32 A;  4HJ7 A;  5LRJ A;  1OXT A;  1X3F A;  5FO8 B;  2P6G A;  5J22 A;  1VDZ A;  1PH8 A;  1WYD A;  5J39 A;  2ZEP A;  4CYQ A;  2Y0M A;  2ZW7 A;  2VUM B;  2D4P A;  1I4Q A;  2JSO A;  4OIK A;  2B2W C;  3PV0 A;  3U9O A;  2JDC A;  3OIP A;  5LMN W;  2V8G A;  1B3A A;  1M4D A;  4CGN A;  2I0Q A;  3CKI B;  4H13 C;  3U9S A;  4B13 A;  1O7I A;  1EIH A;  2YTX A;  2ZW6 A;  2V8H A;  3NSW A;  4I65 A;  2UUB Q;  2NUC A;  2D62 A;  3TO7 A;  2R93 G;  4F0X A;  1EZ8 A;  2DPT A;  4QGU A;  3R9F A;  3L0O A;  1GO3 E;  2AUK A;  2AKW B;  5K8P A;  4IUP A;  1HR0 L;  3NH8 A;  4IAV A;  1B7Y B;  2KEE A;  3FKI B;  2F52 A;  4DV2 L;  1EY4 A;  3I4M H;  3FVL A;  1SYE A;  2PRQ A;  1PA6 A;  2F0J A;  4BXX H;  5IYB G;  4G4K A;  1XPU A;  4OX9 L;  4MFK A;  3K58 A;  4Q38 A;  2XWJ B;  5BN5 A;  1A0I A;  3EQL C;  2Z3O A;  1QUQ B;  2VS1 A;  1WJJ A;  4UBR A;  2F4I A;  3M7G A;  1KIX A;  2I5L X;  4LAA A;  1CA6 A;  3S14 B;  5IP9 H;  2H5M A;  4KLW A;  5IYC G;  1PYT B;  2OZH A;  4JYA L;  3K0Y A;  1E0B A;  4CAE A;  1CZG A;  2OH1 A;  1PH2 A;  2KBN A;  1KDC A;  3T1H Q;  3RUZ A;  3HOX G;  1D5Z C;  4DR7 L;  1SFO B;  1KTK A;  3IAY A;  5DAU A;  4A3G B;  4B6Z A;  3M4O B;  3CPW A;  1F9R A;  2K1B A;  4K3N A;  5FLX c;  4YGO A;  4IPC A;  3GTP H;  2B2Y C;  2X6L A;  2RSO A;  3S2D B;  5LYD A;  1TKW B;  4GLA C;  2PJ5 A;  3F1Z A;  4J1M A;  3S15 B;  4P72 A;  4A3C H;  5IIF A;  1CHP D;  1WVL A;  4IPG A;  2PVV A;  2AFX A;  3D67 A;  1PZK D;  4YU9 A;  1MSH A;  4KOU A;  1YIT A;  1JE4 A;  2RFH A;  3VWE A;  1WI5 A;  1E2W A;  4C3J G;  5LHY 1;  3IO1 A;  2PR8 A;  1VKC A;  3S6H A;  1IXR A;  3OW7 A;  1PDQ A;  3ULP A;  4YRH A;  1HQR D;  1S5D D;  1NSN S;  5D65 A;  1HNW Q;  2H1E A;  2IT1 A;  3RR5 A;  2BA0 A;  2BCO A;  2FMC A;  2B3G A;  2UU9 Q;  1QSM A;  1I12 A;  3CW2 C;  4P6Y A;  5IP7 H;  1V9P A;  4TSS A;  3I4M B;  1P8L A;  1FR3 A;  3FKI H;  2B2U A;  3CXC A;  3V7Z A;  1SEB D;  5C5M A;  3JAM L;  4DV0 Q;  3S16 B;  2PNR C;  3D0F A;  1S7F A;  2C1C A;  2EVN A;  5CBM A;  2V8V A;  4K14 A;  4AQY L;  1DM0 B;  3I4L A;  3N6R A;  4ZK9 B;  4RH6 A;  5HMN A;  3HRZ C;  1N34 L;  1G8Z D;  5IYB H;  1KUX A;  2AJ6 A;  2O4H A;  3FHW A;  4ILW A;  1VQN A;  3SVM A;  3T16 A;  2HCC A;  2JE6 I;  2KED A;  4A3F H;  3MXU A;  2E76 C;  4DV5 L;  3CCR A;  1XPO A;  1ELM P;  4JV5 Q;  1ZG9 A;  4KOR A;  4KSI A;  4LFA L;  4IUU A;  4DYO A;  2ZT9 C;  2ZEL A;  4NGR A;  4AVC A;  2X6G A;  4B5P A;  2LS0 1;  1EWH A;  2PJA A;  2EJM A;  3PUW A;  1A3U A;  5HUR A;  4MN3 A;  1VQA A;  4C2X A;  3AU7 A;  2KUM A;  1FGU A;  4F87 A;  4HR7 B;  3J81 j;  4AH6 A;  5IYD G;  5HVH A;  4Q7A A;  1JOO A;  4A4I A;  1UWV A;  5A2Q L;  3I90 A;  1VQM A;  1LM0 A;  2DN8 A;  4LUO A;  1NMF A;  4OXP A;  1YJW A;  1HXY D;  1BF4 A;  5HY6 A;  3GTG H;  4JXR A;  5EPL A;  4ZI6 A;  1IBM L;  3GTO H;  3T56 B;  1TII D;  4X3R A;  2BE5 D;  4PMB A;  1X54 A;  5IOD A;  3B35 A;  3FP9 A;  3KDF B;  2NZH A;  3FYN A;  2OXP A;  1JJG A;  1T5X D;  1XNQ L;  1U4M A;  3NH5 A;  1A6X A;  1O7L A;  2PW7 A;  3KQX A;  1VQH A;  2F0G A;  2EYO A;  2ZTE A;  2L5T A;  1E1T A;  5EKI A;  3IWW A;  3SI2 A;  1E2V A;  3TRZ A;  4UDU C;  4JI1 Q;  3I56 A;  4IO9 A;  2V4D A;  1TWG H;  3T1Y L;  2ATW A;  4DR7 Q;  1O80 A;  1W6K A;  3EXN A;  5C82 A;  1X9N A;  2D9U A;  4OEM B;  4DAV A;  3PUX A;  3BS1 A;  1IIC A;  3K59 A;  2WUU A;  1ZKO A;  2HB6 A;  3D8G A;  2AUJ D;  4C1N I;  1X3G A;  2PZW A;  3S2H B;  4PV6 A;  4JLY A;  1LT6 D;  2PI2 E;  4A3K B;  2CWA A;  3GP7 A;  2AFZ A;  2K5Q A;  1STN A;  2WB1 G;  4L6T B;  4ZQ3 A;  4LF5 Q;  1V0C A;  3O13 A;  4R7M A;  4FP5 D;  1GUG A;  2ZOG A;  2QDL A;  1QE6 A;  4DV0 L;  1IZ6 A;  2CNT A;  2ZEH A;  5F46 A;  4OWW B;  4H6Z A;  4PPZ A;  2OB0 A;  1NCV A;  2B8F A;  4A75 A;  5E3F A;  2L4N A;  4CDC C;  1DYQ A;  5KIX A;  5AGE A;  3N5F A;  2UUB L;  2QF7 A;  3J81 L;  3NE7 A;  2YTY A;  1HZC A;  2IPK D;  4P74 A;  2AFM A;  4N8F A;  2JA7 B;  2YU9 H;  2DPS A;  1UEA B;  2ZTC A;  4DN4 M;  3VWD A;  1DOK A;  3IEH A;  3LWU A;  4C68 A;  5CBE E;  2ATR A;  5EMI A;  4EQO A;  5M5W H;  1Z6H A;  2JA6 B;  3BG3 A;  3D66 A;  1U0L A;  3EIV A;  1PXU A;  3A56 A;  4TRD A;  4JI8 Q;  3IKJ A;  5LL6 S;  4NP5 A;  1PTO F;  1Y8P B;  4LF5 L;  1J8I A;  4POG A;  3SR1 A;  3Q24 A;  2PE3 A;  1VQI A;  4B3M L;  4UAI A;  4A93 H;  2R1I A;  4MY3 A;  3CC2 A;  5AJ3 L;  1MJB A;  4A32 A;  3U4V A;  2L9H A;  3K6O A;  3NXW A;  1VS0 A;  2VW9 A;  1XRY A;  1U4L A;  4MJ8 A;  4YWL A;  3BYY B;  2F4V L;  3OMC A;  4DXG A;  5JEA G;  5JJL A;  4JI2 Q;  3UE1 A;  1SYC A;  4RCO A;  4YIJ A;  2J9A A;  1YJN A;  2EY5 A;  1NTG A;  1V1Q A;  1Y1V H;  3CP0 A;  4Z65 A;  3QAY A;  3HFZ B;  3SGI A;  1ZLI A;  4UEF A;  3K9T A;  2MGS A;  1XNQ Q;  1K0R A;  3TE4 A;  1TIQ A;  3I3G A;  1D1K A;  1F9Q A;  2QKI C;  2ZM6 L;  1BCP D;  4WJW A;  1CQV A;  3C2P A;  3G3S A;  5LMN L;  3PF4 A;  1Z8T A;  3SHP A;  1QB5 D;  1UWY A;  2ENB A;  1YHQ A;  3DR6 A;  1PTO H;  1SR3 A;  1BBW A;  2V1C C;  4RUH A;  4UWJ A;  1NE3 A;  3GYA A;  2Q2U A;  1QUQ A;  1QZG A;  4CGY B;  1GUO A;  1A2U A;  4YWK A;  4ZYS A;  2B4D B;  3V2T A;  2BEI A;  1OO9 B;  3ONA B;  3T90 A;  2Q7B A;  1Z4R A;  3H0G B;  1Y14 B;  3QO2 A;  4YY3 L;  1N36 L;  1IHZ A;  3AMU A;  4UCM A;  3PFO A;  3HOY B;  1A3T A;  5IE8 A;  1Y9W A;  2EQS A;  1K8A C;  1XWE A;  1P4N A;  4O1N A;  4NGP A;  5FLX E;  1V1P A;  5KTD A;  4FBE A;  4HAE A;  3MVV A;  3B3S A;  1BO0 A;  2G5D A;  5EKK A;  2Q51 A;  2BH8 A;  3SK4 A;  2PQ8 A;  3M9B A;  4GKK L;  5IGB A;  1LTI D;  4KUA A;  1TKH A;  5DNF A;  3DMU A;  4MHD A;  3KOJ A;  2RCN A;  2ZJP A;  4GN5 A;  5C4J B;  5T1I A;  4AVA A;  1JQG A;  2RQX A;  4L5S A;  1UE1 A;  4A3F B;  1XNR Q;  4NGT A;  4OC5 A;  4OC2 A;  2NZ1 D;  3GD7 A;  1PVO A;  3SK5 A;  4KSF A;  3RN5 A;  3FH4 A;  2UUA L;  1IBM Q;  1I1D A;  2JBK A;  2EYH A;  3R3O A;  4OO1 G;  4A3K G;  1PU9 A;  3G4S A;  1EIF A;  1HH2 P;  4KVX A;  4F9U A;  5I9O A;  4WOR A;  1H9M A;  2NSM A;  1MIU A;  4ID6 A;  3T9Y A;  3ISX A;  1BXT A;  1TF9 A;  4NGS A;  3MXG A;  2F3I A;  4IAL A;  2UUA Q;  3FMC A;  4Y52 H;  4UCP A;  4QBJ A;  1AW7 A;  1KRT A;  4II9 A;  1CG2 A;  4MIU A;  3PBB A;  1PRT F;  2J0T D;  4NB3 A;  1ENF A;  1NUC A;  4X3K A;  4JI7 Q;  2VXK A;  5C3E G;  1HFG A;  5AG6 A;  3J81 c;  3JTK A;  2EJG C;  2JBJ A;  4R4O A;  4K8J A;  4P4E A;  4ZBG A;  2NVY H;  3B3V A;  4CRY B;  5COY A;  1FYC A;  1V1O A;  3TRE A;  3S15 H;  4K5X A;  2IY5 B;  3PRT A;  1MBY A;  5KRU A;  3K7A H;  3PB6 X;  3A55 A;  4ZLT F;  3CC4 A;  1QQ9 A;  4XPD B;  4HED A;  4X2T A;  1I94 Q;  1NSL A;  4CKE A;  2G9H D;  3PMF A;  3M4O H;  5K36 G;  1WTH A;  2WII B;  1YIJ A;  3R95 A;  1E1O A;  4KHP Q;  4MHN A;  4A3J H;  3HKZ G;  4AYB E;  1QNU A;  1LO5 D;  4P45 A;  5AG5 A;  2FL4 A;  2YTV A;  1WTO A;  3M7N A;  3DWQ A;  4KLV A;  4QIW E;  1B9N A;  1ARL A;  3PEI A;  5EGT A;  1E2Z A;  1K28 A;  4YWM A;  4AB7 A;  3PZJ A;  1WFQ A;  3OWF A;  2HQY A;  4A39 A;  3HOV G;  3GLJ A;  2KCT A;  2VQE L;  3M4Q A;  3CQZ B;  2Z4H A;  2YYZ A;  3B3C A;  2CF4 A;  2EBJ A;  4DR3 Q;  3A8J E;  1SJH D;  1FJG L;  3FJU A;  2Q4Y A;  5GCN A;  3CXQ A;  3IIB A;  1N71 A;  3KHX A;  2IJ0 A;  4FF4 A;  4NGM A;  2PRB A;  1OXX K;  2I07 B;  3M4P A;  3Q22 A;  2BOS A;  4DK1 A;  4GN3 B;  1UFH A;  1DXM A;  4LUA A;  3SI1 A;  1GM5 A;  1V43 A;  1ZYR C;  2EY6 A;  3I91 A;  4HJ8 A;  1ONL A;  4IFD G;  5DWN A;  4ZAI A;  5GAE C;  1NR4 A;  3S6G A;  1YVC A;  2KOL A;  4EQP A;  4JBJ A;  2QYV A;  2C35 B;  3W2D A;  2KCN A;  2L15 A;  2CKZ B;  3KLW A;  1UE5 A;  2QA4 A;  2WYR A;  1SNQ A;  5H1S E;  1OZP A;  2DF5 A;  4M6H A;  1HZA A;  4CS0 B;  1I21 A;  2PW5 A;  4QB9 A;  2VUM H;  1U9R A;  4RHS A;  3H15 A;  2NMT A;  3HOY G;  3PIO A;  3PO2 G;  2BDN A;  2RDH A;  5CMD A;  3GTK B;  1SJE D;  2ARH A;  3K80 C;  2A8V A;  4NSQ A;  4X3T A;  1PRT D;  1XMT A;  1BLL E;  1IKM A;  3NBH B;  1R9T H;  3OIQ A;  2ZW4 A;  3I70 A;  4RMF A;  1I6H B;  1CX8 A;  3PO3 H;  4DAY B;  1ML0 D;  3SHL A;  1YNN D;  1RO5 A;  5IGE A;  4DR5 Q;  3TFY A;  1QVC A;  2RVL A;  3FVQ A;  2Q7S A;  5CV8 A;  2Z3M A;  4QVT A;  1QOH A;  2JXM B;  5I6Y A;  4MRI A;  3W1G A;  1Z2L A;  4R4T A;  3EVQ A;  4IOA A;  5A28 A;  1B44 D;  4M85 A;  3BZD B;  2B3U A;  1YR0 A;  4XT3 B;  4G1P A;  1JB3 A;  3RBU A;  2A73 B;  2R7F A;  5C4X G;  4CJ0 B;  3GTQ B;  5E1F A;  4P73 A;  2UXB Q;  1NR2 A;  3VYT A;  4GN4 B;  2PDO A;  2GVB A;  3BVZ A;  5D14 A;  1FL0 A;  4FWU A;  2Z3L A;  3TS0 A;  2FIW A;  3T51 B;  3P7J A;  1SDF A;  3B3W A;  4Q0F A;  2ID0 A;  3CCU A;  1EOT A;  3CCE A;  4A3E B;  3CQZ H;  1MI2 A;  1BPM A;  5ELE A;  3S6K A;  2FIA A;  1CA5 A;  1LCP A;  3MHB A;  1QSN A;  4DV3 Q;  4NFR A;  1ZG8 A;  4LF8 L;  3S17 B;  4A37 A;  2C27 A;  2EO8 A;  3ICE A;  4N8X 1;  2E75 C;  4H89 A;  4M6I A;  1VHO A;  4OEL B;  3NTH A;  3HOZ B;  1S5C D;  1AUG A;  1Q2Y A;  4M6G A;  3P75 A;  3TP8 A;  2CVR A;  2E2J B;  4ZX8 A;  2Q43 A;  2FCK A;  1F2P A;  2MUY A;  3FPP A;  2QEX A;  4JI6 Q;  1YGH A;  4R8I A;  1I6V C;  3LNN A;  3A54 A;  4CGM A;  3OYY A;  3J80 c;  1N33 Q;  1K3B C;  1N32 Q;  4HNX B;  2Q2I A;  1VGY A;  5E4X A;  2PC1 A;  1HCZ A;  1LTS D;  1TT2 A;  2K5W A;  1G29 1;  4JI6 L;  1QJO A;  2F0N A;  1EQQ A;  3PB8 X;  4KSA A;  4UPA A;  4MFP A;  3MEH A;  1KDB A;  1GUN A;  3WOE A;  3JAM E;  3GV6 A;  3HOZ G;  1H9J A;  1ON0 A;  2JA7 G;  3RN2 A;  2F3W A;  4K5V A;  4O0A A;  1BOB A;  1BUV T;  2J8N A;  2HCI A;  1LYL A;  5IT9 c;  3H3V C;  2EYP A;  3QB8 A;  1A62 A;  4FXG C;  4YFJ A;  2E5L Q;  4B3R L;  4PNY A;  4KLK A;  1MHW C;  4WRD A;  5JAV A;  1VF5 C;  5CV5 A;  1V8Q A;  4KJN A;  2CH4 A;  1S5B D;  1Q1E A;  4X3U A;  4PZ7 A;  5KEE A;  5M3F B;  1EWC A;  3CCM A;  5C6A A;  3KZW A;  2QGQ A;  1TWA B;  3EFX D;  3RZO B;  2IJZ A;  3W3A A;  4HN7 A;  2WB1 E;  4C7I A;  4DA2 A;  2QDB A;  1CP6 A;  2I00 A;  3IWE A;  4IQZ A;  3G71 A;  1BDO A;  4BBR G;  4A3I B;  3KFU A;  2AQ1 B;  5C4X B;  1EEF D;  5IX3 A;  3CPF A;  2RHS B;  2DGY A;  2XGT A;  5ELB A;  1LOK A;  1PZJ D;  4R9W A;  5EAY A;  4BY1 G;  3TZU A;  2FJ2 A;  1MJ9 A;  4BD9 A;  1I3Q B;  3I4N G;  1VCI A;  4JW0 A;  1TY0 A;  4LK1 C;  5ELD A;  1IBL Q;  4G7Z C;  3S1N B;  2F0L A;  3IFT A;  3KF8 A;  2A68 C;  4X65 Q;  2OZG A;  1NJI C;  5KGU A;  3D2P A;  1NY4 A;  3D7G A;  1KRS A;  1EQT A;  4KI0 A;  2R7Z H;  4FF2 A;  3IC1 A;  1STE A;  1E3P A;  3K5N A;  4BXX G;  3KBG A;  2AMC B;  2VZY A;  4RS2 A;  1N34 Q;  1LT3 D;  4HJ9 A;  1DOM A;  1KLG D;  4A3B H;  1X10 A;  1T5E A;  2JP1 A;  3TEH B;  2IL4 A;  4BBR H;  4UP7 A;  2M2L A;  3TOB A;  4MMO A;  2SDF A;  3PSI A;  3L7Z C;  1Y1W B;  1HDU A;  1STB A;  1JQY D;  4PZ6 A;  5IP9 G;  1HNX Q;  2ZEE A;  1VQ6 A;  4WWV A;  2FFK B;  5FJ8 H;  1B6B A;  1EQV A;  2B58 A;  2A1A A;  1EE3 P;  2D4O A;  3MXN B;  3I3C A;  3R2I A;  1OBR A;  1IU8 A;  5AG7 A;  4NXM L;  2PJ4 A;  2SNM A;  1F77 A;  3BJU A;  4CJ1 B;  5HVG A;  1O78 A;  4DPG A;  3UDG A;  3NWS A;  4FO2 A;  2WAQ G;  4KN7 C;  3TP5 A;  4A3D H;  1K0S A;  1ARM A;  1DTD A;  2CXA A;  2EK8 A;  5M5Y B;  1CI3 M;  3E9I A;  4ZKB B;  1GUT A;  2EOT A;  1EY9 A;  5AJ3 Q;  1YVK A;  5M9O A;  1PH6 A;  3SDZ A;  3RZO H;  4UFV A;  5HH1 A;  3M3Y B;  3EC4 A;  3D31 A;  3G7L A;  1PCA A;  5IGF A;  1TKJ A;  3WT4 A;  3S1M H;  1S5K A;  2Z0Z A;  1VHE A;  1Q12 A;  5M3F H;  3T53 B;  4P4F A;  4CYO A;  4RGN A;  2NWG A;  2P6F A;  5LL6 X;  2D0P A;  1L0Y B;  1P0H A;  4EVY A;  4DAP A;  1XMO L;  1AMP A;  3CXS A;  1STY A;  2Z6B A;  2NVT B;  4JVZ A;  2CHB D;  3BVG A;  4X62 Q;  5COR A;  3QAH A;  1EIG A;  1AZQ A;  5EBV A;  2OOT A;  3IL8 A;  1STA A;  2VQE Q;  1D1I A;  1LFW A;  3HOV H;  4MY0 A;  3UDF A;  2BL1 A;  5FVJ A;  4PXE A;  1XNR L;  1QSO A;  1EU4 A;  4DR6 Q;  2C6P A;  2E2D C;  1JIC A;  2F3V A;  5ISV A;  4K6D A;  3HOV B;  5HVF A;  4OL7 A;  3PP9 A;  2RSN A;  5T1G A;  2XVS A;  4XPK A;  4DR4 Q;  2NVT H;  2L55 A;  1ZYR D;  3TCV A;  4OLL A;  1PLF A;  3H6M A;  4KZT A;  1TKF A;  4CYP A;  5K5P A;  4KUB A;  1YBY A;  2VY3 A;  1HNZ Q;  2PJ3 A;  4C3I H;  1PFS A;  2PNH A;  1YNJ C;  3Q6S A;  3OSO A;  2GAN A;  1XJV A;  3S1M B;  4A93 G;  2C9O A;  2C6G A;  3VYS A;  3LAC A;  3MAQ A;  5C3X A;  1ROD A;  4GS4 A;  2ZOF A;  3EJI A;  3S1R B;  3NE5 B;  4UIB A;  2AWO A;  3S17 H;  2F0V A;  3NBI A;  1HZB A;  1KAA A;  4UA3 A;  4JI7 L;  4FF3 A;  3NEL A;  4DK3 C;  1Z8W A;  4IHM A;  4FNF A;  3NHH A;  2PCU A;  1BQQ T;  3HP3 A;  3CCS A;  5IP7 G;  4PSX A;  2NB0 A;  2Z8L A;  4XPD C;  1C9O A;  3F2U A;  3ZJY C;  1YJ9 A;  3SK8 A;  4PV1 C;  4X6A H;  4B3T L;  5M5X B;  3PGP A;  2IL8 A;  2Z6K C;  4A3K H;  1G51 A;  4A3L H;  4YCU A;  4FAI A;  4YWY A;  4UP8 A;  3F0A A;  3DR8 A;  4BBR B;  3MC0 B;  4L5Q A;  1PH7 A;  2OT2 A;  4LNQ A;  3SE0 A;  2PR1 A;  1SYF A;  2K01 A;  1Q1B A;  3GTL H;  1K3R A;  1F57 A;  1KHI A;  3M85 A;  4LFC Q;  2ZPA A;  2QJ8 A;  4DR1 L;  1S7L A;  3FNC A;  2I79 A;  3C1E A;  2F4V Q;  1MJA A;  2Z10 A;  5IGG A;  2K6A A;  3Q0A A;  4JI2 L;  2VEZ A;  2SOB A;  1A2T A;  1VMC A;  3FF3 A;  1RCV D;  2KQ3 A;  2N49 A;  3EN2 A;  3S1N H;  3JUW A;  5LRG A;  4XTC S;  1OXS C;  1UE6 A;  4RGM A;  1CJW A;  4DFA A;  5CV6 A;  4BBH A;  1ZXT A;  3TN2 A;  3F5B A;  1RL2 A;  2C5C A;  4OME A;  2ODF A;  1T9H A;  4B08 A;  1CFM A;  3VYR A;  3SJF A;  1R9T B;  3X3M A;  1O7Y A;  2FIN B;  1ZLH A;  1H9S B;  3H94 A;  2JJQ A;  3C26 A;  1PTO B;  2D2C C;  4B9W A;  2F0H A;  1TR5 A;  4Q5V A;  4O2D A;  4NXN L;  3W6X A;  2E74 C;  4B12 A;  1CUK A;  3KLS A;  1WTV A;  4JI3 Q;  2GU2 A;  3BI0 A;  5E96 A;  5BWA B;  3A8K E;  2O53 A;  4PXC A;  4LW1 A;  1B53 A;  3PB9 X;  1JB7 A;  4IFD J;  1B1Z A;  4UFX A;  4CBV A;  1SMX A;  2PIY A;  2OTL A;  2BUE A;  1Y1V B;  4OC0 A;  3I4O A;  5F2D A;  3E0J A;  1VQL A;  4JI4 L;  1TWF H;  4LWC A;  4EQN A;  4QC6 A;  1BBU A;  5IT9 E;  3NQI A;  3D68 A;  2REF A;  2DY8 A;  3AQQ A;  4PK3 A;  4DR1 Q;  3V8I A;  4B5O A;  3TDQ A;  4P71 A;  4P75 A;  3S9N A;  4MBU A;  1RJT A;  3BDO A;  4JOI C;  5JEA J;  4U9Z A;  1RTN A;  3JVN A;  1WD1 A;  2EPB A;  3BXM A;  1CPS A;  2AFU A;  5D29 A;  1Q3L A;  2E2H H;  4H44 C;  2CTB A;  3RLN A;  4LF4 L;  2FS5 A;  1A2Z A;  3ZYY X;  4N9P A;  2Q8I B;  1IB1 E;  5G22 A;  3MZ5 A;  2JA6 H;  1LV9 A;  2PZU A;  2EDG A;  2E8G A;  1S3Z A;  3K8A A;  2RA4 A;  1CBX A;  2JA7 H;  5BN3 A;  4JI0 Q;  4EVO A;  4AYB B;  4H2K A;  3TT2 A;  1KD1 C;  2XWB B;  5EBC A;  4ZY0 A;  4KOY A;  1HHV A;  2QEJ C;  1EFW A;  4A3J B;  1YQE A;  3HS0 C;  4U67 3;  3S1Q H;  2PIZ A;  4J6H A;  3K5M A;  4DV1 Q;  1VQ5 A;  5C3E B;  1QMU A;  3LWE A;  4IUV A;  1AZP A;  3OTO Q;  2EYM A;  4Y7N B;  1I50 H;  4NXY A;  1FT7 A;  4FUU A;  2ZJQ A;  2GN5 A;  3S2D H;  1JWU D;  4ME5 A;  3SJG A;  3FEC A;  1I4R A;  2IQ6 A;  2AQ2 B;  2NVY B;  5I6W A;  3BLN A;  4A3J G;  4R1J A;  4A3G H;  4X8I A;  2HUG A;  4H7B A;  2LFN A;  1LT5 D;  3S24 A;  1BKB A;  3OOC A;  1AE2 A;  1IYJ B;  2EVB A;  3FRM A;  2OCE A;  4DUZ Q;  2QW7 A;  1DZ1 A;  2LXK A;  5IT9 L;  4JOI A;  2PJB A;  4GOP B;  4E2A A;  2KA7 A;  2M9V A;  4GNX C;  1FGB D;  1JMC A;  2AFW A;  1A3V A;  4NW2 A;  5KYL A;  1IBL L;  3D4U A;  3NQT A;  2AFS A;  2OZU A;  4OWX B;  2Z0S A;  4DF7 A;  3QNV A;  4JI3 L;  3FPU B;  4RGT A;  4KVM E;  4A33 A;  2CQA A;  2BDO A;  2PO4 A;  4R57 A;  2F1M A;  4CHT B;  3L2P A;  3IWG A;  3NUC A;  2XIW A;  3BI1 A;  4MHZ A;  4NXN Q;  4LUV A;  1J4J A;  1IBK Q;  2CCZ A;  1L2F A;  1CZW A;  4B10 A;  1W3S A;  2GE3 A;  3ERQ A;  2A19 A;  1PH9 A;  5A35 A;  4DR4 L;  2K50 A;  4C56 C;  3A7L A;  2JA8 H;  1LTR D;  5ISR A;  2AWN A;  3E3X A;  1Z8X A;  3PQI A;  3CU7 A;  1TWH H;  3TTH A;  2JYO A;  3NA6 A;  2CWP A;  2JN4 A;  2BE5 C;  2M00 A;  4RA8 A;  2F0U A;  2OTJ A;  1IBK L;  4GNX B;  3TME A;  3TS2 A; 
#chains in the Genus database with same CATH homology
 1B4O A;  5DM7 3;  1AN8 A;  1UNS A;  4HTH A;  1H9R A;  2L11 A;  2WV6 D;  4MCR A;  1U4R A;  1F2Z A;  1H9K A;  2GLF A;  5IB9 A;  5EQ0 A;  1R4Q B;  1SMY C;  3R8B A;  3D4D A;  2R92 B;  5LYL A;  5I9P A;  3I4N B;  4TWE A;  2K04 A;  2XEJ A;  3V96 A;  2I3C A;  4K5W A;  5FKA C;  1JOR A;  2H4O A;  1ICW A;  4L63 B;  5I4D A;  4M8A A;  1S5F D;  1EYC A;  3D3R A;  5CR3 A;  1TXR A;  1CT1 D;  3H09 A;  1I4G A;  1JCK B;  1YNJ D;  4WFN 3;  1XTC D;  2NN6 H;  3MTS A;  1J9O A;  1LTT D;  2LY7 A;  2A6H D;  3L2N A;  1SXT A;  2RKS A;  1TQO A;  3H8G A;  4ZY2 A;  3J81 E;  5J1Q A;  2PVW A;  3WOF A;  4DGZ A;  4A94 A;  2B2T C;  1C8C A;  3GTP B;  4A93 B;  1TF8 A;  1Z8L A;  3VA5 A;  3ITP A;  3S1Q B;  3VH9 A;  3PBE A;  4AXV A;  5G3L D;  3FEE A;  1Z7T A;  5JOB A;  3N52 A;  1VMP A;  2F0I A;  4EGV A;  4K2K A;  2JEB I;  3WAB A;  2YU9 B;  4OC1 A;  4BY7 B;  4V19 0;  1STG A;  2ICE C;  3CT9 A;  5JPM C;  2ZXR A;  5JPN C;  1L0X B;  2QVP A;  5EPJ A;  1DON A;  5CV7 A;  3M4Y A;  1V1P B;  4PMC A;  3QWN A;  1G91 A;  3B3T A;  1I4X A;  3MXP A;  5E4W C;  3GV3 A;  3WC6 A;  5F09 A;  1YSJ A;  5CV9 A;  4B9X A;  2OF1 A;  2WAQ B;  3DHQ A;  3VR6 A;  2IX3 A;  1FNV A;  4DXF A;  4P44 A;  2BO9 A;  1TS4 A;  5I4M A;  4UIA A;  2EK9 A;  1M4L A;  2SNS A;  1EY8 A;  3FX6 A;  1RTQ A;  1LAN A;  5JGF A;  4GZY C;  1F2M A;  3DXJ C;  3KLR A;  3H91 A;  1XYI A;  1HA6 A;  3S9N A;  3Q23 A;  3HLP A;  4O23 A;  2MP1 A;  1CTM A;  2DNC A;  2DEA A;  4WJB A;  1PFN A;  1OXU A;  5LYI A;  2FHT A;  1S4Z A;  3JRU A;  1LAM A;  3ND9 A;  3KGQ A;  4RAU C;  4U68 A;  1FD7 D;  2BA1 A;  4MHE A;  1TS2 A;  1AFP A;  1YLO A;  7CPA A;  3KBX A;  1IL8 A;  2PMZ B;  1B9M A;  4LMQ D;  5THW A;  2F0K A;  3QG1 A;  1PTO C;  2ZEF A;  4I7Z C;  1YNN C;  4DU9 A;  3DWA A;  4XQJ A;  2PJ6 A;  5FLX L;  2BOA A;  4DNT B;  4C2M B;  3NFZ A;  4DNR B;  2C6C A;  4KD3 A;  3J80 E;  2AFO A;  3MN8 A;  1QNK A;  3KL9 A;  5CC4 A;  2HDL A;  4FYD A;  4XT1 B;  2EXZ A;  4F88 A;  1AP0 A;  1Q90 A;  1BBX C;  2OR4 A;  1GXD C;  4UF4 A;  4IUN A;  3BHX A;  1WTR A;  2B2T A;  4F8M A;  3D7H A;  2PCF B;  4P4J A;  1HDQ A;  1BR9 A;  1I4P A;  2F03 A;  2K33 A;  3SJE A;  3KUP A;  1DCZ A;  1S5E D;  4K6L A;  2XN9 C;  3IFE A;  4W9Y A;  1HTL D;  3TX8 A;  4N9T A;  1RKN A;  5JJZ A;  4IUT A;  2VNU D;  2K05 A;  3MFG A;  1Q8I A;  2PQE A;  4QCL A;  3GTM B;  2A6E C;  5I2X A;  4H0L C;  1GYT A;  1KAB A;  4OC3 A;  1TVX A;  4F7X A;  3GTO B;  3QOL A;  3X3N A;  4P4D A;  3I8Z A;  1G6Z A;  1XMB A;  1UUP A;  2R7Z B;  4JBW A;  3OWE B;  2NVX B;  2SEB D;  2XEG A;  4RFB A;  1KLU D;  1DJR D;  4RKL A;  4P4B A;  3S9W A;  4KK7 A;  2R61 A;  4PXB A;  1SAP A;  3IFD A;  3MFY A;  3V38 A;  2NN6 G;  1HA5 A;  1W6J A;  4ONW A;  4P4I A;  3OPO A;  3HKZ B;  3WC7 A;  1WCM B;  2WKC A;  1ILP A;  2L12 A;  1EYD A;  1BNZ A;  1SNC A;  2JA8 B;  2GA4 B;  2NTS A;  1LTB D;  4P10 A;  2CW0 D;  3TSS A;  4J8Q A;  4HMI A;  1TY2 A;  5AFW A;  1RTO A;  3NPP A;  4QUC A;  3C3L A;  3NK9 A;  3P1H A;  2Z4I A;  1Y69 U;  2B2U C;  1U4P A;  2EE1 A;  4MXU A;  3T8W A;  5IGD A;  3IJ3 A;  2Z1C A;  1PFB A;  1IW7 D;  1EYA A;  1I50 B;  3PIP 3;  3TC8 A;  2FMM A;  1NSA A;  1Q7L A;  4MHY A;  1OXV A;  3QIA A;  1F2Y A;  1EY7 A;  3I1U A;  3J7A V;  5C0X H;  4KY5 A;  2VB3 X;  4RGO S;  3A7A B;  3K5L A;  4PXD A;  3LMS A;  4EME A;  4HSP A;  5KNB A;  2PZT A;  3DGV A;  2HDM A;  2KVM A;  3GO5 A;  1JC7 A;  1F9S A;  4MCS A;  5KND A;  1HTP A;  3TP7 A;  4ZY1 A;  2O5J C;  4KD4 A;  1UAP A;  2ICI A;  5K8M A;  5DS0 A;  4IUR A;  1B50 A;  2E2H B;  4BS9 A;  5ELY A;  1SND A;  3CHB D;  1JWM D;  1VF7 A;  3TBI B;  1LLR D;  5JVH 3;  2B8G A;  3L3O C;  2RDF A;  1NAP A;  4EWT A;  2R6G A;  2KJX A;  1CM9 A;  1DD2 A;  2V8D A;  2EZV A;  3SJX A;  2IX0 A;  4KHV A;  3T13 A;  4CKC A;  1IYU A;  4ODG A;  4HSV A;  2B63 B;  4HCE A;  1CPX A;  4OIW A;  4UEE A;  2Y0S B;  3QOJ A;  4A3M B;  2QCP X;  4NJR A;  2F0O A;  3PB7 X;  4DK0 A;  2O5I C;  3PUV A;  4C3H G;  1GUS A;  2IW3 A;  3RZA A;  2ZXO A;  4PQA A;  4KN4 C;  4XIG S;  3D6W A;  1SNP A;  3K2K A;  4OID A;  3GTL B;  4TQU S;  5KNC A;  3EA6 A;  4OC4 A;  1LAP A;  3NTK A;  3VR3 A;  3K57 A;  4NJQ A;  1EEI D;  4XQQ A;  1XX8 A;  1EY6 A;  4C3H B;  4MCQ A;  3BVM A;  1PYW D;  4UEZ A;  1QCB D;  5JH9 A;  2EY2 A;  5EPK A;  4ZUJ A;  4C3J B;  1FNO A;  2J4X A;  4XQN A;  1LAB A;  3MA2 B;  2WIN B;  1SYB A;  3PFE A;  1CK1 A;  2XEF A;  4S3S A;  4XYQ A;  1QIL A;  1CQF A;  2F8H A;  1JOK A;  3CPA A;  5A2Q E;  1PFM A;  3PIO 3;  2B2V A;  2PJ0 A;  3HZX A;  4BY1 B;  3NP8 A;  4TKO B;  1Y0R A;  2VL1 A;  3L9A X;  2DNE A;  5K8N A;  3GB0 A;  4G7H C;  4ZX9 A;  2EYL A;  3HOW B;  1KWM A;  5K36 H;  1RDP D;  1EZ6 A;  1PTO D;  3HUV A;  2GRE A;  1O7Z A;  1RHP A;  4V0B A;  3MXN A;  4R8F A;  2PJC A;  2LKV A;  1PRT B;  4DJL A;  1HEE A;  3FRP B;  2V77 A;  3J80 L;  4QMG A;  4ZRZ A;  3KK7 A;  1D5M C;  3GUX A;  3QJY A;  4K8I A;  4OKO A;  5D3D A;  4PMW A;  2N88 A;  3QB3 A;  2FVG A;  3KLS X;  4KJO A;  4A3D B;  5C0X J;  3HGB A;  2ZEN A;  3NH4 A;  1STH A;  3CDX A;  2CIJ A;  4M1U B;  4IUQ A;  5C4Z A;  3HOU B;  1R4P B;  1QWY A;  5C3W A;  3C46 A;  2F0T A;  1FNU A;  5CV4 A;  3D6C A;  1PMR A;  2JA5 B;  3R2T A;  3WC5 A;  5CGK A;  1ENA A;  3D4W A;  1GOZ A;  2CW0 C;  3RD4 A;  3A8I E;  1X3Q A;  3RZD B;  4ZYQ A;  5HXD A;  2O4X A;  2NYQ A;  1Z47 A;  5TSS A;  1K83 B;  5I2Y A;  5ELC A;  1LT4 D;  1BCP C;  1EY0 A;  3CRK C;  3VAR A;  5M3M B;  4BWG B;  1IYV A;  3TZD A;  4KY6 A;  4FXD A;  4ABN A;  2WKD A;  4XXE A;  2NN6 I;  5IGC A;  1AEX A;  2F0E A;  1XXG A;  4KTA A;  2K5D A;  2WB1 B;  2Q4Z A;  2MHV A;  3CPX A;  4R6T A;  3T4A C;  1TWH B;  2N55 A;  3DEO A;  5FOB B;  2GLJ A;  2LMC B;  4OP4 A;  5CPA A;  3K5O A;  2IX1 A;  1ENC A;  5C0X G;  4FF1 A;  4G7O C;  2F0M A;  2KEC A;  2ZXP A;  2RBM A;  2B2V C;  4RKB A;  4LJZ C;  1JR0 D;  3MRU A;  2Q8T A;  4CJ2 C;  1QG7 A;  2EYF A;  4QB4 A;  5C44 B;  3PUZ A;  4NDX A;  3FED A;  1FNW A;  4QUF A;  4NGQ A;  1SBB B;  3AB9 A;  3ISZ A;  5M5W B;  2VB2 X;  5FK9 C;  3OHX C;  5NUC A;  4RWS C;  1HPC A;  3J7A F;  2PJ7 A;  2TMP A;  4NGN A;  3KQZ A;  1D5X C;  1SNM A;  2B2W A;  1HUN A;  3SK6 A;  2L1B A;  3G6J B;  1TU2 B;  3NTI A;  2XEI A;  1EL0 A;  1LTA D;  4MCP A;  4F9V A;  3ERO A;  3E5S A;  2X69 A;  3BYT B;  1K8M A;  4K2L A;  3D7D A;  3CRL C;  1K8O A;  4R76 A;  2DY7 A;  2Q8R E;  4X3S A;  2POK A;  5JM6 A;  1WTX A;  3V05 A;  4HMJ A;  2XSC A;  1HRJ A;  2R3Z A;  3NBH A;  2B39 A;  1DE4 C;  1IGB A;  3RAM A;  1C4Q A;  3BDC A;  1WTW A;  4RCN A;  1SNO A;  4RHR A;  2PPB C;  4OIJ A;  4KKU A;  3FEW X;  2A5H A;  8CPA A;  1SMY D;  2WZN A;  3KR4 A;  4P2C B;  1TWF B;  1CHQ D;  3SI0 A;  2F0F A;  5EKL A;  2R93 B;  1WTQ A;  2O2L D;  1G2T A;  3GTG B;  4KHZ A;  1Z5R A;  1ZEQ X;  3PO3 B;  1SYD A;  2K03 A;  3LX0 A;  3TP6 A;  3KI9 A;  3B2Y A;  2ANP A;  4KKS A;  2NYZ D;  5C0X I;  3D4R A;  5ELF A;  3R93 A;  3D7F A;  3RMH A;  2MPM A;  4TNU A;  1CP7 A;  2ABZ A;  1ESR A;  4QF4 A;  1YW4 A;  2A6H C;  3DLJ A;  2F0D A;  3B7I A;  1SSO A;  5CYU A;  2VXW A;  4R8N A;  2PJ8 A;  3VR2 A;  3GQB A;  2F7V A;  1SYG A;  4KKT A;  1Y8N B;  2EY1 A;  2MJ8 A;  3DEP A;  5J1Z A;  1GUW A;  1X32 A;  3WDN A;  1JWS D;  2PJ2 A;  3HEJ A;  2A69 C;  1ELL P;  5BN4 A;  1XBU A;  4ZUI A;  4JK1 C;  1XFO A;  1BOS A;  3KAS A;  1M4V A;  4Z9C B;  4QIW B;  1X3P A;  3BDL A;  5LYF A;  1PZI D;  4IZ8 A;  4C3I B;  3PUY A;  1XJO A;  4KV6 A;  1AYE A;  5K8O A;  4OGQ C;  3URY A;  5D8N A;  4DUK A;  1KNE A;  1Y8O B;  3K7A B;  1RF2 D;  2RDG A;  4FXK C;  1GJX A;  3DWP A;  4C3I G;  1KNA A;  4EFD A;  4JZ0 A;  2OEO A;  1RD9 D;  5HGT A;  1R3N A;  3HOX B;  2TSS A;  1MD2 D;  3MWY W;  1WD0 A;  4DAY A;  1GHK A;  4IK2 A;  2NTT A;  1Y0Y A;  3VR4 A;  1Y7E A;  1IY7 A;  1SE4 A;  1M8A A;  2HQE A;  2I46 A;  4L8J A;  1F2O A;  4A38 A;  1ET6 A;  2HC9 A;  4ULL A;  3HG9 A;  1WTP A;  1EU3 A;  2XRS D;  5G3L F;  2JEA I;  5D3I B;  6CPA A;  2ZEG A;  5KYI A;  1ESF A;  1MGS A;  1KDA A;  1PRT C;  2J7Z A;  4KMU C;  2K7V A;  5DEH A;  2KCC A;  1SE2 A;  1II3 A;  3S9L A;  3GTJ B;  1IKL A;  2NBF A;  2WP8 J;  1F2L A;  4F8Z A;  4A3B B;  3E6Z X;  4ZKC B;  2KHS A;  5C4H A;  4FVM A;  2XNA C;  1H8L A;  4HCS A;  4CKB A;  5FO9 B;  4BA2 I;  4O42 A;  1DOL A;  3DUZ A;  3PO2 B;  2XRQ D;  5DM6 3;  2PJ1 A;  1VIX A;  2WAC A;  1EFI D;  1EY5 A;  2F0Q A;  4CPA A;  2EJF C;  2L0C A;  4C1N K;  3H8E A;  1HFN A;  3KHZ A;  1ILQ A;  2A68 D;  2IMO A;  5C5L A;  5JEA H;  2RB7 A;  1BCP B;  3FDT A;  4NKL A;  4XYO A;  3I73 A;  2PJ9 A;  3SXH A;  5CBA E;  1C48 A;  2F0P A;  1MSG A;  1ZG7 A;  1YME A;  4NMZ A;  2EYJ A;  4GM5 A;  3PB4 X;  4IN3 A;  5FO7 B;  4LQG A;  3VR5 A;  3H8F A;  3VAT A;  2AQ3 B;  3P20 A;  3I72 A;  3J7Y W;  1F9P A;  4BBS B;  3UI2 A;  1BPN A;  4PQX A;  2CTC A;  3VA7 A;  4XDX A;  3VYU A;  2K28 A;  4MHP A;  3SEB A;  1JOQ A;  4OHJ A;  5LRK A;  1H9S A;  1SE3 A;  2E2I B;  1IW7 C;  2JEW A;  1YW6 A;  3OMG A;  2A6E D;  3RLF A;  5JVG 3;  2NVQ B;  1GHJ A;  1LAC A;  2B2Y A;  3DM1 A;  1B2T A;  2IWH A;  2PYK A;  3ND8 A;  2F0S A;  4G57 A;  1TS3 A;  3C1F A;  1BCP F;  4KY7 A;  2ZEO A;  2F0W A;  1A15 A;  4OO1 H;  3KR5 A;  1BAV A;  4BA1 I;  2G9D A;  1HUM A;  1HQM C;  1LTG D;  5IOC A;  1G2S A;  1R43 A;  4IFD I;  4OO1 I;  4E6I A;  4IFD H;  1I4H A;  1TWG B;  2D5D A;  3NWT A;  2ZED A;  2A74 C;  5EJW A;  1TWC B;  1D6E C;  2QIL A;  4JYW A;  1TS5 A;  2ZEM A;  5EBD A;  1ET9 A;  1D2B A;  3S9M A;  2A69 D;  2K32 A;  5LRJ A;  1OXT A;  5FO8 B;  5J22 A;  1VDZ A;  2ZEP A;  5J39 A;  2VUM B;  1I4Q A;  2JSO A;  4OIK A;  2B2W C;  3PV0 A;  3U9O A;  3OIP A;  2V8G A;  1B3A A;  3CKI B;  4H13 C;  3U9S A;  1EIH A;  2V8H A;  3NSW A;  4I65 A;  2NUC A;  2D62 A;  1EZ8 A;  2AUK A;  5K8P A;  4IUP A;  3NH8 A;  4IAV A;  2KEE A;  3FKI B;  1EY4 A;  3FVL A;  1SYE A;  2PRQ A;  2F0J A;  4G4K A;  3K58 A;  2XWJ B;  5BN5 A;  3EQL C;  2F4I A;  3M7G A;  4LAA A;  1CA6 A;  3S14 B;  1PYT B;  3K0Y A;  1E0B A;  1CZG A;  1KDC A;  3RUZ A;  1D5Z C;  1SFO B;  1KTK A;  3IAY A;  5DAU A;  4A3G B;  4B6Z A;  3M4O B;  1F9R A;  2K1B A;  4K3N A;  2B2Y C;  2X6L A;  2RSO A;  3S2D B;  5LYD A;  1TKW B;  2PJ5 A;  4J1M A;  3S15 B;  5IIF A;  1CHP D;  1WVL A;  2PVV A;  2AFX A;  3D67 A;  1PZK D;  4YU9 A;  1MSH A;  1JE4 A;  2RFH A;  1E2W A;  4C3J G;  5LHY 1;  3IO1 A;  3OW7 A;  1PDQ A;  1HQR D;  1S5D D;  1NSN S;  5D65 A;  2H1E A;  2IT1 A;  2BA0 A;  2BCO A;  2FMC A;  4P6Y A;  4TSS A;  3I4M B;  1FR3 A;  3V7Z A;  2B2U A;  1SEB D;  5C5M A;  3JAM L;  3S16 B;  2PNR C;  5CBM A;  2C1C A;  2V8V A;  4K14 A;  1DM0 B;  3I4L A;  3N6R A;  4ZK9 B;  4RH6 A;  3HRZ C;  1G8Z D;  2O4H A;  4ILW A;  3SVM A;  3T16 A;  2HCC A;  2JE6 I;  2KED A;  2EWB A;  3MXU A;  2E76 C;  1ELM P;  1ZG9 A;  4KSI A;  4IUU A;  4DYO A;  2ZT9 C;  2ZEL A;  4NGR A;  2X6G A;  2LS0 1;  1EWH A;  2PJA A;  2EJM A;  3PUW A;  1A3U A;  5HUR A;  4MN3 A;  3AU7 A;  2KUM A;  4F87 A;  4HR7 B;  5HVH A;  4Q7A A;  1JOO A;  5A2Q L;  3I90 A;  2DN8 A;  1HXY D;  1BF4 A;  5EPL A;  4ZI6 A;  3T56 B;  1TII D;  4X3R A;  2BE5 D;  4PMB A;  5IOD A;  3B35 A;  2OXP A;  1T5X D;  1U4M A;  3NH5 A;  1A6X A;  1O7L A;  2PW7 A;  3KQX A;  2F0G A;  2EYO A;  5EKI A;  2L5T A;  3IWW A;  3SI2 A;  1E2V A;  4UDU C;  2V4D A;  1O80 A;  1W6K A;  2D9U A;  4DAV A;  3PUX A;  3BS1 A;  3K59 A;  1ZKO A;  2HB6 A;  3D8G A;  2AUJ D;  4C1N I;  2PZW A;  3S2H B;  1LT6 D;  4A3K B;  3GP7 A;  2AFZ A;  2K5Q A;  1STN A;  4ZQ3 A;  4L6T B;  3O13 A;  4R7M A;  4FP5 D;  1GUG A;  2ZOG A;  1QE6 A;  2ZEH A;  4PPZ A;  1NCV A;  2B8F A;  5E3F A;  2L4N A;  1DYQ A;  5KIX A;  3N5F A;  2QF7 A;  3J81 L;  2IPK D;  2AFM A;  2JA7 B;  1UEA B;  4DN4 M;  1DOK A;  3IEH A;  3LWU A;  5CBE E;  4EQO A;  1Z6H A;  2JA6 B;  3BG3 A;  3D66 A;  1PXU A;  4TRD A;  3A56 A;  3IKJ A;  5LL6 S;  1PTO F;  4NP5 A;  1Y8P B;  1J8I A;  3SR1 A;  3Q24 A;  2PE3 A;  4UAI A;  2L9H A;  3K6O A;  3NXW A;  1XRY A;  1U4L A;  3BYY B;  3OMC A;  4DXG A;  5JEA G;  1SYC A;  4RCO A;  4YIJ A;  2J9A A;  2EY5 A;  4Z65 A;  1ZLI A;  4UEF A;  3K9T A;  2MGS A;  1D1K A;  3C2P A;  1F9Q A;  2QKI C;  1BCP D;  4WJW A;  1CQV A;  1QB5 D;  1UWY A;  2ENB A;  1PTO H;  4RUH A;  4CGY B;  1GUO A;  1A2U A;  4ZYS A;  3V2T A;  1OO9 B;  3ONA B;  3H0G B;  3QO2 A;  1IHZ A;  3AMU A;  3PFO A;  3HOY B;  1A3T A;  1XWE A;  4NGP A;  4O1N A;  5FLX E;  1V1P A;  4FBE A;  3MVV A;  4HAE A;  3B3S A;  1BO0 A;  5EKK A;  2Q51 A;  3SK4 A;  5IGB A;  1LTI D;  1TKH A;  5DNF A;  3DMU A;  5C4J B;  5T1I A;  1JQG A;  2RQX A;  4A3F B;  4OC5 A;  4NGT A;  4OC2 A;  2NZ1 D;  3GD7 A;  3SK5 A;  3FH4 A;  2JBK A;  2EYH A;  3R3O A;  4OO1 G;  4F9U A;  5I9O A;  4WOR A;  1H9M A;  2NSM A;  4ID6 A;  3ISX A;  1BXT A;  1TF9 A;  4NGS A;  3MXG A;  4IAL A;  3FMC A;  1AW7 A;  1CG2 A;  4MIU A;  3PBB A;  1PRT F;  2J0T D;  1ENF A;  1NUC A;  4X3K A;  1HFG A;  2EJG C;  2JBJ A;  4K8J A;  4P4E A;  3B3V A;  5COY A;  1FYC A;  1V1O A;  3PRT A;  4K5X A;  1MBY A;  5KRU A;  3PB6 X;  3A55 A;  4ZLT F;  1QQ9 A;  4HED A;  4X2T A;  4CKE A;  2G9H D;  3PMF A;  5K36 G;  2WII B;  4MHN A;  1QNU A;  1LO5 D;  4P45 A;  1WTO A;  3M7N A;  3DWQ A;  1B9N A;  1ARL A;  3PEI A;  5EGT A;  1E2Z A;  3OWF A;  4A39 A;  3GLJ A;  3CQZ B;  2Z4H A;  2YYZ A;  3B3C A;  2CF4 A;  3A8J E;  1SJH D;  3FJU A;  3IIB A;  3KHX A;  2IJ0 A;  4FF4 A;  4NGM A;  1OXX K;  2I07 B;  3Q22 A;  2BOS A;  4DK1 A;  3SI1 A;  1DXM A;  1V43 A;  1ZYR C;  2EY6 A;  3I91 A;  1ONL A;  4IFD G;  4ZAI A;  1NR4 A;  2KOL A;  4EQP A;  2QYV A;  3W2D A;  2KCN A;  2WYR A;  1SNQ A;  2PW5 A;  1U9R A;  4RHS A;  2BDN A;  2RDH A;  5CMD A;  3GTK B;  1SJE D;  4X3T A;  1PRT D;  1BLL E;  1IKM A;  3OIQ A;  3I70 A;  1I6H B;  1CX8 A;  1ML0 D;  3SHL A;  1YNN D;  5IGE A;  2RVL A;  3FVQ A;  5CV8 A;  1QOH A;  2JXM B;  5I6Y A;  4MRI A;  1Z2L A;  3EVQ A;  1B44 D;  3BZD B;  4XT3 B;  4G1P A;  1JB3 A;  3RBU A;  2A73 B;  4CJ0 B;  3GTQ B;  5E1F A;  1NR2 A;  3VYT A;  3BVZ A;  5D14 A;  4FWU A;  3T51 B;  3P7J A;  1SDF A;  3B3W A;  4Q0F A;  2ID0 A;  1EOT A;  4A3E B;  1MI2 A;  1BPM A;  5ELE A;  4NFR A;  1CA5 A;  1LCP A;  3MHB A;  1ZG8 A;  3S17 B;  4A37 A;  2E75 C;  1VHO A;  3NTH A;  3HOZ B;  1S5C D;  3P75 A;  3TP8 A;  2CVR A;  2E2J B;  4ZX8 A;  2Q43 A;  1F2P A;  2MUY A;  3FPP A;  4R8I A;  1I6V C;  3LNN A;  3A54 A;  1VGY A;  5E4X A;  1HCZ A;  1LTS D;  1TT2 A;  2K5W A;  1G29 1;  1QJO A;  2F0N A;  3PB8 X;  3MEH A;  1KDB A;  1GUN A;  3WOE A;  3JAM E;  3GV6 A;  1H9J A;  2F3W A;  4K5V A;  1BUV T;  2HCI A;  3H3V C;  2EYP A;  4FXG C;  4PNY A;  4WRD A;  5JAV A;  1VF5 C;  5CV5 A;  1V8Q A;  4KJN A;  1S5B D;  1Q1E A;  4X3U A;  5KEE A;  5M3F B;  1EWC A;  5C6A A;  3KZW A;  1TWA B;  3EFX D;  3RZO B;  2IJZ A;  3W3A A;  4HN7 A;  4DA2 A;  2QDB A;  1CP6 A;  4IQZ A;  1BDO A;  4A3I B;  2AQ1 B;  5C4X B;  1EEF D;  5ELB A;  1LOK A;  1PZJ D;  4R9W A;  3TZU A;  2FJ2 A;  4BD9 A;  1I3Q B;  1VCI A;  1TY0 A;  4LK1 C;  5ELD A;  4G7Z C;  3S1N B;  2F0L A;  3IFT A;  3KF8 A;  2A68 C;  5KGU A;  3D7G A;  1EQT A;  4KI0 A;  4FF2 A;  3IC1 A;  1STE A;  3K5N A;  3KBG A;  1LT3 D;  1DOM A;  1KLG D;  1T5E A;  2JP1 A;  2M2L A;  4MMO A;  2SDF A;  3L7Z C;  1Y1W B;  1HDU A;  1STB A;  1JQY D;  2ZEE A;  4WWV A;  2FFK B;  1EQV A;  1EE3 P;  3I3C A;  3R2I A;  1OBR A;  2PJ4 A;  2SNM A;  1F77 A;  4CJ1 B;  5HVG A;  1O78 A;  3NWS A;  4FO2 A;  4KN7 C;  3TP5 A;  1ARM A;  2EK8 A;  1DTD A;  5M5Y B;  1CI3 M;  4ZKB B;  1GUT A;  2EOT A;  1EY9 A;  5M9O A;  3SDZ A;  3M3Y B;  3D31 A;  3G7L A;  1PCA A;  5IGF A;  1TKJ A;  3WT4 A;  1VHE A;  1Q12 A;  3T53 B;  4P4F A;  4RGN A;  2NWG A;  5LL6 X;  1L0Y B;  4DAP A;  1AMP A;  1STY A;  2NVT B;  2CHB D;  3BVG A;  5COR A;  1EIG A;  1AZQ A;  2OOT A;  3IL8 A;  1STA A;  1D1I A;  1LFW A;  4PXE A;  1EU4 A;  2C6P A;  2E2D C;  1JIC A;  2F3V A;  4K6D A;  3HOV B;  5HVF A;  4OL7 A;  2RSN A;  5T1G A;  2XVS A;  2L55 A;  1ZYR D;  1PLF A;  3H6M A;  1TKF A;  5K5P A;  2PJ3 A;  1YNJ C;  3Q6S A;  3OSO A;  3S1M B;  2C9O A;  2C6G A;  3VYS A;  3MAQ A;  5C3X A;  1ROD A;  2ZOF A;  3EJI A;  3S1R B;  3NE5 B;  4UIB A;  2AWO A;  2F0V A;  3NBI A;  1KAA A;  4FF3 A;  4IHM A;  4FNF A;  3NHH A;  2PCU A;  1BQQ T;  3HP3 A;  2NB0 A;  2Z8L A;  3F2U A;  3SK8 A;  4PV1 C;  5M5X B;  2IL8 A;  4FAI A;  4YWY A;  4BBR B;  3MC0 B;  2OT2 A;  3SE0 A;  1SYF A;  2K01 A;  1Q1B A;  1F57 A;  3M85 A;  2QJ8 A;  3C1E A;  5IGG A;  2K6A A;  3Q0A A;  2SOB A;  1A2T A;  1VMC A;  3FF3 A;  1RCV D;  2KQ3 A;  5LRG A;  4XTC S;  1OXS C;  4RGM A;  4DFA A;  5CV6 A;  1ZXT A;  3TN2 A;  2C5C A;  4OME A;  4B08 A;  1CFM A;  3VYR A;  3SJF A;  1R9T B;  3X3M A;  1O7Y A;  2FIN B;  1ZLH A;  1H9S B;  3H94 A;  1PTO B;  2D2C C;  4B9W A;  2F0H A;  1TR5 A;  4Q5V A;  2E74 C;  3KLS A;  1WTV A;  2GU2 A;  3BI0 A;  3A8K E;  2O53 A;  4PXC A;  1B53 A;  3PB9 X;  4IFD J;  1B1Z A;  4CBV A;  2PIY A;  1Y1V B;  4OC0 A;  5F2D A;  3E0J A;  4EQN A;  5IT9 E;  3NQI A;  3D68 A;  2DY8 A;  3TDQ A;  1RJT A;  3BDO A;  5JEA J;  1RTN A;  1WD1 A;  2EPB A;  3BXM A;  1CPS A;  2AFU A;  5D29 A;  1Q3L A;  4H44 C;  2CTB A;  3ZYY X;  4N9P A;  2Q8I B;  3MZ5 A;  1LV9 A;  2PZU A;  2EDG A;  2RA4 A;  1CBX A;  5BN3 A;  4EVO A;  4AYB B;  4H2K A;  2XWB B;  5EBC A;  4ZY0 A;  1HHV A;  2QEJ C;  4A3J B;  3HS0 C;  4U67 3;  2PIZ A;  4J6H A;  3K5M A;  5C3E B;  1QMU A;  3LWE A;  4IUV A;  1AZP A;  2EYM A;  4Y7N B;  1FT7 A;  4FUU A;  1JWU D;  4ME5 A;  3SJG A;  3FEC A;  1I4R A;  2IQ6 A;  2AQ2 B;  2NVY B;  5I6W A;  4X8I A;  2HUG A;  4H7B A;  2LFN A;  1LT5 D;  3OOC A;  2EVB A;  1DZ1 A;  5IT9 L;  2PJB A;  2KA7 A;  2M9V A;  2AFW A;  1FGB D;  1A3V A;  4NW2 A;  5KYL A;  3D4U A;  3NQT A;  2AFS A;  4DF7 A;  3QNV A;  3FPU B;  4RGT A;  2CQA A;  2BDO A;  2PO4 A;  2F1M A;  4CHT B;  3NUC A;  2XIW A;  3BI1 A;  4MHZ A;  1CZW A;  3ERQ A;  5A35 A;  4C56 C;  3A7L A;  1LTR D;  5ISR A;  2AWN A;  3CU7 A;  2JYO A;  3NA6 A;  2M00 A;  2BE5 C;  4RA8 A;  2F0U A;  3TME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...