2G9DA

Crystal structure of succinylglutamate desuccinylase from vibrio cholerae, northeast structural genomics target vcr20
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
340
structure length
340
Chain Sequence
KSLFRQSFLFDSLDLDHPMVAQTVRTEQGVTLKLHQRGVLEVIPAQTDAATKNMVISCGIHGDETAPMELLDKWIDDIVSGFQPVAERCLFIMAHPQATVRHVRFIEQNLNRLFDDKPHTPSTELAIADNLKVLLRQFFANTDEHSRWHLDLHCAIRGSKHYSFAVSPKARHPVRSRSLMQFIEQAHIEAVMLSNAPSSTFSWYSAEHYAAQALTLELGQVARLGENLLDRLLAFDLAMRDLISRHKPEHLPRKSVMYRVSRTIVRLHDDFDFRFSDDVENFTAFMHGEVFGHDGDKPLMAKNEGEAIVFPNRKVAIGQRAALMVCKVNTRYEDDQLVYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Succinylglutamate desuccinylase
publication title Crystal Structure of Succinylglutamate desuccinylase from Vibrio cholerae, Northeast Structural Genomics Target VcR20.
rcsb
source organism Vibrio cholerae
total genus 71
structure length 340
sequence length 340
ec nomenclature ec 3.5.1.96: Succinylglutamate desuccinylase.
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.630 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2g9dA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2g9dA01
3VATA 2G9DA 4OC3A 4NGPA 4OC5A 1VGYA 1Y7EA 3SJEA 4DYOA 2EK8A 1TKFA 4UEZA 3JRUA 3PB6X 2Q43A 4P44A 4NFRA 2PJ1A 3D4UA 5LYFA 4P6YA 3S9NA 4PXEA 1CPXA 1LCPA 1GYTA 2GLFA 1EE3P 1ZLHA 2GREA 3D68A 2GU2A 2PIYA 2QYVA 3NH5A 4JZ0A 7CPAA 4A39A 3T8WA 3WC6A 4F9UA 1PCAA 1AYEA 2FVGA 1XBUA 1ARLA 2XEGA 4CPAA 2I3CA 3TC8A 3KL9A 1XRYA 4MHNA 3VARA 1CP6A 3PRTA 4MHYA 4EWTA 1TXRA 2PJ0A 3PBBA 4MMOA 1CP7A 5THWA 4X3RA 4MCPA 4WJBA 2RB7A 3PFOA 3RBUA 1F2PA 4AXVA 3IEHA 3LMSA 3B3CA 2EWBA 2XEFA 3KQZA 5HVFA 3NH8A 2V8DA 2WZNA 4MHZA 4R6TA 3PB4X 4IAVA 4ZY2A 1TF9A 2ZEDA 3I1UA 3NA6A 3KI9A 2O53A 3B35A 3RZAA 2CF4A 1Y0YA 1TKHA 3KZWA 3BI1A 4NGNA 4R7MA 3CPAA 4YU9A 2PJ7A 4X8IA 4NGSA 4UEFA 3FF3A 1ZG7A 3WC5A 3SJFA 3WC7A 2JEWA 2Q4ZA 5LRJA 3H8EA 2XEJA 3BHXA 4PXBA 2J9AA 2PJ8A 4P4FA 5IB9A 3KR4A 5LYDA 3HLPA 2AFZA 5LYIA 3SI0A 5HXDA 4KSIA 1IGBA 1XMBA 4IK2A 1AMPA 3DLJA 2AFOA 4DJLA 4OMEA 1M4LA 3NH4A 5JGFA 3H8FA 5K8OA 5LYLA 2XEIA 1H8LA 1PYTB 2WYRA 4TWEA 3FX6A 2ZEEA 2ZENA 3L2NA 1IY7A 4TNUA 3PFEA 1DE4C 4R76A 3IFEA 3PB9X 1Q7LA 4P10A 1YW6A 3MN8A 2JBKA 1DTDA 2PE3A 4IHMA 1OBRA 3SI1A 3GB0A 2V8HA 4X2TA 1LANA 1QQ9A 4P4DA 2QJ8A 4NGQA 1HEEA 3B3TA 3VH9A 4DUKA 4P45A 4PXDA 4MCRA 4A38A 5LRKA 3D7HA 1ELMP 3B3WA 3K9TA 2ZEFA 4OC1A 2ZEHA 3D7FA 2AFXA 2PJ6A 2ZELA 4G1PA 1Z8LA 4OP4A 1LOKA 3IO1A 4YWYA 1ZLIA 2BCOA 3KASA 3PB7X 2C6CA 4GM5A 1YLOA 4FUUA 3B7IA 3K2KA 3FECA 3FH4A 1TKJA 4P4JA 1XJOA 1Y0RA 1R3NA 2ZEGA 1RTQA 4NGTA 5I4MA 1LAMA 1YSJA 3TX8A 2OR4A 1VIXA 2PIZA 1ZG8A 4ONWA 3SI2A 2C6PA 4MHPA 3LWUA 1UWYA 3S9MA 1F57A 5CPAA 5HVHA 3ISXA 2ANPA 1ARMA 2IQ6A 2PJ5A 3V38A 3WT4A 4F9VA 3D7DA 4UIAA 4Z65A 4NGRA 8CPAA 1F2OA 2PJ2A 2DEAA 4P4BA 2IJZA 3D7GA 3FEDA 1NSAA 3IC1A 5CBMA 6CPAA 4EMEA 3IIBA 2BO9A 5JH9A 4FAIA 3HUVA 4ZY1A 3B2YA 1XFOA 4K3NA 1CX8A 3B3SA 3CPXA 4JYWA 4ZX8A 2CIJA 4OIDA 2GLJA 4Q7AA 1CG2A 3QNVA 3ISZA 5F09A 1YMEA 5D8NA 2HB6A 4ZI6A 1KWMA 1VHOA 2V8GA 2F8HA 4MXUA 1BAVA 5J1QA 2PJ3A 2NSMA 3KQXA 3FEEA 4H2KA 4FBEA 4MCQA 1JQGA 1ELLP 4ZYQA 2PRQA 3KHXA 5K8PA 2IMOA 3PB8X 1BPMA 2V77A 2O4HA 3MRUA 4OC4A 4UIBA 2AFWA 2ZOGA 3IJ3A 5LRGA 2AFSA 3BXMA 1R43A 2PJ4A 4OKOA 3PEIA 4P4IA 2PJ9A 3PBEA 4PXCA 2ABZA 1HDUA 2ZEMA 3GLJA 1BPNA 4MRIA 4R8FA 4RUHA 2V8VA 5ELYA 4LQGA 3FJUA 4NGMA 2CTCA 2ZOFA 1VHEA 3SJXA 3KHZA 2OOTA 2C1CA 2ZEOA 2AFUA 4OIWA 2CTBA 2EK9A 3WABA 4P4EA 3FMCA 1Z2LA 1Z5RA 1HDQA 4UEEA 2RFHA 3NFZA 3S9LA 3B3VA 2VL1A 2C6GA 4MCSA 5HVGA 3CT9A 4OC2A 1ZG9A 1QMUA 3BI0A 2POKA 1CBXA 4WWVA 3D66A 3H8GA 1FNOA 3DGVA 3D67A 3SJGA 2NYQA 4A37A 3RAMA 2PVWA 3IWWA 1LAPA 3GUXA 2BOAA 4ZX9A 1BLLE 2PJBA 4FWUA 3CDXA 4EFDA 2F7VA 5DS0A 1TF8A 4UF4A 1LFWA 5D29A 2PJAA 4NJQA 4OC0A 3KR5A 2PJCA 2HC9A 2AFMA 4PPZA 5K8NA 4A94A 4BD9A 3N5FA 2QVPA 2ZEPA 5JM6A 5K8MA 3KGQA 2Q51A 2PCUA 4B6ZA 1FT7A 2PVVA 4PQAA 1YW4A 4ZY0A 4F8ZA 3V7ZA 4NJRA 4O23A 4W9YA 2JBJA 3FVLA 1CPSA
chains in the Genus database with same CATH superfamily
2EYPA 3NWSA 2RSOA 2K28A 3GTOH 3T13A 4PV1C 4HJ9A 5IT9c 1B53A 2B3GA 5E4WC 5EAYA 3DWQA 4OC5A 3RN5A 4RN7A 4N8X1 4A3MH 1I4GA 4DAYA 1QZGA 5C0XI 1SROA 2F0LA 1WTQA 3NELA 1M1DA 3PB6X 4P44A 4DV2L 1KL9A 1VQ6A 5LYFA 3PZJA 4PXEA 1GYTA 1ILPA 1ZLHA 1WCMG 4DV4L 2GU2A 2QYVA 1KDAA 1P4NA 1IYJB 2IW3A 2VZAA 5CR3A 3G6EA 2B2VC 1AZPA 2K14A 2QKIC 3SR1A 4L8JA 3TN2A 2Q2TA 4WJ4A 3T8WA 5E4XA 4KOUA 4KLKA 2MUYA 3UDXA 1ZO0A 1PH7A 5EMIA 3ULPA 4Q36A 5FLXc 3GTMB 3TMEA 1EY9A 3I8ZA 4QCLA 2Q8TA 1S7KA 1XRYA 4RGMA 4MHNA 3VARA 1CP6A 3HFZB 4EWTA 1HJPA 3M3YB 3NE8A 4A3KH 4Q5VA 1R9TB 2RKSA 5HH1A 4KVXA 4K14A 1KLGD 3VR4A 5M5WB 1M44A 4MCPA 1C48A 4CGPA 4JV5Q 1HPCA 4LF7L 4WJBA 4IQZA 4ME5A 1F2PA 1DOLA 2EDGA 3SDZA 2EYHA 1CM9A 2EJFC 1NR4A 1YVCA 2GVBA 4R4OA 2BDOA 1EQTA 4BBSG 2DPSA 2F0SA 1E0BA 5LMUL 1QSRA 2V8DA 4KOWA 1FL0A 2K5HA 1LT4D 3D6CA 1FJGL 5AFWA 4ZY2A 1CA5A 2M9VA 3LWEA 3J7AV 2HUGA 2FT0A 4AQYQ 4YIJA 1SYEA 3KI9A 2R93H 3T53B 3B35A 4OGQC 3S1QB 2AUKA 2CF4A 4APVA 5C3XA 1SE3A 1W3SA 1HQRD 4X3UA 1SYCA 1RIPA 4IUSA 4R7MA 1JJCB 4C68A 4B3ML 1X32A 4A3LG 2Y0SB 4A3GH 4XQNA 4QIWB 1ZYRC 4GN3B 3AMUA 4NGSA 4LFBQ 3S6GA 2AQ2B 2E74C 3T1HQ 5D65A 1TS2A 3K80C 4NEXA 4P75A 1B6BA 1ZG7A 1VDZA 1X3QA 2WPWA 4DV5Q 2WKDA 2JEWA 4ODGA 1CTMA 1NR2A 4O42A 3H8EA 5LRJA 1Y8PB 1I3QB 1O78A 4CAWA 3E5SA 4E2AA 1RTNA 4GS3A 4CDEC 1IBLQ 4GN5A 1PV4A 3PUYA 3G48A 3A56A 3RNZA 3PCOB 4F8MA 2PJ8A 5EBVA 3R93A 2YU9B 3PO3G 5IB9A 2MQHA 5I2YA 2F0EA 1OXXK 2MO1A 5LYDA 4M6GA 5IOCA 1QVGA 4F0XA 3HOYH 3HLPA 1I6HB 1TR5A 5LYIA 2XTIA 3CF5A 5HXDA 2F0DA 4JW0A 2I46A 1MI2A 1W6KA 2KVMA 3S2DB 1IGBA 4EQNA 3FVQA 4IUQA 4QQBX 1PZKD 3N6RA 1WTPA 3V2TA 3M4OB 4IFDH 3RZOB 4OMEA 2NUCA 2F03A 2NTTA 3TOBA 5EKIA 4QY7A 3CCUA 4IFDJ 1B8AA 4ZK9B 1QUQA 1XPOA 1H8LA 2R7HA 3WR7A 4C1NI 4K0KQ 2HHHQ 1PYTB 4UBRA 3EA6A 2KUMA 3GTGH 1IW7C 2FMMA 3HOZB 5C3EH 4OWWB 4RKBA 4CAXA 1IY7A 1LTAD 4TNUA 4R3KA 3EO4A 4DR2L 1EIGA 4RKLA 1A6XA 1KZFA 1IKLA 5EKKA 2XRSD 3K57A 3IFEA 4CDDC 4MBUA 1Q7LA 1ZEQX 4X64L 3GTQB 2B2UA 1DD2A 1YW6A 3OWFA 2E2JH 4UWIA 5BR8Q 2JA6G 2B5GA 4R57A 4LFAL 3SEBA 4DAYB 2VI7A 3F8TA 4A93B 3U50C 4DR3L 4DNRB 4A3FB 2B63B 1VMPA 3NE7A 4X2TA 1SNOA 3KJPA 1LANA 3SXNA 2BE5D 2Z11A 3S1MH 1WD1A 2Y0SE 2E2HB 1HEEA 3VH9A 4QIWE 1XYIA 1M4DA 2VXWA 3C1EA 4A3DG 5IV0A 4XQJA 4A38A 1GUOA 4K5XA 3DLLA 2B2TA 2JEAI 2BEIA 1R57A 3B3WA 4QC6A 2Z3LA 4ZKBB 1IIDA 3U58A 3BVGA 1K3BC 1Y14B 2ZEHA 3PV0A 5LL6S 3MHBA 2ZELA 1IL2A 4A3LH 1PFMA 3NQTA 1NMGA 1SE8A 4ORFA 3T1YQ 3CHBD 4DUZL 5NUCA 4AYBG 4BS9A 1VQIA 1U4LA 1J9OA 1KRSA 1DGSA 2K5QA 5C4JH 1NMFA 1ZKOA 4EVOA 3DR8A 4KUAA 3EFAA 4JLYA 1NBWA 3VR3A 2J0TD 4UFXA 5JJIA 1XTDA 1PZJD 1RJTA 3MXNB 4IUUA 4FUUA 4MY3A 2ES2A 2L0CA 3J81c 3M4PA 4P4JA 2DGYA 4IPDA 1XJOA 2F4IA 4JYAL 4YRHA 4PK2A 4LF4L 1N34Q 2PCFB 2A69D 4DV6Q 2OEOA 1F9SA 1AZQA 1RO5A 5ELOA 2OR4A 1MHWC 3V96A 1PUAA 3RLNA 1Z47A 1ZG8A 2NVXB 3HOXG 1ESFA 1HA6A 2ZM6Q 1JICA 5DWNA 5CPAA 2Z3KA 1PTOC 1GUWA 3B8GA 1I6VC 4XNHB 5J22A 1O80A 3WT4A 4EX5A 1K8GA 4BINA 1A8VA 2KEEA 1J6QA 5AGEA 2NB0A 4MFZA 3EIVA 2VW9A 3A9LA 4Z65A 4YWLA 5JQ4A 2Z3MA 1AH9A 4ZLTF 4UP9A 3IAYA 4MFLA 4CRYB 1QG7A 4KJNA 4KKSA 3PUXA 1IU8A 1TXYA 3E3XA 2BE5C 4GS4A 4KOVA 1EY4A 4I7ZC 1QOHA 1HNZQ 4UHVA 4C3JB 1OZPA 4IPCA 2JA7G 3D7GA 3R3OA 1A2ZA 4FF3A 4HJ7A 1G91A 3IC1A 2YNDA 4EMEA 1TWAH 3CAMA 1H9MA 4KKTA 4KHPL 5JH9A 5IYBH 1VQLA 3J80E 1LM0A 4ZY1A 2JXMB 4X66Q 1XFOA 4K3NA 1UEAB 5KTCA 3TP7A 2ZXOA 4KY6A 1UE6A 1KC8C 4DR4Q 2J4XA 1LTRD 1RKNA 1GJXA 4YGOA 1GD7A 4LJZC 3OHXC 2JJQA 1BNZA 2K5TA 2NN6G 5FO8B 3ND9A 4QUSA 5LMNL 5IIFA 5M3FH 1K3RA 3HKZB 1TS4A 3PUWA 3D31A 2CH4W 3HGBA 3MXPA 1Y1WH 3HG9A 1BBWA 1IBMQ 1IXRA 4YY3Q 4PSWA 1E24A 1Y1VG 1XEBA 2HB6A 5AG6A 2HQLA 2WKCA 1K28A 3NE5B 3ND8A 1C4QA 4HMIA 3Q24A 1BAVA 1I94Q 3HOUG 4CJ1B 1OXSC 3IU1A 1AN8A 2PJ3A 4PMWA 4BBRG 4G7HC 3FEEA 5C4XH 1CI3M 4DR7L 3CW2C 1YLEA 4HSVA 1EOTA 1JQGA 5FLXE 4P73A 2H1EA 2V1CC 3H3VI 1ET6A 1ELLP 1EY8A 1VMCA 1Q2CA 2P6EA 2PRQA 3KHXA 3J80L 3VYSA 2WFWA 1XWEA 4QUFA 2RA4A 1VQFA 2ZTEA 3Q6SA 1NUCA 2JYOA 2PMZE 5IP7G 5F49A 4A2ZA 4II9A 3I3CA 4FF4A 2B5GB 4A3JH 1EUJA 4RCNA 3D3SA 2AFSA 2PZUA 2B39A 1HR0W 4BBSB 4F7XA 2R7DA 5EPKA 4OONA 5C3WA 2PI2A 2PJ4A 4HIKA 1LT5D 4XNHC 1I5FA 1BOSA 3HOVG 1IL8A 4MRIA 1UE5A 2H5XA 1L0YB 4IO9A 5ELDA 4KS9A 2V8VA 1B3AA 1CZGA 4LFCL 1VHEA 3BDOA 3OWCA 4QMGA 1M4VA 4E6IA 2PW5A 2QCPX 5IYDG 1VQ5A 4V190 2JA7H 1Z8WA 1K83H 1KAWA 2AFUA 1NSNS 3DM1A 2IX3A 1V0CA 3W1BA 1A3TA 1YNXA 3VR5A 3SVMA 5FLXL 1HUMA 4YFJA 2I07B 5C5MA 2CQOA 3WABA 2EPBA 2F0KA 3A8KE 1Q2YA 3ZYYX 3U4ZA 4P72A 1STGA 3E0JA 2UXBQ 1WTVA 2E76C 3R9EA 3R2TA 3K59A 2VL1A 1T5EA 2UXCL 4XIGS 3JAMc 1NE3A 2HDMA 4OC2A 1LTLA 1TQOA 1QMUA 1S5FD 3OIQA 4KOTA 3W3AA 3PO3B 1TY0A 5I2XA 5KEEA 4JI6L 2RHQB 4ONUA 3I4MH 3EJIA 3H8GA 1JMCA 1QSNA 3CRLC 3SK8A 3GYAA 4JI2L 1X3GA 2LFNA 4B5PA 4IJHA 3K7AH 4OO1H 3SJGA 3NENA 5CV9A 5J3BA 1S60A 2PO4A 5T1GA 4A37A 1B9MA 2OTLA 3DWAA 1JE5A 2JDCA 2TMPA 3BDCA 3MZ5A 4OLLA 2VS1A 1EWIA 2Z1CA 2Z3OA 1A3UA 2BSWA 4BY7G 3I90A 3MEFA 3V8IA 3LD2A 3DEPA 1TY2A 3I73A 4POFA 1CKNA 5LMNW 3I4NH 5DS0A 2XSCA 4UPAA 1TF8A 4DR6Q 2RQXA 1HH2P 1VQEA 2Q2HA 4L6TB 4K2LA 1GUNA 1Q86C 3TS2A 4B9XA 5GROA 5M5YH 4IALA 3CMEA 4JOIA 4A3BG 1F9RA 4NJQA 4DK6C 1I50H 5DWMA 4CJ2C 1KUYA 2UUCQ 4FYDA 2JDDA 1N36Q 4OC0A 4XTCS 1VQAA 2HCCA 2JA9A 5E1FA 4U9ZA 1Q46A 2NN6I 3ZZIA 2JA6B 2AFMA 2MO0A 4U68A 1XMQQ 1N9WA 4A94A 4JI8Q 3SK4A 4QB4A 2YNCA 1Q90A 4DV3L 1JWMD 2KEDA 1YNND 4O1NA 4C2MB 4DK3C 2FS5A 2QF7A 1ESRA 3PGZA 4NXYA 5I9OA 3RLOA 2JEBI 4OO1I 1PRTB 2ZEPA 4A3DB 5K8MA 2HT1A 5M3MH 2OF1A 1VQNA 1FT7A 4L8AA 1HTLD 4UDUC 2PVVA 4FD6A 3V7ZA 3GQBA 3IU2A 3HOWH 2ARHA 2AQ1B 3L7ZC 1BVSA 4O23A 4B11A 2G3TA 3QOLA 3RZDH 3SHPA 1X3FA 4X62L 5C44G 5BN4A 1CPSA 1YMEA 4AYBB 1EY0A 1TWCB 2FL4A 2YNEA 1HNXQ 3VATA 2G9DA 2NMTA 3PUZA 1HNWQ 4NGPA 4IN3A 1PH9A 1PRTD 1XE4A 3SJEA 2EK8A 1TKFA 1JE4A 4ABNA 1KABA 3BS1A 2D0OA 3VYUA 4NFRA 4JCVE 1SNMA 1VKCA 1STHA 3D4UA 1KLUD 2OTJA 2BDNA 1CHPD 1LCPA 4TKOB 1XMOL 3QAYA 1EE3P 1WTWA 2Q4YA 2GREA 3OW2A 2PIYA 1O7YA 2LSSA 1RF2D 3G8WA 1GUGA 2EBJA 1G2SA 4C3HB 4GLVB 3J81E 4KY7A 2FXFA 4M85A 1H9SB 2AUJD 1WOCA 4A39A 2KOLA 4ZQ3A 3WC6A 4DR5L 2DF5A 1MJCA 3HOXB 2VB2X 4DA2A 3H4QA 1HFGA 2IX1A 1PCAA 1IZ6A 4A3IG 3EBEA 4UCMA 2ODFA 2YGWA 2LXJA 2EE1A 3PGPA 2PYKA 5FOBB 4BY7H 3CQZB 3I2ZA 4CPAA 4NKLA 3TC8A 4JI1Q 2JA5G 3OTOL 1LACA 1NJIC 1WTHA 4MHYA 1J8IA 5BN5A 4A3EB 2PJ0A 2OU2A 2MGSA 3PBBA 4KSFA 3TCVA 5M5WH 4PV6A 1SFOH 1I4HA 1JWUD 1QNUA 1SYGA 4DAPA 2K4KA 4WJ3M 1BCPB 2FMCA 2PW7A 4DR1L 1I4PA 1SNCA 4A3MG 3S15H 2RB7A 1XNRL 3PFOA 1YNNC 2ICEC 1FGBD 1VQHA 2Z6BA 3CC7A 1VQPA 2NZHA 2DN8A 2EWBA 2HQEA 2IT1A 2K05A 2RDGA 1DCZA 2J8RA 1B2TA 2EUIA 1R4QB 1VQKA 3NH8A 3DMUA 3AU7A 2PDOA 2WZNA 4OWXB 3H6MA 3J81L 3W2DA 3J7A5 4IAVA 4AB7A 3VR2A 1SXTA 1XNQQ 1MKHA 5M5XB 4EGVA 2E5LL 4CS0B 3NA6A 1KDCA 1BCPD 4JI4L 4M6HA 5KIXA 1F2YA 3H3VC 1F2ZA 4KOSA 3S1QH 1P8LA 3GP7A 1Y0YA 4CYOA 3ONAB 1XPUA 3WOEA 1A2TA 1PRTC 4FNFA 4KHVA 4B3RL 2OZGA 3BI1A 2F0WA 4NGNA 3W6SA 2IPKD 5C5LA 3CP0A 2OB0A 2B3VA 4G7ZC 1S3OA 4AVBA 3OYYA 1V1QA 4GKKQ 2KHIA 1F77A 4NXMQ 3CD6A 4KKUA 1DONA 1ENFA 1KTKA 5CV6A 2WACA 4JI5L 1B1ZA 1Y1VB 3C3LA 3SJFA 3WC7A 1YJNA 2OT2A 4R4TA 2ZTCA 2UUBL 2O4XA 1BO0A 1CKNB 2NYZD 2VL6A 1GM5A 3HOUB 4H89A 5JOBA 1E2WA 4OX9L 3DSBA 2PI2E 2R7ZB 5D3DA 2N3SA 4MIUA 3STBC 4DV7Q 2J9AA 4PXBA 1RTOA 1CM0A 3P20A 2CW0C 1EZ8A 1RXTA 3KR4A 2B8FA 4HPSA 4QUCA 4FD4A 1DYQA 1HXYD 2XRQD 4KSIA 3CRKC 3C2PA 4BBHA 1Q2DA 2BL1A 2R93G 1XMBA 2KCTA 2JN4A 3I70A 4C1NK 3ICEA 1AMPA 2G9HD 2R6GA 3NTHA 2ATWA 2KA7A 2JA5H 3M4OH 1N33Q 4DJLA 1YNJD 5ELEA 1LRZA 1M4LA 4CGYB 2R1IA 4NDXA 1EYAA 3G71A 3NH4A 3H8FA 3CCMA 1BQQT 4A3GG 4J1MA 3S6FA 4TWEA 3TOAA 1D5ZC 4KJOA 4AVAA 3HOZH 2ZEEA 5IGFA 3L2NA 2ZW7A 3I7FA 4XXEA 4R76A 3KF8A 1ZYRD 3WDNA 4P10A 4P71A 3NXWA 4CGMA 1BCPC 3TFYA 2WIIB 1YR0A 1VHSA 2GANA 1DTDA 3JUWA 1LABA 4JWPA 1VF7A 3SI1A 1M90C 4B3MQ 2K5DA 5ELBA 3D8GA 2EYFA 3VWDA 4P4DA 2QMLA 3HOYG 4NGQA 2F52A 2QILA 2B2WA 1NMTA 1LTTD 2EQSA 4N9TA 3KJOA 4MCRA 2FFKB 1L2FA 4B13A 3D7HA 3L3OC 3K9TA 4QVTA 2ZEFA 2RBMA 4OC1A 1S5ED 4N9PA 2M2LA 4AG7A 3H15A 2AFXA 2Q2IA 4R4CA 4IFDG 3I4LA 3CCRA 3S16H 1AFPA 3JAME 4F88A 2GA4B 4MTNA 4Y7NH 1LOKA 5IGCA 3IO1A 5BN3A 4I49A 1BKBA 4CGNA 3FKIB 3D2PA 3KASA 1Z9FA 3PB7X 1FD7D 5C3EG 2B8GA 5C82A 2EOTA 2F0QA 2UU9Q 3A7LA 1RHPA 2KCCA 1E22A 1F9QA 1Q81C 1SMYC 1D8LA 2ZJRA 1YX0A 3FH4A 3IWEA 4GXHA 2E8GA 1IW7D 4NB3A 1R3NA 2FIAA 3CCSA 1XXGA 2L11A 2ZEGA 5F48A 1DM0B 3D4DA 1FY7A 3DEOA 4DV0Q 4LF5L 2OQ0A 3BG3A 5A35A 2VQFQ 2CXAA 4B10A 3I91A 3NHHA 2JA8H 4MTKA 4A3BB 1YNJC 4CDFC 1M4IA 4DNCA 2SOBA 1X56A 5EPLA 4I65A 4ONWA 1OXVA 1TWGB 4GZYC 4DF7A 3NTKA 3SI2A 3W91A 4MHPA 1UWYA 5ISVA 3I72A 1TWHH 3ULLA 4JBKA 1F57A 1QZHA 5HGQA 4DR2Q 4R8IA 3QWNA 1CFMA 1ARMA 2Q0YA 5HVHA 4KORA 5CORA 4XYQA 3V38A 1RODA 3MFYA 3TP5A 1Y8NB 4CBVA 3GTJH 3UDGA 2FXQA 3TE4A 3JAML 2LKVA 5HGTA 1N8RC 2EY6A 4ULLA 4L5QA 3NSWA 4NGRA 1YQEA 3EY5A 2RHSB 1B50A 5KGUA 2AE6A 4PMCA 3NBHA 2F4VQ 1FNUA 4ZRZA 4XDXA 4HIOA 2DY7A 2F3IA 2F0HA 1EYGA 3HKSA 2R92B 5DEHA 4R8NA 4C3JH 2IHFA 2IJZA 1VQJA 5C44B 1HZAA 5IODA 5CBMA 2ALYB 1GHJA 3S1NB 4GN4B 1Z9UA 1ENCA 3AYHB 2HDLA 2SNMA 2BO9A 4GNXA 4LF8L 4L5TA 1PTOB 4R1JA 3TRZA 4B14A 3LX0A 1WVLA 3I9SA 3B3SA 3E6ZX 2EJGC 2Q04A 3K58A 2MPMA 1YITA 2NVTB 2P6FA 4JYWA 3FIXA 4MJ8A 1PH3A 3J81i 1ICWA 2Z3PA 4KK7A 1HR0Q 2IL8A 1VQOA 4G7OC 3N7ZA 4YCUA 4OIJA 1D1KA 4HEDA 2QA4A 3UDFA 3QNVA 1SMXA 3ISZA 5CBEE 1PTOD 4JV5L 2PZWA 1CSPA 1BOBA 1STAA 5F09A 2E2IH 4A3IB 2UXDQ 4CKEA 5H84A 3LODA 2IWHA 5GADC 4JBMA 2CY2A 5D8NA 2EXZA 2BH2A 1KWMA 4ZI6A 4A4IA 1UEBA 4MN3A 2I00A 5KNCA 1QNKA 2F8HA 1EWHA 4BA1I 5J1QA 4DK0A 1FYCA 4QGUA 4NMZA 3R8BA 3R9GA 3SE0A 1J4JA 2K03A 2NVQB 1C9OA 1RD9D 4OAEA 2NSMA 4H2KA 3EVQA 1L0CA 4HIMA 3GTOB 1B9NA 4AQYL 2B3UA 2VNUD 3F1ZA 5AJ3L 4ZBGA 3BVMA 4DNIA 4KUBA 5IYBG 5JVG3 4A3MB 4UAIA 4KLVA 3FNCA 3F8KA 3IGRA 3IJ3A 3CPFA 3P2HA 1PVOA 5LRGA 5JPHA 1S4ZA 3H0GB 1IB1E 1UWVA 4IFDI 3TDQA 5IB0A 3CXSA 4ZUIA 5CV5A 5GAGC 4LFBL 2A19A 3T1HL 3KBXA 4BY1B 2PC1A 2F0FA 3PBEA 3U9OA 2ABZA 5M3FG 2ZEMA 3GLJA 1BPNA 4DV5L 2KBNA 4IPGA 4A33A 3KF6A 1DOKA 2REEA 4RUHA 2WP8J 1MJAA 1ZXTA 4PQXA 1Y1WG 5ELYA 3S1RH 3BDLA 1IBLL 4BA2I 1X65A 1JR0D 1NTGA 3EFXD 1C8CA 3K7UC 4MI4A 1P0HA 1SNQA 3SXOA 1S5DD 1A15A 1X55A 2F0NA 1S40A 4C3IB 4RWSC 4OIWA 3M7GA 1LUZA 1A0IA 5C4XG 1U4MA 2HCIA 2CTBA 4A3KB 2O2LD 3CKIB 5LMNQ 4XYOA 3I55A 1YJ9A 1WWZA 4P4EA 3FPPA 3FMCA 1Z2LA 3ER0A 1SE4A 1YVKA 1Z8TA 4LUAA 3OMCA 4NP5A 4KD4A 1X12A 3HZXA 1PZID 2C6GA 5HVGA 2BOSA 4K6DA 4A3JG 4CKBA 4R87A 1Z4EA 4JK1C 1A62A 4C7HA 3PIOA 1QB5D 2POKA 4WWVA 3D66A 2TSSA 3J7AF 1MIUA 2EYLA 2HHHL 4K0KL 3CCJA 1KUVA 3QJYA 3KDFA 4QL5A 1FNOA 1BBUA 2PMZB 2I5MX 2D4PA 1X9NA 1K8OA 4OADA 3DGVA 1AEXA 3J7YW 1SDFA 5ELCA 3Q23A 1GXDC 3TBIB 4ID6A 1DOMA 4A31A 2R93B 2ZW5A 2XNAC 2PVWA 3IWWA 2CFMA 2N55A 2BOAA 1Q1EA 5BR8L 1ET9A 1BLLE 2PJBA 4FWUA 3DHQA 2LXKA 4CGOA 5ELNA 4EFDA 2D0PA 2F7VA 3FHWA 1XJVA 4OWTB 1UNSA 2Q7BA 2H4OA 4A32A 1R4PB 2PQAA 3VR6A 1K8AC 4A3GB 1L0WA 2L1BA 4UF4A 1SE2A 3NQIA 2F0MA 2PJAA 2EY5A 5KRUA 1JJGA 3IKJA 1G2TA 5IT9E 1WTOA 1E3PA 2KJXA 2PJCA 1WCMB 4A3CH 1IBKQ 3CC2A 3T1YL 1O7ZA 1JB7A 4CYPA 3RR5A 1STYA 4DXGA 2A5HA 5IGDA 4JI0Q 3I4MG 3BZKA 3HOYB 5G21A 3DUZA 2QVPA 2EXDA 4OO1G 2B2WC 3KGQA 2WAQE 3P7JA 3FPUB 3DM3A 3D0FA 4RGOS 4M6IA 3F2UA 4K5VA 3JAMi 3VDYA 1QUQB 4EQOA 4HAEA 4J6HA 2I79A 2ZTDA 2DNEA 2JBJA 1N34L 1ASYA 1EFID 1LT3D 4DV6L 1TWCH 3TTHA 3I4NG 1PXUA 4AIMA 1KHIA 4U5YA 5C88A 5TSSA 4IOAA 1IOIA 4OC3A 1NCVA 3GTGB 1VGYA 1Y7EA 3BZDB 2ZM6L 5C3EB 3CPWA 4DYOA 2QGQA 4UEZA 1S5BD 2Q43A 5IT9L 2PJ1A 4J15A 4KN4C 1JQYD 1GOZA 5IWAQ 1CPXA 2GLFA 1Q8IA 3KUPA 2VZYA 4WRDA 1V9PA 2E2JB 5AG7A 1EEFD 3D68A 4BWGB 2SNSA 1ML0D 3H94A 4ME3A 3NH5A 3A8IE 4GKJL 1ICFB 4JZ0A 4JVZA 2VQEQ 3L9AX 3S1MB 1EYDA 1V43A 4A30A 2OZUA 2FINB 2KCWA 4LF9Q 4QBJA 1AYEA 1W2BA 3A5UA 1V8QA 4CRZB 1XBUA 3S2HH 2K1BA 1HNZL 1ARLA 5M3MG 1C7YA 4G4KA 4IOCA 2PQ8A 1DJRD 1WI5A 3QR8A 3SXHA 4EVYA 3HOWG 3PRTA 5DM63 3FRPB 3KF6B 4FF2A 3CXQA 1HUNA 4MHDA 4EQ5A 4MMOA 5JEAJ 1CP7A 4X66L 4R3LA 5C4JB 2A1AA 4X3RA 5THWA 1LV9A 2EIFA 2EJMA 1E7ZA 1Z7TA 1CT1D 1GUSA 4DR4L 3QB3A 1UE7A 5G3LD 3LMSA 1EU3A 3S14H 2L15A 1MBYA 5AG5A 1AE2A 4UY8C 4GLXA 4L63B 1C0AA 3U9SA 5HVFA 3P2FA 1SNPA 2AMCB 2B4DA 5FVJA 5G20A 1XX8A 3W1GA 2B2VA 3PB4X 4R6TA 4TQUS 3GTPH 3DDDA 4ZUJA 4KZTA 4ZYSA 3F2BA 2VEZA 4CDCC 2NVYB 3BVZA 4YCWA 4YY3L 3F2DA 1TF9A 3IFDA 2ZEDA 3I1UA 5HMNA 3M9BA 2LS01 2O53A 3RZAA 3S17B 3FP9A 1CZWA 3PP9A 1I94L 2ZXVA 2CWAA 3KZWA 3URYA 3TO7A 5DNFA 4XT3B 4DU9A 3PIO3 2C27A 3RLFA 4F87A 1U0LA 1LT6D 4YU9A 4XT1B 3AB9A 2A8VA 4MFPA 2JEVA 4UCNA 2ICIA 4UEFA 4FXDA 1VQBA 2DY8A 4P74A 3FRMA 2KENA 2X69A 1WJJA 1MJEA 3WC5A 4JI3Q 3C26A 5IY0A 3IFTA 1XMTA 1GHKA 1SYFA 3V05A 2CHBD 1SBBB 1MK4A 2B2UC 1J5EQ 1RL2A 4Z9CB 3KFUA 4P4FA 3HP3A 2L9HA 5E7NA 2ZXRA 1M1KC 5BWAB 4GLAC 1TWAB 2Q4VA 1MGSA 1PH4A 1ONLA 1LYLA 4B3TQ 2PZTA 2F0IA 3KLSX 3D6WA 4BXXH 1S7LA 2AFZA 4MZ9A 3PO2H 5H86A 1V1OA 4N8FA 2OZHA 3AQQA 2X7BA 3FB3A 2IL4A 3L0OA 4DR1Q 1YJWA 4H6UA 4CAVA 1FNWA 2B2TC 1XNRQ 4TVAB 2PPBC 4LF6Q 4H6ZA 1YGHA 4RS2A 3EXNA 1PLFA 2AFOA 2B29A 5JJZA 2VUMH 3ITPA 5JGFA 5K8OA 1Y9WA 2K33A 4Y52H 1GVPA 4M1UB 2UXBL 1LLRD 1PFSA 1UAPA 4HN7A 1IOFA 2WYRA 3FX6A 2F1MA 2YV5A 1Y1WB 4F6AA 2Q44A 3PFEA 2A73B 3CCVA 3UE1A 5CBAE 3RO0A 2Q7SA 2K5NA 1PYSB 1BR9A 3PB9X 3CC4A 1U5KA 4KOXA 1B7YB 2ASBA 2Z4IA 3MN8A 1TWFB 4K8JA 4B9WA 2JBKA 2PE3A 5C4XB 1VQ8A 1OBRA 5E3FA 4LUVA 4K8IA 2FSRA 2V8HA 3OOCA 4O0AA 2J8MA 1E2VA 2GVAA 1X54A 1CJWA 1QQ9A 1QCBD 3QOJA 3ERSX 2QJ8A 1L1OA 3B3TA 5I0CA 1D1IA 4DN4M 3DR6A 3IRBA 4B3SQ 4NXNQ 4LQ6A 4P45A 3STBD 1NNXA 4PXDA 2L4NA 3A74A 5LRKA 4GOPA 2CW0D 4A3JB 1ELMP 1UUPA 4HCEA 4K30A 5JPNC 3GTMH 4ZGYB 1AUGA 3D7FA 1JCKB 2AQ3B 1N32Q 2SEBD 4JI7Q 3W5OA 4DR6L 4KVOE 3HEJA 3W6XA 4OP4A 3D3RA 5ELFA 3M3YH 1B3QA 4UWJA 1R9TH 4HIDA 1XOVA 5IGEA 2UUAQ 4J3GA 3VA7A 3D8PA 2BCOA 4H7BA 2UUCL 1N36L 4YHHQ 2F5IA 1MSHA 1LTID 3HOZG 3GY9A 3TEHB 2Z8LA 4GM5A 2G5DA 2IJ0A 3VYRA 1H95A 5J8CA 1YLOA 1Y8OB 2DXQA 3EN2A 2CVRA 2B4BA 3K2KA 2JA7B 1XMQL 4KHZA 3FECA 2BA0A 3S6KA 1K83B 4JI8L 4X65L 1TKJA 1VQ7A 3LGJA 3R9FA 1E2ZA 4RAUC 3T4AC 1VQCA 1RTQA 2WINB 3M7NA 5H1SE 3CXCA 2YTYA 5I4MA 2K04A 1AP0A 2E2DC 4JBWA 2WB1E 4RHSA 3HS0C 1VIXA 2PIZA 2F0GA 3RD4A 4XPKA 2C6PA 3LWUA 2CNSA 5K36H 3S9MA 4DAVA 1JWQA 2D4OA 2Q8IB 2G0BA 2B4DB 3ISXA 4DKAC 4MFKA 4DV2Q 4LX9A 2IQ6A 2PJ5A 2KECA 3NEMA 2CNTA 4QJFA 4B5PB 1LTBD 1HNXL 4F9VA 4LK1C 4KI0A 1SEBD 4L5SA 3I4MB 2VZZA 5J39A 3T90A 1HNWL 4JG2A 4DV4Q 2OQKA 3PF5A 4UIAA 4R9MA 2RVLA 2WAQG 4DGZA 3K7AB 3I4OA 3RN2A 1Q7YC 1F2OA 1II3A 1EQRA 3SGIA 2CCZA 1QSOA 3K0XA 1QSTA 5EBDA 2EYOA 5FO9B 3MTSA 5J1ZA 2QEXA 4UFWA 3RNUA 1EIYB 3BZCA 3SHLA 1I3QH 3FXTA 3K8AA 4UFVA 1LO5D 1WFQA 1I12A 3FEDA 4F0YA 4BBRB 1NSAA 2YU9H 4R9WA 3I4NB 1N71A 4BMHA 2A6HC 1SLJA 1T9HA 3IIBA 3UI2A 2C9OA 4RI1A 4FAIA 2R98A 1I6HH 1PTOH 2RDHA 2R8VA 3B2YA 5M5YB 1SMYD 3HUVA 2JA8G 1Z6HA 1I50B 1CX8A 1KNEA 5C0XH 4DUYL 3ERQA 2ZJPA 4J8QA 3S2DH 5JPMC 4LF7Q 1KQSA 4PZ8A 1SJHD 5C0XJ 3M4YA 4JI1L 4DFAA 4A75A 2ZXPA 4OIDA 4M8AA 2GLJA 3RZOH 1NAPA 2OCEA 3G7LA 3ZJYC 3LNNA 4Q7AA 1HZ9A 1PDQA 5EKLA 4HNXB 1XPRA 4WJWA 4MHEA 1HRJA 1QE6A 1WD0A 1CA6A 3HOVB 5LMUQ 1PHJA 1U4RA 1YHAA 5CGKA 4LF5Q 3FEWX 4DNTB 1FJGQ 4FD5A 1YEZA 1SNDA 1SR3A 3GD7A 5M3MB 1TIQA 1KAAA 2V8GA 2ZW4A 3NWTA 2AWOA 4MXUA 3R95A 2PNHA 3GTQH 1QVFA 3BJUA 2JK8A 1LTGD 1PRTF 4DV1L 3HOWB 4C2YA 3KLRA 4FP5D 1F2LA 4C3JG 2Z0ZA 4KY5A 3RZDB 4RA8A 2N49A 1E1TA 5KYIA 3IWGA 4A93H 5E96A 1XNQL 4LAAA 4A3FH 2B63H 4ZYQA 4C2XA 2IMOA 1PH2A 1BPMA 2E2HH 2HIVA 2PRBA 2O4HA 1K73C 3AFPA 2Z3NA 4OC4A 2C35B 4UIBA 1IKMA 2F3VA 1OTCA 2ZOGA 2Y0MA 2RSNA 5EC4A 4RHRA 5CV4A 1HHVA 1MD2D 2EO8A 5G22A 3H0GH 1B70B 3BXMA 3H5ZA 1R43A 3CU7A 4IUVA 4OKOA 4GKKL 1L1OB 2F0JA 4FVMA 4ZAIA 4KV6A 2ENBA 2RDFA 3M4QA 4BY1H 2QDLA 2PJ9A 4NXML 1TIID 1HDUA 5FLMH 4FO2A 1HZCA 4GOPB 5KTAA 3HKZG 2QEJC 4R8FA 1H9JA 2JE6I 4LF8Q 1D6EC 2R3ZA 3FJUA 1VQ4A 3G6JB 2P5ZX 2CTCA 2ZOFA 4BY7B 1IYLA 1EZ6A 3SJXA 3KLSA 4DV7L 4I7AA 3SK6A 3MAQA 1W6JA 2K52A 1YREA 3U4VA 4OIKA 3BYTB 3PUVA 3MXNA 4C3IH 2ATRA 1PH6A 1WTRA 3CZXA 3RUZA 3OSOA 1SFOB 1Z5RA 4JOIC 4X5KA 2NVXH 1HDQA 4UEEA 4B5OA 4NF1A 2K5WA 3S15B 5COYA 2RFHA 1VF5C 5JJKA 3B3VA 4L89A 4Y49B 3D4WA 3K5OA 3SK5A 4MCSA 3DNSA 3CT9A 1N33L 1B4OA 3K5NA 3WOFA 1ZG9A 4U673 3BI0A 1BCPF 1YK3A 1YVOA 2X6GA 4X3TA 4X64Q 3NP8A 4IURA 2OH1A 3R2IA 2YNCC 3GKRA 2AJ6A 4LFAQ 3FBUA 3CCEA 3I3GA 3K6OA 5IP9H 4DR3Q 5AJ3Q 4H13C 5CV7A 4YCVA 5FJ8H 3GTKB 4ZX9A 1CSQA 4WORA 1K0SA 2GFQA 3CDXA 4JC0A 3MVVA 1X6OA 2CWPA 5FK9C 3KBGA 2PR8A 2VXKA 1HQMC 2K5VA 5FO7B 1I1DA 1GUTA 1LFWA 1JT8A 4DUZQ 5D29A 3S24A 1D5XC 3NBIA 2K7VA 4POGA 3MEHA 1WYDA 2JQOA 3MWYW 3Q0AA 3BU2A 1EQQA 2O5IC 2WUUA 1BXTA 1WCMH 1EFWA 2HC9A 4HNWB 2ZT9C 3GTLB 4CAEA 3GV3A 1KNAA 5K5PA 4LMQD 4HJ5A 5I9PA 4QB9A 2JLMA 4JYAQ 1ASZA 1YIJA 4IUNA 1EY6A 1L0XB 3FDTA 1EYCA 4LF4Q 1A63A 3G3SA 1L1OC 2UU9L 2A74C 3C46A 1EOVA 1JOKA 2Z0SA 1S5CD 3P75A 4GOPC 1XF8A 3JTKA 4PQAA 4KD3A 5C6AA 4ZY0A 3T51B 2Z6KA 1U9RA 4OEMB 2JA5B 1SSOA 4RMFA 4F8ZA 2B2YA 4NJRA 1G6ZA 1M4GA 4PZ6A 4HR7B 1PFNA 4DV0L 1JWSD 2VQFL 3FVLA 2HQYA 4KVME 3K5LA 2OWOA 3BJ7A 2AWNA 4XPLA 1PYBA 2GN5A 2B58A 3VA5A 1OXTA 2VY3A 2FIWA 4KTAA 3KF8B 1PU9A 5EPJA 3Q8DA 1BO4A 1CUKA 1SJED 3JRUA 2K6AA 4ZKCB 2DNCA 4L5RC 3F5BA 2K32A 4PK3A 4PSXA 3IL8A 3TZUA 1KUXA 4P6YA 3S9NA 3KYHC 1JORA 4FDBA 1Q12A 4BBSH 3OMGA 2F0OA 3KK7A 4H02A 4DXFA 2H5MA 1YZ6A 4TSSA 4Y49C 2C5CA 4A3CG 4DK1A 3CXPA 2F0PA 2L12A 2WB1G 5F2DA 4PMBA 3OWEB 2ZJQA 7CPAA 1HA5A 2KHSA 1A3VA 1EIHA 4ZCKA 4KHPQ 1I21A 3E0EA 4HJ8A 4LNQA 4IZ8A 5IE8A 4F9UA 2F4VL 4HSPA 2F3WA 1KD1C 2FVGA 4LWCA 4JPBW 3PIPA 1K9MC 2SDFA 3H91A 4OHJA 5EGTA 2XEGA 5J8FA 2I3CA 3M85A 3KL9A 2WV6D 3GO5A 2QECA 3S16B 1K8MA 1TXRA 5C4ZA 1STNA 2P6GA 1U4PA 3LACA 4Y7NB 4S3SA 1MSGA 2VBQA 2WAQB 4IUTA 1VS0A 5IGGA 1GO3E 1QILA 2D9UA 1HTPA 2AHOB 5GAEC 3RBUA 3T56B 4AXVA 3IEHA 3FYNA 4H44C 2O28A 1U6MA 2Q2UA 3B3CA 4JXQA 2XEFA 3HRZC 4YWMA 1PYWD 1HR0L 3KQZA 1G291 3PF4A 3PO3H 2N8NA 4HMJA 2E75C 1WTXA 3E0KA 4V0BA 4MHZA 5CV8A 4KLWA 1EY5A 4DR7Q 4C3HG 1FR3A 2N78A 2JA8B 2PR1A 1BUVT 2UXDL 2NVYH 3UY5A 4G57A 3MXGA 1BBXC 3S17H 1EU4A 1TWHB 1TKHA 2ZPAA 1S3ZA 2F0VA 2A6ED 3JVNA 3VWEA 5IYCG 1JB3A 5D3IB 3GTJB 1EQVA 1Q1BA 3CPAA 1SN8A 2D2CC 5JEAG 2PJ7A 3J7ZC 4X8IA 4C7IA 4A3EG 1STEA 3JC66 3NBHB 1SYDA 2EVBA 4GKJQ 1X10A 3FF3A 3A55A 4JD6A 5KNDA 2MJ8A 3OW7A 1MJBA 1MJ9A 2Q4ZA 5GCNA 3J81j 2XEJA 1ON0A 5EBCA 2DJGC 4LFCQ 3BHXA 3PMFA 1JC7A 3S9WA 2NWGA 3PQIA 5L37A 3L2PA 3O13A 2JA6H 4GNXB 4NPSA 1STBA 3G4SA 2VQYA 2A68D 3MA2B 1Y7RA 1D5MC 3A0JA 2K50A 1ILQA 3H3VH 2BUEA 4HNYB 3OIPA 4C2MH 5G1ZA 4CGLA 1I4QA 5EQ0A 4CYNA 1CKMA 1PH5A 3SI0A 3GIUA 5DAUA 4A3DH 2R7FA 2F0UA 3UDIA 3ULJA 1GHEA 1TKWB 1BDOA 4B08A 4IK2A 2LMCB 1PTOF 1VQDA 3DLJA 4KSAA 2UXCQ 2XVSA 5FKAC 3BLNA 2J7ZA 5LYLA 4JI6Q 2XEIA 2PNRC 5A28A 2QIRA 2E2IB 2HV2A 4JI2Q 2ZENA 1F2MA 1OO9B 2R61A 4FXGC 1JOQA 2MFIA 1G6PA 1DE4C 5CC4A 3KLWA 2A69C 2JSOA 2QW7A 2NZ1D 4X6AH 1V1PA 1ENAA 2XN9C 5GAHC 1YHQA 4JXRA 1TWFH 1D2BA 2EYMA 2I5HA 2R7ZG 1TU2B 4IHMA 3NUCA 3R96A 3GB0A 4C3HH 3P1HA 5IX3A 2WPXA 2A6EC 2RCNA 1YHBA 3OPOA 3WWVA 2REFA 2I5LX 3HOXH 5GQOA 4BXXG 2EY2A 3PO2G 4DUKA 1H9SA 1O7LA 3UE0A 2JP1A 3CQZH 5IYCH 1X3EA 5CMDA 5A2QE 2PJ6A 1CQVA 1I4XA 5JEAH 4G1PA 1Z8LA 4ALPA 4A3EH 2VUMG 1B44D 1EL0A 4YWYA 5JAVA 1K4JA 4ILWA 4DV3Q 1ZLIA 4AH6A 4IPHA 2Z4HA 4CAFA 2A68C 4DAMA 2C6CA 3PIP3 1TT2A 4OXPA 3S1RB 1QWYA 1PH1A 4FD7A 2OXPA 3EQLC 1IBKL 3B7IA 1NE9A 4UA3A 1XTCD 2D62A 4FF1A 3TP6A 4JBJA 1FVIA 1Y0RA 4JI0L 5A27A 2IX0A 1IYVA 4NGTA 4MFJA 4NW2A 4Q38A 3T9YA 4RG1A 4X62Q 1LAMA 2EVNA 4GNXC 1IBML 4CJ0B 1YSJA 5M5XH 3TX8A 3QO2A 1YBYA 3A54A 2MNAA 1JJ2A 4MNOA 2HD3A 1YI2A 4KMUC 4O2DA 5C4HA 2PSWA 3HKZE 4HTHA 3TZDA 1CKOA 3K5MA 1TVXA 2BA1A 2ANPA 1CK1A 2KQ3A 5A2QL 2NN6H 3KDFB 3B6YA 5EJWA 1IICA 1E1OA 4LUOA 1Q8KA 1GKHA 1K0RA 1AE3A 3X3MA 3X3NA 2D5DA 3DWPA 1XMOQ 3D7DA 1VQMA 2NBFA 1G51A 4A76A 2X6LA 2N88A 4HCSA 4K6LA 5AG4A 8CPAA 4NSQA 3FKIG 1Y1VH 1SAPA 2XGTA 3EROA 4RGNA 1G8ZD 5DLQE 4DR5Q 1PH8A 2GIVA 2PJ2A 4MFQA 2LY7A 4YWKA 5I6WA 3MGDA 5IWAL 3BJ8A 2DEAA 2EZVA 3HOUH 2PQAB 4P4BA 4IF5A 2O5JC 2IHEA 1H9RA 2Z6KC 5JJLA 3AEVA 4BBRH 2B2YC 2R7ZH 2DUDA 2MP1A 1KXLA 4C2ZA 3R1KA 6CPAA 3OTOQ 2VQEL 4RGTA 1Q3LA 4PNYA 1UE1A 5T1IA 1NY4A 5ISRA 5LL6X 4XQQA 1TS3A 4LF9L 5IP7H 2HUZA 4JJXA 4K5WA 1HCZA 1SRUA 4P2CB 3C1FA 2HIXA 3CPXA 1DXMA 2L55A 3CCQA 5K36G 4ZX8A 1Z4RA 2CIJA 1PFBA 3AFQA 5M9OA 1X3PA 4XPDB 1WK4A 1CG2A 2FHTA 3PSIA 2WB1B 1FNVA 4OL7A 2F0TA 4X65Q 4M3SA 4RFBA 2YYZA 5LHY1 5M3FB 2EYJA 3HOVH 2Y0SG 1O7IA 4IJLA 1VQ9A 4CKCA 2XWJB 4AG9A 1TS5A 5HY6A 2BH8A 2E5LQ 2CNMA 2DJFC 2Z9HA 4JI4Q 1Y9KA 2GE3A 1VHOA 5JVH3 3GV6A 1S72A 1OXUA 5IYDH 2MHVA 2K75A 2P0WA 3KOJA 2R92G 3TQYA 1NSLA 4B3RQ 3MXUA 4UCPA 3KQXA 4FBEA 4MCQA 2QDBA 3TREA 2M00A 3D2MA 5K8PA 2VB3X 3PB8X 3KKWA 4CHTB 1HFNA 2V77A 3MRUA 1V1PB 1Z8XA 2G3AA 2AFWA 4AVCA 4JI5Q 4E8OA 1BF4A 5C0XG 5DM73 3K81C 2A6HD 2IY5B 2XWBB 4UP8A 2UUBQ 4RCOA 5I6YA 3TO6A 5HURA 1AW7A 5CNPA 5IGBA 3PEIA 4MY0A 4OX9Q 4K2KA 4P4IA 2NTSA 2Z10A 2ID0A 3CCLA 3I56A 4PXCA 2XIWA 2J8NA 1A2UA 4QF4A 1CHQD 3NK9A 3FKIH 4JI3L 1DZ1A 4E0AA 2CH4A 4LQGA 5KNBA 2DPTA 1XIXA 4X3KA 4NGMA 4UP7A 3S2HB 4B12A 4DUYQ 2KCMA 1J5EL 1T5XD 3KHZA 2OOTA 3DXJC 1VQGA 1JOOA 2C1CA 2ZEOA 1S7FA 3F0AA 4A95A 4B3TL 3A8JE 2CQAA 5G3LF 1HZBA 3T16A 4Q0FA 4X3SA 4HJAA 2KCNA 4A93G 2EK9A 4R4QA 1B87A 4A3FG 2B63G 4A3BH 3H09A 3F2CA 2FJ2A 2WSAA 1PA6A 4FXKC 1PMRA 1TWGH 1EY7A 3NFZA 1Y69U 1RDPD 4LF6L 3S9LA 2ZW6A 3E9HA 3S14B 3D4RA 4LW1A 4OELB 2RC4A 2FCKA 3S6HA 2EY1A 3A7AB 4LUZA 1M8AA 3N52A 5D14A 2FE7A 3QG1A 3K9UA 3H0GG 1CBXA 3NTIA 5CYUA 3J80i 2CKZB 4DV1Q 1SQHA 5F46A 1QVCA 1QJOA 3E9IA 1EWCA 3GDEA 1QSMA 4BY1G 3GTPB 4XPDC 5FLMG 1F9PA 3D67A 1KRTA 4AYBE 2NYQA 1IYKA 3RYOA 4CYQA 3RAMA 5KYLA 3GTKH 2NZOA 1KIXA 1D7QA 1LAPA 3GUXA 3CMAA 5I4DA 4IUPA 2R92H 4RH6A 3ZJ0A 1EIFA 5C44H 4EQPA 3S1NH 1CQFA 1Q82C 3TT2A 4C3IG 3TS0A 3BYYB 4A3KG 3QB8A 3TP8A 4NXNL 4B3SL 3Q22A 2I0QA 3EC4A 2Q8RE 1IHZA 4DPGA 3TSSA 1S5KA 4HKFA 4NCZA 2RF4A 2NVTH 3NPPA 4C56C 1FGUA 3KR5A 1N32L 1LTSD 4JI7L 3MC0B 3K0YA 4R4IA 5KTDA 1KDBA 1I4RA 4TRDA 3GTLH 4PPZA 3TO9A 5K8NA 4KOYA 2AKWB 1H9KA 1SYBA 2UUAL 1RCVD 2YTVA 4H0LC 4YHHL 1UFHA 4BD9A 2RCFA 3PO2B 3RMHA 3N5FA 3VYTA 5IP9G 5JM6A 2A4NA 1EEID 4A3IH 1VCIA 2YTXA 1S7NA 2V4DA 3A5ZB 2KHJA 3QIAA 2Q51A 2PCUA 4B6ZA 1IYUA 2K01A 5FJ8G 3QAHA 1P16A 1YW4A 4PG3A 2NVQH 3MFGA 4WFN3 3J80c 4U9YA 4W9YA 5F47A 2PQEA 2L5TA 2VUMB 4KN7C 4PZ7A
chains in the Genus database with same CATH topology
2EYPA 3NWSA 2RSOA 2K28A 3T13A 4PV1C 1B53A 5E4WC 3DWQA 4OC5A 1I4GA 4DAYA 5C0XI 2F0LA 1WTQA 3PB6X 4P44A 5LYFA 4PXEA 1GYTA 1ILPA 1ZLHA 2GU2A 2QYVA 1KDAA 2IW3A 5CR3A 2B2VC 1AZPA 2QKIC 3SR1A 4L8JA 3TN2A 3T8WA 5E4XA 2MUYA 3GTMB 3TMEA 1EY9A 3I8ZA 4QCLA 2Q8TA 1XRYA 4RGMA 4MHNA 3VARA 1CP6A 4EWTA 3M3YB 4Q5VA 1R9TB 2RKSA 4K14A 1KLGD 3VR4A 5M5WB 4MCPA 1C48A 4WJBA 1HPCA 4IQZA 4ME5A 1F2PA 1DOLA 2EDGA 3SDZA 2EYHA 1CM9A 2EJFC 1NR4A 2BDOA 1EQTA 2F0SA 1E0BA 2V8DA 1LT4D 3D6CA 5AFWA 4ZY2A 1CA5A 2M9VA 3LWEA 3J7AV 2HUGA 4YIJA 1SYEA 3KI9A 3T53B 3B35A 4OGQC 3S1QB 2AUKA 2CF4A 5C3XA 1SE3A 1HQRD 4X3UA 1SYCA 4R7MA 1X32A 2Y0SB 4XQNA 4QIWB 1ZYRC 3AMUA 4NGSA 2AQ2B 2E74C 5D65A 1TS2A 1ZG7A 1VDZA 1X3QA 2WKDA 2JEWA 4ODGA 1CTMA 1NR2A 4O42A 3H8EA 5LRJA 1Y8PB 1I3QB 1O78A 3E5SA 1RTNA 3PUYA 3A56A 4F8MA 2PJ8A 3R93A 2YU9B 5IB9A 5I2YA 2F0EA 1OXXK 5LYDA 5IOCA 3HLPA 1I6HB 1TR5A 5LYIA 5HXDA 2F0DA 2I46A 1MI2A 1W6KA 2KVMA 3S2DB 1IGBA 4EQNA 3FVQA 4IUQA 1PZKD 3N6RA 1WTPA 3V2TA 3M4OB 4IFDH 3RZOB 4OMEA 2NUCA 2F03A 2NTTA 5EKIA 4IFDJ 4ZK9B 1H8LA 4C1NI 1PYTB 3EA6A 2KUMA 1IW7C 2FMMA 3HOZB 4RKBA 1IY7A 1LTAD 4TNUA 1EIGA 4RKLA 1A6XA 1IKLA 5EKKA 2XRSD 3K57A 3IFEA 1Q7LA 1ZEQX 3GTQB 2B2UA 1DD2A 1YW6A 3OWFA 3SEBA 4A93B 4DNRB 4A3FB 2B63B 1VMPA 4X2TA 1SNOA 1LANA 2BE5D 1WD1A 2E2HB 1HEEA 3VH9A 1XYIA 2VXWA 3C1EA 4XQJA 4A38A 1GUOA 4K5XA 2B2TA 2JEAI 3B3WA 4ZKBB 3BVGA 2ZEHA 3PV0A 5LL6S 3MHBA 2ZELA 1PFMA 3NQTA 3CHBD 5NUCA 4BS9A 1U4LA 1J9OA 2K5QA 1ZKOA 4EVOA 3VR3A 2J0TD 1PZJD 1RJTA 4IUUA 4FUUA 2L0CA 4P4JA 1XJOA 2F4IA 2PCFB 2A69D 2OEOA 1F9SA 1AZQA 2OR4A 3V96A 1Z47A 1ZG8A 2NVXB 1HA6A 1ESFA 1JICA 5CPAA 1PTOC 1GUWA 1I6VC 5J22A 1O80A 3WT4A 2KEEA 2NB0A 4Z65A 4ZLTF 3IAYA 1QG7A 4KJNA 4KKSA 3PUXA 2BE5C 1EY4A 4I7ZC 1QOHA 4C3JB 3D7GA 3R3OA 4FF3A 1G91A 3IC1A 4EMEA 1H9MA 4KKTA 5JH9A 3J80E 4ZY1A 2JXMB 1XFOA 4K3NA 1UEAB 3TP7A 2ZXOA 4KY6A 2J4XA 1LTRD 1RKNA 1GJXA 4LJZC 3OHXC 1BNZA 2NN6G 5FO8B 3ND9A 5IIFA 3HKZB 1TS4A 3HGBA 3D31A 3PUWA 3MXPA 3HG9A 2HB6A 2WKCA 3NE5B 3ND8A 1C4QA 4HMIA 3Q24A 1BAVA 4CJ1B 1OXSC 1AN8A 2PJ3A 4PMWA 4G7HC 3FEEA 1CI3M 4HSVA 1EOTA 1JQGA 5FLXE 2H1EA 1ELLP 1ET6A 1EY8A 1VMCA 2PRQA 3KHXA 3J80L 3VYSA 1XWEA 4QUFA 2RA4A 3Q6SA 1NUCA 2JYOA 3I3CA 4FF4A 4RCNA 2AFSA 2PZUA 2B39A 4BBSB 4F7XA 5EPKA 5C3WA 2PJ4A 1LT5D 1BOSA 1IL8A 4MRIA 1L0YB 5ELDA 2V8VA 1B3AA 1CZGA 1VHEA 3BDOA 4QMGA 1M4VA 4E6IA 2PW5A 2QCPX 4V190 2AFUA 1NSNS 3DM1A 2IX3A 1A3TA 3VR5A 3SVMA 5FLXL 1HUMA 2I07B 5C5MA 3WABA 2EPBA 2F0KA 3A8KE 3ZYYX 1STGA 3E0JA 1WTVA 2E76C 3R2TA 3K59A 2VL1A 1T5EA 4XIGS 2HDMA 4OC2A 1TQOA 1QMUA 1S5FD 3OIQA 3W3AA 3PO3B 1TY0A 5I2XA 5KEEA 3EJIA 3H8GA 3CRLC 3SK8A 2LFNA 4OO1H 3SJGA 5CV9A 2PO4A 5T1GA 4A37A 1B9MA 3DWAA 2TMPA 3BDCA 3MZ5A 2Z1CA 1A3UA 3I90A 3DEPA 1TY2A 3I73A 5DS0A 2XSCA 1TF8A 2RQXA 4L6TB 4K2LA 1GUNA 4B9XA 4IALA 1F9RA 4NJQA 4CJ2C 4FYDA 4OC0A 4XTCS 2HCCA 5E1FA 2NN6I 2JA6B 2AFMA 4U68A 4A94A 3SK4A 4QB4A 1Q90A 1JWMD 2KEDA 1YNND 4O1NA 4C2MB 2QF7A 1ESRA 5I9OA 2JEBI 4OO1I 1PRTB 2ZEPA 4A3DB 5K8MA 2OF1A 1FT7A 1HTLD 4UDUC 2PVVA 3V7ZA 3GQBA 2AQ1B 3L7ZC 4O23A 3QOLA 5BN4A 1CPSA 1YMEA 4AYBB 1EY0A 1TWCB 3VATA 2G9DA 3PUZA 4NGPA 4IN3A 1PRTD 3SJEA 2EK8A 1TKFA 1JE4A 4ABNA 1KABA 3BS1A 3VYUA 4NFRA 1SNMA 1STHA 3D4UA 1KLUD 2BDNA 1CHPD 1LCPA 4TKOB 1EE3P 1WTWA 2GREA 2PIYA 1O7YA 1RF2D 1GUGA 1G2SA 4C3HB 3J81E 4KY7A 1H9SB 2AUJD 4A39A 2KOLA 4ZQ3A 3WC6A 3HOXB 2VB2X 4DA2A 1HFGA 2IX1A 1PCAA 2EE1A 2PYKA 5FOBB 3CQZB 4CPAA 4NKLA 3TC8A 1LACA 4MHYA 1J8IA 5BN5A 4A3EB 2PJ0A 3PBBA 2MGSA 1I4HA 1JWUD 1QNUA 1SYGA 4DAPA 1BCPB 2FMCA 2PW7A 1I4PA 1SNCA 2RB7A 3PFOA 1YNNC 2ICEC 1FGBD 2DN8A 2EWBA 2HQEA 2IT1A 2K05A 2RDGA 1DCZA 1B2TA 1R4QB 3NH8A 3DMUA 3AU7A 2WZNA 3H6MA 3J81L 3W2DA 4IAVA 3VR2A 1SXTA 5M5XB 4EGVA 3NA6A 1KDCA 1BCPD 5KIXA 1F2YA 3H3VC 1F2ZA 3GP7A 1Y0YA 3ONAB 3WOEA 1A2TA 1PRTC 4FNFA 4KHVA 3BI1A 2F0WA 4NGNA 2IPKD 5C5LA 4G7ZC 1F77A 4KKUA 1DONA 1ENFA 1KTKA 5CV6A 2WACA 1B1ZA 1Y1VB 3C3LA 3SJFA 3WC7A 2OT2A 2O4XA 1BO0A 2NYZD 3HOUB 5JOBA 1E2WA 2R7ZB 5D3DA 4MIUA 2J9AA 4PXBA 1RTOA 3P20A 2CW0C 1EZ8A 3KR4A 2B8FA 4QUCA 1DYQA 1HXYD 2XRQD 4KSIA 3CRKC 3C2PA 1XMBA 4C1NK 3I70A 1AMPA 2G9HD 2R6GA 3NTHA 2KA7A 4DJLA 1YNJD 5ELEA 1M4LA 4CGYB 4NDXA 1EYAA 3NH4A 3H8FA 1BQQT 4J1MA 4TWEA 1D5ZC 4KJOA 2ZEEA 5IGFA 3L2NA 4XXEA 4R76A 3KF8A 1ZYRD 3WDNA 4P10A 3NXWA 1BCPC 2WIIB 1DTDA 1LABA 1VF7A 3SI1A 2K5DA 5ELBA 3D8GA 2EYFA 4P4DA 4NGQA 2QILA 2B2WA 1LTTD 4N9TA 4MCRA 2FFKB 3D7HA 3L3OC 3K9TA 2ZEFA 2RBMA 4OC1A 1S5ED 4N9PA 2M2LA 2AFXA 4IFDG 3I4LA 1AFPA 3JAME 4F88A 2GA4B 1LOKA 5IGCA 3IO1A 5BN3A 3FKIB 3KASA 3PB7X 1FD7D 2B8GA 2EOTA 2F0QA 3A7LA 1RHPA 2KCCA 1F9QA 1SMYC 3FH4A 1IW7D 1R3NA 1XXGA 2L11A 2ZEGA 1DM0B 3D4DA 3DEOA 3BG3A 5A35A 3I91A 3NHHA 4A3BB 1YNJC 2SOBA 5EPLA 4I65A 4ONWA 1OXVA 1TWGB 4GZYC 4DF7A 3NTKA 3SI2A 4MHPA 1UWYA 3I72A 1F57A 5HVHA 4R8IA 3QWNA 1CFMA 1ARMA 5CORA 4XYQA 3V38A 1RODA 3MFYA 3TP5A 1Y8NB 4CBVA 3JAML 2LKVA 5HGTA 2EY6A 4ULLA 3NSWA 4NGRA 1B50A 5KGUA 4PMCA 3NBHA 1FNUA 4ZRZA 4XDXA 2DY7A 2F0HA 2R92B 5DEHA 4R8NA 2IJZA 5C44B 5IODA 5CBMA 1GHJA 3S1NB 1ENCA 2HDLA 2SNMA 2BO9A 1PTOB 3LX0A 1WVLA 3B3SA 3E6ZX 2EJGC 3K58A 2MPMA 2NVTB 4JYWA 1ICWA 4KK7A 2IL8A 4G7OC 4OIJA 1D1KA 4HEDA 3QNVA 3ISZA 5CBEE 1PTOD 2PZWA 1STAA 5F09A 4A3IB 4CKEA 2IWHA 5D8NA 2EXZA 4ZI6A 1KWMA 4MN3A 5KNCA 1QNKA 2F8HA 1EWHA 4BA1I 5J1QA 4DK0A 1FYCA 4NMZA 3R8BA 3SE0A 2K03A 2NVQB 1RD9D 2NSMA 4H2KA 3EVQA 3GTOB 1B9NA 2VNUD 3BVMA 5JVG3 4A3MB 4UAIA 3IJ3A 5LRGA 1S4ZA 3H0GB 4IFDI 3TDQA 4ZUIA 5CV5A 4BY1B 3KBXA 3PBEA 2F0FA 3U9OA 2ABZA 2ZEMA 3GLJA 1BPNA 1DOKA 4RUHA 2WP8J 5ELYA 1ZXTA 4PQXA 3BDLA 4BA2I 1JR0D 3EFXD 1C8CA 1SNQA 1S5DD 1A15A 2F0NA 4OIWA 4C3IB 4RWSC 3M7GA 1U4MA 2HCIA 2CTBA 4A3KB 2O2LD 3CKIB 4XYOA 4P4EA 3FPPA 3FMCA 1Z2LA 1SE4A 3OMCA 4NP5A 4KD4A 3HZXA 1PZID 2C6GA 5HVGA 2BOSA 4K6DA 4CKBA 4JK1C 1QB5D 2POKA 4WWVA 3D66A 2TSSA 3J7AF 2EYLA 3QJYA 1FNOA 2PMZB 1K8OA 3DGVA 1AEXA 3J7YW 1SDFA 5ELCA 3Q23A 1GXDC 3TBIB 4ID6A 1DOMA 2R93B 2XNAC 2PVWA 3IWWA 2N55A 2BOAA 1Q1EA 1ET9A 1BLLE 2PJBA 4FWUA 3DHQA 4EFDA 2F7VA 1UNSA 2H4OA 1R4PB 3VR6A 4A3GB 2L1BA 4UF4A 1SE2A 3NQIA 2F0MA 2PJAA 2EY5A 5KRUA 3IKJA 1G2TA 5IT9E 1WTOA 2KJXA 2PJCA 1WCMB 1O7ZA 1STYA 4DXGA 2A5HA 5IGDA 3HOYB 3DUZA 2QVPA 4OO1G 2B2WC 3KGQA 3P7JA 3FPUB 4RGOS 3F2UA 4K5VA 4EQOA 4HAEA 4J6HA 2DNEA 2JBJA 1EFID 1LT3D 1PXUA 5TSSA 4OC3A 1NCVA 3GTGB 1VGYA 1Y7EA 3BZDB 5C3EB 4DYOA 4UEZA 1S5BD 2Q43A 5IT9L 2PJ1A 4KN4C 1JQYD 1GOZA 1CPXA 2GLFA 1Q8IA 3KUPA 4WRDA 2E2JB 1EEFD 3D68A 4BWGB 2SNSA 1ML0D 3H94A 3NH5A 3A8IE 4JZ0A 3L9AX 3S1MB 1EYDA 1V43A 2FINB 1AYEA 1V8QA 1XBUA 1ARLA 2K1BA 4G4KA 1DJRD 3SXHA 3PRTA 5DM63 3FRPB 4FF2A 1HUNA 4MMOA 5JEAJ 1CP7A 5C4JB 5THWA 4X3RA 1LV9A 2EJMA 1Z7TA 1CT1D 1GUSA 3QB3A 5G3LD 3LMSA 1EU3A 1MBYA 4L63B 3U9SA 5HVFA 1SNPA 1XX8A 2B2VA 3PB4X 4R6TA 4TQUS 4ZUJA 4ZYSA 2NVYB 3BVZA 1TF9A 2ZEDA 3I1UA 3IFDA 2LS01 2O53A 3RZAA 3S17B 1CZWA 3KZWA 3URYA 5DNFA 4XT3B 4DU9A 3PIO3 3RLFA 4F87A 1LT6D 4YU9A 4XT1B 3AB9A 2ICIA 4UEFA 4FXDA 2DY8A 2X69A 3WC5A 3IFTA 1GHKA 1SYFA 2CHBD 1SBBB 2B2UC 4Z9CB 4P4FA 3HP3A 2L9HA 2ZXRA 1TWAB 1MGSA 1ONLA 2PZTA 2F0IA 3KLSX 3D6WA 2AFZA 1V1OA 1FNWA 2B2TC 2PPBC 1PLFA 2AFOA 5JJZA 3ITPA 5JGFA 5K8OA 2K33A 4M1UB 1LLRD 4HN7A 1UAPA 2WYRA 3FX6A 2F1MA 1Y1WB 3PFEA 2A73B 5CBAE 1BR9A 3PB9X 2Z4IA 3MN8A 1TWFB 4K8JA 4B9WA 2JBKA 2PE3A 5C4XB 1OBRA 5E3FA 4K8IA 2V8HA 3OOCA 1E2VA 1QQ9A 1QCBD 3QOJA 2QJ8A 3B3TA 1D1IA 4DN4M 4P45A 4PXDA 2L4NA 5LRKA 2CW0D 4A3JB 1ELMP 1UUPA 4HCEA 5JPNC 3D7FA 1JCKB 2AQ3B 2SEBD 3HEJA 4OP4A 3D3RA 5ELFA 5IGEA 3VA7A 2BCOA 4H7BA 1MSHA 1LTID 2Z8LA 4GM5A 2IJ0A 3VYRA 1YLOA 1Y8OB 2CVRA 3K2KA 2JA7B 4KHZA 3FECA 2BA0A 1K83B 1TKJA 1E2ZA 4RAUC 3T4AC 1RTQA 2WINB 3M7NA 5I4MA 2K04A 1AP0A 2E2DC 4JBWA 4RHSA 3HS0C 1VIXA 2PIZA 2F0GA 3RD4A 2C6PA 3LWUA 5K36H 3S9MA 4DAVA 2Q8IB 3ISXA 2IQ6A 2PJ5A 2KECA 1LTBD 4F9VA 4LK1C 4KI0A 1SEBD 3I4MB 5J39A 4UIAA 2RVLA 4DGZA 3K7AB 1F2OA 1II3A 5EBDA 2EYOA 5FO9B 3MTSA 5J1ZA 3SHLA 1LO5D 3FEDA 4BBRB 1NSAA 4R9WA 3I4NB 2A6HC 3IIBA 3UI2A 2C9OA 4FAIA 3HUVA 1PTOH 2RDHA 3B2YA 5M5YB 1SMYD 1Z6HA 1I50B 1CX8A 1KNEA 5C0XH 3ERQA 4J8QA 5JPMC 1SJHD 5C0XJ 3M4YA 4DFAA 4OIDA 2ZXPA 4M8AA 2GLJA 1NAPA 3G7LA 4Q7AA 3LNNA 1PDQA 5EKLA 4WJWA 4MHEA 1HRJA 1QE6A 1WD0A 1CA6A 3HOVB 1U4RA 5CGKA 3FEWX 4DNTB 1SNDA 3GD7A 5M3MB 1KAAA 2V8GA 3NWTA 2AWOA 4MXUA 1LTGD 1PRTF 3HOWB 3KLRA 4FP5D 1F2LA 4C3JG 4KY5A 3RZDB 4RA8A 5KYIA 4LAAA 4ZYQA 2IMOA 1BPMA 2O4HA 4OC4A 4UIBA 1IKMA 2F3VA 2ZOGA 2RSNA 4RHRA 5CV4A 1HHVA 1MD2D 3BXMA 1R43A 3CU7A 4IUVA 4OKOA 2F0JA 4FVMA 4ZAIA 4KV6A 2ENBA 2RDFA 2PJ9A 1TIID 1HDUA 4FO2A 2QEJC 4R8FA 1H9JA 2JE6I 1D6EC 2R3ZA 3FJUA 3G6JB 2CTCA 2ZOFA 4BY7B 1EZ6A 3SJXA 3KLSA 3SK6A 3MAQA 1W6JA 4OIKA 3BYTB 3PUVA 3MXNA 1WTRA 3RUZA 3OSOA 1SFOB 1Z5RA 1HDQA 4UEEA 2K5WA 3S15B 5COYA 2RFHA 1VF5C 3B3VA 3D4WA 3K5OA 3SK5A 4MCSA 3CT9A 1B4OA 3K5NA 3WOFA 1ZG9A 4U673 3BI0A 1BCPF 2X6GA 4X3TA 3NP8A 4IURA 3R2IA 3K6OA 4H13C 5CV7A 3GTKB 4ZX9A 4WORA 3CDXA 3MVVA 5FK9C 3KBGA 1HQMC 5FO7B 1GUTA 1LFWA 5D29A 1D5XC 3NBIA 2K7VA 3MEHA 3MWYW 3Q0AA 2O5IC 1BXTA 2HC9A 2ZT9C 3GTLB 3GV3A 1KNAA 5K5PA 4LMQD 5I9PA 4IUNA 1EY6A 1L0XB 3FDTA 1EYCA 2A74C 3C46A 1JOKA 1S5CD 3P75A 4PQAA 4KD3A 5C6AA 4ZY0A 3T51B 4F8ZA 1U9RA 2JA5B 1SSOA 2B2YA 4NJRA 1G6ZA 4HR7B 1PFNA 1JWSD 3FVLA 3K5LA 2AWNA 3VA5A 1OXTA 4KTAA 5EPJA 1SJED 3JRUA 2K6AA 4ZKCB 2DNCA 2K32A 3IL8A 3TZUA 4P6YA 3S9NA 1JORA 1Q12A 3OMGA 2F0OA 3KK7A 4DXFA 4TSSA 2C5CA 4DK1A 2F0PA 2L12A 5F2DA 4PMBA 3OWEB 7CPAA 1HA5A 2KHSA 1A3VA 1EIHA 4F9UA 4IZ8A 4HSPA 2F3WA 2FVGA 2SDFA 3H91A 4OHJA 5EGTA 2XEGA 2I3CA 3M85A 3KL9A 2WV6D 3GO5A 3S16B 1K8MA 1TXRA 5C4ZA 1STNA 1U4PA 4Y7NB 4S3SA 1MSGA 2WAQB 4IUTA 5IGGA 1QILA 2D9UA 1HTPA 3RBUA 3T56B 4AXVA 3IEHA 4H44C 3B3CA 2XEFA 3HRZC 1PYWD 3KQZA 1G291 4HMJA 2E75C 1WTXA 4V0BA 4MHZA 5CV8A 1EY5A 4C3HG 1FR3A 2JA8B 1BUVT 4G57A 3MXGA 1BBXC 1EU4A 1TWHB 1TKHA 2F0VA 2A6ED 1JB3A 5D3IB 3GTJB 1EQVA 1Q1BA 3CPAA 2D2CC 5JEAG 2PJ7A 4X8IA 1STEA 1SYDA 2EVBA 3FF3A 3A55A 5KNDA 2MJ8A 3OW7A 2Q4ZA 2XEJA 5EBCA 3BHXA 3PMFA 1JC7A 3S9WA 2NWGA 3O13A 1STBA 2A68D 3MA2B 1D5MC 1ILQA 3OIPA 1I4QA 5EQ0A 3SI0A 5DAUA 2F0UA 1TKWB 1BDOA 4B08A 4IK2A 2LMCB 1PTOF 3DLJA 2XVSA 5FKAC 2J7ZA 5LYLA 2XEIA 2PNRC 2E2IB 2ZENA 1F2MA 1OO9B 2R61A 4FXGC 1JOQA 1DE4C 5CC4A 2A69C 2JSOA 2NZ1D 1V1PA 1ENAA 2XN9C 1D2BA 2EYMA 1TU2B 4IHMA 3NUCA 3GB0A 3P1HA 2A6EC 3OPOA 2EY2A 4DUKA 1H9SA 1O7LA 2JP1A 5CMDA 5A2QE 2PJ6A 1CQVA 1I4XA 5JEAH 4G1PA 1Z8LA 1B44D 1EL0A 4YWYA 5JAVA 4ILWA 1ZLIA 2Z4HA 2A68C 2C6CA 3PIP3 1TT2A 3S1RB 1QWYA 2OXPA 3EQLC 3B7IA 1XTCD 2D62A 4FF1A 3TP6A 1Y0RA 2IX0A 1IYVA 4NGTA 4NW2A 1LAMA 4CJ0B 1YSJA 3TX8A 3QO2A 3A54A 5C4HA 4KMUC 3TZDA 4HTHA 3K5MA 1TVXA 2BA1A 2ANPA 1CK1A 2KQ3A 5A2QL 2NN6H 5EJWA 3X3MA 3X3NA 2D5DA 3DWPA 3D7DA 2NBFA 2X6LA 2N88A 4HCSA 4K6LA 8CPAA 3EROA 1SAPA 4RGNA 2PJ2A 1G8ZD 2LY7A 5I6WA 2DEAA 2EZVA 4P4BA 2O5JC 1H9RA 2B2YC 2MP1A 6CPAA 4RGTA 1Q3LA 4PNYA 5T1IA 5ISRA 5LL6X 4XQQA 1TS3A 4K5WA 1HCZA 4P2CB 3C1FA 3CPXA 1DXMA 2L55A 5K36G 4ZX8A 2CIJA 1PFBA 5M9OA 1X3PA 1CG2A 2FHTA 2WB1B 1FNVA 4OL7A 2F0TA 4RFBA 2YYZA 5LHY1 5M3FB 2EYJA 4CKCA 2XWJB 1TS5A 1VHOA 5JVH3 3GV6A 1OXUA 2MHVA 3MXUA 3KQXA 4FBEA 4MCQA 2QDBA 2M00A 5K8PA 2VB3X 3PB8X 4CHTB 1HFNA 2V77A 3MRUA 1V1PB 2AFWA 1BF4A 5C0XG 5DM73 2A6HD 2XWBB 4RCOA 5I6YA 5HURA 1AW7A 5IGBA 3PEIA 4K2KA 4P4IA 2NTSA 2ID0A 4PXCA 2XIWA 1A2UA 4QF4A 1CHQD 3NK9A 1DZ1A 4LQGA 5KNBA 4X3KA 4NGMA 3S2HB 1T5XD 3KHZA 2OOTA 3DXJC 2C1CA 1JOOA 2ZEOA 3A8JE 2CQAA 5G3LF 3T16A 4Q0FA 4X3SA 2KCNA 2EK9A 3H09A 2FJ2A 4FXKC 1PMRA 1EY7A 3NFZA 1Y69U 1RDPD 3S9LA 3S14B 3D4RA 2EY1A 3A7AB 1M8AA 3N52A 5D14A 3QG1A 1CBXA 3NTIA 5CYUA 1QJOA 1EWCA 3GTPB 1F9PA 3D67A 2NYQA 3RAMA 5KYLA 1LAPA 3GUXA 5I4DA 4IUPA 4RH6A 4EQPA 1CQFA 4C3IG 3BYYB 3TP8A 3Q22A 2Q8RE 1IHZA 3TSSA 3NPPA 4C56C 3KR5A 1LTSD 3MC0B 3K0YA 1KDBA 1I4RA 4TRDA 4PPZA 5K8NA 1H9KA 1SYBA 1RCVD 4H0LC 4BD9A 3PO2B 3RMHA 3N5FA 3VYTA 5JM6A 1EEID 1VCIA 2V4DA 3QIAA 2Q51A 2PCUA 4B6ZA 1IYUA 2K01A 1YW4A 3MFGA 4WFN3 4W9YA 2PQEA 2L5TA 2VUMB 4KN7C 3V05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VAT A;  2G9D A;  4OC3 A;  4NGP A;  4OC5 A;  1VGY A;  1Y7E A;  3SJE A;  4DYO A;  2EK8 A;  1TKF A;  4UEZ A;  3JRU A;  3PB6 X;  2Q43 A;  4P44 A;  4NFR A;  2PJ1 A;  3D4U A;  5LYF A;  4P6Y A;  3S9N A;  4PXE A;  1CPX A;  1LCP A;  1GYT A;  2GLF A;  1EE3 P;  1ZLH A;  2GRE A;  3D68 A;  2GU2 A;  2PIY A;  2QYV A;  3NH5 A;  4JZ0 A;  7CPA A;  4A39 A;  3T8W A;  3WC6 A;  4F9U A;  1PCA A;  1AYE A;  2FVG A;  1XBU A;  1ARL A;  2XEG A;  4CPA A;  2I3C A;  3TC8 A;  3KL9 A;  1XRY A;  4MHN A;  3VAR A;  1CP6 A;  3PRT A;  4MHY A;  4EWT A;  1TXR A;  2PJ0 A;  3PBB A;  4MMO A;  1CP7 A;  5THW A;  4X3R A;  4MCP A;  4WJB A;  2RB7 A;  3PFO A;  3RBU A;  1F2P A;  4AXV A;  3IEH A;  3LMS A;  3B3C A;  2EWB A;  2XEF A;  3KQZ A;  5HVF A;  3NH8 A;  2V8D A;  2WZN A;  4MHZ A;  4R6T A;  3PB4 X;  4IAV A;  4ZY2 A;  1TF9 A;  2ZED A;  3I1U A;  3NA6 A;  3KI9 A;  2O53 A;  3B35 A;  3RZA A;  2CF4 A;  1Y0Y A;  1TKH A;  3KZW A;  3BI1 A;  4NGN A;  4R7M A;  3CPA A;  4YU9 A;  2PJ7 A;  4X8I A;  4NGS A;  4UEF A;  3FF3 A;  1ZG7 A;  3WC5 A;  3SJF A;  3WC7 A;  2JEW A;  2Q4Z A;  5LRJ A;  3H8E A;  2XEJ A;  3BHX A;  4PXB A;  2J9A A;  2PJ8 A;  4P4F A;  5IB9 A;  3KR4 A;  5LYD A;  3HLP A;  2AFZ A;  5LYI A;  3SI0 A;  5HXD A;  4KSI A;  1IGB A;  1XMB A;  4IK2 A;  1AMP A;  3DLJ A;  2AFO A;  4DJL A;  4OME A;  1M4L A;  3NH4 A;  5JGF A;  3H8F A;  5K8O A;  5LYL A;  2XEI A;  1H8L A;  1PYT B;  2WYR A;  4TWE A;  3FX6 A;  2ZEE A;  2ZEN A;  3L2N A;  1IY7 A;  4TNU A;  3PFE A;  1DE4 C;  4R76 A;  3IFE A;  3PB9 X;  1Q7L A;  4P10 A;  1YW6 A;  3MN8 A;  2JBK A;  1DTD A;  2PE3 A;  4IHM A;  1OBR A;  3SI1 A;  3GB0 A;  2V8H A;  4X2T A;  1LAN A;  1QQ9 A;  4P4D A;  2QJ8 A;  4NGQ A;  1HEE A;  3B3T A;  3VH9 A;  4DUK A;  4P45 A;  4PXD A;  4MCR A;  4A38 A;  5LRK A;  3D7H A;  1ELM P;  3B3W A;  3K9T A;  2ZEF A;  4OC1 A;  2ZEH A;  3D7F A;  2AFX A;  2PJ6 A;  2ZEL A;  4G1P A;  1Z8L A;  4OP4 A;  1LOK A;  3IO1 A;  4YWY A;  1ZLI A;  2BCO A;  3KAS A;  3PB7 X;  2C6C A;  4GM5 A;  1YLO A;  4FUU A;  3B7I A;  3K2K A;  3FEC A;  3FH4 A;  1TKJ A;  4P4J A;  1XJO A;  1Y0R A;  1R3N A;  2ZEG A;  1RTQ A;  4NGT A;  5I4M A;  1LAM A;  1YSJ A;  3TX8 A;  2OR4 A;  1VIX A;  2PIZ A;  1ZG8 A;  4ONW A;  3SI2 A;  2C6P A;  4MHP A;  3LWU A;  1UWY A;  3S9M A;  1F57 A;  5CPA A;  5HVH A;  3ISX A;  2ANP A;  1ARM A;  2IQ6 A;  2PJ5 A;  3V38 A;  3WT4 A;  4F9V A;  3D7D A;  4UIA A;  4Z65 A;  4NGR A;  8CPA A;  1F2O A;  2PJ2 A;  2DEA A;  4P4B A;  2IJZ A;  3D7G A;  3FED A;  1NSA A;  3IC1 A;  5CBM A;  6CPA A;  4EME A;  3IIB A;  2BO9 A;  5JH9 A;  4FAI A;  3HUV A;  4ZY1 A;  3B2Y A;  1XFO A;  4K3N A;  1CX8 A;  3B3S A;  3CPX A;  4JYW A;  4ZX8 A;  2CIJ A;  4OID A;  2GLJ A;  4Q7A A;  1CG2 A;  3QNV A;  3ISZ A;  5F09 A;  1YME A;  5D8N A;  2HB6 A;  4ZI6 A;  1KWM A;  1VHO A;  2V8G A;  2F8H A;  4MXU A;  1BAV A;  5J1Q A;  2PJ3 A;  2NSM A;  3KQX A;  3FEE A;  4H2K A;  4FBE A;  4MCQ A;  1JQG A;  1ELL P;  4ZYQ A;  2PRQ A;  3KHX A;  5K8P A;  2IMO A;  3PB8 X;  1BPM A;  2V77 A;  2O4H A;  3MRU A;  4OC4 A;  4UIB A;  2AFW A;  2ZOG A;  3IJ3 A;  5LRG A;  2AFS A;  3BXM A;  1R43 A;  2PJ4 A;  4OKO A;  3PEI A;  4P4I A;  2PJ9 A;  3PBE A;  4PXC A;  2ABZ A;  1HDU A;  2ZEM A;  3GLJ A;  1BPN A;  4MRI A;  4R8F A;  4RUH A;  2V8V A;  5ELY A;  4LQG A;  3FJU A;  4NGM A;  2CTC A;  2ZOF A;  1VHE A;  3SJX A;  3KHZ A;  2OOT A;  2C1C A;  2ZEO A;  2AFU A;  4OIW A;  2CTB A;  2EK9 A;  3WAB A;  4P4E A;  3FMC A;  1Z2L A;  1Z5R A;  1HDQ A;  4UEE A;  2RFH A;  3NFZ A;  3S9L A;  3B3V A;  2VL1 A;  2C6G A;  4MCS A;  5HVG A;  3CT9 A;  4OC2 A;  1ZG9 A;  1QMU A;  3BI0 A;  2POK A;  1CBX A;  4WWV A;  3D66 A;  3H8G A;  1FNO A;  3DGV A;  3D67 A;  3SJG A;  2NYQ A;  4A37 A;  3RAM A;  2PVW A;  3IWW A;  1LAP A;  3GUX A;  2BOA A;  4ZX9 A;  1BLL E;  2PJB A;  4FWU A;  3CDX A;  4EFD A;  2F7V A;  5DS0 A;  1TF8 A;  4UF4 A;  1LFW A;  5D29 A;  2PJA A;  4NJQ A;  4OC0 A;  3KR5 A;  2PJC A;  2HC9 A;  2AFM A;  4PPZ A;  5K8N A;  4A94 A;  4BD9 A;  3N5F A;  2QVP A;  2ZEP A;  5JM6 A;  5K8M A;  3KGQ A;  2Q51 A;  2PCU A;  4B6Z A;  1FT7 A;  2PVV A;  4PQA A;  1YW4 A;  4ZY0 A;  4F8Z A;  3V7Z A;  4NJR A;  4O23 A;  4W9Y A;  2JBJ A;  3FVL A;  1CPS A; 
#chains in the Genus database with same CATH topology
 2EYP A;  3NWS A;  2RSO A;  2K28 A;  3GTO H;  3T13 A;  4PV1 C;  4HJ9 A;  5IT9 c;  1B53 A;  2B3G A;  5E4W C;  5EAY A;  3DWQ A;  4OC5 A;  3RN5 A;  4RN7 A;  4N8X 1;  4A3M H;  1I4G A;  4DAY A;  1QZG A;  5C0X I;  1SRO A;  2F0L A;  1WTQ A;  3NEL A;  1M1D A;  3PB6 X;  4P44 A;  4DV2 L;  1KL9 A;  1VQ6 A;  5LYF A;  3PZJ A;  4PXE A;  1GYT A;  1ILP A;  1ZLH A;  1WCM G;  4DV4 L;  2GU2 A;  2QYV A;  1KDA A;  1P4N A;  1IYJ B;  2IW3 A;  2VZA A;  5CR3 A;  3G6E A;  2B2V C;  1AZP A;  2K14 A;  2QKI C;  3SR1 A;  4L8J A;  3TN2 A;  2Q2T A;  4WJ4 A;  3T8W A;  5E4X A;  4KOU A;  4KLK A;  2MUY A;  3UDX A;  1ZO0 A;  1PH7 A;  5EMI A;  3ULP A;  4Q36 A;  5FLX c;  3GTM B;  3TME A;  1EY9 A;  3I8Z A;  4QCL A;  2Q8T A;  1S7K A;  1XRY A;  4RGM A;  4MHN A;  3VAR A;  1CP6 A;  3HFZ B;  4EWT A;  1HJP A;  3M3Y B;  3NE8 A;  4A3K H;  4Q5V A;  1R9T B;  2RKS A;  5HH1 A;  4KVX A;  4K14 A;  1KLG D;  3VR4 A;  5M5W B;  1M44 A;  4MCP A;  1C48 A;  4CGP A;  4JV5 Q;  1HPC A;  4LF7 L;  4WJB A;  4IQZ A;  4ME5 A;  1F2P A;  1DOL A;  2EDG A;  3SDZ A;  2EYH A;  1CM9 A;  2EJF C;  1NR4 A;  1YVC A;  2GVB A;  4R4O A;  2BDO A;  1EQT A;  4BBS G;  2DPS A;  2F0S A;  1E0B A;  5LMU L;  1QSR A;  2V8D A;  4KOW A;  1FL0 A;  2K5H A;  1LT4 D;  3D6C A;  1FJG L;  5AFW A;  4ZY2 A;  1CA5 A;  2M9V A;  3LWE A;  3J7A V;  2HUG A;  2FT0 A;  4AQY Q;  4YIJ A;  1SYE A;  3KI9 A;  2R93 H;  3T53 B;  3B35 A;  4OGQ C;  3S1Q B;  2AUK A;  2CF4 A;  4APV A;  5C3X A;  1SE3 A;  1W3S A;  1HQR D;  4X3U A;  1SYC A;  1RIP A;  4IUS A;  4R7M A;  1JJC B;  4C68 A;  4B3M L;  1X32 A;  4A3L G;  2Y0S B;  4A3G H;  4XQN A;  4QIW B;  1ZYR C;  4GN3 B;  3AMU A;  4NGS A;  4LFB Q;  3S6G A;  2AQ2 B;  2E74 C;  3T1H Q;  5D65 A;  1TS2 A;  3K80 C;  4NEX A;  4P75 A;  1B6B A;  1ZG7 A;  1VDZ A;  1X3Q A;  2WPW A;  4DV5 Q;  2WKD A;  2JEW A;  4ODG A;  1CTM A;  1NR2 A;  4O42 A;  3H8E A;  5LRJ A;  1Y8P B;  1I3Q B;  1O78 A;  4CAW A;  3E5S A;  4E2A A;  1RTN A;  4GS3 A;  4CDE C;  1IBL Q;  4GN5 A;  1PV4 A;  3PUY A;  3G48 A;  3A56 A;  3RNZ A;  3PCO B;  4F8M A;  2PJ8 A;  5EBV A;  3R93 A;  2YU9 B;  3PO3 G;  5IB9 A;  2MQH A;  5I2Y A;  2F0E A;  1OXX K;  2MO1 A;  5LYD A;  4M6G A;  5IOC A;  1QVG A;  4F0X A;  3HOY H;  3HLP A;  1I6H B;  1TR5 A;  5LYI A;  2XTI A;  3CF5 A;  5HXD A;  2F0D A;  4JW0 A;  2I46 A;  1MI2 A;  1W6K A;  2KVM A;  3S2D B;  1IGB A;  4EQN A;  3FVQ A;  4IUQ A;  4QQB X;  1PZK D;  3N6R A;  1WTP A;  3V2T A;  3M4O B;  4IFD H;  3RZO B;  4OME A;  2NUC A;  2F03 A;  2NTT A;  3TOB A;  5EKI A;  4QY7 A;  3CCU A;  4IFD J;  1B8A A;  4ZK9 B;  1QUQ A;  1XPO A;  1H8L A;  2R7H A;  3WR7 A;  4C1N I;  4K0K Q;  2HHH Q;  1PYT B;  4UBR A;  3EA6 A;  2KUM A;  3GTG H;  1IW7 C;  2FMM A;  3HOZ B;  5C3E H;  4OWW B;  4RKB A;  4CAX A;  1IY7 A;  1LTA D;  4TNU A;  4R3K A;  3EO4 A;  4DR2 L;  1EIG A;  4RKL A;  1A6X A;  1KZF A;  1IKL A;  5EKK A;  2XRS D;  3K57 A;  3IFE A;  4CDD C;  4MBU A;  1Q7L A;  1ZEQ X;  4X64 L;  3GTQ B;  2B2U A;  1DD2 A;  1YW6 A;  3OWF A;  2E2J H;  4UWI A;  5BR8 Q;  2JA6 G;  2B5G A;  4R57 A;  4LFA L;  3SEB A;  4DAY B;  2VI7 A;  3F8T A;  4A93 B;  3U50 C;  4DR3 L;  4DNR B;  4A3F B;  2B63 B;  1VMP A;  3NE7 A;  4X2T A;  1SNO A;  3KJP A;  1LAN A;  3SXN A;  2BE5 D;  2Z11 A;  3S1M H;  1WD1 A;  2Y0S E;  2E2H B;  1HEE A;  3VH9 A;  4QIW E;  1XYI A;  1M4D A;  2VXW A;  3C1E A;  4A3D G;  5IV0 A;  4XQJ A;  4A38 A;  1GUO A;  4K5X A;  3DLL A;  2B2T A;  2JEA I;  2BEI A;  1R57 A;  3B3W A;  4QC6 A;  2Z3L A;  4ZKB B;  1IID A;  3U58 A;  3BVG A;  1K3B C;  1Y14 B;  2ZEH A;  3PV0 A;  5LL6 S;  3MHB A;  2ZEL A;  1IL2 A;  4A3L H;  1PFM A;  3NQT A;  1NMG A;  1SE8 A;  4ORF A;  3T1Y Q;  3CHB D;  4DUZ L;  5NUC A;  4AYB G;  4BS9 A;  1VQI A;  1U4L A;  1J9O A;  1KRS A;  1DGS A;  2K5Q A;  5C4J H;  1NMF A;  1ZKO A;  4EVO A;  3DR8 A;  4KUA A;  3EFA A;  4JLY A;  1NBW A;  3VR3 A;  2J0T D;  4UFX A;  5JJI A;  1XTD A;  1PZJ D;  1RJT A;  3MXN B;  4IUU A;  4FUU A;  4MY3 A;  2ES2 A;  2L0C A;  3J81 c;  3M4P A;  4P4J A;  2DGY A;  4IPD A;  1XJO A;  2F4I A;  4JYA L;  4YRH A;  4PK2 A;  4LF4 L;  1N34 Q;  2PCF B;  2A69 D;  4DV6 Q;  2OEO A;  1F9S A;  1AZQ A;  1RO5 A;  5ELO A;  2OR4 A;  1MHW C;  3V96 A;  1PUA A;  3RLN A;  1Z47 A;  1ZG8 A;  2NVX B;  3HOX G;  1ESF A;  1HA6 A;  2ZM6 Q;  1JIC A;  5DWN A;  5CPA A;  2Z3K A;  1PTO C;  1GUW A;  3B8G A;  1I6V C;  4XNH B;  5J22 A;  1O80 A;  3WT4 A;  4EX5 A;  1K8G A;  4BIN A;  1A8V A;  2KEE A;  1J6Q A;  5AGE A;  2NB0 A;  4MFZ A;  3EIV A;  2VW9 A;  3A9L A;  4Z65 A;  4YWL A;  5JQ4 A;  2Z3M A;  1AH9 A;  4ZLT F;  4UP9 A;  3IAY A;  4MFL A;  4CRY B;  1QG7 A;  4KJN A;  4KKS A;  3PUX A;  1IU8 A;  1TXY A;  3E3X A;  2BE5 C;  4GS4 A;  4KOV A;  1EY4 A;  4I7Z C;  1QOH A;  1HNZ Q;  4UHV A;  4C3J B;  1OZP A;  4IPC A;  2JA7 G;  3D7G A;  3R3O A;  1A2Z A;  4FF3 A;  4HJ7 A;  1G91 A;  3IC1 A;  2YND A;  4EME A;  1TWA H;  3CAM A;  1H9M A;  4KKT A;  4KHP L;  5JH9 A;  5IYB H;  1VQL A;  3J80 E;  1LM0 A;  4ZY1 A;  2JXM B;  4X66 Q;  1XFO A;  4K3N A;  1UEA B;  5KTC A;  3TP7 A;  2ZXO A;  4KY6 A;  1UE6 A;  1KC8 C;  4DR4 Q;  2J4X A;  1LTR D;  1RKN A;  1GJX A;  4YGO A;  1GD7 A;  4LJZ C;  3OHX C;  2JJQ A;  1BNZ A;  2K5T A;  2NN6 G;  5FO8 B;  3ND9 A;  4QUS A;  5LMN L;  5IIF A;  5M3F H;  1K3R A;  3HKZ B;  1TS4 A;  3PUW A;  3D31 A;  2CH4 W;  3HGB A;  3MXP A;  1Y1W H;  3HG9 A;  1BBW A;  1IBM Q;  1IXR A;  4YY3 Q;  4PSW A;  1E24 A;  1Y1V G;  1XEB A;  2HB6 A;  5AG6 A;  2HQL A;  2WKC A;  1K28 A;  3NE5 B;  3ND8 A;  1C4Q A;  4HMI A;  3Q24 A;  1BAV A;  1I94 Q;  3HOU G;  4CJ1 B;  1OXS C;  3IU1 A;  1AN8 A;  2PJ3 A;  4PMW A;  4BBR G;  4G7H C;  3FEE A;  5C4X H;  1CI3 M;  4DR7 L;  3CW2 C;  1YLE A;  4HSV A;  1EOT A;  1JQG A;  5FLX E;  4P73 A;  2H1E A;  2V1C C;  3H3V I;  1ET6 A;  1ELL P;  1EY8 A;  1VMC A;  1Q2C A;  2P6E A;  2PRQ A;  3KHX A;  3J80 L;  3VYS A;  2WFW A;  1XWE A;  4QUF A;  2RA4 A;  1VQF A;  2ZTE A;  3Q6S A;  1NUC A;  2JYO A;  2PMZ E;  5IP7 G;  5F49 A;  4A2Z A;  4II9 A;  3I3C A;  4FF4 A;  2B5G B;  4A3J H;  1EUJ A;  4RCN A;  3D3S A;  2AFS A;  2PZU A;  2B39 A;  1HR0 W;  4BBS B;  4F7X A;  2R7D A;  5EPK A;  4OON A;  5C3W A;  2PI2 A;  2PJ4 A;  4HIK A;  1LT5 D;  4XNH C;  1I5F A;  1BOS A;  3HOV G;  1IL8 A;  4MRI A;  1UE5 A;  2H5X A;  1L0Y B;  4IO9 A;  5ELD A;  4KS9 A;  2V8V A;  1B3A A;  1CZG A;  4LFC L;  1VHE A;  3BDO A;  3OWC A;  4QMG A;  1M4V A;  4E6I A;  2PW5 A;  2QCP X;  5IYD G;  1VQ5 A;  4V19 0;  2JA7 H;  1Z8W A;  1K83 H;  1KAW A;  2AFU A;  1NSN S;  3DM1 A;  2IX3 A;  1V0C A;  3W1B A;  1A3T A;  1YNX A;  3VR5 A;  3SVM A;  5FLX L;  1HUM A;  4YFJ A;  2I07 B;  5C5M A;  2CQO A;  3WAB A;  2EPB A;  2F0K A;  3A8K E;  1Q2Y A;  3ZYY X;  3U4Z A;  4P72 A;  1STG A;  3E0J A;  2UXB Q;  1WTV A;  2E76 C;  3R9E A;  3R2T A;  3K59 A;  2VL1 A;  1T5E A;  2UXC L;  4XIG S;  3JAM c;  1NE3 A;  2HDM A;  4OC2 A;  1LTL A;  1TQO A;  1QMU A;  1S5F D;  3OIQ A;  4KOT A;  3W3A A;  3PO3 B;  1TY0 A;  5I2X A;  5KEE A;  4JI6 L;  2RHQ B;  4ONU A;  3I4M H;  3EJI A;  3H8G A;  1JMC A;  1QSN A;  3CRL C;  3SK8 A;  3GYA A;  4JI2 L;  1X3G A;  2LFN A;  4B5P A;  4IJH A;  3K7A H;  4OO1 H;  3SJG A;  3NEN A;  5CV9 A;  5J3B A;  1S60 A;  2PO4 A;  5T1G A;  4A37 A;  1B9M A;  2OTL A;  3DWA A;  1JE5 A;  2JDC A;  2TMP A;  3BDC A;  3MZ5 A;  4OLL A;  2VS1 A;  1EWI A;  2Z1C A;  2Z3O A;  1A3U A;  2BSW A;  4BY7 G;  3I90 A;  3MEF A;  3V8I A;  3LD2 A;  3DEP A;  1TY2 A;  3I73 A;  4POF A;  1CKN A;  5LMN W;  3I4N H;  5DS0 A;  2XSC A;  4UPA A;  1TF8 A;  4DR6 Q;  2RQX A;  1HH2 P;  1VQE A;  2Q2H A;  4L6T B;  4K2L A;  1GUN A;  1Q86 C;  3TS2 A;  4B9X A;  5GRO A;  5M5Y H;  4IAL A;  3CME A;  4JOI A;  4A3B G;  1F9R A;  4NJQ A;  4DK6 C;  1I50 H;  5DWM A;  4CJ2 C;  1KUY A;  2UUC Q;  4FYD A;  2JDD A;  1N36 Q;  4OC0 A;  4XTC S;  1VQA A;  2HCC A;  2JA9 A;  5E1F A;  4U9Z A;  1Q46 A;  2NN6 I;  3ZZI A;  2JA6 B;  2AFM A;  2MO0 A;  4U68 A;  1XMQ Q;  1N9W A;  4A94 A;  4JI8 Q;  3SK4 A;  4QB4 A;  2YNC A;  1Q90 A;  4DV3 L;  1JWM D;  2KED A;  1YNN D;  4O1N A;  4C2M B;  4DK3 C;  2FS5 A;  2QF7 A;  1ESR A;  3PGZ A;  4NXY A;  5I9O A;  3RLO A;  2JEB I;  4OO1 I;  1PRT B;  2ZEP A;  4A3D B;  5K8M A;  2HT1 A;  5M3M H;  2OF1 A;  1VQN A;  1FT7 A;  4L8A A;  1HTL D;  4UDU C;  2PVV A;  4FD6 A;  3V7Z A;  3GQB A;  3IU2 A;  3HOW H;  2ARH A;  2AQ1 B;  3L7Z C;  1BVS A;  4O23 A;  4B11 A;  2G3T A;  3QOL A;  3RZD H;  3SHP A;  1X3F A;  4X62 L;  5C44 G;  5BN4 A;  1CPS A;  1YME A;  4AYB B;  1EY0 A;  1TWC B;  2FL4 A;  2YNE A;  1HNX Q;  3VAT A;  2G9D A;  2NMT A;  3PUZ A;  1HNW Q;  4NGP A;  4IN3 A;  1PH9 A;  1PRT D;  1XE4 A;  3SJE A;  2EK8 A;  1TKF A;  1JE4 A;  4ABN A;  1KAB A;  3BS1 A;  2D0O A;  3VYU A;  4NFR A;  4JCV E;  1SNM A;  1VKC A;  1STH A;  3D4U A;  1KLU D;  2OTJ A;  2BDN A;  1CHP D;  1LCP A;  4TKO B;  1XMO L;  3QAY A;  1EE3 P;  1WTW A;  2Q4Y A;  2GRE A;  3OW2 A;  2PIY A;  1O7Y A;  2LSS A;  1RF2 D;  3G8W A;  1GUG A;  2EBJ A;  1G2S A;  4C3H B;  4GLV B;  3J81 E;  4KY7 A;  2FXF A;  4M85 A;  1H9S B;  2AUJ D;  1WOC A;  4A39 A;  2KOL A;  4ZQ3 A;  3WC6 A;  4DR5 L;  2DF5 A;  1MJC A;  3HOX B;  2VB2 X;  4DA2 A;  3H4Q A;  1HFG A;  2IX1 A;  1PCA A;  1IZ6 A;  4A3I G;  3EBE A;  4UCM A;  2ODF A;  2YGW A;  2LXJ A;  2EE1 A;  3PGP A;  2PYK A;  5FOB B;  4BY7 H;  3CQZ B;  3I2Z A;  4CPA A;  4NKL A;  3TC8 A;  4JI1 Q;  2JA5 G;  3OTO L;  1LAC A;  1NJI C;  1WTH A;  4MHY A;  1J8I A;  5BN5 A;  4A3E B;  2PJ0 A;  2OU2 A;  2MGS A;  3PBB A;  4KSF A;  3TCV A;  5M5W H;  4PV6 A;  1SFO H;  1I4H A;  1JWU D;  1QNU A;  1SYG A;  4DAP A;  2K4K A;  4WJ3 M;  1BCP B;  2FMC A;  2PW7 A;  4DR1 L;  1I4P A;  1SNC A;  4A3M G;  3S15 H;  2RB7 A;  1XNR L;  3PFO A;  1YNN C;  2ICE C;  1FGB D;  1VQH A;  2Z6B A;  3CC7 A;  1VQP A;  2NZH A;  2DN8 A;  2EWB A;  2HQE A;  2IT1 A;  2K05 A;  2RDG A;  1DCZ A;  2J8R A;  1B2T A;  2EUI A;  1R4Q B;  1VQK A;  3NH8 A;  3DMU A;  3AU7 A;  2PDO A;  2WZN A;  4OWX B;  3H6M A;  3J81 L;  3W2D A;  3J7A 5;  4IAV A;  4AB7 A;  3VR2 A;  1SXT A;  1XNQ Q;  1MKH A;  5M5X B;  4EGV A;  2E5L L;  4CS0 B;  3NA6 A;  1KDC A;  1BCP D;  4JI4 L;  4M6H A;  5KIX A;  1F2Y A;  3H3V C;  1F2Z A;  4KOS A;  3S1Q H;  1P8L A;  3GP7 A;  1Y0Y A;  4CYO A;  3ONA B;  1XPU A;  3WOE A;  1A2T A;  1PRT C;  4FNF A;  4KHV A;  4B3R L;  2OZG A;  3BI1 A;  2F0W A;  4NGN A;  3W6S A;  2IPK D;  5C5L A;  3CP0 A;  2OB0 A;  2B3V A;  4G7Z C;  1S3O A;  4AVB A;  3OYY A;  1V1Q A;  4GKK Q;  2KHI A;  1F77 A;  4NXM Q;  3CD6 A;  4KKU A;  1DON A;  1ENF A;  1KTK A;  5CV6 A;  2WAC A;  4JI5 L;  1B1Z A;  1Y1V B;  3C3L A;  3SJF A;  3WC7 A;  1YJN A;  2OT2 A;  4R4T A;  2ZTC A;  2UUB L;  2O4X A;  1BO0 A;  1CKN B;  2NYZ D;  2VL6 A;  1GM5 A;  3HOU B;  4H89 A;  5JOB A;  1E2W A;  4OX9 L;  3DSB A;  2PI2 E;  2R7Z B;  5D3D A;  2N3S A;  4MIU A;  3STB C;  4DV7 Q;  2J9A A;  4PXB A;  1RTO A;  1CM0 A;  3P20 A;  2CW0 C;  1EZ8 A;  1RXT A;  3KR4 A;  2B8F A;  4HPS A;  4QUC A;  4FD4 A;  1DYQ A;  1HXY D;  2XRQ D;  4KSI A;  3CRK C;  3C2P A;  4BBH A;  1Q2D A;  2BL1 A;  2R93 G;  1XMB A;  2KCT A;  2JN4 A;  3I70 A;  4C1N K;  3ICE A;  1AMP A;  2G9H D;  2R6G A;  3NTH A;  2ATW A;  2KA7 A;  2JA5 H;  3M4O H;  1N33 Q;  4DJL A;  1YNJ D;  5ELE A;  1LRZ A;  1M4L A;  4CGY B;  2R1I A;  4NDX A;  1EYA A;  3G71 A;  3NH4 A;  3H8F A;  3CCM A;  1BQQ T;  4A3G G;  4J1M A;  3S6F A;  4TWE A;  3TOA A;  1D5Z C;  4KJO A;  4AVA A;  3HOZ H;  2ZEE A;  5IGF A;  3L2N A;  2ZW7 A;  3I7F A;  4XXE A;  4R76 A;  3KF8 A;  1ZYR D;  3WDN A;  4P10 A;  4P71 A;  3NXW A;  4CGM A;  1BCP C;  3TFY A;  2WII B;  1YR0 A;  1VHS A;  2GAN A;  1DTD A;  3JUW A;  1LAB A;  4JWP A;  1VF7 A;  3SI1 A;  1M90 C;  4B3M Q;  2K5D A;  5ELB A;  3D8G A;  2EYF A;  3VWD A;  4P4D A;  2QML A;  3HOY G;  4NGQ A;  2F52 A;  2QIL A;  2B2W A;  1NMT A;  1LTT D;  2EQS A;  4N9T A;  3KJO A;  4MCR A;  2FFK B;  1L2F A;  4B13 A;  3D7H A;  3L3O C;  3K9T A;  4QVT A;  2ZEF A;  2RBM A;  4OC1 A;  1S5E D;  4N9P A;  2M2L A;  4AG7 A;  3H15 A;  2AFX A;  2Q2I A;  4R4C A;  4IFD G;  3I4L A;  3CCR A;  3S16 H;  1AFP A;  3JAM E;  4F88 A;  2GA4 B;  4MTN A;  4Y7N H;  1LOK A;  5IGC A;  3IO1 A;  5BN3 A;  4I49 A;  1BKB A;  4CGN A;  3FKI B;  3D2P A;  3KAS A;  1Z9F A;  3PB7 X;  1FD7 D;  5C3E G;  2B8G A;  5C82 A;  2EOT A;  2F0Q A;  2UU9 Q;  3A7L A;  1RHP A;  2KCC A;  1E22 A;  1F9Q A;  1Q81 C;  1SMY C;  1D8L A;  2ZJR A;  1YX0 A;  3FH4 A;  3IWE A;  4GXH A;  2E8G A;  1IW7 D;  4NB3 A;  1R3N A;  2FIA A;  3CCS A;  1XXG A;  2L11 A;  2ZEG A;  5F48 A;  1DM0 B;  3D4D A;  1FY7 A;  3DEO A;  4DV0 Q;  4LF5 L;  2OQ0 A;  3BG3 A;  5A35 A;  2VQF Q;  2CXA A;  4B10 A;  3I91 A;  3NHH A;  2JA8 H;  4MTK A;  4A3B B;  1YNJ C;  4CDF C;  1M4I A;  4DNC A;  2SOB A;  1X56 A;  5EPL A;  4I65 A;  4ONW A;  1OXV A;  1TWG B;  4GZY C;  4DF7 A;  3NTK A;  3SI2 A;  3W91 A;  4MHP A;  1UWY A;  5ISV A;  3I72 A;  1TWH H;  3ULL A;  4JBK A;  1F57 A;  1QZH A;  5HGQ A;  4DR2 Q;  4R8I A;  3QWN A;  1CFM A;  1ARM A;  2Q0Y A;  5HVH A;  4KOR A;  5COR A;  4XYQ A;  3V38 A;  1ROD A;  3MFY A;  3TP5 A;  1Y8N B;  4CBV A;  3GTJ H;  3UDG A;  2FXQ A;  3TE4 A;  3JAM L;  2LKV A;  5HGT A;  1N8R C;  2EY6 A;  4ULL A;  4L5Q A;  3NSW A;  4NGR A;  1YQE A;  3EY5 A;  2RHS B;  1B50 A;  5KGU A;  2AE6 A;  4PMC A;  3NBH A;  2F4V Q;  1FNU A;  4ZRZ A;  4XDX A;  4HIO A;  2DY7 A;  2F3I A;  2F0H A;  1EYG A;  3HKS A;  2R92 B;  5DEH A;  4R8N A;  4C3J H;  2IHF A;  2IJZ A;  1VQJ A;  5C44 B;  1HZA A;  5IOD A;  5CBM A;  2ALY B;  1GHJ A;  3S1N B;  4GN4 B;  1Z9U A;  1ENC A;  3AYH B;  2HDL A;  2SNM A;  2BO9 A;  4GNX A;  4LF8 L;  4L5T A;  1PTO B;  4R1J A;  3TRZ A;  4B14 A;  3LX0 A;  1WVL A;  3I9S A;  3B3S A;  3E6Z X;  2EJG C;  2Q04 A;  3K58 A;  2MPM A;  1YIT A;  2NVT B;  2P6F A;  4JYW A;  3FIX A;  4MJ8 A;  1PH3 A;  3J81 i;  1ICW A;  2Z3P A;  4KK7 A;  1HR0 Q;  2IL8 A;  1VQO A;  4G7O C;  3N7Z A;  4YCU A;  4OIJ A;  1D1K A;  4HED A;  2QA4 A;  3UDF A;  3QNV A;  1SMX A;  3ISZ A;  5CBE E;  1PTO D;  4JV5 L;  2PZW A;  1CSP A;  1BOB A;  1STA A;  5F09 A;  2E2I H;  4A3I B;  2UXD Q;  4CKE A;  5H84 A;  3LOD A;  2IWH A;  5GAD C;  4JBM A;  2CY2 A;  5D8N A;  2EXZ A;  2BH2 A;  1KWM A;  4ZI6 A;  4A4I A;  1UEB A;  4MN3 A;  2I00 A;  5KNC A;  1QNK A;  2F8H A;  1EWH A;  4BA1 I;  5J1Q A;  4DK0 A;  1FYC A;  4QGU A;  4NMZ A;  3R8B A;  3R9G A;  3SE0 A;  1J4J A;  2K03 A;  2NVQ B;  1C9O A;  1RD9 D;  4OAE A;  2NSM A;  4H2K A;  3EVQ A;  1L0C A;  4HIM A;  3GTO B;  1B9N A;  4AQY L;  2B3U A;  2VNU D;  3F1Z A;  5AJ3 L;  4ZBG A;  3BVM A;  4DNI A;  4KUB A;  5IYB G;  5JVG 3;  4A3M B;  4UAI A;  4KLV A;  3FNC A;  3F8K A;  3IGR A;  3IJ3 A;  3CPF A;  3P2H A;  1PVO A;  5LRG A;  5JPH A;  1S4Z A;  3H0G B;  1IB1 E;  1UWV A;  4IFD I;  3TDQ A;  5IB0 A;  3CXS A;  4ZUI A;  5CV5 A;  5GAG C;  4LFB L;  2A19 A;  3T1H L;  3KBX A;  4BY1 B;  2PC1 A;  2F0F A;  3PBE A;  3U9O A;  2ABZ A;  5M3F G;  2ZEM A;  3GLJ A;  1BPN A;  4DV5 L;  2KBN A;  4IPG A;  4A33 A;  3KF6 A;  1DOK A;  2REE A;  4RUH A;  2WP8 J;  1MJA A;  1ZXT A;  4PQX A;  1Y1W G;  5ELY A;  3S1R H;  3BDL A;  1IBL L;  4BA2 I;  1X65 A;  1JR0 D;  1NTG A;  3EFX D;  1C8C A;  3K7U C;  4MI4 A;  1P0H A;  1SNQ A;  3SXO A;  1S5D D;  1A15 A;  1X55 A;  2F0N A;  1S40 A;  4C3I B;  4RWS C;  4OIW A;  3M7G A;  1LUZ A;  1A0I A;  5C4X G;  1U4M A;  2HCI A;  2CTB A;  4A3K B;  2O2L D;  3CKI B;  5LMN Q;  4XYO A;  3I55 A;  1YJ9 A;  1WWZ A;  4P4E A;  3FPP A;  3FMC A;  1Z2L A;  3ER0 A;  1SE4 A;  1YVK A;  1Z8T A;  4LUA A;  3OMC A;  4NP5 A;  4KD4 A;  1X12 A;  3HZX A;  1PZI D;  2C6G A;  5HVG A;  2BOS A;  4K6D A;  4A3J G;  4CKB A;  4R87 A;  1Z4E A;  4JK1 C;  1A62 A;  4C7H A;  3PIO A;  1QB5 D;  2POK A;  4WWV A;  3D66 A;  2TSS A;  3J7A F;  1MIU A;  2EYL A;  2HHH L;  4K0K L;  3CCJ A;  1KUV A;  3QJY A;  3KDF A;  4QL5 A;  1FNO A;  1BBU A;  2PMZ B;  2I5M X;  2D4P A;  1X9N A;  1K8O A;  4OAD A;  3DGV A;  1AEX A;  3J7Y W;  1SDF A;  5ELC A;  3Q23 A;  1GXD C;  3TBI B;  4ID6 A;  1DOM A;  4A31 A;  2R93 B;  2ZW5 A;  2XNA C;  2PVW A;  3IWW A;  2CFM A;  2N55 A;  2BOA A;  1Q1E A;  5BR8 L;  1ET9 A;  1BLL E;  2PJB A;  4FWU A;  3DHQ A;  2LXK A;  4CGO A;  5ELN A;  4EFD A;  2D0P A;  2F7V A;  3FHW A;  1XJV A;  4OWT B;  1UNS A;  2Q7B A;  2H4O A;  4A32 A;  1R4P B;  2PQA A;  3VR6 A;  1K8A C;  4A3G B;  1L0W A;  2L1B A;  4UF4 A;  1SE2 A;  3NQI A;  2F0M A;  2PJA A;  2EY5 A;  5KRU A;  1JJG A;  3IKJ A;  1G2T A;  5IT9 E;  1WTO A;  1E3P A;  2KJX A;  2PJC A;  1WCM B;  4A3C H;  1IBK Q;  3CC2 A;  3T1Y L;  1O7Z A;  1JB7 A;  4CYP A;  3RR5 A;  1STY A;  4DXG A;  2A5H A;  5IGD A;  4JI0 Q;  3I4M G;  3BZK A;  3HOY B;  5G21 A;  3DUZ A;  2QVP A;  2EXD A;  4OO1 G;  2B2W C;  3KGQ A;  2WAQ E;  3P7J A;  3FPU B;  3DM3 A;  3D0F A;  4RGO S;  4M6I A;  3F2U A;  4K5V A;  3JAM i;  3VDY A;  1QUQ B;  4EQO A;  4HAE A;  4J6H A;  2I79 A;  2ZTD A;  2DNE A;  2JBJ A;  1N34 L;  1ASY A;  1EFI D;  1LT3 D;  4DV6 L;  1TWC H;  3TTH A;  3I4N G;  1PXU A;  4AIM A;  1KHI A;  4U5Y A;  5C88 A;  5TSS A;  4IOA A;  1IOI A;  4OC3 A;  1NCV A;  3GTG B;  1VGY A;  1Y7E A;  3BZD B;  2ZM6 L;  5C3E B;  3CPW A;  4DYO A;  2QGQ A;  4UEZ A;  1S5B D;  2Q43 A;  5IT9 L;  2PJ1 A;  4J15 A;  4KN4 C;  1JQY D;  1GOZ A;  5IWA Q;  1CPX A;  2GLF A;  1Q8I A;  3KUP A;  2VZY A;  4WRD A;  1V9P A;  2E2J B;  5AG7 A;  1EEF D;  3D68 A;  4BWG B;  2SNS A;  1ML0 D;  3H94 A;  4ME3 A;  3NH5 A;  3A8I E;  4GKJ L;  1ICF B;  4JZ0 A;  4JVZ A;  2VQE Q;  3L9A X;  3S1M B;  1EYD A;  1V43 A;  4A30 A;  2OZU A;  2FIN B;  2KCW A;  4LF9 Q;  4QBJ A;  1AYE A;  1W2B A;  3A5U A;  1V8Q A;  4CRZ B;  1XBU A;  3S2H H;  2K1B A;  1HNZ L;  1ARL A;  5M3M G;  1C7Y A;  4G4K A;  4IOC A;  2PQ8 A;  1DJR D;  1WI5 A;  3QR8 A;  3SXH A;  4EVY A;  3HOW G;  3PRT A;  5DM6 3;  3FRP B;  3KF6 B;  4FF2 A;  3CXQ A;  1HUN A;  4MHD A;  4EQ5 A;  4MMO A;  5JEA J;  1CP7 A;  4X66 L;  4R3L A;  5C4J B;  2A1A A;  4X3R A;  5THW A;  1LV9 A;  2EIF A;  2EJM A;  1E7Z A;  1Z7T A;  1CT1 D;  1GUS A;  4DR4 L;  3QB3 A;  1UE7 A;  5G3L D;  3LMS A;  1EU3 A;  3S14 H;  2L15 A;  1MBY A;  5AG5 A;  1AE2 A;  4UY8 C;  4GLX A;  4L63 B;  1C0A A;  3U9S A;  5HVF A;  3P2F A;  1SNP A;  2AMC B;  2B4D A;  5FVJ A;  5G20 A;  1XX8 A;  3W1G A;  2B2V A;  3PB4 X;  4R6T A;  4TQU S;  3GTP H;  3DDD A;  4ZUJ A;  4KZT A;  4ZYS A;  3F2B A;  2VEZ A;  4CDC C;  2NVY B;  3BVZ A;  4YCW A;  4YY3 L;  3F2D A;  1TF9 A;  3IFD A;  2ZED A;  3I1U A;  5HMN A;  3M9B A;  2LS0 1;  2O53 A;  3RZA A;  3S17 B;  3FP9 A;  1CZW A;  3PP9 A;  1I94 L;  2ZXV A;  2CWA A;  3KZW A;  3URY A;  3TO7 A;  5DNF A;  4XT3 B;  4DU9 A;  3PIO 3;  2C27 A;  3RLF A;  4F87 A;  1U0L A;  1LT6 D;  4YU9 A;  4XT1 B;  3AB9 A;  2A8V A;  4MFP A;  2JEV A;  4UCN A;  2ICI A;  4UEF A;  4FXD A;  1VQB A;  2DY8 A;  4P74 A;  3FRM A;  2KEN A;  2X69 A;  1WJJ A;  1MJE A;  3WC5 A;  4JI3 Q;  3C26 A;  5IY0 A;  3IFT A;  1XMT A;  1GHK A;  1SYF A;  3V05 A;  2CHB D;  1SBB B;  1MK4 A;  2B2U C;  1J5E Q;  1RL2 A;  4Z9C B;  3KFU A;  4P4F A;  3HP3 A;  2L9H A;  5E7N A;  2ZXR A;  1M1K C;  5BWA B;  4GLA C;  1TWA B;  2Q4V A;  1MGS A;  1PH4 A;  1ONL A;  1LYL A;  4B3T Q;  2PZT A;  2F0I A;  3KLS X;  3D6W A;  4BXX H;  1S7L A;  2AFZ A;  4MZ9 A;  3PO2 H;  5H86 A;  1V1O A;  4N8F A;  2OZH A;  3AQQ A;  2X7B A;  3FB3 A;  2IL4 A;  3L0O A;  4DR1 Q;  1YJW A;  4H6U A;  4CAV A;  1FNW A;  2B2T C;  1XNR Q;  4TVA B;  2PPB C;  4LF6 Q;  4H6Z A;  1YGH A;  4RS2 A;  3EXN A;  1PLF A;  2AFO A;  2B29 A;  5JJZ A;  2VUM H;  3ITP A;  5JGF A;  5K8O A;  1Y9W A;  2K33 A;  4Y52 H;  1GVP A;  4M1U B;  2UXB L;  1LLR D;  1PFS A;  1UAP A;  4HN7 A;  1IOF A;  2WYR A;  3FX6 A;  2F1M A;  2YV5 A;  1Y1W B;  4F6A A;  2Q44 A;  3PFE A;  2A73 B;  3CCV A;  3UE1 A;  5CBA E;  3RO0 A;  2Q7S A;  2K5N A;  1PYS B;  1BR9 A;  3PB9 X;  3CC4 A;  1U5K A;  4KOX A;  1B7Y B;  2ASB A;  2Z4I A;  3MN8 A;  1TWF B;  4K8J A;  4B9W A;  2JBK A;  2PE3 A;  5C4X B;  1VQ8 A;  1OBR A;  5E3F A;  4LUV A;  4K8I A;  2FSR A;  2V8H A;  3OOC A;  4O0A A;  2J8M A;  1E2V A;  2GVA A;  1X54 A;  1CJW A;  1QQ9 A;  1QCB D;  3QOJ A;  3ERS X;  2QJ8 A;  1L1O A;  3B3T A;  5I0C A;  1D1I A;  4DN4 M;  3DR6 A;  3IRB A;  4B3S Q;  4NXN Q;  4LQ6 A;  4P45 A;  3STB D;  1NNX A;  4PXD A;  2L4N A;  3A74 A;  5LRK A;  4GOP A;  2CW0 D;  4A3J B;  1ELM P;  1UUP A;  4HCE A;  4K30 A;  5JPN C;  3GTM H;  4ZGY B;  1AUG A;  3D7F A;  1JCK B;  2AQ3 B;  1N32 Q;  2SEB D;  4JI7 Q;  3W5O A;  4DR6 L;  4KVO E;  3HEJ A;  3W6X A;  4OP4 A;  3D3R A;  5ELF A;  3M3Y H;  1B3Q A;  4UWJ A;  1R9T H;  4HID A;  1XOV A;  5IGE A;  2UUA Q;  4J3G A;  3VA7 A;  3D8P A;  2BCO A;  4H7B A;  2UUC L;  1N36 L;  4YHH Q;  2F5I A;  1MSH A;  1LTI D;  3HOZ G;  3GY9 A;  3TEH B;  2Z8L A;  4GM5 A;  2G5D A;  2IJ0 A;  3VYR A;  1H95 A;  5J8C A;  1YLO A;  1Y8O B;  2DXQ A;  3EN2 A;  2CVR A;  2B4B A;  3K2K A;  2JA7 B;  1XMQ L;  4KHZ A;  3FEC A;  2BA0 A;  3S6K A;  1K83 B;  4JI8 L;  4X65 L;  1TKJ A;  1VQ7 A;  3LGJ A;  3R9F A;  1E2Z A;  4RAU C;  3T4A C;  1VQC A;  1RTQ A;  2WIN B;  3M7N A;  5H1S E;  3CXC A;  2YTY A;  5I4M A;  2K04 A;  1AP0 A;  2E2D C;  4JBW A;  2WB1 E;  4RHS A;  3HS0 C;  1VIX A;  2PIZ A;  2F0G A;  3RD4 A;  4XPK A;  2C6P A;  3LWU A;  2CNS A;  5K36 H;  3S9M A;  4DAV A;  1JWQ A;  2D4O A;  2Q8I B;  2G0B A;  2B4D B;  3ISX A;  4DKA C;  4MFK A;  4DV2 Q;  4LX9 A;  2IQ6 A;  2PJ5 A;  2KEC A;  3NEM A;  2CNT A;  4QJF A;  4B5P B;  1LTB D;  1HNX L;  4F9V A;  4LK1 C;  4KI0 A;  1SEB D;  4L5S A;  3I4M B;  2VZZ A;  5J39 A;  3T90 A;  1HNW L;  4JG2 A;  4DV4 Q;  2OQK A;  3PF5 A;  4UIA A;  4R9M A;  2RVL A;  2WAQ G;  4DGZ A;  3K7A B;  3I4O A;  3RN2 A;  1Q7Y C;  1F2O A;  1II3 A;  1EQR A;  3SGI A;  2CCZ A;  1QSO A;  3K0X A;  1QST A;  5EBD A;  2EYO A;  5FO9 B;  3MTS A;  5J1Z A;  2QEX A;  4UFW A;  3RNU A;  1EIY B;  3BZC A;  3SHL A;  1I3Q H;  3FXT A;  3K8A A;  4UFV A;  1LO5 D;  1WFQ A;  1I12 A;  3FED A;  4F0Y A;  4BBR B;  1NSA A;  2YU9 H;  4R9W A;  3I4N B;  1N71 A;  4BMH A;  2A6H C;  1SLJ A;  1T9H A;  3IIB A;  3UI2 A;  2C9O A;  4RI1 A;  4FAI A;  2R98 A;  1I6H H;  1PTO H;  2RDH A;  2R8V A;  3B2Y A;  5M5Y B;  1SMY D;  3HUV A;  2JA8 G;  1Z6H A;  1I50 B;  1CX8 A;  1KNE A;  5C0X H;  4DUY L;  3ERQ A;  2ZJP A;  4J8Q A;  3S2D H;  5JPM C;  4LF7 Q;  1KQS A;  4PZ8 A;  1SJH D;  5C0X J;  3M4Y A;  4JI1 L;  4DFA A;  4A75 A;  2ZXP A;  4OID A;  4M8A A;  2GLJ A;  3RZO H;  1NAP A;  2OCE A;  3G7L A;  3ZJY C;  3LNN A;  4Q7A A;  1HZ9 A;  1PDQ A;  5EKL A;  4HNX B;  1XPR A;  4WJW A;  4MHE A;  1HRJ A;  1QE6 A;  1WD0 A;  1CA6 A;  3HOV B;  5LMU Q;  1PHJ A;  1U4R A;  1YHA A;  5CGK A;  4LF5 Q;  3FEW X;  4DNT B;  1FJG Q;  4FD5 A;  1YEZ A;  1SND A;  1SR3 A;  3GD7 A;  5M3M B;  1TIQ A;  1KAA A;  2V8G A;  2ZW4 A;  3NWT A;  2AWO A;  4MXU A;  3R95 A;  2PNH A;  3GTQ H;  1QVF A;  3BJU A;  2JK8 A;  1LTG D;  1PRT F;  4DV1 L;  3HOW B;  4C2Y A;  3KLR A;  4FP5 D;  1F2L A;  4C3J G;  2Z0Z A;  4KY5 A;  3RZD B;  4RA8 A;  2N49 A;  1E1T A;  5KYI A;  3IWG A;  4A93 H;  5E96 A;  1XNQ L;  4LAA A;  4A3F H;  2B63 H;  4ZYQ A;  4C2X A;  2IMO A;  1PH2 A;  1BPM A;  2E2H H;  2HIV A;  2PRB A;  2O4H A;  1K73 C;  3AFP A;  2Z3N A;  4OC4 A;  2C35 B;  4UIB A;  1IKM A;  2F3V A;  1OTC A;  2ZOG A;  2Y0M A;  2RSN A;  5EC4 A;  4RHR A;  5CV4 A;  1HHV A;  1MD2 D;  2EO8 A;  5G22 A;  3H0G H;  1B70 B;  3BXM A;  3H5Z A;  1R43 A;  3CU7 A;  4IUV A;  4OKO A;  4GKK L;  1L1O B;  2F0J A;  4FVM A;  4ZAI A;  4KV6 A;  2ENB A;  2RDF A;  3M4Q A;  4BY1 H;  2QDL A;  2PJ9 A;  4NXM L;  1TII D;  1HDU A;  5FLM H;  4FO2 A;  1HZC A;  4GOP B;  5KTA A;  3HKZ G;  2QEJ C;  4R8F A;  1H9J A;  2JE6 I;  4LF8 Q;  1D6E C;  2R3Z A;  3FJU A;  1VQ4 A;  3G6J B;  2P5Z X;  2CTC A;  2ZOF A;  4BY7 B;  1IYL A;  1EZ6 A;  3SJX A;  3KLS A;  4DV7 L;  4I7A A;  3SK6 A;  3MAQ A;  1W6J A;  2K52 A;  1YRE A;  3U4V A;  4OIK A;  3BYT B;  3PUV A;  3MXN A;  4C3I H;  2ATR A;  1PH6 A;  1WTR A;  3CZX A;  3RUZ A;  3OSO A;  1SFO B;  1Z5R A;  4JOI C;  4X5K A;  2NVX H;  1HDQ A;  4UEE A;  4B5O A;  4NF1 A;  2K5W A;  3S15 B;  5COY A;  2RFH A;  1VF5 C;  5JJK A;  3B3V A;  4L89 A;  4Y49 B;  3D4W A;  3K5O A;  3SK5 A;  4MCS A;  3DNS A;  3CT9 A;  1N33 L;  1B4O A;  3K5N A;  3WOF A;  1ZG9 A;  4U67 3;  3BI0 A;  1BCP F;  1YK3 A;  1YVO A;  2X6G A;  4X3T A;  4X64 Q;  3NP8 A;  4IUR A;  2OH1 A;  3R2I A;  2YNC C;  3GKR A;  2AJ6 A;  4LFA Q;  3FBU A;  3CCE A;  3I3G A;  3K6O A;  5IP9 H;  4DR3 Q;  5AJ3 Q;  4H13 C;  5CV7 A;  4YCV A;  5FJ8 H;  3GTK B;  4ZX9 A;  1CSQ A;  4WOR A;  1K0S A;  2GFQ A;  3CDX A;  4JC0 A;  3MVV A;  1X6O A;  2CWP A;  5FK9 C;  3KBG A;  2PR8 A;  2VXK A;  1HQM C;  2K5V A;  5FO7 B;  1I1D A;  1GUT A;  1LFW A;  1JT8 A;  4DUZ Q;  5D29 A;  3S24 A;  1D5X C;  3NBI A;  2K7V A;  4POG A;  3MEH A;  1WYD A;  2JQO A;  3MWY W;  3Q0A A;  3BU2 A;  1EQQ A;  2O5I C;  2WUU A;  1BXT A;  1WCM H;  1EFW A;  2HC9 A;  4HNW B;  2ZT9 C;  3GTL B;  4CAE A;  3GV3 A;  1KNA A;  5K5P A;  4LMQ D;  4HJ5 A;  5I9P A;  4QB9 A;  2JLM A;  4JYA Q;  1ASZ A;  1YIJ A;  4IUN A;  1EY6 A;  1L0X B;  3FDT A;  1EYC A;  4LF4 Q;  1A63 A;  3G3S A;  1L1O C;  2UU9 L;  2A74 C;  3C46 A;  1EOV A;  1JOK A;  2Z0S A;  1S5C D;  3P75 A;  4GOP C;  1XF8 A;  3JTK A;  4PQA A;  4KD3 A;  5C6A A;  4ZY0 A;  3T51 B;  2Z6K A;  1U9R A;  4OEM B;  2JA5 B;  1SSO A;  4RMF A;  4F8Z A;  2B2Y A;  4NJR A;  1G6Z A;  1M4G A;  4PZ6 A;  4HR7 B;  1PFN A;  4DV0 L;  1JWS D;  2VQF L;  3FVL A;  2HQY A;  4KVM E;  3K5L A;  2OWO A;  3BJ7 A;  2AWN A;  4XPL A;  1PYB A;  2GN5 A;  2B58 A;  3VA5 A;  1OXT A;  2VY3 A;  2FIW A;  4KTA A;  3KF8 B;  1PU9 A;  5EPJ A;  3Q8D A;  1BO4 A;  1CUK A;  1SJE D;  3JRU A;  2K6A A;  4ZKC B;  2DNC A;  4L5R C;  3F5B A;  2K32 A;  4PK3 A;  4PSX A;  3IL8 A;  3TZU A;  1KUX A;  4P6Y A;  3S9N A;  3KYH C;  1JOR A;  4FDB A;  1Q12 A;  4BBS H;  3OMG A;  2F0O A;  3KK7 A;  4H02 A;  4DXF A;  2H5M A;  1YZ6 A;  4TSS A;  4Y49 C;  2C5C A;  4A3C G;  4DK1 A;  3CXP A;  2F0P A;  2L12 A;  2WB1 G;  5F2D A;  4PMB A;  3OWE B;  2ZJQ A;  7CPA A;  1HA5 A;  2KHS A;  1A3V A;  1EIH A;  4ZCK A;  4KHP Q;  1I21 A;  3E0E A;  4HJ8 A;  4LNQ A;  4IZ8 A;  5IE8 A;  4F9U A;  2F4V L;  4HSP A;  2F3W A;  1KD1 C;  2FVG A;  4LWC A;  4JPB W;  3PIP A;  1K9M C;  2SDF A;  3H91 A;  4OHJ A;  5EGT A;  2XEG A;  5J8F A;  2I3C A;  3M85 A;  3KL9 A;  2WV6 D;  3GO5 A;  2QEC A;  3S16 B;  1K8M A;  1TXR A;  5C4Z A;  1STN A;  2P6G A;  1U4P A;  3LAC A;  4Y7N B;  4S3S A;  1MSG A;  2VBQ A;  2WAQ B;  4IUT A;  1VS0 A;  5IGG A;  1GO3 E;  1QIL A;  2D9U A;  1HTP A;  2AHO B;  5GAE C;  3RBU A;  3T56 B;  4AXV A;  3IEH A;  3FYN A;  4H44 C;  2O28 A;  1U6M A;  2Q2U A;  3B3C A;  4JXQ A;  2XEF A;  3HRZ C;  4YWM A;  1PYW D;  1HR0 L;  3KQZ A;  1G29 1;  3PF4 A;  3PO3 H;  2N8N A;  4HMJ A;  2E75 C;  1WTX A;  3E0K A;  4V0B A;  4MHZ A;  5CV8 A;  4KLW A;  1EY5 A;  4DR7 Q;  4C3H G;  1FR3 A;  2N78 A;  2JA8 B;  2PR1 A;  1BUV T;  2UXD L;  2NVY H;  3UY5 A;  4G57 A;  3MXG A;  1BBX C;  3S17 H;  1EU4 A;  1TWH B;  1TKH A;  2ZPA A;  1S3Z A;  2F0V A;  2A6E D;  3JVN A;  3VWE A;  5IYC G;  1JB3 A;  5D3I B;  3GTJ B;  1EQV A;  1Q1B A;  3CPA A;  1SN8 A;  2D2C C;  5JEA G;  2PJ7 A;  3J7Z C;  4X8I A;  4C7I A;  4A3E G;  1STE A;  3JC6 6;  3NBH B;  1SYD A;  2EVB A;  4GKJ Q;  1X10 A;  3FF3 A;  3A55 A;  4JD6 A;  5KND A;  2MJ8 A;  3OW7 A;  1MJB A;  1MJ9 A;  2Q4Z A;  5GCN A;  3J81 j;  2XEJ A;  1ON0 A;  5EBC A;  2DJG C;  4LFC Q;  3BHX A;  3PMF A;  1JC7 A;  3S9W A;  2NWG A;  3PQI A;  5L37 A;  3L2P A;  3O13 A;  2JA6 H;  4GNX B;  4NPS A;  1STB A;  3G4S A;  2VQY A;  2A68 D;  3MA2 B;  1Y7R A;  1D5M C;  3A0J A;  2K50 A;  1ILQ A;  3H3V H;  2BUE A;  4HNY B;  3OIP A;  4C2M H;  5G1Z A;  4CGL A;  1I4Q A;  5EQ0 A;  4CYN A;  1CKM A;  1PH5 A;  3SI0 A;  3GIU A;  5DAU A;  4A3D H;  2R7F A;  2F0U A;  3UDI A;  3ULJ A;  1GHE A;  1TKW B;  1BDO A;  4B08 A;  4IK2 A;  2LMC B;  1PTO F;  1VQD A;  3DLJ A;  4KSA A;  2UXC Q;  2XVS A;  5FKA C;  3BLN A;  2J7Z A;  5LYL A;  4JI6 Q;  2XEI A;  2PNR C;  5A28 A;  2QIR A;  2E2I B;  2HV2 A;  4JI2 Q;  2ZEN A;  1F2M A;  1OO9 B;  2R61 A;  4FXG C;  1JOQ A;  2MFI A;  1G6P A;  1DE4 C;  5CC4 A;  3KLW A;  2A69 C;  2JSO A;  2QW7 A;  2NZ1 D;  4X6A H;  1V1P A;  1ENA A;  2XN9 C;  5GAH C;  1YHQ A;  4JXR A;  1TWF H;  1D2B A;  2EYM A;  2I5H A;  2R7Z G;  1TU2 B;  4IHM A;  3NUC A;  3R96 A;  3GB0 A;  4C3H H;  3P1H A;  5IX3 A;  2WPX A;  2A6E C;  2RCN A;  1YHB A;  3OPO A;  3WWV A;  2REF A;  2I5L X;  3HOX H;  5GQO A;  4BXX G;  2EY2 A;  3PO2 G;  4DUK A;  1H9S A;  1O7L A;  3UE0 A;  2JP1 A;  3CQZ H;  5IYC H;  1X3E A;  5CMD A;  5A2Q E;  2PJ6 A;  1CQV A;  1I4X A;  5JEA H;  4G1P A;  1Z8L A;  4ALP A;  4A3E H;  2VUM G;  1B44 D;  1EL0 A;  4YWY A;  5JAV A;  1K4J A;  4ILW A;  4DV3 Q;  1ZLI A;  4AH6 A;  4IPH A;  2Z4H A;  4CAF A;  2A68 C;  4DAM A;  2C6C A;  3PIP 3;  1TT2 A;  4OXP A;  3S1R B;  1QWY A;  1PH1 A;  4FD7 A;  2OXP A;  3EQL C;  1IBK L;  3B7I A;  1NE9 A;  4UA3 A;  1XTC D;  2D62 A;  4FF1 A;  3TP6 A;  4JBJ A;  1FVI A;  1Y0R A;  4JI0 L;  5A27 A;  2IX0 A;  1IYV A;  4NGT A;  4MFJ A;  4NW2 A;  4Q38 A;  3T9Y A;  4RG1 A;  4X62 Q;  1LAM A;  2EVN A;  4GNX C;  1IBM L;  4CJ0 B;  1YSJ A;  5M5X H;  3TX8 A;  3QO2 A;  1YBY A;  3A54 A;  2MNA A;  1JJ2 A;  4MNO A;  2HD3 A;  1YI2 A;  4KMU C;  4O2D A;  5C4H A;  2PSW A;  3HKZ E;  4HTH A;  3TZD A;  1CKO A;  3K5M A;  1TVX A;  2BA1 A;  2ANP A;  1CK1 A;  2KQ3 A;  5A2Q L;  2NN6 H;  3KDF B;  3B6Y A;  5EJW A;  1IIC A;  1E1O A;  4LUO A;  1Q8K A;  1GKH A;  1K0R A;  1AE3 A;  3X3M A;  3X3N A;  2D5D A;  3DWP A;  1XMO Q;  3D7D A;  1VQM A;  2NBF A;  1G51 A;  4A76 A;  2X6L A;  2N88 A;  4HCS A;  4K6L A;  5AG4 A;  8CPA A;  4NSQ A;  3FKI G;  1Y1V H;  1SAP A;  2XGT A;  3ERO A;  4RGN A;  1G8Z D;  5DLQ E;  4DR5 Q;  1PH8 A;  2GIV A;  2PJ2 A;  4MFQ A;  2LY7 A;  4YWK A;  5I6W A;  3MGD A;  5IWA L;  3BJ8 A;  2DEA A;  2EZV A;  3HOU H;  2PQA B;  4P4B A;  4IF5 A;  2O5J C;  2IHE A;  1H9R A;  2Z6K C;  5JJL A;  3AEV A;  4BBR H;  2B2Y C;  2R7Z H;  2DUD A;  2MP1 A;  1KXL A;  4C2Z A;  3R1K A;  6CPA A;  3OTO Q;  2VQE L;  4RGT A;  1Q3L A;  4PNY A;  1UE1 A;  5T1I A;  1NY4 A;  5ISR A;  5LL6 X;  4XQQ A;  1TS3 A;  4LF9 L;  5IP7 H;  2HUZ A;  4JJX A;  4K5W A;  1HCZ A;  1SRU A;  4P2C B;  3C1F A;  2HIX A;  3CPX A;  1DXM A;  2L55 A;  3CCQ A;  5K36 G;  4ZX8 A;  1Z4R A;  2CIJ A;  1PFB A;  3AFQ A;  5M9O A;  1X3P A;  4XPD B;  1WK4 A;  1CG2 A;  2FHT A;  3PSI A;  2WB1 B;  1FNV A;  4OL7 A;  2F0T A;  4X65 Q;  4M3S A;  4RFB A;  2YYZ A;  5LHY 1;  5M3F B;  2EYJ A;  3HOV H;  2Y0S G;  1O7I A;  4IJL A;  1VQ9 A;  4CKC A;  2XWJ B;  4AG9 A;  1TS5 A;  5HY6 A;  2BH8 A;  2E5L Q;  2CNM A;  2DJF C;  2Z9H A;  4JI4 Q;  1Y9K A;  2GE3 A;  1VHO A;  5JVH 3;  3GV6 A;  1S72 A;  1OXU A;  5IYD H;  2MHV A;  2K75 A;  2P0W A;  3KOJ A;  2R92 G;  3TQY A;  1NSL A;  4B3R Q;  3MXU A;  4UCP A;  3KQX A;  4FBE A;  4MCQ A;  2QDB A;  3TRE A;  2M00 A;  3D2M A;  5K8P A;  2VB3 X;  3PB8 X;  3KKW A;  4CHT B;  1HFN A;  2V77 A;  3MRU A;  1V1P B;  1Z8X A;  2G3A A;  2AFW A;  4AVC A;  4JI5 Q;  4E8O A;  1BF4 A;  5C0X G;  5DM7 3;  3K81 C;  2A6H D;  2IY5 B;  2XWB B;  4UP8 A;  2UUB Q;  4RCO A;  5I6Y A;  3TO6 A;  5HUR A;  1AW7 A;  5CNP A;  5IGB A;  3PEI A;  4MY0 A;  4OX9 Q;  4K2K A;  4P4I A;  2NTS A;  2Z10 A;  2ID0 A;  3CCL A;  3I56 A;  4PXC A;  2XIW A;  2J8N A;  1A2U A;  4QF4 A;  1CHQ D;  3NK9 A;  3FKI H;  4JI3 L;  1DZ1 A;  4E0A A;  2CH4 A;  4LQG A;  5KNB A;  2DPT A;  1XIX A;  4X3K A;  4NGM A;  4UP7 A;  3S2H B;  4B12 A;  4DUY Q;  2KCM A;  1J5E L;  1T5X D;  3KHZ A;  2OOT A;  3DXJ C;  1VQG A;  1JOO A;  2C1C A;  2ZEO A;  1S7F A;  3F0A A;  4A95 A;  4B3T L;  3A8J E;  2CQA A;  5G3L F;  1HZB A;  3T16 A;  4Q0F A;  4X3S A;  4HJA A;  2KCN A;  4A93 G;  2EK9 A;  4R4Q A;  1B87 A;  4A3F G;  2B63 G;  4A3B H;  3H09 A;  3F2C A;  2FJ2 A;  2WSA A;  1PA6 A;  4FXK C;  1PMR A;  1TWG H;  1EY7 A;  3NFZ A;  1Y69 U;  1RDP D;  4LF6 L;  3S9L A;  2ZW6 A;  3E9H A;  3S14 B;  3D4R A;  4LW1 A;  4OEL B;  2RC4 A;  2FCK A;  3S6H A;  2EY1 A;  3A7A B;  4LUZ A;  1M8A A;  3N52 A;  5D14 A;  2FE7 A;  3QG1 A;  3K9U A;  3H0G G;  1CBX A;  3NTI A;  5CYU A;  3J80 i;  2CKZ B;  4DV1 Q;  1SQH A;  5F46 A;  1QVC A;  1QJO A;  3E9I A;  1EWC A;  3GDE A;  1QSM A;  4BY1 G;  3GTP B;  4XPD C;  5FLM G;  1F9P A;  3D67 A;  1KRT A;  4AYB E;  2NYQ A;  1IYK A;  3RYO A;  4CYQ A;  3RAM A;  5KYL A;  3GTK H;  2NZO A;  1KIX A;  1D7Q A;  1LAP A;  3GUX A;  3CMA A;  5I4D A;  4IUP A;  2R92 H;  4RH6 A;  3ZJ0 A;  1EIF A;  5C44 H;  4EQP A;  3S1N H;  1CQF A;  1Q82 C;  3TT2 A;  4C3I G;  3TS0 A;  3BYY B;  4A3K G;  3QB8 A;  3TP8 A;  4NXN L;  4B3S L;  3Q22 A;  2I0Q A;  3EC4 A;  2Q8R E;  1IHZ A;  4DPG A;  3TSS A;  1S5K A;  4HKF A;  4NCZ A;  2RF4 A;  2NVT H;  3NPP A;  4C56 C;  1FGU A;  3KR5 A;  1N32 L;  1LTS D;  4JI7 L;  3MC0 B;  3K0Y A;  4R4I A;  5KTD A;  1KDB A;  1I4R A;  4TRD A;  3GTL H;  4PPZ A;  3TO9 A;  5K8N A;  4KOY A;  2AKW B;  1H9K A;  1SYB A;  2UUA L;  1RCV D;  2YTV A;  4H0L C;  4YHH L;  1UFH A;  4BD9 A;  2RCF A;  3PO2 B;  3RMH A;  3N5F A;  3VYT A;  5IP9 G;  5JM6 A;  2A4N A;  1EEI D;  4A3I H;  1VCI A;  2YTX A;  1S7N A;  2V4D A;  3A5Z B;  2KHJ A;  3QIA A;  2Q51 A;  2PCU A;  4B6Z A;  1IYU A;  2K01 A;  5FJ8 G;  3QAH A;  1P16 A;  1YW4 A;  4PG3 A;  2NVQ H;  3MFG A;  4WFN 3;  3J80 c;  4U9Y A;  4W9Y A;  5F47 A;  2PQE A;  2L5T A;  2VUM B;  4KN7 C;  4PZ7 A; 
#chains in the Genus database with same CATH homology
 2EYP A;  3NWS A;  2RSO A;  2K28 A;  3T13 A;  4PV1 C;  1B53 A;  5E4W C;  3DWQ A;  4OC5 A;  1I4G A;  4DAY A;  5C0X I;  2F0L A;  1WTQ A;  3PB6 X;  4P44 A;  5LYF A;  4PXE A;  1GYT A;  1ILP A;  1ZLH A;  2GU2 A;  2QYV A;  1KDA A;  2IW3 A;  5CR3 A;  2B2V C;  1AZP A;  2QKI C;  3SR1 A;  4L8J A;  3TN2 A;  3T8W A;  5E4X A;  2MUY A;  3GTM B;  3TME A;  1EY9 A;  3I8Z A;  4QCL A;  2Q8T A;  1XRY A;  4RGM A;  4MHN A;  3VAR A;  1CP6 A;  4EWT A;  3M3Y B;  4Q5V A;  1R9T B;  2RKS A;  4K14 A;  1KLG D;  3VR4 A;  5M5W B;  4MCP A;  1C48 A;  4WJB A;  1HPC A;  4IQZ A;  4ME5 A;  1F2P A;  1DOL A;  2EDG A;  3SDZ A;  2EYH A;  1CM9 A;  2EJF C;  1NR4 A;  2BDO A;  1EQT A;  2F0S A;  1E0B A;  2V8D A;  1LT4 D;  3D6C A;  5AFW A;  4ZY2 A;  1CA5 A;  2M9V A;  3LWE A;  3J7A V;  2HUG A;  4YIJ A;  1SYE A;  3KI9 A;  3T53 B;  3B35 A;  4OGQ C;  3S1Q B;  2AUK A;  2CF4 A;  5C3X A;  1SE3 A;  1HQR D;  4X3U A;  1SYC A;  4R7M A;  1X32 A;  2Y0S B;  4XQN A;  4QIW B;  1ZYR C;  3AMU A;  4NGS A;  2AQ2 B;  2E74 C;  5D65 A;  1TS2 A;  1ZG7 A;  1VDZ A;  1X3Q A;  2WKD A;  2JEW A;  4ODG A;  1CTM A;  1NR2 A;  4O42 A;  3H8E A;  5LRJ A;  1Y8P B;  1I3Q B;  1O78 A;  3E5S A;  1RTN A;  3PUY A;  3A56 A;  4F8M A;  2PJ8 A;  3R93 A;  2YU9 B;  5IB9 A;  5I2Y A;  2F0E A;  1OXX K;  5LYD A;  5IOC A;  3HLP A;  1I6H B;  1TR5 A;  5LYI A;  5HXD A;  2F0D A;  2I46 A;  1MI2 A;  1W6K A;  2KVM A;  3S2D B;  1IGB A;  4EQN A;  3FVQ A;  4IUQ A;  1PZK D;  3N6R A;  1WTP A;  3V2T A;  3M4O B;  4IFD H;  3RZO B;  4OME A;  2NUC A;  2F03 A;  2NTT A;  5EKI A;  4IFD J;  4ZK9 B;  1H8L A;  4C1N I;  1PYT B;  3EA6 A;  2KUM A;  1IW7 C;  2FMM A;  3HOZ B;  4RKB A;  1IY7 A;  1LTA D;  4TNU A;  1EIG A;  4RKL A;  1A6X A;  1IKL A;  5EKK A;  2XRS D;  3K57 A;  3IFE A;  1Q7L A;  1ZEQ X;  3GTQ B;  2B2U A;  1DD2 A;  1YW6 A;  3OWF A;  3SEB A;  4A93 B;  4DNR B;  4A3F B;  2B63 B;  1VMP A;  4X2T A;  1SNO A;  1LAN A;  2BE5 D;  1WD1 A;  2E2H B;  1HEE A;  3VH9 A;  1XYI A;  2VXW A;  3C1E A;  4XQJ A;  4A38 A;  1GUO A;  4K5X A;  2B2T A;  2JEA I;  3B3W A;  4ZKB B;  3BVG A;  2ZEH A;  3PV0 A;  5LL6 S;  3MHB A;  2ZEL A;  1PFM A;  3NQT A;  3CHB D;  5NUC A;  4BS9 A;  1U4L A;  1J9O A;  2K5Q A;  1ZKO A;  4EVO A;  3VR3 A;  2J0T D;  1PZJ D;  1RJT A;  4IUU A;  4FUU A;  2L0C A;  4P4J A;  1XJO A;  2F4I A;  2PCF B;  2A69 D;  2OEO A;  1F9S A;  1AZQ A;  2OR4 A;  3V96 A;  1Z47 A;  1ZG8 A;  2NVX B;  1HA6 A;  1ESF A;  1JIC A;  5CPA A;  1PTO C;  1GUW A;  1I6V C;  5J22 A;  1O80 A;  3WT4 A;  2KEE A;  2NB0 A;  4Z65 A;  4ZLT F;  3IAY A;  1QG7 A;  4KJN A;  4KKS A;  3PUX A;  2BE5 C;  1EY4 A;  4I7Z C;  1QOH A;  4C3J B;  3D7G A;  3R3O A;  4FF3 A;  1G91 A;  3IC1 A;  4EME A;  1H9M A;  4KKT A;  5JH9 A;  3J80 E;  4ZY1 A;  2JXM B;  1XFO A;  4K3N A;  1UEA B;  3TP7 A;  2ZXO A;  4KY6 A;  2J4X A;  1LTR D;  1RKN A;  1GJX A;  4LJZ C;  3OHX C;  1BNZ A;  2NN6 G;  5FO8 B;  3ND9 A;  5IIF A;  3HKZ B;  1TS4 A;  3HGB A;  3D31 A;  3PUW A;  3MXP A;  3HG9 A;  2HB6 A;  2WKC A;  3NE5 B;  3ND8 A;  1C4Q A;  4HMI A;  3Q24 A;  1BAV A;  4CJ1 B;  1OXS C;  1AN8 A;  2PJ3 A;  4PMW A;  4G7H C;  3FEE A;  1CI3 M;  4HSV A;  1EOT A;  1JQG A;  5FLX E;  2H1E A;  1ELL P;  1ET6 A;  1EY8 A;  1VMC A;  2PRQ A;  3KHX A;  3J80 L;  3VYS A;  1XWE A;  4QUF A;  2RA4 A;  3Q6S A;  1NUC A;  2JYO A;  3I3C A;  4FF4 A;  4RCN A;  2AFS A;  2PZU A;  2B39 A;  4BBS B;  4F7X A;  5EPK A;  5C3W A;  2PJ4 A;  1LT5 D;  1BOS A;  1IL8 A;  4MRI A;  1L0Y B;  5ELD A;  2V8V A;  1B3A A;  1CZG A;  1VHE A;  3BDO A;  4QMG A;  1M4V A;  4E6I A;  2PW5 A;  2QCP X;  4V19 0;  2AFU A;  1NSN S;  3DM1 A;  2IX3 A;  1A3T A;  3VR5 A;  3SVM A;  5FLX L;  1HUM A;  2I07 B;  5C5M A;  3WAB A;  2EPB A;  2F0K A;  3A8K E;  3ZYY X;  1STG A;  3E0J A;  1WTV A;  2E76 C;  3R2T A;  3K59 A;  2VL1 A;  1T5E A;  4XIG S;  2HDM A;  4OC2 A;  1TQO A;  1QMU A;  1S5F D;  3OIQ A;  3W3A A;  3PO3 B;  1TY0 A;  5I2X A;  5KEE A;  3EJI A;  3H8G A;  3CRL C;  3SK8 A;  2LFN A;  4OO1 H;  3SJG A;  5CV9 A;  2PO4 A;  5T1G A;  4A37 A;  1B9M A;  3DWA A;  2TMP A;  3BDC A;  3MZ5 A;  2Z1C A;  1A3U A;  3I90 A;  3DEP A;  1TY2 A;  3I73 A;  5DS0 A;  2XSC A;  1TF8 A;  2RQX A;  4L6T B;  4K2L A;  1GUN A;  4B9X A;  4IAL A;  1F9R A;  4NJQ A;  4CJ2 C;  4FYD A;  4OC0 A;  4XTC S;  2HCC A;  5E1F A;  2NN6 I;  2JA6 B;  2AFM A;  4U68 A;  4A94 A;  3SK4 A;  4QB4 A;  1Q90 A;  1JWM D;  2KED A;  1YNN D;  4O1N A;  4C2M B;  2QF7 A;  1ESR A;  5I9O A;  2JEB I;  4OO1 I;  1PRT B;  2ZEP A;  4A3D B;  5K8M A;  2OF1 A;  1FT7 A;  1HTL D;  4UDU C;  2PVV A;  3V7Z A;  3GQB A;  2AQ1 B;  3L7Z C;  4O23 A;  3QOL A;  5BN4 A;  1CPS A;  1YME A;  4AYB B;  1EY0 A;  1TWC B;  3VAT A;  2G9D A;  3PUZ A;  4NGP A;  4IN3 A;  1PRT D;  3SJE A;  2EK8 A;  1TKF A;  1JE4 A;  4ABN A;  1KAB A;  3BS1 A;  3VYU A;  4NFR A;  1SNM A;  1STH A;  3D4U A;  1KLU D;  2BDN A;  1CHP D;  1LCP A;  4TKO B;  1EE3 P;  1WTW A;  2GRE A;  2PIY A;  1O7Y A;  1RF2 D;  1GUG A;  1G2S A;  4C3H B;  3J81 E;  4KY7 A;  1H9S B;  2AUJ D;  4A39 A;  2KOL A;  4ZQ3 A;  3WC6 A;  3HOX B;  2VB2 X;  4DA2 A;  1HFG A;  2IX1 A;  1PCA A;  2EE1 A;  2PYK A;  5FOB B;  3CQZ B;  4CPA A;  4NKL A;  3TC8 A;  1LAC A;  4MHY A;  1J8I A;  5BN5 A;  4A3E B;  2PJ0 A;  3PBB A;  2MGS A;  1I4H A;  1JWU D;  1QNU A;  1SYG A;  4DAP A;  1BCP B;  2FMC A;  2PW7 A;  1I4P A;  1SNC A;  2RB7 A;  3PFO A;  1YNN C;  2ICE C;  1FGB D;  2DN8 A;  2EWB A;  2HQE A;  2IT1 A;  2K05 A;  2RDG A;  1DCZ A;  1B2T A;  1R4Q B;  3NH8 A;  3DMU A;  3AU7 A;  2WZN A;  3H6M A;  3J81 L;  3W2D A;  4IAV A;  3VR2 A;  1SXT A;  5M5X B;  4EGV A;  3NA6 A;  1KDC A;  1BCP D;  5KIX A;  1F2Y A;  3H3V C;  1F2Z A;  3GP7 A;  1Y0Y A;  3ONA B;  3WOE A;  1A2T A;  1PRT C;  4FNF A;  4KHV A;  3BI1 A;  2F0W A;  4NGN A;  2IPK D;  5C5L A;  4G7Z C;  1F77 A;  4KKU A;  1DON A;  1ENF A;  1KTK A;  5CV6 A;  2WAC A;  1B1Z A;  1Y1V B;  3C3L A;  3SJF A;  3WC7 A;  2OT2 A;  2O4X A;  1BO0 A;  2NYZ D;  3HOU B;  5JOB A;  1E2W A;  2R7Z B;  5D3D A;  4MIU A;  2J9A A;  4PXB A;  1RTO A;  3P20 A;  2CW0 C;  1EZ8 A;  3KR4 A;  2B8F A;  4QUC A;  1DYQ A;  1HXY D;  2XRQ D;  4KSI A;  3CRK C;  3C2P A;  1XMB A;  4C1N K;  3I70 A;  1AMP A;  2G9H D;  2R6G A;  3NTH A;  2KA7 A;  4DJL A;  1YNJ D;  5ELE A;  1M4L A;  4CGY B;  4NDX A;  1EYA A;  3NH4 A;  3H8F A;  1BQQ T;  4J1M A;  4TWE A;  1D5Z C;  4KJO A;  2ZEE A;  5IGF A;  3L2N A;  4XXE A;  4R76 A;  3KF8 A;  1ZYR D;  3WDN A;  4P10 A;  3NXW A;  1BCP C;  2WII B;  1DTD A;  1LAB A;  1VF7 A;  3SI1 A;  2K5D A;  5ELB A;  3D8G A;  2EYF A;  4P4D A;  4NGQ A;  2QIL A;  2B2W A;  1LTT D;  4N9T A;  4MCR A;  2FFK B;  3D7H A;  3L3O C;  3K9T A;  2ZEF A;  2RBM A;  4OC1 A;  1S5E D;  4N9P A;  2M2L A;  2AFX A;  4IFD G;  3I4L A;  1AFP A;  3JAM E;  4F88 A;  2GA4 B;  1LOK A;  5IGC A;  3IO1 A;  5BN3 A;  3FKI B;  3KAS A;  3PB7 X;  1FD7 D;  2B8G A;  2EOT A;  2F0Q A;  3A7L A;  1RHP A;  2KCC A;  1F9Q A;  1SMY C;  3FH4 A;  1IW7 D;  1R3N A;  1XXG A;  2L11 A;  2ZEG A;  1DM0 B;  3D4D A;  3DEO A;  3BG3 A;  5A35 A;  3I91 A;  3NHH A;  4A3B B;  1YNJ C;  2SOB A;  5EPL A;  4I65 A;  4ONW A;  1OXV A;  1TWG B;  4GZY C;  4DF7 A;  3NTK A;  3SI2 A;  4MHP A;  1UWY A;  3I72 A;  1F57 A;  5HVH A;  4R8I A;  3QWN A;  1CFM A;  1ARM A;  5COR A;  4XYQ A;  3V38 A;  1ROD A;  3MFY A;  3TP5 A;  1Y8N B;  4CBV A;  3JAM L;  2LKV A;  5HGT A;  2EY6 A;  4ULL A;  3NSW A;  4NGR A;  1B50 A;  5KGU A;  4PMC A;  3NBH A;  1FNU A;  4ZRZ A;  4XDX A;  2DY7 A;  2F0H A;  2R92 B;  5DEH A;  4R8N A;  2IJZ A;  5C44 B;  5IOD A;  5CBM A;  1GHJ A;  3S1N B;  1ENC A;  2HDL A;  2SNM A;  2BO9 A;  1PTO B;  3LX0 A;  1WVL A;  3B3S A;  3E6Z X;  2EJG C;  3K58 A;  2MPM A;  2NVT B;  4JYW A;  1ICW A;  4KK7 A;  2IL8 A;  4G7O C;  4OIJ A;  1D1K A;  4HED A;  3QNV A;  3ISZ A;  5CBE E;  1PTO D;  2PZW A;  1STA A;  5F09 A;  4A3I B;  4CKE A;  2IWH A;  5D8N A;  2EXZ A;  4ZI6 A;  1KWM A;  4MN3 A;  5KNC A;  1QNK A;  2F8H A;  1EWH A;  4BA1 I;  5J1Q A;  4DK0 A;  1FYC A;  4NMZ A;  3R8B A;  3SE0 A;  2K03 A;  2NVQ B;  1RD9 D;  2NSM A;  4H2K A;  3EVQ A;  3GTO B;  1B9N A;  2VNU D;  3BVM A;  5JVG 3;  4A3M B;  4UAI A;  3IJ3 A;  5LRG A;  1S4Z A;  3H0G B;  4IFD I;  3TDQ A;  4ZUI A;  5CV5 A;  4BY1 B;  3KBX A;  3PBE A;  2F0F A;  3U9O A;  2ABZ A;  2ZEM A;  3GLJ A;  1BPN A;  1DOK A;  4RUH A;  2WP8 J;  5ELY A;  1ZXT A;  4PQX A;  3BDL A;  4BA2 I;  1JR0 D;  3EFX D;  1C8C A;  1SNQ A;  1S5D D;  1A15 A;  2F0N A;  4OIW A;  4C3I B;  4RWS C;  3M7G A;  1U4M A;  2HCI A;  2CTB A;  4A3K B;  2O2L D;  3CKI B;  4XYO A;  4P4E A;  3FPP A;  3FMC A;  1Z2L A;  1SE4 A;  3OMC A;  4NP5 A;  4KD4 A;  3HZX A;  1PZI D;  2C6G A;  5HVG A;  2BOS A;  4K6D A;  4CKB A;  4JK1 C;  1QB5 D;  2POK A;  4WWV A;  3D66 A;  2TSS A;  3J7A F;  2EYL A;  3QJY A;  1FNO A;  2PMZ B;  1K8O A;  3DGV A;  1AEX A;  3J7Y W;  1SDF A;  5ELC A;  3Q23 A;  1GXD C;  3TBI B;  4ID6 A;  1DOM A;  2R93 B;  2XNA C;  2PVW A;  3IWW A;  2N55 A;  2BOA A;  1Q1E A;  1ET9 A;  1BLL E;  2PJB A;  4FWU A;  3DHQ A;  4EFD A;  2F7V A;  1UNS A;  2H4O A;  1R4P B;  3VR6 A;  4A3G B;  2L1B A;  4UF4 A;  1SE2 A;  3NQI A;  2F0M A;  2PJA A;  2EY5 A;  5KRU A;  3IKJ A;  1G2T A;  5IT9 E;  1WTO A;  2KJX A;  2PJC A;  1WCM B;  1O7Z A;  1STY A;  4DXG A;  2A5H A;  5IGD A;  3HOY B;  3DUZ A;  2QVP A;  4OO1 G;  2B2W C;  3KGQ A;  3P7J A;  3FPU B;  4RGO S;  3F2U A;  4K5V A;  4EQO A;  4HAE A;  4J6H A;  2DNE A;  2JBJ A;  1EFI D;  1LT3 D;  1PXU A;  5TSS A;  4OC3 A;  1NCV A;  3GTG B;  1VGY A;  1Y7E A;  3BZD B;  5C3E B;  4DYO A;  4UEZ A;  1S5B D;  2Q43 A;  5IT9 L;  2PJ1 A;  4KN4 C;  1JQY D;  1GOZ A;  1CPX A;  2GLF A;  1Q8I A;  3KUP A;  4WRD A;  2E2J B;  1EEF D;  3D68 A;  4BWG B;  2SNS A;  1ML0 D;  3H94 A;  3NH5 A;  3A8I E;  4JZ0 A;  3L9A X;  3S1M B;  1EYD A;  1V43 A;  2FIN B;  1AYE A;  1V8Q A;  1XBU A;  1ARL A;  2K1B A;  4G4K A;  1DJR D;  3SXH A;  3PRT A;  5DM6 3;  3FRP B;  4FF2 A;  1HUN A;  4MMO A;  5JEA J;  1CP7 A;  5C4J B;  5THW A;  4X3R A;  1LV9 A;  2EJM A;  1Z7T A;  1CT1 D;  1GUS A;  3QB3 A;  5G3L D;  3LMS A;  1EU3 A;  1MBY A;  4L63 B;  3U9S A;  5HVF A;  1SNP A;  1XX8 A;  2B2V A;  3PB4 X;  4R6T A;  4TQU S;  4ZUJ A;  4ZYS A;  2NVY B;  3BVZ A;  1TF9 A;  2ZED A;  3I1U A;  3IFD A;  2LS0 1;  2O53 A;  3RZA A;  3S17 B;  1CZW A;  3KZW A;  3URY A;  5DNF A;  4XT3 B;  4DU9 A;  3PIO 3;  3RLF A;  4F87 A;  1LT6 D;  4YU9 A;  4XT1 B;  3AB9 A;  2ICI A;  4UEF A;  4FXD A;  2DY8 A;  2X69 A;  3WC5 A;  3IFT A;  1GHK A;  1SYF A;  2CHB D;  1SBB B;  2B2U C;  4Z9C B;  4P4F A;  3HP3 A;  2L9H A;  2ZXR A;  1TWA B;  1MGS A;  1ONL A;  2PZT A;  2F0I A;  3KLS X;  3D6W A;  2AFZ A;  1V1O A;  1FNW A;  2B2T C;  2PPB C;  1PLF A;  2AFO A;  5JJZ A;  3ITP A;  5JGF A;  5K8O A;  2K33 A;  4M1U B;  1LLR D;  4HN7 A;  1UAP A;  2WYR A;  3FX6 A;  2F1M A;  1Y1W B;  3PFE A;  2A73 B;  5CBA E;  1BR9 A;  3PB9 X;  2Z4I A;  3MN8 A;  1TWF B;  4K8J A;  4B9W A;  2JBK A;  2PE3 A;  5C4X B;  1OBR A;  5E3F A;  4K8I A;  2V8H A;  3OOC A;  1E2V A;  1QQ9 A;  1QCB D;  3QOJ A;  2QJ8 A;  3B3T A;  1D1I A;  4DN4 M;  4P45 A;  4PXD A;  2L4N A;  5LRK A;  2CW0 D;  4A3J B;  1ELM P;  1UUP A;  4HCE A;  5JPN C;  3D7F A;  1JCK B;  2AQ3 B;  2SEB D;  3HEJ A;  4OP4 A;  3D3R A;  5ELF A;  5IGE A;  3VA7 A;  2BCO A;  4H7B A;  1MSH A;  1LTI D;  2Z8L A;  4GM5 A;  2IJ0 A;  3VYR A;  1YLO A;  1Y8O B;  2CVR A;  3K2K A;  2JA7 B;  4KHZ A;  3FEC A;  2BA0 A;  1K83 B;  1TKJ A;  1E2Z A;  4RAU C;  3T4A C;  1RTQ A;  2WIN B;  3M7N A;  5I4M A;  2K04 A;  1AP0 A;  2E2D C;  4JBW A;  4RHS A;  3HS0 C;  1VIX A;  2PIZ A;  2F0G A;  3RD4 A;  2C6P A;  3LWU A;  5K36 H;  3S9M A;  4DAV A;  2Q8I B;  3ISX A;  2IQ6 A;  2PJ5 A;  2KEC A;  1LTB D;  4F9V A;  4LK1 C;  4KI0 A;  1SEB D;  3I4M B;  5J39 A;  4UIA A;  2RVL A;  4DGZ A;  3K7A B;  1F2O A;  1II3 A;  5EBD A;  2EYO A;  5FO9 B;  3MTS A;  5J1Z A;  3SHL A;  1LO5 D;  3FED A;  4BBR B;  1NSA A;  4R9W A;  3I4N B;  2A6H C;  3IIB A;  3UI2 A;  2C9O A;  4FAI A;  3HUV A;  1PTO H;  2RDH A;  3B2Y A;  5M5Y B;  1SMY D;  1Z6H A;  1I50 B;  1CX8 A;  1KNE A;  5C0X H;  3ERQ A;  4J8Q A;  5JPM C;  1SJH D;  5C0X J;  3M4Y A;  4DFA A;  4OID A;  2ZXP A;  4M8A A;  2GLJ A;  1NAP A;  3G7L A;  4Q7A A;  3LNN A;  1PDQ A;  5EKL A;  4WJW A;  4MHE A;  1HRJ A;  1QE6 A;  1WD0 A;  1CA6 A;  3HOV B;  1U4R A;  5CGK A;  3FEW X;  4DNT B;  1SND A;  3GD7 A;  5M3M B;  1KAA A;  2V8G A;  3NWT A;  2AWO A;  4MXU A;  1LTG D;  1PRT F;  3HOW B;  3KLR A;  4FP5 D;  1F2L A;  4C3J G;  4KY5 A;  3RZD B;  4RA8 A;  5KYI A;  4LAA A;  4ZYQ A;  2IMO A;  1BPM A;  2O4H A;  4OC4 A;  4UIB A;  1IKM A;  2F3V A;  2ZOG A;  2RSN A;  4RHR A;  5CV4 A;  1HHV A;  1MD2 D;  3BXM A;  1R43 A;  3CU7 A;  4IUV A;  4OKO A;  2F0J A;  4FVM A;  4ZAI A;  4KV6 A;  2ENB A;  2RDF A;  2PJ9 A;  1TII D;  1HDU A;  4FO2 A;  2QEJ C;  4R8F A;  1H9J A;  2JE6 I;  1D6E C;  2R3Z A;  3FJU A;  3G6J B;  2CTC A;  2ZOF A;  4BY7 B;  1EZ6 A;  3SJX A;  3KLS A;  3SK6 A;  3MAQ A;  1W6J A;  4OIK A;  3BYT B;  3PUV A;  3MXN A;  1WTR A;  3RUZ A;  3OSO A;  1SFO B;  1Z5R A;  1HDQ A;  4UEE A;  2K5W A;  3S15 B;  5COY A;  2RFH A;  1VF5 C;  3B3V A;  3D4W A;  3K5O A;  3SK5 A;  4MCS A;  3CT9 A;  1B4O A;  3K5N A;  3WOF A;  1ZG9 A;  4U67 3;  3BI0 A;  1BCP F;  2X6G A;  4X3T A;  3NP8 A;  4IUR A;  3R2I A;  3K6O A;  4H13 C;  5CV7 A;  3GTK B;  4ZX9 A;  4WOR A;  3CDX A;  3MVV A;  5FK9 C;  3KBG A;  1HQM C;  5FO7 B;  1GUT A;  1LFW A;  5D29 A;  1D5X C;  3NBI A;  2K7V A;  3MEH A;  3MWY W;  3Q0A A;  2O5I C;  1BXT A;  2HC9 A;  2ZT9 C;  3GTL B;  3GV3 A;  1KNA A;  5K5P A;  4LMQ D;  5I9P A;  4IUN A;  1EY6 A;  1L0X B;  3FDT A;  1EYC A;  2A74 C;  3C46 A;  1JOK A;  1S5C D;  3P75 A;  4PQA A;  4KD3 A;  5C6A A;  4ZY0 A;  3T51 B;  4F8Z A;  1U9R A;  2JA5 B;  1SSO A;  2B2Y A;  4NJR A;  1G6Z A;  4HR7 B;  1PFN A;  1JWS D;  3FVL A;  3K5L A;  2AWN A;  3VA5 A;  1OXT A;  4KTA A;  5EPJ A;  1SJE D;  3JRU A;  2K6A A;  4ZKC B;  2DNC A;  2K32 A;  3IL8 A;  3TZU A;  4P6Y A;  3S9N A;  1JOR A;  1Q12 A;  3OMG A;  2F0O A;  3KK7 A;  4DXF A;  4TSS A;  2C5C A;  4DK1 A;  2F0P A;  2L12 A;  5F2D A;  4PMB A;  3OWE B;  7CPA A;  1HA5 A;  2KHS A;  1A3V A;  1EIH A;  4F9U A;  4IZ8 A;  4HSP A;  2F3W A;  2FVG A;  2SDF A;  3H91 A;  4OHJ A;  5EGT A;  2XEG A;  2I3C A;  3M85 A;  3KL9 A;  2WV6 D;  3GO5 A;  3S16 B;  1K8M A;  1TXR A;  5C4Z A;  1STN A;  1U4P A;  4Y7N B;  4S3S A;  1MSG A;  2WAQ B;  4IUT A;  5IGG A;  1QIL A;  2D9U A;  1HTP A;  3RBU A;  3T56 B;  4AXV A;  3IEH A;  4H44 C;  3B3C A;  2XEF A;  3HRZ C;  1PYW D;  3KQZ A;  1G29 1;  4HMJ A;  2E75 C;  1WTX A;  4V0B A;  4MHZ A;  5CV8 A;  1EY5 A;  4C3H G;  1FR3 A;  2JA8 B;  1BUV T;  4G57 A;  3MXG A;  1BBX C;  1EU4 A;  1TWH B;  1TKH A;  2F0V A;  2A6E D;  1JB3 A;  5D3I B;  3GTJ B;  1EQV A;  1Q1B A;  3CPA A;  2D2C C;  5JEA G;  2PJ7 A;  4X8I A;  1STE A;  1SYD A;  2EVB A;  3FF3 A;  3A55 A;  5KND A;  2MJ8 A;  3OW7 A;  2Q4Z A;  2XEJ A;  5EBC A;  3BHX A;  3PMF A;  1JC7 A;  3S9W A;  2NWG A;  3O13 A;  1STB A;  2A68 D;  3MA2 B;  1D5M C;  1ILQ A;  3OIP A;  1I4Q A;  5EQ0 A;  3SI0 A;  5DAU A;  2F0U A;  1TKW B;  1BDO A;  4B08 A;  4IK2 A;  2LMC B;  1PTO F;  3DLJ A;  2XVS A;  5FKA C;  2J7Z A;  5LYL A;  2XEI A;  2PNR C;  2E2I B;  2ZEN A;  1F2M A;  1OO9 B;  2R61 A;  4FXG C;  1JOQ A;  1DE4 C;  5CC4 A;  2A69 C;  2JSO A;  2NZ1 D;  1V1P A;  1ENA A;  2XN9 C;  1D2B A;  2EYM A;  1TU2 B;  4IHM A;  3NUC A;  3GB0 A;  3P1H A;  2A6E C;  3OPO A;  2EY2 A;  4DUK A;  1H9S A;  1O7L A;  2JP1 A;  5CMD A;  5A2Q E;  2PJ6 A;  1CQV A;  1I4X A;  5JEA H;  4G1P A;  1Z8L A;  1B44 D;  1EL0 A;  4YWY A;  5JAV A;  4ILW A;  1ZLI A;  2Z4H A;  2A68 C;  2C6C A;  3PIP 3;  1TT2 A;  3S1R B;  1QWY A;  2OXP A;  3EQL C;  3B7I A;  1XTC D;  2D62 A;  4FF1 A;  3TP6 A;  1Y0R A;  2IX0 A;  1IYV A;  4NGT A;  4NW2 A;  1LAM A;  4CJ0 B;  1YSJ A;  3TX8 A;  3QO2 A;  3A54 A;  5C4H A;  4KMU C;  3TZD A;  4HTH A;  3K5M A;  1TVX A;  2BA1 A;  2ANP A;  1CK1 A;  2KQ3 A;  5A2Q L;  2NN6 H;  5EJW A;  3X3M A;  3X3N A;  2D5D A;  3DWP A;  3D7D A;  2NBF A;  2X6L A;  2N88 A;  4HCS A;  4K6L A;  8CPA A;  3ERO A;  1SAP A;  4RGN A;  2PJ2 A;  1G8Z D;  2LY7 A;  5I6W A;  2DEA A;  2EZV A;  4P4B A;  2O5J C;  1H9R A;  2B2Y C;  2MP1 A;  6CPA A;  4RGT A;  1Q3L A;  4PNY A;  5T1I A;  5ISR A;  5LL6 X;  4XQQ A;  1TS3 A;  4K5W A;  1HCZ A;  4P2C B;  3C1F A;  3CPX A;  1DXM A;  2L55 A;  5K36 G;  4ZX8 A;  2CIJ A;  1PFB A;  5M9O A;  1X3P A;  1CG2 A;  2FHT A;  2WB1 B;  1FNV A;  4OL7 A;  2F0T A;  4RFB A;  2YYZ A;  5LHY 1;  5M3F B;  2EYJ A;  4CKC A;  2XWJ B;  1TS5 A;  1VHO A;  5JVH 3;  3GV6 A;  1OXU A;  2MHV A;  3MXU A;  3KQX A;  4FBE A;  4MCQ A;  2QDB A;  2M00 A;  5K8P A;  2VB3 X;  3PB8 X;  4CHT B;  1HFN A;  2V77 A;  3MRU A;  1V1P B;  2AFW A;  1BF4 A;  5C0X G;  5DM7 3;  2A6H D;  2XWB B;  4RCO A;  5I6Y A;  5HUR A;  1AW7 A;  5IGB A;  3PEI A;  4K2K A;  4P4I A;  2NTS A;  2ID0 A;  4PXC A;  2XIW A;  1A2U A;  4QF4 A;  1CHQ D;  3NK9 A;  1DZ1 A;  4LQG A;  5KNB A;  4X3K A;  4NGM A;  3S2H B;  1T5X D;  3KHZ A;  2OOT A;  3DXJ C;  2C1C A;  1JOO A;  2ZEO A;  3A8J E;  2CQA A;  5G3L F;  3T16 A;  4Q0F A;  4X3S A;  2KCN A;  2EK9 A;  3H09 A;  2FJ2 A;  4FXK C;  1PMR A;  1EY7 A;  3NFZ A;  1Y69 U;  1RDP D;  3S9L A;  3S14 B;  3D4R A;  2EY1 A;  3A7A B;  1M8A A;  3N52 A;  5D14 A;  3QG1 A;  1CBX A;  3NTI A;  5CYU A;  1QJO A;  1EWC A;  3GTP B;  1F9P A;  3D67 A;  2NYQ A;  3RAM A;  5KYL A;  1LAP A;  3GUX A;  5I4D A;  4IUP A;  4RH6 A;  4EQP A;  1CQF A;  4C3I G;  3BYY B;  3TP8 A;  3Q22 A;  2Q8R E;  1IHZ A;  3TSS A;  3NPP A;  4C56 C;  3KR5 A;  1LTS D;  3MC0 B;  3K0Y A;  1KDB A;  1I4R A;  4TRD A;  4PPZ A;  5K8N A;  1H9K A;  1SYB A;  1RCV D;  4H0L C;  4BD9 A;  3PO2 B;  3RMH A;  3N5F A;  3VYT A;  5JM6 A;  1EEI D;  1VCI A;  2V4D A;  3QIA A;  2Q51 A;  2PCU A;  4B6Z A;  1IYU A;  2K01 A;  1YW4 A;  3MFG A;  4WFN 3;  4W9Y A;  2PQE A;  2L5T A;  2VUM B;  4KN7 C;  3V05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...