2G9DA

Crystal structure of succinylglutamate desuccinylase from vibrio cholerae, northeast structural genomics target vcr20
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
340
structure length
340
Chain Sequence
KSLFRQSFLFDSLDLDHPMVAQTVRTEQGVTLKLHQRGVLEVIPAQTDAATKNMVISCGIHGDETAPMELLDKWIDDIVSGFQPVAERCLFIMAHPQATVRHVRFIEQNLNRLFDDKPHTPSTELAIADNLKVLLRQFFANTDEHSRWHLDLHCAIRGSKHYSFAVSPKARHPVRSRSLMQFIEQAHIEAVMLSNAPSSTFSWYSAEHYAAQALTLELGQVARLGENLLDRLLAFDLAMRDLISRHKPEHLPRKSVMYRVSRTIVRLHDDFDFRFSDDVENFTAFMHGEVFGHDGDKPLMAKNEGEAIVFPNRKVAIGQRAALMVCKVNTRYEDDQLVYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinylglutamate desuccinylase
publication title Crystal Structure of Succinylglutamate desuccinylase from Vibrio cholerae, Northeast Structural Genomics Target VcR20.
rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
total genus 71
structure length 340
sequence length 340
ec nomenclature ec 3.5.1.96: Succinylglutamate desuccinylase.
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.630 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2g9dA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2g9dA01
3KASA 4Q7AA 5DS0A 5LYIA 4A94A 3SI0A 1YW6A 2NYQA 5I4MA 4YWYA 4PXDA 3KHXA 1TF9A 3NFZA 2G9DA 2VL1A 1ZG8A 1OBRA 2C1CA 1F2PA 3KR4A 3FJUA 1ZG7A 3IJ3A 1HEEA 4ZYQA 3ISXA 4A38A 4NFRA 2POKA 1ELLP 2GLJA 2J9AA 4ZX8A 1TKFA 3B7IA 3IWWA 5LRKA 3TC8A 3BI0A 3PRTA 3HLPA 2PVWA 3DGVA 4PPZA 2PJ0A 5D29A 1PYTB 4JZ0A 5LRGA 2NSMA 4O23A 4FWUA 1CPSA 2C6CA 1VIXA 2PIZA 2BOAA 2GREA 3WT4A 4A37A 3B3SA 4OIWA 3VARA 1VGYA 1LFWA 1JQGA 4CPAA 3B3TA 3QNVA 3FH4A 3GUXA 1HDUA 3D4UA 2CTCA 3H8EA 3T8WA 4H2KA 4MHPA 3NH5A 1LOKA 4IAVA 4IK2A 3WC5A 5LYLA 1XBUA 3PFOA 4P44A 2ZELA 4NGMA 3SJXA 2V77A 2OR4A 3PBBA 3FX6A 2HB6A 4OC1A 3SI1A 1BPNA 3B3CA 3JRUA 3KGQA 4FAIA 1KWMA 2AFUA 1BPMA 4WWVA 4IHMA 2BCOA 4PXBA 3GLJA 6CPAA 2AFZA 3D68A 3KR5A 3TX8A 1H8LA 3PB4X 2PIYA 1F2OA 2GU2A 4WJBA 2Q4ZA 1FNOA 2PJBA 1CPXA 3B3WA 5F09A 1CBXA 3RZAA 2WZNA 2QYVA 4P45A 2CTBA 3CT9A 4TNUA 2PJ2A 3BHXA 1TKHA 4NGPA 3KQXA 5CBMA 4YU9A 4F9VA 3DLJA 2PVVA 4OKOA 2QVPA 1Y7EA 1YSJA 1VHOA 3V38A 2AFSA 3VH9A 1ZG9A 3D7FA 4ZX9A 2JEWA 3GB0A 1XMBA 2ZOGA 5IB9A 4KSIA 4F9UA 5LYDA 2PJAA 4FBEA 2XEGA 2EWBA 4LQGA 4EFDA 3IIBA 2ZEGA 1CP7A 3FVLA 4TWEA 3KL9A 2V8DA 5ELYA 1ZLHA 2ANPA 3CDXA 2AFXA 4OC0A 3D66A 3PB9X 4MRIA 3SJFA 4Z65A 1R3NA 4ZY1A 3FECA 2RB7A 3WC6A 1ZLIA 2XEFA 1TF8A 2JBJA 4NJRA 3D7HA 2IJZA 1Y0RA 1ARMA 3B3VA 2PJ6A 1EE3P 4UEFA 5K8NA 1LAMA 2HC9A 4DJLA 5K8MA 1YMEA 1QMUA 1Z2LA 1YW4A 3MN8A 3B2YA 1IGBA 2EK8A 3FEDA 3PFEA 3S9NA 3I1UA 4UIBA 2ZEOA 4F8ZA 3LWUA 3CPAA 4PQAA 4MHNA 1IY7A 4EWTA 8CPAA 3IFEA 4NGRA 1GYTA 2PJ3A 4MMOA 2ZEMA 4OP4A 4P4IA 3IEHA 2AFMA 2PJ5A 3VATA 4FUUA 2PJ8A 3FEEA 3KI9A 2F7VA 3NA6A 5JGFA 1CX8A 4A39A 2I3CA 2WYRA 1YLOA 2ZEDA 4AXVA 2JBKA 2IMOA 3L2NA 4OMEA 4EMEA 1TXRA 4P4EA 4PXEA 3CPXA 1ARLA 2CIJA 3B35A 2F8HA 4MCSA 4R7MA 4UEEA 4X2TA 2ZEFA 3BXMA 5HVFA 3PEIA 3SJGA 1Q7LA 2PE3A 3PBEA 3K9TA 3KHZA 1LCPA 4G1PA 3RBUA 2XEJA 3NH8A 4W9YA 1R43A 4OC3A 2V8HA 4P6YA 2AFWA 3D7GA 1CP6A 1Z5RA 4DYOA 1M4LA 4R76A 5K8PA 1RTQA 1DE4C 1TKJA 2FVGA 2CF4A 4GM5A 2IQ6A 3MRUA 2XEIA 1QQ9A 2DEAA 3KQZA 2PCUA 1BLLE 3HUVA 3FMCA 1ELMP 5LYFA 4ZI6A 5JM6A 5THWA 1Y0YA 4OC4A 3IO1A 4R6TA 3WC7A 3H8GA 3BI1A 2PJCA 5D8NA 4DUKA 4P4JA 4NGSA 4ONWA 2ZEEA 3ISZA 3NH4A 4UEZA 2AFOA 2O4HA 4MHYA 1FT7A 1UWYA 2EK9A 1Z8LA 4JYWA 1XJOA 4NJQA 2PJ9A 4X3RA 3FF3A 5HVGA 2PJ7A 5K8OA 1XFOA 3PB7X 1HDQA 2V8GA 1CG2A 2ZEPA 1LANA 4NGNA 3SJEA 3D67A 3PB6X 4K3NA 4R8FA 5LRJA 3IC1A 5HXDA 1DTDA 2O53A 4PXCA 3N5FA 4NGQA 1NSAA 1VHEA 2BO9A 2ABZA 4OC2A 1AMPA 2QJ8A 3WABA 4ZY0A 2V8VA 2C6PA 1XRYA 4P4FA 4RUHA 4BD9A 2Q51A 3H8FA 4MXUA 2PJ1A 2PRQA 4NGTA 2OOTA 4MHZA 4P4DA 4MCPA 4MCQA 4P10A 3KZWA 4ZY2A 2C6GA 4B6ZA 2PJ4A 4X8IA 3S9MA 3K2KA 3D7DA 3SI2A 7CPAA 1BAVA 4UF4A 4OIDA 1F57A 2GLFA 4MCRA 3S9LA 2ZENA 3RAMA 3V7ZA 1PCAA 5CPAA 3LMSA 5HVHA 2ZEHA 1AYEA 5J1QA 4UIAA 5JH9A 3PB8X 2ZOFA 4P4BA 1LAPA 2RFHA 2Q43A 4OC5A
chains in the Genus database with same CATH superfamily
1HNZL 3KASA 1SE8A 3RNUA 3C2PA 4Q7AA 1QSRA 5F46A 4A94A 1IZ6A 1PH9A 2NYQA 5JPMC 2RSNA 4FO2A 3GKRA 1M44A 1YEZA 2OXPA 3A8JE 2UXDQ 1S40A 1KDCA 3MVVA 1G6PA 3DMUA 2NVQH 5M5XB 2VL1A 2EYOA 2EY1A 1VQ4A 1S5ED 4C3JB 1F2PA 1ZG7A 4IUQA 1EL0A 2WSAA 3F2CA 2FE7A 4RI1A 2VBQA 2BEIA 2PQ8A 3ISXA 2NZ1D 3CQZH 5C0XJ 3STBC 5LL6X 4LF6L 1IYJB 4DR6Q 1X54A 5C4JH 5IE8A 3HS0C 1JOOA 3JAMc 4K5XA 4XDXA 3B7IA 1KHIA 3D4RA 3WWVA 2WPWA 2PMZB 4UWJA 1EY5A 3J81j 1PU9A 3R9GA 1NR2A 3TP6A 1RXTA 1YNXA 2A69C 1CI3M 4K8IA 4BBRG 1GO3E 2PVWA 3DNSA 1E1TA 1KRTA 4B13A 3FVQA 4B3SL 1S60A 3K57A 4QGUA 3HP3A 1HNWQ 1B6BA 1C7YA 3K0XA 4HCEA 3CZXA 4RG1A 1CPSA 1SLJA 5LHY1 3TZDA 1E24A 1S3OA 4ZRZA 4C3IH 1I6HH 1VIXA 2AE6A 2Z0SA 2BOAA 4M85A 3TFYA 1L1OC 3OWEB 2KVMA 1KUXA 4OIWA 3TRZA 1SDFA 3NE8A 1DGSA 1WTPA 3E0EA 2F03A 1LFWA 1VQBA 4CPAA 3U50C 3B3TA 1CK1A 3FKIB 3FH4A 1UEAB 2N78A 4C7IA 1QSMA 3KBGA 3QB8A 4BY7B 1HHVA 2L12A 3I4MB 4BBSH 4QVTA 2F4IA 4IUSA 3SHLA 4MHPA 1IBKQ 1O7IA 5HY6A 1N34Q 4IAVA 2TSSA 2K33A 1VQHA 3IWGA 4C2YA 2IPKD 1NMGA 5JPHA 2Z3PA 2CW0C 1S5DD 1KRSA 4PMWA 3I73A 1AZPA 4C2XA 2V77A 3CCVA 1F9PA 1XMQL 4Y7NH 5BWAB 2OR4A 2OT2A 3CCLA 1JMCA 4OC1A 1F2MA 3B3CA 4KOWA 4FAIA 4TVAB 1VMPA 2BH2A 4WJWA 2JK8A 3RR5A 4AYBG 1V9PA 4KUBA 1LT5D 2NB0A 3BU2A 2BCOA 4I7AA 5JVG3 1STGA 6CPAA 2QCPX 2AFZA 3V05A 2EE1A 2R93B 3VWEA 4MFKA 4IZ8A 1KAWA 4A3EB 4QY7A 1H9RA 4DUYL 1B8AA 4LJZC 1I94Q 2L9HA 2IL4A 2MO0A 4GOPC 2B4DA 5C44B 1MD2D 2EYJA 4IFDH 3NBHB 4EQPA 4EX5A 3R3OA 4POGA 2CFMA 1JOKA 4NXYA 2A6HD 3RD4A 1YVOA 2F3WA 2ID0A 3I4NG 2CQOA 1VHSA 1AZQA 3RZAA 4LK1C 2QYVA 4P45A 3EVQA 3J81i 1XPRA 3H5ZA 4AB7A 3GYAA 3IFTA 4RGMA 2BH8A 3I91A 2ZJRA 3BHXA 2OQKA 2VL6A 3EA6A 1E3PA 1R9TB 4YU9A 4KJOA 4F9VA 1EU3A 3ZJYC 1XNRQ 2PVVA 4OKOA 5M3MB 4U673 2QVPA 5FJ8G 1Y1WB 3ND8A 3URYA 1X56A 4RCOA 3DM3A 4POFA 2MNAA 4P72A 3L2PA 2A4NA 3V38A 2AFSA 1CFMA 3F2DA 3IWEA 1ZG9A 3GDEA 1TWFH 3MA2B 4OO1G 1WJJA 2F0UA 2ZOGA 4AYBE 3T53B 5LYDA 1RTOA 3R2TA 5D3IB 3S14B 2FJ2A 4A3CG 4BXXH 2XEGA 2H5XA 2GFQA 4QIWB 1QZHA 2TMPA 1ICFB 2WB1B 2EJFC 4DV1L 1DOKA 3VYRA 1PRTB 4LQGA 4RAUC 4B08A 1EYCA 1CP7A 1B3AA 2UUAL 5IT9L 1ZLHA 4A3FG 1X12A 1RODA 4MFPA 3H3VI 1GUTA 1Q7YC 3NE5B 1T5EA 2PCFB 1BBXC 4UP9A 1X9NA 2REEA 3PB9X 4MRIA 1K0RA 3EO4A 1D5ZC 2R1IA 3IKJA 4MJ8A 4Z65A 4A3JB 3A5UA 3HOWG 2B2UC 4ZY1A 3UDXA 2RB7A 4MY0A 1I4GA 1OO9B 2F0SA 2XWJB 1Q12A 1IL8A 2Y0SG 3EFXD 1NMTA 3F0AA 4HNWB 3SVMA 3BVMA 2LMCB 4OWXB 1GHJA 3KFUA 4IUNA 3GTJB 2UUCQ 4M6GA 1Y0RA 1ARMA 3AU7A 1YHAA 2WIIB 4XNHB 1LTAD 1S4ZA 4FXKC 4NW2A 4YWKA 2WAQG 1WWZA 1C0AA 1EQVA 3LWEA 3HKSA 4A3BG 4BBRH 5K36G 4UFXA 1IBML 1QMUA 4A3GG 3M3YB 2UXCL 1GOZA 3AFPA 2CH4A 3RNZA 4A95A 5BR8Q 4DR1L 1BOBA 1SJED 3CHBD 2EK8A 4C7HA 1W6JA 4PQAA 1QVCA 1ET6A 2OZGA 1X3FA 1IY7A 3D2PA 3NP8A 2ZPAA 2B39A 1FJGQ 1YNND 3M4OB 4MMOA 1S5BD 4KLWA 4JI1L 1I4XA 1VQ7A 1K4JA 4CGNA 5FLXE 4X62L 1WTQA 4KN7C 1HZBA 3VYTA 3CXPA 2EYHA 2AFMA 2EUIA 1NE3A 3J7AF 2K4KA 1YLEA 2EY5A 3VATA 1VQDA 5IGCA 2DGYA 3GV3A 1SNMA 4ZLTF 3B6YA 2WAQE 1TS2A 2R3ZA 3HOUB 1BNZA 3BJ7A 3CW2C 2D0PA 4KN4C 1UFHA 3ZYYX 1TS4A 5C5MA 2WYRA 1S5FD 4FXDA 1HPCA 2Z4HA 1GXDC 4EMEA 2I5HA 5I2XA 1TXRA 1HNWL 3D0FA 2F0MA 2CIJA 1UWVA 4R4IA 2F8HA 3DR8A 1DYQA 3I9SA 1IXRA 4RS2A 4DV4Q 1WTRA 1Q86C 1NAPA 1Y8NB 4K6DA 4KVME 4XT1B 2Z8LA 2PRBA 1EY6A 4YHHQ 2B2YC 3F8TA 1Q7LA 3PBEA 3KDFA 3WDNA 3KHZA 2NTSA 2VQEQ 1D5MC 4MTKA 1PTOC 1V1QA 3GO5A 4JI5Q 3HRZC 1LCPA 4G1PA 1SYDA 4KVOE 4DR3Q 4GOPA 3ER0A 4JVZA 4BY1G 3NH8A 2UU9Q 3H3VC 2A6ED 3ULJA 3P1HA 3PUVA 3FRMA 4BINA 3I4NH 4W9YA 1Y8OB 3TP8A 1TT2A 4XPDC 1QNKA 2A68D 4OC3A 1IBKL 2ODFA 1N34L 4P6YA 1JWMD 3D7GA 1PDQA 2I07B 1CP6A 1Z5RA 4DR4Q 1M4LA 2GVAA 4JC0A 2JA7G 1NSLA 1A15A 4K14A 4CJ1B 5KNCA 1V0CA 5FO8B 1TKJA 1B70B 4CDEC 5FJ8H 2JA6G 2QF7A 5GAGC 1K3RA 2L55A 1FNUA 2KEDA 4XTCS 4FD4A 3MRUA 1WI5A 4ZKBB 4UY8C 4OO1H 3M4PA 4JI0Q 2F0DA 2XEIA 5IIFA 1A3UA 2DEAA 5KTAA 4A3CH 1CQVA 3MC0B 2YU9B 2HDMA 3J80L 1ZKOA 1BLLE 1QUQB 1LYLA 1OZPA 2F0GA 3H6MA 1WTWA 2R7HA 5CBEE 4R4CA 5AG7A 4AQYL 2FIWA 4CKEA 2JEAI 5LMNQ 2VUMB 5JM6A 1PA6A 4A3FH 2SNMA 2OZHA 4OADA 2XTIA 3PUWA 2B4BA 1J5EQ 1Q8KA 4KY5A 3CPWA 4I49A 2FT0A 1JWQA 3RLFA 1Y9KA 4R6TA 1F2ZA 3HOWH 3H8GA 3OTOQ 3NBIA 2J7ZA 1HR0Q 4PSXA 2VQFL 1G8ZD 3FRPB 2E2JH 2ZW6A 3K7UC 1O7ZA 2VZAA 3QOLA 2L4NA 1FYCA 4UEZA 2ZJPA 3K7AB 1VQJA 4MHYA 3RZDB 1XNRL 3NHHA 4ZCKA 1FT7A 4RGOS 4G57A 4LW1A 3GTPH 1U6MA 4JYWA 4A3BH 2EDGA 1XJOA 4G4KA 3CQZB 4JZ0A 5K36H 4B9WA 2E5LQ 5HVGA 2HUGA 4BWGB 3GY9A 3RZOH 5CC4A 5BN4A 4A3GH 2GANA 2IL8A 1CKOA 3EBEA 4MBUA 1I4PA 4X64Q 3H91A 4L89A 3H15A 1JC7A 2XWBB 3PB6X 1I50H 4K3NA 1WTVA 3I90A 4LUOA 5CV7A 4X66L 3M9BA 1KAAA 5KGUA 5HXDA 4DU9A 3JC66 1SYBA 1DTDA 1S7NA 2F0HA 4UA3A 3PO3B 4GNXA 2F0PA 1SFOH 5C4XG 4PXCA 3N5FA 2O2LD 3PP9A 2DF5A 1ZYRC 3WR7A 2VEZA 4WRDA 3MWYW 3HKZB 1NSAA 5CORA 1I6HB 2BO9A 3TS0A 2R92G 4F0YA 4OC2A 4RMFA 2BA0A 3EC4A 2A73B 2QJ8A 1YX0A 2KBNA 4LF5L 2K28A 2C6PA 2OH1A 2V8VA 4HNXB 2P5ZX 4P4FA 4JK1C 5A35A 5KTCA 2UUCL 2Z6KA 1TWGH 3HOZG 1DJRD 4MXUA 3TOAA 1WK4A 1WOCA 3S6GA 4A31A 1U5KA 5IB0A 3CCSA 1KUVA 3BVGA 1KQSA 1VQ9A 4DXFA 3G4SA 4GLXA 2ZT9C 3NXWA 4R8NA 3S15H 4B6ZA 3R95A 2M00A 2NWGA 4X8IA 1N36L 1S7KA 1PH3A 2MP1A 2G5DA 4XYOA 2NVXB 3FHWA 3SI2A 4IPDA 4NSQA 4B3SQ 1KZFA 2A5HA 5BR8L 5GROA 4KOUA 3V96A 1BAVA 4UF4A 3A55A 4OIDA 2RC4A 2I79A 1TWHH 3A8IE 2ZENA 4YIJA 4CGPA 3J7YW 1VQMA 1RKNA 2YV5A 1PCAA 2RHQB 1G2TA 3W6XA 5CPAA 1TS5A 1SE2A 2B2YA 1Y7RA 2ZEHA 1CA5A 4CYNA 4A93B 1B1ZA 2ZOFA 5M3FB 1CJWA 4BY1H 1HQRD 1AFPA 4BA2I 3A74A 1V1PA 2Q43A 1T9HA 4XQNA 3J7ZC 4RUHA 4MI4A 5DS0A 5LYIA 4JCVE 4DK6C 3CRLC 3SI0A 1YW6A 2QEXA 4MIUA 3KHXA 4H7BA 3OOCA 2XIWA 2NYZD 2JA7H 1XIXA 1YREA 1L0CA 2Z0ZA 2BUEA 3NFZA 1V8QA 2M9VA 1BCPC 1MIUA 2JA6H 4JLYA 1OBRA 4LQ6A 2P6FA 3AFQA 1K83H 3GTMH 5F48A 1VQIA 1GUGA 2E76C 4DAYA 5IP9G 2EQSA 3J81E 1TR5A 2K5QA 1M4DA 3S2HH 1DOMA 2J0TD 4NFRA 1G91A 1TY2A 1AUGA 1ELLP 2GLJA 1I3QB 2KEEA 4ZQ3A 4XPLA 4ZX8A 1VF7A 3HOVG 3TO6A 2K50A 5LRKA 3TC8A 2AHOB 3BI0A 1TWFB 1S7FA 3PRTA 4R3LA 4Y49C 1BF4A 3KBXA 4YHHL 4PPZA 1FY7A 2PJ0A 4DUYQ 4CAFA 2SDFA 1EU4A 4JI5L 3BDCA 4YCVA 3I2ZA 2D4OA 4O23A 3TTHA 3NWTA 4FWUA 2LSSA 1QE6A 1SE4A 3T1YQ 1GJXA 1VMCA 1EIFA 4HSPA 2ZW4A 3A0JA 1A8VA 1CKNB 1G2SA 2QEJC 3B3SA 2BA1A 1X55A 1Z8WA 2XN9C 1SYGA 3T1HL 5AFWA 4DR4L 3VARA 2VB2X 2OF1A 2F52A 3R9EA 1WVLA 5JEAJ 1RIPA 4A3DB 1TKWB 3QNVA 5DEHA 1ML0D 2R7DA 5J22A 3D3SA 3BDLA 1VQAA 1XPUA 1YVCA 2CTCA 1CZWA 1KUYA 1HA6A 2HHHL 3VR2A 1Z9FA 4PMBA 4AIMA 3PO2B 2VZYA 4P74A 3NH5A 1LT6D 2K5VA 4IQZA 4JI0L 5FK9C 2O5JC 3NELA 4IK2A 4KKTA 4Y49B 5LYLA 3PFOA 4H44C 3BZCA 4NGMA 1I4QA 4KOSA 5CV5A 4K2KA 4KORA 1SMYC 2I0QA 3DXJC 4PZ6A 1VQKA 2Q7SA 3TP7A 3NSWA 4LUVA 4U68A 1X3QA 2HB6A 3PBBA 3SI1A 1BPNA 3KGQA 3TQYA 2UUAQ 2F0LA 2K14A 5C4XH 1J5EL 1BPMA 2KCTA 5DAUA 3VR4A 4IHMA 4PXBA 1IYUA 4DPGA 4HKFA 3GLJA 5LMNW 2R92H 3A54A 2A74C 2Q0YA 4LF9L 2QA4A 4KSAA 5EPKA 2KQ3A 4JI2L 1PH1A 1Z47A 3W3AA 3N7ZA 4L5RC 2JA8G 1FNVA 2PIYA 1RF2D 3S24A 1F2OA 2QMLA 1HR0W 2YNEA 1CHPD 3HOZH 1Z4EA 1HQMC 1SNDA 4WJBA 2HDLA 3GV6A 3W6SA 2Q4ZA 4GN4B 1FNOA 4A32A 2EJMA 3L3OC 4MY3A 4L8JA 3NE7A 1W6KA 3DWPA 1J4JA 2WKCA 5F09A 2PZUA 4X65L 1IYLA 2F3VA 1O80A 2E5LL 4QQBX 1XX8A 3MXNA 3IAYA 3H3VH 1LLRD 4H02A 4TNUA 4OX9L 3KF6A 4R4OA 3VR3A 4JYAQ 3U9SA 2GN5A 1TKHA 1FNWA 2UXCQ 1AN8A 3KQXA 3HFZB 2B58A 1LM0A 1IICA 1VQ8A 2B4DB 4LF8Q 2R98A 4MHDA 1GD7A 1Y9WA 3ERQA 1N32L 4JV5Q 4F8MA 1YSJA 3R2IA 2L5TA 4FF2A 1XTCD 2KCWA 2VS1A 3PF5A 1WCMG 4HJAA 3S1RH 3S1NH 4KUAA 2OWOA 4DR2Q 2P6EA 5C4ZA 5IB9A 2N3SA 1SYEA 2LY7A 3CC4A 4JI1Q 2QIRA 1NTGA 2ZXOA 1UE7A 2PJAA 4FBEA 4X62Q 4FP5D 4LWCA 3RO0A 3CCMA 1YJ9A 2EWBA 4LF4L 5E96A 5FOBB 1Q3LA 2X6GA 3FVLA 1WTOA 4NF1A 4TWEA 1O78A 4A3IG 2EYPA 2V8DA 3P2FA 5ELYA 1GHKA 2Z3MA 4IUUA 2J8NA 4HIMA 2R7ZB 2NN6G 1L0WA 4OC0A 4IFDJ 2HQYA 3S9WA 3SJFA 2F1MA 4I65A 2QDBA 1XPOA 4ONUA 1F2LA 2K7VA 3WC6A 3SHPA 5IP9H 1IU8A 3HZXA 1LTSD 4FF3A 2HT1A 3GTQB 1CM0A 2KJXA 2XEFA 1TF8A 1QWYA 4NJRA 4UDUC 2IJZA 1M8AA 4X3TA 5EKLA 1IW7C 4JBKA 1RO5A 3B3VA 3EIVA 1B9NA 3HOVH 2L1BA 4F88A 4E8OA 3I72A 3ND9A 1EYDA 1FGUA 4GKKQ 2FL4A 1D6EC 3A56A 1MBYA 3PUZA 2FS5A 5K8NA 4RKLA 5EKKA 2VI7A 2HC9A 2ZTDA 2L11A 3KJPA 1N33L 4YGOA 4M6IA 1JWUD 3HEJA 5IX3A 5K8MA 4NB3A 2FXFA 2B63G 4C2MB 1PRTF 1Z2LA 4GXHA 4JD6A 4RWSC 2UXBQ 1YW4A 2JA5B 1M1KC 3DEPA 1NR4A 5IODA 3S6HA 4DF7A 3AYHB 2F0IA 3J81c 2ZEOA 5A2QL 4DA2A 4F7XA 2H5MA 8CPAA 3HOXB 4NXMQ 4NGRA 1KDBA 2H1EA 3SXNA 1GYTA 3S17H 2PJ3A 3HOWB 4X5KA 5ISRA 3IEHA 4LMQD 3K58A 3C46A 4PSWA 3AMUA 3GTKB 5G20A 3R8BA 4J15A 3Q24A 2FINB 1PVOA 3F2UA 1RCVD 3UY5A 5EBVA 4FUUA 5ELOA 3CRKC 3SEBA 2FFKB 1MJAA 5GADC 2EBJA 1M90C 3KI9A 3TBIB 1L1OB 1QJOA 4LUAA 3GTLH 3GTPB 3NA6A 1KD1C 4HJ8A 3J7A5 1XEBA 2Z9HA 1PFNA 3ZJ0A 4UHVA 2I00A 2I3CA 4CGOA 1YLOA 1IKLA 1CQFA 1SR3A 2JDDA 4TQUS 1SQHA 2DPTA 2WKDA 2G0BA 3Q0AA 2IMOA 4A3GB 4DV5Q 4AQYQ 3F2BA 4YRHA 4OMEA 2B2WA 1BO0A 2K1BA 5H1SE 3PGPA 1KXLA 3EJIA 1LTID 3T1YL 1I50B 3B35A 5IGDA 2A1AA 4NXNQ 2BE5D 1MKHA 2WFWA 1NNXA 3ITPA 3H0GB 2VQFQ 3U4VA 5E7NA 4CHTB 2JA8H 5BN3A 5KEEA 5HVFA 3PEIA 1IHZA 5C3XA 2AMCB 3U58A 1ET9A 3LNNA 4PZ8A 5EPJA 4FYDA 1EY8A 3DDDA 2QW7A 2RDHA 1SYFA 3E9IA 4AG7A 1YNJD 4KJNA 4PK2A 4HCSA 3T16A 3K59A 3E0KA 2Z1CA 2FXQA 1R43A 4Y52H 3TOBA 3KLWA 3X3NA 1PH8A 1PTOD 1LRZA 3GTGB 2V8HA 2Z3KA 3S6KA 2AFWA 4B5PA 4IPGA 4GS3A 4MZ9A 4OAEA 1QSOA 4M3SA 2HIXA 1RTQA 3MHBA 2IY5B 2FVGA 5EC4A 4GOPB 2CF4A 3S1QB 2R8VA 3TT2A 4GM5A 1YGHA 2IQ6A 4X66Q 1IBLQ 1WCMH 1H9SA 3JAML 1JOQA 2WPXA 2PQEA 1A6XA 1PZJD 5IYBG 3KLSA 1YQEA 1HCZA 4KKSA 1EIYB 1S72A 2NVTB 2K32A 2AUKA 1Q2YA 5KRUA 5IYDG 1TWHB 4UP8A 3KQZA 4HR7B 3D3RA 4JPBW 1SBBB 2PCUA 5IV0A 4A76A 3UDGA 3C3LA 1TIQA 3FKIG 3K5LA 5AG5A 5CNPA 1IB1E 3M85A 4HIOA 2PNRC 4BY7G 1S5CD 1Y8PB 4A3IH 4LF5Q 4DK0A 1ELMP 1Q82C 3S1MH 4FD6A 5LYFA 1UUPA 2PI2A 2EVBA 3DM1A 2NN6H 4BY1B 4OC4A 3EY5A 5M5YB 1TWCB 1WD1A 5EAYA 2X7BA 3E5SA 3WC7A 4N8X1 4R4QA 3BI1A 5CGKA 1A63A 5D8NA 4DUKA 1V1OA 2PMZE 4K0KL 2JEBI 5T1IA 4NGSA 4ONWA 1N36Q 2ZEEA 2DPSA 3I3GA 4JYAL 3ISZA 5CBAE 1YJWA 4DAPA 2AFOA 2JA6B 2K52A 1PFBA 3NENA 5FKAC 4LF8L 2PI2E 1Y69U 1UWYA 2HCCA 2FIAA 2EK9A 3JTKA 3R93A 1AEXA 4JV5L 5IWAL 1PH4A 1TWAB 4HJ9A 2D4PA 3GP7A 4IF5A 4X3RA 1STNA 2PJ9A 2I5MX 2E2HB 4GNXC 1YK3A 4XQJA 4HNYB 1O7LA 3S2HB 4KI0A 3P75A 4NP5A 3PB7X 4KSFA 4DR2L 4K5WA 4FD5A 2B63H 5C3EG 1K28A 4A3EG 2V8GA 1A3TA 1CG2A 2ZEPA 3A8KE 1M1DA 1LANA 2MGSA 3VR5A 4DFAA 4JI7Q 3I55A 3JUWA 3RN5A 1M4IA 3IC1A 2XRQD 1F9QA 4XQQA 3Q6SA 4CKBA 2Z6KC 2E75C 3L7ZC 4LFCL 2AUJD 1ILPA 2MPMA 3PIP3 1SE3A 3GIUA 3CU7A 5EQ0A 4RH6A 1K73C 3GTOH 5CYUA 1A2UA 4II9A 2ZM6L 3CXQA 3QJYA 5G1ZA 5IGGA 3KKWA 2Q2HA 1Q1EA 4C68A 3QWNA 2ATRA 4J1MA 4DR5L 1ZYRD 3OSOA 3BVZA 2DXQA 3M7NA 1Y1WG 2ZXRA 1HFNA 4BBHA 2LS01 1JORA 1QSTA 4DAMA 2B2VA 1EQQA 2PJ1A 5I0CA 4YY3Q 2OOTA 2NVYH 3NBHA 2Z3OA 5I6WA 4MHZA 2JQOA 4QUCA 4ALPA 3PUXA 3J80i 4MCQA 1WD0A 4GKKL 1XYIA 1HXYD 3RN2A 2Z10A 4N9TA 2DUDA 4Q36A 2CNTA 3VWDA 1HNXQ 3CXCA 2JN4A 4DNIA 2ZTCA 2VXKA 2WB1G 4R87A 1SRUA 5G3LD 2A6HC 2CHBD 5EBCA 2UXBL 4ODGA 4HJ7A 1XMOQ 2C35B 4C3HB 2N49A 4OIJA 1FVIA 1U4MA 2FHTA 3PCOB 1STYA 3TS2A 2B3GA 2KHIA 2PNHA 2B5GB 1JR0D 5K5PA 1NSNS 1EIHA 5M5XH 2QECA 3GD7A 5C4XB 3V7ZA 4A3JG 2M2LA 2OZUA 4YFJA 4NXML 4EGVA 1MSGA 2AWOA 3T1HQ 2E2IB 1IOIA 4XXEA 4UIAA 2RF4A 5JH9A 2IJ0A 3VDYA 4A33A 4KY6A 2Q04A 1PMRA 3KF8B 3U9OA 5E3FA 2ZW5A 3NPPA 1JJCB 4Q38A 1RD9D 2PZWA 2HHHQ 4LUZA 3I4LA 1I21A 4DV7Q 1D1IA 4CRYB 2DN8A 2K5DA 3NUCA 5T1GA 1NBWA 4KKUA 3OYYA 4C1NK 5I9PA 2NBFA 4O42A 2JSOA 2ALYB 1ZG8A 1SROA 1PTOB 1EFWA 1Q8IA 5KIXA 2C1CA 2MO1A 2K05A 3HOYB 3FJUA 4K6LA 5M9OA 1FR3A 4QIWE 4DV5L 3IJ3A 4AVAA 2WB1E 3R96A 4G7HC 3D4WA 4XPDB 2JDCA 4OLLA 2G3AA 5IYBH 1NMFA 2NZOA 2YGWA 2POKA 4NXNL 3G6EA 5IYDH 4A3KG 1TKFA 2EJGC 3IWWA 4LF9Q 4HTHA 1QVFA 5AJ3Q 3FKIH 4JI2Q 3S1RB 3HLPA 3DSBA 3K5OA 3E6ZX 4BY7H 2EXDA 4ZK9B 4CAVA 3DGVA 3H94A 5IGFA 2AWNA 4LAAA 5CV8A 5TSSA 4LNQA 2NVQB 2NSMA 1EWCA 5FO7B 2AJ6A 5ELDA 2K5NA 5G3LF 1DONA 1RTNA 4HIDA 1DZ1A 4ZUIA 4RA8A 4Z9CB 2EY2A 4CDCC 1I4RA 1Z6HA 4JG2A 1QZGA 2PIZA 4X65Q 2GREA 3VYUA 3WT4A 1VQCA 1EY9A 5H86A 2K01A 4J3GA 5C4JB 4KOYA 2RHSB 4R3KA 4OX9Q 2PQAB 1LTBD 5ELBA 1NJIC 2NN6I 2DY7A 1RJTA 4JI6Q 4R4TA 1JQGA 1XXGA 2RSOA 4L6TB 4B9XA 4DK1A 3Q22A 1VQ5A 1HDUA 2SEBD 1YNNC 1N32Q 1GHEA 4OL7A 3L9AX 1IBLL 5GAHC 1C8CA 4HMIA 2XVSA 1D7QA 4H2KA 1QILA 4MTNA 1LTTD 3D31A 5C3EH 4A3EH 3CKIB 4DNTB 1E7ZA 1WTXA 3WC5A 5C3WA 3C26A 4DR7L 1HTLD 4C3IB 4P44A 1K8AC 4U5YA 2B3UA 3SJXA 2PC1A 2SNSA 3QO2A 5EBDA 4LF4Q 1QNUA 4CJ2C 3FX6A 1PUAA 4DV3L 3JRUA 2DJFC 4P2CB 1LTLA 4A4IA 3FB3A 1KWMA 2AFUA 2PSWA 4H89A 2I46A 4WWVA 1AP0A 1VS0A 4KV6A 4UCPA 2JYOA 4BBSB 5IOCA 1E2VA 4B3RQ 1L0XB 5D3DA 3LODA 1R9TH 3G48A 4FXGC 4F87A 3TX8A 1H8LA 1Q2DA 3UE0A 3PB4X 1BDOA 1XNQQ 3K5NA 1QSNA 4PMCA 1Y1WH 2WP8J 5FLXc 1E2ZA 3S17B 1F9RA 5CR3A 4CAXA 1TVXA 2H4OA 4K5VA 4FNFA 4R57A 1Q90A 4Y7NB 4UCMA 3BJUA 3P20A 4UP7A 4GLVB 2A8VA 3QR8A 1KNAA 1HRJA 3S14H 1ZO0A 1NCVA 3D2MA 5J1ZA 5I6YA 2ZXVA 2Q7BA 1N33Q 2CTBA 4RKBA 3CT9A 4CYPA 4JW0A 2GVBA 3GTLB 2WACA 1GUNA 4NGPA 1S5KA 3I3CA 5CBMA 2XSCA 2J4XA 4JI7L 3S16H 1JT8A 3UDFA 1Y7EA 2K5TA 1FL0A 1V43A 2PO4A 4N8FA 1VHOA 1VKCA 4NEXA 4F0XA 1EQTA 1HZAA 4A3JH 3VH9A 4ME5A 3D7FA 4CDFC 5IT9E 4G7OC 4EVYA 1PXUA 2BDOA 4FF1A 2JEWA 3MXNB 1XMBA 4CYOA 1CTMA 2RKSA 1STBA 5JEAG 3GTJH 2RFHA 5FLMG 4MFLA 3TO7A 1QUQA 2Z11A 1VDZA 1GVPA 4N9PA 1HUMA 3IIBA 2UUBQ 5COYA 3KYHC 4M6HA 2ZJQA 4OWWB 3KL9A 5DM63 3CMAA 2ANPA 2AFXA 2YYZA 1WTHA 4YY3L 2D9UA 5DLQE 4GN3B 3TN2A 3TE4A 1GUWA 4IUPA 2ATWA 1G51A 3O13A 1XF8A 3M3YH 4B11A 2PR8A 3STBD 1BBUA 1ONLA 3MEHA 4OELB 5FO9B 1HNXL 3FECA 3F8KA 2FSRA 2DNEA 4M8AA 1OTCA 1UAPA 1ZLIA 4H0LC 2A19A 1YJNA 1XMOL 2JBJA 3IGRA 3D7HA 3AEVA 1DOLA 5HGQA 3QAYA 2A69D 2G9HD 4DN4M 1PHJA 3PO3G 4A3KH 4UBRA 1B44D 1RL2A 3M4OH 2DNCA 3PF4A 1IOFA 4UWIA 2CWPA 4KD3A 3M7GA 3BZKA 4A3LG 1I12A 3CF5A 3HKZG 4UEFA 1K3BC 1BCPB 4DJLA 2KENA 1IW7D 2ICIA 1P16A 1YMEA 1I1DA 3FIXA 3TREA 4FVMA 1YHQA 4X3UA 1CT1D 1LUZA 1PH6A 1IGBA 3RLOA 3OHXC 3BYTB 2PW7A 4Q0FA 3CC2A 1B53A 1VCIA 4A3IB 5FVJA 3JVNA 1YZ6A 4DAVA 4RHRA 1ENCA 2RA4A 4DV7L 4L5QA 3IFEA 1AH9A 5E4WC 4QB9A 2F4VQ 2RQXA 4HPSA 3QG1A 2ZEMA 2KCNA 4P4IA 4OXPA 2KHSA 4BBRB 2O4XA 5EKIA 2PJ5A 4O0AA 4XT3B 5I4DA 3Q23A 4DV0Q 4R9WA 3OWCA 4CAWA 2B2WC 2MFIA 4P75A 3P7JA 3SR1A 3CXSA 4JOIA 2CW0D 3MXUA 1BXTA 4OHJA 2F5IA 2PJ8A 3FEEA 1BKBA 1S7LA 3DEOA 1GM5A 3KLSX 2F7VA 3MXGA 3NQTA 5JGFA 4A93G 5AJ3L 4A39A 3OPOA 1TS3A 3HKZE 2PW5A 3SK6A 1R4PB 2ZEDA 4AXVA 5M3FG 2KCMA 1PLFA 1X3PA 2B63B 1BUVT 3HGBA 3M4YA 5KYIA 3DHQA 3F1ZA 1YBYA 5ELFA 2CNSA 3OWFA 5C0XG 4P4EA 1MSHA 5JJKA 3CPXA 1P0HA 4PXEA 3V8IA 1XOVA 2CH4W 3NTHA 4MCSA 4NKLA 2P0WA 1CHQD 1B9MA 3CCQA 2WINB 3E9HA 5M5WH 2ZEFA 3BXMA 1VF5C 2KA7A 2O28A 4UFWA 3EQLC 5HGTA 4K0KQ 3IFDA 3SXHA 1XTDA 1MHWC 4IURA 1DM0B 4ZAIA 3OW2A 3SJGA 1EYAA 4PK3A 2PE3A 2RVLA 2IHFA 4LF7L 4JI6L 3MGDA 3TEHB 3DLLA 1JJ2A 4XPKA 3K9UA 3FDTA 3T4AC 1A2TA 1MJCA 2K5HA 1TY0A 5IWAQ 4KY7A 3G7LA 1EFID 5EJWA 1P4NA 1EY7A 2CKZB 4F6AA 1OXXK 2YU9H 4C1NI 5KNDA 4B3TQ 2JJQA 4AYBB 1LTGD 5DWMA 4HEDA 4OIKA 3OMGA 3T9YA 5L37A 1A3VA 3NWSA 1DE4C 3TMEA 3OMCA 3N52A 4OEMB 3J80E 5IGBA 4DNCA 3QOJA 1GUSA 2CWAA 2B8FA 4G7ZC 4APVA 4LFCQ 2NTTA 1HJPA 2GA4B 4B5PB 3K8AA 4CRZB 3IL8A 3I4NB 5F49A 4B3RL 5JEAH 1HH2P 4ULLA 5FLMH 3K7AH 2Y0MA 3K6OA 4OGQC 2F0JA 2ZM6Q 1ILQA 3RZDH 5JOBA 4A3DG 3HUVA 1M4VA 1XNQL 2JXMB 4DR5Q 1A2ZA 4U9YA 2L0CA 4A3MG 1EEID 4P73A 4GKJL 4KHPL 5JJLA 3MAQA 1H9SB 4ZI6A 4WFN3 5THWA 1UEBA 1YR0A 2HQEA 4IOCA 1C4QA 5KNBA 3FEWX 3PO2G 2JA9A 3PGZA 1Z8TA 2F0WA 3R9FA 5ELNA 5IT9c 2Z3NA 1CKNA 2LXKA 2PJCA 1JE5A 1O7YA 2RDGA 4QUSA 1X3EA 4UCNA 1E1OA 2R6GA 1TQOA 1R57A 4JI4Q 2HIVA 2F0EA 3QIAA 3NH4A 4IN3A 2O4HA 3PO3H 4LX9A 1EZ8A 1Z8LA 4L8AA 3QAHA 2OCEA 3M4QA 4A3LH 3G3SA 2B2TA 4A3FB 3FF3A 2VXWA 1D1KA 3S2DH 3T51B 1ZXTA 2EYLA 2PJ7A 5K8OA 4O1NA 1BO4A 1SSOA 2IT1A 3MFYA 3DR6A 4NGNA 4PV6A 3SJEA 2DJGC 3D67A 5KTDA 2EIFA 2E2JB 3P2HA 1HZ9A 1Y1VG 1CKMA 2K5WA 2Y0SB 4R8FA 2UUBL 2VNUD 2YNCA 3OIQA 2K75A 2F0TA 4I7ZC 2B2VC 3MEFA 5D14A 3LACA 1ASZA 1J8IA 4DK3C 2WAQB 3U4ZA 1Y14B 4XIGS 4GZYC 4NGQA 2NVXH 4RCNA 4A3BB 1EWHA 2ES2A 2GE3A 1ZEQX 3G71A 2ABZA 1OXTA 3HG9A 1AMPA 3VA7A 3BS1A 3RZOB 2KCCA 3JAMi 3WABA 3I4OA 4KS9A 3B8GA 1XRYA 1C9OA 2Q51A 2PYKA 3H8FA 4CAEA 2YTXA 3NTKA 2YTYA 5G22A 2DY8A 4CGYB 5JPNC 2F0VA 4ZYSA 4MCPA 4A93H 2RBMA 4P10A 4P4DA 2CCZA 5CV6A 3KZWA 3I8ZA 2C6GA 5M3FH 2PJ4A 2B8GA 1SFOB 3S9MA 5C3EB 4C3JG 2Q8RE 3UI2A 1EEFD 4OWTB 2HUZA 3D7DA 3D4DA 5C0XH 4EQOA 1DCZA 1PH2A 4UPAA 2IX0A 2LFNA 5D65A 5IP7G 2E2DC 1I6VC 4IPCA 1PRTC 2BOSA 2R7ZG 1F57A 4MCRA 1E22A 4KLVA 5ISVA 1FD7D 1Q1BA 2F0QA 2V4DA 4MFJA 1TWGB 3RAMA 4NDXA 2V1CC 2X69A 3PSIA 2F4VL 4AVBA 3K5MA 1JQYD 2VW9A 2VQYA 3LMSA 3N6RA 4RN7A 5HVHA 3KDFB 5J1QA 3H4QA 1BR9A 4ILWA 3PB8X 3S15B 4DV6Q 4JI8L 3KLRA 2HCIA 2VZZA 4OC5A 2OTJA 4DV0L 1I3QH 2ENBA 4IUVA 5GAEC 1YHBA 4Q5VA 2AQ2B 5GCNA 4RGTA 1SNCA 2ICEC 3UE1A 4XNHC 4P71A 4NPSA 5I4MA 4YWYA 3T56B 4PXDA 1EOTA 2F0KA 5C82A 3CP0A 1TF9A 4DR7Q 3ZZIA 1H9KA 1J9OA 2OEOA 2EOTA 4V0BA 1Q2CA 4B3MQ 1GKHA 2G9DA 5CV9A 4HN7A 1U9RA 4TSSA 4BMHA 1STHA 2JA5G 3D8GA 4GN5A 3KR4A 4A30A 2BDNA 2Z3LA 4LFBL 1OXSC 1GUOA 2D2CC 1HEEA 4DV3Q 4ZYQA 3I4MG 1Z7TA 1SMXA 4KLKA 4EQNA 1Z4RA 1U4RA 4AVCA 4LFAQ 2PPBC 4A38A 1MGSA 5EGTA 1QCBD 4IALA 3S16B 2Q4VA 4B14A 3A7AB 1K9MC 1JB7A 1EY0A 5AGEA 4IO9A 2J9AA 3HOXG 5G21A 4KTAA 4KOTA 1K8OA 4A3DH 3VYSA 4A3MH 4J6HA 1EIGA 1R4QB 2JA7B 5D29A 1PYTB 1STAA 2Q2TA 3G6JB 3J81L 3J80c 2O5IC 5LRGA 3PO2H 3T13A 2JLMA 1K83B 3GTMB 4BS9A 1H95A 1I5FA 2SOBA 3SK8A 3KJOA 2C6CA 3F5BA 1YITA 2D62A 2MHVA 1Q81C 3IU2A 4ZBGA 4B3TL 5F47A 4A37A 1MI2A 2R93G 2ARHA 3A7LA 4CDDC 1PTOF 2K04A 1MK4A 3BLNA 1VGYA 2EY6A 3CAMA 3DWQA 4L63B 3TCVA 3BYYB 1SYCA 4DUZQ 3G8WA 3GUXA 2IW3A 3AQQA 5C44G 3D4UA 1VQLA 2Z6BA 2ZW7A 5JVH3 2RCFA 3MXPA 3H8EA 3T8WA 5DWNA 1JICA 2ZTEA 3H0GG 1IKMA 1LOKA 4R9MA 3TSSA 3ULPA 2K03A 1L1OA 1C48A 4ID6A 3WOEA 4A3KB 2OQ0A 2L15A 5LMUQ 2UXDL 1XBUA 4QF4A 3BG3A 1SAPA 4QC6A 1CM9A 1K8MA 1VQPA 2ZELA 4IUTA 1Y1VH 1EYGA 5CMDA 1L2FA 5M3MG 3SK5A 1CSPA 4E2AA 2OU2A 2Y0SE 5C5LA 1Q46A 1VQOA 3LX0A 1E2WA 4ABNA 4GNXB 4HSVA 2Q2UA 4DR6L 1D2BA 1OXVA 4J8QA 4B12A 3D68A 3KR5A 3ICEA 5E4XA 3SE0A 4S3SA 5GQOA 2AQ3B 2N55A 4PV1C 4JI4L 4K2LA 3FNCA 2BE5C 2GU2A 3PMFA 4JJXA 1JCKB 1OXUA 1HUNA 3SDZA 2PJBA 4IPHA 1QOHA 1CPXA 2IHEA 3B3WA 3CCRA 1TIID 3OW7A 3FBUA 1PH5A 3CCUA 3FPPA 1SJHD 1CBXA 4DV2Q 2EYMA 1D8LA 4C3JH 1YNJC 2WZNA 3BJ8A 5NUCA 3EXNA 4JWPA 3ULLA 1UE5A 2BL1A 2EXZA 2JEVA 2PJ2A 4PZ7A 5IGEA 2R92B 2F0OA 5IP7H 1UE6A 4QL5A 1AE3A 3DLJA 2R7ZH 2IX1A 4AG9A 4FD7A 3PQIA 3EFAA 4CGLA 3HOZB 3K81C 5IYCG 4JI3Q 4ZX9A 3V2TA 1JJGA 1H9MA 3GB0A 3NEMA 1X10A 1N9WA 2E8GA 5C0XI 3GTQH 4KSIA 3CCEA 4WJ3M 2NMTA 3X3MA 4F9UA 1W2BA 4A75A 3UDIA 5M5WB 1KL9A 3BDOA 3ONAB 1NE9A 2HQLA 2N8NA 1PFMA 2NUCA 4YWMA 4TKOB 1V1PB 2IWHA 4IFDI 2G3TA 1X6OA 4EFDA 5DM73 5HMNA 5JAVA 1PYBA 2ZEGA 1D5XC 2C9OA 4HMJA 5J8CA 3I70A 2K6AA 3TZUA 1BCPD 5E1FA 1IYVA 4H6ZA 1RHPA 3CDXA 4KMUC 1ASYA 3D66A 1TU2B 2AKWB 1SNQA 3L0OA 3NQIA 5CV4A 3VA5A 2MJ8A 4C2MH 4O2DA 4CGMA 3MTSA 1HFGA 4XYQA 2JA5H 1B87A 5JJZA 1R3NA 2D5DA 3S1NB 2KECA 5C88A 1HZCA 3I4MH 1L0YB 4DAYB 4JBWA 3LGJA 3PIPA 3SXOA 1W3SA 1I94L 2Q8IB 1SN8A 3W5OA 4WJ4A 2PR1A 3MZ5A 2PJ6A 1EE3P 4NMZA 3HOXH 4GS4A 4KVXA 4A2ZA 3PV0A 4JXQA 3PZJA 3W1GA 4MHEA 5A2QE 3RYOA 1YI2A 3HOUG 5IY0A 2LKVA 4C56C 3FYNA 4E0AA 2F0NA 1MJ9A 1LAMA 3TP5A 1EUJA 2B2UA 1PV4A 1QG7A 3GTKH 1U4LA 1B4OA 1U4PA 1J6QA 4LF7Q 4JBMA 1DXMA 3MN8A 1ENAA 4L5SA 3B2YA 4DV6L 1N71A 3DWAA 1AW7A 3PFEA 3FEDA 1EY4A 3S9NA 3I1UA 2HV2A 4UIBA 5J8FA 3I7FA 5HURA 2QKIC 4F8ZA 3LWUA 1S3ZA 3CPAA 4JOIC 1PFSA 1UE1A 1PZKD 2D0OA 2R93H 4MHNA 2R61A 4EWTA 4PQXA 1QB5D 5A27A 4DNRB 3HOVB 5JQ4A 4HAEA 2EYFA 4B3ML 4K8JA 4YCUA 4OP4A 5LL6S 1LABA 1PZID 3KK7A 5C44H 1LO5D 5A28A 3A9LA 4C3HG 1X65A 1LACA 3CD6A 1HNZQ 1WYDA 3FP9A 2KUMA 4LFAL 3H0GH 3KOJA 3FPUB 4EVOA 2X6LA 1KABA 1IL2A 4B10A 4MNOA 4FDBA 1SMYD 2MUYA 2PZTA 3D6WA 1BCPF 3C1FA 4CBVA 3W2DA 1CX8A 3EROA 3AB9A 5KYLA 3S2DB 4ZUJA 5M3MH 5ELCA 2JBKA 4GKJQ 1AE2A 4KHPQ 3L2NA 1XE4A 5AG6A 4KD4A 1XMTA 2CVRA 4IJHA 1VQNA 1YIJA 4LF6Q 1ARLA 3GTGH 3PUYA 4R7MA 4JBJA 4UEEA 1CZGA 4PG3A 4CYQA 1K0SA 4X2TA 2B5GA 4ORFA 3A5ZB 1EQRA 4OONA 4CKCA 1BVSA 3ERSX 2RCNA 1X3GA 2A6EC 2B29A 3S1QH 2FCKA 2EO8A 3HOYG 3S9LA 2KHJA 3K9TA 3W91A 1B3QA 4QJFA 1JWSD 2A68C 1B2TA 2KOLA 4DUZL 2VUMG 3RBUA 2AQ1B 3KF8A 2XEJA 1BQQT 1KLGD 1KC8C 4MN3A 4TRDA 1HTPA 2RDFA 2NVTH 4B5OA 1YVKA 3JAME 1KTKA 2F3IA 1PYWD 1M4GA 5ELEA 3TDQA 4H6UA 4ME3A 1SNOA 1FJGL 5LMUL 1VQGA 1E0BA 1LT3D 3SGIA 2CQAA 3KF6B 2XRSD 3R1KA 4DYOA 4DGZA 4MFZA 4QMGA 2J8MA 1VQEA 3IRBA 1BOSA 4R76A 5K8PA 3OIPA 2JA8B 2Q44A 2Q4YA 4QB4A 3NTIA 5M5YH 1TWCH 2FMCA 3K0YA 3NK9A 1F77A 4K30A 3LD2A 1CSQA 2IX3A 1BBWA 5IYCH 1I4HA 1K8GA 1SXTA 4V190 2WUUA 4UFVA 5HH1A 4ZGYB 1MJEA 1Z8XA 4UAIA 3PIO3 1A62A 1ON0A 1QQ9A 2CY2A 1NUCA 5DNFA 1KNEA 3T90A 3FXTA 4X3KA 4X3SA 3EN2A 3D6CA 1EZ6A 4KOXA 1XMQQ 1T5XD 2B3VA 3KUPA 4L5TA 4YCWA 4PNYA 3CCJA 3FMCA 4E6IA 5AG4A 1TWAH 1UNSA 3RUZA 4NCZA 4RHSA 2EVNA 3VR6A 1A0IA 2EPBA 4M1UB 2E2HH 1Y0YA 1PYSB 3IO1A 1LTRD 2Z4IA 4AH6A 1KLUD 4DV4L 3S6FA 3QB3A 1G291 2B2TC 1WCMB 2REFA 2JE6I 5EMIA 4DV2L 1STEA 4C3IG 1N8RC 4P4JA 3DUZA 4KHZA 1LV9A 3CMEA 2P6GA 1JE4A 2PQAA 4OO1I 2VQEL 2YTVA 2PDOA 2XNAC 1G6ZA 1VQ6A 2EZVA 4DR3L 2J8RA 2E74C 2MQHA 2ZXPA 1Z9UA 3MFGA 2UU9L 2C5CA 2C27A 2YNCC 2Q2IA 3HOUH 1XWEA 1XJVA 5J39A 3S1MB 4NJQA 4BBSG 1QVGA 4JI3L 4IOAA 3WOFA 1B7YB 2JP1A 2YNDA 1XFOA 2F0FA 2R7FA 2XGTA 2VY3A 1HDQA 2I5LX 4U9ZA 5EPLA 5C6AA 2QILA 4YWLA 1ENFA 1ESRA 4JI8Q 4A3MB 4KZTA 5I2YA 4KK7A 5LRJA 4HIKA 3CC7A 5F2DA 3J7AV 1DD2A 2CNMA 1CUKA 3GQBA 4EQ5A 4RGNA 3D8PA 2O53A 1SNPA 2BSWA 1B50A 3BZDB 2FMMA 3TO9A 3E3XA 4KHVA 5FLXL 1VHEA 4C3HH 3K80C 1ICWA 3CPFA 1FGBD 4DXGA 4DKAC 2ASBA 4DV1Q 3C1EA 4LFBQ 4JXRA 4ZY0A 1F2YA 1II3A 4X6AH 5H84A 1KDAA 3SK4A 5LMNL 4BD9A 4QBJA 1MJBA 4WORA 1SEBD 5C4HA 2PRQA 4NGTA 2E2IH 1KIXA 4IFDG 3OTOL 1HR0L 4ZY2A 1F9SA 2N88A 2OTLA 1ESFA 1RDPD 4R1JA 2HD3A 1EOVA 1VQFA 4ZKCB 4QUFA 2NZHA 3K2KA 1IYKA 3I56A 3W1BA 2VB3X 3PIOA 3GTOB 1P8LA 3RLNA 4KOVA 1WFQA 7CPAA 1LT4D 3RMHA 1PH7A 1Y1VB 3H09A 1IIDA 4RFBA 4IJLA 5I9OA 1H9JA 2GLFA 4CS0B 1HA5A 4R8IA 1PTOH 3E0JA 1X32A 4H13C 3Q8DA 3HOYH 2WV6D 4FF4A 1PRTD 2NVYB 2QDLA 4HJ5A 2LXJA 2CXAA 5J3BA 2GIVA 1CA6A 1IBMQ 1AYEA 3IU1A 5BN5A 1TXYA 2QGQA 1JB3A 2VUMH 4GLAC 4BA1I 5JJIA 2OB0A 4X64L 4C2ZA 1U0LA 4QCLA 1EWIA 4CJ0B 4MFQA 4P4BA 1NY4A 1LAPA 4BXXG 2Q8TA 4DR1Q
chains in the Genus database with same CATH topology
3KASA 3C2PA 4Q7AA 4A94A 2NYQA 5JPMC 2RSNA 4FO2A 2OXPA 3A8JE 1KDCA 3MVVA 3DMUA 5M5XB 2VL1A 2EYOA 2EY1A 1S5ED 4C3JB 1F2PA 1ZG7A 4IUQA 1EL0A 3ISXA 2NZ1D 5C0XJ 5LL6X 3HS0C 1JOOA 4K5XA 4XDXA 3B7IA 3D4RA 2PMZB 1EY5A 1NR2A 3TP6A 2A69C 1CI3M 4K8IA 2PVWA 3FVQA 3K57A 3HP3A 4HCEA 1CPSA 5LHY1 3TZDA 4ZRZA 1VIXA 2BOAA 3OWEB 2KVMA 4OIWA 1SDFA 2F03A 1WTPA 1LFWA 4CPAA 3B3TA 1CK1A 3FKIB 3FH4A 1UEAB 3KBGA 4BY7B 1HHVA 2L12A 3I4MB 2F4IA 4MHPA 3SHLA 4IAVA 2TSSA 2K33A 2IPKD 2CW0C 1S5DD 4PMWA 3I73A 1AZPA 2V77A 1F9PA 2OR4A 2OT2A 4OC1A 1F2MA 3B3CA 4FAIA 1VMPA 4WJWA 1LT5D 2NB0A 2BCOA 5JVG3 1STGA 6CPAA 2QCPX 2AFZA 3V05A 2EE1A 2R93B 4IZ8A 4A3EB 1H9RA 4LJZC 2L9HA 5C44B 1MD2D 2EYJA 4IFDH 4EQPA 3R3OA 1JOKA 2A6HD 3RD4A 2F3WA 2ID0A 1AZQA 3RZAA 4LK1C 2QYVA 4P45A 3EVQA 3IFTA 4RGMA 3I91A 3BHXA 3EA6A 1R9TB 4YU9A 4KJOA 4F9VA 1EU3A 2PVVA 4OKOA 5M3MB 4U673 2QVPA 1Y1WB 3ND8A 3URYA 4RCOA 3V38A 2AFSA 1CFMA 1ZG9A 3MA2B 4OO1G 2F0UA 2ZOGA 3T53B 5LYDA 1RTOA 3R2TA 5D3IB 3S14B 2FJ2A 2XEGA 4QIWB 2TMPA 2WB1B 2EJFC 1DOKA 3VYRA 1PRTB 4LQGA 4RAUC 4B08A 1EYCA 1CP7A 1B3AA 5IT9L 1ZLHA 1RODA 1GUTA 3NE5B 1T5EA 2PCFB 1BBXC 3PB9X 4MRIA 1D5ZC 3IKJA 4Z65A 4A3JB 2B2UC 4ZY1A 2RB7A 1I4GA 1OO9B 2F0SA 2XWJB 1Q12A 1IL8A 3EFXD 3SVMA 3BVMA 2LMCB 1GHJA 4IUNA 3GTJB 1Y0RA 1ARMA 3AU7A 2WIIB 1LTAD 1S4ZA 4FXKC 4NW2A 1EQVA 3LWEA 5K36G 1QMUA 3M3YB 1GOZA 2EK8A 1SJED 3CHBD 1W6JA 4PQAA 1ET6A 1IY7A 3NP8A 2B39A 1YNND 3M4OB 4MMOA 1S5BD 1I4XA 5FLXE 1WTQA 4KN7C 3VYTA 2EYHA 2AFMA 3J7AF 2EY5A 3VATA 5IGCA 3GV3A 1SNMA 4ZLTF 1TS2A 2R3ZA 3HOUB 1BNZA 4KN4C 3ZYYX 1TS4A 5C5MA 2WYRA 1S5FD 4FXDA 1HPCA 2Z4HA 1GXDC 4EMEA 5I2XA 1TXRA 2F0MA 2CIJA 2F8HA 1DYQA 1WTRA 1NAPA 1Y8NB 4K6DA 4XT1B 2Z8LA 1EY6A 2B2YC 1Q7LA 3PBEA 3WDNA 3KHZA 2NTSA 1D5MC 1PTOC 3GO5A 1LCPA 3HRZC 4G1PA 1SYDA 3NH8A 3H3VC 2A6ED 3P1HA 3PUVA 4W9YA 1Y8OB 3TP8A 1TT2A 1QNKA 2A68D 4OC3A 4P6YA 1JWMD 3D7GA 1PDQA 2I07B 1CP6A 1Z5RA 1M4LA 1A15A 4K14A 4CJ1B 5KNCA 5FO8B 1TKJA 2QF7A 2L55A 1FNUA 2KEDA 4XTCS 3MRUA 4ZKBB 4OO1H 2F0DA 2XEIA 5IIFA 1A3UA 2DEAA 1CQVA 3MC0B 2YU9B 2HDMA 3J80L 1ZKOA 1BLLE 2F0GA 3H6MA 1WTWA 5CBEE 4CKEA 2JEAI 2VUMB 5JM6A 2SNMA 3PUWA 4KY5A 3RLFA 4R6TA 1F2ZA 3H8GA 3NBIA 2J7ZA 1G8ZD 3FRPB 1O7ZA 3QOLA 2L4NA 1FYCA 4UEZA 3K7AB 4MHYA 3RZDB 3NHHA 1FT7A 4RGOS 4G57A 4JYWA 2EDGA 1XJOA 4G4KA 3CQZB 5K36H 4B9WA 5HVGA 2HUGA 4BWGB 5CC4A 5BN4A 2IL8A 1I4PA 3H91A 1JC7A 2XWBB 3PB6X 4K3NA 1WTVA 3I90A 5CV7A 5KGUA 1KAAA 5HXDA 4DU9A 1SYBA 1DTDA 2F0HA 3PO3B 2F0PA 4PXCA 3N5FA 2O2LD 1ZYRC 4WRDA 3MWYW 3HKZB 1NSAA 5CORA 1I6HB 2BO9A 4OC2A 2BA0A 2A73B 2QJ8A 2K28A 2C6PA 2V8VA 4P4FA 4JK1C 5A35A 4MXUA 1DJRD 3BVGA 4DXFA 2ZT9C 3NXWA 4R8NA 4B6ZA 2M00A 2NWGA 4X8IA 2MP1A 4XYOA 2NVXB 3SI2A 2A5HA 3V96A 1BAVA 4UF4A 3A55A 4OIDA 3A8IE 2ZENA 4YIJA 3J7YW 1RKNA 1PCAA 1G2TA 5CPAA 1TS5A 1SE2A 2B2YA 2ZEHA 1CA5A 4A93B 1B1ZA 2ZOFA 5M3FB 1HQRD 1AFPA 4BA2I 1V1PA 2Q43A 4RUHA 4XQNA 5DS0A 5LYIA 3CRLC 3SI0A 1YW6A 4MIUA 3KHXA 4H7BA 3OOCA 2XIWA 2NYZD 3NFZA 1V8QA 2M9VA 1BCPC 1OBRA 1GUGA 2E76C 4DAYA 3J81E 1TR5A 2K5QA 1DOMA 2J0TD 4NFRA 1G91A 1TY2A 1ELLP 2GLJA 1I3QB 2KEEA 4ZQ3A 4ZX8A 1VF7A 5LRKA 3TC8A 3BI0A 1TWFB 3PRTA 1BF4A 3KBXA 4PPZA 2PJ0A 2SDFA 1EU4A 3BDCA 4O23A 3NWTA 4FWUA 1QE6A 1SE4A 1GJXA 1VMCA 4HSPA 1G2SA 2QEJC 3B3SA 2BA1A 2XN9C 1SYGA 5AFWA 3VARA 2VB2X 2OF1A 1WVLA 5JEAJ 4A3DB 3QNVA 1TKWB 5DEHA 1ML0D 5J22A 3BDLA 2CTCA 1CZWA 1HA6A 3VR2A 4PMBA 3PO2B 3NH5A 1LT6D 4IQZA 5FK9C 2O5JC 4IK2A 4KKTA 5LYLA 3PFOA 4H44C 4NGMA 1I4QA 5CV5A 4K2KA 1SMYC 3DXJC 3TP7A 3NSWA 4U68A 3PBBA 1X3QA 2HB6A 3SI1A 1BPNA 3KGQA 2F0LA 1BPMA 5DAUA 3VR4A 4IHMA 4PXBA 1IYUA 3GLJA 3A54A 2A74C 5EPKA 2KQ3A 1Z47A 3W3AA 1FNVA 2PIYA 1RF2D 1F2OA 1CHPD 1HQMC 1SNDA 4WJBA 2HDLA 3GV6A 2Q4ZA 1FNOA 2EJMA 3L3OC 4L8JA 1W6KA 3DWPA 5F09A 2WKCA 2PZUA 2F3VA 1O80A 1XX8A 3MXNA 3IAYA 1LLRD 4TNUA 3VR3A 3U9SA 1TKHA 1FNWA 1AN8A 3KQXA 3ERQA 4F8MA 1YSJA 3R2IA 2L5TA 4FF2A 1XTCD 5IB9A 5C4ZA 1SYEA 2LY7A 2ZXOA 2PJAA 4FBEA 4FP5D 2EWBA 5FOBB 1Q3LA 2X6GA 3FVLA 1WTOA 4TWEA 1O78A 2EYPA 2V8DA 5ELYA 1GHKA 4IUUA 2R7ZB 2NN6G 4OC0A 4IFDJ 3S9WA 3SJFA 2F1MA 4I65A 2QDBA 1F2LA 2K7VA 3WC6A 3HZXA 1LTSD 4FF3A 3GTQB 2KJXA 2XEFA 1TF8A 1QWYA 4NJRA 4UDUC 2IJZA 1M8AA 4X3TA 5EKLA 1IW7C 3B3VA 1B9NA 2L1BA 4F88A 3I72A 3ND9A 1EYDA 1D6EC 3A56A 1MBYA 3PUZA 5K8NA 4RKLA 5EKKA 2HC9A 2L11A 1JWUD 3HEJA 5K8MA 4C2MB 1PRTF 1Z2LA 4RWSC 1YW4A 2JA5B 3DEPA 1NR4A 5IODA 4DF7A 2F0IA 2ZEOA 5A2QL 4DA2A 4F7XA 8CPAA 3HOXB 4NGRA 1KDBA 2H1EA 1GYTA 2PJ3A 3HOWB 5ISRA 3IEHA 4LMQD 3K58A 3C46A 3AMUA 3GTKB 3R8BA 3Q24A 2FINB 3F2UA 1RCVD 4FUUA 3CRKC 3SEBA 2FFKB 3KI9A 3TBIB 1QJOA 3GTPB 3NA6A 1PFNA 2I3CA 1YLOA 1IKLA 1CQFA 4TQUS 2WKDA 3Q0AA 2IMOA 4A3GB 4OMEA 2B2WA 1BO0A 2K1BA 3EJIA 1LTID 1I50B 3B35A 5IGDA 2BE5D 3ITPA 3H0GB 4CHTB 5BN3A 5KEEA 5HVFA 3PEIA 1IHZA 5C3XA 1ET9A 3LNNA 5EPJA 4FYDA 1EY8A 2RDHA 1SYFA 1YNJD 4KJNA 4HCSA 3T16A 3K59A 2Z1CA 1R43A 3X3NA 1PTOD 3GTGB 2V8HA 2AFWA 1RTQA 3MHBA 2FVGA 2CF4A 3S1QB 4GM5A 2IQ6A 1H9SA 3JAML 1JOQA 2PQEA 1A6XA 1PZJD 3KLSA 1HCZA 4KKSA 2NVTB 2K32A 2AUKA 5KRUA 1TWHB 3KQZA 4HR7B 3D3RA 2PCUA 1SBBB 3C3LA 3K5LA 3M85A 2PNRC 1S5CD 1Y8PB 1ELMP 4DK0A 5LYFA 1UUPA 2EVBA 3DM1A 2NN6H 4BY1B 4OC4A 5M5YB 1TWCB 1WD1A 3E5SA 3WC7A 3BI1A 5CGKA 5D8NA 4DUKA 1V1OA 2JEBI 5T1IA 4NGSA 4ONWA 2ZEEA 3ISZA 5CBAE 4DAPA 2AFOA 2JA6B 1PFBA 5FKAC 1UWYA 1Y69U 2HCCA 2EK9A 3R93A 1AEXA 1TWAB 3GP7A 4X3RA 1STNA 2PJ9A 2E2HB 4XQJA 1O7LA 3S2HB 4KI0A 3P75A 4NP5A 3PB7X 4K5WA 2V8GA 1A3TA 1CG2A 2ZEPA 3A8KE 1LANA 2MGSA 3VR5A 4DFAA 3IC1A 2XRQD 1F9QA 4XQQA 3Q6SA 4CKBA 2E75C 3L7ZC 2AUJD 1ILPA 2MPMA 3PIP3 1SE3A 3CU7A 5EQ0A 4RH6A 5CYUA 1A2UA 3QJYA 5IGGA 1Q1EA 3QWNA 4J1MA 1ZYRD 3OSOA 3BVZA 3M7NA 1HFNA 2ZXRA 2LS01 1JORA 2B2VA 2PJ1A 2OOTA 3NBHA 5I6WA 4MHZA 4QUCA 3PUXA 4MCQA 1WD0A 1XYIA 1HXYD 4N9TA 5G3LD 2A6HC 2CHBD 5EBCA 4ODGA 4C3HB 4OIJA 1U4MA 2FHTA 1STYA 3S9LA 1JR0D 5K5PA 1NSNS 1EIHA 3GD7A 5C4XB 3V7ZA 2M2LA 4EGVA 1MSGA 2AWOA 2E2IB 4XXEA 4UIAA 5JH9A 2IJ0A 4KY6A 1PMRA 3U9OA 5E3FA 3NPPA 1RD9D 2PZWA 3I4LA 1D1IA 2DN8A 2K5DA 3NUCA 5T1GA 4KKUA 4C1NK 5I9PA 2NBFA 4O42A 2JSOA 1ZG8A 1PTOB 1Q8IA 5KIXA 2C1CA 3HOYB 2K05A 3FJUA 4K6LA 5M9OA 1FR3A 3IJ3A 4G7HC 3D4WA 2POKA 1TKFA 2EJGC 3IWWA 4HTHA 3S1RB 3HLPA 3K5OA 3E6ZX 4ZK9B 3DGVA 3H94A 5IGFA 2AWNA 4LAAA 5CV8A 5TSSA 2NVQB 4JZ0A 2NSMA 1EWCA 5FO7B 5ELDA 5G3LF 1DONA 1RTNA 1DZ1A 4ZUIA 4RA8A 4Z9CB 2EY2A 1I4RA 1Z6HA 2PIZA 2GREA 3VYUA 3WT4A 1EY9A 2K01A 5C4JB 1LTBD 5ELBA 2NN6I 2DY7A 1RJTA 1JQGA 1XXGA 2RSOA 4L6TB 4B9XA 4DK1A 3Q22A 1HDUA 2SEBD 1YNNC 4OL7A 3L9AX 1C8CA 4HMIA 2XVSA 4H2KA 1QILA 1LTTD 3D31A 3CKIB 4DNTB 1WTXA 3WC5A 5C3WA 1HTLD 4C3IB 4P44A 3SJXA 2SNSA 3QO2A 5EBDA 1QNUA 4CJ2C 3FX6A 3JRUA 4P2CB 1KWMA 2AFUA 2I46A 4WWVA 1AP0A 4KV6A 2JYOA 4BBSB 5IOCA 1E2VA 1L0XB 5D3DA 4FXGC 4F87A 3TX8A 1H8LA 3PB4X 1BDOA 3K5NA 4PMCA 2WP8J 1E2ZA 3S17B 1F9RA 5CR3A 1TVXA 2H4OA 4K5VA 4FNFA 1Q90A 4Y7NB 3P20A 1HRJA 1KNAA 1NCVA 5J1ZA 5I6YA 2CTBA 4RKBA 3CT9A 3GTLB 2WACA 1GUNA 4NGPA 3I3CA 5CBMA 2XSCA 2J4XA 1Y7EA 1V43A 1VHOA 2PO4A 1EQTA 3VH9A 4ME5A 3D7FA 5IT9E 4G7OC 1PXUA 2BDOA 4FF1A 2JEWA 1XMBA 1CTMA 2RKSA 1STBA 5JEAG 1VDZA 4N9PA 1HUMA 3IIBA 5COYA 3KL9A 5DM63 2ANPA 2AFXA 2YYZA 2D9UA 3TN2A 1GUWA 4IUPA 3O13A 3MEHA 1ONLA 5FO9B 3FECA 2DNEA 4M8AA 1UAPA 1ZLIA 4H0LC 2JBJA 3D7HA 1DOLA 2A69D 2G9HD 4DN4M 1B44D 2DNCA 4KD3A 3M7GA 4UEFA 1BCPB 4DJLA 1IW7D 2ICIA 1YMEA 4FVMA 4X3UA 1CT1D 1IGBA 3OHXC 3BYTB 2PW7A 4Q0FA 1B53A 1VCIA 4A3IB 4DAVA 4RHRA 1ENCA 2RA4A 3IFEA 5E4WC 2RQXA 3QG1A 2ZEMA 2KCNA 4P4IA 2KHSA 4BBRB 2O4XA 5EKIA 2PJ5A 4XT3B 5I4DA 3Q23A 4R9WA 2B2WC 3P7JA 3SR1A 2CW0D 3MXUA 1BXTA 4OHJA 2PJ8A 3FEEA 3DEOA 3KLSX 2F7VA 3MXGA 3NQTA 5JGFA 4A39A 3OPOA 1TS3A 2PW5A 3SK6A 1R4PB 2ZEDA 4AXVA 1PLFA 1X3PA 2B63B 1BUVT 3HGBA 3M4YA 5KYIA 3DHQA 5ELFA 3OWFA 5C0XG 4P4EA 1MSHA 4PXEA 3CPXA 3NTHA 4MCSA 4NKLA 1CHQD 1B9MA 2WINB 2ZEFA 3BXMA 1VF5C 2KA7A 3EQLC 5HGTA 3IFDA 3SXHA 4IURA 1DM0B 4ZAIA 3SJGA 1EYAA 2PE3A 2RVLA 3FDTA 3T4AC 1A2TA 1TY0A 4KY7A 3G7LA 1EFID 5EJWA 1EY7A 1OXXK 4C1NI 5KNDA 4AYBB 1LTGD 4HEDA 4OIKA 3OMGA 1A3VA 3NWSA 1DE4C 3TMEA 3OMCA 3N52A 3J80E 5IGBA 3QOJA 1GUSA 2B8FA 4G7ZC 2NTTA 2GA4B 3IL8A 3I4NB 5JEAH 4ULLA 3K6OA 4OGQC 2F0JA 1ILQA 5JOBA 3HUVA 1M4VA 2JXMB 2L0CA 1EEID 3MAQA 1H9SB 4ZI6A 4WFN3 5THWA 2HQEA 1C4QA 5KNBA 3FEWX 2F0WA 2PJCA 1O7YA 2RDGA 2R6GA 1TQOA 2F0EA 3QIAA 3NH4A 4IN3A 2O4HA 1EZ8A 1Z8LA 2B2TA 4A3FB 3FF3A 2VXWA 1D1KA 3T51B 1ZXTA 2EYLA 2PJ7A 5K8OA 4O1NA 1SSOA 2IT1A 3MFYA 4NGNA 3SJEA 3D67A 2E2JB 2K5WA 2Y0SB 4R8FA 2VNUD 3OIQA 2F0TA 4I7ZC 2B2VC 5D14A 1J8IA 2WAQB 4XIGS 4GZYC 4NGQA 4RCNA 4A3BB 1EWHA 1ZEQX 2ABZA 1OXTA 3HG9A 1AMPA 3VA7A 3BS1A 3RZOB 2KCCA 3WABA 1XRYA 2Q51A 2PYKA 3H8FA 3NTKA 2DY8A 4CGYB 5JPNC 2F0VA 4ZYSA 4MCPA 4P4DA 2RBMA 4P10A 5CV6A 3KZWA 3I8ZA 2C6GA 2PJ4A 2B8GA 1SFOB 3S9MA 5C3EB 4C3JG 2Q8RE 3UI2A 1EEFD 3D7DA 3D4DA 5C0XH 4EQOA 1DCZA 2IX0A 2LFNA 5D65A 2E2DC 1I6VC 1PRTC 2BOSA 1F57A 4MCRA 1FD7D 1Q1BA 2F0QA 2V4DA 1TWGB 3RAMA 4NDXA 2X69A 3K5MA 1JQYD 3LMSA 5HVHA 3N6RA 5J1QA 1BR9A 4ILWA 3PB8X 3S15B 3KLRA 2HCIA 4OC5A 2ENBA 4IUVA 4Q5VA 2AQ2B 4RGTA 1SNCA 2ICEC 5I4MA 4YWYA 3T56B 4PXDA 1EOTA 2F0KA 1TF9A 1H9KA 1J9OA 2OEOA 2EOTA 4V0BA 5CV9A 2G9DA 4HN7A 1U9RA 4TSSA 1STHA 3D8GA 3KR4A 2BDNA 1OXSC 1GUOA 2D2CC 1HEEA 4ZYQA 1Z7TA 4EQNA 1U4RA 2PPBC 4A38A 1MGSA 5EGTA 1QCBD 4IALA 3S16B 3A7AB 1EY0A 2J9AA 4KTAA 1K8OA 3VYSA 4J6HA 1EIGA 1R4QB 2JA7B 5D29A 1PYTB 1STAA 3G6JB 3J81L 2O5IC 5LRGA 3T13A 1K83B 3GTMB 4BS9A 2SOBA 3SK8A 2C6CA 2D62A 2MHVA 4A37A 1MI2A 3A7LA 1PTOF 2K04A 1VGYA 2EY6A 3DWQA 4L63B 3BYYB 1SYCA 3GUXA 2IW3A 3D4UA 5JVH3 3MXPA 3H8EA 3T8WA 1JICA 1IKMA 1LOKA 3TSSA 2K03A 1C48A 4ID6A 3WOEA 4A3KB 1XBUA 4QF4A 3BG3A 1SAPA 1CM9A 1K8MA 2ZELA 4IUTA 5CMDA 3SK5A 5C5LA 3LX0A 1E2WA 4ABNA 4HSVA 1D2BA 1OXVA 4J8QA 3D68A 3KR5A 5E4XA 3SE0A 4S3SA 2AQ3B 2N55A 4PV1C 4K2LA 2BE5C 2GU2A 3PMFA 1JCKB 1OXUA 1HUNA 3SDZA 2PJBA 1QOHA 1CPXA 3B3WA 1TIID 3OW7A 3FPPA 1SJHD 1CBXA 2EYMA 1YNJC 2WZNA 5NUCA 2EXZA 2PJ2A 5IGEA 2R92B 2F0OA 3DLJA 2IX1A 3HOZB 4ZX9A 3V2TA 1H9MA 3GB0A 5C0XI 4KSIA 4F9UA 3X3MA 5M5WB 3BDOA 3ONAB 4IFDI 1PFMA 2NUCA 2IWHA 4TKOB 1V1PB 4EFDA 5DM73 5JAVA 2ZEGA 1D5XC 2C9OA 4HMJA 3I70A 2K6AA 3TZUA 1BCPD 5E1FA 1IYVA 1RHPA 3CDXA 4KMUC 3D66A 1TU2B 3NQIA 1SNQA 5CV4A 3VA5A 2MJ8A 3MTSA 1HFGA 4XYQA 1R3NA 5JJZA 2D5DA 3S1NB 2KECA 1L0YB 4JBWA 2Q8IB 3MZ5A 2PJ6A 1EE3P 4NMZA 3PV0A 5A2QE 4MHEA 2LKVA 4C56C 2F0NA 1LAMA 3TP5A 2B2UA 1QG7A 1U4LA 1B4OA 1U4PA 1DXMA 3MN8A 1ENAA 3B2YA 3DWAA 1AW7A 3PFEA 3FEDA 1EY4A 3S9NA 3I1UA 4UIBA 5HURA 2QKIC 4F8ZA 3LWUA 3CPAA 1PZKD 4MHNA 2R61A 4EWTA 4PQXA 1QB5D 4DNRB 3HOVB 4HAEA 2EYFA 4K8JA 4OP4A 5LL6S 1LABA 1PZID 3KK7A 1LO5D 4C3HG 1LACA 2KUMA 3FPUB 4EVOA 2X6LA 1KABA 1SMYD 2MUYA 2PZTA 3D6WA 1BCPF 3C1FA 4CBVA 3W2DA 1CX8A 3EROA 3AB9A 5KYLA 3S2DB 4ZUJA 5ELCA 2JBKA 3L2NA 4KD4A 2CVRA 1ARLA 3PUYA 4R7MA 4UEEA 1CZGA 4X2TA 4CKCA 2A6EC 3K9TA 1JWSD 2A68C 1B2TA 2KOLA 3RBUA 2AQ1B 3KF8A 2XEJA 1BQQT 1KLGD 4MN3A 4TRDA 1HTPA 2RDFA 3JAME 1KTKA 1PYWD 5ELEA 3TDQA 1SNOA 1E0BA 1LT3D 2CQAA 2XRSD 4DYOA 4DGZA 4QMGA 1BOSA 4R76A 5K8PA 3OIPA 2JA8B 4QB4A 3NTIA 3K0YA 2FMCA 3NK9A 1F77A 2IX3A 1I4HA 1SXTA 4V190 4UAIA 3PIO3 1QQ9A 1NUCA 5DNFA 1KNEA 4X3KA 4X3SA 3D6CA 1EZ6A 1T5XD 3KUPA 4PNYA 3FMCA 4E6IA 1UNSA 3RUZA 4RHSA 3VR6A 2EPBA 4M1UB 1Y0YA 3IO1A 1LTRD 2Z4IA 1KLUD 3QB3A 1G291 2B2TC 1WCMB 2JE6I 1STEA 4C3IG 4P4JA 3DUZA 4KHZA 1LV9A 1JE4A 4OO1I 2XNAC 1G6ZA 2EZVA 2E74C 2ZXPA 3MFGA 2C5CA 1XWEA 5J39A 3S1MB 4NJQA 3WOFA 2JP1A 1XFOA 2F0FA 1HDQA 5EPLA 5C6AA 2QILA 1ENFA 1ESRA 4A3MB 5I2YA 4KK7A 5LRJA 5F2DA 3J7AV 1DD2A 3GQBA 4RGNA 2O53A 1SNPA 1B50A 3BZDB 2FMMA 4KHVA 1VHEA 5FLXL 1ICWA 1FGBD 4DXGA 3C1EA 4ZY0A 1F2YA 1II3A 1KDAA 3SK4A 4BD9A 4WORA 1SEBD 5C4HA 2PRQA 4NGTA 4IFDG 4ZY2A 1F9SA 2N88A 1ESFA 1RDPD 4ZKCB 4QUFA 3K2KA 2VB3X 3GTOB 7CPAA 1LT4D 3RMHA 1Y1VB 3H09A 4RFBA 5I9OA 1H9JA 2GLFA 1HA5A 4R8IA 1PTOH 3E0JA 1X32A 4H13C 2WV6D 4FF4A 1PRTD 2NVYB 1CA6A 1AYEA 5BN5A 1JB3A 4BA1I 4QCLA 4P4BA 4CJ0B 1LAPA 2Q8TA 2RFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAS A;  4Q7A A;  5DS0 A;  5LYI A;  4A94 A;  3SI0 A;  1YW6 A;  2NYQ A;  5I4M A;  4YWY A;  4PXD A;  3KHX A;  1TF9 A;  3NFZ A;  2G9D A;  2VL1 A;  1ZG8 A;  1OBR A;  2C1C A;  1F2P A;  3KR4 A;  3FJU A;  1ZG7 A;  3IJ3 A;  1HEE A;  4ZYQ A;  3ISX A;  4A38 A;  4NFR A;  2POK A;  1ELL P;  2GLJ A;  2J9A A;  4ZX8 A;  1TKF A;  3B7I A;  3IWW A;  5LRK A;  3TC8 A;  3BI0 A;  3PRT A;  3HLP A;  2PVW A;  3DGV A;  4PPZ A;  2PJ0 A;  5D29 A;  1PYT B;  4JZ0 A;  5LRG A;  2NSM A;  4O23 A;  4FWU A;  1CPS A;  2C6C A;  1VIX A;  2PIZ A;  2BOA A;  2GRE A;  3WT4 A;  4A37 A;  3B3S A;  4OIW A;  3VAR A;  1VGY A;  1LFW A;  1JQG A;  4CPA A;  3B3T A;  3QNV A;  3FH4 A;  3GUX A;  1HDU A;  3D4U A;  2CTC A;  3H8E A;  3T8W A;  4H2K A;  4MHP A;  3NH5 A;  1LOK A;  4IAV A;  4IK2 A;  3WC5 A;  5LYL A;  1XBU A;  3PFO A;  4P44 A;  2ZEL A;  4NGM A;  3SJX A;  2V77 A;  2OR4 A;  3PBB A;  3FX6 A;  2HB6 A;  4OC1 A;  3SI1 A;  1BPN A;  3B3C A;  3JRU A;  3KGQ A;  4FAI A;  1KWM A;  2AFU A;  1BPM A;  4WWV A;  4IHM A;  2BCO A;  4PXB A;  3GLJ A;  6CPA A;  2AFZ A;  3D68 A;  3KR5 A;  3TX8 A;  1H8L A;  3PB4 X;  2PIY A;  1F2O A;  2GU2 A;  4WJB A;  2Q4Z A;  1FNO A;  2PJB A;  1CPX A;  3B3W A;  5F09 A;  1CBX A;  3RZA A;  2WZN A;  2QYV A;  4P45 A;  2CTB A;  3CT9 A;  4TNU A;  2PJ2 A;  3BHX A;  1TKH A;  4NGP A;  3KQX A;  5CBM A;  4YU9 A;  4F9V A;  3DLJ A;  2PVV A;  4OKO A;  2QVP A;  1Y7E A;  1YSJ A;  1VHO A;  3V38 A;  2AFS A;  3VH9 A;  1ZG9 A;  3D7F A;  4ZX9 A;  2JEW A;  3GB0 A;  1XMB A;  2ZOG A;  5IB9 A;  4KSI A;  4F9U A;  5LYD A;  2PJA A;  4FBE A;  2XEG A;  2EWB A;  4LQG A;  4EFD A;  3IIB A;  2ZEG A;  1CP7 A;  3FVL A;  4TWE A;  3KL9 A;  2V8D A;  5ELY A;  1ZLH A;  2ANP A;  3CDX A;  2AFX A;  4OC0 A;  3D66 A;  3PB9 X;  4MRI A;  3SJF A;  4Z65 A;  1R3N A;  4ZY1 A;  3FEC A;  2RB7 A;  3WC6 A;  1ZLI A;  2XEF A;  1TF8 A;  2JBJ A;  4NJR A;  3D7H A;  2IJZ A;  1Y0R A;  1ARM A;  3B3V A;  2PJ6 A;  1EE3 P;  4UEF A;  5K8N A;  1LAM A;  2HC9 A;  4DJL A;  5K8M A;  1YME A;  1QMU A;  1Z2L A;  1YW4 A;  3MN8 A;  3B2Y A;  1IGB A;  2EK8 A;  3FED A;  3PFE A;  3S9N A;  3I1U A;  4UIB A;  2ZEO A;  4F8Z A;  3LWU A;  3CPA A;  4PQA A;  4MHN A;  1IY7 A;  4EWT A;  8CPA A;  3IFE A;  4NGR A;  1GYT A;  2PJ3 A;  4MMO A;  2ZEM A;  4OP4 A;  4P4I A;  3IEH A;  2AFM A;  2PJ5 A;  3VAT A;  4FUU A;  2PJ8 A;  3FEE A;  3KI9 A;  2F7V A;  3NA6 A;  5JGF A;  1CX8 A;  4A39 A;  2I3C A;  2WYR A;  1YLO A;  2ZED A;  4AXV A;  2JBK A;  2IMO A;  3L2N A;  4OME A;  4EME A;  1TXR A;  4P4E A;  4PXE A;  3CPX A;  1ARL A;  2CIJ A;  3B35 A;  2F8H A;  4MCS A;  4R7M A;  4UEE A;  4X2T A;  2ZEF A;  3BXM A;  5HVF A;  3PEI A;  3SJG A;  1Q7L A;  2PE3 A;  3PBE A;  3K9T A;  3KHZ A;  1LCP A;  4G1P A;  3RBU A;  2XEJ A;  3NH8 A;  4W9Y A;  1R43 A;  4OC3 A;  2V8H A;  4P6Y A;  2AFW A;  3D7G A;  1CP6 A;  1Z5R A;  4DYO A;  1M4L A;  4R76 A;  5K8P A;  1RTQ A;  1DE4 C;  1TKJ A;  2FVG A;  2CF4 A;  4GM5 A;  2IQ6 A;  3MRU A;  2XEI A;  1QQ9 A;  2DEA A;  3KQZ A;  2PCU A;  1BLL E;  3HUV A;  3FMC A;  1ELM P;  5LYF A;  4ZI6 A;  5JM6 A;  5THW A;  1Y0Y A;  4OC4 A;  3IO1 A;  4R6T A;  3WC7 A;  3H8G A;  3BI1 A;  2PJC A;  5D8N A;  4DUK A;  4P4J A;  4NGS A;  4ONW A;  2ZEE A;  3ISZ A;  3NH4 A;  4UEZ A;  2AFO A;  2O4H A;  4MHY A;  1FT7 A;  1UWY A;  2EK9 A;  1Z8L A;  4JYW A;  1XJO A;  4NJQ A;  2PJ9 A;  4X3R A;  3FF3 A;  5HVG A;  2PJ7 A;  5K8O A;  1XFO A;  3PB7 X;  1HDQ A;  2V8G A;  1CG2 A;  2ZEP A;  1LAN A;  4NGN A;  3SJE A;  3D67 A;  3PB6 X;  4K3N A;  4R8F A;  5LRJ A;  3IC1 A;  5HXD A;  1DTD A;  2O53 A;  4PXC A;  3N5F A;  4NGQ A;  1NSA A;  1VHE A;  2BO9 A;  2ABZ A;  4OC2 A;  1AMP A;  2QJ8 A;  3WAB A;  4ZY0 A;  2V8V A;  2C6P A;  1XRY A;  4P4F A;  4RUH A;  4BD9 A;  2Q51 A;  3H8F A;  4MXU A;  2PJ1 A;  2PRQ A;  4NGT A;  2OOT A;  4MHZ A;  4P4D A;  4MCP A;  4MCQ A;  4P10 A;  3KZW A;  4ZY2 A;  2C6G A;  4B6Z A;  2PJ4 A;  4X8I A;  3S9M A;  3K2K A;  3D7D A;  3SI2 A;  7CPA A;  1BAV A;  4UF4 A;  4OID A;  1F57 A;  2GLF A;  4MCR A;  3S9L A;  2ZEN A;  3RAM A;  3V7Z A;  1PCA A;  5CPA A;  3LMS A;  5HVH A;  2ZEH A;  1AYE A;  5J1Q A;  4UIA A;  5JH9 A;  3PB8 X;  2ZOF A;  4P4B A;  1LAP A;  2RFH A;  2Q43 A;  4OC5 A; 
#chains in the Genus database with same CATH topology
 1HNZ L;  3KAS A;  1SE8 A;  3RNU A;  3C2P A;  4Q7A A;  1QSR A;  5F46 A;  4A94 A;  1IZ6 A;  1PH9 A;  2NYQ A;  5JPM C;  2RSN A;  4FO2 A;  3GKR A;  1M44 A;  1YEZ A;  2OXP A;  3A8J E;  2UXD Q;  1S40 A;  1KDC A;  3MVV A;  1G6P A;  3DMU A;  2NVQ H;  5M5X B;  2VL1 A;  2EYO A;  2EY1 A;  1VQ4 A;  1S5E D;  4C3J B;  1F2P A;  1ZG7 A;  4IUQ A;  1EL0 A;  2WSA A;  3F2C A;  2FE7 A;  4RI1 A;  2VBQ A;  2BEI A;  2PQ8 A;  3ISX A;  2NZ1 D;  3CQZ H;  5C0X J;  3STB C;  5LL6 X;  4LF6 L;  1IYJ B;  4DR6 Q;  1X54 A;  5C4J H;  5IE8 A;  3HS0 C;  1JOO A;  3JAM c;  4K5X A;  4XDX A;  3B7I A;  1KHI A;  3D4R A;  3WWV A;  2WPW A;  2PMZ B;  4UWJ A;  1EY5 A;  3J81 j;  1PU9 A;  3R9G A;  1NR2 A;  3TP6 A;  1RXT A;  1YNX A;  2A69 C;  1CI3 M;  4K8I A;  4BBR G;  1GO3 E;  2PVW A;  3DNS A;  1E1T A;  1KRT A;  4B13 A;  3FVQ A;  4B3S L;  1S60 A;  3K57 A;  4QGU A;  3HP3 A;  1HNW Q;  1B6B A;  1C7Y A;  3K0X A;  4HCE A;  3CZX A;  4RG1 A;  1CPS A;  1SLJ A;  5LHY 1;  3TZD A;  1E24 A;  1S3O A;  4ZRZ A;  4C3I H;  1I6H H;  1VIX A;  2AE6 A;  2Z0S A;  2BOA A;  4M85 A;  3TFY A;  1L1O C;  3OWE B;  2KVM A;  1KUX A;  4OIW A;  3TRZ A;  1SDF A;  3NE8 A;  1DGS A;  1WTP A;  3E0E A;  2F03 A;  1LFW A;  1VQB A;  4CPA A;  3U50 C;  3B3T A;  1CK1 A;  3FKI B;  3FH4 A;  1UEA B;  2N78 A;  4C7I A;  1QSM A;  3KBG A;  3QB8 A;  4BY7 B;  1HHV A;  2L12 A;  3I4M B;  4BBS H;  4QVT A;  2F4I A;  4IUS A;  3SHL A;  4MHP A;  1IBK Q;  1O7I A;  5HY6 A;  1N34 Q;  4IAV A;  2TSS A;  2K33 A;  1VQH A;  3IWG A;  4C2Y A;  2IPK D;  1NMG A;  5JPH A;  2Z3P A;  2CW0 C;  1S5D D;  1KRS A;  4PMW A;  3I73 A;  1AZP A;  4C2X A;  2V77 A;  3CCV A;  1F9P A;  1XMQ L;  4Y7N H;  5BWA B;  2OR4 A;  2OT2 A;  3CCL A;  1JMC A;  4OC1 A;  1F2M A;  3B3C A;  4KOW A;  4FAI A;  4TVA B;  1VMP A;  2BH2 A;  4WJW A;  2JK8 A;  3RR5 A;  4AYB G;  1V9P A;  4KUB A;  1LT5 D;  2NB0 A;  3BU2 A;  2BCO A;  4I7A A;  5JVG 3;  1STG A;  6CPA A;  2QCP X;  2AFZ A;  3V05 A;  2EE1 A;  2R93 B;  3VWE A;  4MFK A;  4IZ8 A;  1KAW A;  4A3E B;  4QY7 A;  1H9R A;  4DUY L;  1B8A A;  4LJZ C;  1I94 Q;  2L9H A;  2IL4 A;  2MO0 A;  4GOP C;  2B4D A;  5C44 B;  1MD2 D;  2EYJ A;  4IFD H;  3NBH B;  4EQP A;  4EX5 A;  3R3O A;  4POG A;  2CFM A;  1JOK A;  4NXY A;  2A6H D;  3RD4 A;  1YVO A;  2F3W A;  2ID0 A;  3I4N G;  2CQO A;  1VHS A;  1AZQ A;  3RZA A;  4LK1 C;  2QYV A;  4P45 A;  3EVQ A;  3J81 i;  1XPR A;  3H5Z A;  4AB7 A;  3GYA A;  3IFT A;  4RGM A;  2BH8 A;  3I91 A;  2ZJR A;  3BHX A;  2OQK A;  2VL6 A;  3EA6 A;  1E3P A;  1R9T B;  4YU9 A;  4KJO A;  4F9V A;  1EU3 A;  3ZJY C;  1XNR Q;  2PVV A;  4OKO A;  5M3M B;  4U67 3;  2QVP A;  5FJ8 G;  1Y1W B;  3ND8 A;  3URY A;  1X56 A;  4RCO A;  3DM3 A;  4POF A;  2MNA A;  4P72 A;  3L2P A;  2A4N A;  3V38 A;  2AFS A;  1CFM A;  3F2D A;  3IWE A;  1ZG9 A;  3GDE A;  1TWF H;  3MA2 B;  4OO1 G;  1WJJ A;  2F0U A;  2ZOG A;  4AYB E;  3T53 B;  5LYD A;  1RTO A;  3R2T A;  5D3I B;  3S14 B;  2FJ2 A;  4A3C G;  4BXX H;  2XEG A;  2H5X A;  2GFQ A;  4QIW B;  1QZH A;  2TMP A;  1ICF B;  2WB1 B;  2EJF C;  4DV1 L;  1DOK A;  3VYR A;  1PRT B;  4LQG A;  4RAU C;  4B08 A;  1EYC A;  1CP7 A;  1B3A A;  2UUA L;  5IT9 L;  1ZLH A;  4A3F G;  1X12 A;  1ROD A;  4MFP A;  3H3V I;  1GUT A;  1Q7Y C;  3NE5 B;  1T5E A;  2PCF B;  1BBX C;  4UP9 A;  1X9N A;  2REE A;  3PB9 X;  4MRI A;  1K0R A;  3EO4 A;  1D5Z C;  2R1I A;  3IKJ A;  4MJ8 A;  4Z65 A;  4A3J B;  3A5U A;  3HOW G;  2B2U C;  4ZY1 A;  3UDX A;  2RB7 A;  4MY0 A;  1I4G A;  1OO9 B;  2F0S A;  2XWJ B;  1Q12 A;  1IL8 A;  2Y0S G;  3EFX D;  1NMT A;  3F0A A;  4HNW B;  3SVM A;  3BVM A;  2LMC B;  4OWX B;  1GHJ A;  3KFU A;  4IUN A;  3GTJ B;  2UUC Q;  4M6G A;  1Y0R A;  1ARM A;  3AU7 A;  1YHA A;  2WII B;  4XNH B;  1LTA D;  1S4Z A;  4FXK C;  4NW2 A;  4YWK A;  2WAQ G;  1WWZ A;  1C0A A;  1EQV A;  3LWE A;  3HKS A;  4A3B G;  4BBR H;  5K36 G;  4UFX A;  1IBM L;  1QMU A;  4A3G G;  3M3Y B;  2UXC L;  1GOZ A;  3AFP A;  2CH4 A;  3RNZ A;  4A95 A;  5BR8 Q;  4DR1 L;  1BOB A;  1SJE D;  3CHB D;  2EK8 A;  4C7H A;  1W6J A;  4PQA A;  1QVC A;  1ET6 A;  2OZG A;  1X3F A;  1IY7 A;  3D2P A;  3NP8 A;  2ZPA A;  2B39 A;  1FJG Q;  1YNN D;  3M4O B;  4MMO A;  1S5B D;  4KLW A;  4JI1 L;  1I4X A;  1VQ7 A;  1K4J A;  4CGN A;  5FLX E;  4X62 L;  1WTQ A;  4KN7 C;  1HZB A;  3VYT A;  3CXP A;  2EYH A;  2AFM A;  2EUI A;  1NE3 A;  3J7A F;  2K4K A;  1YLE A;  2EY5 A;  3VAT A;  1VQD A;  5IGC A;  2DGY A;  3GV3 A;  1SNM A;  4ZLT F;  3B6Y A;  2WAQ E;  1TS2 A;  2R3Z A;  3HOU B;  1BNZ A;  3BJ7 A;  3CW2 C;  2D0P A;  4KN4 C;  1UFH A;  3ZYY X;  1TS4 A;  5C5M A;  2WYR A;  1S5F D;  4FXD A;  1HPC A;  2Z4H A;  1GXD C;  4EME A;  2I5H A;  5I2X A;  1TXR A;  1HNW L;  3D0F A;  2F0M A;  2CIJ A;  1UWV A;  4R4I A;  2F8H A;  3DR8 A;  1DYQ A;  3I9S A;  1IXR A;  4RS2 A;  4DV4 Q;  1WTR A;  1Q86 C;  1NAP A;  1Y8N B;  4K6D A;  4KVM E;  4XT1 B;  2Z8L A;  2PRB A;  1EY6 A;  4YHH Q;  2B2Y C;  3F8T A;  1Q7L A;  3PBE A;  3KDF A;  3WDN A;  3KHZ A;  2NTS A;  2VQE Q;  1D5M C;  4MTK A;  1PTO C;  1V1Q A;  3GO5 A;  4JI5 Q;  3HRZ C;  1LCP A;  4G1P A;  1SYD A;  4KVO E;  4DR3 Q;  4GOP A;  3ER0 A;  4JVZ A;  4BY1 G;  3NH8 A;  2UU9 Q;  3H3V C;  2A6E D;  3ULJ A;  3P1H A;  3PUV A;  3FRM A;  4BIN A;  3I4N H;  4W9Y A;  1Y8O B;  3TP8 A;  1TT2 A;  4XPD C;  1QNK A;  2A68 D;  4OC3 A;  1IBK L;  2ODF A;  1N34 L;  4P6Y A;  1JWM D;  3D7G A;  1PDQ A;  2I07 B;  1CP6 A;  1Z5R A;  4DR4 Q;  1M4L A;  2GVA A;  4JC0 A;  2JA7 G;  1NSL A;  1A15 A;  4K14 A;  4CJ1 B;  5KNC A;  1V0C A;  5FO8 B;  1TKJ A;  1B70 B;  4CDE C;  5FJ8 H;  2JA6 G;  2QF7 A;  5GAG C;  1K3R A;  2L55 A;  1FNU A;  2KED A;  4XTC S;  4FD4 A;  3MRU A;  1WI5 A;  4ZKB B;  4UY8 C;  4OO1 H;  3M4P A;  4JI0 Q;  2F0D A;  2XEI A;  5IIF A;  1A3U A;  2DEA A;  5KTA A;  4A3C H;  1CQV A;  3MC0 B;  2YU9 B;  2HDM A;  3J80 L;  1ZKO A;  1BLL E;  1QUQ B;  1LYL A;  1OZP A;  2F0G A;  3H6M A;  1WTW A;  2R7H A;  5CBE E;  4R4C A;  5AG7 A;  4AQY L;  2FIW A;  4CKE A;  2JEA I;  5LMN Q;  2VUM B;  5JM6 A;  1PA6 A;  4A3F H;  2SNM A;  2OZH A;  4OAD A;  2XTI A;  3PUW A;  2B4B A;  1J5E Q;  1Q8K A;  4KY5 A;  3CPW A;  4I49 A;  2FT0 A;  1JWQ A;  3RLF A;  1Y9K A;  4R6T A;  1F2Z A;  3HOW H;  3H8G A;  3OTO Q;  3NBI A;  2J7Z A;  1HR0 Q;  4PSX A;  2VQF L;  1G8Z D;  3FRP B;  2E2J H;  2ZW6 A;  3K7U C;  1O7Z A;  2VZA A;  3QOL A;  2L4N A;  1FYC A;  4UEZ A;  2ZJP A;  3K7A B;  1VQJ A;  4MHY A;  3RZD B;  1XNR L;  3NHH A;  4ZCK A;  1FT7 A;  4RGO S;  4G57 A;  4LW1 A;  3GTP H;  1U6M A;  4JYW A;  4A3B H;  2EDG A;  1XJO A;  4G4K A;  3CQZ B;  4JZ0 A;  5K36 H;  4B9W A;  2E5L Q;  5HVG A;  2HUG A;  4BWG B;  3GY9 A;  3RZO H;  5CC4 A;  5BN4 A;  4A3G H;  2GAN A;  2IL8 A;  1CKO A;  3EBE A;  4MBU A;  1I4P A;  4X64 Q;  3H91 A;  4L89 A;  3H15 A;  1JC7 A;  2XWB B;  3PB6 X;  1I50 H;  4K3N A;  1WTV A;  3I90 A;  4LUO A;  5CV7 A;  4X66 L;  3M9B A;  1KAA A;  5KGU A;  5HXD A;  4DU9 A;  3JC6 6;  1SYB A;  1DTD A;  1S7N A;  2F0H A;  4UA3 A;  3PO3 B;  4GNX A;  2F0P A;  1SFO H;  5C4X G;  4PXC A;  3N5F A;  2O2L D;  3PP9 A;  2DF5 A;  1ZYR C;  3WR7 A;  2VEZ A;  4WRD A;  3MWY W;  3HKZ B;  1NSA A;  5COR A;  1I6H B;  2BO9 A;  3TS0 A;  2R92 G;  4F0Y A;  4OC2 A;  4RMF A;  2BA0 A;  3EC4 A;  2A73 B;  2QJ8 A;  1YX0 A;  2KBN A;  4LF5 L;  2K28 A;  2C6P A;  2OH1 A;  2V8V A;  4HNX B;  2P5Z X;  4P4F A;  4JK1 C;  5A35 A;  5KTC A;  2UUC L;  2Z6K A;  1TWG H;  3HOZ G;  1DJR D;  4MXU A;  3TOA A;  1WK4 A;  1WOC A;  3S6G A;  4A31 A;  1U5K A;  5IB0 A;  3CCS A;  1KUV A;  3BVG A;  1KQS A;  1VQ9 A;  4DXF A;  3G4S A;  4GLX A;  2ZT9 C;  3NXW A;  4R8N A;  3S15 H;  4B6Z A;  3R95 A;  2M00 A;  2NWG A;  4X8I A;  1N36 L;  1S7K A;  1PH3 A;  2MP1 A;  2G5D A;  4XYO A;  2NVX B;  3FHW A;  3SI2 A;  4IPD A;  4NSQ A;  4B3S Q;  1KZF A;  2A5H A;  5BR8 L;  5GRO A;  4KOU A;  3V96 A;  1BAV A;  4UF4 A;  3A55 A;  4OID A;  2RC4 A;  2I79 A;  1TWH H;  3A8I E;  2ZEN A;  4YIJ A;  4CGP A;  3J7Y W;  1VQM A;  1RKN A;  2YV5 A;  1PCA A;  2RHQ B;  1G2T A;  3W6X A;  5CPA A;  1TS5 A;  1SE2 A;  2B2Y A;  1Y7R A;  2ZEH A;  1CA5 A;  4CYN A;  4A93 B;  1B1Z A;  2ZOF A;  5M3F B;  1CJW A;  4BY1 H;  1HQR D;  1AFP A;  4BA2 I;  3A74 A;  1V1P A;  2Q43 A;  1T9H A;  4XQN A;  3J7Z C;  4RUH A;  4MI4 A;  5DS0 A;  5LYI A;  4JCV E;  4DK6 C;  3CRL C;  3SI0 A;  1YW6 A;  2QEX A;  4MIU A;  3KHX A;  4H7B A;  3OOC A;  2XIW A;  2NYZ D;  2JA7 H;  1XIX A;  1YRE A;  1L0C A;  2Z0Z A;  2BUE A;  3NFZ A;  1V8Q A;  2M9V A;  1BCP C;  1MIU A;  2JA6 H;  4JLY A;  1OBR A;  4LQ6 A;  2P6F A;  3AFQ A;  1K83 H;  3GTM H;  5F48 A;  1VQI A;  1GUG A;  2E76 C;  4DAY A;  5IP9 G;  2EQS A;  3J81 E;  1TR5 A;  2K5Q A;  1M4D A;  3S2H H;  1DOM A;  2J0T D;  4NFR A;  1G91 A;  1TY2 A;  1AUG A;  1ELL P;  2GLJ A;  1I3Q B;  2KEE A;  4ZQ3 A;  4XPL A;  4ZX8 A;  1VF7 A;  3HOV G;  3TO6 A;  2K50 A;  5LRK A;  3TC8 A;  2AHO B;  3BI0 A;  1TWF B;  1S7F A;  3PRT A;  4R3L A;  4Y49 C;  1BF4 A;  3KBX A;  4YHH L;  4PPZ A;  1FY7 A;  2PJ0 A;  4DUY Q;  4CAF A;  2SDF A;  1EU4 A;  4JI5 L;  3BDC A;  4YCV A;  3I2Z A;  2D4O A;  4O23 A;  3TTH A;  3NWT A;  4FWU A;  2LSS A;  1QE6 A;  1SE4 A;  3T1Y Q;  1GJX A;  1VMC A;  1EIF A;  4HSP A;  2ZW4 A;  3A0J A;  1A8V A;  1CKN B;  1G2S A;  2QEJ C;  3B3S A;  2BA1 A;  1X55 A;  1Z8W A;  2XN9 C;  1SYG A;  3T1H L;  5AFW A;  4DR4 L;  3VAR A;  2VB2 X;  2OF1 A;  2F52 A;  3R9E A;  1WVL A;  5JEA J;  1RIP A;  4A3D B;  1TKW B;  3QNV A;  5DEH A;  1ML0 D;  2R7D A;  5J22 A;  3D3S A;  3BDL A;  1VQA A;  1XPU A;  1YVC A;  2CTC A;  1CZW A;  1KUY A;  1HA6 A;  2HHH L;  3VR2 A;  1Z9F A;  4PMB A;  4AIM A;  3PO2 B;  2VZY A;  4P74 A;  3NH5 A;  1LT6 D;  2K5V A;  4IQZ A;  4JI0 L;  5FK9 C;  2O5J C;  3NEL A;  4IK2 A;  4KKT A;  4Y49 B;  5LYL A;  3PFO A;  4H44 C;  3BZC A;  4NGM A;  1I4Q A;  4KOS A;  5CV5 A;  4K2K A;  4KOR A;  1SMY C;  2I0Q A;  3DXJ C;  4PZ6 A;  1VQK A;  2Q7S A;  3TP7 A;  3NSW A;  4LUV A;  4U68 A;  1X3Q A;  2HB6 A;  3PBB A;  3SI1 A;  1BPN A;  3KGQ A;  3TQY A;  2UUA Q;  2F0L A;  2K14 A;  5C4X H;  1J5E L;  1BPM A;  2KCT A;  5DAU A;  3VR4 A;  4IHM A;  4PXB A;  1IYU A;  4DPG A;  4HKF A;  3GLJ A;  5LMN W;  2R92 H;  3A54 A;  2A74 C;  2Q0Y A;  4LF9 L;  2QA4 A;  4KSA A;  5EPK A;  2KQ3 A;  4JI2 L;  1PH1 A;  1Z47 A;  3W3A A;  3N7Z A;  4L5R C;  2JA8 G;  1FNV A;  2PIY A;  1RF2 D;  3S24 A;  1F2O A;  2QML A;  1HR0 W;  2YNE A;  1CHP D;  3HOZ H;  1Z4E A;  1HQM C;  1SND A;  4WJB A;  2HDL A;  3GV6 A;  3W6S A;  2Q4Z A;  4GN4 B;  1FNO A;  4A32 A;  2EJM A;  3L3O C;  4MY3 A;  4L8J A;  3NE7 A;  1W6K A;  3DWP A;  1J4J A;  2WKC A;  5F09 A;  2PZU A;  4X65 L;  1IYL A;  2F3V A;  1O80 A;  2E5L L;  4QQB X;  1XX8 A;  3MXN A;  3IAY A;  3H3V H;  1LLR D;  4H02 A;  4TNU A;  4OX9 L;  3KF6 A;  4R4O A;  3VR3 A;  4JYA Q;  3U9S A;  2GN5 A;  1TKH A;  1FNW A;  2UXC Q;  1AN8 A;  3KQX A;  3HFZ B;  2B58 A;  1LM0 A;  1IIC A;  1VQ8 A;  2B4D B;  4LF8 Q;  2R98 A;  4MHD A;  1GD7 A;  1Y9W A;  3ERQ A;  1N32 L;  4JV5 Q;  4F8M A;  1YSJ A;  3R2I A;  2L5T A;  4FF2 A;  1XTC D;  2KCW A;  2VS1 A;  3PF5 A;  1WCM G;  4HJA A;  3S1R H;  3S1N H;  4KUA A;  2OWO A;  4DR2 Q;  2P6E A;  5C4Z A;  5IB9 A;  2N3S A;  1SYE A;  2LY7 A;  3CC4 A;  4JI1 Q;  2QIR A;  1NTG A;  2ZXO A;  1UE7 A;  2PJA A;  4FBE A;  4X62 Q;  4FP5 D;  4LWC A;  3RO0 A;  3CCM A;  1YJ9 A;  2EWB A;  4LF4 L;  5E96 A;  5FOB B;  1Q3L A;  2X6G A;  3FVL A;  1WTO A;  4NF1 A;  4TWE A;  1O78 A;  4A3I G;  2EYP A;  2V8D A;  3P2F A;  5ELY A;  1GHK A;  2Z3M A;  4IUU A;  2J8N A;  4HIM A;  2R7Z B;  2NN6 G;  1L0W A;  4OC0 A;  4IFD J;  2HQY A;  3S9W A;  3SJF A;  2F1M A;  4I65 A;  2QDB A;  1XPO A;  4ONU A;  1F2L A;  2K7V A;  3WC6 A;  3SHP A;  5IP9 H;  1IU8 A;  3HZX A;  1LTS D;  4FF3 A;  2HT1 A;  3GTQ B;  1CM0 A;  2KJX A;  2XEF A;  1TF8 A;  1QWY A;  4NJR A;  4UDU C;  2IJZ A;  1M8A A;  4X3T A;  5EKL A;  1IW7 C;  4JBK A;  1RO5 A;  3B3V A;  3EIV A;  1B9N A;  3HOV H;  2L1B A;  4F88 A;  4E8O A;  3I72 A;  3ND9 A;  1EYD A;  1FGU A;  4GKK Q;  2FL4 A;  1D6E C;  3A56 A;  1MBY A;  3PUZ A;  2FS5 A;  5K8N A;  4RKL A;  5EKK A;  2VI7 A;  2HC9 A;  2ZTD A;  2L11 A;  3KJP A;  1N33 L;  4YGO A;  4M6I A;  1JWU D;  3HEJ A;  5IX3 A;  5K8M A;  4NB3 A;  2FXF A;  2B63 G;  4C2M B;  1PRT F;  1Z2L A;  4GXH A;  4JD6 A;  4RWS C;  2UXB Q;  1YW4 A;  2JA5 B;  1M1K C;  3DEP A;  1NR4 A;  5IOD A;  3S6H A;  4DF7 A;  3AYH B;  2F0I A;  3J81 c;  2ZEO A;  5A2Q L;  4DA2 A;  4F7X A;  2H5M A;  8CPA A;  3HOX B;  4NXM Q;  4NGR A;  1KDB A;  2H1E A;  3SXN A;  1GYT A;  3S17 H;  2PJ3 A;  3HOW B;  4X5K A;  5ISR A;  3IEH A;  4LMQ D;  3K58 A;  3C46 A;  4PSW A;  3AMU A;  3GTK B;  5G20 A;  3R8B A;  4J15 A;  3Q24 A;  2FIN B;  1PVO A;  3F2U A;  1RCV D;  3UY5 A;  5EBV A;  4FUU A;  5ELO A;  3CRK C;  3SEB A;  2FFK B;  1MJA A;  5GAD C;  2EBJ A;  1M90 C;  3KI9 A;  3TBI B;  1L1O B;  1QJO A;  4LUA A;  3GTL H;  3GTP B;  3NA6 A;  1KD1 C;  4HJ8 A;  3J7A 5;  1XEB A;  2Z9H A;  1PFN A;  3ZJ0 A;  4UHV A;  2I00 A;  2I3C A;  4CGO A;  1YLO A;  1IKL A;  1CQF A;  1SR3 A;  2JDD A;  4TQU S;  1SQH A;  2DPT A;  2WKD A;  2G0B A;  3Q0A A;  2IMO A;  4A3G B;  4DV5 Q;  4AQY Q;  3F2B A;  4YRH A;  4OME A;  2B2W A;  1BO0 A;  2K1B A;  5H1S E;  3PGP A;  1KXL A;  3EJI A;  1LTI D;  3T1Y L;  1I50 B;  3B35 A;  5IGD A;  2A1A A;  4NXN Q;  2BE5 D;  1MKH A;  2WFW A;  1NNX A;  3ITP A;  3H0G B;  2VQF Q;  3U4V A;  5E7N A;  4CHT B;  2JA8 H;  5BN3 A;  5KEE A;  5HVF A;  3PEI A;  1IHZ A;  5C3X A;  2AMC B;  3U58 A;  1ET9 A;  3LNN A;  4PZ8 A;  5EPJ A;  4FYD A;  1EY8 A;  3DDD A;  2QW7 A;  2RDH A;  1SYF A;  3E9I A;  4AG7 A;  1YNJ D;  4KJN A;  4PK2 A;  4HCS A;  3T16 A;  3K59 A;  3E0K A;  2Z1C A;  2FXQ A;  1R43 A;  4Y52 H;  3TOB A;  3KLW A;  3X3N A;  1PH8 A;  1PTO D;  1LRZ A;  3GTG B;  2V8H A;  2Z3K A;  3S6K A;  2AFW A;  4B5P A;  4IPG A;  4GS3 A;  4MZ9 A;  4OAE A;  1QSO A;  4M3S A;  2HIX A;  1RTQ A;  3MHB A;  2IY5 B;  2FVG A;  5EC4 A;  4GOP B;  2CF4 A;  3S1Q B;  2R8V A;  3TT2 A;  4GM5 A;  1YGH A;  2IQ6 A;  4X66 Q;  1IBL Q;  1WCM H;  1H9S A;  3JAM L;  1JOQ A;  2WPX A;  2PQE A;  1A6X A;  1PZJ D;  5IYB G;  3KLS A;  1YQE A;  1HCZ A;  4KKS A;  1EIY B;  1S72 A;  2NVT B;  2K32 A;  2AUK A;  1Q2Y A;  5KRU A;  5IYD G;  1TWH B;  4UP8 A;  3KQZ A;  4HR7 B;  3D3R A;  4JPB W;  1SBB B;  2PCU A;  5IV0 A;  4A76 A;  3UDG A;  3C3L A;  1TIQ A;  3FKI G;  3K5L A;  5AG5 A;  5CNP A;  1IB1 E;  3M85 A;  4HIO A;  2PNR C;  4BY7 G;  1S5C D;  1Y8P B;  4A3I H;  4LF5 Q;  4DK0 A;  1ELM P;  1Q82 C;  3S1M H;  4FD6 A;  5LYF A;  1UUP A;  2PI2 A;  2EVB A;  3DM1 A;  2NN6 H;  4BY1 B;  4OC4 A;  3EY5 A;  5M5Y B;  1TWC B;  1WD1 A;  5EAY A;  2X7B A;  3E5S A;  3WC7 A;  4N8X 1;  4R4Q A;  3BI1 A;  5CGK A;  1A63 A;  5D8N A;  4DUK A;  1V1O A;  2PMZ E;  4K0K L;  2JEB I;  5T1I A;  4NGS A;  4ONW A;  1N36 Q;  2ZEE A;  2DPS A;  3I3G A;  4JYA L;  3ISZ A;  5CBA E;  1YJW A;  4DAP A;  2AFO A;  2JA6 B;  2K52 A;  1PFB A;  3NEN A;  5FKA C;  4LF8 L;  2PI2 E;  1Y69 U;  1UWY A;  2HCC A;  2FIA A;  2EK9 A;  3JTK A;  3R93 A;  1AEX A;  4JV5 L;  5IWA L;  1PH4 A;  1TWA B;  4HJ9 A;  2D4P A;  3GP7 A;  4IF5 A;  4X3R A;  1STN A;  2PJ9 A;  2I5M X;  2E2H B;  4GNX C;  1YK3 A;  4XQJ A;  4HNY B;  1O7L A;  3S2H B;  4KI0 A;  3P75 A;  4NP5 A;  3PB7 X;  4KSF A;  4DR2 L;  4K5W A;  4FD5 A;  2B63 H;  5C3E G;  1K28 A;  4A3E G;  2V8G A;  1A3T A;  1CG2 A;  2ZEP A;  3A8K E;  1M1D A;  1LAN A;  2MGS A;  3VR5 A;  4DFA A;  4JI7 Q;  3I55 A;  3JUW A;  3RN5 A;  1M4I A;  3IC1 A;  2XRQ D;  1F9Q A;  4XQQ A;  3Q6S A;  4CKB A;  2Z6K C;  2E75 C;  3L7Z C;  4LFC L;  2AUJ D;  1ILP A;  2MPM A;  3PIP 3;  1SE3 A;  3GIU A;  3CU7 A;  5EQ0 A;  4RH6 A;  1K73 C;  3GTO H;  5CYU A;  1A2U A;  4II9 A;  2ZM6 L;  3CXQ A;  3QJY A;  5G1Z A;  5IGG A;  3KKW A;  2Q2H A;  1Q1E A;  4C68 A;  3QWN A;  2ATR A;  4J1M A;  4DR5 L;  1ZYR D;  3OSO A;  3BVZ A;  2DXQ A;  3M7N A;  1Y1W G;  2ZXR A;  1HFN A;  4BBH A;  2LS0 1;  1JOR A;  1QST A;  4DAM A;  2B2V A;  1EQQ A;  2PJ1 A;  5I0C A;  4YY3 Q;  2OOT A;  2NVY H;  3NBH A;  2Z3O A;  5I6W A;  4MHZ A;  2JQO A;  4QUC A;  4ALP A;  3PUX A;  3J80 i;  4MCQ A;  1WD0 A;  4GKK L;  1XYI A;  1HXY D;  3RN2 A;  2Z10 A;  4N9T A;  2DUD A;  4Q36 A;  2CNT A;  3VWD A;  1HNX Q;  3CXC A;  2JN4 A;  4DNI A;  2ZTC A;  2VXK A;  2WB1 G;  4R87 A;  1SRU A;  5G3L D;  2A6H C;  2CHB D;  5EBC A;  2UXB L;  4ODG A;  4HJ7 A;  1XMO Q;  2C35 B;  4C3H B;  2N49 A;  4OIJ A;  1FVI A;  1U4M A;  2FHT A;  3PCO B;  1STY A;  3TS2 A;  2B3G A;  2KHI A;  2PNH A;  2B5G B;  1JR0 D;  5K5P A;  1NSN S;  1EIH A;  5M5X H;  2QEC A;  3GD7 A;  5C4X B;  3V7Z A;  4A3J G;  2M2L A;  2OZU A;  4YFJ A;  4NXM L;  4EGV A;  1MSG A;  2AWO A;  3T1H Q;  2E2I B;  1IOI A;  4XXE A;  4UIA A;  2RF4 A;  5JH9 A;  2IJ0 A;  3VDY A;  4A33 A;  4KY6 A;  2Q04 A;  1PMR A;  3KF8 B;  3U9O A;  5E3F A;  2ZW5 A;  3NPP A;  1JJC B;  4Q38 A;  1RD9 D;  2PZW A;  2HHH Q;  4LUZ A;  3I4L A;  1I21 A;  4DV7 Q;  1D1I A;  4CRY B;  2DN8 A;  2K5D A;  3NUC A;  5T1G A;  1NBW A;  4KKU A;  3OYY A;  4C1N K;  5I9P A;  2NBF A;  4O42 A;  2JSO A;  2ALY B;  1ZG8 A;  1SRO A;  1PTO B;  1EFW A;  1Q8I A;  5KIX A;  2C1C A;  2MO1 A;  2K05 A;  3HOY B;  3FJU A;  4K6L A;  5M9O A;  1FR3 A;  4QIW E;  4DV5 L;  3IJ3 A;  4AVA A;  2WB1 E;  3R96 A;  4G7H C;  3D4W A;  4XPD B;  2JDC A;  4OLL A;  2G3A A;  5IYB H;  1NMF A;  2NZO A;  2YGW A;  2POK A;  4NXN L;  3G6E A;  5IYD H;  4A3K G;  1TKF A;  2EJG C;  3IWW A;  4LF9 Q;  4HTH A;  1QVF A;  5AJ3 Q;  3FKI H;  4JI2 Q;  3S1R B;  3HLP A;  3DSB A;  3K5O A;  3E6Z X;  4BY7 H;  2EXD A;  4ZK9 B;  4CAV A;  3DGV A;  3H94 A;  5IGF A;  2AWN A;  4LAA A;  5CV8 A;  5TSS A;  4LNQ A;  2NVQ B;  2NSM A;  1EWC A;  5FO7 B;  2AJ6 A;  5ELD A;  2K5N A;  5G3L F;  1DON A;  1RTN A;  4HID A;  1DZ1 A;  4ZUI A;  4RA8 A;  4Z9C B;  2EY2 A;  4CDC C;  1I4R A;  1Z6H A;  4JG2 A;  1QZG A;  2PIZ A;  4X65 Q;  2GRE A;  3VYU A;  3WT4 A;  1VQC A;  1EY9 A;  5H86 A;  2K01 A;  4J3G A;  5C4J B;  4KOY A;  2RHS B;  4R3K A;  4OX9 Q;  2PQA B;  1LTB D;  5ELB A;  1NJI C;  2NN6 I;  2DY7 A;  1RJT A;  4JI6 Q;  4R4T A;  1JQG A;  1XXG A;  2RSO A;  4L6T B;  4B9X A;  4DK1 A;  3Q22 A;  1VQ5 A;  1HDU A;  2SEB D;  1YNN C;  1N32 Q;  1GHE A;  4OL7 A;  3L9A X;  1IBL L;  5GAH C;  1C8C A;  4HMI A;  2XVS A;  1D7Q A;  4H2K A;  1QIL A;  4MTN A;  1LTT D;  3D31 A;  5C3E H;  4A3E H;  3CKI B;  4DNT B;  1E7Z A;  1WTX A;  3WC5 A;  5C3W A;  3C26 A;  4DR7 L;  1HTL D;  4C3I B;  4P44 A;  1K8A C;  4U5Y A;  2B3U A;  3SJX A;  2PC1 A;  2SNS A;  3QO2 A;  5EBD A;  4LF4 Q;  1QNU A;  4CJ2 C;  3FX6 A;  1PUA A;  4DV3 L;  3JRU A;  2DJF C;  4P2C B;  1LTL A;  4A4I A;  3FB3 A;  1KWM A;  2AFU A;  2PSW A;  4H89 A;  2I46 A;  4WWV A;  1AP0 A;  1VS0 A;  4KV6 A;  4UCP A;  2JYO A;  4BBS B;  5IOC A;  1E2V A;  4B3R Q;  1L0X B;  5D3D A;  3LOD A;  1R9T H;  3G48 A;  4FXG C;  4F87 A;  3TX8 A;  1H8L A;  1Q2D A;  3UE0 A;  3PB4 X;  1BDO A;  1XNQ Q;  3K5N A;  1QSN A;  4PMC A;  1Y1W H;  2WP8 J;  5FLX c;  1E2Z A;  3S17 B;  1F9R A;  5CR3 A;  4CAX A;  1TVX A;  2H4O A;  4K5V A;  4FNF A;  4R57 A;  1Q90 A;  4Y7N B;  4UCM A;  3BJU A;  3P20 A;  4UP7 A;  4GLV B;  2A8V A;  3QR8 A;  1KNA A;  1HRJ A;  3S14 H;  1ZO0 A;  1NCV A;  3D2M A;  5J1Z A;  5I6Y A;  2ZXV A;  2Q7B A;  1N33 Q;  2CTB A;  4RKB A;  3CT9 A;  4CYP A;  4JW0 A;  2GVB A;  3GTL B;  2WAC A;  1GUN A;  4NGP A;  1S5K A;  3I3C A;  5CBM A;  2XSC A;  2J4X A;  4JI7 L;  3S16 H;  1JT8 A;  3UDF A;  1Y7E A;  2K5T A;  1FL0 A;  1V43 A;  2PO4 A;  4N8F A;  1VHO A;  1VKC A;  4NEX A;  4F0X A;  1EQT A;  1HZA A;  4A3J H;  3VH9 A;  4ME5 A;  3D7F A;  4CDF C;  5IT9 E;  4G7O C;  4EVY A;  1PXU A;  2BDO A;  4FF1 A;  2JEW A;  3MXN B;  1XMB A;  4CYO A;  1CTM A;  2RKS A;  1STB A;  5JEA G;  3GTJ H;  2RFH A;  5FLM G;  4MFL A;  3TO7 A;  1QUQ A;  2Z11 A;  1VDZ A;  1GVP A;  4N9P A;  1HUM A;  3IIB A;  2UUB Q;  5COY A;  3KYH C;  4M6H A;  2ZJQ A;  4OWW B;  3KL9 A;  5DM6 3;  3CMA A;  2ANP A;  2AFX A;  2YYZ A;  1WTH A;  4YY3 L;  2D9U A;  5DLQ E;  4GN3 B;  3TN2 A;  3TE4 A;  1GUW A;  4IUP A;  2ATW A;  1G51 A;  3O13 A;  1XF8 A;  3M3Y H;  4B11 A;  2PR8 A;  3STB D;  1BBU A;  1ONL A;  3MEH A;  4OEL B;  5FO9 B;  1HNX L;  3FEC A;  3F8K A;  2FSR A;  2DNE A;  4M8A A;  1OTC A;  1UAP A;  1ZLI A;  4H0L C;  2A19 A;  1YJN A;  1XMO L;  2JBJ A;  3IGR A;  3D7H A;  3AEV A;  1DOL A;  5HGQ A;  3QAY A;  2A69 D;  2G9H D;  4DN4 M;  1PHJ A;  3PO3 G;  4A3K H;  4UBR A;  1B44 D;  1RL2 A;  3M4O H;  2DNC A;  3PF4 A;  1IOF A;  4UWI A;  2CWP A;  4KD3 A;  3M7G A;  3BZK A;  4A3L G;  1I12 A;  3CF5 A;  3HKZ G;  4UEF A;  1K3B C;  1BCP B;  4DJL A;  2KEN A;  1IW7 D;  2ICI A;  1P16 A;  1YME A;  1I1D A;  3FIX A;  3TRE A;  4FVM A;  1YHQ A;  4X3U A;  1CT1 D;  1LUZ A;  1PH6 A;  1IGB A;  3RLO A;  3OHX C;  3BYT B;  2PW7 A;  4Q0F A;  3CC2 A;  1B53 A;  1VCI A;  4A3I B;  5FVJ A;  3JVN A;  1YZ6 A;  4DAV A;  4RHR A;  1ENC A;  2RA4 A;  4DV7 L;  4L5Q A;  3IFE A;  1AH9 A;  5E4W C;  4QB9 A;  2F4V Q;  2RQX A;  4HPS A;  3QG1 A;  2ZEM A;  2KCN A;  4P4I A;  4OXP A;  2KHS A;  4BBR B;  2O4X A;  5EKI A;  2PJ5 A;  4O0A A;  4XT3 B;  5I4D A;  3Q23 A;  4DV0 Q;  4R9W A;  3OWC A;  4CAW A;  2B2W C;  2MFI A;  4P75 A;  3P7J A;  3SR1 A;  3CXS A;  4JOI A;  2CW0 D;  3MXU A;  1BXT A;  4OHJ A;  2F5I A;  2PJ8 A;  3FEE A;  1BKB A;  1S7L A;  3DEO A;  1GM5 A;  3KLS X;  2F7V A;  3MXG A;  3NQT A;  5JGF A;  4A93 G;  5AJ3 L;  4A39 A;  3OPO A;  1TS3 A;  3HKZ E;  2PW5 A;  3SK6 A;  1R4P B;  2ZED A;  4AXV A;  5M3F G;  2KCM A;  1PLF A;  1X3P A;  2B63 B;  1BUV T;  3HGB A;  3M4Y A;  5KYI A;  3DHQ A;  3F1Z A;  1YBY A;  5ELF A;  2CNS A;  3OWF A;  5C0X G;  4P4E A;  1MSH A;  5JJK A;  3CPX A;  1P0H A;  4PXE A;  3V8I A;  1XOV A;  2CH4 W;  3NTH A;  4MCS A;  4NKL A;  2P0W A;  1CHQ D;  1B9M A;  3CCQ A;  2WIN B;  3E9H A;  5M5W H;  2ZEF A;  3BXM A;  1VF5 C;  2KA7 A;  2O28 A;  4UFW A;  3EQL C;  5HGT A;  4K0K Q;  3IFD A;  3SXH A;  1XTD A;  1MHW C;  4IUR A;  1DM0 B;  4ZAI A;  3OW2 A;  3SJG A;  1EYA A;  4PK3 A;  2PE3 A;  2RVL A;  2IHF A;  4LF7 L;  4JI6 L;  3MGD A;  3TEH B;  3DLL A;  1JJ2 A;  4XPK A;  3K9U A;  3FDT A;  3T4A C;  1A2T A;  1MJC A;  2K5H A;  1TY0 A;  5IWA Q;  4KY7 A;  3G7L A;  1EFI D;  5EJW A;  1P4N A;  1EY7 A;  2CKZ B;  4F6A A;  1OXX K;  2YU9 H;  4C1N I;  5KND A;  4B3T Q;  2JJQ A;  4AYB B;  1LTG D;  5DWM A;  4HED A;  4OIK A;  3OMG A;  3T9Y A;  5L37 A;  1A3V A;  3NWS A;  1DE4 C;  3TME A;  3OMC A;  3N52 A;  4OEM B;  3J80 E;  5IGB A;  4DNC A;  3QOJ A;  1GUS A;  2CWA A;  2B8F A;  4G7Z C;  4APV A;  4LFC Q;  2NTT A;  1HJP A;  2GA4 B;  4B5P B;  3K8A A;  4CRZ B;  3IL8 A;  3I4N B;  5F49 A;  4B3R L;  5JEA H;  1HH2 P;  4ULL A;  5FLM H;  3K7A H;  2Y0M A;  3K6O A;  4OGQ C;  2F0J A;  2ZM6 Q;  1ILQ A;  3RZD H;  5JOB A;  4A3D G;  3HUV A;  1M4V A;  1XNQ L;  2JXM B;  4DR5 Q;  1A2Z A;  4U9Y A;  2L0C A;  4A3M G;  1EEI D;  4P73 A;  4GKJ L;  4KHP L;  5JJL A;  3MAQ A;  1H9S B;  4ZI6 A;  4WFN 3;  5THW A;  1UEB A;  1YR0 A;  2HQE A;  4IOC A;  1C4Q A;  5KNB A;  3FEW X;  3PO2 G;  2JA9 A;  3PGZ A;  1Z8T A;  2F0W A;  3R9F A;  5ELN A;  5IT9 c;  2Z3N A;  1CKN A;  2LXK A;  2PJC A;  1JE5 A;  1O7Y A;  2RDG A;  4QUS A;  1X3E A;  4UCN A;  1E1O A;  2R6G A;  1TQO A;  1R57 A;  4JI4 Q;  2HIV A;  2F0E A;  3QIA A;  3NH4 A;  4IN3 A;  2O4H A;  3PO3 H;  4LX9 A;  1EZ8 A;  1Z8L A;  4L8A A;  3QAH A;  2OCE A;  3M4Q A;  4A3L H;  3G3S A;  2B2T A;  4A3F B;  3FF3 A;  2VXW A;  1D1K A;  3S2D H;  3T51 B;  1ZXT A;  2EYL A;  2PJ7 A;  5K8O A;  4O1N A;  1BO4 A;  1SSO A;  2IT1 A;  3MFY A;  3DR6 A;  4NGN A;  4PV6 A;  3SJE A;  2DJG C;  3D67 A;  5KTD A;  2EIF A;  2E2J B;  3P2H A;  1HZ9 A;  1Y1V G;  1CKM A;  2K5W A;  2Y0S B;  4R8F A;  2UUB L;  2VNU D;  2YNC A;  3OIQ A;  2K75 A;  2F0T A;  4I7Z C;  2B2V C;  3MEF A;  5D14 A;  3LAC A;  1ASZ A;  1J8I A;  4DK3 C;  2WAQ B;  3U4Z A;  1Y14 B;  4XIG S;  4GZY C;  4NGQ A;  2NVX H;  4RCN A;  4A3B B;  1EWH A;  2ES2 A;  2GE3 A;  1ZEQ X;  3G71 A;  2ABZ A;  1OXT A;  3HG9 A;  1AMP A;  3VA7 A;  3BS1 A;  3RZO B;  2KCC A;  3JAM i;  3WAB A;  3I4O A;  4KS9 A;  3B8G A;  1XRY A;  1C9O A;  2Q51 A;  2PYK A;  3H8F A;  4CAE A;  2YTX A;  3NTK A;  2YTY A;  5G22 A;  2DY8 A;  4CGY B;  5JPN C;  2F0V A;  4ZYS A;  4MCP A;  4A93 H;  2RBM A;  4P10 A;  4P4D A;  2CCZ A;  5CV6 A;  3KZW A;  3I8Z A;  2C6G A;  5M3F H;  2PJ4 A;  2B8G A;  1SFO B;  3S9M A;  5C3E B;  4C3J G;  2Q8R E;  3UI2 A;  1EEF D;  4OWT B;  2HUZ A;  3D7D A;  3D4D A;  5C0X H;  4EQO A;  1DCZ A;  1PH2 A;  4UPA A;  2IX0 A;  2LFN A;  5D65 A;  5IP7 G;  2E2D C;  1I6V C;  4IPC A;  1PRT C;  2BOS A;  2R7Z G;  1F57 A;  4MCR A;  1E22 A;  4KLV A;  5ISV A;  1FD7 D;  1Q1B A;  2F0Q A;  2V4D A;  4MFJ A;  1TWG B;  3RAM A;  4NDX A;  2V1C C;  2X69 A;  3PSI A;  2F4V L;  4AVB A;  3K5M A;  1JQY D;  2VW9 A;  2VQY A;  3LMS A;  3N6R A;  4RN7 A;  5HVH A;  3KDF B;  5J1Q A;  3H4Q A;  1BR9 A;  4ILW A;  3PB8 X;  3S15 B;  4DV6 Q;  4JI8 L;  3KLR A;  2HCI A;  2VZZ A;  4OC5 A;  2OTJ A;  4DV0 L;  1I3Q H;  2ENB A;  4IUV A;  5GAE C;  1YHB A;  4Q5V A;  2AQ2 B;  5GCN A;  4RGT A;  1SNC A;  2ICE C;  3UE1 A;  4XNH C;  4P71 A;  4NPS A;  5I4M A;  4YWY A;  3T56 B;  4PXD A;  1EOT A;  2F0K A;  5C82 A;  3CP0 A;  1TF9 A;  4DR7 Q;  3ZZI A;  1H9K A;  1J9O A;  2OEO A;  2EOT A;  4V0B A;  1Q2C A;  4B3M Q;  1GKH A;  2G9D A;  5CV9 A;  4HN7 A;  1U9R A;  4TSS A;  4BMH A;  1STH A;  2JA5 G;  3D8G A;  4GN5 A;  3KR4 A;  4A30 A;  2BDN A;  2Z3L A;  4LFB L;  1OXS C;  1GUO A;  2D2C C;  1HEE A;  4DV3 Q;  4ZYQ A;  3I4M G;  1Z7T A;  1SMX A;  4KLK A;  4EQN A;  1Z4R A;  1U4R A;  4AVC A;  4LFA Q;  2PPB C;  4A38 A;  1MGS A;  5EGT A;  1QCB D;  4IAL A;  3S16 B;  2Q4V A;  4B14 A;  3A7A B;  1K9M C;  1JB7 A;  1EY0 A;  5AGE A;  4IO9 A;  2J9A A;  3HOX G;  5G21 A;  4KTA A;  4KOT A;  1K8O A;  4A3D H;  3VYS A;  4A3M H;  4J6H A;  1EIG A;  1R4Q B;  2JA7 B;  5D29 A;  1PYT B;  1STA A;  2Q2T A;  3G6J B;  3J81 L;  3J80 c;  2O5I C;  5LRG A;  3PO2 H;  3T13 A;  2JLM A;  1K83 B;  3GTM B;  4BS9 A;  1H95 A;  1I5F A;  2SOB A;  3SK8 A;  3KJO A;  2C6C A;  3F5B A;  1YIT A;  2D62 A;  2MHV A;  1Q81 C;  3IU2 A;  4ZBG A;  4B3T L;  5F47 A;  4A37 A;  1MI2 A;  2R93 G;  2ARH A;  3A7L A;  4CDD C;  1PTO F;  2K04 A;  1MK4 A;  3BLN A;  1VGY A;  2EY6 A;  3CAM A;  3DWQ A;  4L63 B;  3TCV A;  3BYY B;  1SYC A;  4DUZ Q;  3G8W A;  3GUX A;  2IW3 A;  3AQQ A;  5C44 G;  3D4U A;  1VQL A;  2Z6B A;  2ZW7 A;  5JVH 3;  2RCF A;  3MXP A;  3H8E A;  3T8W A;  5DWN A;  1JIC A;  2ZTE A;  3H0G G;  1IKM A;  1LOK A;  4R9M A;  3TSS A;  3ULP A;  2K03 A;  1L1O A;  1C48 A;  4ID6 A;  3WOE A;  4A3K B;  2OQ0 A;  2L15 A;  5LMU Q;  2UXD L;  1XBU A;  4QF4 A;  3BG3 A;  1SAP A;  4QC6 A;  1CM9 A;  1K8M A;  1VQP A;  2ZEL A;  4IUT A;  1Y1V H;  1EYG A;  5CMD A;  1L2F A;  5M3M G;  3SK5 A;  1CSP A;  4E2A A;  2OU2 A;  2Y0S E;  5C5L A;  1Q46 A;  1VQO A;  3LX0 A;  1E2W A;  4ABN A;  4GNX B;  4HSV A;  2Q2U A;  4DR6 L;  1D2B A;  1OXV A;  4J8Q A;  4B12 A;  3D68 A;  3KR5 A;  3ICE A;  5E4X A;  3SE0 A;  4S3S A;  5GQO A;  2AQ3 B;  2N55 A;  4PV1 C;  4JI4 L;  4K2L A;  3FNC A;  2BE5 C;  2GU2 A;  3PMF A;  4JJX A;  1JCK B;  1OXU A;  1HUN A;  3SDZ A;  2PJB A;  4IPH A;  1QOH A;  1CPX A;  2IHE A;  3B3W A;  3CCR A;  1TII D;  3OW7 A;  3FBU A;  1PH5 A;  3CCU A;  3FPP A;  1SJH D;  1CBX A;  4DV2 Q;  2EYM A;  1D8L A;  4C3J H;  1YNJ C;  2WZN A;  3BJ8 A;  5NUC A;  3EXN A;  4JWP A;  3ULL A;  1UE5 A;  2BL1 A;  2EXZ A;  2JEV A;  2PJ2 A;  4PZ7 A;  5IGE A;  2R92 B;  2F0O A;  5IP7 H;  1UE6 A;  4QL5 A;  1AE3 A;  3DLJ A;  2R7Z H;  2IX1 A;  4AG9 A;  4FD7 A;  3PQI A;  3EFA A;  4CGL A;  3HOZ B;  3K81 C;  5IYC G;  4JI3 Q;  4ZX9 A;  3V2T A;  1JJG A;  1H9M A;  3GB0 A;  3NEM A;  1X10 A;  1N9W A;  2E8G A;  5C0X I;  3GTQ H;  4KSI A;  3CCE A;  4WJ3 M;  2NMT A;  3X3M A;  4F9U A;  1W2B A;  4A75 A;  3UDI A;  5M5W B;  1KL9 A;  3BDO A;  3ONA B;  1NE9 A;  2HQL A;  2N8N A;  1PFM A;  2NUC A;  4YWM A;  4TKO B;  1V1P B;  2IWH A;  4IFD I;  2G3T A;  1X6O A;  4EFD A;  5DM7 3;  5HMN A;  5JAV A;  1PYB A;  2ZEG A;  1D5X C;  2C9O A;  4HMJ A;  5J8C A;  3I70 A;  2K6A A;  3TZU A;  1BCP D;  5E1F A;  1IYV A;  4H6Z A;  1RHP A;  3CDX A;  4KMU C;  1ASY A;  3D66 A;  1TU2 B;  2AKW B;  1SNQ A;  3L0O A;  3NQI A;  5CV4 A;  3VA5 A;  2MJ8 A;  4C2M H;  4O2D A;  4CGM A;  3MTS A;  1HFG A;  4XYQ A;  2JA5 H;  1B87 A;  5JJZ A;  1R3N A;  2D5D A;  3S1N B;  2KEC A;  5C88 A;  1HZC A;  3I4M H;  1L0Y B;  4DAY B;  4JBW A;  3LGJ A;  3PIP A;  3SXO A;  1W3S A;  1I94 L;  2Q8I B;  1SN8 A;  3W5O A;  4WJ4 A;  2PR1 A;  3MZ5 A;  2PJ6 A;  1EE3 P;  4NMZ A;  3HOX H;  4GS4 A;  4KVX A;  4A2Z A;  3PV0 A;  4JXQ A;  3PZJ A;  3W1G A;  4MHE A;  5A2Q E;  3RYO A;  1YI2 A;  3HOU G;  5IY0 A;  2LKV A;  4C56 C;  3FYN A;  4E0A A;  2F0N A;  1MJ9 A;  1LAM A;  3TP5 A;  1EUJ A;  2B2U A;  1PV4 A;  1QG7 A;  3GTK H;  1U4L A;  1B4O A;  1U4P A;  1J6Q A;  4LF7 Q;  4JBM A;  1DXM A;  3MN8 A;  1ENA A;  4L5S A;  3B2Y A;  4DV6 L;  1N71 A;  3DWA A;  1AW7 A;  3PFE A;  3FED A;  1EY4 A;  3S9N A;  3I1U A;  2HV2 A;  4UIB A;  5J8F A;  3I7F A;  5HUR A;  2QKI C;  4F8Z A;  3LWU A;  1S3Z A;  3CPA A;  4JOI C;  1PFS A;  1UE1 A;  1PZK D;  2D0O A;  2R93 H;  4MHN A;  2R61 A;  4EWT A;  4PQX A;  1QB5 D;  5A27 A;  4DNR B;  3HOV B;  5JQ4 A;  4HAE A;  2EYF A;  4B3M L;  4K8J A;  4YCU A;  4OP4 A;  5LL6 S;  1LAB A;  1PZI D;  3KK7 A;  5C44 H;  1LO5 D;  5A28 A;  3A9L A;  4C3H G;  1X65 A;  1LAC A;  3CD6 A;  1HNZ Q;  1WYD A;  3FP9 A;  2KUM A;  4LFA L;  3H0G H;  3KOJ A;  3FPU B;  4EVO A;  2X6L A;  1KAB A;  1IL2 A;  4B10 A;  4MNO A;  4FDB A;  1SMY D;  2MUY A;  2PZT A;  3D6W A;  1BCP F;  3C1F A;  4CBV A;  3W2D A;  1CX8 A;  3ERO A;  3AB9 A;  5KYL A;  3S2D B;  4ZUJ A;  5M3M H;  5ELC A;  2JBK A;  4GKJ Q;  1AE2 A;  4KHP Q;  3L2N A;  1XE4 A;  5AG6 A;  4KD4 A;  1XMT A;  2CVR A;  4IJH A;  1VQN A;  1YIJ A;  4LF6 Q;  1ARL A;  3GTG H;  3PUY A;  4R7M A;  4JBJ A;  4UEE A;  1CZG A;  4PG3 A;  4CYQ A;  1K0S A;  4X2T A;  2B5G A;  4ORF A;  3A5Z B;  1EQR A;  4OON A;  4CKC A;  1BVS A;  3ERS X;  2RCN A;  1X3G A;  2A6E C;  2B29 A;  3S1Q H;  2FCK A;  2EO8 A;  3HOY G;  3S9L A;  2KHJ A;  3K9T A;  3W91 A;  1B3Q A;  4QJF A;  1JWS D;  2A68 C;  1B2T A;  2KOL A;  4DUZ L;  2VUM G;  3RBU A;  2AQ1 B;  3KF8 A;  2XEJ A;  1BQQ T;  1KLG D;  1KC8 C;  4MN3 A;  4TRD A;  1HTP A;  2RDF A;  2NVT H;  4B5O A;  1YVK A;  3JAM E;  1KTK A;  2F3I A;  1PYW D;  1M4G A;  5ELE A;  3TDQ A;  4H6U A;  4ME3 A;  1SNO A;  1FJG L;  5LMU L;  1VQG A;  1E0B A;  1LT3 D;  3SGI A;  2CQA A;  3KF6 B;  2XRS D;  3R1K A;  4DYO A;  4DGZ A;  4MFZ A;  4QMG A;  2J8M A;  1VQE A;  3IRB A;  1BOS A;  4R76 A;  5K8P A;  3OIP A;  2JA8 B;  2Q44 A;  2Q4Y A;  4QB4 A;  3NTI A;  5M5Y H;  1TWC H;  2FMC A;  3K0Y A;  3NK9 A;  1F77 A;  4K30 A;  3LD2 A;  1CSQ A;  2IX3 A;  1BBW A;  5IYC H;  1I4H A;  1K8G A;  1SXT A;  4V19 0;  2WUU A;  4UFV A;  5HH1 A;  4ZGY B;  1MJE A;  1Z8X A;  4UAI A;  3PIO 3;  1A62 A;  1ON0 A;  1QQ9 A;  2CY2 A;  1NUC A;  5DNF A;  1KNE A;  3T90 A;  3FXT A;  4X3K A;  4X3S A;  3EN2 A;  3D6C A;  1EZ6 A;  4KOX A;  1XMQ Q;  1T5X D;  2B3V A;  3KUP A;  4L5T A;  4YCW A;  4PNY A;  3CCJ A;  3FMC A;  4E6I A;  5AG4 A;  1TWA H;  1UNS A;  3RUZ A;  4NCZ A;  4RHS A;  2EVN A;  3VR6 A;  1A0I A;  2EPB A;  4M1U B;  2E2H H;  1Y0Y A;  1PYS B;  3IO1 A;  1LTR D;  2Z4I A;  4AH6 A;  1KLU D;  4DV4 L;  3S6F A;  3QB3 A;  1G29 1;  2B2T C;  1WCM B;  2REF A;  2JE6 I;  5EMI A;  4DV2 L;  1STE A;  4C3I G;  1N8R C;  4P4J A;  3DUZ A;  4KHZ A;  1LV9 A;  3CME A;  2P6G A;  1JE4 A;  2PQA A;  4OO1 I;  2VQE L;  2YTV A;  2PDO A;  2XNA C;  1G6Z A;  1VQ6 A;  2EZV A;  4DR3 L;  2J8R A;  2E74 C;  2MQH A;  2ZXP A;  1Z9U A;  3MFG A;  2UU9 L;  2C5C A;  2C27 A;  2YNC C;  2Q2I A;  3HOU H;  1XWE A;  1XJV A;  5J39 A;  3S1M B;  4NJQ A;  4BBS G;  1QVG A;  4JI3 L;  4IOA A;  3WOF A;  1B7Y B;  2JP1 A;  2YND A;  1XFO A;  2F0F A;  2R7F A;  2XGT A;  2VY3 A;  1HDQ A;  2I5L X;  4U9Z A;  5EPL A;  5C6A A;  2QIL A;  4YWL A;  1ENF A;  1ESR A;  4JI8 Q;  4A3M B;  4KZT A;  5I2Y A;  4KK7 A;  5LRJ A;  4HIK A;  3CC7 A;  5F2D A;  3J7A V;  1DD2 A;  2CNM A;  1CUK A;  3GQB A;  4EQ5 A;  4RGN A;  3D8P A;  2O53 A;  1SNP A;  2BSW A;  1B50 A;  3BZD B;  2FMM A;  3TO9 A;  3E3X A;  4KHV A;  5FLX L;  1VHE A;  4C3H H;  3K80 C;  1ICW A;  3CPF A;  1FGB D;  4DXG A;  4DKA C;  2ASB A;  4DV1 Q;  3C1E A;  4LFB Q;  4JXR A;  4ZY0 A;  1F2Y A;  1II3 A;  4X6A H;  5H84 A;  1KDA A;  3SK4 A;  5LMN L;  4BD9 A;  4QBJ A;  1MJB A;  4WOR A;  1SEB D;  5C4H A;  2PRQ A;  4NGT A;  2E2I H;  1KIX A;  4IFD G;  3OTO L;  1HR0 L;  4ZY2 A;  1F9S A;  2N88 A;  2OTL A;  1ESF A;  1RDP D;  4R1J A;  2HD3 A;  1EOV A;  1VQF A;  4ZKC B;  4QUF A;  2NZH A;  3K2K A;  1IYK A;  3I56 A;  3W1B A;  2VB3 X;  3PIO A;  3GTO B;  1P8L A;  3RLN A;  4KOV A;  1WFQ A;  7CPA A;  1LT4 D;  3RMH A;  1PH7 A;  1Y1V B;  3H09 A;  1IID A;  4RFB A;  4IJL A;  5I9O A;  1H9J A;  2GLF A;  4CS0 B;  1HA5 A;  4R8I A;  1PTO H;  3E0J A;  1X32 A;  4H13 C;  3Q8D A;  3HOY H;  2WV6 D;  4FF4 A;  1PRT D;  2NVY B;  2QDL A;  4HJ5 A;  2LXJ A;  2CXA A;  5J3B A;  2GIV A;  1CA6 A;  1IBM Q;  1AYE A;  3IU1 A;  5BN5 A;  1TXY A;  2QGQ A;  1JB3 A;  2VUM H;  4GLA C;  4BA1 I;  5JJI A;  2OB0 A;  4X64 L;  4C2Z A;  1U0L A;  4QCL A;  1EWI A;  4CJ0 B;  4MFQ A;  4P4B A;  1NY4 A;  1LAP A;  4BXX G;  2Q8T A;  4DR1 Q; 
#chains in the Genus database with same CATH homology
 3KAS A;  3C2P A;  4Q7A A;  4A94 A;  2NYQ A;  5JPM C;  2RSN A;  4FO2 A;  2OXP A;  3A8J E;  1KDC A;  3MVV A;  3DMU A;  5M5X B;  2VL1 A;  2EYO A;  2EY1 A;  1S5E D;  4C3J B;  1F2P A;  1ZG7 A;  4IUQ A;  1EL0 A;  3ISX A;  2NZ1 D;  5C0X J;  5LL6 X;  3HS0 C;  1JOO A;  4K5X A;  4XDX A;  3B7I A;  3D4R A;  2PMZ B;  1EY5 A;  1NR2 A;  3TP6 A;  2A69 C;  1CI3 M;  4K8I A;  2PVW A;  3FVQ A;  3K57 A;  3HP3 A;  4HCE A;  1CPS A;  5LHY 1;  3TZD A;  4ZRZ A;  1VIX A;  2BOA A;  3OWE B;  2KVM A;  4OIW A;  1SDF A;  2F03 A;  1WTP A;  1LFW A;  4CPA A;  3B3T A;  1CK1 A;  3FKI B;  3FH4 A;  1UEA B;  3KBG A;  4BY7 B;  1HHV A;  2L12 A;  3I4M B;  2F4I A;  4MHP A;  3SHL A;  4IAV A;  2TSS A;  2K33 A;  2IPK D;  2CW0 C;  1S5D D;  4PMW A;  3I73 A;  1AZP A;  2V77 A;  1F9P A;  2OR4 A;  2OT2 A;  4OC1 A;  1F2M A;  3B3C A;  4FAI A;  1VMP A;  4WJW A;  1LT5 D;  2NB0 A;  2BCO A;  5JVG 3;  1STG A;  6CPA A;  2QCP X;  2AFZ A;  3V05 A;  2EE1 A;  2R93 B;  4IZ8 A;  4A3E B;  1H9R A;  4LJZ C;  2L9H A;  5C44 B;  1MD2 D;  2EYJ A;  4IFD H;  4EQP A;  3R3O A;  1JOK A;  2A6H D;  3RD4 A;  2F3W A;  2ID0 A;  1AZQ A;  3RZA A;  4LK1 C;  2QYV A;  4P45 A;  3EVQ A;  3IFT A;  4RGM A;  3I91 A;  3BHX A;  3EA6 A;  1R9T B;  4YU9 A;  4KJO A;  4F9V A;  1EU3 A;  2PVV A;  4OKO A;  5M3M B;  4U67 3;  2QVP A;  1Y1W B;  3ND8 A;  3URY A;  4RCO A;  3V38 A;  2AFS A;  1CFM A;  1ZG9 A;  3MA2 B;  4OO1 G;  2F0U A;  2ZOG A;  3T53 B;  5LYD A;  1RTO A;  3R2T A;  5D3I B;  3S14 B;  2FJ2 A;  2XEG A;  4QIW B;  2TMP A;  2WB1 B;  2EJF C;  1DOK A;  3VYR A;  1PRT B;  4LQG A;  4RAU C;  4B08 A;  1EYC A;  1CP7 A;  1B3A A;  5IT9 L;  1ZLH A;  1ROD A;  1GUT A;  3NE5 B;  1T5E A;  2PCF B;  1BBX C;  3PB9 X;  4MRI A;  1D5Z C;  3IKJ A;  4Z65 A;  4A3J B;  2B2U C;  4ZY1 A;  2RB7 A;  1I4G A;  1OO9 B;  2F0S A;  2XWJ B;  1Q12 A;  1IL8 A;  3EFX D;  3SVM A;  3BVM A;  2LMC B;  1GHJ A;  4IUN A;  3GTJ B;  1Y0R A;  1ARM A;  3AU7 A;  2WII B;  1LTA D;  1S4Z A;  4FXK C;  4NW2 A;  1EQV A;  3LWE A;  5K36 G;  1QMU A;  3M3Y B;  1GOZ A;  2EK8 A;  1SJE D;  3CHB D;  1W6J A;  4PQA A;  1ET6 A;  1IY7 A;  3NP8 A;  2B39 A;  1YNN D;  3M4O B;  4MMO A;  1S5B D;  1I4X A;  5FLX E;  1WTQ A;  4KN7 C;  3VYT A;  2EYH A;  2AFM A;  3J7A F;  2EY5 A;  3VAT A;  5IGC A;  3GV3 A;  1SNM A;  4ZLT F;  1TS2 A;  2R3Z A;  3HOU B;  1BNZ A;  4KN4 C;  3ZYY X;  1TS4 A;  5C5M A;  2WYR A;  1S5F D;  4FXD A;  1HPC A;  2Z4H A;  1GXD C;  4EME A;  5I2X A;  1TXR A;  2F0M A;  2CIJ A;  2F8H A;  1DYQ A;  1WTR A;  1NAP A;  1Y8N B;  4K6D A;  4XT1 B;  2Z8L A;  1EY6 A;  2B2Y C;  1Q7L A;  3PBE A;  3WDN A;  3KHZ A;  2NTS A;  1D5M C;  1PTO C;  3GO5 A;  1LCP A;  3HRZ C;  4G1P A;  1SYD A;  3NH8 A;  3H3V C;  2A6E D;  3P1H A;  3PUV A;  4W9Y A;  1Y8O B;  3TP8 A;  1TT2 A;  1QNK A;  2A68 D;  4OC3 A;  4P6Y A;  1JWM D;  3D7G A;  1PDQ A;  2I07 B;  1CP6 A;  1Z5R A;  1M4L A;  1A15 A;  4K14 A;  4CJ1 B;  5KNC A;  5FO8 B;  1TKJ A;  2QF7 A;  2L55 A;  1FNU A;  2KED A;  4XTC S;  3MRU A;  4ZKB B;  4OO1 H;  2F0D A;  2XEI A;  5IIF A;  1A3U A;  2DEA A;  1CQV A;  3MC0 B;  2YU9 B;  2HDM A;  3J80 L;  1ZKO A;  1BLL E;  2F0G A;  3H6M A;  1WTW A;  5CBE E;  4CKE A;  2JEA I;  2VUM B;  5JM6 A;  2SNM A;  3PUW A;  4KY5 A;  3RLF A;  4R6T A;  1F2Z A;  3H8G A;  3NBI A;  2J7Z A;  1G8Z D;  3FRP B;  1O7Z A;  3QOL A;  2L4N A;  1FYC A;  4UEZ A;  3K7A B;  4MHY A;  3RZD B;  3NHH A;  1FT7 A;  4RGO S;  4G57 A;  4JYW A;  2EDG A;  1XJO A;  4G4K A;  3CQZ B;  5K36 H;  4B9W A;  5HVG A;  2HUG A;  4BWG B;  5CC4 A;  5BN4 A;  2IL8 A;  1I4P A;  3H91 A;  1JC7 A;  2XWB B;  3PB6 X;  4K3N A;  1WTV A;  3I90 A;  5CV7 A;  5KGU A;  1KAA A;  5HXD A;  4DU9 A;  1SYB A;  1DTD A;  2F0H A;  3PO3 B;  2F0P A;  4PXC A;  3N5F A;  2O2L D;  1ZYR C;  4WRD A;  3MWY W;  3HKZ B;  1NSA A;  5COR A;  1I6H B;  2BO9 A;  4OC2 A;  2BA0 A;  2A73 B;  2QJ8 A;  2K28 A;  2C6P A;  2V8V A;  4P4F A;  4JK1 C;  5A35 A;  4MXU A;  1DJR D;  3BVG A;  4DXF A;  2ZT9 C;  3NXW A;  4R8N A;  4B6Z A;  2M00 A;  2NWG A;  4X8I A;  2MP1 A;  4XYO A;  2NVX B;  3SI2 A;  2A5H A;  3V96 A;  1BAV A;  4UF4 A;  3A55 A;  4OID A;  3A8I E;  2ZEN A;  4YIJ A;  3J7Y W;  1RKN A;  1PCA A;  1G2T A;  5CPA A;  1TS5 A;  1SE2 A;  2B2Y A;  2ZEH A;  1CA5 A;  4A93 B;  1B1Z A;  2ZOF A;  5M3F B;  1HQR D;  1AFP A;  4BA2 I;  1V1P A;  2Q43 A;  4RUH A;  4XQN A;  5DS0 A;  5LYI A;  3CRL C;  3SI0 A;  1YW6 A;  4MIU A;  3KHX A;  4H7B A;  3OOC A;  2XIW A;  2NYZ D;  3NFZ A;  1V8Q A;  2M9V A;  1BCP C;  1OBR A;  1GUG A;  2E76 C;  4DAY A;  3J81 E;  1TR5 A;  2K5Q A;  1DOM A;  2J0T D;  4NFR A;  1G91 A;  1TY2 A;  1ELL P;  2GLJ A;  1I3Q B;  2KEE A;  4ZQ3 A;  4ZX8 A;  1VF7 A;  5LRK A;  3TC8 A;  3BI0 A;  1TWF B;  3PRT A;  1BF4 A;  3KBX A;  4PPZ A;  2PJ0 A;  2SDF A;  1EU4 A;  3BDC A;  4O23 A;  3NWT A;  4FWU A;  1QE6 A;  1SE4 A;  1GJX A;  1VMC A;  4HSP A;  1G2S A;  2QEJ C;  3B3S A;  2BA1 A;  2XN9 C;  1SYG A;  5AFW A;  3VAR A;  2VB2 X;  2OF1 A;  1WVL A;  5JEA J;  4A3D B;  3QNV A;  1TKW B;  5DEH A;  1ML0 D;  5J22 A;  3BDL A;  2CTC A;  1CZW A;  1HA6 A;  3VR2 A;  4PMB A;  3PO2 B;  3NH5 A;  1LT6 D;  4IQZ A;  5FK9 C;  2O5J C;  4IK2 A;  4KKT A;  5LYL A;  3PFO A;  4H44 C;  4NGM A;  1I4Q A;  5CV5 A;  4K2K A;  1SMY C;  3DXJ C;  3TP7 A;  3NSW A;  4U68 A;  3PBB A;  1X3Q A;  2HB6 A;  3SI1 A;  1BPN A;  3KGQ A;  2F0L A;  1BPM A;  5DAU A;  3VR4 A;  4IHM A;  4PXB A;  1IYU A;  3GLJ A;  3A54 A;  2A74 C;  5EPK A;  2KQ3 A;  1Z47 A;  3W3A A;  1FNV A;  2PIY A;  1RF2 D;  1F2O A;  1CHP D;  1HQM C;  1SND A;  4WJB A;  2HDL A;  3GV6 A;  2Q4Z A;  1FNO A;  2EJM A;  3L3O C;  4L8J A;  1W6K A;  3DWP A;  5F09 A;  2WKC A;  2PZU A;  2F3V A;  1O80 A;  1XX8 A;  3MXN A;  3IAY A;  1LLR D;  4TNU A;  3VR3 A;  3U9S A;  1TKH A;  1FNW A;  1AN8 A;  3KQX A;  3ERQ A;  4F8M A;  1YSJ A;  3R2I A;  2L5T A;  4FF2 A;  1XTC D;  5IB9 A;  5C4Z A;  1SYE A;  2LY7 A;  2ZXO A;  2PJA A;  4FBE A;  4FP5 D;  2EWB A;  5FOB B;  1Q3L A;  2X6G A;  3FVL A;  1WTO A;  4TWE A;  1O78 A;  2EYP A;  2V8D A;  5ELY A;  1GHK A;  4IUU A;  2R7Z B;  2NN6 G;  4OC0 A;  4IFD J;  3S9W A;  3SJF A;  2F1M A;  4I65 A;  2QDB A;  1F2L A;  2K7V A;  3WC6 A;  3HZX A;  1LTS D;  4FF3 A;  3GTQ B;  2KJX A;  2XEF A;  1TF8 A;  1QWY A;  4NJR A;  4UDU C;  2IJZ A;  1M8A A;  4X3T A;  5EKL A;  1IW7 C;  3B3V A;  1B9N A;  2L1B A;  4F88 A;  3I72 A;  3ND9 A;  1EYD A;  1D6E C;  3A56 A;  1MBY A;  3PUZ A;  5K8N A;  4RKL A;  5EKK A;  2HC9 A;  2L11 A;  1JWU D;  3HEJ A;  5K8M A;  4C2M B;  1PRT F;  1Z2L A;  4RWS C;  1YW4 A;  2JA5 B;  3DEP A;  1NR4 A;  5IOD A;  4DF7 A;  2F0I A;  2ZEO A;  5A2Q L;  4DA2 A;  4F7X A;  8CPA A;  3HOX B;  4NGR A;  1KDB A;  2H1E A;  1GYT A;  2PJ3 A;  3HOW B;  5ISR A;  3IEH A;  4LMQ D;  3K58 A;  3C46 A;  3AMU A;  3GTK B;  3R8B A;  3Q24 A;  2FIN B;  3F2U A;  1RCV D;  4FUU A;  3CRK C;  3SEB A;  2FFK B;  3KI9 A;  3TBI B;  1QJO A;  3GTP B;  3NA6 A;  1PFN A;  2I3C A;  1YLO A;  1IKL A;  1CQF A;  4TQU S;  2WKD A;  3Q0A A;  2IMO A;  4A3G B;  4OME A;  2B2W A;  1BO0 A;  2K1B A;  3EJI A;  1LTI D;  1I50 B;  3B35 A;  5IGD A;  2BE5 D;  3ITP A;  3H0G B;  4CHT B;  5BN3 A;  5KEE A;  5HVF A;  3PEI A;  1IHZ A;  5C3X A;  1ET9 A;  3LNN A;  5EPJ A;  4FYD A;  1EY8 A;  2RDH A;  1SYF A;  1YNJ D;  4KJN A;  4HCS A;  3T16 A;  3K59 A;  2Z1C A;  1R43 A;  3X3N A;  1PTO D;  3GTG B;  2V8H A;  2AFW A;  1RTQ A;  3MHB A;  2FVG A;  2CF4 A;  3S1Q B;  4GM5 A;  2IQ6 A;  1H9S A;  3JAM L;  1JOQ A;  2PQE A;  1A6X A;  1PZJ D;  3KLS A;  1HCZ A;  4KKS A;  2NVT B;  2K32 A;  2AUK A;  5KRU A;  1TWH B;  3KQZ A;  4HR7 B;  3D3R A;  2PCU A;  1SBB B;  3C3L A;  3K5L A;  3M85 A;  2PNR C;  1S5C D;  1Y8P B;  1ELM P;  4DK0 A;  5LYF A;  1UUP A;  2EVB A;  3DM1 A;  2NN6 H;  4BY1 B;  4OC4 A;  5M5Y B;  1TWC B;  1WD1 A;  3E5S A;  3WC7 A;  3BI1 A;  5CGK A;  5D8N A;  4DUK A;  1V1O A;  2JEB I;  5T1I A;  4NGS A;  4ONW A;  2ZEE A;  3ISZ A;  5CBA E;  4DAP A;  2AFO A;  2JA6 B;  1PFB A;  5FKA C;  1UWY A;  1Y69 U;  2HCC A;  2EK9 A;  3R93 A;  1AEX A;  1TWA B;  3GP7 A;  4X3R A;  1STN A;  2PJ9 A;  2E2H B;  4XQJ A;  1O7L A;  3S2H B;  4KI0 A;  3P75 A;  4NP5 A;  3PB7 X;  4K5W A;  2V8G A;  1A3T A;  1CG2 A;  2ZEP A;  3A8K E;  1LAN A;  2MGS A;  3VR5 A;  4DFA A;  3IC1 A;  2XRQ D;  1F9Q A;  4XQQ A;  3Q6S A;  4CKB A;  2E75 C;  3L7Z C;  2AUJ D;  1ILP A;  2MPM A;  3PIP 3;  1SE3 A;  3CU7 A;  5EQ0 A;  4RH6 A;  5CYU A;  1A2U A;  3QJY A;  5IGG A;  1Q1E A;  3QWN A;  4J1M A;  1ZYR D;  3OSO A;  3BVZ A;  3M7N A;  1HFN A;  2ZXR A;  2LS0 1;  1JOR A;  2B2V A;  2PJ1 A;  2OOT A;  3NBH A;  5I6W A;  4MHZ A;  4QUC A;  3PUX A;  4MCQ A;  1WD0 A;  1XYI A;  1HXY D;  4N9T A;  5G3L D;  2A6H C;  2CHB D;  5EBC A;  4ODG A;  4C3H B;  4OIJ A;  1U4M A;  2FHT A;  1STY A;  3S9L A;  1JR0 D;  5K5P A;  1NSN S;  1EIH A;  3GD7 A;  5C4X B;  3V7Z A;  2M2L A;  4EGV A;  1MSG A;  2AWO A;  2E2I B;  4XXE A;  4UIA A;  5JH9 A;  2IJ0 A;  4KY6 A;  1PMR A;  3U9O A;  5E3F A;  3NPP A;  1RD9 D;  2PZW A;  3I4L A;  1D1I A;  2DN8 A;  2K5D A;  3NUC A;  5T1G A;  4KKU A;  4C1N K;  5I9P A;  2NBF A;  4O42 A;  2JSO A;  1ZG8 A;  1PTO B;  1Q8I A;  5KIX A;  2C1C A;  3HOY B;  2K05 A;  3FJU A;  4K6L A;  5M9O A;  1FR3 A;  3IJ3 A;  4G7H C;  3D4W A;  2POK A;  1TKF A;  2EJG C;  3IWW A;  4HTH A;  3S1R B;  3HLP A;  3K5O A;  3E6Z X;  4ZK9 B;  3DGV A;  3H94 A;  5IGF A;  2AWN A;  4LAA A;  5CV8 A;  5TSS A;  2NVQ B;  4JZ0 A;  2NSM A;  1EWC A;  5FO7 B;  5ELD A;  5G3L F;  1DON A;  1RTN A;  1DZ1 A;  4ZUI A;  4RA8 A;  4Z9C B;  2EY2 A;  1I4R A;  1Z6H A;  2PIZ A;  2GRE A;  3VYU A;  3WT4 A;  1EY9 A;  2K01 A;  5C4J B;  1LTB D;  5ELB A;  2NN6 I;  2DY7 A;  1RJT A;  1JQG A;  1XXG A;  2RSO A;  4L6T B;  4B9X A;  4DK1 A;  3Q22 A;  1HDU A;  2SEB D;  1YNN C;  4OL7 A;  3L9A X;  1C8C A;  4HMI A;  2XVS A;  4H2K A;  1QIL A;  1LTT D;  3D31 A;  3CKI B;  4DNT B;  1WTX A;  3WC5 A;  5C3W A;  1HTL D;  4C3I B;  4P44 A;  3SJX A;  2SNS A;  3QO2 A;  5EBD A;  1QNU A;  4CJ2 C;  3FX6 A;  3JRU A;  4P2C B;  1KWM A;  2AFU A;  2I46 A;  4WWV A;  1AP0 A;  4KV6 A;  2JYO A;  4BBS B;  5IOC A;  1E2V A;  1L0X B;  5D3D A;  4FXG C;  4F87 A;  3TX8 A;  1H8L A;  3PB4 X;  1BDO A;  3K5N A;  4PMC A;  2WP8 J;  1E2Z A;  3S17 B;  1F9R A;  5CR3 A;  1TVX A;  2H4O A;  4K5V A;  4FNF A;  1Q90 A;  4Y7N B;  3P20 A;  1HRJ A;  1KNA A;  1NCV A;  5J1Z A;  5I6Y A;  2CTB A;  4RKB A;  3CT9 A;  3GTL B;  2WAC A;  1GUN A;  4NGP A;  3I3C A;  5CBM A;  2XSC A;  2J4X A;  1Y7E A;  1V43 A;  1VHO A;  2PO4 A;  1EQT A;  3VH9 A;  4ME5 A;  3D7F A;  5IT9 E;  4G7O C;  1PXU A;  2BDO A;  4FF1 A;  2JEW A;  1XMB A;  1CTM A;  2RKS A;  1STB A;  5JEA G;  1VDZ A;  4N9P A;  1HUM A;  3IIB A;  5COY A;  3KL9 A;  5DM6 3;  2ANP A;  2AFX A;  2YYZ A;  2D9U A;  3TN2 A;  1GUW A;  4IUP A;  3O13 A;  3MEH A;  1ONL A;  5FO9 B;  3FEC A;  2DNE A;  4M8A A;  1UAP A;  1ZLI A;  4H0L C;  2JBJ A;  3D7H A;  1DOL A;  2A69 D;  2G9H D;  4DN4 M;  1B44 D;  2DNC A;  4KD3 A;  3M7G A;  4UEF A;  1BCP B;  4DJL A;  1IW7 D;  2ICI A;  1YME A;  4FVM A;  4X3U A;  1CT1 D;  1IGB A;  3OHX C;  3BYT B;  2PW7 A;  4Q0F A;  1B53 A;  1VCI A;  4A3I B;  4DAV A;  4RHR A;  1ENC A;  2RA4 A;  3IFE A;  5E4W C;  2RQX A;  3QG1 A;  2ZEM A;  2KCN A;  4P4I A;  2KHS A;  4BBR B;  2O4X A;  5EKI A;  2PJ5 A;  4XT3 B;  5I4D A;  3Q23 A;  4R9W A;  2B2W C;  3P7J A;  3SR1 A;  2CW0 D;  3MXU A;  1BXT A;  4OHJ A;  2PJ8 A;  3FEE A;  3DEO A;  3KLS X;  2F7V A;  3MXG A;  3NQT A;  5JGF A;  4A39 A;  3OPO A;  1TS3 A;  2PW5 A;  3SK6 A;  1R4P B;  2ZED A;  4AXV A;  1PLF A;  1X3P A;  2B63 B;  1BUV T;  3HGB A;  3M4Y A;  5KYI A;  3DHQ A;  5ELF A;  3OWF A;  5C0X G;  4P4E A;  1MSH A;  4PXE A;  3CPX A;  3NTH A;  4MCS A;  4NKL A;  1CHQ D;  1B9M A;  2WIN B;  2ZEF A;  3BXM A;  1VF5 C;  2KA7 A;  3EQL C;  5HGT A;  3IFD A;  3SXH A;  4IUR A;  1DM0 B;  4ZAI A;  3SJG A;  1EYA A;  2PE3 A;  2RVL A;  3FDT A;  3T4A C;  1A2T A;  1TY0 A;  4KY7 A;  3G7L A;  1EFI D;  5EJW A;  1EY7 A;  1OXX K;  4C1N I;  5KND A;  4AYB B;  1LTG D;  4HED A;  4OIK A;  3OMG A;  1A3V A;  3NWS A;  1DE4 C;  3TME A;  3OMC A;  3N52 A;  3J80 E;  5IGB A;  3QOJ A;  1GUS A;  2B8F A;  4G7Z C;  2NTT A;  2GA4 B;  3IL8 A;  3I4N B;  5JEA H;  4ULL A;  3K6O A;  4OGQ C;  2F0J A;  1ILQ A;  5JOB A;  3HUV A;  1M4V A;  2JXM B;  2L0C A;  1EEI D;  3MAQ A;  1H9S B;  4ZI6 A;  4WFN 3;  5THW A;  2HQE A;  1C4Q A;  5KNB A;  3FEW X;  2F0W A;  2PJC A;  1O7Y A;  2RDG A;  2R6G A;  1TQO A;  2F0E A;  3QIA A;  3NH4 A;  4IN3 A;  2O4H A;  1EZ8 A;  1Z8L A;  2B2T A;  4A3F B;  3FF3 A;  2VXW A;  1D1K A;  3T51 B;  1ZXT A;  2EYL A;  2PJ7 A;  5K8O A;  4O1N A;  1SSO A;  2IT1 A;  3MFY A;  4NGN A;  3SJE A;  3D67 A;  2E2J B;  2K5W A;  2Y0S B;  4R8F A;  2VNU D;  3OIQ A;  2F0T A;  4I7Z C;  2B2V C;  5D14 A;  1J8I A;  2WAQ B;  4XIG S;  4GZY C;  4NGQ A;  4RCN A;  4A3B B;  1EWH A;  1ZEQ X;  2ABZ A;  1OXT A;  3HG9 A;  1AMP A;  3VA7 A;  3BS1 A;  3RZO B;  2KCC A;  3WAB A;  1XRY A;  2Q51 A;  2PYK A;  3H8F A;  3NTK A;  2DY8 A;  4CGY B;  5JPN C;  2F0V A;  4ZYS A;  4MCP A;  4P4D A;  2RBM A;  4P10 A;  5CV6 A;  3KZW A;  3I8Z A;  2C6G A;  2PJ4 A;  2B8G A;  1SFO B;  3S9M A;  5C3E B;  4C3J G;  2Q8R E;  3UI2 A;  1EEF D;  3D7D A;  3D4D A;  5C0X H;  4EQO A;  1DCZ A;  2IX0 A;  2LFN A;  5D65 A;  2E2D C;  1I6V C;  1PRT C;  2BOS A;  1F57 A;  4MCR A;  1FD7 D;  1Q1B A;  2F0Q A;  2V4D A;  1TWG B;  3RAM A;  4NDX A;  2X69 A;  3K5M A;  1JQY D;  3LMS A;  5HVH A;  3N6R A;  5J1Q A;  1BR9 A;  4ILW A;  3PB8 X;  3S15 B;  3KLR A;  2HCI A;  4OC5 A;  2ENB A;  4IUV A;  4Q5V A;  2AQ2 B;  4RGT A;  1SNC A;  2ICE C;  5I4M A;  4YWY A;  3T56 B;  4PXD A;  1EOT A;  2F0K A;  1TF9 A;  1H9K A;  1J9O A;  2OEO A;  2EOT A;  4V0B A;  5CV9 A;  2G9D A;  4HN7 A;  1U9R A;  4TSS A;  1STH A;  3D8G A;  3KR4 A;  2BDN A;  1OXS C;  1GUO A;  2D2C C;  1HEE A;  4ZYQ A;  1Z7T A;  4EQN A;  1U4R A;  2PPB C;  4A38 A;  1MGS A;  5EGT A;  1QCB D;  4IAL A;  3S16 B;  3A7A B;  1EY0 A;  2J9A A;  4KTA A;  1K8O A;  3VYS A;  4J6H A;  1EIG A;  1R4Q B;  2JA7 B;  5D29 A;  1PYT B;  1STA A;  3G6J B;  3J81 L;  2O5I C;  5LRG A;  3T13 A;  1K83 B;  3GTM B;  4BS9 A;  2SOB A;  3SK8 A;  2C6C A;  2D62 A;  2MHV A;  4A37 A;  1MI2 A;  3A7L A;  1PTO F;  2K04 A;  1VGY A;  2EY6 A;  3DWQ A;  4L63 B;  3BYY B;  1SYC A;  3GUX A;  2IW3 A;  3D4U A;  5JVH 3;  3MXP A;  3H8E A;  3T8W A;  1JIC A;  1IKM A;  1LOK A;  3TSS A;  2K03 A;  1C48 A;  4ID6 A;  3WOE A;  4A3K B;  1XBU A;  4QF4 A;  3BG3 A;  1SAP A;  1CM9 A;  1K8M A;  2ZEL A;  4IUT A;  5CMD A;  3SK5 A;  5C5L A;  3LX0 A;  1E2W A;  4ABN A;  4HSV A;  1D2B A;  1OXV A;  4J8Q A;  3D68 A;  3KR5 A;  5E4X A;  3SE0 A;  4S3S A;  2AQ3 B;  2N55 A;  4PV1 C;  4K2L A;  2BE5 C;  2GU2 A;  3PMF A;  1JCK B;  1OXU A;  1HUN A;  3SDZ A;  2PJB A;  1QOH A;  1CPX A;  3B3W A;  1TII D;  3OW7 A;  3FPP A;  1SJH D;  1CBX A;  2EYM A;  1YNJ C;  2WZN A;  5NUC A;  2EXZ A;  2PJ2 A;  5IGE A;  2R92 B;  2F0O A;  3DLJ A;  2IX1 A;  3HOZ B;  4ZX9 A;  3V2T A;  1H9M A;  3GB0 A;  5C0X I;  4KSI A;  4F9U A;  3X3M A;  5M5W B;  3BDO A;  3ONA B;  4IFD I;  1PFM A;  2NUC A;  2IWH A;  4TKO B;  1V1P B;  4EFD A;  5DM7 3;  5JAV A;  2ZEG A;  1D5X C;  2C9O A;  4HMJ A;  3I70 A;  2K6A A;  3TZU A;  1BCP D;  5E1F A;  1IYV A;  1RHP A;  3CDX A;  4KMU C;  3D66 A;  1TU2 B;  3NQI A;  1SNQ A;  5CV4 A;  3VA5 A;  2MJ8 A;  3MTS A;  1HFG A;  4XYQ A;  1R3N A;  5JJZ A;  2D5D A;  3S1N B;  2KEC A;  1L0Y B;  4JBW A;  2Q8I B;  3MZ5 A;  2PJ6 A;  1EE3 P;  4NMZ A;  3PV0 A;  5A2Q E;  4MHE A;  2LKV A;  4C56 C;  2F0N A;  1LAM A;  3TP5 A;  2B2U A;  1QG7 A;  1U4L A;  1B4O A;  1U4P A;  1DXM A;  3MN8 A;  1ENA A;  3B2Y A;  3DWA A;  1AW7 A;  3PFE A;  3FED A;  1EY4 A;  3S9N A;  3I1U A;  4UIB A;  5HUR A;  2QKI C;  4F8Z A;  3LWU A;  3CPA A;  1PZK D;  4MHN A;  2R61 A;  4EWT A;  4PQX A;  1QB5 D;  4DNR B;  3HOV B;  4HAE A;  2EYF A;  4K8J A;  4OP4 A;  5LL6 S;  1LAB A;  1PZI D;  3KK7 A;  1LO5 D;  4C3H G;  1LAC A;  2KUM A;  3FPU B;  4EVO A;  2X6L A;  1KAB A;  1SMY D;  2MUY A;  2PZT A;  3D6W A;  1BCP F;  3C1F A;  4CBV A;  3W2D A;  1CX8 A;  3ERO A;  3AB9 A;  5KYL A;  3S2D B;  4ZUJ A;  5ELC A;  2JBK A;  3L2N A;  4KD4 A;  2CVR A;  1ARL A;  3PUY A;  4R7M A;  4UEE A;  1CZG A;  4X2T A;  4CKC A;  2A6E C;  3K9T A;  1JWS D;  2A68 C;  1B2T A;  2KOL A;  3RBU A;  2AQ1 B;  3KF8 A;  2XEJ A;  1BQQ T;  1KLG D;  4MN3 A;  4TRD A;  1HTP A;  2RDF A;  3JAM E;  1KTK A;  1PYW D;  5ELE A;  3TDQ A;  1SNO A;  1E0B A;  1LT3 D;  2CQA A;  2XRS D;  4DYO A;  4DGZ A;  4QMG A;  1BOS A;  4R76 A;  5K8P A;  3OIP A;  2JA8 B;  4QB4 A;  3NTI A;  3K0Y A;  2FMC A;  3NK9 A;  1F77 A;  2IX3 A;  1I4H A;  1SXT A;  4V19 0;  4UAI A;  3PIO 3;  1QQ9 A;  1NUC A;  5DNF A;  1KNE A;  4X3K A;  4X3S A;  3D6C A;  1EZ6 A;  1T5X D;  3KUP A;  4PNY A;  3FMC A;  4E6I A;  1UNS A;  3RUZ A;  4RHS A;  3VR6 A;  2EPB A;  4M1U B;  1Y0Y A;  3IO1 A;  1LTR D;  2Z4I A;  1KLU D;  3QB3 A;  1G29 1;  2B2T C;  1WCM B;  2JE6 I;  1STE A;  4C3I G;  4P4J A;  3DUZ A;  4KHZ A;  1LV9 A;  1JE4 A;  4OO1 I;  2XNA C;  1G6Z A;  2EZV A;  2E74 C;  2ZXP A;  3MFG A;  2C5C A;  1XWE A;  5J39 A;  3S1M B;  4NJQ A;  3WOF A;  2JP1 A;  1XFO A;  2F0F A;  1HDQ A;  5EPL A;  5C6A A;  2QIL A;  1ENF A;  1ESR A;  4A3M B;  5I2Y A;  4KK7 A;  5LRJ A;  5F2D A;  3J7A V;  1DD2 A;  3GQB A;  4RGN A;  2O53 A;  1SNP A;  1B50 A;  3BZD B;  2FMM A;  4KHV A;  1VHE A;  5FLX L;  1ICW A;  1FGB D;  4DXG A;  3C1E A;  4ZY0 A;  1F2Y A;  1II3 A;  1KDA A;  3SK4 A;  4BD9 A;  4WOR A;  1SEB D;  5C4H A;  2PRQ A;  4NGT A;  4IFD G;  4ZY2 A;  1F9S A;  2N88 A;  1ESF A;  1RDP D;  4ZKC B;  4QUF A;  3K2K A;  2VB3 X;  3GTO B;  7CPA A;  1LT4 D;  3RMH A;  1Y1V B;  3H09 A;  4RFB A;  5I9O A;  1H9J A;  2GLF A;  1HA5 A;  4R8I A;  1PTO H;  3E0J A;  1X32 A;  4H13 C;  2WV6 D;  4FF4 A;  1PRT D;  2NVY B;  1CA6 A;  1AYE A;  5BN5 A;  1JB3 A;  4BA1 I;  4QCL A;  4P4B A;  4CJ0 B;  1LAP A;  2Q8T A;  2RFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...