2G9DA

Crystal structure of succinylglutamate desuccinylase from vibrio cholerae, northeast structural genomics target vcr20
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
340
structure length
340
Chain Sequence
KSLFRQSFLFDSLDLDHPMVAQTVRTEQGVTLKLHQRGVLEVIPAQTDAATKNMVISCGIHGDETAPMELLDKWIDDIVSGFQPVAERCLFIMAHPQATVRHVRFIEQNLNRLFDDKPHTPSTELAIADNLKVLLRQFFANTDEHSRWHLDLHCAIRGSKHYSFAVSPKARHPVRSRSLMQFIEQAHIEAVMLSNAPSSTFSWYSAEHYAAQALTLELGQVARLGENLLDRLLAFDLAMRDLISRHKPEHLPRKSVMYRVSRTIVRLHDDFDFRFSDDVENFTAFMHGEVFGHDGDKPLMAKNEGEAIVFPNRKVAIGQRAALMVCKVNTRYEDDQLVYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinylglutamate desuccinylase
publication title Crystal Structure of Succinylglutamate desuccinylase from Vibrio cholerae, Northeast Structural Genomics Target VcR20.
rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
total genus 71
structure length 340
sequence length 340
ec nomenclature ec 3.5.1.96: Succinylglutamate desuccinylase.
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.630 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2g9dA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2g9dA01
3B3VA 1HDQA 1M4LA 1YW6A 3D67A 3RBUA 3D7DA 3MN8A 2EK8A 3SJXA 3IJ3A 4MRIA 1UWYA 2AFOA 1BAVA 1XFOA 4AXVA 1CPSA 4IHMA 3KR4A 5LRKA 2ZEDA 3B3TA 1IGBA 2AFXA 2IMOA 5JM6A 4EWTA 4X8IA 4UEZA 2WZNA 2O53A 1LAMA 3CPXA 2FVGA 1CP7A 1Y7EA 2PCUA 3D4UA 1PYTB 3VH9A 3NH8A 1Z2LA 4A94A 4ZX9A 5K8OA 3BI0A 3H8FA 1LFWA 3IWWA 2ZEHA 3D66A 2RB7A 1TF8A 3PB4X 1VHOA 3PBEA 2PE3A 1FNOA 1CPXA 1VGYA 2GLFA 3SI0A 1ZG7A 3RAMA 4WWVA 5D29A 2EWBA 4UEFA 1IY7A 5K8NA 2PJ7A 4PPZA 3FMCA 1LOKA 1F2OA 1ZLHA 3FH4A 4UF4A 4MHZA 2ZEOA 1YSJA 8CPAA 3CDXA 2ANPA 4O23A 2BOAA 4NJQA 4OIDA 2PIZA 2PJ0A 3B35A 4Z65A 1R43A 1LAPA 4PXBA 2PJ6A 3H8EA 4MHPA 3KQXA 4A38A 3DGVA 1Z8LA 4UEEA 4P4BA 1TKFA 2OOTA 4G1PA 1AMPA 3B7IA 1CX8A 4ZY2A 3FX6A 1FT7A 5HVGA 2CIJA 1XBUA 3I1UA 4GM5A 4P4IA 3LWUA 3NFZA 3KQZA 1BLLE 1Q7LA 5IB9A 4FBEA 1XRYA 3ISZA 4OC5A 4OKOA 3FVLA 4OIWA 3TC8A 4R6TA 3SJFA 2O4HA 3S9LA 1VIXA 3S9NA 3KI9A 2V8GA 4OP4A 1TKJA 5J1QA 5ELYA 2JBJA 1F2PA 3D68A 3L2NA 3PFOA 3K2KA 4F9VA 4OC0A 4R76A 5LYIA 3IIBA 1QQ9A 1LANA 4PXCA 3FEDA 7CPAA 1XJOA 3DLJA 3KZWA 4P6YA 2PJ9A 4Q7AA 5LYDA 4A39A 3GUXA 4A37A 2CTCA 1TF9A 5LYLA 1H8LA 2CTBA 3PB8X 3KHZA 3FECA 4OC3A 4ZI6A 2ZEMA 2OR4A 1YLOA 3FF3A 4PXDA 2PVVA 3QNVA 3SJGA 5I4MA 1TKHA 4NFRA 1BPNA 2PJBA 5F09A 5HVHA 4EMEA 2V77A 3NA6A 2XEGA 3ISXA 3VATA 3LMSA 3VARA 4IAVA 2PJ3A 3PFEA 1KWMA 4MMOA 2ZEGA 2C6GA 2HC9A 2V8HA 4NGPA 4DJLA 2ZEEA 4W9YA 3CPAA 2ZOFA 5HXDA 1DE4C 1OBRA 2J9AA 4JYWA 6CPAA 4KSIA 1XMBA 3PEIA 3PBBA 2G9DA 2Q4ZA 2IQ6A 4NGQA 2IJZA 4MHYA 4P4FA 2PJCA 1EE3P 3NH4A 4ZY0A 2RFHA 2AFWA 3B3CA 4JZ0A 2Q43A 3KASA 2GREA 1DTDA 5CBMA 2ZELA 3PB7X 2EK9A 3TX8A 4YWYA 4FUUA 3HLPA 3S9MA 4P4EA 2ZOGA 4BD9A 3BXMA 3PB9X 5LRJA 5HVFA 2PRQA 1LCPA 4UIAA 4FWUA 1VHEA 4F9UA 4OC1A 4FAIA 1PCAA 1JQGA 2F7VA 3SI1A 4X2TA 4CPAA 3MRUA 2QYVA 4K3NA 4P44A 3H8GA 4F8ZA 3B3WA 3IC1A 3B2YA 2PJ5A 1AYEA 3WABA 1GYTA 2Q51A 3BHXA 2AFMA 3KHXA 5CPAA 4P45A 4P10A 2F8HA 5LYFA 4IK2A 4LQGA 3WC6A 4ZYQA 3PB6X 4B6ZA 1F57A 2JEWA 1ZLIA 4P4DA 2AFSA 3B3SA 4TNUA 1HEEA 3D7FA 3D7HA 2VL1A 2JBKA 1Y0RA 2PJ2A 5JGFA 3JRUA 2ZEFA 1YMEA 2ZENA 4PQAA 4NJRA 3IFEA 1BPMA 4DYOA 3D7GA 4ZY1A 2DEAA 4R8FA 5THWA 1CG2A 4PXEA 4OC2A 2C6CA 5K8PA 4RUHA 2QJ8A 1NSAA 2AFZA 3T8WA 3NH5A 3V38A 2QVPA 5D8NA 1ELLP 3FEEA 3CT9A 2HB6A 1TXRA 2XEJA 2AFUA 2NSMA 3K9TA 3IEHA 4UIBA 5DS0A 4H2KA 2C6PA 1RTQA 3HUVA 4MCSA 2ABZA 2BCOA 3IO1A 4OC4A 1CP6A 1QMUA 4MCRA 2ZEPA 3BI1A 2PVWA 1R3NA 4P4JA 2GU2A 2PJ4A 4MHNA 2XEFA 4NGSA 1CBXA 4MCPA 1ZG8A 4NGMA 4NGRA 2CF4A 3GB0A 3KR5A 5K8MA 1Z5RA 3SI2A 2NYQA 1ARLA 3WT4A 4DUKA 3KGQA 2PJ1A 1Y0YA 4NGTA 1ARMA 4YU9A 3WC5A 1HDUA 2V8VA 2C1CA 2PJAA 3GLJA 4OMEA 4ZX8A 2POKA 4TWEA 3FJUA 4WJBA 3N5FA 2XEIA 3RZAA 2BO9A 4MXUA 5JH9A 3V7ZA 4ONWA 1ELMP 2I3CA 2PJ8A 2GLJA 4EFDA 5LRGA 4R7MA 4X3RA 2PIYA 3WC7A 2WYRA 2V8DA 1ZG9A 3KL9A 4NGNA 3SJEA 4MCQA 1YW4A 3PRTA
chains in the Genus database with same CATH superfamily
1NBWA 2NVYH 5EPKA 2XIWA 1HDQA 1YR0A 3D67A 3IU1A 3CMAA 3MWYW 3R93A 1E22A 4IUSA 3KLWA 1UFHA 4POGA 3RBUA 5JEAG 4J6HA 3ULPA 2VS1A 1KDAA 1RF2D 4LFAL 3SGIA 3M3YH 2WV6D 4UPAA 2C35B 1UWYA 2AFOA 4C7IA 3K0XA 1NMGA 4C3HH 1BAVA 2RDGA 1EY6A 1DOLA 1XFOA 2TMPA 5GAEC 1SE4A 2YNCA 4KI0A 3TBIB 4B9WA 2PMZB 1XYIA 3CCLA 2DPTA 3Q24A 2F0OA 2F0PA 4LNQA 1M90C 3M7GA 1WTQA 2ZEDA 4B3SQ 1IGBA 3FP9A 4XQQA 3QO2A 1HZCA 3H3VI 3PUYA 4JW0A 1V43A 4UEZA 4LF9Q 3HOZB 1AW7A 4AH6A 1N34Q 4R4CA 2WPWA 3KF8A 3NPPA 2YU9H 1B4OA 1YGHA 3KF6A 2Q7SA 1F77A 3KJPA 2EBJA 1Q2CA 4MHEA 4BBSB 4DR2Q 3D4UA 3VH9A 2DGYA 4M6HA 1TWAH 1KLGD 4BY7H 4AVCA 3TZUA 3NH8A 4B3RL 4UP9A 1Y69U 3R8BA 4JI0L 3R2IA 1B3AA 1UE7A 3G8WA 1KD1C 1Z4RA 1U4RA 4ZX9A 2EVBA 5IYCH 2E5LQ 1GUNA 2F0SA 3NENA 2PYKA 3WWVA 3BI0A 4CGMA 5HMNA 4XPDB 3TS2A 4XYOA 3I7FA 4LUVA 2PE3A 3KF8B 3A8JE 3LACA 2DN8A 1LT6D 4JYAL 1CPXA 2GLFA 5IWAQ 1OXUA 1WTRA 3KF6B 4H7BA 4U9ZA 4OIKA 5CMDA 1ZG7A 4DR3L 5JPMC 3BS1A 3PGPA 4BBRH 1IY7A 5K8NA 3CPFA 1A15A 1X3FA 2HUGA 2F0TA 5C3WA 4OO1G 1B7YB 1HPCA 4HN7A 2NVYB 5IP7G 4MHZA 2ZEOA 1YSJA 2HT1A 1XF8A 4IF5A 1NNXA 1K9MC 1VQKA 3A8IE 1S7FA 5A2QE 1SE8A 2BOAA 2ZXOA 1C48A 3TP7A 1TS5A 3CU7A 4A2ZA 1EIFA 3HFZB 4LF4L 4C3HB 4K5VA 3H8EA 5IB0A 2F0QA 1KAWA 1Q82C 1EY4A 4JJXA 4A38A 3DGVA 4UEEA 4O0AA 1TXYA 2UU9Q 4G1PA 3FX6A 4OHJA 2O5JC 1HCZA 1FT7A 1ET9A 4C3IG 1YLEA 2LSSA 4R4QA 4ZCKA 3X3MA 3ZYYX 2IX3A 1IBML 2Q8RE 2PI2E 3MTSA 3LWUA 1LTBD 2ATWA 2XVSA 4A3GH 5F47A 1KDBA 4C2MH 2NVTH 2YU9B 5AGEA 3ZZIA 1PYBA 1TWGH 4DUZQ 5CYUA 1XRYA 5ELFA 1IL2A 3FVLA 2Z11A 4EX5A 3F1ZA 2E75C 1BUVT 4RMFA 3TC8A 3N52A 4R6TA 5IX3A 1SYCA 2ZW7A 2ID0A 4LFBQ 3S9LA 1TWAB 1IBKQ 1G51A 1PFNA 2R7DA 1CA5A 4BY7B 3J80i 3SXHA 4HIMA 3L7ZC 2K1BA 1MK4A 1NMFA 1WTXA 2NWGA 4HR7B 5K5PA 1WCMB 5DLQE 3IAYA 1Z7TA 4OP4A 4IZ8A 1X6OA 3VA7A 2ATRA 4LFCQ 5J1QA 3PUVA 1F2PA 4P71A 3VR4A 3PFOA 4F9VA 4HJ7A 5LYIA 3Q0AA 2KECA 4PXCA 2AWOA 3FEDA 1XJOA 5KYLA 3G6EA 2R92G 1F9QA 1LTID 4A3IH 4MY3A 1PRTC 3KZWA 4B3TQ 4UFXA 3S9WA 1EFWA 4O2DA 2PJ9A 3QAHA 3S17H 2XN9C 2Z1CA 3BG3A 2KHJA 2PRBA 2I5MX 3GDEA 4BBRB 4YCWA 1EYCA 5LYDA 2PZWA 3P1HA 5EJWA 1JB7A 3P20A 2VQEQ 3K9UA 2CTCA 1IB1E 1NUCA 3C1EA 1A3TA 2L15A 1GD7A 3KDFA 4LUOA 1VQ8A 4XT1B 3SXOA 1SYEA 1S7KA 4GKKL 4IPGA 3VA5A 4ODGA 3GIUA 1QOHA 1S7LA 4BXXG 3H15A 2KEEA 4MJ8A 4A3KH 1IYKA 2OU2A 2ZEMA 5DNFA 4IUPA 4O42A 2OEOA 5DAUA 4DAPA 2IX1A 3URYA 4NSQA 3GTQH 3L0OA 1PXUA 2OB0A 1S3ZA 2FE7A 3HKZE 1D1IA 4F8MA 3KLRA 4OWXB 1Q90A 1MKHA 4ULLA 2EUIA 3SXNA 3EIVA 2A6HD 4FNFA 5I4MA 1VMCA 2LMCB 4UFWA 4QQBX 1TKHA 3CF5A 4NFRA 1M8AA 1HHVA 1BPNA 4QGUA 5F09A 3E9HA 2JQOA 2FIWA 4F0YA 3I4NB 2HCCA 1Z9UA 2DJFC 4JI4Q 4A3GB 1BO4A 3VATA 1PFSA 4IUQA 1CI3M 2JA8H 1TWGB 3ERQA 2VUMH 2C9OA 5EPLA 4FD7A 4KUAA 4B5PA 4IAVA 4KZTA 3PFEA 2FMCA 2N8NA 1ESFA 1CKNB 1JT8A 1Q46A 3FKIB 1DOMA 3MHBA 2R93H 2C6GA 1JC7A 1KNEA 4RHSA 3TN2A 4LK1C 3GV6A 3R1KA 1DGSA 3TO6A 2Z4HA 4HMJA 5IYDG 3U9OA 4W9YA 3S2DB 5HXDA 1QUQA 4JCVE 1X10A 4NXYA 1MJCA 2X7BA 2MO1A 1YNXA 2K5DA 4RKLA 1N33L 1E7ZA 3J81E 4DV6L 5C4XH 3G4SA 3G3SA 4CGYB 4BBSG 4A3EH 3D2PA 3PBBA 2G9DA 3PSIA 2Q4ZA 5F48A 1U0LA 3U4ZA 5G21A 2IQ6A 5C44H 4NGQA 1EQTA 4QUSA 4P4FA 2HCIA 2PJCA 2OCEA 3TEHB 3T1YQ 3NH4A 4ZY0A 4A3IB 4KLVA 1X56A 5LL6S 4WRDA 5CBEE 4JZ0A 1SMXA 3OTOQ 4FD5A 3SK6A 2A73B 4HPSA 5C88A 5KEEA 3KASA 1LO5D 2SNMA 3GO5A 2QKIC 1DTDA 5CBMA 4N8X1 2EK9A 2B2TA 2ZW4A 1STHA 5DWMA 4P4EA 4GNXB 2H5MA 1MHWC 2NTTA 1PH4A 1CJWA 1PUAA 4KY5A 1L0YB 1U4LA 4DN4M 3EXNA 2XGTA 5AG6A 5EC4A 4JK1C 3S6GA 1VDZA 5FLXL 3OMCA 1Y8PB 4A3JB 2VB3X 1Y7RA 2MQHA 1R9TH 3C26A 2RA4A 3TZDA 1J4JA 3MRUA 2QECA 2K5HA 2Y0SE 4FF3A 2OZGA 2QA4A 3GTQB 4QB9A 4QVTA 1VF5C 1J5EL 2BUEA 3DEPA 3H8GA 3HOUH 2G3AA 4MBUA 1Z4EA 2X69A 1EL0A 1EQRA 5IYBH 4JI7Q 4F0XA 1CKMA 1KABA 3PO2H 3I56A 2KCMA 2CY2A 2SDFA 2L0CA 4C3HG 5C3XA 1TY0A 2E76C 3P75A 4UHVA 5IV0A 3BHXA 3TE4A 1CKOA 4AIMA 5FVJA 2YTVA 2JA8B 4HIDA 2QEJC 3HG9A 4PMWA 1N32Q 3HP3A 4IK2A 4LQGA 2KA7A 3FRPB 3WC6A 4A3CH 1E3PA 2M00A 1K8AC 1F57A 5LMUQ 3N7ZA 3MFYA 1CT1D 1CZWA 4TNUA 3J80c 3D7FA 4WJ4A 3TS0A 4R9WA 3D6CA 2MNAA 1HR0Q 5C4XB 2JBKA 1CQFA 3QWNA 1Y0RA 1B70B 2Z6KC 4A3EB 2PJ2A 3H5ZA 4HNYB 3JRUA 4EVOA 3R9GA 4TRDA 3DNSA 2P6FA 4BY7G 4ZQ3A 3P2FA 1VQJA 5C44B 4KLKA 1VQMA 4JPBW 4DKAC 2BDNA 4HAEA 4K14A 3VDYA 2PC1A 1YJ9A 3D7GA 4HJAA 1WCMG 1FD7D 5C0XJ 1PH6A 1D2BA 3S24A 2F0WA 1ESRA 2HV2A 5IYCG 4DF7A 3T4AC 4XPLA 3IFDA 3LD2A 1IIDA 3Q23A 2N49A 2C6CA 2KHSA 4FXDA 2EJMA 2TSSA 4YHHL 1IBLQ 1IYJB 2ZW6A 4DV7L 2Q44A 1PV4A 3Q6SA 5EKLA 2QJ8A 2K50A 4A3FH 1SYFA 3QB8A 2E2HB 1JQYD 2UUCQ 1LTLA 5AJ3Q 5FK9C 2GIVA 4CRZB 4BBRG 5FKAC 3CAMA 2QVPA 3CQZH 1R9TB 1FJGQ 1RL2A 1HFNA 1QSRA 3CT9A 4MFJA 4CDEC 4CKBA 1PH3A 3AEVA 4DV5L 3RLFA 1QSOA 4JI3Q 3I8ZA 3E3XA 3TSSA 4JBMA 2XEJA 1FNUA 1LABA 4CBVA 3OWCA 3HOUB 3IEHA 2YTYA 1S5KA 3E9IA 3HKSA 1BOSA 4JI1L 2ZXVA 4XNHB 3PMFA 4GS4A 2C6PA 3IL8A 5JJZA 1I6VC 5H86A 2VQFL 3K6OA 4JG2A 3TRZA 4AQYQ 4CDCC 4IFDH 4X66L 3OSOA 2JA5H 4OC4A 3J7AF 2JA7B 1C7YA 1LTSD 1K4JA 4B3ML 4LX9A 3TO7A 2R8VA 2JE6I 1M4VA 5HH1A 2IW3A 1R3NA 1WK4A 2VXKA 5E1FA 4A93H 4LUZA 4X6AH 4XT3B 3M4OH 2E8GA 2F0FA 5I9PA 1GUWA 2CF4A 4X3SA 4A3GG 1LTTD 5K8MA 3BJ7A 2Z9HA 1JOKA 3T1HQ 4DR6Q 2LFNA 2CKZB 2NYQA 1ARLA 1KLUD 3KKWA 4JWPA 2K5TA 4QMGA 1SRUA 3FKIG 4LF6L 1DOKA 2CNSA 3H94A 4C2ZA 5C4ZA 1ILQA 1P16A 3G48A 4LF7Q 4UWIA 1YNNC 2UUAQ 1HDUA 1SFOH 1JOOA 2KOLA 4IFDI 3W6SA 2A8VA 2PJAA 2K7VA 3KBXA 1R4QB 1FL0A 3O13A 4M6GA 2UXBL 3FJUA 1E1TA 1SBBB 3DLLA 1PRTD 3E0KA 4A95A 4A3BH 2NZ1D 4N9PA 4X3UA 4XXEA 1STYA 2NVXH 1VQIA 4OWWB 1Z9FA 5CV8A 3ONAB 5DWNA 3D6WA 4A3IG 1RO5A 3FNCA 3BLNA 3V7ZA 2AMCB 1V8QA 1RTOA 4NP5A 5KGUA 2EYPA 2KENA 4A3FB 4UDUC 3DHQA 1NR4A 3K57A 3A5ZB 4L6TB 1LT3D 4R4OA 4ZRZA 5CC4A 1JCKB 3PUXA 3CQZB 3S1QB 3EROA 3KL9A 1XJVA 4IALA 4NGNA 4KLWA 3PIO3 4HIKA 1WI5A 1NE9A 5L37A 2HIVA 3GD7A 3PRTA 5GAGC 5M5WB 1H9SA 4BMHA 3OW7A 2J8NA 3NBHA 3SR1A 3UDFA 4YY3Q 1PH7A 5IT9E 4JXQA 4EVYA 1PRTF 2QGQA 4A3JG 3K7AH 4GS3A 1CHQD 2N88A 2EK8A 1HZAA 3V2TA 4ALPA 3UY5A 5A28A 2VW9A 2R6GA 1I3QB 1YJNA 2RBMA 2B2WA 2JA5B 3PCOB 5IP9H 2F03A 1QVCA 4IHMA 1BBUA 2Z4IA 2NB0A 3D3RA 5ELDA 4DAVA 3J81i 1F9SA 4CGPA 2WKCA 1E0BA 4PNYA 2YGWA 3B3TA 3R96A 3VWDA 4E8OA 3BYTB 2AFXA 4CAWA 4A93B 3TMEA 3M4OB 4EWTA 2AQ3B 4QIWE 3U58A 1KUYA 3BYYB 3I9SA 1W2BA 1PZID 3EO4A 2WZNA 1LAMA 2JA8G 4JI8L 1SNQA 2P5ZX 2QMLA 3JVNA 1HR0W 3GYAA 5H1SE 2L4NA 2Y0SB 4DV0Q 2Z8LA 4DK0A 1X3GA 2PCUA 2IL8A 3QB3A 1SMYC 1YITA 1PZJD 2Z3LA 1SAPA 3I4MH 3RZDH 4DR4L 2MPMA 1SFOB 2BA0A 1PFBA 1SNPA 2IHFA 3HRZC 3D4WA 2D2CC 1HXYD 4PZ7A 4APVA 1OZPA 1Z2LA 2FXFA 4ZKBB 2F0IA 1EYAA 1A3VA 3U50C 1R57A 1ICWA 4HCEA 1I94L 4FYDA 1P8LA 4J1MA 4DR7L 2UXCQ 5C4XG 2GANA 3GTJH 4A3EG 1IU8A 3TCVA 5FO8B 2Y0MA 4XQNA 5CV7A 4QJFA 4A3BB 1JWUD 3H8FA 4R9MA 5HY6A 2ZXPA 1LFWA 5C44G 2NVXB 3HOXH 3D66A 2RB7A 1TF8A 4ME5A 1NSLA 1KNAA 2EIFA 4YCUA 1M1KC 1EOTA 5FLMH 1FNOA 2F3WA 2B5GB 2Q2TA 1TS3A 1XTCD 2D0PA 2Q4YA 5EBDA 4X3KA 4JI6L 1SDFA 5COYA 4CYOA 1R4PB 3FMCA 5GCNA 1F2OA 1HQMC 2EXDA 2RHQB 4I7ZC 4A33A 1MJ9A 4HSPA 3CDXA 1GHJA 3KK7A 3BJUA 3SK5A 2ANPA 2Z3MA 1V1PB 2EOTA 1MBYA 4O23A 1BDOA 2PW7A 4Y7NB 3DWQA 3K7AB 3AU7A 2PIZA 1TIID 4IN3A 1MD2D 5F2DA 3FB3A 1EY8A 4KOXA 1R43A 1K0RA 3LWEA 3I2ZA 3HEJA 2PJ6A 5DM63 5IGGA 4IURA 1B2TA 5M5XH 2UXDL 2QIRA 1S5BD 3DM3A 4POFA 5K36H 2E2DC 1Z8LA 3HOUG 3TTHA 3G6JB 3DSBA 4FF2A 1TKFA 4P4BA 2IPKD 3TOBA 4P72A 5IYBG 2B4BA 1CX8A 2WAQB 4DV4Q 3I90A 5KNBA 3S16H 3B6YA 1FNVA 3K58A 4CKCA 1EYGA 3M4YA 4L5RC 4LF5Q 4YFJA 2ZTDA 2LY7A 2JA7G 4KOUA 3TP6A 3LX0A 3KQZA 4K6DA 4RFBA 4CKEA 1BLLE 1XMOL 3BU2A 4XQJA 2B63H 2D0OA 5C82A 3LGJA 3QOLA 4PQXA 3KYHC 4A3CG 1ASZA 2V1CC 3VYUA 1X3PA 1VQ5A 4B10A 4DR1L 3SJFA 4GLAC 2DNEA 4JBJA 4C1NK 4NXMQ 3RZDB 1VIXA 2A68C 3E0JA 3HGBA 5EKKA 1XXGA 1F2MA 5EMIA 2JK8A 2NUCA 2OQ0A 1HA6A 1TKJA 4UCMA 4EQOA 3R2TA 2JBJA 4M6IA 3D68A 4KUBA 5CBAE 4CGOA 1K3BC 3EA6A 1STAA 2JEVA 4FP5D 4R76A 3HOXB 1I1DA 5TSSA 1B6BA 1LTRD 7CPAA 3IU2A 1C0AA 4P6YA 3BVMA 4EQNA 1Y14B 2ICIA 5FO7B 2NVQH 2WIIB 1HNWQ 3PP9A 1UE5A 4KD4A 2K01A 1PRTB 4FXKC 5KTDA 3GTMB 2O5IC 4XIGS 3ZJYC 3GTLH 3QOJA 1J6QA 4A3FG 2EDGA 4DNTB 2K6AA 4K5WA 2M9VA 1RKNA 2B2WC 1RDPD 1WTOA 2L11A 1Q1BA 1CK1A 3L9AX 1X12A 1X3EA 4BY1H 2K05A 2MJ8A 5M3FH 1I4PA 2ZW5A 4UCNA 3H6MA 1Q12A 1ZXTA 2KEDA 2LS01 4MIUA 5M5XB 2B8FA 2OR4A 3KBGA 1GO3E 3NHHA 4DUYL 4LF9L 3NE7A 2A69D 1SYDA 2BOSA 2G5DA 1TS2A 4JI0Q 1II3A 1K83H 2BDOA 3J81c 4IFDG 3K5NA 1YNJD 2LXKA 2JA5G 1VQNA 2VB2X 2F4IA 1DXMA 4CDFC 4DFAA 5JQ4A 2XEGA 4EQ5A 2EJGC 1BBWA 3A5UA 3VARA 4AYBE 5IOCA 1VQPA 5IY0A 1LUZA 1TWFH 2B63B 4JXRA 3TFYA 2VZYA 2Q8TA 3H91A 1Q7YC 1B8AA 1YBYA 4MMOA 4A93G 1A2ZA 4JYAQ 2ZEGA 4J3GA 2F3IA 2E5LL 1CA6A 4R3LA 2F5IA 2HC9A 3F2CA 4DR3Q 1VQOA 2V8HA 4DJLA 3GTKH 3F5BA 2ZEEA 3CCJA 1YNND 2ZOFA 4N9TA 3N6RA 4TSSA 2OTJA 3TT2A 1OBRA 2Y0SG 3JAML 4JYWA 6CPAA 4CHTB 3NQIA 2QF7A 3STBC 4KSIA 3PEIA 5CV9A 3BJ8A 3T53B 2FINB 3A9LA 2NZHA 4RGOS 2EY2A 3M3YB 2VEZA 4UCPA 5E4XA 5C4JH 1CUKA 4CGLA 5KRUA 3CXCA 1YEZA 2F52A 4DPGA 4RWSC 2J4XA 1U6MA 1ICFB 2HDMA 3UE0A 4XYQA 2B2VA 3D0FA 3ZJ0A 4A3BG 2GREA 1BCPC 2Z3PA 1YHQA 1GKHA 2ZELA 3M9BA 1WOCA 2EE1A 5C5LA 3HLPA 1QSTA 2F1MA 3K5LA 4E2AA 3ERSX 2F0GA 4BD9A 3PB9X 3GTLB 4Y52H 2RC4A 1QJOA 1G2SA 4LAAA 5HVFA 2PRQA 1IBMQ 5LMNL 1IOIA 1LCPA 4UIAA 1V1QA 4LJZC 1QNUA 2HIXA 5D65A 1JQGA 2SNSA 1OXVA 2UU9L 1M4IA 1ZYRD 4X2TA 2VZAA 4DR5Q 4FXGC 2NBFA 3MXNA 4U673 2J8RA 4P73A 4K3NA 1XX8A 4P44A 2Z0SA 4CAFA 3W1BA 4F8ZA 4I49A 3EJIA 3IRBA 2WUUA 3B3WA 4Y49C 4G7ZC 4AG9A 5CORA 3CHBD 1VCIA 4PMBA 3A7LA 4KTAA 1ENCA 3B2YA 1STNA 1XPUA 2WP8J 4X65Q 1GYTA 5IP9G 3W1GA 4NPSA 3CCQA 4X5KA 1MSHA 3GV3A 3E6ZX 3S15H 3TQYA 3OHXC 4LFBL 2I79A 2HHHL 3Q8DA 1LTAD 2N3SA 2EYJA 4P10A 2B39A 2Z6KA 1TWFB 1L0WA 2E2JH 2WAQG 3PZJA 4R1JA 4C68A 5LYFA 2J7ZA 4QF4A 3PB6X 2VQYA 2EZVA 2HQYA 4LFCL 4B6ZA 2XRQD 4AVAA 1WWZA 3MXNB 2VBQA 4L5QA 1ZLIA 5LHY1 3GTKB 3MFGA 4FF4A 4P4DA 3B3SA 3CXQA 4IUNA 2HD3A 1NY4A 4L63B 4OAEA 4GOPA 3I55A 2VL1A 2ARHA 4A3MH 4B3TL 1B44D 2ZEFA 1QWYA 4KVXA 1JWQA 1KQSA 3I4MG 4GKKQ 2H1EA 5EKIA 3I3GA 1PH5A 1BR9A 3FYNA 2EPBA 2OTLA 2FJ2A 2PZTA 4X64Q 4DYOA 1SXTA 4AVBA 2ALYB 1BOBA 3WOEA 3NWSA 1ZEQX 4JC0A 3MXGA 5THWA 3ND8A 2BEIA 5IODA 3H0GH 4PXEA 1TS4A 4OC2A 3HOXG 4RUHA 4CGNA 2CW0C 1PA6A 1S7NA 4FVMA 4HNWB 5FLMG 2AQ2B 4LF8Q 2PR8A 4UP8A 1P4NA 3KDFB 4C1NI 3DDDA 3AFQA 1YZ6A 3T13A 4C2MB 2NVTB 1EWIA 4PSWA 1JB3A 4L89A 1X3QA 4F88A 4ZK9B 1HUNA 2OWOA 4XPDC 3RZOH 4F7XA 3W3AA 5IGFA 4N8FA 3LNNA 4JVZA 3V8IA 3D8GA 5C0XH 4UIBA 2KUMA 5DS0A 4H2KA 2Q2HA 3S6HA 3SHLA 1PVOA 2SEBD 2RSOA 3SK8A 4MCSA 1ML0D 2RDFA 1BF4A 1N33Q 1ENFA 2ABZA 2GVBA 1TU2B 2KCTA 4K8JA 1VQ6A 2R3ZA 5K36G 4G7HC 3MAQA 5M9OA 3PQIA 3S15B 1STBA 2VL6A 2JP1A 1QMUA 4RI1A 1EZ6A 5T1IA 3A56A 2ZEPA 1VQFA 2E2JB 3BDLA 4P4JA 4B5PB 2XTIA 2GU2A 4KK7A 3S17B 2XWBB 2XEFA 2RHSB 4NGSA 2F0VA 1HNZQ 2E2IH 4GZYC 4A3LH 1YVOA 3F2UA 4KOWA 4HTHA 4NGRA 3CCUA 2XNAC 1F9PA 3RO0A 4H0LC 1SNDA 2R7ZH 4PZ6A 2Z3KA 1FGBD 2A68D 4FF1A 2B63G 1QUQB 3K5OA 1GUOA 4CJ2C 2OQKA 5EAYA 4DUKA 4YCVA 4GN3B 1H9RA 1RD9D 2MUYA 2KQ3A 3D4RA 2CQAA 3CC4A 4Z9CB 1GXDC 1QVFA 3S14H 3A0JA 1ARMA 3K0YA 1WD0A 4H13C 2B2UC 4ZYSA 4DV2L 1PH2A 1H95A 4A3KB 3S6FA 2B2VC 4PZ8A 2V8VA 4A31A 3UDGA 2L1BA 4CJ0B 2FT0A 1S5FD 1VF7A 4KHPL 1EY0A 1VQGA 4X62L 2XEIA 1LACA 4F87A 1G91A 4UY8C 1J5EQ 2IHEA 3RZAA 1LM0A 1OXXK 3UDXA 5IT9c 3PIPA 3AMUA 2DPSA 3H0GB 4K5XA 1PLFA 3BZDB 1RJTA 1GOZA 4M1UB 3KLSA 4K2KA 2F4VQ 2F0NA 1Z8XA 4GKJQ 5KNCA 3FXTA 4A30A 1MJEA 2O4XA 1KRSA 3C46A 1ELMP 2PJ8A 5GADC 4DV3Q 2KHIA 2WSAA 2GLJA 3JAME 2L9HA 2VUMB 1Q2YA 3DM1A 4KVME 3S2HH 4HKFA 3J80L 1XPRA 4LW1A 1ZG9A 3SJEA 3HS0C 4ZYQA 2R93B 3RZOB 4Q5VA 1K8OA 1EU4A 4XPKA 2HDLA 4X3TA 4Q0FA 1H9JA 2F0UA 1KIXA 2CH4A 4OADA 2XRSD 4A3DH 3CPWA 3E5SA 3D7DA 3MN8A 3SJXA 1HJPA 3IJ3A 5M3FG 2WFWA 4MRIA 4ZLTF 1N32L 3J7YW 5C5MA 1BBXC 1RCVD 1SJED 2AJ6A 1CPSA 3S1RH 5M3MH 1XMQL 1B53A 3MEFA 4JBWA 3R3OA 4ZAIA 3EVQA 2WKDA 1Y8NB 1HH2P 4C3JH 2IMOA 1XNQQ 4G7OC 4PK2A 2E2IB 5JM6A 4JV5L 3BDOA 3AB9A 4IPDA 1WD1A 1FNWA 4GOPC 2R7ZB 3CPXA 3U9SA 1PZKD 5EBVA 2FVGA 1IOFA 2Q2UA 1KUVA 2YYZA 4YHHQ 3S1NH 4GXHA 3NSWA 3NK9A 3A54A 3NTIA 3RR5A 3S14B 5JJKA 3E0EA 4KJNA 5BWAB 3C1FA 3STBD 1H9MA 1M44A 2Z6BA 4H89A 1D5MC 2CWPA 1S3OA 2K5VA 1ILPA 4DK6C 5CV5A 1F2YA 1IBLL 4L5TA 3PV0A 2L55A 1G2TA 1RXTA 2C27A 1N8RC 5IGDA 5JAVA 5K8OA 3HZXA 2CXAA 1JR0D 2JEBI 4KY7A 3HOWH 1KHIA 1I12A 2FFKB 4KMUC 5AJ3L 3UI2A 3PO2B 1BCPD 4JI1Q 3IWWA 2ZTCA 1HNXL 1FJGL 2ZEHA 4R57A 1QCBD 4ZBGA 1I4XA 5I6YA 1NCVA 5ELBA 4RH6A 1EYDA 5G3LD 3RD4A 4NXNL 2BA1A 4JI3L 4X66Q 2FS5A 4DGZA 4R87A 1G6ZA 5G22A 4KHZA 2UUBL 3QIAA 3CRLC 2AUKA 4R8IA 3M85A 3S2HB 4B3MQ 1S60A 4TVAB 1Y9WA 2EO8A 2PJ7A 4PPZA 4ID6A 5DEHA 1SE2A 1LOKA 1ZLHA 2REFA 3FH4A 1VQHA 1DZ1A 4UF4A 4AQYL 3W6XA 4DA2A 2RQXA 3M4PA 3UE1A 4ABNA 5CV6A 4K6LA 4MTNA 1T9HA 1OO9B 1XNRL 3EFAA 2B3UA 3RYOA 4NJQA 4A3DB 2DUDA 2PJ0A 2ENBA 3TP8A 3MGDA 5I2YA 1HTLD 3CC7A 3MXPA 4L8JA 4Z65A 2FSRA 1SNMA 3NBIA 4IOAA 1BCPF 3QJYA 4PXBA 4UWJA 1A0IA 1DM0B 1BXTA 4JBKA 1TWCH 4MHPA 4MFQA 3HKZB 5IGCA 1YX0A 3S1RB 2FIAA 5G3LF 2G3TA 2YNEA 1M1DA 2WINB 2OOTA 1LT4D 1AMPA 4BINA 3B7IA 4ZY2A 3J7AV 5M5YH 3QR8A 2WB1E 4MY0A 3MVVA 2CIJA 3T1HL 5I0CA 5G1ZA 2MFIA 4GLVB 3CCMA 4C3JB 4B5OA 4H6UA 2QCPX 1Q2DA 3I1UA 5IP7H 4XDXA 4J15A 4P4IA 3NUCA 4DNCA 1Q86C 1JE5A 3NFZA 3LODA 5FJ8H 2JXMB 5GQOA 1Q7LA 1B9MA 1L1OC 3MEHA 3I4LA 2F0JA 4OC5A 3S1NB 1SE3A 1STEA 5AFWA 4OIWA 4HNXB 1K8MA 1XMTA 3SK4A 2FCKA 1F2LA 2K75A 4HIOA 5ISVA 1N36L 2DF5A 4QCLA 1JWMD 1OTCA 3S9NA 1GJXA 2ICEC 1B3QA 1EIGA 3GTPH 3TO9A 4CYNA 2PW5A 1E1OA 2PQAA 2V8GA 4HJ8A 4NW2A 3M7NA 5E7NA 2CWAA 1YJWA 3G71A 3IWEA 5ELYA 2N78A 5JEAJ 2OZUA 2IWHA 3HOWB 3BVGA 1JWSD 3GY9A 4OC0A 1VS0A 3DR6A 4A3KG 1KL9A 1KZFA 3JC66 4CAVA 1QQ9A 3FBUA 2OXPA 3L2PA 1DONA 1OXTA 4K0KQ 1N9WA 1I4HA 1ONLA 2EYMA 4YY3L 4EGVA 3H0GG 2R7FA 4HJ5A 3IWGA 1TKWB 2RCNA 2ASBA 1Y9KA 3D3SA 3GUXA 5FLXE 4II9A 4RGTA 1TF9A 1YIJA 1AUGA 4QUCA 4DV1Q 2VZZA 5LYLA 1G291 1H8LA 2CTBA 4B12A 1SN8A 1H9SB 3KHZA 2MGSA 2HQEA 3NBHB 1IL8A 3KJOA 1K8GA 4QUFA 4YRHA 2VUMG 5AG4A 4RN7A 2B4DA 4JI8Q 2EVNA 4I7AA 1QNKA 2BH2A 4BA2I 1YHBA 2R93G 3BZKA 3EQLC 4U68A 5A2QL 1TWCB 1BQQT 1EIHA 1I6HH 5J8FA 3A7AB 3NE8A 5EPJA 2RKSA 1YLOA 5C0XG 1M4GA 1WTWA 4OLLA 3K5MA 2B58A 3BDCA 4ONUA 4UA3A 1YREA 1EOVA 5M5YB 2PVVA 1Q8IA 3RN5A 2JJQA 4QC6A 3SJGA 4IFDJ 4BBHA 3K59A 1MIUA 4OONA 3VR5A 1HUMA 2PJBA 5E3FA 2CVRA 5HVHA 4DV0L 4G4KA 2RVLA 2B3GA 3NA6A 1MI2A 2YNDA 4ORFA 4NF1A 4CAEA 1HRJA 2JA6H 4XNHC 2D4OA 1A62A 2F0LA 1EEID 1L0XB 2LKVA 4JI2Q 4A3LG 1PYSB 2R98A 2MO0A 1EUJA 1QE6A 3A74A 2GN5A 2R7ZG 1FVIA 5ELNA 2JA9A 4JI6Q 2IY5B 4CS0B 3CPAA 1DE4C 1E2WA 2A1AA 1NTGA 2NMTA 5IGBA 2L12A 2OZHA 3JAMi 1KRTA 1K3RA 3TP5A 2GVAA 1XMBA 5J22A 4PV6A 4PG3A 4MI4A 1PU9A 3FPPA 2PQ8A 2PNRC 2IJZA 2ZM6L 3PO3H 2PPBC 5JJLA 3NWTA 2Q8IB 4DNIA 2AFWA 4EQPA 4RKBA 4G57A 1HFGA 2UXDQ 2CQOA 1EY5A 3PO2G 1QZGA 3HOZH 3TX8A 2QW7A 1X65A 4FUUA 5IIFA 3S9MA 1EWHA 3NQTA 2ZOGA 1MJBA 3BXMA 3P2HA 3GQBA 3MZ5A 1L0CA 4RAUC 5LRJA 4R4TA 1XPOA 1BCPB 4JOIA 4OXPA 4R3KA 4FWUA 4A32A 4F9UA 2Q0YA 4OC1A 4FAIA 1PCAA 5CR3A 3B8GA 1SNOA 4KOTA 2F7VA 3SI1A 1BO0A 4IUVA 4DV4L 1IKMA 4CPAA 1I4QA 5LL6X 1TIQA 3ULJA 1NE3A 1IW7C 3I4MB 1IXRA 2QDBA 3VR2A 4KORA 2QEXA 4OX9Q 3M4QA 4UP7A 4A3DG 1KDCA 1PH9A 2J0TD 3PGZA 4IPCA 1VQCA 3GTJB 2PJ5A 1EU3A 4PV1C 1O7LA 5ELOA 3WABA 3X3NA 2Q51A 4JI5L 1O7ZA 3HKZG 4Y49B 5T1GA 3MXUA 4YWKA 1O7IA 3ER0A 5BR8L 5CPAA 4P45A 4NXML 1FR3A 1CQVA 2DY7A 4IUTA 4LFAQ 3GTOH 4BS9A 1A8VA 2XSCA 4C3JG 4LMQD 3NXWA 3QAYA 4KOYA 4IJLA 3UDIA 3T51B 4MN3A 3WOFA 5AG5A 4R4IA 1UEBA 3DXJC 3RNUA 1HEEA 4AB7A 4DAMA 5JGFA 2LXJA 4DK3C 5A35A 1QZHA 1YMEA 4M8AA 1RHPA 3CC2A 1XWEA 2AWNA 3IFEA 1HNWL 3SVMA 4B3SL 3PO3B 2WB1B 3J81L 5JVH3 5D14A 4OWTB 2K03A 5KNDA 1AE3A 1XTDA 4IO9A 2JLMA 2DEAA 4R8FA 4L8AA 3HOWG 1N34L 1PTOC 1CG2A 1AZQA 2ZT9C 1PH8A 1W6KA 4DUYQ 4B3RQ 2A6EC 2P6GA 3OOCA 2C5CA 3CMEA 3S16B 4MZ9A 2IL4A 1LRZA 4WORA 3DWPA 4FD4A 1RIPA 4DR2L 3W5OA 1O78A 2AFZA 3T8WA 3V38A 1XIXA 5D8NA 2CNMA 4YGOA 1HZ9A 3FEEA 4KV6A 2HB6A 4Q36A 4A4IA 1STGA 5KYIA 3TREA 2PR1A 3PF5A 3GKRA 3R95A 4IUUA 3A8KE 1AZPA 1WCMH 2I5LX 2ZJQA 5C4HA 3MC0B 1I21A 1I4RA 2AUJD 3VYSA 3TDQA 2ZJRA 3K9TA 1RTQA 1VQ4A 2PO4A 5D3DA 2GE3A 4E0AA 2EYHA 4B11A 5FOBB 5IWAL 1TQOA 2CH4W 1B1ZA 2I5HA 2BSWA 4KKTA 1CP6A 4MCRA 3CXPA 1XEBA 1UUPA 4S3SA 1AFPA 2Z3NA 2PVWA 1BVSA 3GTOB 1MJAA 2KCWA 4LF4Q 2B2UA 2PJ4A 4DAYA 2DXQA 5ISRA 5BN5A 4GN5A 4QIWB 2NVQB 4NGMA 1G6PA 1VQBA 5FJ8G 4LWCA 1J8IA 1Z5RA 3H09A 5J3BA 3DUZA 1Q8KA 4B13A 3WT4A 3KGQA 2PJ1A 2G9HD 4NGTA 4YU9A 3FVQA 4OEMB 5LMNQ 3WC5A 3JAMc 4BY1B 1LLRD 4LUAA 1CZGA 5M3FB 2RCFA 3ITPA 4NMZA 1A2TA 2YV5A 3GP7A 2B3VA 4OMEA 3EFXD 4DNRB 1BNZA 4ZX8A 2POKA 3KLSX 1QSMA 1GUSA 3N5FA 4DAYB 5IGEA 3VR6A 1ENAA 2BO9A 5C3EH 4IOCA 4K8IA 4JOIC 3I4NH 4MXUA 4DUZL 1K83B 1JJGA 4H6ZA 3FEWX 1X54A 1VQLA 3GTGH 1QILA 4DXGA 5JH9A 4DR5L 4ONWA 5I4DA 2I3CA 4U5YA 1JJCB 1AEXA 1G8ZD 3T90A 1IBKL 1VQDA 3RN2A 5F49A 4JLYA 2K04A 3FKIH 5IE8A 4EFDA 5LRGA 1QVGA 3R9EA 4KKUA 1EY9A 4X3RA 3D8PA 2HHHQ 2PIYA 3AQQA 2WYRA 2GFQA 2AKWB 1E2ZA 2V8DA 1NR2A 1UE6A 1YW4A 3F8KA 3S2DH 3B3VA 2IJ0A 1SMYD 4P74A 1M4LA 1S4ZA 1YW6A 2I0QA 4X65L 1VQ7A 2ES2A 2SOBA 4CRYB 1D1KA 1GHEA 2CHBD 2MHVA 1CSQA 2RSNA 1JORA 3RNZA 1M4DA 5BN4A 3PIOA 4UFVA 3NTHA 1TWHH 1WYDA 3OYYA 1IZ6A 4AXVA 4MTKA 3WDNA 3KR4A 1QB5D 5C4JB 5LRKA 1N71A 3IFTA 4HJ9A 1A2UA 1EEFD 4YWLA 2VQEL 4RS2A 3BVZA 3I3CA 3K81C 1NAPA 1GUGA 1K0SA 4AG7A 3FDTA 2PZUA 3T9YA 2BE5C 4X8IA 4KSAA 1SJHD 3CCVA 5EQ0A 1Z47A 2O53A 4FO2A 1CSPA 4FD6A 4GN4B 1JJ2A 1RTNA 1CP7A 4A3JH 2YNCC 4CDDC 2JA6G 4NEXA 4U9YA 4X64L 1Y7EA 1CKNA 1VMPA 1SROA 1GHKA 4GOPB 2F0KA 5F46A 5E96A 1TR5A 3I91A 1PYTB 4OGQC 4IPHA 4A94A 4KKSA 4KN7C 2NTSA 4RGMA 4LF8L 3EY5A 2X6LA 2IT1A 1LTGD 1IYLA 5CGKA 4JI4L 3CZXA 5C3EB 4TKOB 3K7UC 1X9NA 2KVMA 3ULLA 3PO3G 3H3VC 3GTGB 1VHOA 3PB4X 3PBEA 2WB1G 4MFZA 2ZXRA 1LT5D 2X6GA 2QDLA 4DV6Q 1VGYA 5KTAA 4NB3A 3SI0A 4KOVA 1SEBD 2BL1A 1DJRD 2Q4VA 2PDOA 1VHSA 1CHPD 1U4PA 3RAMA 4WWVA 4R8NA 2EWBA 2L5TA 5D29A 4UEFA 3HOZG 2I46A 1Y1WH 2HUZA 1JE4A 1Y1VH 4GNXA 3EBEA 1T5EA 8CPAA 2Q7BA 3RMHA 2A74C 4KSFA 4F6AA 5I2XA 3F2DA 1IHZA 3WR7A 1IW7D 4A76A 2D62A 1J9OA 1K73C 4OIDA 3B35A 3T1YL 3HOVH 1SYGA 3OIQA 4KY6A 5C0XI 2PNHA 3U4VA 3W2DA 4A3MB 2H5XA 1FYCA 2IX0A 5HURA 1LAPA 1V0CA 3OTOL 1P0HA 1S5ED 5IT9L 1TWHB 3FHWA 1VQEA 1HZBA 1YQEA 3KQXA 4FDBA 4H44C 1HNZL 3V05A 1L1OA 1I50H 2EYOA 4DV2Q 1HTPA 2WACA 4KJOA 4ME3A 1IICA 2F0MA 3PUZA 5HVGA 1XBUA 4PK3A 1CM0A 3CCSA 3PUWA 4KHPQ 3NE5B 4X62Q 4GM5A 1QSNA 1VKCA 3RLOA 2AHOB 4Q38A 4DXFA 4RCOA 4AYBB 4CYPA 2E2HH 1W6JA 5IB9A 5ELEA 4FBEA 1YVKA 3ISZA 4UAIA 2KBNA 1MGSA 2P6EA 4OKOA 3IKJA 1GVPA 2K33A 5LMNW 3NP8A 1SYBA 4A75A 4WJ3M 1I4GA 2I07B 1F9RA 2K5QA 2PQEA 4NCZA 2O4HA 2EY5A 4B9XA 1L1OB 4JI7L 3KI9A 5FLXc 1WVLA 2BH8A 3I73A 4QL5A 2F4VL 2I00A 2AE6A 1V9PA 2PSWA 4GKJL 1O80A 4E6IA 3VYTA 1X55A 4CJ1B 3W91A 1C4QA 1Q1EA 5J39A 4DV3L 3L2NA 3K2KA 2ZJPA 4BY1G 2JA7H 1PTOD 2NYZD 3IIBA 2K4KA 1EY7A 4CAXA 3CD6A 2F3VA 2A6ED 1LANA 3HOYH 2F0EA 3OIPA 3DLJA 1K28A 4RA8A 5KTCA 3TOAA 1JICA 4HMIA 4QB4A 2B29A 4BWGB 4Q7AA 2PI2A 5LMUL 4OIJA 4MFPA 2JSOA 4A39A 1E24A 3CRKC 4A37A 3F8TA 2K5WA 1Y1WB 1XMQQ 4LQ6A 1Y1VB 1B50A 3PF4A 2NN6H 1HR0L 3QG1A 1TY2A 1C8CA 4OL7A 2JYOA 1DD2A 3PB8X 3J7A5 2J8MA 4JD6A 3FECA 4JV5Q 1VQAA 1DCZA 1Z8TA 1RODA 4OELB 4OC3A 3HOVB 3VYRA 4ZI6A 2ODFA 5JEAH 2R1IA 2AQ1B 3VR3A 4DV7Q 1PTOF 1AN8A 1BKBA 1NMTA 1XNQL 3D2MA 2VNUD 1S5DD 1I50B 3A55A 3FF3A 4PXDA 1JOQA 1A63A 2B8GA 3SDZA 5J8CA 3QNVA 1PH1A 4K2LA 2M2LA 3SEBA 4DV5Q 2FXQA 2QILA 2WAQE 1B87A 4B14A 2UUCL 2V77A 3C2PA 4EMEA 4ZUIA 3DEOA 3L3OC 4YWMA 2JDCA 4K30A 2NN6I 3ISXA 3LMSA 1EQVA 3F2BA 2VQFQ 3S1QH 1Y8OB 1HNXQ 1WFQA 3EN2A 5FO9B 2PJ3A 1U4MA 1KWMA 2R7HA 4PSXA 4I65A 1I5FA 2O28A 2K14A 5H84A 4NXNQ 1W3SA 5M5WH 2UUBQ 4NGPA 2V4DA 1YI2A 5E4WC 1ZO0A 4C2XA 4C7HA 2OT2A 3JTKA 4KD3A 1O7YA 1U5KA 3DR8A 2K28A 2YTXA 2J9AA 4BA1I 1X32A 1AE2A 1I3QH 3JUWA 5EBCA 2NZOA 5GROA 4B08A 3IGRA 3K80C 3CP0A 2JEAI 1XNRQ 3KOJA 2A69C 4P75A 1CTMA 4C56C 3HOYB 2XWJB 4MHYA 3OMGA 1EE3P 1KUXA 1EQQA 4KN4C 4GLXA 4NKLA 2RFHA 3B3CA 3F0AA 5NUCA 4LF6Q 4GNXC 3FIXA 5G20A 2OH1A 4ZKCB 1KC8C 1YNJC 4M85A 4MHDA 4ZGYB 1EWCA 2Q43A 5M3MB 4KS9A 5HGTA 5EGTA 2PMZE 5C3EG 3I4NG 3PB7X 1FY7A 4YWYA 1OXSC 4DR6L 1XOVA 4OO1H 5AG7A 1EFID 3Q22A 5JOBA 5I6WA 2UXBQ 4KVOE 4H02A 2EYLA 2B2YA 4IJHA 5J1ZA 1VQ9A 2CCZA 1PTOH 3OW2A 2EQSA 5DM73 1VHEA 3S6KA 4LF7L 1F2ZA 1ASYA 2UUAL 3OWFA 2K52A 1PHJA 5JJIA 3T56B 3KUPA 1UE1A 2KCNA 2FL4A 1Q3LA 3SE0A 2B2TC 2QYVA 1D7QA 3J81j 1AP0A 2P0WA 5C6AA 1N36Q 1DYQA 2DNCA 1GUTA 1ET6A 1UEAB 3IC1A 1D6EC 3V96A 1AH9A 1IYVA 3KFUA 4A3MG 4C3IH 1AYEA 2E74C 3BZCA 4V0BA 2A5HA 2FHTA 5BN3A 3J7ZC 4KHVA 2Q04A 1JMCA 3C3LA 4OO1I 2BE5D 2AFMA 3KHXA 2H4OA 5HGQA 2A19A 1CFMA 4HEDA 2K5NA 1V1OA 2CW0D 2F8HA 1MSGA 2EJFC 1UAPA 2F0DA 2JN4A 1Z8WA 5D3IB 1GM5A 1ZKOA 5CNPA 3G7LA 1SQHA 5JVG3 2JEWA 4QY7A 5JPHA 4QBJA 4AYBG 4IQZA 4RGNA 3EC4A 2AFSA 4KOSA 2D9UA 4Y7NH 4M3SA 2G0BA 2PQAB 1WJJA 1HA5A 1ZYRC 3I4OA 3D7HA 5KIXA 2ZTEA 1IYUA 4RCNA 4K0KL 2Z3OA 1PMRA 1D5XC 2ZENA 2VY3A 4DK1A 4NJRA 3CCRA 1B9NA 2FMMA 1BPMA 4TQUS 2RF4A 1YHAA 1Q81C 1SSOA 4P2CB 2R92H 4ZY1A 3D4DA 1WTPA 1KTKA 1S5CD 2DJGC 3CKIB 5ELCA 1TT2A 3RLNA 4DV1L 1LV9A 1PFMA 4DR4Q 3CW2C 1KXLA 1A6XA 3H4QA 3AFPA 5K8PA 3AYHB 5CV4A 1PYWD 1A3UA 3I72A 2JDDA 4ZUJA 3J80E 1L2FA 5GAHC 1I94Q 3SHPA 1S72A 4DR7Q 2B5GA 2K32A 3ICEA 1NJIC 1PTOB 4HSVA 1NSAA 4UBRA 1PDQA 3NH5A 3S1MH 4BXXH 2Z0ZA 1U9RA 1Y1WG 1ELLP 2B4DB 1Y1VG 3D31A 4PMCA 1D8LA 1Z6HA 1LYLA 2UXCL 4V190 2CNTA 2CFMA 1TXRA 3OWEB 2DY8A 3DWAA 1V1PA 2F0HA 1WTVA 2AFUA 2NSMA 2EYFA 3GTPB 2GA4B 1TVXA 1S40A 2KJXA 3RUZA 5JPNC 3CXSA 3HOVG 4L5SA 2RDHA 3HUVA 4C3IB 3VWEA 1D5ZC 4NDXA 3R9FA 2ZPAA 2WPXA 2N55A 3I70A 3DMUA 4JI2L 2BCOA 3IO1A 1E2VA 3ND9A 4RHRA 4DU9A 3BI1A 4CYQA 2A6HC 2KCCA 2ZM6Q 2EY6A 1EIYB 4MHNA 2Z10A 4J8QA 5A27A 1NSNS 4O1NA 3GTMH 1CBXA 1ZG8A 3MA2B 4MCPA 2REEA 1XE4A 3GB0A 3OPOA 3KR5A 4C2YA 3SI2A 5IYDH 2D4PA 4HCSA 1KAAA 2R61A 1HQRD 4RG1A 3PIP3 1Y0YA 2EXZA 3FRMA 4BBSH 2Q2IA 3P7JA 3FPUB 3T16A 1ON0A 3NEMA 1XMOQ 4MFLA 2C1CA 2MP1A 2OF1A 4MFKA 1T5XD 3GLJA 2R92B 1IKLA 3CCEA 4MNOA 1I6HB 4WJWA 4TWEA 4LF5L 4DR1Q 1SLJA 4WJBA 1UWVA 1QG7A 1SNCA 2B2YC 2O2LD 1YVCA 1FGUA 1UNSA 1CM9A 2A4NA 3NELA 3HOYG 2VXWA 1H9KA 1C9OA 2EY1A 2PCFB 4ILWA 1WTHA 1SR3A 3NTKA 2D5DA 4WFN3 3K8AA 2VI7A 5I9OA 5M3MG 4JI5Q 2HQLA 1EZ8A 5BR8Q 3S1MB 4R7MA 4XTCS 4OX9L 2JA6B 3H3VH 3WC7A 4YIJA 4PQAA 4MCQA 1YK3A 2NN6G
chains in the Genus database with same CATH topology
5EPKA 2XIWA 1HDQA 3D67A 3MWYW 3R93A 3RBUA 5JEAG 4J6HA 1KDAA 1RF2D 2WV6D 1UWYA 2AFOA 1BAVA 2RDGA 1EY6A 1DOLA 1XFOA 2TMPA 1SE4A 4KI0A 3TBIB 4B9WA 2PMZB 1XYIA 3Q24A 2F0OA 2F0PA 3M7GA 1WTQA 2ZEDA 1IGBA 4XQQA 3QO2A 3PUYA 1V43A 4UEZA 3HOZB 1AW7A 3KF8A 3NPPA 1B4OA 1F77A 4MHEA 4BBSB 3D4UA 3VH9A 1KLGD 3TZUA 3NH8A 1Y69U 3R8BA 3R2IA 1B3AA 1U4RA 4ZX9A 2EVBA 1GUNA 2F0SA 2PYKA 3BI0A 4XYOA 2PE3A 3A8JE 2DN8A 1LT6D 1CPXA 2GLFA 1WTRA 1OXUA 4H7BA 4OIKA 5CMDA 1ZG7A 5JPMC 3BS1A 1IY7A 5K8NA 5C3WA 1A15A 2HUGA 2F0TA 4OO1G 1HPCA 4HN7A 2NVYB 4MHZA 2ZEOA 1YSJA 3A8IE 5A2QE 2BOAA 2ZXOA 1C48A 3TP7A 1TS5A 3CU7A 4C3HB 4K5VA 3H8EA 2F0QA 1EY4A 4A38A 3DGVA 4UEEA 4G1PA 3FX6A 4OHJA 2O5JC 1HCZA 1FT7A 1ET9A 4C3IG 3X3MA 3ZYYX 2IX3A 2Q8RE 3MTSA 3LWUA 1LTBD 2XVSA 1KDBA 2YU9B 5CYUA 1XRYA 5ELFA 3FVLA 2E75C 1BUVT 3TC8A 3N52A 4R6TA 1SYCA 2ID0A 3S9LA 1TWAB 1CA5A 1PFNA 4BY7B 3SXHA 3L7ZC 2K1BA 1WTXA 2NWGA 4HR7B 5K5PA 1WCMB 3IAYA 1Z7TA 4OP4A 4IZ8A 3VA7A 5J1QA 3PUVA 1F2PA 3VR4A 3PFOA 4F9VA 5LYIA 3Q0AA 2KECA 4PXCA 2AWOA 3FEDA 1XJOA 5KYLA 1F9QA 1LTID 1PRTC 3KZWA 3S9WA 2PJ9A 2XN9C 2Z1CA 3BG3A 4BBRB 5LYDA 1EYCA 2PZWA 3P1HA 5EJWA 3P20A 2CTCA 1NUCA 3C1EA 1A3TA 4XT1B 1SYEA 3VA5A 4ODGA 1QOHA 2KEEA 2ZEMA 5DNFA 4IUPA 4O42A 2OEOA 5DAUA 4DAPA 2IX1A 3URYA 1PXUA 1D1IA 4F8MA 3KLRA 1Q90A 4ULLA 2A6HD 4FNFA 5I4MA 1VMCA 2LMCB 1TKHA 4NFRA 1M8AA 1HHVA 1BPNA 5F09A 3I4NB 2HCCA 4A3GB 3VATA 4IUQA 1CI3M 1TWGB 3ERQA 2C9OA 5EPLA 4IAVA 3PFEA 2FMCA 1ESFA 3FKIB 1DOMA 3MHBA 2C6GA 1JC7A 1KNEA 4RHSA 3TN2A 4LK1C 3GV6A 2Z4HA 4HMJA 4W9YA 3U9OA 3S2DB 5HXDA 2K5DA 4RKLA 3J81E 4CGYB 3PBBA 2G9DA 2Q4ZA 2IQ6A 4NGQA 1EQTA 4P4FA 2HCIA 2PJCA 3NH4A 4ZY0A 4A3IB 5LL6S 4WRDA 5CBEE 4JZ0A 3SK6A 2A73B 5KEEA 3KASA 1LO5D 2SNMA 3GO5A 2QKIC 1DTDA 5CBMA 2EK9A 2B2TA 1STHA 4P4EA 2NTTA 4KY5A 1L0YB 1U4LA 4DN4M 4JK1C 1VDZA 5FLXL 3OMCA 1Y8PB 4A3JB 2VB3X 2RA4A 3TZDA 3MRUA 4FF3A 3GTQB 1VF5C 3DEPA 3H8GA 2X69A 1EL0A 1KABA 2SDFA 2L0CA 4C3HG 5C3XA 1TY0A 2E76C 3P75A 3BHXA 2JA8B 2QEJC 3HG9A 4PMWA 3HP3A 4IK2A 4LQGA 2KA7A 3FRPB 3WC6A 2M00A 1F57A 3MFYA 1CT1D 1CZWA 4TNUA 3D7FA 4R9WA 3D6CA 5C4XB 2JBKA 1CQFA 3QWNA 1Y0RA 2PJ2A 4A3EB 3JRUA 4EVOA 4TRDA 4ZQ3A 5C44B 2BDNA 4HAEA 4K14A 3D7GA 1FD7D 5C0XJ 1D2BA 2F0WA 1ESRA 4DF7A 3T4AC 3IFDA 3Q23A 2C6CA 2KHSA 4FXDA 2EJMA 2TSSA 3Q6SA 5EKLA 2QJ8A 1SYFA 2E2HB 1JQYD 5FK9C 5FKAC 2QVPA 1R9TB 1HFNA 3CT9A 4CKBA 3RLFA 3I8ZA 3TSSA 2XEJA 1FNUA 1LABA 4CBVA 3HOUB 3IEHA 1BOSA 3PMFA 2C6PA 3IL8A 5JJZA 1I6VC 3K6OA 4IFDH 3OSOA 4OC4A 3J7AF 2JA7B 1LTSD 2JE6I 1M4VA 2IW3A 1R3NA 5E1FA 4XT3B 2F0FA 5I9PA 1GUWA 2CF4A 4X3SA 1LTTD 5K8MA 1JOKA 2LFNA 2NYQA 1ARLA 1KLUD 4QMGA 1DOKA 3H94A 5C4ZA 1ILQA 1YNNC 1HDUA 1JOOA 2KOLA 4IFDI 2PJAA 2K7VA 3KBXA 1R4QB 3O13A 3FJUA 1SBBB 1PRTD 2NZ1D 4N9PA 4X3UA 4XXEA 1STYA 5CV8A 3ONAB 3D6WA 3V7ZA 1V8QA 1RTOA 4NP5A 5KGUA 2EYPA 4A3FB 4UDUC 3DHQA 1NR4A 3K57A 4L6TB 1LT3D 3S1QB 4ZRZA 5CC4A 1JCKB 3PUXA 3CQZB 3EROA 3KL9A 4IALA 4NGNA 3PIO3 3PRTA 3GD7A 5M5WB 1H9SA 3OW7A 3NBHA 3SR1A 5IT9E 1PRTF 1CHQD 2N88A 2EK8A 3V2TA 2R6GA 1I3QB 2RBMA 2B2WA 2JA5B 2F03A 4IHMA 2Z4IA 2NB0A 3D3RA 5ELDA 4DAVA 1F9SA 2WKCA 1E0BA 4PNYA 3B3TA 3BYTB 2AFXA 4A93B 3TMEA 3M4OB 4EWTA 2AQ3B 3BYYB 1PZID 2WZNA 1LAMA 1SNQA 2L4NA 2Y0SB 2Z8LA 4DK0A 2PCUA 2IL8A 3QB3A 1SMYC 1PZJD 1SAPA 2MPMA 1SFOB 2BA0A 1PFBA 1SNPA 3HRZC 3D4WA 2D2CC 1HXYD 1Z2LA 4ZKBB 2F0IA 1EYAA 1A3VA 1ICWA 4HCEA 4FYDA 4J1MA 5FO8B 4XQNA 5CV7A 4A3BB 1JWUD 3H8FA 2ZXPA 1LFWA 2NVXB 3D66A 2RB7A 1TF8A 4ME5A 1KNAA 1EOTA 1FNOA 2F3WA 1TS3A 1XTCD 5EBDA 4X3KA 1SDFA 5COYA 1R4PB 3FMCA 1F2OA 1HQMC 4I7ZC 4HSPA 3CDXA 1GHJA 3KK7A 3SK5A 2ANPA 1V1PB 2EOTA 1MBYA 4O23A 1BDOA 2PW7A 4Y7NB 3DWQA 3K7AB 3AU7A 2PIZA 1TIID 4IN3A 1MD2D 5F2DA 1EY8A 1R43A 3LWEA 2PJ6A 3HEJA 5DM63 5IGGA 4IURA 1B2TA 1S5BD 5K36H 2E2DC 1Z8LA 3G6JB 4P4BA 4FF2A 1TKFA 2IPKD 1CX8A 2WAQB 3I90A 5KNBA 1FNVA 3K58A 4CKCA 3M4YA 2LY7A 3TP6A 3LX0A 3KQZA 4K6DA 4RFBA 4CKEA 1BLLE 4XQJA 3QOLA 4PQXA 3VYUA 1X3PA 3SJFA 2DNEA 4C1NK 3RZDB 1VIXA 2A68C 3E0JA 3HGBA 5EKKA 1XXGA 1F2MA 2NUCA 1HA6A 1TKJA 4EQOA 3R2TA 2JBJA 3D68A 5CBAE 3EA6A 1STAA 4R76A 4FP5D 3HOXB 5TSSA 1LTRD 7CPAA 4P6YA 3BVMA 4EQNA 2ICIA 5FO7B 2WIIB 4KD4A 2K01A 1PRTB 4FXKC 3GTMB 2O5IC 4XIGS 3QOJA 2EDGA 4DNTB 2K6AA 4K5WA 2M9VA 1RKNA 2B2WC 1RDPD 1WTOA 2L11A 1Q1BA 1CK1A 3L9AX 2K05A 2MJ8A 1I4PA 3H6MA 1Q12A 1ZXTA 2KEDA 2LS01 4MIUA 5M5XB 2B8FA 2OR4A 3KBGA 3NHHA 2A69D 1SYDA 2BOSA 1TS2A 1II3A 2BDOA 4IFDG 3K5NA 1YNJD 2VB2X 2F4IA 1DXMA 4DFAA 2XEGA 2EJGC 3VARA 5IOCA 2B63B 2Q8TA 3H91A 4MMOA 2ZEGA 1CA6A 2HC9A 2V8HA 4DJLA 2ZEEA 1YNND 2ZOFA 4N9TA 3N6RA 4TSSA 1OBRA 3JAML 4JYWA 6CPAA 4CHTB 3NQIA 2QF7A 4KSIA 3PEIA 5CV9A 3T53B 2FINB 4RGOS 2EY2A 3M3YB 5E4XA 5KRUA 4RWSC 2J4XA 2HDMA 4XYQA 2B2VA 2GREA 1BCPC 2ZELA 2EE1A 5C5LA 3HLPA 2F1MA 3K5LA 2F0GA 4BD9A 3PB9X 3GTLB 1QJOA 1G2SA 4LAAA 5HVFA 2PRQA 1LCPA 4UIAA 4LJZC 1QNUA 5D65A 1JQGA 2SNSA 1OXVA 1ZYRD 4X2TA 4FXGC 2NBFA 3MXNA 4U673 4K3NA 1XX8A 4P44A 4F8ZA 3EJIA 3B3WA 4G7ZC 5CORA 3CHBD 1VCIA 4PMBA 3A7LA 4KTAA 1ENCA 3B2YA 1STNA 2WP8J 1GYTA 1MSHA 3GV3A 3E6ZX 3OHXC 1LTAD 2EYJA 4P10A 2B39A 1TWFB 5LYFA 2J7ZA 4QF4A 3PB6X 2EZVA 4B6ZA 2XRQD 1ZLIA 5LHY1 3GTKB 3MFGA 4FF4A 4P4DA 3B3SA 4IUNA 4L63B 2VL1A 1B44D 2ZEFA 1QWYA 2H1EA 5EKIA 1BR9A 2EPBA 2FJ2A 2PZTA 4DYOA 1SXTA 3WOEA 3NWSA 1ZEQX 3MXGA 5THWA 3ND8A 5IODA 4PXEA 1TS4A 4OC2A 4RUHA 2CW0C 4FVMA 2AQ2B 4C1NI 3T13A 4C2MB 2NVTB 1JB3A 1X3QA 4F88A 4ZK9B 1HUNA 4F7XA 3W3AA 5IGFA 3LNNA 3D8GA 5C0XH 4UIBA 2KUMA 5DS0A 4H2KA 3SHLA 2SEBD 2RSOA 3SK8A 4MCSA 1ML0D 2RDFA 1BF4A 1ENFA 2ABZA 1TU2B 4K8JA 2R3ZA 5K36G 4G7HC 3MAQA 5M9OA 3S15B 1STBA 2JP1A 1QMUA 1EZ6A 5T1IA 3A56A 2ZEPA 2E2JB 3BDLA 4P4JA 2GU2A 4KK7A 3S17B 2XWBB 2XEFA 4NGSA 2F0VA 4GZYC 3F2UA 4HTHA 4NGRA 2XNAC 1F9PA 4H0LC 1SNDA 1FGBD 2A68D 4FF1A 4CJ2C 3K5OA 1GUOA 4DUKA 1H9RA 1RD9D 2MUYA 2KQ3A 3D4RA 2CQAA 4Z9CB 1GXDC 1ARMA 3K0YA 1WD0A 4H13C 2B2UC 4ZYSA 4A3KB 2B2VC 2V8VA 2L1BA 4CJ0B 1S5FD 1VF7A 1EY0A 2XEIA 1LACA 4F87A 1G91A 3RZAA 1OXXK 3AMUA 3H0GB 4K5XA 1PLFA 3BZDB 1RJTA 1GOZA 4M1UB 3KLSA 4K2KA 2F0NA 5KNCA 2O4XA 3C46A 1ELMP 2PJ8A 2GLJA 3JAME 2L9HA 2VUMB 3DM1A 3J80L 1ZG9A 3SJEA 3HS0C 4ZYQA 2R93B 3RZOB 4Q5VA 1K8OA 1EU4A 2HDLA 4X3TA 4Q0FA 1H9JA 2F0UA 2XRSD 3E5SA 3D7DA 3MN8A 3SJXA 3IJ3A 4MRIA 4ZLTF 3J7YW 5C5MA 1BBXC 1RCVD 1SJED 1CPSA 1B53A 4JBWA 3R3OA 4ZAIA 3EVQA 2WKDA 1Y8NB 2IMOA 4G7OC 2E2IB 5JM6A 3BDOA 3AB9A 1WD1A 1FNWA 2R7ZB 3CPXA 3U9SA 1PZKD 2FVGA 2YYZA 3NSWA 3NK9A 3A54A 3NTIA 3S14B 4KJNA 3C1FA 1H9MA 1D5MC 1ILPA 5CV5A 1F2YA 3PV0A 2L55A 1G2TA 5IGDA 5JAVA 5K8OA 3HZXA 1JR0D 2JEBI 4KY7A 2FFKB 4KMUC 3UI2A 3PO2B 1BCPD 3IWWA 2ZEHA 1QCBD 1I4XA 5I6YA 1NCVA 5ELBA 4RH6A 1EYDA 5G3LD 3RD4A 2BA1A 4DGZA 1G6ZA 4KHZA 3QIAA 3CRLC 2AUKA 4R8IA 3M85A 3S2HB 2PJ7A 4PPZA 4ID6A 5DEHA 1SE2A 1LOKA 1ZLHA 3FH4A 1DZ1A 4UF4A 4DA2A 2RQXA 4ABNA 5CV6A 4K6LA 1OO9B 4NJQA 4A3DB 2PJ0A 2ENBA 3TP8A 5I2YA 1HTLD 3MXPA 4L8JA 4Z65A 1SNMA 3NBIA 4PXBA 1BCPF 3QJYA 1DM0B 1BXTA 4MHPA 3HKZB 5IGCA 3S1RB 5G3LF 2WINB 2OOTA 1LT4D 1AMPA 3B7IA 4ZY2A 3J7AV 3MVVA 2CIJA 4C3JB 2QCPX 3I1UA 4XDXA 4P4IA 3NUCA 3NFZA 2JXMB 1Q7LA 1B9MA 3MEHA 3I4LA 2F0JA 4OC5A 3S1NB 1SE3A 1STEA 5AFWA 4OIWA 1K8MA 3SK4A 1F2LA 4QCLA 1JWMD 3S9NA 1GJXA 2ICEC 1EIGA 2PW5A 2V8GA 4NW2A 3M7NA 5ELYA 5JEAJ 2IWHA 3HOWB 3BVGA 1JWSD 4OC0A 1QQ9A 2OXPA 1DONA 1OXTA 1I4HA 1ONLA 2EYMA 4EGVA 1TKWB 3GUXA 5FLXE 4RGTA 1TF9A 5LYLA 4QUCA 1G291 1H8LA 2CTBA 1H9SB 3KHZA 2MGSA 2HQEA 1IL8A 4QUFA 1QNKA 4BA2I 3EQLC 4U68A 5A2QL 1TWCB 1BQQT 1EIHA 3A7AB 5EPJA 2RKSA 1YLOA 5C0XG 1WTWA 3K5MA 3BDCA 2PVVA 5M5YB 1Q8IA 3SJGA 4IFDJ 3K59A 3VR5A 1HUMA 2PJBA 5E3FA 2CVRA 5HVHA 4G4KA 2RVLA 3NA6A 1MI2A 1HRJA 2F0LA 1EEID 1L0XB 2LKVA 1QE6A 3CPAA 1DE4C 1E2WA 5IGBA 2L12A 3TP5A 1XMBA 5J22A 3FPPA 2PNRC 2IJZA 2PPBC 3NWTA 2Q8IB 2AFWA 4EQPA 4RKBA 4G57A 1HFGA 1EY5A 3TX8A 4FUUA 5IIFA 3S9MA 1EWHA 3NQTA 2ZOGA 3BXMA 3GQBA 3MZ5A 4RAUC 5LRJA 1BCPB 4FWUA 4F9UA 4OC1A 4FAIA 1PCAA 5CR3A 1SNOA 2F7VA 3SI1A 1BO0A 4IUVA 4CPAA 1IKMA 1I4QA 5LL6X 1IW7C 3I4MB 2QDBA 3VR2A 1KDCA 2J0TD 3GTJB 2PJ5A 1EU3A 4PV1C 1O7LA 3WABA 3X3NA 2Q51A 1O7ZA 5T1GA 3MXUA 5CPAA 4P45A 1FR3A 1CQVA 2DY7A 4IUTA 4BS9A 2XSCA 4C3JG 4LMQD 3NXWA 3T51B 4MN3A 3WOFA 3DXJC 1HEEA 5JGFA 5A35A 1YMEA 4M8AA 1RHPA 1XWEA 2AWNA 3IFEA 3SVMA 3PO3B 2WB1B 3J81L 5JVH3 5D14A 2K03A 5KNDA 2DEAA 4R8FA 1CG2A 1PTOC 1AZQA 2ZT9C 1W6KA 2A6EC 3OOCA 2C5CA 3S16B 4WORA 3DWPA 1O78A 2AFZA 3T8WA 3V38A 5D8NA 3FEEA 4KV6A 2HB6A 1STGA 5KYIA 4IUUA 3A8KE 1AZPA 5C4HA 3MC0B 1I4RA 2AUJD 3VYSA 3TDQA 3K9TA 1RTQA 2PO4A 5D3DA 2EYHA 5FOBB 1TQOA 1B1ZA 4KKTA 1CP6A 4MCRA 1UUPA 4S3SA 1AFPA 2PVWA 3GTOB 2B2UA 2PJ4A 4DAYA 5ISRA 5BN5A 4QIWB 2NVQB 4NGMA 1J8IA 1Z5RA 3H09A 3DUZA 3WT4A 3KGQA 2PJ1A 2G9HD 4NGTA 4YU9A 3FVQA 3WC5A 4BY1B 1LLRD 1CZGA 5M3FB 3ITPA 4NMZA 1A2TA 3GP7A 4OMEA 3EFXD 4DNRB 1BNZA 4ZX8A 2POKA 3KLSX 1GUSA 3N5FA 5IGEA 3VR6A 1ENAA 2BO9A 4K8IA 4MXUA 1K83B 3FEWX 1QILA 4DXGA 5JH9A 4ONWA 5I4DA 2I3CA 1AEXA 1G8ZD 2K04A 4EFDA 5LRGA 4KKUA 1EY9A 4X3RA 2PIYA 2WYRA 2V8DA 1E2ZA 1NR2A 1YW4A 3B3VA 2IJ0A 1SMYD 1M4LA 1YW6A 1S4ZA 2SOBA 1D1KA 2CHBD 2MHVA 2RSNA 1JORA 5BN4A 3NTHA 4AXVA 3WDNA 3KR4A 1QB5D 5C4JB 5LRKA 3IFTA 1A2UA 1EEFD 3BVZA 3I3CA 1NAPA 1GUGA 3FDTA 2PZUA 2BE5C 4X8IA 1SJHD 5EQ0A 1Z47A 2O53A 4FO2A 1RTNA 1CP7A 1Y7EA 1VMPA 1GHKA 2F0KA 1TR5A 3I91A 1PYTB 4OGQC 4A94A 4KKSA 4KN7C 2NTSA 4RGMA 2X6LA 2IT1A 1LTGD 5CGKA 5C3EB 4TKOB 2KVMA 3H3VC 3GTGB 1VHOA 3PB4X 3PBEA 2ZXRA 1LT5D 2X6GA 1VGYA 3SI0A 1SEBD 1DJRD 1CHPD 1U4PA 3RAMA 4WWVA 4R8NA 2EWBA 2L5TA 5D29A 4UEFA 2I46A 1JE4A 1T5EA 8CPAA 3RMHA 2A74C 5I2XA 1IHZA 1IW7D 2D62A 1J9OA 4OIDA 3B35A 1SYGA 3OIQA 4KY6A 5C0XI 3W2DA 4A3MB 5HURA 1FYCA 2IX0A 1LAPA 1S5ED 5IT9L 1TWHB 3KQXA 4H44C 3V05A 2EYOA 1HTPA 2WACA 4KJOA 2F0MA 3PUZA 5HVGA 1XBUA 3PUWA 3NE5B 4GM5A 4DXFA 4RCOA 4AYBB 1W6JA 5IB9A 5ELEA 4FBEA 3ISZA 4UAIA 1MGSA 4OKOA 3IKJA 2K33A 3NP8A 1SYBA 1I4GA 2I07B 1F9RA 2K5QA 2PQEA 2O4HA 2EY5A 4B9XA 3KI9A 1WVLA 3I73A 1O80A 4E6IA 3VYTA 4CJ1B 1C4QA 1Q1EA 5J39A 3L2NA 3K2KA 1PTOD 2NYZD 3IIBA 1EY7A 2F3VA 2A6ED 1LANA 2F0EA 3OIPA 3DLJA 4RA8A 1JICA 4HMIA 4QB4A 4BWGB 4Q7AA 4OIJA 2JSOA 4A39A 3CRKC 4A37A 1Y1WB 2K5WA 1Y1VB 1B50A 2NN6H 3QG1A 1TY2A 1C8CA 4OL7A 2JYOA 1DD2A 3PB8X 3FECA 1DCZA 1RODA 4OC3A 3HOVB 3VYRA 4ZI6A 5JEAH 2AQ1B 3VR3A 1PTOF 1AN8A 2VNUD 1S5DD 1I50B 3A55A 3FF3A 4PXDA 1JOQA 2B8GA 3SDZA 3QNVA 4K2LA 2M2LA 3SEBA 2QILA 4EMEA 2V77A 3C2PA 4ZUIA 3DEOA 3L3OC 2NN6I 3ISXA 3LMSA 1EQVA 1Y8OB 5FO9B 2PJ3A 1U4MA 1KWMA 4I65A 4NGPA 2V4DA 5E4WC 2OT2A 4KD3A 1O7YA 2K28A 2J9AA 4BA1I 1X32A 5EBCA 4B08A 2JEAI 2A69C 4C56C 1CTMA 3HOYB 4MHYA 2XWJB 3OMGA 1EE3P 4KN4C 4NKLA 2RFHA 3B3CA 5NUCA 4ZKCB 1YNJC 1EWCA 2Q43A 5M3MB 5HGTA 5EGTA 3PB7X 4YWYA 1OXSC 4OO1H 1EFID 3Q22A 5JOBA 5I6WA 2EYLA 2B2YA 5J1ZA 1PTOH 5DM73 1VHEA 1F2ZA 3OWFA 3T56B 3KUPA 2KCNA 1Q3LA 3SE0A 2B2TC 2QYVA 1AP0A 5C6AA 1DYQA 2DNCA 1GUTA 1ET6A 1UEAB 3IC1A 1D6EC 3V96A 1IYVA 1AYEA 2E74C 4V0BA 2A5HA 2FHTA 5BN3A 4KHVA 3C3LA 4OO1I 2AFMA 2BE5D 3KHXA 2H4OA 1CFMA 4HEDA 1V1OA 2CW0D 2F8HA 1MSGA 2EJFC 1UAPA 2F0DA 5D3IB 1ZKOA 3G7LA 5JVG3 2JEWA 4IQZA 4RGNA 2AFSA 2D9UA 1HA5A 1ZYRC 3D7HA 5KIXA 1IYUA 4RCNA 1PMRA 1D5XC 2ZENA 4DK1A 4NJRA 1B9NA 2FMMA 1BPMA 4TQUS 1SSOA 4P2CB 4ZY1A 3D4DA 1WTPA 1KTKA 1S5CD 3CKIB 5ELCA 1TT2A 1LV9A 1PFMA 1A6XA 5K8PA 5CV4A 1PYWD 1A3UA 3I72A 4ZUJA 3J80E 2K32A 1PTOB 4HSVA 1NSAA 1PDQA 3NH5A 1U9RA 1ELLP 3D31A 4PMCA 1Z6HA 4V190 1TXRA 2DY8A 3DWAA 3OWEB 1V1PA 2F0HA 1WTVA 2AFUA 2NSMA 2EYFA 3GTPB 2GA4B 1TVXA 2KJXA 3RUZA 5JPNC 2RDHA 3HUVA 4C3IB 1D5ZC 4NDXA 2N55A 3I70A 3DMUA 2BCOA 3IO1A 1E2VA 3ND9A 4RHRA 4DU9A 3BI1A 2A6HC 2KCCA 2EY6A 4MHNA 4J8QA 1NSNS 4O1NA 1CBXA 1ZG8A 4MCPA 3MA2B 3GB0A 3OPOA 3KR5A 3SI2A 4HCSA 1KAAA 2R61A 1HQRD 3PIP3 1Y0YA 2EXZA 3P7JA 3FPUB 3T16A 2C1CA 2MP1A 2OF1A 1T5XD 3GLJA 2R92B 1IKLA 1I6HB 4TWEA 4WJWA 4WJBA 1QG7A 1SNCA 2B2YC 2O2LD 1UNSA 1CM9A 2VXWA 1H9KA 2EY1A 2PCFB 4ILWA 3NTKA 2D5DA 4WFN3 5I9OA 1EZ8A 3S1MB 4R7MA 4XTCS 2JA6B 3WC7A 4YIJA 4PQAA 4MCQA 2NN6G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B3V A;  1HDQ A;  1M4L A;  1YW6 A;  3D67 A;  3RBU A;  3D7D A;  3MN8 A;  2EK8 A;  3SJX A;  3IJ3 A;  4MRI A;  1UWY A;  2AFO A;  1BAV A;  1XFO A;  4AXV A;  1CPS A;  4IHM A;  3KR4 A;  5LRK A;  2ZED A;  3B3T A;  1IGB A;  2AFX A;  2IMO A;  5JM6 A;  4EWT A;  4X8I A;  4UEZ A;  2WZN A;  2O53 A;  1LAM A;  3CPX A;  2FVG A;  1CP7 A;  1Y7E A;  2PCU A;  3D4U A;  1PYT B;  3VH9 A;  3NH8 A;  1Z2L A;  4A94 A;  4ZX9 A;  5K8O A;  3BI0 A;  3H8F A;  1LFW A;  3IWW A;  2ZEH A;  3D66 A;  2RB7 A;  1TF8 A;  3PB4 X;  1VHO A;  3PBE A;  2PE3 A;  1FNO A;  1CPX A;  1VGY A;  2GLF A;  3SI0 A;  1ZG7 A;  3RAM A;  4WWV A;  5D29 A;  2EWB A;  4UEF A;  1IY7 A;  5K8N A;  2PJ7 A;  4PPZ A;  3FMC A;  1LOK A;  1F2O A;  1ZLH A;  3FH4 A;  4UF4 A;  4MHZ A;  2ZEO A;  1YSJ A;  8CPA A;  3CDX A;  2ANP A;  4O23 A;  2BOA A;  4NJQ A;  4OID A;  2PIZ A;  2PJ0 A;  3B35 A;  4Z65 A;  1R43 A;  1LAP A;  4PXB A;  2PJ6 A;  3H8E A;  4MHP A;  3KQX A;  4A38 A;  3DGV A;  1Z8L A;  4UEE A;  4P4B A;  1TKF A;  2OOT A;  4G1P A;  1AMP A;  3B7I A;  1CX8 A;  4ZY2 A;  3FX6 A;  1FT7 A;  5HVG A;  2CIJ A;  1XBU A;  3I1U A;  4GM5 A;  4P4I A;  3LWU A;  3NFZ A;  3KQZ A;  1BLL E;  1Q7L A;  5IB9 A;  4FBE A;  1XRY A;  3ISZ A;  4OC5 A;  4OKO A;  3FVL A;  4OIW A;  3TC8 A;  4R6T A;  3SJF A;  2O4H A;  3S9L A;  1VIX A;  3S9N A;  3KI9 A;  2V8G A;  4OP4 A;  1TKJ A;  5J1Q A;  5ELY A;  2JBJ A;  1F2P A;  3D68 A;  3L2N A;  3PFO A;  3K2K A;  4F9V A;  4OC0 A;  4R76 A;  5LYI A;  3IIB A;  1QQ9 A;  1LAN A;  4PXC A;  3FED A;  7CPA A;  1XJO A;  3DLJ A;  3KZW A;  4P6Y A;  2PJ9 A;  4Q7A A;  5LYD A;  4A39 A;  3GUX A;  4A37 A;  2CTC A;  1TF9 A;  5LYL A;  1H8L A;  2CTB A;  3PB8 X;  3KHZ A;  3FEC A;  4OC3 A;  4ZI6 A;  2ZEM A;  2OR4 A;  1YLO A;  3FF3 A;  4PXD A;  2PVV A;  3QNV A;  3SJG A;  5I4M A;  1TKH A;  4NFR A;  1BPN A;  2PJB A;  5F09 A;  5HVH A;  4EME A;  2V77 A;  3NA6 A;  2XEG A;  3ISX A;  3VAT A;  3LMS A;  3VAR A;  4IAV A;  2PJ3 A;  3PFE A;  1KWM A;  4MMO A;  2ZEG A;  2C6G A;  2HC9 A;  2V8H A;  4NGP A;  4DJL A;  2ZEE A;  4W9Y A;  3CPA A;  2ZOF A;  5HXD A;  1DE4 C;  1OBR A;  2J9A A;  4JYW A;  6CPA A;  4KSI A;  1XMB A;  3PEI A;  3PBB A;  2G9D A;  2Q4Z A;  2IQ6 A;  4NGQ A;  2IJZ A;  4MHY A;  4P4F A;  2PJC A;  1EE3 P;  3NH4 A;  4ZY0 A;  2RFH A;  2AFW A;  3B3C A;  4JZ0 A;  2Q43 A;  3KAS A;  2GRE A;  1DTD A;  5CBM A;  2ZEL A;  3PB7 X;  2EK9 A;  3TX8 A;  4YWY A;  4FUU A;  3HLP A;  3S9M A;  4P4E A;  2ZOG A;  4BD9 A;  3BXM A;  3PB9 X;  5LRJ A;  5HVF A;  2PRQ A;  1LCP A;  4UIA A;  4FWU A;  1VHE A;  4F9U A;  4OC1 A;  4FAI A;  1PCA A;  1JQG A;  2F7V A;  3SI1 A;  4X2T A;  4CPA A;  3MRU A;  2QYV A;  4K3N A;  4P44 A;  3H8G A;  4F8Z A;  3B3W A;  3IC1 A;  3B2Y A;  2PJ5 A;  1AYE A;  3WAB A;  1GYT A;  2Q51 A;  3BHX A;  2AFM A;  3KHX A;  5CPA A;  4P45 A;  4P10 A;  2F8H A;  5LYF A;  4IK2 A;  4LQG A;  3WC6 A;  4ZYQ A;  3PB6 X;  4B6Z A;  1F57 A;  2JEW A;  1ZLI A;  4P4D A;  2AFS A;  3B3S A;  4TNU A;  1HEE A;  3D7F A;  3D7H A;  2VL1 A;  2JBK A;  1Y0R A;  2PJ2 A;  5JGF A;  3JRU A;  2ZEF A;  1YME A;  2ZEN A;  4PQA A;  4NJR A;  3IFE A;  1BPM A;  4DYO A;  3D7G A;  4ZY1 A;  2DEA A;  4R8F A;  5THW A;  1CG2 A;  4PXE A;  4OC2 A;  2C6C A;  5K8P A;  4RUH A;  2QJ8 A;  1NSA A;  2AFZ A;  3T8W A;  3NH5 A;  3V38 A;  2QVP A;  5D8N A;  1ELL P;  3FEE A;  3CT9 A;  2HB6 A;  1TXR A;  2XEJ A;  2AFU A;  2NSM A;  3K9T A;  3IEH A;  4UIB A;  5DS0 A;  4H2K A;  2C6P A;  1RTQ A;  3HUV A;  4MCS A;  2ABZ A;  2BCO A;  3IO1 A;  4OC4 A;  1CP6 A;  1QMU A;  4MCR A;  2ZEP A;  3BI1 A;  2PVW A;  1R3N A;  4P4J A;  2GU2 A;  2PJ4 A;  4MHN A;  2XEF A;  4NGS A;  1CBX A;  4MCP A;  1ZG8 A;  4NGM A;  4NGR A;  2CF4 A;  3GB0 A;  3KR5 A;  5K8M A;  1Z5R A;  3SI2 A;  2NYQ A;  1ARL A;  3WT4 A;  4DUK A;  3KGQ A;  2PJ1 A;  1Y0Y A;  4NGT A;  1ARM A;  4YU9 A;  3WC5 A;  1HDU A;  2V8V A;  2C1C A;  2PJA A;  3GLJ A;  4OME A;  4ZX8 A;  2POK A;  4TWE A;  3FJU A;  4WJB A;  3N5F A;  2XEI A;  3RZA A;  2BO9 A;  4MXU A;  5JH9 A;  3V7Z A;  4ONW A;  1ELM P;  2I3C A;  2PJ8 A;  2GLJ A;  4EFD A;  5LRG A;  4R7M A;  4X3R A;  2PIY A;  3WC7 A;  2WYR A;  2V8D A;  1ZG9 A;  3KL9 A;  4NGN A;  3SJE A;  4MCQ A;  1YW4 A;  3PRT A; 
#chains in the Genus database with same CATH topology
 1NBW A;  2NVY H;  5EPK A;  2XIW A;  1HDQ A;  1YR0 A;  3D67 A;  3IU1 A;  3CMA A;  3MWY W;  3R93 A;  1E22 A;  4IUS A;  3KLW A;  1UFH A;  4POG A;  3RBU A;  5JEA G;  4J6H A;  3ULP A;  2VS1 A;  1KDA A;  1RF2 D;  4LFA L;  3SGI A;  3M3Y H;  2WV6 D;  4UPA A;  2C35 B;  1UWY A;  2AFO A;  4C7I A;  3K0X A;  1NMG A;  4C3H H;  1BAV A;  2RDG A;  1EY6 A;  1DOL A;  1XFO A;  2TMP A;  5GAE C;  1SE4 A;  2YNC A;  4KI0 A;  3TBI B;  4B9W A;  2PMZ B;  1XYI A;  3CCL A;  2DPT A;  3Q24 A;  2F0O A;  2F0P A;  4LNQ A;  1M90 C;  3M7G A;  1WTQ A;  2ZED A;  4B3S Q;  1IGB A;  3FP9 A;  4XQQ A;  3QO2 A;  1HZC A;  3H3V I;  3PUY A;  4JW0 A;  1V43 A;  4UEZ A;  4LF9 Q;  3HOZ B;  1AW7 A;  4AH6 A;  1N34 Q;  4R4C A;  2WPW A;  3KF8 A;  3NPP A;  2YU9 H;  1B4O A;  1YGH A;  3KF6 A;  2Q7S A;  1F77 A;  3KJP A;  2EBJ A;  1Q2C A;  4MHE A;  4BBS B;  4DR2 Q;  3D4U A;  3VH9 A;  2DGY A;  4M6H A;  1TWA H;  1KLG D;  4BY7 H;  4AVC A;  3TZU A;  3NH8 A;  4B3R L;  4UP9 A;  1Y69 U;  3R8B A;  4JI0 L;  3R2I A;  1B3A A;  1UE7 A;  3G8W A;  1KD1 C;  1Z4R A;  1U4R A;  4ZX9 A;  2EVB A;  5IYC H;  2E5L Q;  1GUN A;  2F0S A;  3NEN A;  2PYK A;  3WWV A;  3BI0 A;  4CGM A;  5HMN A;  4XPD B;  3TS2 A;  4XYO A;  3I7F A;  4LUV A;  2PE3 A;  3KF8 B;  3A8J E;  3LAC A;  2DN8 A;  1LT6 D;  4JYA L;  1CPX A;  2GLF A;  5IWA Q;  1OXU A;  1WTR A;  3KF6 B;  4H7B A;  4U9Z A;  4OIK A;  5CMD A;  1ZG7 A;  4DR3 L;  5JPM C;  3BS1 A;  3PGP A;  4BBR H;  1IY7 A;  5K8N A;  3CPF A;  1A15 A;  1X3F A;  2HUG A;  2F0T A;  5C3W A;  4OO1 G;  1B7Y B;  1HPC A;  4HN7 A;  2NVY B;  5IP7 G;  4MHZ A;  2ZEO A;  1YSJ A;  2HT1 A;  1XF8 A;  4IF5 A;  1NNX A;  1K9M C;  1VQK A;  3A8I E;  1S7F A;  5A2Q E;  1SE8 A;  2BOA A;  2ZXO A;  1C48 A;  3TP7 A;  1TS5 A;  3CU7 A;  4A2Z A;  1EIF A;  3HFZ B;  4LF4 L;  4C3H B;  4K5V A;  3H8E A;  5IB0 A;  2F0Q A;  1KAW A;  1Q82 C;  1EY4 A;  4JJX A;  4A38 A;  3DGV A;  4UEE A;  4O0A A;  1TXY A;  2UU9 Q;  4G1P A;  3FX6 A;  4OHJ A;  2O5J C;  1HCZ A;  1FT7 A;  1ET9 A;  4C3I G;  1YLE A;  2LSS A;  4R4Q A;  4ZCK A;  3X3M A;  3ZYY X;  2IX3 A;  1IBM L;  2Q8R E;  2PI2 E;  3MTS A;  3LWU A;  1LTB D;  2ATW A;  2XVS A;  4A3G H;  5F47 A;  1KDB A;  4C2M H;  2NVT H;  2YU9 B;  5AGE A;  3ZZI A;  1PYB A;  1TWG H;  4DUZ Q;  5CYU A;  1XRY A;  5ELF A;  1IL2 A;  3FVL A;  2Z11 A;  4EX5 A;  3F1Z A;  2E75 C;  1BUV T;  4RMF A;  3TC8 A;  3N52 A;  4R6T A;  5IX3 A;  1SYC A;  2ZW7 A;  2ID0 A;  4LFB Q;  3S9L A;  1TWA B;  1IBK Q;  1G51 A;  1PFN A;  2R7D A;  1CA5 A;  4BY7 B;  3J80 i;  3SXH A;  4HIM A;  3L7Z C;  2K1B A;  1MK4 A;  1NMF A;  1WTX A;  2NWG A;  4HR7 B;  5K5P A;  1WCM B;  5DLQ E;  3IAY A;  1Z7T A;  4OP4 A;  4IZ8 A;  1X6O A;  3VA7 A;  2ATR A;  4LFC Q;  5J1Q A;  3PUV A;  1F2P A;  4P71 A;  3VR4 A;  3PFO A;  4F9V A;  4HJ7 A;  5LYI A;  3Q0A A;  2KEC A;  4PXC A;  2AWO A;  3FED A;  1XJO A;  5KYL A;  3G6E A;  2R92 G;  1F9Q A;  1LTI D;  4A3I H;  4MY3 A;  1PRT C;  3KZW A;  4B3T Q;  4UFX A;  3S9W A;  1EFW A;  4O2D A;  2PJ9 A;  3QAH A;  3S17 H;  2XN9 C;  2Z1C A;  3BG3 A;  2KHJ A;  2PRB A;  2I5M X;  3GDE A;  4BBR B;  4YCW A;  1EYC A;  5LYD A;  2PZW A;  3P1H A;  5EJW A;  1JB7 A;  3P20 A;  2VQE Q;  3K9U A;  2CTC A;  1IB1 E;  1NUC A;  3C1E A;  1A3T A;  2L15 A;  1GD7 A;  3KDF A;  4LUO A;  1VQ8 A;  4XT1 B;  3SXO A;  1SYE A;  1S7K A;  4GKK L;  4IPG A;  3VA5 A;  4ODG A;  3GIU A;  1QOH A;  1S7L A;  4BXX G;  3H15 A;  2KEE A;  4MJ8 A;  4A3K H;  1IYK A;  2OU2 A;  2ZEM A;  5DNF A;  4IUP A;  4O42 A;  2OEO A;  5DAU A;  4DAP A;  2IX1 A;  3URY A;  4NSQ A;  3GTQ H;  3L0O A;  1PXU A;  2OB0 A;  1S3Z A;  2FE7 A;  3HKZ E;  1D1I A;  4F8M A;  3KLR A;  4OWX B;  1Q90 A;  1MKH A;  4ULL A;  2EUI A;  3SXN A;  3EIV A;  2A6H D;  4FNF A;  5I4M A;  1VMC A;  2LMC B;  4UFW A;  4QQB X;  1TKH A;  3CF5 A;  4NFR A;  1M8A A;  1HHV A;  1BPN A;  4QGU A;  5F09 A;  3E9H A;  2JQO A;  2FIW A;  4F0Y A;  3I4N B;  2HCC A;  1Z9U A;  2DJF C;  4JI4 Q;  4A3G B;  1BO4 A;  3VAT A;  1PFS A;  4IUQ A;  1CI3 M;  2JA8 H;  1TWG B;  3ERQ A;  2VUM H;  2C9O A;  5EPL A;  4FD7 A;  4KUA A;  4B5P A;  4IAV A;  4KZT A;  3PFE A;  2FMC A;  2N8N A;  1ESF A;  1CKN B;  1JT8 A;  1Q46 A;  3FKI B;  1DOM A;  3MHB A;  2R93 H;  2C6G A;  1JC7 A;  1KNE A;  4RHS A;  3TN2 A;  4LK1 C;  3GV6 A;  3R1K A;  1DGS A;  3TO6 A;  2Z4H A;  4HMJ A;  5IYD G;  3U9O A;  4W9Y A;  3S2D B;  5HXD A;  1QUQ A;  4JCV E;  1X10 A;  4NXY A;  1MJC A;  2X7B A;  2MO1 A;  1YNX A;  2K5D A;  4RKL A;  1N33 L;  1E7Z A;  3J81 E;  4DV6 L;  5C4X H;  3G4S A;  3G3S A;  4CGY B;  4BBS G;  4A3E H;  3D2P A;  3PBB A;  2G9D A;  3PSI A;  2Q4Z A;  5F48 A;  1U0L A;  3U4Z A;  5G21 A;  2IQ6 A;  5C44 H;  4NGQ A;  1EQT A;  4QUS A;  4P4F A;  2HCI A;  2PJC A;  2OCE A;  3TEH B;  3T1Y Q;  3NH4 A;  4ZY0 A;  4A3I B;  4KLV A;  1X56 A;  5LL6 S;  4WRD A;  5CBE E;  4JZ0 A;  1SMX A;  3OTO Q;  4FD5 A;  3SK6 A;  2A73 B;  4HPS A;  5C88 A;  5KEE A;  3KAS A;  1LO5 D;  2SNM A;  3GO5 A;  2QKI C;  1DTD A;  5CBM A;  4N8X 1;  2EK9 A;  2B2T A;  2ZW4 A;  1STH A;  5DWM A;  4P4E A;  4GNX B;  2H5M A;  1MHW C;  2NTT A;  1PH4 A;  1CJW A;  1PUA A;  4KY5 A;  1L0Y B;  1U4L A;  4DN4 M;  3EXN A;  2XGT A;  5AG6 A;  5EC4 A;  4JK1 C;  3S6G A;  1VDZ A;  5FLX L;  3OMC A;  1Y8P B;  4A3J B;  2VB3 X;  1Y7R A;  2MQH A;  1R9T H;  3C26 A;  2RA4 A;  3TZD A;  1J4J A;  3MRU A;  2QEC A;  2K5H A;  2Y0S E;  4FF3 A;  2OZG A;  2QA4 A;  3GTQ B;  4QB9 A;  4QVT A;  1VF5 C;  1J5E L;  2BUE A;  3DEP A;  3H8G A;  3HOU H;  2G3A A;  4MBU A;  1Z4E A;  2X69 A;  1EL0 A;  1EQR A;  5IYB H;  4JI7 Q;  4F0X A;  1CKM A;  1KAB A;  3PO2 H;  3I56 A;  2KCM A;  2CY2 A;  2SDF A;  2L0C A;  4C3H G;  5C3X A;  1TY0 A;  2E76 C;  3P75 A;  4UHV A;  5IV0 A;  3BHX A;  3TE4 A;  1CKO A;  4AIM A;  5FVJ A;  2YTV A;  2JA8 B;  4HID A;  2QEJ C;  3HG9 A;  4PMW A;  1N32 Q;  3HP3 A;  4IK2 A;  4LQG A;  2KA7 A;  3FRP B;  3WC6 A;  4A3C H;  1E3P A;  2M00 A;  1K8A C;  1F57 A;  5LMU Q;  3N7Z A;  3MFY A;  1CT1 D;  1CZW A;  4TNU A;  3J80 c;  3D7F A;  4WJ4 A;  3TS0 A;  4R9W A;  3D6C A;  2MNA A;  1HR0 Q;  5C4X B;  2JBK A;  1CQF A;  3QWN A;  1Y0R A;  1B70 B;  2Z6K C;  4A3E B;  2PJ2 A;  3H5Z A;  4HNY B;  3JRU A;  4EVO A;  3R9G A;  4TRD A;  3DNS A;  2P6F A;  4BY7 G;  4ZQ3 A;  3P2F A;  1VQJ A;  5C44 B;  4KLK A;  1VQM A;  4JPB W;  4DKA C;  2BDN A;  4HAE A;  4K14 A;  3VDY A;  2PC1 A;  1YJ9 A;  3D7G A;  4HJA A;  1WCM G;  1FD7 D;  5C0X J;  1PH6 A;  1D2B A;  3S24 A;  2F0W A;  1ESR A;  2HV2 A;  5IYC G;  4DF7 A;  3T4A C;  4XPL A;  3IFD A;  3LD2 A;  1IID A;  3Q23 A;  2N49 A;  2C6C A;  2KHS A;  4FXD A;  2EJM A;  2TSS A;  4YHH L;  1IBL Q;  1IYJ B;  2ZW6 A;  4DV7 L;  2Q44 A;  1PV4 A;  3Q6S A;  5EKL A;  2QJ8 A;  2K50 A;  4A3F H;  1SYF A;  3QB8 A;  2E2H B;  1JQY D;  2UUC Q;  1LTL A;  5AJ3 Q;  5FK9 C;  2GIV A;  4CRZ B;  4BBR G;  5FKA C;  3CAM A;  2QVP A;  3CQZ H;  1R9T B;  1FJG Q;  1RL2 A;  1HFN A;  1QSR A;  3CT9 A;  4MFJ A;  4CDE C;  4CKB A;  1PH3 A;  3AEV A;  4DV5 L;  3RLF A;  1QSO A;  4JI3 Q;  3I8Z A;  3E3X A;  3TSS A;  4JBM A;  2XEJ A;  1FNU A;  1LAB A;  4CBV A;  3OWC A;  3HOU B;  3IEH A;  2YTY A;  1S5K A;  3E9I A;  3HKS A;  1BOS A;  4JI1 L;  2ZXV A;  4XNH B;  3PMF A;  4GS4 A;  2C6P A;  3IL8 A;  5JJZ A;  1I6V C;  5H86 A;  2VQF L;  3K6O A;  4JG2 A;  3TRZ A;  4AQY Q;  4CDC C;  4IFD H;  4X66 L;  3OSO A;  2JA5 H;  4OC4 A;  3J7A F;  2JA7 B;  1C7Y A;  1LTS D;  1K4J A;  4B3M L;  4LX9 A;  3TO7 A;  2R8V A;  2JE6 I;  1M4V A;  5HH1 A;  2IW3 A;  1R3N A;  1WK4 A;  2VXK A;  5E1F A;  4A93 H;  4LUZ A;  4X6A H;  4XT3 B;  3M4O H;  2E8G A;  2F0F A;  5I9P A;  1GUW A;  2CF4 A;  4X3S A;  4A3G G;  1LTT D;  5K8M A;  3BJ7 A;  2Z9H A;  1JOK A;  3T1H Q;  4DR6 Q;  2LFN A;  2CKZ B;  2NYQ A;  1ARL A;  1KLU D;  3KKW A;  4JWP A;  2K5T A;  4QMG A;  1SRU A;  3FKI G;  4LF6 L;  1DOK A;  2CNS A;  3H94 A;  4C2Z A;  5C4Z A;  1ILQ A;  1P16 A;  3G48 A;  4LF7 Q;  4UWI A;  1YNN C;  2UUA Q;  1HDU A;  1SFO H;  1JOO A;  2KOL A;  4IFD I;  3W6S A;  2A8V A;  2PJA A;  2K7V A;  3KBX A;  1R4Q B;  1FL0 A;  3O13 A;  4M6G A;  2UXB L;  3FJU A;  1E1T A;  1SBB B;  3DLL A;  1PRT D;  3E0K A;  4A95 A;  4A3B H;  2NZ1 D;  4N9P A;  4X3U A;  4XXE A;  1STY A;  2NVX H;  1VQI A;  4OWW B;  1Z9F A;  5CV8 A;  3ONA B;  5DWN A;  3D6W A;  4A3I G;  1RO5 A;  3FNC A;  3BLN A;  3V7Z A;  2AMC B;  1V8Q A;  1RTO A;  4NP5 A;  5KGU A;  2EYP A;  2KEN A;  4A3F B;  4UDU C;  3DHQ A;  1NR4 A;  3K57 A;  3A5Z B;  4L6T B;  1LT3 D;  4R4O A;  4ZRZ A;  5CC4 A;  1JCK B;  3PUX A;  3CQZ B;  3S1Q B;  3ERO A;  3KL9 A;  1XJV A;  4IAL A;  4NGN A;  4KLW A;  3PIO 3;  4HIK A;  1WI5 A;  1NE9 A;  5L37 A;  2HIV A;  3GD7 A;  3PRT A;  5GAG C;  5M5W B;  1H9S A;  4BMH A;  3OW7 A;  2J8N A;  3NBH A;  3SR1 A;  3UDF A;  4YY3 Q;  1PH7 A;  5IT9 E;  4JXQ A;  4EVY A;  1PRT F;  2QGQ A;  4A3J G;  3K7A H;  4GS3 A;  1CHQ D;  2N88 A;  2EK8 A;  1HZA A;  3V2T A;  4ALP A;  3UY5 A;  5A28 A;  2VW9 A;  2R6G A;  1I3Q B;  1YJN A;  2RBM A;  2B2W A;  2JA5 B;  3PCO B;  5IP9 H;  2F03 A;  1QVC A;  4IHM A;  1BBU A;  2Z4I A;  2NB0 A;  3D3R A;  5ELD A;  4DAV A;  3J81 i;  1F9S A;  4CGP A;  2WKC A;  1E0B A;  4PNY A;  2YGW A;  3B3T A;  3R96 A;  3VWD A;  4E8O A;  3BYT B;  2AFX A;  4CAW A;  4A93 B;  3TME A;  3M4O B;  4EWT A;  2AQ3 B;  4QIW E;  3U58 A;  1KUY A;  3BYY B;  3I9S A;  1W2B A;  1PZI D;  3EO4 A;  2WZN A;  1LAM A;  2JA8 G;  4JI8 L;  1SNQ A;  2P5Z X;  2QML A;  3JVN A;  1HR0 W;  3GYA A;  5H1S E;  2L4N A;  2Y0S B;  4DV0 Q;  2Z8L A;  4DK0 A;  1X3G A;  2PCU A;  2IL8 A;  3QB3 A;  1SMY C;  1YIT A;  1PZJ D;  2Z3L A;  1SAP A;  3I4M H;  3RZD H;  4DR4 L;  2MPM A;  1SFO B;  2BA0 A;  1PFB A;  1SNP A;  2IHF A;  3HRZ C;  3D4W A;  2D2C C;  1HXY D;  4PZ7 A;  4APV A;  1OZP A;  1Z2L A;  2FXF A;  4ZKB B;  2F0I A;  1EYA A;  1A3V A;  3U50 C;  1R57 A;  1ICW A;  4HCE A;  1I94 L;  4FYD A;  1P8L A;  4J1M A;  4DR7 L;  2UXC Q;  5C4X G;  2GAN A;  3GTJ H;  4A3E G;  1IU8 A;  3TCV A;  5FO8 B;  2Y0M A;  4XQN A;  5CV7 A;  4QJF A;  4A3B B;  1JWU D;  3H8F A;  4R9M A;  5HY6 A;  2ZXP A;  1LFW A;  5C44 G;  2NVX B;  3HOX H;  3D66 A;  2RB7 A;  1TF8 A;  4ME5 A;  1NSL A;  1KNA A;  2EIF A;  4YCU A;  1M1K C;  1EOT A;  5FLM H;  1FNO A;  2F3W A;  2B5G B;  2Q2T A;  1TS3 A;  1XTC D;  2D0P A;  2Q4Y A;  5EBD A;  4X3K A;  4JI6 L;  1SDF A;  5COY A;  4CYO A;  1R4P B;  3FMC A;  5GCN A;  1F2O A;  1HQM C;  2EXD A;  2RHQ B;  4I7Z C;  4A33 A;  1MJ9 A;  4HSP A;  3CDX A;  1GHJ A;  3KK7 A;  3BJU A;  3SK5 A;  2ANP A;  2Z3M A;  1V1P B;  2EOT A;  1MBY A;  4O23 A;  1BDO A;  2PW7 A;  4Y7N B;  3DWQ A;  3K7A B;  3AU7 A;  2PIZ A;  1TII D;  4IN3 A;  1MD2 D;  5F2D A;  3FB3 A;  1EY8 A;  4KOX A;  1R43 A;  1K0R A;  3LWE A;  3I2Z A;  3HEJ A;  2PJ6 A;  5DM6 3;  5IGG A;  4IUR A;  1B2T A;  5M5X H;  2UXD L;  2QIR A;  1S5B D;  3DM3 A;  4POF A;  5K36 H;  2E2D C;  1Z8L A;  3HOU G;  3TTH A;  3G6J B;  3DSB A;  4FF2 A;  1TKF A;  4P4B A;  2IPK D;  3TOB A;  4P72 A;  5IYB G;  2B4B A;  1CX8 A;  2WAQ B;  4DV4 Q;  3I90 A;  5KNB A;  3S16 H;  3B6Y A;  1FNV A;  3K58 A;  4CKC A;  1EYG A;  3M4Y A;  4L5R C;  4LF5 Q;  4YFJ A;  2ZTD A;  2LY7 A;  2JA7 G;  4KOU A;  3TP6 A;  3LX0 A;  3KQZ A;  4K6D A;  4RFB A;  4CKE A;  1BLL E;  1XMO L;  3BU2 A;  4XQJ A;  2B63 H;  2D0O A;  5C82 A;  3LGJ A;  3QOL A;  4PQX A;  3KYH C;  4A3C G;  1ASZ A;  2V1C C;  3VYU A;  1X3P A;  1VQ5 A;  4B10 A;  4DR1 L;  3SJF A;  4GLA C;  2DNE A;  4JBJ A;  4C1N K;  4NXM Q;  3RZD B;  1VIX A;  2A68 C;  3E0J A;  3HGB A;  5EKK A;  1XXG A;  1F2M A;  5EMI A;  2JK8 A;  2NUC A;  2OQ0 A;  1HA6 A;  1TKJ A;  4UCM A;  4EQO A;  3R2T A;  2JBJ A;  4M6I A;  3D68 A;  4KUB A;  5CBA E;  4CGO A;  1K3B C;  3EA6 A;  1STA A;  2JEV A;  4FP5 D;  4R76 A;  3HOX B;  1I1D A;  5TSS A;  1B6B A;  1LTR D;  7CPA A;  3IU2 A;  1C0A A;  4P6Y A;  3BVM A;  4EQN A;  1Y14 B;  2ICI A;  5FO7 B;  2NVQ H;  2WII B;  1HNW Q;  3PP9 A;  1UE5 A;  4KD4 A;  2K01 A;  1PRT B;  4FXK C;  5KTD A;  3GTM B;  2O5I C;  4XIG S;  3ZJY C;  3GTL H;  3QOJ A;  1J6Q A;  4A3F G;  2EDG A;  4DNT B;  2K6A A;  4K5W A;  2M9V A;  1RKN A;  2B2W C;  1RDP D;  1WTO A;  2L11 A;  1Q1B A;  1CK1 A;  3L9A X;  1X12 A;  1X3E A;  4BY1 H;  2K05 A;  2MJ8 A;  5M3F H;  1I4P A;  2ZW5 A;  4UCN A;  3H6M A;  1Q12 A;  1ZXT A;  2KED A;  2LS0 1;  4MIU A;  5M5X B;  2B8F A;  2OR4 A;  3KBG A;  1GO3 E;  3NHH A;  4DUY L;  4LF9 L;  3NE7 A;  2A69 D;  1SYD A;  2BOS A;  2G5D A;  1TS2 A;  4JI0 Q;  1II3 A;  1K83 H;  2BDO A;  3J81 c;  4IFD G;  3K5N A;  1YNJ D;  2LXK A;  2JA5 G;  1VQN A;  2VB2 X;  2F4I A;  1DXM A;  4CDF C;  4DFA A;  5JQ4 A;  2XEG A;  4EQ5 A;  2EJG C;  1BBW A;  3A5U A;  3VAR A;  4AYB E;  5IOC A;  1VQP A;  5IY0 A;  1LUZ A;  1TWF H;  2B63 B;  4JXR A;  3TFY A;  2VZY A;  2Q8T A;  3H91 A;  1Q7Y C;  1B8A A;  1YBY A;  4MMO A;  4A93 G;  1A2Z A;  4JYA Q;  2ZEG A;  4J3G A;  2F3I A;  2E5L L;  1CA6 A;  4R3L A;  2F5I A;  2HC9 A;  3F2C A;  4DR3 Q;  1VQO A;  2V8H A;  4DJL A;  3GTK H;  3F5B A;  2ZEE A;  3CCJ A;  1YNN D;  2ZOF A;  4N9T A;  3N6R A;  4TSS A;  2OTJ A;  3TT2 A;  1OBR A;  2Y0S G;  3JAM L;  4JYW A;  6CPA A;  4CHT B;  3NQI A;  2QF7 A;  3STB C;  4KSI A;  3PEI A;  5CV9 A;  3BJ8 A;  3T53 B;  2FIN B;  3A9L A;  2NZH A;  4RGO S;  2EY2 A;  3M3Y B;  2VEZ A;  4UCP A;  5E4X A;  5C4J H;  1CUK A;  4CGL A;  5KRU A;  3CXC A;  1YEZ A;  2F52 A;  4DPG A;  4RWS C;  2J4X A;  1U6M A;  1ICF B;  2HDM A;  3UE0 A;  4XYQ A;  2B2V A;  3D0F A;  3ZJ0 A;  4A3B G;  2GRE A;  1BCP C;  2Z3P A;  1YHQ A;  1GKH A;  2ZEL A;  3M9B A;  1WOC A;  2EE1 A;  5C5L A;  3HLP A;  1QST A;  2F1M A;  3K5L A;  4E2A A;  3ERS X;  2F0G A;  4BD9 A;  3PB9 X;  3GTL B;  4Y52 H;  2RC4 A;  1QJO A;  1G2S A;  4LAA A;  5HVF A;  2PRQ A;  1IBM Q;  5LMN L;  1IOI A;  1LCP A;  4UIA A;  1V1Q A;  4LJZ C;  1QNU A;  2HIX A;  5D65 A;  1JQG A;  2SNS A;  1OXV A;  2UU9 L;  1M4I A;  1ZYR D;  4X2T A;  2VZA A;  4DR5 Q;  4FXG C;  2NBF A;  3MXN A;  4U67 3;  2J8R A;  4P73 A;  4K3N A;  1XX8 A;  4P44 A;  2Z0S A;  4CAF A;  3W1B A;  4F8Z A;  4I49 A;  3EJI A;  3IRB A;  2WUU A;  3B3W A;  4Y49 C;  4G7Z C;  4AG9 A;  5COR A;  3CHB D;  1VCI A;  4PMB A;  3A7L A;  4KTA A;  1ENC A;  3B2Y A;  1STN A;  1XPU A;  2WP8 J;  4X65 Q;  1GYT A;  5IP9 G;  3W1G A;  4NPS A;  3CCQ A;  4X5K A;  1MSH A;  3GV3 A;  3E6Z X;  3S15 H;  3TQY A;  3OHX C;  4LFB L;  2I79 A;  2HHH L;  3Q8D A;  1LTA D;  2N3S A;  2EYJ A;  4P10 A;  2B39 A;  2Z6K A;  1TWF B;  1L0W A;  2E2J H;  2WAQ G;  3PZJ A;  4R1J A;  4C68 A;  5LYF A;  2J7Z A;  4QF4 A;  3PB6 X;  2VQY A;  2EZV A;  2HQY A;  4LFC L;  4B6Z A;  2XRQ D;  4AVA A;  1WWZ A;  3MXN B;  2VBQ A;  4L5Q A;  1ZLI A;  5LHY 1;  3GTK B;  3MFG A;  4FF4 A;  4P4D A;  3B3S A;  3CXQ A;  4IUN A;  2HD3 A;  1NY4 A;  4L63 B;  4OAE A;  4GOP A;  3I55 A;  2VL1 A;  2ARH A;  4A3M H;  4B3T L;  1B44 D;  2ZEF A;  1QWY A;  4KVX A;  1JWQ A;  1KQS A;  3I4M G;  4GKK Q;  2H1E A;  5EKI A;  3I3G A;  1PH5 A;  1BR9 A;  3FYN A;  2EPB A;  2OTL A;  2FJ2 A;  2PZT A;  4X64 Q;  4DYO A;  1SXT A;  4AVB A;  2ALY B;  1BOB A;  3WOE A;  3NWS A;  1ZEQ X;  4JC0 A;  3MXG A;  5THW A;  3ND8 A;  2BEI A;  5IOD A;  3H0G H;  4PXE A;  1TS4 A;  4OC2 A;  3HOX G;  4RUH A;  4CGN A;  2CW0 C;  1PA6 A;  1S7N A;  4FVM A;  4HNW B;  5FLM G;  2AQ2 B;  4LF8 Q;  2PR8 A;  4UP8 A;  1P4N A;  3KDF B;  4C1N I;  3DDD A;  3AFQ A;  1YZ6 A;  3T13 A;  4C2M B;  2NVT B;  1EWI A;  4PSW A;  1JB3 A;  4L89 A;  1X3Q A;  4F88 A;  4ZK9 B;  1HUN A;  2OWO A;  4XPD C;  3RZO H;  4F7X A;  3W3A A;  5IGF A;  4N8F A;  3LNN A;  4JVZ A;  3V8I A;  3D8G A;  5C0X H;  4UIB A;  2KUM A;  5DS0 A;  4H2K A;  2Q2H A;  3S6H A;  3SHL A;  1PVO A;  2SEB D;  2RSO A;  3SK8 A;  4MCS A;  1ML0 D;  2RDF A;  1BF4 A;  1N33 Q;  1ENF A;  2ABZ A;  2GVB A;  1TU2 B;  2KCT A;  4K8J A;  1VQ6 A;  2R3Z A;  5K36 G;  4G7H C;  3MAQ A;  5M9O A;  3PQI A;  3S15 B;  1STB A;  2VL6 A;  2JP1 A;  1QMU A;  4RI1 A;  1EZ6 A;  5T1I A;  3A56 A;  2ZEP A;  1VQF A;  2E2J B;  3BDL A;  4P4J A;  4B5P B;  2XTI A;  2GU2 A;  4KK7 A;  3S17 B;  2XWB B;  2XEF A;  2RHS B;  4NGS A;  2F0V A;  1HNZ Q;  2E2I H;  4GZY C;  4A3L H;  1YVO A;  3F2U A;  4KOW A;  4HTH A;  4NGR A;  3CCU A;  2XNA C;  1F9P A;  3RO0 A;  4H0L C;  1SND A;  2R7Z H;  4PZ6 A;  2Z3K A;  1FGB D;  2A68 D;  4FF1 A;  2B63 G;  1QUQ B;  3K5O A;  1GUO A;  4CJ2 C;  2OQK A;  5EAY A;  4DUK A;  4YCV A;  4GN3 B;  1H9R A;  1RD9 D;  2MUY A;  2KQ3 A;  3D4R A;  2CQA A;  3CC4 A;  4Z9C B;  1GXD C;  1QVF A;  3S14 H;  3A0J A;  1ARM A;  3K0Y A;  1WD0 A;  4H13 C;  2B2U C;  4ZYS A;  4DV2 L;  1PH2 A;  1H95 A;  4A3K B;  3S6F A;  2B2V C;  4PZ8 A;  2V8V A;  4A31 A;  3UDG A;  2L1B A;  4CJ0 B;  2FT0 A;  1S5F D;  1VF7 A;  4KHP L;  1EY0 A;  1VQG A;  4X62 L;  2XEI A;  1LAC A;  4F87 A;  1G91 A;  4UY8 C;  1J5E Q;  2IHE A;  3RZA A;  1LM0 A;  1OXX K;  3UDX A;  5IT9 c;  3PIP A;  3AMU A;  2DPS A;  3H0G B;  4K5X A;  1PLF A;  3BZD B;  1RJT A;  1GOZ A;  4M1U B;  3KLS A;  4K2K A;  2F4V Q;  2F0N A;  1Z8X A;  4GKJ Q;  5KNC A;  3FXT A;  4A30 A;  1MJE A;  2O4X A;  1KRS A;  3C46 A;  1ELM P;  2PJ8 A;  5GAD C;  4DV3 Q;  2KHI A;  2WSA A;  2GLJ A;  3JAM E;  2L9H A;  2VUM B;  1Q2Y A;  3DM1 A;  4KVM E;  3S2H H;  4HKF A;  3J80 L;  1XPR A;  4LW1 A;  1ZG9 A;  3SJE A;  3HS0 C;  4ZYQ A;  2R93 B;  3RZO B;  4Q5V A;  1K8O A;  1EU4 A;  4XPK A;  2HDL A;  4X3T A;  4Q0F A;  1H9J A;  2F0U A;  1KIX A;  2CH4 A;  4OAD A;  2XRS D;  4A3D H;  3CPW A;  3E5S A;  3D7D A;  3MN8 A;  3SJX A;  1HJP A;  3IJ3 A;  5M3F G;  2WFW A;  4MRI A;  4ZLT F;  1N32 L;  3J7Y W;  5C5M A;  1BBX C;  1RCV D;  1SJE D;  2AJ6 A;  1CPS A;  3S1R H;  5M3M H;  1XMQ L;  1B53 A;  3MEF A;  4JBW A;  3R3O A;  4ZAI A;  3EVQ A;  2WKD A;  1Y8N B;  1HH2 P;  4C3J H;  2IMO A;  1XNQ Q;  4G7O C;  4PK2 A;  2E2I B;  5JM6 A;  4JV5 L;  3BDO A;  3AB9 A;  4IPD A;  1WD1 A;  1FNW A;  4GOP C;  2R7Z B;  3CPX A;  3U9S A;  1PZK D;  5EBV A;  2FVG A;  1IOF A;  2Q2U A;  1KUV A;  2YYZ A;  4YHH Q;  3S1N H;  4GXH A;  3NSW A;  3NK9 A;  3A54 A;  3NTI A;  3RR5 A;  3S14 B;  5JJK A;  3E0E A;  4KJN A;  5BWA B;  3C1F A;  3STB D;  1H9M A;  1M44 A;  2Z6B A;  4H89 A;  1D5M C;  2CWP A;  1S3O A;  2K5V A;  1ILP A;  4DK6 C;  5CV5 A;  1F2Y A;  1IBL L;  4L5T A;  3PV0 A;  2L55 A;  1G2T A;  1RXT A;  2C27 A;  1N8R C;  5IGD A;  5JAV A;  5K8O A;  3HZX A;  2CXA A;  1JR0 D;  2JEB I;  4KY7 A;  3HOW H;  1KHI A;  1I12 A;  2FFK B;  4KMU C;  5AJ3 L;  3UI2 A;  3PO2 B;  1BCP D;  4JI1 Q;  3IWW A;  2ZTC A;  1HNX L;  1FJG L;  2ZEH A;  4R57 A;  1QCB D;  4ZBG A;  1I4X A;  5I6Y A;  1NCV A;  5ELB A;  4RH6 A;  1EYD A;  5G3L D;  3RD4 A;  4NXN L;  2BA1 A;  4JI3 L;  4X66 Q;  2FS5 A;  4DGZ A;  4R87 A;  1G6Z A;  5G22 A;  4KHZ A;  2UUB L;  3QIA A;  3CRL C;  2AUK A;  4R8I A;  3M85 A;  3S2H B;  4B3M Q;  1S60 A;  4TVA B;  1Y9W A;  2EO8 A;  2PJ7 A;  4PPZ A;  4ID6 A;  5DEH A;  1SE2 A;  1LOK A;  1ZLH A;  2REF A;  3FH4 A;  1VQH A;  1DZ1 A;  4UF4 A;  4AQY L;  3W6X A;  4DA2 A;  2RQX A;  3M4P A;  3UE1 A;  4ABN A;  5CV6 A;  4K6L A;  4MTN A;  1T9H A;  1OO9 B;  1XNR L;  3EFA A;  2B3U A;  3RYO A;  4NJQ A;  4A3D B;  2DUD A;  2PJ0 A;  2ENB A;  3TP8 A;  3MGD A;  5I2Y A;  1HTL D;  3CC7 A;  3MXP A;  4L8J A;  4Z65 A;  2FSR A;  1SNM A;  3NBI A;  4IOA A;  1BCP F;  3QJY A;  4PXB A;  4UWJ A;  1A0I A;  1DM0 B;  1BXT A;  4JBK A;  1TWC H;  4MHP A;  4MFQ A;  3HKZ B;  5IGC A;  1YX0 A;  3S1R B;  2FIA A;  5G3L F;  2G3T A;  2YNE A;  1M1D A;  2WIN B;  2OOT A;  1LT4 D;  1AMP A;  4BIN A;  3B7I A;  4ZY2 A;  3J7A V;  5M5Y H;  3QR8 A;  2WB1 E;  4MY0 A;  3MVV A;  2CIJ A;  3T1H L;  5I0C A;  5G1Z A;  2MFI A;  4GLV B;  3CCM A;  4C3J B;  4B5O A;  4H6U A;  2QCP X;  1Q2D A;  3I1U A;  5IP7 H;  4XDX A;  4J15 A;  4P4I A;  3NUC A;  4DNC A;  1Q86 C;  1JE5 A;  3NFZ A;  3LOD A;  5FJ8 H;  2JXM B;  5GQO A;  1Q7L A;  1B9M A;  1L1O C;  3MEH A;  3I4L A;  2F0J A;  4OC5 A;  3S1N B;  1SE3 A;  1STE A;  5AFW A;  4OIW A;  4HNX B;  1K8M A;  1XMT A;  3SK4 A;  2FCK A;  1F2L A;  2K75 A;  4HIO A;  5ISV A;  1N36 L;  2DF5 A;  4QCL A;  1JWM D;  1OTC A;  3S9N A;  1GJX A;  2ICE C;  1B3Q A;  1EIG A;  3GTP H;  3TO9 A;  4CYN A;  2PW5 A;  1E1O A;  2PQA A;  2V8G A;  4HJ8 A;  4NW2 A;  3M7N A;  5E7N A;  2CWA A;  1YJW A;  3G71 A;  3IWE A;  5ELY A;  2N78 A;  5JEA J;  2OZU A;  2IWH A;  3HOW B;  3BVG A;  1JWS D;  3GY9 A;  4OC0 A;  1VS0 A;  3DR6 A;  4A3K G;  1KL9 A;  1KZF A;  3JC6 6;  4CAV A;  1QQ9 A;  3FBU A;  2OXP A;  3L2P A;  1DON A;  1OXT A;  4K0K Q;  1N9W A;  1I4H A;  1ONL A;  2EYM A;  4YY3 L;  4EGV A;  3H0G G;  2R7F A;  4HJ5 A;  3IWG A;  1TKW B;  2RCN A;  2ASB A;  1Y9K A;  3D3S A;  3GUX A;  5FLX E;  4II9 A;  4RGT A;  1TF9 A;  1YIJ A;  1AUG A;  4QUC A;  4DV1 Q;  2VZZ A;  5LYL A;  1G29 1;  1H8L A;  2CTB A;  4B12 A;  1SN8 A;  1H9S B;  3KHZ A;  2MGS A;  2HQE A;  3NBH B;  1IL8 A;  3KJO A;  1K8G A;  4QUF A;  4YRH A;  2VUM G;  5AG4 A;  4RN7 A;  2B4D A;  4JI8 Q;  2EVN A;  4I7A A;  1QNK A;  2BH2 A;  4BA2 I;  1YHB A;  2R93 G;  3BZK A;  3EQL C;  4U68 A;  5A2Q L;  1TWC B;  1BQQ T;  1EIH A;  1I6H H;  5J8F A;  3A7A B;  3NE8 A;  5EPJ A;  2RKS A;  1YLO A;  5C0X G;  1M4G A;  1WTW A;  4OLL A;  3K5M A;  2B58 A;  3BDC A;  4ONU A;  4UA3 A;  1YRE A;  1EOV A;  5M5Y B;  2PVV A;  1Q8I A;  3RN5 A;  2JJQ A;  4QC6 A;  3SJG A;  4IFD J;  4BBH A;  3K59 A;  1MIU A;  4OON A;  3VR5 A;  1HUM A;  2PJB A;  5E3F A;  2CVR A;  5HVH A;  4DV0 L;  4G4K A;  2RVL A;  2B3G A;  3NA6 A;  1MI2 A;  2YND A;  4ORF A;  4NF1 A;  4CAE A;  1HRJ A;  2JA6 H;  4XNH C;  2D4O A;  1A62 A;  2F0L A;  1EEI D;  1L0X B;  2LKV A;  4JI2 Q;  4A3L G;  1PYS B;  2R98 A;  2MO0 A;  1EUJ A;  1QE6 A;  3A74 A;  2GN5 A;  2R7Z G;  1FVI A;  5ELN A;  2JA9 A;  4JI6 Q;  2IY5 B;  4CS0 B;  3CPA A;  1DE4 C;  1E2W A;  2A1A A;  1NTG A;  2NMT A;  5IGB A;  2L12 A;  2OZH A;  3JAM i;  1KRT A;  1K3R A;  3TP5 A;  2GVA A;  1XMB A;  5J22 A;  4PV6 A;  4PG3 A;  4MI4 A;  1PU9 A;  3FPP A;  2PQ8 A;  2PNR C;  2IJZ A;  2ZM6 L;  3PO3 H;  2PPB C;  5JJL A;  3NWT A;  2Q8I B;  4DNI A;  2AFW A;  4EQP A;  4RKB A;  4G57 A;  1HFG A;  2UXD Q;  2CQO A;  1EY5 A;  3PO2 G;  1QZG A;  3HOZ H;  3TX8 A;  2QW7 A;  1X65 A;  4FUU A;  5IIF A;  3S9M A;  1EWH A;  3NQT A;  2ZOG A;  1MJB A;  3BXM A;  3P2H A;  3GQB A;  3MZ5 A;  1L0C A;  4RAU C;  5LRJ A;  4R4T A;  1XPO A;  1BCP B;  4JOI A;  4OXP A;  4R3K A;  4FWU A;  4A32 A;  4F9U A;  2Q0Y A;  4OC1 A;  4FAI A;  1PCA A;  5CR3 A;  3B8G A;  1SNO A;  4KOT A;  2F7V A;  3SI1 A;  1BO0 A;  4IUV A;  4DV4 L;  1IKM A;  4CPA A;  1I4Q A;  5LL6 X;  1TIQ A;  3ULJ A;  1NE3 A;  1IW7 C;  3I4M B;  1IXR A;  2QDB A;  3VR2 A;  4KOR A;  2QEX A;  4OX9 Q;  3M4Q A;  4UP7 A;  4A3D G;  1KDC A;  1PH9 A;  2J0T D;  3PGZ A;  4IPC A;  1VQC A;  3GTJ B;  2PJ5 A;  1EU3 A;  4PV1 C;  1O7L A;  5ELO A;  3WAB A;  3X3N A;  2Q51 A;  4JI5 L;  1O7Z A;  3HKZ G;  4Y49 B;  5T1G A;  3MXU A;  4YWK A;  1O7I A;  3ER0 A;  5BR8 L;  5CPA A;  4P45 A;  4NXM L;  1FR3 A;  1CQV A;  2DY7 A;  4IUT A;  4LFA Q;  3GTO H;  4BS9 A;  1A8V A;  2XSC A;  4C3J G;  4LMQ D;  3NXW A;  3QAY A;  4KOY A;  4IJL A;  3UDI A;  3T51 B;  4MN3 A;  3WOF A;  5AG5 A;  4R4I A;  1UEB A;  3DXJ C;  3RNU A;  1HEE A;  4AB7 A;  4DAM A;  5JGF A;  2LXJ A;  4DK3 C;  5A35 A;  1QZH A;  1YME A;  4M8A A;  1RHP A;  3CC2 A;  1XWE A;  2AWN A;  3IFE A;  1HNW L;  3SVM A;  4B3S L;  3PO3 B;  2WB1 B;  3J81 L;  5JVH 3;  5D14 A;  4OWT B;  2K03 A;  5KND A;  1AE3 A;  1XTD A;  4IO9 A;  2JLM A;  2DEA A;  4R8F A;  4L8A A;  3HOW G;  1N34 L;  1PTO C;  1CG2 A;  1AZQ A;  2ZT9 C;  1PH8 A;  1W6K A;  4DUY Q;  4B3R Q;  2A6E C;  2P6G A;  3OOC A;  2C5C A;  3CME A;  3S16 B;  4MZ9 A;  2IL4 A;  1LRZ A;  4WOR A;  3DWP A;  4FD4 A;  1RIP A;  4DR2 L;  3W5O A;  1O78 A;  2AFZ A;  3T8W A;  3V38 A;  1XIX A;  5D8N A;  2CNM A;  4YGO A;  1HZ9 A;  3FEE A;  4KV6 A;  2HB6 A;  4Q36 A;  4A4I A;  1STG A;  5KYI A;  3TRE A;  2PR1 A;  3PF5 A;  3GKR A;  3R95 A;  4IUU A;  3A8K E;  1AZP A;  1WCM H;  2I5L X;  2ZJQ A;  5C4H A;  3MC0 B;  1I21 A;  1I4R A;  2AUJ D;  3VYS A;  3TDQ A;  2ZJR A;  3K9T A;  1RTQ A;  1VQ4 A;  2PO4 A;  5D3D A;  2GE3 A;  4E0A A;  2EYH A;  4B11 A;  5FOB B;  5IWA L;  1TQO A;  2CH4 W;  1B1Z A;  2I5H A;  2BSW A;  4KKT A;  1CP6 A;  4MCR A;  3CXP A;  1XEB A;  1UUP A;  4S3S A;  1AFP A;  2Z3N A;  2PVW A;  1BVS A;  3GTO B;  1MJA A;  2KCW A;  4LF4 Q;  2B2U A;  2PJ4 A;  4DAY A;  2DXQ A;  5ISR A;  5BN5 A;  4GN5 A;  4QIW B;  2NVQ B;  4NGM A;  1G6P A;  1VQB A;  5FJ8 G;  4LWC A;  1J8I A;  1Z5R A;  3H09 A;  5J3B A;  3DUZ A;  1Q8K A;  4B13 A;  3WT4 A;  3KGQ A;  2PJ1 A;  2G9H D;  4NGT A;  4YU9 A;  3FVQ A;  4OEM B;  5LMN Q;  3WC5 A;  3JAM c;  4BY1 B;  1LLR D;  4LUA A;  1CZG A;  5M3F B;  2RCF A;  3ITP A;  4NMZ A;  1A2T A;  2YV5 A;  3GP7 A;  2B3V A;  4OME A;  3EFX D;  4DNR B;  1BNZ A;  4ZX8 A;  2POK A;  3KLS X;  1QSM A;  1GUS A;  3N5F A;  4DAY B;  5IGE A;  3VR6 A;  1ENA A;  2BO9 A;  5C3E H;  4IOC A;  4K8I A;  4JOI C;  3I4N H;  4MXU A;  4DUZ L;  1K83 B;  1JJG A;  4H6Z A;  3FEW X;  1X54 A;  1VQL A;  3GTG H;  1QIL A;  4DXG A;  5JH9 A;  4DR5 L;  4ONW A;  5I4D A;  2I3C A;  4U5Y A;  1JJC B;  1AEX A;  1G8Z D;  3T90 A;  1IBK L;  1VQD A;  3RN2 A;  5F49 A;  4JLY A;  2K04 A;  3FKI H;  5IE8 A;  4EFD A;  5LRG A;  1QVG A;  3R9E A;  4KKU A;  1EY9 A;  4X3R A;  3D8P A;  2HHH Q;  2PIY A;  3AQQ A;  2WYR A;  2GFQ A;  2AKW B;  1E2Z A;  2V8D A;  1NR2 A;  1UE6 A;  1YW4 A;  3F8K A;  3S2D H;  3B3V A;  2IJ0 A;  1SMY D;  4P74 A;  1M4L A;  1S4Z A;  1YW6 A;  2I0Q A;  4X65 L;  1VQ7 A;  2ES2 A;  2SOB A;  4CRY B;  1D1K A;  1GHE A;  2CHB D;  2MHV A;  1CSQ A;  2RSN A;  1JOR A;  3RNZ A;  1M4D A;  5BN4 A;  3PIO A;  4UFV A;  3NTH A;  1TWH H;  1WYD A;  3OYY A;  1IZ6 A;  4AXV A;  4MTK A;  3WDN A;  3KR4 A;  1QB5 D;  5C4J B;  5LRK A;  1N71 A;  3IFT A;  4HJ9 A;  1A2U A;  1EEF D;  4YWL A;  2VQE L;  4RS2 A;  3BVZ A;  3I3C A;  3K81 C;  1NAP A;  1GUG A;  1K0S A;  4AG7 A;  3FDT A;  2PZU A;  3T9Y A;  2BE5 C;  4X8I A;  4KSA A;  1SJH D;  3CCV A;  5EQ0 A;  1Z47 A;  2O53 A;  4FO2 A;  1CSP A;  4FD6 A;  4GN4 B;  1JJ2 A;  1RTN A;  1CP7 A;  4A3J H;  2YNC C;  4CDD C;  2JA6 G;  4NEX A;  4U9Y A;  4X64 L;  1Y7E A;  1CKN A;  1VMP A;  1SRO A;  1GHK A;  4GOP B;  2F0K A;  5F46 A;  5E96 A;  1TR5 A;  3I91 A;  1PYT B;  4OGQ C;  4IPH A;  4A94 A;  4KKS A;  4KN7 C;  2NTS A;  4RGM A;  4LF8 L;  3EY5 A;  2X6L A;  2IT1 A;  1LTG D;  1IYL A;  5CGK A;  4JI4 L;  3CZX A;  5C3E B;  4TKO B;  3K7U C;  1X9N A;  2KVM A;  3ULL A;  3PO3 G;  3H3V C;  3GTG B;  1VHO A;  3PB4 X;  3PBE A;  2WB1 G;  4MFZ A;  2ZXR A;  1LT5 D;  2X6G A;  2QDL A;  4DV6 Q;  1VGY A;  5KTA A;  4NB3 A;  3SI0 A;  4KOV A;  1SEB D;  2BL1 A;  1DJR D;  2Q4V A;  2PDO A;  1VHS A;  1CHP D;  1U4P A;  3RAM A;  4WWV A;  4R8N A;  2EWB A;  2L5T A;  5D29 A;  4UEF A;  3HOZ G;  2I46 A;  1Y1W H;  2HUZ A;  1JE4 A;  1Y1V H;  4GNX A;  3EBE A;  1T5E A;  8CPA A;  2Q7B A;  3RMH A;  2A74 C;  4KSF A;  4F6A A;  5I2X A;  3F2D A;  1IHZ A;  3WR7 A;  1IW7 D;  4A76 A;  2D62 A;  1J9O A;  1K73 C;  4OID A;  3B35 A;  3T1Y L;  3HOV H;  1SYG A;  3OIQ A;  4KY6 A;  5C0X I;  2PNH A;  3U4V A;  3W2D A;  4A3M B;  2H5X A;  1FYC A;  2IX0 A;  5HUR A;  1LAP A;  1V0C A;  3OTO L;  1P0H A;  1S5E D;  5IT9 L;  1TWH B;  3FHW A;  1VQE A;  1HZB A;  1YQE A;  3KQX A;  4FDB A;  4H44 C;  1HNZ L;  3V05 A;  1L1O A;  1I50 H;  2EYO A;  4DV2 Q;  1HTP A;  2WAC A;  4KJO A;  4ME3 A;  1IIC A;  2F0M A;  3PUZ A;  5HVG A;  1XBU A;  4PK3 A;  1CM0 A;  3CCS A;  3PUW A;  4KHP Q;  3NE5 B;  4X62 Q;  4GM5 A;  1QSN A;  1VKC A;  3RLO A;  2AHO B;  4Q38 A;  4DXF A;  4RCO A;  4AYB B;  4CYP A;  2E2H H;  1W6J A;  5IB9 A;  5ELE A;  4FBE A;  1YVK A;  3ISZ A;  4UAI A;  2KBN A;  1MGS A;  2P6E A;  4OKO A;  3IKJ A;  1GVP A;  2K33 A;  5LMN W;  3NP8 A;  1SYB A;  4A75 A;  4WJ3 M;  1I4G A;  2I07 B;  1F9R A;  2K5Q A;  2PQE A;  4NCZ A;  2O4H A;  2EY5 A;  4B9X A;  1L1O B;  4JI7 L;  3KI9 A;  5FLX c;  1WVL A;  2BH8 A;  3I73 A;  4QL5 A;  2F4V L;  2I00 A;  2AE6 A;  1V9P A;  2PSW A;  4GKJ L;  1O80 A;  4E6I A;  3VYT A;  1X55 A;  4CJ1 B;  3W91 A;  1C4Q A;  1Q1E A;  5J39 A;  4DV3 L;  3L2N A;  3K2K A;  2ZJP A;  4BY1 G;  2JA7 H;  1PTO D;  2NYZ D;  3IIB A;  2K4K A;  1EY7 A;  4CAX A;  3CD6 A;  2F3V A;  2A6E D;  1LAN A;  3HOY H;  2F0E A;  3OIP A;  3DLJ A;  1K28 A;  4RA8 A;  5KTC A;  3TOA A;  1JIC A;  4HMI A;  4QB4 A;  2B29 A;  4BWG B;  4Q7A A;  2PI2 A;  5LMU L;  4OIJ A;  4MFP A;  2JSO A;  4A39 A;  1E24 A;  3CRK C;  4A37 A;  3F8T A;  2K5W A;  1Y1W B;  1XMQ Q;  4LQ6 A;  1Y1V B;  1B50 A;  3PF4 A;  2NN6 H;  1HR0 L;  3QG1 A;  1TY2 A;  1C8C A;  4OL7 A;  2JYO A;  1DD2 A;  3PB8 X;  3J7A 5;  2J8M A;  4JD6 A;  3FEC A;  4JV5 Q;  1VQA A;  1DCZ A;  1Z8T A;  1ROD A;  4OEL B;  4OC3 A;  3HOV B;  3VYR A;  4ZI6 A;  2ODF A;  5JEA H;  2R1I A;  2AQ1 B;  3VR3 A;  4DV7 Q;  1PTO F;  1AN8 A;  1BKB A;  1NMT A;  1XNQ L;  3D2M A;  2VNU D;  1S5D D;  1I50 B;  3A55 A;  3FF3 A;  4PXD A;  1JOQ A;  1A63 A;  2B8G A;  3SDZ A;  5J8C A;  3QNV A;  1PH1 A;  4K2L A;  2M2L A;  3SEB A;  4DV5 Q;  2FXQ A;  2QIL A;  2WAQ E;  1B87 A;  4B14 A;  2UUC L;  2V77 A;  3C2P A;  4EME A;  4ZUI A;  3DEO A;  3L3O C;  4YWM A;  2JDC A;  4K30 A;  2NN6 I;  3ISX A;  3LMS A;  1EQV A;  3F2B A;  2VQF Q;  3S1Q H;  1Y8O B;  1HNX Q;  1WFQ A;  3EN2 A;  5FO9 B;  2PJ3 A;  1U4M A;  1KWM A;  2R7H A;  4PSX A;  4I65 A;  1I5F A;  2O28 A;  2K14 A;  5H84 A;  4NXN Q;  1W3S A;  5M5W H;  2UUB Q;  4NGP A;  2V4D A;  1YI2 A;  5E4W C;  1ZO0 A;  4C2X A;  4C7H A;  2OT2 A;  3JTK A;  4KD3 A;  1O7Y A;  1U5K A;  3DR8 A;  2K28 A;  2YTX A;  2J9A A;  4BA1 I;  1X32 A;  1AE2 A;  1I3Q H;  3JUW A;  5EBC A;  2NZO A;  5GRO A;  4B08 A;  3IGR A;  3K80 C;  3CP0 A;  2JEA I;  1XNR Q;  3KOJ A;  2A69 C;  4P75 A;  1CTM A;  4C56 C;  3HOY B;  2XWJ B;  4MHY A;  3OMG A;  1EE3 P;  1KUX A;  1EQQ A;  4KN4 C;  4GLX A;  4NKL A;  2RFH A;  3B3C A;  3F0A A;  5NUC A;  4LF6 Q;  4GNX C;  3FIX A;  5G20 A;  2OH1 A;  4ZKC B;  1KC8 C;  1YNJ C;  4M85 A;  4MHD A;  4ZGY B;  1EWC A;  2Q43 A;  5M3M B;  4KS9 A;  5HGT A;  5EGT A;  2PMZ E;  5C3E G;  3I4N G;  3PB7 X;  1FY7 A;  4YWY A;  1OXS C;  4DR6 L;  1XOV A;  4OO1 H;  5AG7 A;  1EFI D;  3Q22 A;  5JOB A;  5I6W A;  2UXB Q;  4KVO E;  4H02 A;  2EYL A;  2B2Y A;  4IJH A;  5J1Z A;  1VQ9 A;  2CCZ A;  1PTO H;  3OW2 A;  2EQS A;  5DM7 3;  1VHE A;  3S6K A;  4LF7 L;  1F2Z A;  1ASY A;  2UUA L;  3OWF A;  2K52 A;  1PHJ A;  5JJI A;  3T56 B;  3KUP A;  1UE1 A;  2KCN A;  2FL4 A;  1Q3L A;  3SE0 A;  2B2T C;  2QYV A;  1D7Q A;  3J81 j;  1AP0 A;  2P0W A;  5C6A A;  1N36 Q;  1DYQ A;  2DNC A;  1GUT A;  1ET6 A;  1UEA B;  3IC1 A;  1D6E C;  3V96 A;  1AH9 A;  1IYV A;  3KFU A;  4A3M G;  4C3I H;  1AYE A;  2E74 C;  3BZC A;  4V0B A;  2A5H A;  2FHT A;  5BN3 A;  3J7Z C;  4KHV A;  2Q04 A;  1JMC A;  3C3L A;  4OO1 I;  2BE5 D;  2AFM A;  3KHX A;  2H4O A;  5HGQ A;  2A19 A;  1CFM A;  4HED A;  2K5N A;  1V1O A;  2CW0 D;  2F8H A;  1MSG A;  2EJF C;  1UAP A;  2F0D A;  2JN4 A;  1Z8W A;  5D3I B;  1GM5 A;  1ZKO A;  5CNP A;  3G7L A;  1SQH A;  5JVG 3;  2JEW A;  4QY7 A;  5JPH A;  4QBJ A;  4AYB G;  4IQZ A;  4RGN A;  3EC4 A;  2AFS A;  4KOS A;  2D9U A;  4Y7N H;  4M3S A;  2G0B A;  2PQA B;  1WJJ A;  1HA5 A;  1ZYR C;  3I4O A;  3D7H A;  5KIX A;  2ZTE A;  1IYU A;  4RCN A;  4K0K L;  2Z3O A;  1PMR A;  1D5X C;  2ZEN A;  2VY3 A;  4DK1 A;  4NJR A;  3CCR A;  1B9N A;  2FMM A;  1BPM A;  4TQU S;  2RF4 A;  1YHA A;  1Q81 C;  1SSO A;  4P2C B;  2R92 H;  4ZY1 A;  3D4D A;  1WTP A;  1KTK A;  1S5C D;  2DJG C;  3CKI B;  5ELC A;  1TT2 A;  3RLN A;  4DV1 L;  1LV9 A;  1PFM A;  4DR4 Q;  3CW2 C;  1KXL A;  1A6X A;  3H4Q A;  3AFP A;  5K8P A;  3AYH B;  5CV4 A;  1PYW D;  1A3U A;  3I72 A;  2JDD A;  4ZUJ A;  3J80 E;  1L2F A;  5GAH C;  1I94 Q;  3SHP A;  1S72 A;  4DR7 Q;  2B5G A;  2K32 A;  3ICE A;  1NJI C;  1PTO B;  4HSV A;  1NSA A;  4UBR A;  1PDQ A;  3NH5 A;  3S1M H;  4BXX H;  2Z0Z A;  1U9R A;  1Y1W G;  1ELL P;  2B4D B;  1Y1V G;  3D31 A;  4PMC A;  1D8L A;  1Z6H A;  1LYL A;  2UXC L;  4V19 0;  2CNT A;  2CFM A;  1TXR A;  3OWE B;  2DY8 A;  3DWA A;  1V1P A;  2F0H A;  1WTV A;  2AFU A;  2NSM A;  2EYF A;  3GTP B;  2GA4 B;  1TVX A;  1S40 A;  2KJX A;  3RUZ A;  5JPN C;  3CXS A;  3HOV G;  4L5S A;  2RDH A;  3HUV A;  4C3I B;  3VWE A;  1D5Z C;  4NDX A;  3R9F A;  2ZPA A;  2WPX A;  2N55 A;  3I70 A;  3DMU A;  4JI2 L;  2BCO A;  3IO1 A;  1E2V A;  3ND9 A;  4RHR A;  4DU9 A;  3BI1 A;  4CYQ A;  2A6H C;  2KCC A;  2ZM6 Q;  2EY6 A;  1EIY B;  4MHN A;  2Z10 A;  4J8Q A;  5A27 A;  1NSN S;  4O1N A;  3GTM H;  1CBX A;  1ZG8 A;  3MA2 B;  4MCP A;  2REE A;  1XE4 A;  3GB0 A;  3OPO A;  3KR5 A;  4C2Y A;  3SI2 A;  5IYD H;  2D4P A;  4HCS A;  1KAA A;  2R61 A;  1HQR D;  4RG1 A;  3PIP 3;  1Y0Y A;  2EXZ A;  3FRM A;  4BBS H;  2Q2I A;  3P7J A;  3FPU B;  3T16 A;  1ON0 A;  3NEM A;  1XMO Q;  4MFL A;  2C1C A;  2MP1 A;  2OF1 A;  4MFK A;  1T5X D;  3GLJ A;  2R92 B;  1IKL A;  3CCE A;  4MNO A;  1I6H B;  4WJW A;  4TWE A;  4LF5 L;  4DR1 Q;  1SLJ A;  4WJB A;  1UWV A;  1QG7 A;  1SNC A;  2B2Y C;  2O2L D;  1YVC A;  1FGU A;  1UNS A;  1CM9 A;  2A4N A;  3NEL A;  3HOY G;  2VXW A;  1H9K A;  1C9O A;  2EY1 A;  2PCF B;  4ILW A;  1WTH A;  1SR3 A;  3NTK A;  2D5D A;  4WFN 3;  3K8A A;  2VI7 A;  5I9O A;  5M3M G;  4JI5 Q;  2HQL A;  1EZ8 A;  5BR8 Q;  3S1M B;  4R7M A;  4XTC S;  4OX9 L;  2JA6 B;  3H3V H;  3WC7 A;  4YIJ A;  4PQA A;  4MCQ A;  1YK3 A;  2NN6 G; 
#chains in the Genus database with same CATH homology
 5EPK A;  2XIW A;  1HDQ A;  3D67 A;  3MWY W;  3R93 A;  3RBU A;  5JEA G;  4J6H A;  1KDA A;  1RF2 D;  2WV6 D;  1UWY A;  2AFO A;  1BAV A;  2RDG A;  1EY6 A;  1DOL A;  1XFO A;  2TMP A;  1SE4 A;  4KI0 A;  3TBI B;  4B9W A;  2PMZ B;  1XYI A;  3Q24 A;  2F0O A;  2F0P A;  3M7G A;  1WTQ A;  2ZED A;  1IGB A;  4XQQ A;  3QO2 A;  3PUY A;  1V43 A;  4UEZ A;  3HOZ B;  1AW7 A;  3KF8 A;  3NPP A;  1B4O A;  1F77 A;  4MHE A;  4BBS B;  3D4U A;  3VH9 A;  1KLG D;  3TZU A;  3NH8 A;  1Y69 U;  3R8B A;  3R2I A;  1B3A A;  1U4R A;  4ZX9 A;  2EVB A;  1GUN A;  2F0S A;  2PYK A;  3BI0 A;  4XYO A;  2PE3 A;  3A8J E;  2DN8 A;  1LT6 D;  1CPX A;  2GLF A;  1WTR A;  1OXU A;  4H7B A;  4OIK A;  5CMD A;  1ZG7 A;  5JPM C;  3BS1 A;  1IY7 A;  5K8N A;  5C3W A;  1A15 A;  2HUG A;  2F0T A;  4OO1 G;  1HPC A;  4HN7 A;  2NVY B;  4MHZ A;  2ZEO A;  1YSJ A;  3A8I E;  5A2Q E;  2BOA A;  2ZXO A;  1C48 A;  3TP7 A;  1TS5 A;  3CU7 A;  4C3H B;  4K5V A;  3H8E A;  2F0Q A;  1EY4 A;  4A38 A;  3DGV A;  4UEE A;  4G1P A;  3FX6 A;  4OHJ A;  2O5J C;  1HCZ A;  1FT7 A;  1ET9 A;  4C3I G;  3X3M A;  3ZYY X;  2IX3 A;  2Q8R E;  3MTS A;  3LWU A;  1LTB D;  2XVS A;  1KDB A;  2YU9 B;  5CYU A;  1XRY A;  5ELF A;  3FVL A;  2E75 C;  1BUV T;  3TC8 A;  3N52 A;  4R6T A;  1SYC A;  2ID0 A;  3S9L A;  1TWA B;  1CA5 A;  1PFN A;  4BY7 B;  3SXH A;  3L7Z C;  2K1B A;  1WTX A;  2NWG A;  4HR7 B;  5K5P A;  1WCM B;  3IAY A;  1Z7T A;  4OP4 A;  4IZ8 A;  3VA7 A;  5J1Q A;  3PUV A;  1F2P A;  3VR4 A;  3PFO A;  4F9V A;  5LYI A;  3Q0A A;  2KEC A;  4PXC A;  2AWO A;  3FED A;  1XJO A;  5KYL A;  1F9Q A;  1LTI D;  1PRT C;  3KZW A;  3S9W A;  2PJ9 A;  2XN9 C;  2Z1C A;  3BG3 A;  4BBR B;  5LYD A;  1EYC A;  2PZW A;  3P1H A;  5EJW A;  3P20 A;  2CTC A;  1NUC A;  3C1E A;  1A3T A;  4XT1 B;  1SYE A;  3VA5 A;  4ODG A;  1QOH A;  2KEE A;  2ZEM A;  5DNF A;  4IUP A;  4O42 A;  2OEO A;  5DAU A;  4DAP A;  2IX1 A;  3URY A;  1PXU A;  1D1I A;  4F8M A;  3KLR A;  1Q90 A;  4ULL A;  2A6H D;  4FNF A;  5I4M A;  1VMC A;  2LMC B;  1TKH A;  4NFR A;  1M8A A;  1HHV A;  1BPN A;  5F09 A;  3I4N B;  2HCC A;  4A3G B;  3VAT A;  4IUQ A;  1CI3 M;  1TWG B;  3ERQ A;  2C9O A;  5EPL A;  4IAV A;  3PFE A;  2FMC A;  1ESF A;  3FKI B;  1DOM A;  3MHB A;  2C6G A;  1JC7 A;  1KNE A;  4RHS A;  3TN2 A;  4LK1 C;  3GV6 A;  2Z4H A;  4HMJ A;  4W9Y A;  3U9O A;  3S2D B;  5HXD A;  2K5D A;  4RKL A;  3J81 E;  4CGY B;  3PBB A;  2G9D A;  2Q4Z A;  2IQ6 A;  4NGQ A;  1EQT A;  4P4F A;  2HCI A;  2PJC A;  3NH4 A;  4ZY0 A;  4A3I B;  5LL6 S;  4WRD A;  5CBE E;  4JZ0 A;  3SK6 A;  2A73 B;  5KEE A;  3KAS A;  1LO5 D;  2SNM A;  3GO5 A;  2QKI C;  1DTD A;  5CBM A;  2EK9 A;  2B2T A;  1STH A;  4P4E A;  2NTT A;  4KY5 A;  1L0Y B;  1U4L A;  4DN4 M;  4JK1 C;  1VDZ A;  5FLX L;  3OMC A;  1Y8P B;  4A3J B;  2VB3 X;  2RA4 A;  3TZD A;  3MRU A;  4FF3 A;  3GTQ B;  1VF5 C;  3DEP A;  3H8G A;  2X69 A;  1EL0 A;  1KAB A;  2SDF A;  2L0C A;  4C3H G;  5C3X A;  1TY0 A;  2E76 C;  3P75 A;  3BHX A;  2JA8 B;  2QEJ C;  3HG9 A;  4PMW A;  3HP3 A;  4IK2 A;  4LQG A;  2KA7 A;  3FRP B;  3WC6 A;  2M00 A;  1F57 A;  3MFY A;  1CT1 D;  1CZW A;  4TNU A;  3D7F A;  4R9W A;  3D6C A;  5C4X B;  2JBK A;  1CQF A;  3QWN A;  1Y0R A;  2PJ2 A;  4A3E B;  3JRU A;  4EVO A;  4TRD A;  4ZQ3 A;  5C44 B;  2BDN A;  4HAE A;  4K14 A;  3D7G A;  1FD7 D;  5C0X J;  1D2B A;  2F0W A;  1ESR A;  4DF7 A;  3T4A C;  3IFD A;  3Q23 A;  2C6C A;  2KHS A;  4FXD A;  2EJM A;  2TSS A;  3Q6S A;  5EKL A;  2QJ8 A;  1SYF A;  2E2H B;  1JQY D;  5FK9 C;  5FKA C;  2QVP A;  1R9T B;  1HFN A;  3CT9 A;  4CKB A;  3RLF A;  3I8Z A;  3TSS A;  2XEJ A;  1FNU A;  1LAB A;  4CBV A;  3HOU B;  3IEH A;  1BOS A;  3PMF A;  2C6P A;  3IL8 A;  5JJZ A;  1I6V C;  3K6O A;  4IFD H;  3OSO A;  4OC4 A;  3J7A F;  2JA7 B;  1LTS D;  2JE6 I;  1M4V A;  2IW3 A;  1R3N A;  5E1F A;  4XT3 B;  2F0F A;  5I9P A;  1GUW A;  2CF4 A;  4X3S A;  1LTT D;  5K8M A;  1JOK A;  2LFN A;  2NYQ A;  1ARL A;  1KLU D;  4QMG A;  1DOK A;  3H94 A;  5C4Z A;  1ILQ A;  1YNN C;  1HDU A;  1JOO A;  2KOL A;  4IFD I;  2PJA A;  2K7V A;  3KBX A;  1R4Q B;  3O13 A;  3FJU A;  1SBB B;  1PRT D;  2NZ1 D;  4N9P A;  4X3U A;  4XXE A;  1STY A;  5CV8 A;  3ONA B;  3D6W A;  3V7Z A;  1V8Q A;  1RTO A;  4NP5 A;  5KGU A;  2EYP A;  4A3F B;  4UDU C;  3DHQ A;  1NR4 A;  3K57 A;  4L6T B;  1LT3 D;  3S1Q B;  4ZRZ A;  5CC4 A;  1JCK B;  3PUX A;  3CQZ B;  3ERO A;  3KL9 A;  4IAL A;  4NGN A;  3PIO 3;  3PRT A;  3GD7 A;  5M5W B;  1H9S A;  3OW7 A;  3NBH A;  3SR1 A;  5IT9 E;  1PRT F;  1CHQ D;  2N88 A;  2EK8 A;  3V2T A;  2R6G A;  1I3Q B;  2RBM A;  2B2W A;  2JA5 B;  2F03 A;  4IHM A;  2Z4I A;  2NB0 A;  3D3R A;  5ELD A;  4DAV A;  1F9S A;  2WKC A;  1E0B A;  4PNY A;  3B3T A;  3BYT B;  2AFX A;  4A93 B;  3TME A;  3M4O B;  4EWT A;  2AQ3 B;  3BYY B;  1PZI D;  2WZN A;  1LAM A;  1SNQ A;  2L4N A;  2Y0S B;  2Z8L A;  4DK0 A;  2PCU A;  2IL8 A;  3QB3 A;  1SMY C;  1PZJ D;  1SAP A;  2MPM A;  1SFO B;  2BA0 A;  1PFB A;  1SNP A;  3HRZ C;  3D4W A;  2D2C C;  1HXY D;  1Z2L A;  4ZKB B;  2F0I A;  1EYA A;  1A3V A;  1ICW A;  4HCE A;  4FYD A;  4J1M A;  5FO8 B;  4XQN A;  5CV7 A;  4A3B B;  1JWU D;  3H8F A;  2ZXP A;  1LFW A;  2NVX B;  3D66 A;  2RB7 A;  1TF8 A;  4ME5 A;  1KNA A;  1EOT A;  1FNO A;  2F3W A;  1TS3 A;  1XTC D;  5EBD A;  4X3K A;  1SDF A;  5COY A;  1R4P B;  3FMC A;  1F2O A;  1HQM C;  4I7Z C;  4HSP A;  3CDX A;  1GHJ A;  3KK7 A;  3SK5 A;  2ANP A;  1V1P B;  2EOT A;  1MBY A;  4O23 A;  1BDO A;  2PW7 A;  4Y7N B;  3DWQ A;  3K7A B;  3AU7 A;  2PIZ A;  1TII D;  4IN3 A;  1MD2 D;  5F2D A;  1EY8 A;  1R43 A;  3LWE A;  2PJ6 A;  3HEJ A;  5DM6 3;  5IGG A;  4IUR A;  1B2T A;  1S5B D;  5K36 H;  2E2D C;  1Z8L A;  3G6J B;  4P4B A;  4FF2 A;  1TKF A;  2IPK D;  1CX8 A;  2WAQ B;  3I90 A;  5KNB A;  1FNV A;  3K58 A;  4CKC A;  3M4Y A;  2LY7 A;  3TP6 A;  3LX0 A;  3KQZ A;  4K6D A;  4RFB A;  4CKE A;  1BLL E;  4XQJ A;  3QOL A;  4PQX A;  3VYU A;  1X3P A;  3SJF A;  2DNE A;  4C1N K;  3RZD B;  1VIX A;  2A68 C;  3E0J A;  3HGB A;  5EKK A;  1XXG A;  1F2M A;  2NUC A;  1HA6 A;  1TKJ A;  4EQO A;  3R2T A;  2JBJ A;  3D68 A;  5CBA E;  3EA6 A;  1STA A;  4R76 A;  4FP5 D;  3HOX B;  5TSS A;  1LTR D;  7CPA A;  4P6Y A;  3BVM A;  4EQN A;  2ICI A;  5FO7 B;  2WII B;  4KD4 A;  2K01 A;  1PRT B;  4FXK C;  3GTM B;  2O5I C;  4XIG S;  3QOJ A;  2EDG A;  4DNT B;  2K6A A;  4K5W A;  2M9V A;  1RKN A;  2B2W C;  1RDP D;  1WTO A;  2L11 A;  1Q1B A;  1CK1 A;  3L9A X;  2K05 A;  2MJ8 A;  1I4P A;  3H6M A;  1Q12 A;  1ZXT A;  2KED A;  2LS0 1;  4MIU A;  5M5X B;  2B8F A;  2OR4 A;  3KBG A;  3NHH A;  2A69 D;  1SYD A;  2BOS A;  1TS2 A;  1II3 A;  2BDO A;  4IFD G;  3K5N A;  1YNJ D;  2VB2 X;  2F4I A;  1DXM A;  4DFA A;  2XEG A;  2EJG C;  3VAR A;  5IOC A;  2B63 B;  2Q8T A;  3H91 A;  4MMO A;  2ZEG A;  1CA6 A;  2HC9 A;  2V8H A;  4DJL A;  2ZEE A;  1YNN D;  2ZOF A;  4N9T A;  3N6R A;  4TSS A;  1OBR A;  3JAM L;  4JYW A;  6CPA A;  4CHT B;  3NQI A;  2QF7 A;  4KSI A;  3PEI A;  5CV9 A;  3T53 B;  2FIN B;  4RGO S;  2EY2 A;  3M3Y B;  5E4X A;  5KRU A;  4RWS C;  2J4X A;  2HDM A;  4XYQ A;  2B2V A;  2GRE A;  1BCP C;  2ZEL A;  2EE1 A;  5C5L A;  3HLP A;  2F1M A;  3K5L A;  2F0G A;  4BD9 A;  3PB9 X;  3GTL B;  1QJO A;  1G2S A;  4LAA A;  5HVF A;  2PRQ A;  1LCP A;  4UIA A;  4LJZ C;  1QNU A;  5D65 A;  1JQG A;  2SNS A;  1OXV A;  1ZYR D;  4X2T A;  4FXG C;  2NBF A;  3MXN A;  4U67 3;  4K3N A;  1XX8 A;  4P44 A;  4F8Z A;  3EJI A;  3B3W A;  4G7Z C;  5COR A;  3CHB D;  1VCI A;  4PMB A;  3A7L A;  4KTA A;  1ENC A;  3B2Y A;  1STN A;  2WP8 J;  1GYT A;  1MSH A;  3GV3 A;  3E6Z X;  3OHX C;  1LTA D;  2EYJ A;  4P10 A;  2B39 A;  1TWF B;  5LYF A;  2J7Z A;  4QF4 A;  3PB6 X;  2EZV A;  4B6Z A;  2XRQ D;  1ZLI A;  5LHY 1;  3GTK B;  3MFG A;  4FF4 A;  4P4D A;  3B3S A;  4IUN A;  4L63 B;  2VL1 A;  1B44 D;  2ZEF A;  1QWY A;  2H1E A;  5EKI A;  1BR9 A;  2EPB A;  2FJ2 A;  2PZT A;  4DYO A;  1SXT A;  3WOE A;  3NWS A;  1ZEQ X;  3MXG A;  5THW A;  3ND8 A;  5IOD A;  4PXE A;  1TS4 A;  4OC2 A;  4RUH A;  2CW0 C;  4FVM A;  2AQ2 B;  4C1N I;  3T13 A;  4C2M B;  2NVT B;  1JB3 A;  1X3Q A;  4F88 A;  4ZK9 B;  1HUN A;  4F7X A;  3W3A A;  5IGF A;  3LNN A;  3D8G A;  5C0X H;  4UIB A;  2KUM A;  5DS0 A;  4H2K A;  3SHL A;  2SEB D;  2RSO A;  3SK8 A;  4MCS A;  1ML0 D;  2RDF A;  1BF4 A;  1ENF A;  2ABZ A;  1TU2 B;  4K8J A;  2R3Z A;  5K36 G;  4G7H C;  3MAQ A;  5M9O A;  3S15 B;  1STB A;  2JP1 A;  1QMU A;  1EZ6 A;  5T1I A;  3A56 A;  2ZEP A;  2E2J B;  3BDL A;  4P4J A;  2GU2 A;  4KK7 A;  3S17 B;  2XWB B;  2XEF A;  4NGS A;  2F0V A;  4GZY C;  3F2U A;  4HTH A;  4NGR A;  2XNA C;  1F9P A;  4H0L C;  1SND A;  1FGB D;  2A68 D;  4FF1 A;  4CJ2 C;  3K5O A;  1GUO A;  4DUK A;  1H9R A;  1RD9 D;  2MUY A;  2KQ3 A;  3D4R A;  2CQA A;  4Z9C B;  1GXD C;  1ARM A;  3K0Y A;  1WD0 A;  4H13 C;  2B2U C;  4ZYS A;  4A3K B;  2B2V C;  2V8V A;  2L1B A;  4CJ0 B;  1S5F D;  1VF7 A;  1EY0 A;  2XEI A;  1LAC A;  4F87 A;  1G91 A;  3RZA A;  1OXX K;  3AMU A;  3H0G B;  4K5X A;  1PLF A;  3BZD B;  1RJT A;  1GOZ A;  4M1U B;  3KLS A;  4K2K A;  2F0N A;  5KNC A;  2O4X A;  3C46 A;  1ELM P;  2PJ8 A;  2GLJ A;  3JAM E;  2L9H A;  2VUM B;  3DM1 A;  3J80 L;  1ZG9 A;  3SJE A;  3HS0 C;  4ZYQ A;  2R93 B;  3RZO B;  4Q5V A;  1K8O A;  1EU4 A;  2HDL A;  4X3T A;  4Q0F A;  1H9J A;  2F0U A;  2XRS D;  3E5S A;  3D7D A;  3MN8 A;  3SJX A;  3IJ3 A;  4MRI A;  4ZLT F;  3J7Y W;  5C5M A;  1BBX C;  1RCV D;  1SJE D;  1CPS A;  1B53 A;  4JBW A;  3R3O A;  4ZAI A;  3EVQ A;  2WKD A;  1Y8N B;  2IMO A;  4G7O C;  2E2I B;  5JM6 A;  3BDO A;  3AB9 A;  1WD1 A;  1FNW A;  2R7Z B;  3CPX A;  3U9S A;  1PZK D;  2FVG A;  2YYZ A;  3NSW A;  3NK9 A;  3A54 A;  3NTI A;  3S14 B;  4KJN A;  3C1F A;  1H9M A;  1D5M C;  1ILP A;  5CV5 A;  1F2Y A;  3PV0 A;  2L55 A;  1G2T A;  5IGD A;  5JAV A;  5K8O A;  3HZX A;  1JR0 D;  2JEB I;  4KY7 A;  2FFK B;  4KMU C;  3UI2 A;  3PO2 B;  1BCP D;  3IWW A;  2ZEH A;  1QCB D;  1I4X A;  5I6Y A;  1NCV A;  5ELB A;  4RH6 A;  1EYD A;  5G3L D;  3RD4 A;  2BA1 A;  4DGZ A;  1G6Z A;  4KHZ A;  3QIA A;  3CRL C;  2AUK A;  4R8I A;  3M85 A;  3S2H B;  2PJ7 A;  4PPZ A;  4ID6 A;  5DEH A;  1SE2 A;  1LOK A;  1ZLH A;  3FH4 A;  1DZ1 A;  4UF4 A;  4DA2 A;  2RQX A;  4ABN A;  5CV6 A;  4K6L A;  1OO9 B;  4NJQ A;  4A3D B;  2PJ0 A;  2ENB A;  3TP8 A;  5I2Y A;  1HTL D;  3MXP A;  4L8J A;  4Z65 A;  1SNM A;  3NBI A;  4PXB A;  1BCP F;  3QJY A;  1DM0 B;  1BXT A;  4MHP A;  3HKZ B;  5IGC A;  3S1R B;  5G3L F;  2WIN B;  2OOT A;  1LT4 D;  1AMP A;  3B7I A;  4ZY2 A;  3J7A V;  3MVV A;  2CIJ A;  4C3J B;  2QCP X;  3I1U A;  4XDX A;  4P4I A;  3NUC A;  3NFZ A;  2JXM B;  1Q7L A;  1B9M A;  3MEH A;  3I4L A;  2F0J A;  4OC5 A;  3S1N B;  1SE3 A;  1STE A;  5AFW A;  4OIW A;  1K8M A;  3SK4 A;  1F2L A;  4QCL A;  1JWM D;  3S9N A;  1GJX A;  2ICE C;  1EIG A;  2PW5 A;  2V8G A;  4NW2 A;  3M7N A;  5ELY A;  5JEA J;  2IWH A;  3HOW B;  3BVG A;  1JWS D;  4OC0 A;  1QQ9 A;  2OXP A;  1DON A;  1OXT A;  1I4H A;  1ONL A;  2EYM A;  4EGV A;  1TKW B;  3GUX A;  5FLX E;  4RGT A;  1TF9 A;  5LYL A;  4QUC A;  1G29 1;  1H8L A;  2CTB A;  1H9S B;  3KHZ A;  2MGS A;  2HQE A;  1IL8 A;  4QUF A;  1QNK A;  4BA2 I;  3EQL C;  4U68 A;  5A2Q L;  1TWC B;  1BQQ T;  1EIH A;  3A7A B;  5EPJ A;  2RKS A;  1YLO A;  5C0X G;  1WTW A;  3K5M A;  3BDC A;  2PVV A;  5M5Y B;  1Q8I A;  3SJG A;  4IFD J;  3K59 A;  3VR5 A;  1HUM A;  2PJB A;  5E3F A;  2CVR A;  5HVH A;  4G4K A;  2RVL A;  3NA6 A;  1MI2 A;  1HRJ A;  2F0L A;  1EEI D;  1L0X B;  2LKV A;  1QE6 A;  3CPA A;  1DE4 C;  1E2W A;  5IGB A;  2L12 A;  3TP5 A;  1XMB A;  5J22 A;  3FPP A;  2PNR C;  2IJZ A;  2PPB C;  3NWT A;  2Q8I B;  2AFW A;  4EQP A;  4RKB A;  4G57 A;  1HFG A;  1EY5 A;  3TX8 A;  4FUU A;  5IIF A;  3S9M A;  1EWH A;  3NQT A;  2ZOG A;  3BXM A;  3GQB A;  3MZ5 A;  4RAU C;  5LRJ A;  1BCP B;  4FWU A;  4F9U A;  4OC1 A;  4FAI A;  1PCA A;  5CR3 A;  1SNO A;  2F7V A;  3SI1 A;  1BO0 A;  4IUV A;  4CPA A;  1IKM A;  1I4Q A;  5LL6 X;  1IW7 C;  3I4M B;  2QDB A;  3VR2 A;  1KDC A;  2J0T D;  3GTJ B;  2PJ5 A;  1EU3 A;  4PV1 C;  1O7L A;  3WAB A;  3X3N A;  2Q51 A;  1O7Z A;  5T1G A;  3MXU A;  5CPA A;  4P45 A;  1FR3 A;  1CQV A;  2DY7 A;  4IUT A;  4BS9 A;  2XSC A;  4C3J G;  4LMQ D;  3NXW A;  3T51 B;  4MN3 A;  3WOF A;  3DXJ C;  1HEE A;  5JGF A;  5A35 A;  1YME A;  4M8A A;  1RHP A;  1XWE A;  2AWN A;  3IFE A;  3SVM A;  3PO3 B;  2WB1 B;  3J81 L;  5JVH 3;  5D14 A;  2K03 A;  5KND A;  2DEA A;  4R8F A;  1CG2 A;  1PTO C;  1AZQ A;  2ZT9 C;  1W6K A;  2A6E C;  3OOC A;  2C5C A;  3S16 B;  4WOR A;  3DWP A;  1O78 A;  2AFZ A;  3T8W A;  3V38 A;  5D8N A;  3FEE A;  4KV6 A;  2HB6 A;  1STG A;  5KYI A;  4IUU A;  3A8K E;  1AZP A;  5C4H A;  3MC0 B;  1I4R A;  2AUJ D;  3VYS A;  3TDQ A;  3K9T A;  1RTQ A;  2PO4 A;  5D3D A;  2EYH A;  5FOB B;  1TQO A;  1B1Z A;  4KKT A;  1CP6 A;  4MCR A;  1UUP A;  4S3S A;  1AFP A;  2PVW A;  3GTO B;  2B2U A;  2PJ4 A;  4DAY A;  5ISR A;  5BN5 A;  4QIW B;  2NVQ B;  4NGM A;  1J8I A;  1Z5R A;  3H09 A;  3DUZ A;  3WT4 A;  3KGQ A;  2PJ1 A;  2G9H D;  4NGT A;  4YU9 A;  3FVQ A;  3WC5 A;  4BY1 B;  1LLR D;  1CZG A;  5M3F B;  3ITP A;  4NMZ A;  1A2T A;  3GP7 A;  4OME A;  3EFX D;  4DNR B;  1BNZ A;  4ZX8 A;  2POK A;  3KLS X;  1GUS A;  3N5F A;  5IGE A;  3VR6 A;  1ENA A;  2BO9 A;  4K8I A;  4MXU A;  1K83 B;  3FEW X;  1QIL A;  4DXG A;  5JH9 A;  4ONW A;  5I4D A;  2I3C A;  1AEX A;  1G8Z D;  2K04 A;  4EFD A;  5LRG A;  4KKU A;  1EY9 A;  4X3R A;  2PIY A;  2WYR A;  2V8D A;  1E2Z A;  1NR2 A;  1YW4 A;  3B3V A;  2IJ0 A;  1SMY D;  1M4L A;  1YW6 A;  1S4Z A;  2SOB A;  1D1K A;  2CHB D;  2MHV A;  2RSN A;  1JOR A;  5BN4 A;  3NTH A;  4AXV A;  3WDN A;  3KR4 A;  1QB5 D;  5C4J B;  5LRK A;  3IFT A;  1A2U A;  1EEF D;  3BVZ A;  3I3C A;  1NAP A;  1GUG A;  3FDT A;  2PZU A;  2BE5 C;  4X8I A;  1SJH D;  5EQ0 A;  1Z47 A;  2O53 A;  4FO2 A;  1RTN A;  1CP7 A;  1Y7E A;  1VMP A;  1GHK A;  2F0K A;  1TR5 A;  3I91 A;  1PYT B;  4OGQ C;  4A94 A;  4KKS A;  4KN7 C;  2NTS A;  4RGM A;  2X6L A;  2IT1 A;  1LTG D;  5CGK A;  5C3E B;  4TKO B;  2KVM A;  3H3V C;  3GTG B;  1VHO A;  3PB4 X;  3PBE A;  2ZXR A;  1LT5 D;  2X6G A;  1VGY A;  3SI0 A;  1SEB D;  1DJR D;  1CHP D;  1U4P A;  3RAM A;  4WWV A;  4R8N A;  2EWB A;  2L5T A;  5D29 A;  4UEF A;  2I46 A;  1JE4 A;  1T5E A;  8CPA A;  3RMH A;  2A74 C;  5I2X A;  1IHZ A;  1IW7 D;  2D62 A;  1J9O A;  4OID A;  3B35 A;  1SYG A;  3OIQ A;  4KY6 A;  5C0X I;  3W2D A;  4A3M B;  5HUR A;  1FYC A;  2IX0 A;  1LAP A;  1S5E D;  5IT9 L;  1TWH B;  3KQX A;  4H44 C;  3V05 A;  2EYO A;  1HTP A;  2WAC A;  4KJO A;  2F0M A;  3PUZ A;  5HVG A;  1XBU A;  3PUW A;  3NE5 B;  4GM5 A;  4DXF A;  4RCO A;  4AYB B;  1W6J A;  5IB9 A;  5ELE A;  4FBE A;  3ISZ A;  4UAI A;  1MGS A;  4OKO A;  3IKJ A;  2K33 A;  3NP8 A;  1SYB A;  1I4G A;  2I07 B;  1F9R A;  2K5Q A;  2PQE A;  2O4H A;  2EY5 A;  4B9X A;  3KI9 A;  1WVL A;  3I73 A;  1O80 A;  4E6I A;  3VYT A;  4CJ1 B;  1C4Q A;  1Q1E A;  5J39 A;  3L2N A;  3K2K A;  1PTO D;  2NYZ D;  3IIB A;  1EY7 A;  2F3V A;  2A6E D;  1LAN A;  2F0E A;  3OIP A;  3DLJ A;  4RA8 A;  1JIC A;  4HMI A;  4QB4 A;  4BWG B;  4Q7A A;  4OIJ A;  2JSO A;  4A39 A;  3CRK C;  4A37 A;  1Y1W B;  2K5W A;  1Y1V B;  1B50 A;  2NN6 H;  3QG1 A;  1TY2 A;  1C8C A;  4OL7 A;  2JYO A;  1DD2 A;  3PB8 X;  3FEC A;  1DCZ A;  1ROD A;  4OC3 A;  3HOV B;  3VYR A;  4ZI6 A;  5JEA H;  2AQ1 B;  3VR3 A;  1PTO F;  1AN8 A;  2VNU D;  1S5D D;  1I50 B;  3A55 A;  3FF3 A;  4PXD A;  1JOQ A;  2B8G A;  3SDZ A;  3QNV A;  4K2L A;  2M2L A;  3SEB A;  2QIL A;  4EME A;  2V77 A;  3C2P A;  4ZUI A;  3DEO A;  3L3O C;  2NN6 I;  3ISX A;  3LMS A;  1EQV A;  1Y8O B;  5FO9 B;  2PJ3 A;  1U4M A;  1KWM A;  4I65 A;  4NGP A;  2V4D A;  5E4W C;  2OT2 A;  4KD3 A;  1O7Y A;  2K28 A;  2J9A A;  4BA1 I;  1X32 A;  5EBC A;  4B08 A;  2JEA I;  2A69 C;  4C56 C;  1CTM A;  3HOY B;  4MHY A;  2XWJ B;  3OMG A;  1EE3 P;  4KN4 C;  4NKL A;  2RFH A;  3B3C A;  5NUC A;  4ZKC B;  1YNJ C;  1EWC A;  2Q43 A;  5M3M B;  5HGT A;  5EGT A;  3PB7 X;  4YWY A;  1OXS C;  4OO1 H;  1EFI D;  3Q22 A;  5JOB A;  5I6W A;  2EYL A;  2B2Y A;  5J1Z A;  1PTO H;  5DM7 3;  1VHE A;  1F2Z A;  3OWF A;  3T56 B;  3KUP A;  2KCN A;  1Q3L A;  3SE0 A;  2B2T C;  2QYV A;  1AP0 A;  5C6A A;  1DYQ A;  2DNC A;  1GUT A;  1ET6 A;  1UEA B;  3IC1 A;  1D6E C;  3V96 A;  1IYV A;  1AYE A;  2E74 C;  4V0B A;  2A5H A;  2FHT A;  5BN3 A;  4KHV A;  3C3L A;  4OO1 I;  2AFM A;  2BE5 D;  3KHX A;  2H4O A;  1CFM A;  4HED A;  1V1O A;  2CW0 D;  2F8H A;  1MSG A;  2EJF C;  1UAP A;  2F0D A;  5D3I B;  1ZKO A;  3G7L A;  5JVG 3;  2JEW A;  4IQZ A;  4RGN A;  2AFS A;  2D9U A;  1HA5 A;  1ZYR C;  3D7H A;  5KIX A;  1IYU A;  4RCN A;  1PMR A;  1D5X C;  2ZEN A;  4DK1 A;  4NJR A;  1B9N A;  2FMM A;  1BPM A;  4TQU S;  1SSO A;  4P2C B;  4ZY1 A;  3D4D A;  1WTP A;  1KTK A;  1S5C D;  3CKI B;  5ELC A;  1TT2 A;  1LV9 A;  1PFM A;  1A6X A;  5K8P A;  5CV4 A;  1PYW D;  1A3U A;  3I72 A;  4ZUJ A;  3J80 E;  2K32 A;  1PTO B;  4HSV A;  1NSA A;  1PDQ A;  3NH5 A;  1U9R A;  1ELL P;  3D31 A;  4PMC A;  1Z6H A;  4V19 0;  1TXR A;  2DY8 A;  3DWA A;  3OWE B;  1V1P A;  2F0H A;  1WTV A;  2AFU A;  2NSM A;  2EYF A;  3GTP B;  2GA4 B;  1TVX A;  2KJX A;  3RUZ A;  5JPN C;  2RDH A;  3HUV A;  4C3I B;  1D5Z C;  4NDX A;  2N55 A;  3I70 A;  3DMU A;  2BCO A;  3IO1 A;  1E2V A;  3ND9 A;  4RHR A;  4DU9 A;  3BI1 A;  2A6H C;  2KCC A;  2EY6 A;  4MHN A;  4J8Q A;  1NSN S;  4O1N A;  1CBX A;  1ZG8 A;  4MCP A;  3MA2 B;  3GB0 A;  3OPO A;  3KR5 A;  3SI2 A;  4HCS A;  1KAA A;  2R61 A;  1HQR D;  3PIP 3;  1Y0Y A;  2EXZ A;  3P7J A;  3FPU B;  3T16 A;  2C1C A;  2MP1 A;  2OF1 A;  1T5X D;  3GLJ A;  2R92 B;  1IKL A;  1I6H B;  4TWE A;  4WJW A;  4WJB A;  1QG7 A;  1SNC A;  2B2Y C;  2O2L D;  1UNS A;  1CM9 A;  2VXW A;  1H9K A;  2EY1 A;  2PCF B;  4ILW A;  3NTK A;  2D5D A;  4WFN 3;  5I9O A;  1EZ8 A;  3S1M B;  4R7M A;  4XTC S;  2JA6 B;  3WC7 A;  4YIJ A;  4PQA A;  4MCQ A;  2NN6 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...