2G9DA

Crystal structure of succinylglutamate desuccinylase from vibrio cholerae, northeast structural genomics target vcr20
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
340
structure length
340
Chain Sequence
b'KSLFRQSFLFDSLDLDHPMVAQTVRTEQGVTLKLHQRGVLEVIPAQTDAATKNMVISCGIHGDETAPMELLDKWIDDIVSGFQPVAERCLFIMAHPQATVRHVRFIEQNLNRLFDDKPHTPSTELAIADNLKVLLRQFFANTDEHSRWHLDLHCAIRGSKHYSFAVSPKARHPVRSRSLMQFIEQAHIEAVMLSNAPSSTFSWYSAEHYAAQALTLELGQVARLGENLLDRLLAFDLAMRDLISRHKPEHLPRKSVMYRVSRTIVRLHDDFDFRFSDDVENFTAFMHGEVFGHDGDKPLMAKNEGEAIVFPNRKVAIGQRAALMVCKVNTRYEDDQLVYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinylglutamate desuccinylase
publication title Crystal Structure of Succinylglutamate desuccinylase from Vibrio cholerae, Northeast Structural Genomics Target VcR20.
rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
total genus 71
structure length 340
sequence length 340
ec nomenclature ec 3.5.1.96: Succinylglutamate desuccinylase.
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.630 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2g9dA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2g9dA01
4MMOA 3L2NA 2HC9A 5LYDA 3SJGA 5HXDA 5K8MA 2GLJA 2Q43A 3BHXA 3PFEA 4OC4A 4ZY2A 3WC6A 2AFMA 2DEAA 3FECA 8CPAA 2JBJA 5JGFA 3DLJA 4MCQA 3SI2A 3IWWA 4TWEA 3RAMA 4X8IA 3PB4X 2PRQA 4TNUA 2PJ6A 2PIYA 1R43A 3PB7X 3KI9A 3TC8A 1GYTA 1HDUA 2AFSA 7CPAA 4AXVA 2PIZA 4NGPA 2RB7A 1XBUA 2V77A 4OC0A 2QJ8A 1OBRA 4GM5A 3H8EA 5K8PA 2FVGA 2C6PA 3B3WA 4P4DA 3V38A 4FAIA 1HEEA 1LOKA 5LYIA 3LMSA 3WC5A 3H8FA 2PJCA 3HUVA 3IJ3A 3SJEA 4WWVA 3WABA 3WC7A 3TX8A 3B7IA 4PQAA 4NGMA 2HB6A 3KL9A 1CPSA 2XEGA 4Q7AA 2PJ4A 4IHMA 2AFOA 3FMCA 2PVWA 2ZENA 3D7HA 3NH8A 2NYQA 1XJOA 3KQZA 1YW4A 4IK2A 4P6YA 3SI0A 5IB9A 3FJUA 4A94A 3FF3A 4UEFA 3K2KA 1YLOA 2EWBA 3V7ZA 4P45A 1AYEA 2PJ8A 3SI1A 4A37A 1Y7EA 2XEJA 3FEEA 3H8GA 4G1PA 3PBBA 3KR5A 3KHXA 4PXEA 3S9MA 2ZEOA 5I4MA 3FX6A 1PYTB 4NJQA 3I1UA 2J9AA 3FVLA 2BOAA 2JBKA 4OIWA 4DJLA 4UF4A 1YSJA 2ABZA 2ZEGA 4MHZA 1ZLIA 5D29A 3D66A 3N5FA 1DTDA 2AFXA 3FH4A 5HVHA 3RBUA 1Z8LA 5THWA 1FT7A 3LWUA 2GLFA 2GREA 4DUKA 3B3TA 2ZEMA 4UIBA 4ZX9A 4ZYQA 4BD9A 3IFEA 2PVVA 2ZOFA 3QNVA 5HVGA 1LAPA 1JQGA 4R76A 2BO9A 3GB0A 1Y0YA 3KZWA 4OC2A 1BPNA 3NH5A 2PJ7A 1H8LA 1ARLA 2PJ0A 3KASA 5LRJA 3D7FA 4P4BA 4NFRA 3KR4A 1TKHA 2PJ3A 2ZEDA 1FNOA 4RUHA 1BAVA 5CPAA 3WT4A 5JH9A 4H2KA 3JRUA 4Z65A 2OR4A 4MXUA 1M4LA 2F8HA 2POKA 3IO1A 6CPAA 2NSMA 2IQ6A 3SJFA 2F7VA 1YW6A 1CPXA 1IGBA 5ELYA 1CP7A 1ZG7A 1IY7A 4ONWA 4ZI6A 3GLJA 2V8VA 4R7MA 4EMEA 5J1QA 4OC1A 2AFZA 3PFOA 4MHYA 1Y0RA 3S9LA 4F9UA 2Q51A 2BCOA 2OOTA 2O53A 3SJXA 4IAVA 2WZNA 3CT9A 2EK8A 2CTCA 3B35A 4PXCA 1Q7LA 3KQXA 2ZELA 4MCPA 4R6TA 4ZX8A 2I3CA 5LRKA 4O23A 3B2YA 3NFZA 4K3NA 2G9DA 1VIXA 4FUUA 2AFWA 4OKOA 2C6CA 4WJBA 4P4IA 4F8ZA 4ZY1A 5LRGA 2PJ5A 2EK9A 1CG2A 2RFHA 5LYLA 1TF8A 2CF4A 1NSAA 1ZG8A 4X3RA 5D8NA 3KHZA 4R8FA 1ZG9A 5JM6A 3K9TA 3D68A 3DGVA 4YWYA 3FEDA 1HDQA 4P4EA 1QQ9A 4UIAA 1TKFA 2ZOGA 3PEIA 5DS0A 1CX8A 2PJ1A 3IIBA 2PE3A 3CPXA 1RTQA 4X2TA 2Q4ZA 1R3NA 4DYOA 4A39A 2PJ9A 1Z2LA 1XRYA 3VH9A 2JEWA 2WYRA 5K8OA 3VARA 2C1CA 2C6GA 3ISXA 1DE4C 2XEIA 4P10A 1F2OA 1ZLHA 3NH4A 1EE3P 4JZ0A 3PB9X 4EFDA 4NGTA 3B3SA 1LFWA 5F09A 4PXBA 2ANPA 4ZY0A 3BI1A 4NGNA 2PJBA 3D4UA 1KWMA 4KSIA 3B3CA 3VATA 3BI0A 4NGSA 2CTBA 3ISZA 1LANA 4NGQA 2QVPA 1F57A 4FWUA 4OC3A 4LQGA 2O4HA 2ZEHA 4EWTA 4MCRA 1TKJA 3PBEA 3S9NA 5K8NA 4CPAA 4P4FA 4UEZA 2GU2A 4PXDA 3CDXA 3NA6A 2ZEEA 4YU9A 3GUXA 2QYVA 2AFUA 2PJ2A 1QMUA 4OP4A 2ZEPA 4A38A 4NJRA 3T8WA 2IMOA 2IJZA 3MRUA 4P4JA 1CP6A 4MRIA 3B3VA 5HVFA 3D7DA 3D7GA 2XEFA 2V8GA 3CPAA 1VHOA 3KGQA 4OIDA 1BLLE 1PCAA 5CBMA 2ZEFA 4W9YA 4FBEA 1VGYA 1YMEA 2PJAA 2VL1A 4MCSA 1ELLP 3IC1A 2CIJA 1XMBA 1ELMP 4MHPA 1LCPA 1TXRA 3HLPA 1XFOA 3PRTA 2V8HA 3BXMA 4P44A 4B6ZA 2PCUA 1TF9A 4JYWA 1CBXA 1AMPA 1F2PA 3IEHA 4MHNA 4PPZA 5LYFA 1ARMA 1UWYA 4NGRA 3D67A 1VHEA 4OC5A 2V8DA 1Z5RA 4OMEA 4UEEA 3RZAA 1BPMA 3PB6X 1LAMA 4F9VA 3MN8A 3PB8X
chains in the Genus database with same CATH superfamily
4JW0A 2K14A 1GO3E 1JT8A 2ZM6L 1LTAD 4GOPA 5C44B 3VWDA 4AQYL 1PV4A 1EIYB 5JEAJ 2HCIA 2EUIA 1KNAA 4C68A 2B2WC 3SJGA 5LHY1 1PHJA 4RH6A 5BN5A 2ZW5A 3K7UC 5K8MA 2WB1G 1NMFA 4QQBX 1K83B 4LF9L 1C0AA 3H5ZA 4DAYB 1M1DA 4RFBA 2Q2TA 3S1NB 2WB1E 3OMGA 4A3BH 1HR0L 3BHXA 3P2FA 3PFEA 4OC4A 1SBBB 3LD2A 3PIOA 3DLJA 5M3MG 3S1MB 5ELCA 4DNTB 3C3LA 1O7IA 1SMXA 2QCPX 5EPKA 2HUZA 3RAMA 3I90A 4P74A 3VWEA 1YZ6A 4WJ4A 2E2JH 3DHQA 2A6EC 3PB7X 3IFTA 2J4XA 1XWEA 5ISVA 1KABA 1HDUA 4JI4Q 2RHQB 2K52A 4DV2L 2AFSA 2DPTA 1TKWB 4U9ZA 1A62A 4AXVA 1O78A 2A19A 3IAYA 2FMCA 2K6AA 4B9XA 2RB7A 2V77A 5I4DA 1YVCA 2DNCA 1OBRA 3F8TA 4K2KA 1X10A 2QECA 1WCMB 1VQKA 2ID0A 4E2AA 3UY5A 2WFWA 4A3KG 3V38A 3A8IE 2KCNA 5CR3A 3FPUB 5EBCA 5C82A 3CCJA 1HEEA 3J7ZC 1YVKA 4OO1I 2N55A 1MSGA 5LYIA 3KLSA 1QNKA 3E3XA 2NMTA 3R9FA 3ZJ0A 3K59A 4FXGC 2HD3A 1A6XA 4IOAA 2PJCA 3WABA 3WC7A 1YJ9A 2F0WA 3B7IA 4C2MB 1PYBA 2Q7BA 1RIPA 4JI2L 2XEGA 4WFN3 4IHMA 3S6FA 2LXJA 1PTOF 1HNZQ 1ESFA 4DR1L 1PLFA 2KCCA 4P72A 3OWFA 5ELOA 3BS1A 2EXDA 4NXML 3TO7A 1LABA 2Q2HA 1S60A 2V1CC 2N8NA 4JG2A 2F0JA 1LYLA 3SK5A 4A30A 4JC0A 2EIFA 1WVLA 4P73A 5IB9A 3KFUA 3TP6A 5M5XH 3HKZG 1TWAH 1VQ5A 3A55A 4DR5L 3R1KA 4DR3Q 4Y49B 3H0GG 4GKJL 1HNWQ 2UU9Q 4BWGB 3WOEA 4A3BB 1PTOH 4R9MA 4G7HC 4A75A 4A37A 1JICA 1N33Q 4A3EH 5A35A 3U58A 2R98A 3FEEA 3F8KA 4OONA 4DR4L 3L9AX 3GTKH 3KR5A 2EVNA 2O28A 1Y9WA 3PGPA 2EO8A 2MJ8A 2YYZA 3FHWA 3S9MA 2C9OA 1SE2A 2Q0YA 3K9UA 2GVAA 4JD6A 3D0FA 2EY6A 2IY5B 5KYIA 3TE4A 3Q6SA 5IP9H 2K4KA 4UHVA 2YGWA 2ASBA 4DV1L 2Q8RE 4DV6Q 1XEBA 1WTXA 2BOAA 4OIWA 3G7LA 2NVXH 2VZZA 2HQEA 3A9LA 4HJAA 4A76A 3K0XA 4P75A 2UXBL 1ZLIA 1IBMQ 1TIID 3DM1A 4APVA 1ET9A 3TFYA 1V8QA 1H9MA 3W1BA 2Z1CA 4IPDA 5DLQE 4Z9CB 5G3LD 5HY6A 2CH4A 3DWPA 2MP1A 3QOLA 4DV7Q 3M85A 1BQQT 4DUKA 4DN4M 4R9WA 4B14A 3NTHA 3OTOL 2HIXA 4MFJA 4N8FA 1QG7A 4UIBA 4LX9A 3IFEA 4H13C 4UY8C 5A27A 2PVVA 1YREA 5CBEE 1WD1A 1PH2A 3A7LA 1M4IA 2QEJC 1NNXA 2HIVA 2I5HA 1D8LA 2PZWA 3NTIA 3TSSA 3MHBA 3I70A 1HR0W 4UP9A 3K7AH 3CCMA 1Y0YA 3N7ZA 1KDCA 3IGRA 4X5KA 1JB3A 1Y1VB 4EQPA 5A2QL 4OGQC 3I3GA 2KQ3A 3PO3H 1H8LA 1TWAB 1K0SA 2F0GA 3DEPA 1E0BA 3BZCA 4NB3A 2Q44A 2XRQD 2B4DB 1L2FA 3D7FA 2ENBA 4AYBB 2PW7A 1C8CA 4NFRA 1TS3A 1RHPA 1IBLL 1Z8TA 3ULLA 3RR5A 1EU4A 3QB3A 5D65A 1PH1A 4RUHA 4JI8L 1U4RA 1BAVA 2AJ6A 2R93B 2K1BA 3GTKB 1BOSA 4BY1H 2LXKA 5JEAG 4F6AA 1AZPA 2OR4A 3SGIA 4NMZA 5M9OA 2F8HA 3IO1A 2FIAA 4XQJA 2B63B 2F7VA 1DJRD 1IGBA 1YNNC 1I4QA 1Q1EA 4IUSA 1S40A 1CSPA 4CJ1B 4KTAA 4DA2A 4K0KQ 1BXTA 4R7MA 4KUAA 4UAIA 5IT9E 4HJ8A 2XGTA 2WPWA 4IALA 5J1QA 4OC1A 1CM9A 1Y8NB 3WDNA 4AG9A 2C35B 5E4WC 4MHYA 3FDTA 3TO6A 3M4OH 4ZUJA 1VQDA 3V8IA 1BDOA 4G57A 2RA4A 1UE1A 4F88A 1KAWA 1LTGD 5IODA 2XWBB 4XPDC 3PIO3 5JJIA 4ZQ3A 2OOTA 4YY3Q 4A3KH 2EY5A 1EWHA 2WZNA 1EEFD 5JQ4A 2CTCA 3D31A 3B35A 4JWPA 4PXCA 5KIXA 2J7ZA 1XPOA 2M2LA 5BN3A 1F2YA 3I7FA 2EY1A 3OW7A 1PRTC 2ZELA 3ZYYX 3OYYA 3M7NA 3D3SA 2K28A 3PO2B 1I3QH 2I3CA 1QE6A 1UUPA 1XTCD 4K8JA 1YIJA 3NSWA 1R9TB 2KHJA 3M4YA 3A5UA 4K3NA 4AB7A 2I07B 1X56A 2JA6B 4QUFA 2F0KA 3EY5A 2C6CA 3EFAA 1S5BD 4A3FG 2Z9HA 3S2HB 4B13A 2K5VA 3GTJH 1HZCA 4UWJA 2K50A 4KOXA 3NK9A 4R1JA 3SK4A 5LRGA 2EK9A 1JORA 4BBRH 1SYBA 4BY1B 2MHVA 4BBSB 1JOKA 3OWCA 2CKZB 3H0GH 1NSAA 3CMEA 3S6KA 1KIXA 1YBYA 3HOZB 3W1GA 2VUMB 2D5DA 3NELA 2Z3LA 3KHZA 4R8FA 4FD7A 1O7YA 3D68A 1FY7A 1YR0A 1MIUA 1I12A 4CYPA 4YWYA 2PQEA 1HDQA 2R7HA 3J7AF 4K5WA 4N8X1 2MO0A 3DDDA 3MC0B 2PJ1A 2RKSA 1EZ6A 3H15A 1QJOA 2RQXA 3IIBA 1S72A 2L55A 4F0XA 3UDIA 5BR8Q 3I55A 1RTQA 1YNXA 2R6GA 3BJ7A 4X2TA 2D0OA 2F3IA 4FF3A 3Q23A 4DUYQ 1D7QA 4NXYA 1S4ZA 3FRMA 5EAYA 4JI4L 4L6TB 1HQMC 5KNCA 3HOVB 1Z2LA 4P2CB 4DPGA 4WJ3M 3ULPA 1EEID 1OXUA 1HXYD 4FD5A 4BS9A 4WRDA 2A6ED 1IYJB 1CKOA 2ZTEA 5CORA 5T1GA 2VB2X 2Q8TA 1QSOA 4UCNA 1FD7D 3OIPA 1EY4A 3PZJA 3I4NB 5IYDG 1SDFA 3TS0A 5KRUA 4CS0B 5C88A 1DE4C 1F2LA 4I7ZC 4P10A 1I50H 4C1NK 4FDBA 4LNQA 3AYHB 4NGTA 1FGUA 2NVYH 4UA3A 3KLWA 5IB0A 1IOIA 1BO4A 1D1KA 4A93G 5C3XA 3QB8A 1B3AA 1B1ZA 2UXCQ 1JCKB 3GTJB 5IP7H 2KEEA 3BI1A 2D4OA 1G91A 2JE6I 5C4JH 2I79A 4KSIA 1V1PA 4KHPQ 5C44G 5G21A 3N52A 1JE4A 3VATA 3R95A 1HNZL 2AWNA 3WOFA 3UE0A 1LANA 4X3KA 4BBRB 1Z8WA 2QVPA 4FWUA 4IOCA 3ONAB 1PH3A 1G6ZA 4JLYA 5KGUA 1EUJA 5M5WB 4ZK9B 3CXSA 2ZEHA 4KZTA 3TREA 1TWFB 2ZJQA 4LQGA 1B8AA 4E0AA 4CBVA 4MCRA 2K5QA 4CRZB 1KAAA 1KZFA 2PZTA 4PSWA 4LJZC 1Q90A 4J6HA 1NCVA 1A15A 4K14A 3I2ZA 3I73A 1L0YB 3D4WA 1E2VA 4DR3L 3J7AV 2P6FA 1HNWL 1X54A 2EVBA 1II3A 1V9PA 1B44D 1PZID 4RMFA 3GUXA 2BL1A 2WPXA 1N33L 2Z4HA 2ZEPA 1TWHH 3IU1A 4UCMA 3A5ZB 4NJRA 2G9HD 4HEDA 2IMOA 1PMRA 2CQAA 2HT1A 2IJZA 1BVSA 3HG9A 2R61A 1JC7A 3NEMA 2VZAA 3B3VA 4KHZA 1SR3A 3TN2A 5IGEA 2AKWB 3BLNA 4CHTB 1EY0A 1SYDA 2UUCQ 1Q8KA 1PU9A 4BY7B 5LMUQ 1TVXA 1A2TA 1O80A 3CF5A 4OIDA 4DV6L 1T5EA 4QB9A 2K75A 1KDAA 1Q8IA 4W9YA 3VR3A 1S7NA 5GCNA 3E9IA 1YMEA 2WP8J 2JA7B 1TR5A 5D3IB 2IX3A 1ELLP 3J81c 2CIJA 2BA0A 1SNPA 4LUZA 3TOAA 3J80i 1XMBA 1YQEA 1J5EL 1VQ6A 1X65A 3SXNA 2KHSA 2K04A 4CYOA 1W6KA 2NVYB 4LW1A 4A3DH 1AE2A 1YLEA 1HTLD 3Q0AA 2Z6KA 5H84A 4M8AA 4P44A 3VR5A 2V8HA 3BXMA 2QF7A 2XRSD 2PCUA 3LX0A 1EYCA 3OHXC 4GNXC 4A2ZA 2RC4A 4EGVA 3G6EA 1X32A 4BBHA 1VQFA 1H9KA 1AMPA 1PDQA 4K30A 2CW0C 2VI7A 1E7ZA 5JPNC 1F77A 1Y8PB 4PPZA 2PNRC 3TS2A 2NUCA 5LYFA 3CCVA 1YVOA 4NPSA 1UWYA 5J1ZA 1KTKA 3PSIA 5M5YH 1OXSC 1VHEA 4H7BA 4OC5A 4R87A 1KL9A 1HA5A 4CYQA 1TQOA 4OMEA 4A3BG 2A1AA 3PV0A 3S17H 2JA9A 1RTNA 3LWEA 1HPCA 2QEXA 2HHHQ 4UEEA 1GUNA 2F0MA 3DR8A 4OEMB 4ODGA 2N3SA 4DAPA 1BBWA 3DM3A 1BPMA 4KN7C 1LAMA 4IPCA 4OIKA 4RKLA 3MN8A 1ZKOA 1MI2A 4ILWA 4KI0A 3PCOB 4HSPA 1R4QB 3S16H 2PZUA 2K5WA 4C3HB 4XDXA 3DR6A 4MMOA 1EIFA 1XJVA 1D6EC 1HZBA 1VKCA 1VDZA 5LYDA 1Y69U 1GVPA 4YWLA 2EPBA 2RSOA 2M9VA 1YEZA 4ZGYB 2GLJA 3M3YB 1UNSA 2L1BA 4LQ6A 1LTLA 1NMGA 1IYUA 4PMWA 3ZJYC 4O42A 1BO0A 4PV6A 5JGFA 3HP3A 4HJ5A 1PVOA 5C3EB 4JVZA 3IWWA 1A63A 4K0KL 1QWYA 3TEHB 5CC4A 5FLMG 4IF5A 2TSSA 4PV1C 2PRQA 3PB4X 4X8IA 4XTCS 1QSTA 5IX3A 1IOFA 1YNND 3F2UA 2JP1A 1R43A 2PJ6A 4DNRB 3PUWA 3CCQA 5C4XB 7CPAA 5GQOA 2NTTA 4Y52H 4II9A 2DN8A 1KUXA 4IPGA 3VR6A 2Y0SE 4NGPA 1DOLA 3GTPB 3FPPA 1D2BA 1C48A 1XBUA 1Q7YC 1LRZA 3KUPA 2QJ8A 1PYSB 3D6WA 3HGBA 3TP7A 4GM5A 1CUKA 4LF7L 2IW3A 1S3ZA 2VXKA 2SEBD 2B5GA 2FVGA 1Y1VG 1Q12A 2A73B 1CSQA 1Y1WH 4FD4A 2I5MX 3GY9A 2F0QA 4A3CH 1QZHA 2N49A 1X3QA 5M5YB 4C3IH 4B3SQ 1BUVT 3EIVA 1CI3M 4HNWB 4KKSA 4AYBG 2VNUD 3H8FA 4C2XA 2ZJPA 5A2QE 3S17B 3HUVA 4PZ7A 3NXWA 1KLUD 1PRTD 5EKIA 5C44H 4NGMA 2HB6A 4AYBE 3RLFA 4Q38A 4JOIC 4JI5Q 1KXLA 4Q7AA 2R93G 2NVTB 1EYGA 1S7KA 1WTWA 1N71A 3FMCA 1XMOQ 2BDNA 1ICFB 3S1QB 1KRSA 1VQNA 5DEHA 1BOBA 3NH8A 3S1NH 2OU2A 4CAEA 1DYQA 2Z3MA 4KOSA 5IP9G 2B63G 2PR1A 1L1OB 4P6YA 2RHSB 1O7ZA 2JQOA 2G3AA 2HQYA 4I65A 3S1MH 3HOWB 4QJFA 1E1OA 1DOMA 3K2KA 4GOPB 1YLOA 2EWBA 3D2MA 3DEOA 3V7ZA 1RTOA 4P45A 5H1SE 3CCRA 1IL8A 2RVLA 4AG7A 1AYEA 3MGDA 3NTKA 2PJ8A 4Y7NH 2KEDA 4FF4A 3TO9A 1U9RA 1Y7EA 1LM0A 5K5PA 4UFWA 3H8GA 4H6UA 1WCMH 2PMZB 1KUVA 2AQ3B 2ZPAA 3OOCA 3HEJA 1CQFA 4QIWE 2ZEOA 2FJ2A 4DUYL 1PYTB 3FX6A 4ZYSA 5J22A 3MEFA 2BEIA 4IUTA 3C46A 3I1UA 3SHLA 4JI0L 4FYDA 1VMPA 3D8PA 2EXZA 3Q22A 4IFDJ 4PSXA 3IRBA 3EO4A 4KLWA 1STBA 1JB7A 3A7AB 2ABZA 3MFGA 4C2MH 2ZW4A 2NVQH 5D14A 1QVGA 2Q4YA 3IL8A 1XXGA 2JA6G 1KUYA 3U9SA 3FH4A 4GN3B 5HVHA 3A8JE 4A3LH 3PUZA 5FLXc 5EJWA 2GLFA 2D9UA 3M7GA 1K8OA 1I6VC 2ZEMA 4CAXA 1A3TA 1FL0A 3G3SA 2B2UC 2VQEQ 2UXCL 1A3UA 3QNVA 3CPFA 3HRZC 4BY1G 5LL6S 4BBSG 5EMIA 4KHPL 1B6BA 4AH6A 4DR6Q 2Z3PA 4LMQD 1G51A 1J4JA 2BO9A 4R76A 5G1ZA 1PTOC 4LF4L 2E8GA 2VUMG 1PH5A 1NY4A 3HOZG 1XPUA 3ZZIA 3F2CA 3BDCA 1IW7C 4JXQA 4HTHA 4KJOA 4RG1A 1BPNA 1FNWA 1TXYA 2B29A 1ARLA 2X6LA 3F5BA 4DKAC 3KASA 2B2TA 1LTTD 2B8GA 1Q2YA 5LRJA 4JPBW 4KORA 2FXQA 4PG3A 5DWMA 3G8WA 1D1IA 4GLVB 1XPRA 3I3CA 2F0SA 4Y7NB 3KR4A 2PJ3A 1NUCA 1S5KA 2NBFA 5CPAA 3WT4A 5JH9A 1PA6A 1CK1A 2L5TA 4Z65A 1FJGQ 2JA5H 3HOVG 1EFID 2O2LD 3L2PA 5T1IA 1Q1BA 4MXUA 1PFBA 1EZ8A 2EYFA 1HUNA 1DM0B 3OW2A 6CPAA 4GNXA 3SJFA 1M90C 2FT0A 3D6CA 2KCWA 3RN2A 1VQJA 4J1MA 5I2XA 3I4NG 2JJQA 1CP7A 5CV6A 2UUCL 4R4OA 4ONWA 5FLMH 5LMUL 1P4NA 1VQPA 4FF2A 3GLJA 2ZTCA 2RCFA 3RZDH 2V8VA 2NVQB 5KNDA 1H9SA 4XYQA 1T9HA 1X3PA 3K5MA 5F49A 3H4QA 5FJ8H 4LFBQ 5AG6A 3T1YL 3HS0C 1SN8A 3JAML 5FLXL 3PF5A 4U5YA 3SVMA 1A8VA 4AVCA 5DNFA 1Y1VH 4A32A 4DV3Q 1I4GA 4IAVA 5G20A 4BBRG 1Q7LA 2ZTDA 2B4BA 2F0NA 2AUJD 2Q2IA 2OQ0A 2KHIA 2ICEC 3MZ5A 2REEA 2HCCA 3AFQA 3HKZE 4JK1C 4RCNA 2DPSA 5J3BA 4EVYA 4ZX8A 3NQIA 3GKRA 1VS0A 4BA1I 1QNUA 2F0DA 1IBKQ 4PK3A 4XPLA 4CKEA 1STHA 2OWOA 2R93H 1G2SA 1STYA 3I4OA 1ILPA 2MUYA 1J8IA 2OB0A 4OADA 1AW7A 4JI3Q 2HHHL 2DY7A 1A2ZA 4OKOA 4F7XA 4MFKA 3TMEA 2EYLA 3VR2A 2O5IC 4JI6Q 1AE3A 4JCVE 3QAYA 5EKLA 4DR7Q 1CKMA 3SE0A 2MO1A 2PJ5A 5IGFA 2B63H 3KF6A 2Q7SA 1CG2A 5K36H 4C3JB 2WACA 5FKAC 2JA5B 1SQHA 4YCWA 3FBUA 4LF8Q 2LKVA 2CF4A 2UUBL 1VQHA 2J8MA 4L5SA 2MQHA 4ZAIA 5D8NA 1DGSA 1N36L 4BY7G 3CC4A 4JV5Q 1FNUA 5G22A 1ZG9A 4POFA 2KA7A 4B3MQ 3FEDA 4RGMA 4P4EA 1EQVA 1RD9D 1X9NA 1QQ9A 1RXTA 3PGZA 2ZOGA 3OIQA 1QVCA 3D8GA 1VQCA 5I6WA 3RZDB 2PE3A 4K8IA 1HZ9A 1U4PA 2SNSA 4KOWA 5IP7G 4O2DA 3EC4A 4A3IB 4DYOA 4A39A 2XVSA 2PJ9A 3PO2H 1E3PA 2P0WA 4JOIA 3ICEA 1J9OA 1PZKD 4G7ZC 2YTXA 4IFDG 1R9TH 1IZ6A 3E0JA 3GTMH 4GXHA 2YNCC 2K5TA 2A6HC 1JWSD 1ML0D 2ATWA 2DUDA 2JA6H 1N32Q 1PH7A 2C6GA 4JI7Q 5J8CA 1XF8A 3EQLC 3R93A 3S2HH 3ISXA 4N9TA 1NE3A 1MJBA 4KVOE 1P16A 1LT3D 1GUTA 1K9MC 2EDGA 4KSFA 5LMNQ 3CCLA 2KUMA 4B3SL 3PB9X 4E8OA 3BVMA 5IGBA 1P0HA 1LT4D 4IQZA 4MTKA 1WWZA 3KDFA 4BBSH 4PXBA 1B53A 1U0LA 1Y8OB 4CGYB 5CV8A 2Z3KA 3HOXH 1CZGA 3PUYA 4C3HG 4CJ0B 1KWMA 4MIUA 2VUMH 3HOZH 1XMTA 3CRKC 3BI0A 3KF8A 3L0OA 3UDGA 2DXQA 3ISZA 1I21A 1XMOL 1V1OA 4KY7A 3HOYH 1BCPB 1G2TA 1U4LA 5IY0A 3AQQA 5LL6X 1VQOA 4U9YA 3S14B 3BVZA 2XNAC 2IWHA 3J80E 3S9NA 5K8NA 3KK7A 3MEHA 2GIVA 3EVQA 4XT3B 2GU2A 4RGTA 1H9RA 5E3FA 2XTIA 4FF1A 2FHTA 1N34Q 2FCKA 4U68A 5C3EG 3EROA 1Z9FA 2CH4W 1HNXQ 2RDHA 3HOVH 3VYSA 4UP8A 1QMUA 5J39A 4A38A 4A3DG 4M85A 1NBWA 4X64Q 5C4XG 1DCZA 1RL2A 3QJYA 4EQOA 3U4VA 4OX9L 3MRUA 4P4JA 2F4IA 3SK6A 1CP6A 2JN4A 4IFDI 1LTBD 3I4NH 3EFXD 4H02A 2ZJRA 1VF7A 2L0CA 1J6QA 4DAVA 2B2WA 2B2UA 2IHFA 3IU2A 1BBXC 4RN7A 4QF4A 2HQLA 3GTMB 3HZXA 2B4DA 1QVFA 4DV5Q 1SNDA 3SK8A 2JA8H 1SJED 2NZOA 3D4RA 5IIFA 1TWGB 1VGYA 3LGJA 3S6HA 4MCSA 4HMJA 2FSRA 1VQ9A 4LF6Q 2JXMB 3CMAA 1EFWA 1LCPA 4H44C 2EE1A 4UFVA 1EY9A 1WD0A 3GV3A 1VQLA 3JTKA 5M5WH 1SYGA 1TWFH 4L8AA 3HOXB 5ELEA 2DF5A 3E0EA 3PIPA 1MBYA 1CBXA 2VQEL 2Z3OA 3B8GA 2BH8A 3W91A 1F2PA 2L12A 3BZDB 1S7FA 2ZT9C 3LNNA 4DR6L 3K57A 3HOYB 3HOWG 4NGRA 4X65Q 1V1QA 3K58A 5M3FH 4C7HA 1VQMA 1PH9A 4JI1Q 3L7ZC 1K28A 1Z5RA 2WB1B 1QILA 3Q24A 1PTOD 3JUWA 4DAMA 5KNBA 4HAEA 1MKHA 1IIDA 1L0WA 2GFQA 1IW7D 1IYVA 1D5XC 5IWAQ 1SNCA 2Z4IA 3R2IA 1EY6A 4K6DA 1PH8A 4CKCA 3PB8X 1WTRA 1GUWA 1QCBD 3NQTA 1VQBA 1Z9UA 3L2NA 4BY7H 2HC9A 2PMZE 1O7LA 4PMCA 4TRDA 2RDGA 2K32A 3VR4A 3K5OA 3I91A 3FB3A 1K73C 1SYEA 1HCZA 5HXDA 3BG3A 1WJJA 2A4NA 2JA7H 3NE5B 1BF4A 3TRZA 4MY0A 2XSCA 5KTCA 1LO5D 1QSNA 1Y1WG 3CPWA 4KJNA 4B9WA 4FNFA 2Q43A 4A3CG 4MFQA 1R57A 5F2DA 1EQTA 1NE9A 4JYAQ 4IO9A 2MFIA 4GLAC 2F5IA 1RODA 1JOQA 2DEAA 4C3IG 1JJGA 5IYCH 3FECA 2JA8B 8CPAA 3SI2A 2K5DA 4JBJA 1RDPD 1MSHA 2PSWA 4OL7A 4RGOS 1WK4A 5E4XA 2F4VQ 2LS01 2BSWA 3NWSA 3TC8A 1OXTA 4LFBL 4J3GA 4CAVA 3GP7A 3ERSX 1VHSA 4IFDH 2E74C 3DWQA 4FD6A 1ASZA 1F2ZA 3C1EA 2ZM6Q 5F47A 4OC0A 5HH1A 2PYKA 5EGTA 3CCEA 4DV3L 4AQYQ 3FKIH 2FE7A 3MWYW 3H8EA 4RA8A 5K8PA 2QKIC 2B3GA 5ELFA 1GUOA 2AE6A 2B8FA 1SSOA 1AH9A 1VQ4A 4X66Q 2BH2A 3BJUA 2UU9L 1LOKA 4LF9Q 3F2BA 5M3FB 2R7DA 4BA2I 5F48A 2CNSA 3OMCA 3SJEA 4C3HH 4R4QA 4R3LA 4WWVA 4B5OA 4HPSA 4PQAA 4UBRA 4CGPA 5HGTA 4J8QA 4KVME 1CPSA 5BWAB 2NYZD 2VY3A 2R3ZA 4YCVA 3OSOA 5JJKA 1WCMG 3G71A 4GOPC 4M1UB 1B3QA 1K4JA 4DR7L 2PVWA 1SFOB 2HDLA 1JJ2A 3M3YH 1XOVA 3MVVA 4X3SA 2DJGC 2I5LX 3D7HA 3GQBA 1MJ9A 2NYQA 1K8MA 4ZBGA 1CKNA 5F46A 4KLVA 3KQZA 4LF8L 3CCSA 5C3EH 3FJUA 4A94A 3Q8DA 2PQAB 4HCSA 5IGGA 4MTNA 1IBML 3CD6A 2KVMA 5AGEA 5C4HA 5IT9c 4HIMA 1I5FA 1YJNA 1GUGA 4B3ML 2YNCA 5C4XH 1EQQA 3SI1A 4DV7L 1PZJD 4QBJA 2XEJA 2RDFA 4LK1C 4XPDB 4F8MA 2PI2E 3GTPH 4A3LG 5DM63 2N78A 4G1PA 4A3GB 1Z4RA 2UUAQ 2B39A 1YX0A 2LMCB 1CHPD 3CKIB 1OTCA 3E6ZX 2E5LQ 4PXEA 2R7FA 1HFGA 1PRTB 3NBHA 2HDMA 3EN2A 3T4AC 4UDUC 4NJQA 3JAME 4WORA 4NXMQ 2EZVA 1FYCA 3QAHA 1HJPA 1UEAB 1EQRA 3FYNA 2H1EA 2EY2A 2E76C 1F2MA 2G5DA 1XTDA 3FVLA 3FKIB 3MXUA 4QB4A 3TTHA 4DJLA 4UF4A 2FXFA 5JPMC 3KJPA 2R1IA 4OIJA 4XYOA 1CFMA 1MHWC 1GHJA 2A68C 1B9MA 1Z8XA 4XPKA 3J81j 2ZEGA 3IKJA 4MHZA 5D29A 3PUVA 4JI7L 3S9WA 3AEVA 4R8NA 3UE1A 3N5FA 1AEXA 2NVTH 1DTDA 4LUAA 2AFXA 2D2CC 2K01A 4KOTA 2OEOA 1QUQA 2B5GB 2PW5A 3RBUA 3SR1A 5LMNL 1Z47A 1A2UA 2A6HD 1B70B 3S1QH 2GREA 3CZXA 1ESRA 1A0IA 2J0TD 3BZKA 4RGNA 4CYNA 4GKKQ 3LACA 4BD9A 2X7BA 1BBUA 5CNPA 1JQYD 5IV0A 2CWPA 3UDFA 1ILQA 4OELB 3NE8A 3HOWH 1JQGA 1ZYRC 2EYOA 4OXPA 2JA5G 1QSRA 2WUUA 2EYPA 4UFXA 3C2PA 4MY3A 5C5MA 2IT1A 4CDEC 5JPHA 4DF7A 3FVQA 4PK2A 4C7IA 1IB1E 4OC2A 3QOJA 5CGKA 2H5MA 1STAA 4U673 4IUNA 2PJ7A 1OXXK 4DUZQ 2PJ0A 5GROA 3BYTB 2UXBQ 3PIP3 3J81L 5IT9L 1NMTA 4ZKCB 4BINA 1JOOA 1X3FA 2A69C 4IZ8A 1HRJA 3V96A 2EYJA 3TP8A 1TKHA 5FJ8G 2D62A 1HNXL 2WKDA 3PQIA 3RLOA 1UE5A 1KC8C 4YY3L 4A3IG 4H2KA 4X64L 3JRUA 4NP5A 3VA7A 2ZXRA 3U50C 1UEBA 2BA1A 3I4MB 5D3DA 1YNJC 2C27A 2POKA 2IL8A 2NSMA 2IQ6A 3KLRA 3P2HA 1X6OA 1YW6A 2OCEA 1CPXA 3G48A 1UAPA 5ELDA 5ELYA 2SNMA 2MPMA 3C26A 1VQAA 3QR8A 1IYKA 3R8BA 1M8AA 1KRTA 4XNHB 2IX1A 3H94A 4KHVA 5FOBB 4DR2Q 4DV5L 3KLSX 3P7JA 1C9OA 1SAPA 3MTSA 3CRLC 4ULLA 1AFPA 3P1HA 3M9BA 1RJTA 2IJ0A 1S5ED 3SXHA 1DZ1A 2BOSA 1IXRA 2AFZA 4L63B 4Y49C 1MJEA 1IBLQ 2NTSA 3S9LA 4DNCA 4F9UA 1LTSD 2Q51A 5CV7A 2C5CA 2BCOA 5G3LF 5JJZA 4A3FB 4CAFA 2R7ZB 3IWEA 2O53A 3SJXA 1WOCA 5K36G 2EK8A 3T53B 5HGQA 3MXNA 5HURA 1HFNA 4ZRZA 3DSBA 3J7YW 2Z6BA 1PFSA 1I6HB 1IHZA 1EL0A 5H86A 4F0YA 1EWIA 2L11A 2OZHA 1U6MA 1WTOA 5EBVA 1F9SA 5KEEA 4NXNQ 2R92B 4QL5A 2KJXA 1EWCA 3DWAA 5C0XJ 2B3VA 4O23A 3HOUH 1JWUD 3STBC 1Z4EA 5EKKA 4V0BA 4NDXA 2QDLA 1VIXA 1XNQQ 4ABNA 4FUUA 2AFWA 5BR8L 3ULJA 1PFNA 1Q86C 4WJBA 4IJLA 4F8ZA 4B3TQ 2NB0A 2Q8IB 1LT5D 1I1DA 5IWAL 2G3TA 1KDBA 4HNXB 4GLXA 1WTHA 2ARHA 2DGYA 3T1HQ 4OWTB 1ET6A 4M6GA 5LYLA 4JJXA 3PO2G 1C7YA 1TF8A 4X3RA 1TY2A 4OHJA 4J15A 4DGZA 2OTLA 1GHEA 1M4DA 4AVAA 5A28A 5AG4A 3S24A 3UI2A 2CHBD 2OT2A 3E9HA 4UPAA 5CV5A 1M1KC 5JM6A 3SHPA 4LUVA 1Y9KA 5LMNW 1CHQD 3DGVA 3E0KA 4K2LA 4NW2A 4UIAA 1HA6A 4G7OC 1N8RC 2IX0A 3PEIA 4B12A 2PCFB 2YNEA 5GADC 1TS5A 3K5LA 1ZO0A 4O0AA 4A3MB 5DS0A 4GNXB 1IKLA 4L89A 3F1ZA 2XIWA 1T5XD 4JBWA 4DU9A 4DV0Q 4YFJA 4KUBA 2Q4ZA 4NKLA 1K8AC 3HOXG 4B5PA 1SLJA 3I9SA 4KKTA 2GANA 2QDBA 1CTMA 1H9SB 1XRYA 1CA5A 3PF4A 3VH9A 1YK3A 4KKUA 2JEWA 1D5MC 3KOJA 5FK9C 2P6GA 1XNRQ 3FNCA 3JAMi 1TWCB 3CW2C 2WYRA 1SEBD 2WINB 3HOYG 5K8OA 4CDDC 1SRUA 2E2DC 4KLKA 3GTGH 3UDXA 2PRBA 2MGSA 2R8VA 2LSSA 2F0LA 1YHQA 1XIXA 1B2TA 3IWGA 4BMHA 4X66L 3FP9A 2LY7A 1GHKA 3I56A 4I7AA 5IGCA 2CXAA 1WI5A 1F2OA 1LUZA 1EE3P 3HOUB 3F0AA 4JZ0A 4EFDA 2VB3X 2DJFC 3ND8A 4IN3A 3X3MA 3CC7A 3B3SA 1BCPC 3G6JB 3R2TA 2ALYB 4C3JH 2F0FA 4X62Q 2IPKD 3KBXA 2ANPA 4ZY0A 4HJ7A 2RCNA 4DK6C 2V4DA 1WFQA 4N9PA 2YU9H 3B3CA 3FXTA 2KECA 3RZOB 2JDCA 2B58A 4NGQA 3VA5A 2E2HB 1F57A 2BE5C 4K5XA 1S7LA 2F0IA 2A8VA 2L15A 2Z0ZA 4H6ZA 2O4HA 2OXPA 4RCOA 4M6HA 4Q36A 4EWTA 2AWOA 3IFDA 1YITA 1VCIA 1HTPA 1W6JA 2KENA 3MFYA 3CCUA 1H9JA 2F0EA 2QW7A 2Z8LA 2EYMA 4X3TA 1ASYA 1TKJA 4P4FA 3KF6B 2K5HA 3MAQA 3H3VH 4UEZA 2Q04A 2B2YC 4GZYC 2OF1A 4IUPA 4XXEA 3GDEA 4GN5A 1RKNA 1QOHA 5COYA 3X3NA 4R8IA 1P8LA 1QZGA 2ES2A 4QMGA 2Z11A 3CDXA 4PXDA 3A54A 2P5ZX 5C4ZA 4A3IH 4CAWA 4RKBA 2D0PA 3V2TA 2QYVA 1Z6HA 1AP0A 2AFUA 2PJ2A 5JVG3 1BKBA 3LODA 4OP4A 3H6MA 1NJIC 5E96A 1GOZA 1SNOA 2J8RA 1B9NA 3VYUA 3T8WA 4V190 1EY5A 2Z3NA 3AMUA 1GD7A 3MA2B 4DAYA 2UUAL 4LWCA 4EQ5A 2E5LL 2WIIB 1WTQA 1EIHA 2CY2A 2ZXPA 4IURA 3VDYA 1I4HA 3D7DA 2PO4A 1CJWA 2CCZA 1BCPF 3CXQA 3N6RA 4TQUS 1NAPA 3CPAA 4KMUC 1VHOA 2OZUA 2CW0D 3R96A 1KQSA 4ONUA 2PPBC 4HN7A 3GTGB 3ND9A 5M3FG 5CBMA 2ZEFA 1MD2D 2K33A 1FGBD 4DXGA 4YCUA 2VL1A 1TS4A 1RO5A 3PMFA 1H95A 3IC1A 4MHDA 4A31A 1RCVD 2KCMA 3SEBA 2A74C 2LFNA 3P20A 4LFAQ 1JWMD 1ELMP 2RF4A 4MHPA 1W2BA 1TXRA 4EX5A 2L4NA 4CDFC 2A68D 1XFOA 4B6ZA 3GD7A 1ZXTA 2Q2UA 4A3JH 3R3OA 4GKKL 1S5FD 3S14H 2YU9B 1TF9A 4JYWA 1YI2A 4RHSA 1SMYC 2F0PA 4BXXH 2E2JB 4HKFA 4JBMA 4NSQA 1I4XA 2NN6G 1NSNS 4ZLTF 1LTID 3IEHA 3KDFB 1RF2D 2ICIA 1MJAA 1LV9A 1SYCA 3W2DA 2E2IH 3TP5A 4C56C 1B4OA 1ARMA 5I0CA 2JA7G 3RN5A 4TVAB 4CGLA 3C1FA 3FIXA 1LTRD 2F0HA 2K03A 2PI2A 2K7VA 5C0XG 1X55A 3D67A 4CDCC 3A56A 3KF8B 3V05A 1L0XB 1ZYRD 3BYYB 2EJFC 1DD2A 4DUZL 4G4KA 4ZKBB 1SROA 2O4XA 1ON0A 3RUZA 4A4IA 5IYCG 4FP5D 2ZXVA 4AVBA 1B87A 2CNTA 4MFLA 4F9VA 1Q2DA 4TSSA 1J5EQ 1LT6D 3U9OA 5JVH3 3TCVA 4L8JA 4A3GG 2H4OA 4XT1B 2VQFQ 3W6XA 2QA4A 3HKSA 2BDOA 2L9HA 4POGA 1Q2CA 3D2PA 5E7NA 5AG7A 3RYOA 2Y0SB 4CGOA 1S5CD 2A69D 2GVBA 3T90A 2QGQA 1SXTA 4QGUA 1B7YB 1TIQA 3I72A 4FVMA 4A95A 1YHAA 3FKIG 1JWQA 3CP0A 1TWGH 1OZPA 5I9OA 1YJWA 2J8NA 1IYLA 2SDFA 3FRPB 2Y0MA 4B3RQ 4ME5A 2VBQA 3K80C 4ZY2A 3CQZH 1WTVA 3WC6A 3K8AA 1PH4A 4L5RC 1YNJD 1EY7A 3T51B 2RSNA 4DK3C 2HUGA 4OO1H 2UXDQ 2AFMA 2JBJA 4MCQA 4DR2L 5M5XB 4QY7A 3F2DA 4M6IA 4LFCQ 1HUMA 5JOBA 3J7A5 4TWEA 4C2YA 1Y7RA 1IICA 1E22A 2YNDA 3KKWA 4TNUA 2Z6KC 4JI5L 4XQQA 2PIYA 5I2YA 3AU7A 2JYOA 5CV4A 2PDOA 3KI9A 2FIWA 1GYTA 4MI4A 1VMCA 1PTOB 3WWVA 3JVNA 1GKHA 1V0CA 2JEBI 1PUAA 2PIZA 4A3EB 1XMQQ 2NN6I 1EYAA 4KD3A 5EBDA 5AJ3Q 5ELNA 3QWNA 5FO7B 4A3JB 1C4QA 4KOUA 1NR2A 4P71A 4QC6A 3NPPA 4KVXA 5C0XI 1TY0A 2C6PA 4I49A 3B3WA 2I0QA 3NENA 4P4DA 2E2IB 4FAIA 5KTAA 3K5NA 4R4IA 4LUOA 4NXNL 2CWAA 2JEAI 4K6LA 5M3MH 3LMSA 4JXRA 3WC5A 4H0LC 1CZWA 2NVXB 3IJ3A 1WYDA 4X3UA 4F87A 1B50A 3A8KE 1I4PA 3TX8A 3H91A 3W5OA 4MFPA 3S1RH 3KL9A 4YGOA 1XNQL 3J81E 3RNUA 1CT1D 1SE8A 5GAEC 1NTGA 2ZXOA 5EPLA 3GTLH 2PJ4A 3L3OC 2CFMA 3ITPA 4B3TL 2VL6A 4UWIA 2AFOA 5KTDA 3STBD 2WAQB 4MBUA 1JJCB 5TSSA 3I4MG 1ZEQX 2ZENA 4QIWB 2Z0SA 4PQXA 3T1HL 1AN8A 2AQ2B 5AFWA 2XWJB 2B2VC 4L5QA 2YTVA 3QIAA 1XJOA 4LF7Q 1YW4A 4IK2A 3SI0A 4CGMA 2ZW6A 3FF3A 4UEFA 3NP8A 1W3SA 2NZHA 4R3KA 1E2ZA 4HMIA 4ZUIA 4MZ9A 4OAEA 1Q3LA 3K7AB 1NR4A 2F0VA 4OLLA 3CQZB 1IKMA 1VQ7A 3PO3B 2OH1A 1EOTA 2WKCA 1HQRD 2QIRA 5EPJA 5IE8A 1E2WA 1ENCA 3PBBA 4HSVA 2KOLA 3SDZA 3GTQH 5L37A 1N9WA 3KHXA 1FVIA 2I46A 2E75C 4KY6A 4DV0L 4HCEA 2R7ZG 3TOBA 4LAAA 3HFZB 5I4MA 2NZ1D 3K6OA 2F0OA 4Q5VA 1V1PB 3GIUA 1GUSA 2J9AA 1PXUA 5C3WA 2JBKA 1E24A 2REFA 1XNRL 5HMNA 1S3OA 2R92G 1FR3A 3E5SA 1JE5A 4O1NA 3CC2A 1YSJA 4CGNA 4LF5Q 5EQ0A 1DXMA 3NWTA 2D4PA 1UWVA 3D66A 4IPHA 1GJXA 2PC1A 4RI1A 1YHBA 5IGDA 4RS2A 5M3MB 1ENAA 1Z8LA 1SFOH 1QB5D 3A74A 2MNAA 5DWNA 3AFPA 3PUXA 1FT7A 5THWA 2B2YA 3LWUA 3EJIA 2YV5A 3B3TA 2AHOB 5FVJA 3S1RB 2Q4VA 3W6SA 4B10A 3NE7A 2NN6H 4X62L 4KD4A 4ZX9A 2N88A 1A3VA 1FJGL 1I94Q 4ZYQA 3GTLB 2G0BA 2QMLA 1K3BC 2ZOFA 3WR7A 5HVGA 1PRTF 1LAPA 2PNHA 1HZAA 3T56B 2NWGA 5C0XH 3S6GA 1KNEA 1BCPD 3DMUA 1VQEA 3M4OB 3KYHC 1ICWA 4HIOA 4YWMA 4KY5A 3GB0A 1U5KA 3KZWA 4KS9A 4JI0Q 4A3KB 2YTYA 2JSOA 4KV6A 3NH5A 5CYUA 4YHHQ 4H89A 1SYFA 1GXDC 4DV4Q 3T13A 4A3GH 2BE5D 2JLMA 4A3MG 4DNIA 3GO5A 4MJ8A 4P4BA 1CKNB 1CM0A 2K05A 4FXDA 1I3QB 2OTJA 2FMMA 1EY8A 3I4LA 3TZDA 4ID6A 3RNZA 1X3GA 2ATRA 4NEXA 2ZEDA 4CJ2C 3BVGA 1STEA 1FNOA 3KJOA 2Z10A 3GYAA 3TQYA 3GTQB 4XNHC 5BN4A 2F0TA 2RBMA 4EVOA 2FS5A 1UE7A 5C5LA 1M4LA 3OWEB 1DOKA 1M4VA 1PH6A 3CU7A 4XIGS 4DXFA 4R4CA 4EQNA 2F03A 1SE4A 4OWXB 4LF4Q 1PYWD 3SXOA 1D5ZC 1HR0Q 3HKZB 1ZG7A 1IBKL 2EJMA 4QVTA 3K0YA 2ZW7A 1IY7A 3CAMA 3NBHB 4ZI6A 3H0GB 4NCZA 1SE3A 1L1OC 3HOUG 1FNVA 4JI3L 2OQKA 4EMEA 2JA8G 4JI6L 3QO2A 3PFOA 5I6YA 3BDLA 4X6AH 4QCLA 4DV2Q 1Y0RA 1R4PB 4LFAL 1SNMA 1I4RA 4K5VA 1TT2A 2QILA 2FINB 5JEAH 1VF5C 1EU3A 1BNZA 1K3RA 4IJHA 3CT9A 1AZQA 3NHHA 1QUQB 1KLGD 2DY8A 1MJCA 1CQVA 2A5HA 5DAUA 3J80c 3S15H 4HIKA 4JV5L 3KQXA 3R9EA 5J8FA 3KBGA 2XN9C 3FEWX 3BU2A 3S2DH 4MCPA 1EIGA 4R6TA 4YRHA 2FFKB 2EOTA 1MGSA 3CHBD 1KD1C 3A0JA 2B2TC 3PP9A 2F3WA 5LRKA 2F0UA 1UFHA 5FO9B 1Q81C 1SMYD 3B2YA 1Q82C 3U4ZA 2VXWA 3NFZA 3NBIA 2G9DA 4L5TA 1STGA 4JI2Q 2F3VA 3P75A 1JR0D 1GM5A 2JEVA 3T9YA 4P4IA 3I4MH 1TS2A 4ZY1A 1I50B 4DR1Q 3T1YQ 4RWSC 5I9PA 3TZUA 3BDOA 5FLXE 3J81i 2VQFL 3TT2A 4E6IA 5IYBG 1K8GA 2RFHA 3BJ8A 2X6GA 3DXJC 3EBEA 1DONA 1ENFA 1JMCA 1ZG8A 5EC4A 5C4JB 1Y14B 4MN3A 3TDQA 1N32L 2M00A 4DR5Q 1V43A 1STNA 4HR7B 1G291 4GKJQ 2JDDA 3K9TA 3GV6A 3T16A 1EOVA 1LACA 2KBNA 4M3SA 4IUQA 2IHEA 1M4GA 4B3RL 1TKFA 1LLRD 1CX8A 2EBJA 1X12A 5ELBA 2UXDL 4A3FH 1OO9B 1SNQA 2R7ZH 1X3EA 4DR4Q 4KK7A 4LFCL 4ALPA 3CPXA 4C3JG 3G4SA 3B6YA 1TU2B 4KSAA 2F52A 3TBIB 3DNSA 4HJ9A 1I6HH 5KYLA 1R3NA 4C2ZA 4S3SA 4AIMA 4HIDA 2AUKA 2R92H 2AMCB 4DV1Q 1EYDA 1K0RA 1TWHB 1XMQL 4B11A 2PQAA 5AJ3L 1OXVA 3J80L 5DM73 3S15B 2UUBQ 2WSAA 3O13A 5CMDA 4UCPA 3VARA 2IL4A 1N36Q 1YGHA 2C1CA 2HV2A 2K5NA 5AG5A 3S2DB 3URYA 1N34L 2B2VA 2XEIA 3H09A 3GTOH 3MXNB 4RAUC 2X69A 1ZLHA 2VQYA 3NH4A 1HH2P 4PZ6A 5GAHC 1HHVA 1Z7TA 3OTOQ 2PR8A 3CXCA 2H5XA 1LFWA 5F09A 4QUSA 1XYIA 2VEZA 4IUUA 4NGNA 2ODFA 2PJBA 4JBKA 3D4UA 3R9GA 1UE6A 2VZYA 1F9QA 4NGSA 2Y0SG 2CTBA 1SJHD 3QG1A 4A3DB 1F9RA 1VQIA 5IOCA 4HNYB 4ORFA 1BR9A 4PNYA 4QUCA 3RMHA 1MK4A 4OC3A 3EA6A 1QSMA 2AQ1B 2CQOA 4B08A 1E1TA 3I8ZA 2VW9A 4ZCKA 2SOBA 4A3MH 3PBEA 5IYDH 4CPAA 1G8ZD 1IU8A 1KHIA 4UP7A 4WJWA 3DUZA 3DLLA 1U4MA 4R57A 4LF6L 3NA6A 2ZEEA 4Q0FA 3M4PA 4YU9A 1WTPA 4A93H 2B3UA 1CA6A 4JI8Q 1G6PA 2CVRA 2I00A 5C6AA 1TWCH 4A3EG 4FXKC 3ERQA 5E1FA 1ONLA 4RHRA 4XQNA 4PZ8A 5FO8B 4DK1A 5GAGC 4A3JG 4MRIA 4IUVA 4BXXG 1VQGA 5HVFA 5JJLA 2WV6D 2PQ8A 3RLNA 3S16B 3M4QA 3D7GA 2XEFA 4C1NI 2GA4B 1L0CA 3NUCA 2V8GA 2JK8A 4X65L 4FO2A 1K83H 3RD4A 4GS3A 1S5DD 3H3VI 3KGQA 4GS4A 5JAVA 4OWWB 1BLLE 4A33A 1M44A 4JI1L 4B5PB 4GN4B 1F9PA 1PCAA 1NSLA 4FBEA 4LF5L 2PJAA 2GE3A 2BUEA 3GTOB 4MNOA 5NUCA 3MXGA 2EYHA 3RZOH 2KCTA 2E2HH 3HLPA 4CKBA 3PRTA 2TMPA 3W3AA 3D4DA 3RO0A 2WAQG 1VQ8A 3MXPA 2VS1A 3VYRA 3H3VC 4R4TA 1I94L 4YIJA 4OX9Q 2GN5A 4KOVA 4DFAA 1AUGA 2WAQE 3JC66 4MHNA 2EQSA 4ME3A 5ISRA 2EJGC 4KOYA 2DNEA 5CV9A 1XE4A 4JYAL 1XX8A 3CXPA 4MFZA 2CNMA 2V8DA 2P6EA 3D3RA 4YHHL 3OPOA 5CBAE 3VYTA 4DV4L 4DK0A 2F1MA 4OO1G 1Y1WB 4KN4C 4YWKA 3PO3G 1IL2A 4TKOB 3RZAA 4NF1A 4CRYB 2FL4A 3ER0A 4PMBA 3EXNA 2F4VL 3PB6X 5IYBH 1PFMA 2OZGA 4A93B 3K81C 4C3IB 3AB9A 1Q46A 1L1OA 2O5JC 4MHEA 3JAMc
chains in the Genus database with same CATH topology
1LTAD 5C44B 5JEAJ 2HCIA 1KNAA 2B2WC 3SJGA 5LHY1 4RH6A 5BN5A 5K8MA 1K83B 4RFBA 3BHXA 3S1NB 3PFEA 3OMGA 4OC4A 1SBBB 3DLJA 3S1MB 5ELCA 4DNTB 3C3LA 2QCPX 5EPKA 3RAMA 3I90A 3DHQA 2A6EC 3PB7X 3IFTA 2J4XA 1XWEA 1KABA 1HDUA 2AFSA 1TKWB 4AXVA 1O78A 3IAYA 2FMCA 2K6AA 4B9XA 2RB7A 2V77A 5I4DA 2DNCA 1OBRA 4K2KA 1WCMB 2ID0A 3V38A 3A8IE 2KCNA 5CR3A 3FPUB 5EBCA 1HEEA 4OO1I 2N55A 1MSGA 5LYIA 3KLSA 1QNKA 3K59A 4FXGC 1A6XA 2PJCA 3WABA 3WC7A 2F0WA 3B7IA 4C2MB 2XEGA 4WFN3 4IHMA 1PTOF 1ESFA 1PLFA 2KCCA 3BS1A 3OWFA 1LABA 2F0JA 3SK5A 1WVLA 5IB9A 3TP6A 3A55A 4BWGB 3WOEA 4A3BB 1PTOH 4G7HC 4A37A 1JICA 5A35A 3FEEA 3L9AX 3KR5A 2MJ8A 2YYZA 3S9MA 2C9OA 1SE2A 2EY6A 5KYIA 3Q6SA 2Q8RE 2BOAA 1WTXA 4OIWA 3G7LA 2HQEA 1ZLIA 1TIID 3DM1A 1ET9A 1V8QA 1H9MA 2Z1CA 4Z9CB 5G3LD 3DWPA 2MP1A 3QOLA 3M85A 1BQQT 4DUKA 4DN4M 4R9WA 3NTHA 1QG7A 4UIBA 3IFEA 4H13C 2PVVA 5CBEE 1WD1A 3A7LA 2QEJC 2PZWA 3TSSA 3NTIA 3MHBA 3I70A 1Y0YA 1KDCA 1JB3A 1Y1VB 4EQPA 5A2QL 4OGQC 2KQ3A 1H8LA 1TWAB 2F0GA 3DEPA 1E0BA 2XRQD 3D7FA 2ENBA 4AYBB 2PW7A 1C8CA 4NFRA 1TS3A 1RHPA 1EU4A 3QB3A 5D65A 4RUHA 1U4RA 1BAVA 2R93B 2K1BA 3GTKB 1BOSA 5JEAG 1AZPA 2OR4A 4NMZA 5M9OA 2F8HA 3IO1A 4XQJA 2B63B 2F7VA 1DJRD 1IGBA 1YNNC 1I4QA 1Q1EA 4CJ1B 4KTAA 4DA2A 1BXTA 4R7MA 4UAIA 5IT9E 4IALA 5J1QA 4OC1A 1CM9A 1Y8NB 3WDNA 5E4WC 4MHYA 3FDTA 4ZUJA 1BDOA 4G57A 2RA4A 4F88A 1LTGD 5IODA 2XWBB 3PIO3 2OOTA 4ZQ3A 2WZNA 2EY5A 1EWHA 1EEFD 2CTCA 3D31A 3B35A 4PXCA 5KIXA 2J7ZA 2M2LA 5BN3A 1F2YA 2EY1A 3OW7A 1PRTC 2ZELA 3ZYYX 3M7NA 2K28A 3PO2B 2I3CA 1QE6A 1UUPA 1XTCD 4K8JA 3NSWA 1R9TB 3M4YA 4K3NA 2I07B 2JA6B 4QUFA 2F0KA 2C6CA 1S5BD 3S2HB 3NK9A 5LRGA 3SK4A 2EK9A 1JORA 1SYBA 4BY1B 2MHVA 4BBSB 1JOKA 1NSAA 2VUMB 3HOZB 2D5DA 3KHZA 4R8FA 1O7YA 3D68A 4YWYA 2PQEA 1HDQA 3J7AF 4K5WA 3MC0B 2PJ1A 2RKSA 1EZ6A 1QJOA 2RQXA 3IIBA 2L55A 1RTQA 2R6GA 4X2TA 4FF3A 3Q23A 1S4ZA 4L6TB 1HQMC 5KNCA 3HOVB 1Z2LA 4P2CB 1EEID 1OXUA 1HXYD 4BS9A 4WRDA 2A6ED 5CORA 5T1GA 2VB2X 2Q8TA 1FD7D 3OIPA 1EY4A 3I4NB 1SDFA 5KRUA 1DE4C 1F2LA 4I7ZC 4P10A 4C1NK 4NGTA 1D1KA 5C3XA 1B3AA 1B1ZA 1JCKB 3GTJB 3BI1A 2KEEA 1G91A 2JE6I 4KSIA 1V1PA 3N52A 1JE4A 3VATA 2AWNA 3WOFA 1LANA 4X3KA 4BBRB 2QVPA 4FWUA 3ONAB 1G6ZA 5KGUA 4LQGA 5M5WB 4ZK9B 2ZEHA 1TWFB 4CBVA 4MCRA 2K5QA 1KAAA 2PZTA 4LJZC 1Q90A 4J6HA 1NCVA 1A15A 4K14A 3D4WA 1L0YB 3I73A 1E2VA 3J7AV 2EVBA 1II3A 1B44D 1PZID 3GUXA 2Z4HA 2ZEPA 4NJRA 2G9HD 4HEDA 2IMOA 1PMRA 2CQAA 2IJZA 3HG9A 2R61A 1JC7A 3B3VA 4KHZA 3TN2A 5IGEA 4CHTB 1EY0A 1SYDA 4BY7B 1TVXA 1A2TA 1O80A 4OIDA 1T5EA 1KDAA 1Q8IA 4W9YA 3VR3A 1YMEA 2WP8J 2JA7B 1TR5A 5D3IB 2IX3A 1ELLP 2CIJA 2BA0A 1SNPA 1XMBA 2KHSA 2K04A 1W6KA 2NVYB 1HTLD 3Q0AA 4M8AA 4P44A 3VR5A 2V8HA 3BXMA 2QF7A 2XRSD 2PCUA 3LX0A 1EYCA 3OHXC 4EGVA 1X32A 1H9KA 1AMPA 1PDQA 2CW0C 5JPNC 1F77A 1Y8PB 4PPZA 2PNRC 5LYFA 2NUCA 1UWYA 5J1ZA 1KTKA 1OXSC 1VHEA 4H7BA 4OC5A 1HA5A 1TQOA 4OMEA 3PV0A 1RTNA 3LWEA 1HPCA 4UEEA 1GUNA 2F0MA 4ODGA 4DAPA 1BPMA 4KN7C 1LAMA 4OIKA 4RKLA 3MN8A 1ZKOA 1MI2A 4ILWA 4KI0A 4HSPA 1R4QB 2PZUA 2K5WA 4C3HB 4XDXA 4MMOA 1D6EC 1VDZA 5LYDA 1Y69U 2EPBA 2RSOA 2M9VA 2GLJA 3M3YB 1UNSA 2L1BA 1IYUA 4PMWA 4O42A 1BO0A 5JGFA 3HP3A 5C3EB 3IWWA 1QWYA 5CC4A 4X8IA 2TSSA 4PV1C 2PRQA 3PB4X 4XTCS 1YNND 3F2UA 2JP1A 1R43A 2PJ6A 4DNRB 3PUWA 5C4XB 7CPAA 2NTTA 2DN8A 3VR6A 4NGPA 1DOLA 3GTPB 3FPPA 1D2BA 1C48A 1XBUA 3KUPA 2QJ8A 3D6WA 3HGBA 3TP7A 4GM5A 2IW3A 2SEBD 2FVGA 1Q12A 2A73B 2F0QA 1X3QA 5M5YB 1BUVT 1CI3M 4KKSA 2VNUD 3H8FA 5A2QE 3S17B 3HUVA 3NXWA 1KLUD 1PRTD 5EKIA 4NGMA 2HB6A 3RLFA 4Q7AA 2NVTB 1WTWA 3FMCA 2BDNA 3S1QB 5DEHA 3NH8A 1DYQA 4P6YA 1O7ZA 4I65A 3HOWB 1DOMA 3K2KA 1YLOA 2EWBA 3DEOA 3V7ZA 1RTOA 4P45A 1IL8A 2RVLA 1AYEA 3NTKA 2PJ8A 4FF4A 2KEDA 1U9RA 1Y7EA 5K5PA 3H8GA 2PMZB 2AQ3B 3OOCA 3HEJA 1CQFA 2ZEOA 2FJ2A 1PYTB 3FX6A 4ZYSA 5J22A 4IUTA 3C46A 3I1UA 3SHLA 4FYDA 1VMPA 2EXZA 3Q22A 4IFDJ 1STBA 3A7AB 2ABZA 3MFGA 5D14A 3IL8A 1XXGA 3U9SA 3FH4A 5HVHA 3A8JE 3PUZA 5EJWA 2GLFA 2D9UA 3M7GA 1K8OA 1I6VC 2ZEMA 1A3TA 2B2UC 1A3UA 3QNVA 3HRZC 5LL6S 4R76A 4LMQD 2BO9A 1PTOC 3BDCA 1IW7C 4HTHA 4KJOA 1BPNA 1FNWA 1ARLA 2X6LA 3KASA 2B2TA 1LTTD 2B8GA 5LRJA 1D1IA 3I3CA 2F0SA 4Y7NB 3KR4A 2PJ3A 1NUCA 2NBFA 5CPAA 3WT4A 5JH9A 1CK1A 2L5TA 4Z65A 1EFID 2O2LD 5T1IA 1Q1BA 4MXUA 1PFBA 1EZ8A 2EYFA 1HUNA 1DM0B 6CPAA 3SJFA 3D6CA 4J1MA 5I2XA 1CP7A 5CV6A 4ONWA 4FF2A 3GLJA 2V8VA 2NVQB 5KNDA 1H9SA 4XYQA 1X3PA 3K5MA 3HS0C 3JAML 5FLXL 3SVMA 5DNFA 1I4GA 4IAVA 1Q7LA 2F0NA 2AUJD 3MZ5A 2ICEC 2HCCA 4JK1C 4RCNA 4ZX8A 3NQIA 4BA1I 1QNUA 2F0DA 4CKEA 1STHA 1G2SA 1STYA 1ILPA 2MUYA 1J8IA 1AW7A 2DY7A 4OKOA 4F7XA 3TMEA 2EYLA 3VR2A 2O5IC 5EKLA 3SE0A 2PJ5A 5IGFA 1CG2A 5K36H 4C3JB 2WACA 5FKAC 2JA5B 2LKVA 2CF4A 4ZAIA 5D8NA 1FNUA 1ZG9A 2KA7A 3FEDA 4RGMA 4P4EA 1EQVA 1RD9D 1QQ9A 2ZOGA 3OIQA 3D8GA 5I6WA 3RZDB 2PE3A 4K8IA 1U4PA 2SNSA 4A3IB 4DYOA 4A39A 2XVSA 2PJ9A 1J9OA 1PZKD 4G7ZC 4IFDG 3E0JA 2A6HC 1JWSD 1ML0D 2C6GA 3EQLC 3R93A 3ISXA 4N9TA 1LT3D 1GUTA 2EDGA 2KUMA 3PB9X 3BVMA 5IGBA 1LT4D 4IQZA 4PXBA 1B53A 1Y8OB 4CGYB 5CV8A 1CZGA 3PUYA 4C3HG 4CJ0B 1KWMA 4MIUA 3CRKC 3BI0A 3KF8A 3ISZA 1V1OA 4KY7A 1BCPB 1G2TA 1U4LA 5LL6X 3S14B 2IWHA 2XNAC 3BVZA 3J80E 3S9NA 5K8NA 3KK7A 3MEHA 3EVQA 4XT3B 2GU2A 4RGTA 1H9RA 5E3FA 4FF1A 2FHTA 4U68A 3EROA 2RDHA 3VYSA 1QMUA 5J39A 4A38A 1DCZA 3QJYA 4EQOA 3MRUA 4P4JA 2F4IA 3SK6A 1CP6A 4IFDI 1LTBD 3EFXD 1VF7A 2L0CA 4DAVA 2B2WA 2B2UA 1BBXC 4QF4A 3GTMB 3HZXA 1SNDA 3SK8A 1SJED 3D4RA 5IIFA 1TWGB 1VGYA 4MCSA 4HMJA 2JXMB 1LCPA 4H44C 2EE1A 1EY9A 1WD0A 3GV3A 1SYGA 3HOXB 5ELEA 1MBYA 1CBXA 1F2PA 2L12A 3BZDB 2ZT9C 3LNNA 3K57A 3HOYB 4NGRA 3K58A 3L7ZC 1Z5RA 2WB1B 1QILA 3Q24A 1PTOD 5KNBA 4HAEA 1IW7D 1IYVA 1D5XC 1SNCA 2Z4IA 1EY6A 3R2IA 4K6DA 4CKCA 3PB8X 1WTRA 1GUWA 1QCBD 3NQTA 3L2NA 2HC9A 1O7LA 4PMCA 4TRDA 2RDGA 2K32A 3VR4A 3K5OA 3I91A 1SYEA 1HCZA 5HXDA 3BG3A 3NE5B 1BF4A 2XSCA 1LO5D 4KJNA 4B9WA 4FNFA 2Q43A 5F2DA 1EQTA 1RODA 1JOQA 2DEAA 4C3IG 3FECA 8CPAA 2JA8B 3SI2A 2K5DA 1RDPD 1MSHA 4OL7A 4RGOS 5E4XA 2LS01 3TC8A 3NWSA 1OXTA 3GP7A 4IFDH 2E74C 3DWQA 1F2ZA 3C1EA 4OC0A 2PYKA 5EGTA 3MWYW 3H8EA 4RA8A 5K8PA 2QKIC 5ELFA 1GUOA 2B8FA 1SSOA 1LOKA 5M3FB 4BA2I 3OMCA 3SJEA 4WWVA 4PQAA 5HGTA 4J8QA 1CPSA 2NYZD 2R3ZA 3OSOA 4M1UB 2PVWA 1SFOB 2HDLA 3MVVA 4X3SA 3D7HA 3GQBA 2NYQA 1K8MA 3KQZA 3FJUA 4A94A 4HCSA 5IGGA 2KVMA 5C4HA 1GUGA 3SI1A 1PZJD 2XEJA 2RDFA 4LK1C 4F8MA 5DM63 4G1PA 4A3GB 2B39A 4PXEA 2LMCB 1CHPD 3CKIB 3E6ZX 1HFGA 1PRTB 3NBHA 2HDMA 3T4AC 4UDUC 4NJQA 3JAME 4WORA 2EZVA 1FYCA 1UEAB 2H1EA 2EY2A 2E76C 1F2MA 3FVLA 3FKIB 3MXUA 4QB4A 4DJLA 4UF4A 5JPMC 4OIJA 4XYOA 1CFMA 2A68C 1GHJA 1B9MA 2ZEGA 3IKJA 4MHZA 5D29A 3PUVA 3S9WA 4R8NA 3N5FA 1AEXA 1DTDA 2AFXA 2D2CC 2K01A 2OEOA 2PW5A 3RBUA 3SR1A 1Z47A 1A2UA 2A6HD 2GREA 1ESRA 2J0TD 4RGNA 4BD9A 1JQYD 1ILQA 1JQGA 1ZYRC 2EYOA 2EYPA 3C2PA 5C5MA 2IT1A 4DF7A 3FVQA 4OC2A 3QOJA 5CGKA 1STAA 4U673 4IUNA 2PJ7A 1OXXK 2PJ0A 3BYTB 3PIP3 3J81L 5IT9L 4ZKCB 1JOOA 4IZ8A 2A69C 1HRJA 3V96A 2EYJA 3TP8A 1TKHA 2D62A 2WKDA 4H2KA 3JRUA 4NP5A 3VA7A 2ZXRA 2BA1A 3I4MB 5D3DA 1YNJC 2POKA 2IL8A 2NSMA 2IQ6A 3KLRA 1YW6A 1CPXA 1UAPA 5ELDA 5ELYA 2SNMA 2MPMA 3R8BA 1M8AA 2IX1A 3H94A 4KHVA 5FOBB 3KLSX 3P7JA 1SAPA 3MTSA 3CRLC 4ULLA 1AFPA 3P1HA 1DZ1A 1RJTA 2IJ0A 1S5ED 3SXHA 2AFZA 2BOSA 4L63B 2NTSA 3S9LA 4F9UA 1LTSD 2Q51A 5CV7A 2C5CA 2BCOA 5G3LF 5JJZA 4A3FB 2R7ZB 2O53A 3SJXA 5K36G 2EK8A 3T53B 3MXNA 5HURA 1HFNA 4ZRZA 3J7YW 1I6HB 1IHZA 1EL0A 2L11A 1WTOA 1F9SA 5KEEA 2R92B 2KJXA 1EWCA 3DWAA 5C0XJ 4O23A 1JWUD 5EKKA 4V0BA 4NDXA 1VIXA 4ABNA 4FUUA 2AFWA 1PFNA 4WJBA 4F8ZA 2NB0A 2Q8IB 1LT5D 1KDBA 1ET6A 5LYLA 1TF8A 4X3RA 1TY2A 4OHJA 4DGZA 3UI2A 2CHBD 2OT2A 5JM6A 5CV5A 3DGVA 1CHQD 4K2LA 4NW2A 4UIAA 1HA6A 4G7OC 2IX0A 3PEIA 2PCFB 5DS0A 3K5LA 1TS5A 4A3MB 1IKLA 2XIWA 1T5XD 4JBWA 4DU9A 2Q4ZA 4NKLA 4KKTA 2QDBA 1CTMA 1H9SB 1XRYA 1CA5A 3VH9A 4KKUA 2JEWA 1D5MC 5FK9C 1TWCB 2WYRA 1SEBD 2WINB 5K8OA 2E2DC 2MGSA 2F0LA 1B2TA 2LY7A 1GHKA 5IGCA 1F2OA 1EE3P 3HOUB 4JZ0A 4EFDA 2VB3X 3ND8A 4IN3A 3X3MA 3B3SA 1BCPC 3G6JB 3R2TA 2F0FA 2IPKD 3KBXA 2ANPA 4ZY0A 2V4DA 4N9PA 3B3CA 2KECA 3RZOB 4NGQA 3VA5A 2E2HB 1F57A 2BE5C 4K5XA 2F0IA 2O4HA 2OXPA 4RCOA 4EWTA 2AWOA 3IFDA 1VCIA 1HTPA 1W6JA 3MFYA 1TKJA 1H9JA 2F0EA 2Z8LA 4X3TA 2EYMA 4P4FA 3MAQA 4UEZA 2B2YC 4GZYC 2OF1A 4IUPA 4XXEA 1RKNA 1QOHA 5COYA 3X3NA 4R8IA 4PXDA 3CDXA 4QMGA 3A54A 5C4ZA 4RKBA 3V2TA 2QYVA 1Z6HA 1AP0A 2AFUA 2PJ2A 5JVG3 4OP4A 3H6MA 1GOZA 1SNOA 1B9NA 3VYUA 3T8WA 4V190 1EY5A 3AMUA 3MA2B 4DAYA 2WIIB 1WTQA 1EIHA 2ZXPA 4IURA 1I4HA 3D7DA 2PO4A 1BCPF 3N6RA 4TQUS 1NAPA 3CPAA 4KMUC 1VHOA 2CW0D 2PPBC 4HN7A 3GTGB 3ND9A 5CBMA 2ZEFA 1MD2D 2K33A 1FGBD 4DXGA 2VL1A 1TS4A 3PMFA 3IC1A 1RCVD 3SEBA 2A74C 2LFNA 3P20A 1JWMD 1ELMP 4MHPA 1TXRA 2L4NA 2A68D 1XFOA 4B6ZA 3GD7A 1ZXTA 1TF9A 3R3OA 4JYWA 1S5FD 2YU9B 4RHSA 1SMYC 2F0PA 2E2JB 1I4XA 2NN6G 1NSNS 4ZLTF 1LTID 3IEHA 1RF2D 2ICIA 1LV9A 1SYCA 3W2DA 3TP5A 4C56C 1B4OA 1ARMA 3C1FA 1LTRD 2F0HA 2K03A 5C0XG 2K7VA 3D67A 3A56A 3V05A 1L0XB 1ZYRD 3BYYB 2EJFC 1DD2A 4G4KA 4ZKBB 2O4XA 3RUZA 4FP5D 4F9VA 4TSSA 1LT6D 3U9OA 5JVH3 4L8JA 2H4OA 4XT1B 2BDOA 2L9HA 2Y0SB 1S5CD 2A69D 1SXTA 3I72A 4FVMA 5I9OA 2SDFA 3FRPB 4ME5A 4ZY2A 1WTVA 3WC6A 4OO1H 1YNJD 1EY7A 3T51B 2RSNA 2AFMA 2HUGA 2JBJA 4MCQA 5M5XB 1HUMA 5JOBA 4TWEA 4TNUA 4XQQA 2PIYA 5I2YA 3AU7A 2JYOA 5CV4A 3KI9A 1GYTA 1VMCA 1PTOB 2JEBI 2PIZA 4A3EB 2NN6I 1EYAA 4KD3A 5EBDA 3QWNA 5FO7B 4A3JB 1C4QA 1NR2A 3NPPA 5C0XI 1TY0A 2C6PA 3B3WA 4P4DA 2E2IB 4FAIA 3K5NA 2JEAI 4K6LA 3LMSA 3WC5A 4H0LC 1CZWA 2NVXB 3IJ3A 4X3UA 4F87A 1B50A 3A8KE 1I4PA 3TX8A 3H91A 3KL9A 3J81E 1CT1D 2ZXOA 5EPLA 2PJ4A 3L3OC 3ITPA 2AFOA 2WAQB 5TSSA 1ZEQX 2ZENA 4QIWB 4PQXA 1AN8A 2AQ2B 5AFWA 2XWJB 2B2VC 3QIAA 1XJOA 1YW4A 4IK2A 3SI0A 3FF3A 4UEFA 3NP8A 1E2ZA 4HMIA 4ZUIA 1Q3LA 3K7AB 1NR4A 2F0VA 3CQZB 1IKMA 3PO3B 1EOTA 2WKCA 1HQRD 5EPJA 1E2WA 1ENCA 3PBBA 4HSVA 2KOLA 3SDZA 3KHXA 2I46A 2E75C 4KY6A 4HCEA 4LAAA 5I4MA 2NZ1D 3K6OA 2F0OA 4Q5VA 1V1PB 1GUSA 2J9AA 1PXUA 5C3WA 2JBKA 1FR3A 3E5SA 4O1NA 1YSJA 5EQ0A 1DXMA 3NWTA 3D66A 1GJXA 5IGDA 5M3MB 1ENAA 1Z8LA 1QB5D 5THWA 1FT7A 3PUXA 2B2YA 3LWUA 3EJIA 3B3TA 3S1RB 2NN6H 4ZX9A 4KD4A 4ZYQA 2N88A 1A3VA 3GTLB 2ZOFA 5HVGA 1PRTF 1LAPA 3T56B 2NWGA 5C0XH 1KNEA 1BCPD 3DMUA 3M4OB 1ICWA 3GB0A 4KY5A 3KZWA 4A3KB 4KV6A 2JSOA 3NH5A 5CYUA 1SYFA 1GXDC 3T13A 2BE5D 3GO5A 4P4BA 2K05A 4FXDA 1I3QB 2FMMA 1EY8A 3I4LA 3TZDA 4ID6A 2ZEDA 4CJ2C 3BVGA 1STEA 1FNOA 3GTQB 5BN4A 2F0TA 2RBMA 4EVOA 5C5LA 1M4LA 3OWEB 1DOKA 1M4VA 3CU7A 4XIGS 4DXFA 4EQNA 2F03A 1SE4A 1PYWD 1D5ZC 1ZG7A 3HKZB 2EJMA 3K0YA 1IY7A 4ZI6A 3H0GB 1SE3A 1FNVA 4EMEA 3PFOA 3QO2A 5I6YA 3BDLA 4QCLA 1Y0RA 1R4PB 1SNMA 1I4RA 4K5VA 1TT2A 2QILA 2FINB 5JEAH 1VF5C 1EU3A 1BNZA 3CT9A 1AZQA 3NHHA 1KLGD 2DY8A 1CQVA 2A5HA 5DAUA 3KQXA 3KBGA 2XN9C 3FEWX 4MCPA 4R6TA 1EIGA 2FFKB 2EOTA 1MGSA 3CHBD 2B2TC 2F3WA 5LRKA 2F0UA 5FO9B 3B2YA 1SMYD 3NFZA 2VXWA 3NBIA 2G9DA 1STGA 2F3VA 3P75A 1JR0D 4P4IA 1TS2A 4ZY1A 1I50B 4RWSC 5I9PA 3TZUA 3BDOA 5FLXE 4E6IA 2RFHA 2X6GA 3DXJC 1DONA 1ENFA 1ZG8A 5C4JB 4MN3A 3TDQA 2M00A 1V43A 1STNA 4HR7B 1G291 3K9TA 3GV6A 3T16A 1LACA 4IUQA 1TKFA 1LLRD 1CX8A 5ELBA 1OO9B 1SNQA 4KK7A 3CPXA 4C3JG 1TU2B 3TBIB 5KYLA 1R3NA 4S3SA 2AUKA 1EYDA 1TWHB 1OXVA 3J80L 5DM73 3S15B 3O13A 5CMDA 3VARA 2C1CA 3S2DB 3URYA 2B2VA 2XEIA 3H09A 4RAUC 2X69A 1ZLHA 3NH4A 1HHVA 1Z7TA 1LFWA 5F09A 4IUUA 4NGNA 2PJBA 3D4UA 1F9QA 4NGSA 2CTBA 1SJHD 3QG1A 4A3DB 1F9RA 5IOCA 1BR9A 4PNYA 4QUCA 3RMHA 4OC3A 3EA6A 2AQ1B 4B08A 3I8ZA 2SOBA 3PBEA 4CPAA 1G8ZD 4WJWA 3DUZA 1U4MA 3NA6A 2ZEEA 4Q0FA 4YU9A 1WTPA 1CA6A 2CVRA 5C6AA 4FXKC 3ERQA 5E1FA 1ONLA 4RHRA 4XQNA 5FO8B 4DK1A 4MRIA 4IUVA 5HVFA 2WV6D 3S16B 3D7GA 2XEFA 4C1NI 2GA4B 3NUCA 2V8GA 4FO2A 3RD4A 1S5DD 3KGQA 5JAVA 1BLLE 1F9PA 1PCAA 4FBEA 2PJAA 3GTOB 5NUCA 3MXGA 2EYHA 3HLPA 4CKBA 3PRTA 2TMPA 3W3AA 3D4DA 3MXPA 3H3VC 3VYRA 4YIJA 4DFAA 4MHNA 5ISRA 2EJGC 2DNEA 5CV9A 1XX8A 2V8DA 3D3RA 3OPOA 5CBAE 3VYTA 4DK0A 2F1MA 4OO1G 1Y1WB 4KN4C 3RZAA 4TKOB 4PMBA 3PB6X 1PFMA 4A93B 4C3IB 3AB9A 2O5JC 4MHEA 1XYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MMO A;  3L2N A;  2HC9 A;  5LYD A;  3SJG A;  5HXD A;  5K8M A;  2GLJ A;  2Q43 A;  3BHX A;  3PFE A;  4OC4 A;  4ZY2 A;  3WC6 A;  2AFM A;  2DEA A;  3FEC A;  8CPA A;  2JBJ A;  5JGF A;  3DLJ A;  4MCQ A;  3SI2 A;  3IWW A;  4TWE A;  3RAM A;  4X8I A;  3PB4 X;  2PRQ A;  4TNU A;  2PJ6 A;  2PIY A;  1R43 A;  3PB7 X;  3KI9 A;  3TC8 A;  1GYT A;  1HDU A;  2AFS A;  7CPA A;  4AXV A;  2PIZ A;  4NGP A;  2RB7 A;  1XBU A;  2V77 A;  4OC0 A;  2QJ8 A;  1OBR A;  4GM5 A;  3H8E A;  5K8P A;  2FVG A;  2C6P A;  3B3W A;  4P4D A;  3V38 A;  4FAI A;  1HEE A;  1LOK A;  5LYI A;  3LMS A;  3WC5 A;  3H8F A;  2PJC A;  3HUV A;  3IJ3 A;  3SJE A;  4WWV A;  3WAB A;  3WC7 A;  3TX8 A;  3B7I A;  4PQA A;  4NGM A;  2HB6 A;  3KL9 A;  1CPS A;  2XEG A;  4Q7A A;  2PJ4 A;  4IHM A;  2AFO A;  3FMC A;  2PVW A;  2ZEN A;  3D7H A;  3NH8 A;  2NYQ A;  1XJO A;  3KQZ A;  1YW4 A;  4IK2 A;  4P6Y A;  3SI0 A;  5IB9 A;  3FJU A;  4A94 A;  3FF3 A;  4UEF A;  3K2K A;  1YLO A;  2EWB A;  3V7Z A;  4P45 A;  1AYE A;  2PJ8 A;  3SI1 A;  4A37 A;  1Y7E A;  2XEJ A;  3FEE A;  3H8G A;  4G1P A;  3PBB A;  3KR5 A;  3KHX A;  4PXE A;  3S9M A;  2ZEO A;  5I4M A;  3FX6 A;  1PYT B;  4NJQ A;  3I1U A;  2J9A A;  3FVL A;  2BOA A;  2JBK A;  4OIW A;  4DJL A;  4UF4 A;  1YSJ A;  2ABZ A;  2ZEG A;  4MHZ A;  1ZLI A;  5D29 A;  3D66 A;  3N5F A;  1DTD A;  2AFX A;  3FH4 A;  5HVH A;  3RBU A;  1Z8L A;  5THW A;  1FT7 A;  3LWU A;  2GLF A;  2GRE A;  4DUK A;  3B3T A;  2ZEM A;  4UIB A;  4ZX9 A;  4ZYQ A;  4BD9 A;  3IFE A;  2PVV A;  2ZOF A;  3QNV A;  5HVG A;  1LAP A;  1JQG A;  4R76 A;  2BO9 A;  3GB0 A;  1Y0Y A;  3KZW A;  4OC2 A;  1BPN A;  3NH5 A;  2PJ7 A;  1H8L A;  1ARL A;  2PJ0 A;  3KAS A;  5LRJ A;  3D7F A;  4P4B A;  4NFR A;  3KR4 A;  1TKH A;  2PJ3 A;  2ZED A;  1FNO A;  4RUH A;  1BAV A;  5CPA A;  3WT4 A;  5JH9 A;  4H2K A;  3JRU A;  4Z65 A;  2OR4 A;  4MXU A;  1M4L A;  2F8H A;  2POK A;  3IO1 A;  6CPA A;  2NSM A;  2IQ6 A;  3SJF A;  2F7V A;  1YW6 A;  1CPX A;  1IGB A;  5ELY A;  1CP7 A;  1ZG7 A;  1IY7 A;  4ONW A;  4ZI6 A;  3GLJ A;  2V8V A;  4R7M A;  4EME A;  5J1Q A;  4OC1 A;  2AFZ A;  3PFO A;  4MHY A;  1Y0R A;  3S9L A;  4F9U A;  2Q51 A;  2BCO A;  2OOT A;  2O53 A;  3SJX A;  4IAV A;  2WZN A;  3CT9 A;  2EK8 A;  2CTC A;  3B35 A;  4PXC A;  1Q7L A;  3KQX A;  2ZEL A;  4MCP A;  4R6T A;  4ZX8 A;  2I3C A;  5LRK A;  4O23 A;  3B2Y A;  3NFZ A;  4K3N A;  2G9D A;  1VIX A;  4FUU A;  2AFW A;  4OKO A;  2C6C A;  4WJB A;  4P4I A;  4F8Z A;  4ZY1 A;  5LRG A;  2PJ5 A;  2EK9 A;  1CG2 A;  2RFH A;  5LYL A;  1TF8 A;  2CF4 A;  1NSA A;  1ZG8 A;  4X3R A;  5D8N A;  3KHZ A;  4R8F A;  1ZG9 A;  5JM6 A;  3K9T A;  3D68 A;  3DGV A;  4YWY A;  3FED A;  1HDQ A;  4P4E A;  1QQ9 A;  4UIA A;  1TKF A;  2ZOG A;  3PEI A;  5DS0 A;  1CX8 A;  2PJ1 A;  3IIB A;  2PE3 A;  3CPX A;  1RTQ A;  4X2T A;  2Q4Z A;  1R3N A;  4DYO A;  4A39 A;  2PJ9 A;  1Z2L A;  1XRY A;  3VH9 A;  2JEW A;  2WYR A;  5K8O A;  3VAR A;  2C1C A;  2C6G A;  3ISX A;  1DE4 C;  2XEI A;  4P10 A;  1F2O A;  1ZLH A;  3NH4 A;  1EE3 P;  4JZ0 A;  3PB9 X;  4EFD A;  4NGT A;  3B3S A;  1LFW A;  5F09 A;  4PXB A;  2ANP A;  4ZY0 A;  3BI1 A;  4NGN A;  2PJB A;  3D4U A;  1KWM A;  4KSI A;  3B3C A;  3VAT A;  3BI0 A;  4NGS A;  2CTB A;  3ISZ A;  1LAN A;  4NGQ A;  2QVP A;  1F57 A;  4FWU A;  4OC3 A;  4LQG A;  2O4H A;  2ZEH A;  4EWT A;  4MCR A;  1TKJ A;  3PBE A;  3S9N A;  5K8N A;  4CPA A;  4P4F A;  4UEZ A;  2GU2 A;  4PXD A;  3CDX A;  3NA6 A;  2ZEE A;  4YU9 A;  3GUX A;  2QYV A;  2AFU A;  2PJ2 A;  1QMU A;  4OP4 A;  2ZEP A;  4A38 A;  4NJR A;  3T8W A;  2IMO A;  2IJZ A;  3MRU A;  4P4J A;  1CP6 A;  4MRI A;  3B3V A;  5HVF A;  3D7D A;  3D7G A;  2XEF A;  2V8G A;  3CPA A;  1VHO A;  3KGQ A;  4OID A;  1BLL E;  1PCA A;  5CBM A;  2ZEF A;  4W9Y A;  4FBE A;  1VGY A;  1YME A;  2PJA A;  2VL1 A;  4MCS A;  1ELL P;  3IC1 A;  2CIJ A;  1XMB A;  1ELM P;  4MHP A;  1LCP A;  1TXR A;  3HLP A;  1XFO A;  3PRT A;  2V8H A;  3BXM A;  4P44 A;  4B6Z A;  2PCU A;  1TF9 A;  4JYW A;  1CBX A;  1AMP A;  1F2P A;  3IEH A;  4MHN A;  4PPZ A;  5LYF A;  1ARM A;  1UWY A;  4NGR A;  3D67 A;  1VHE A;  4OC5 A;  2V8D A;  1Z5R A;  4OME A;  4UEE A;  3RZA A;  1BPM A;  3PB6 X;  1LAM A;  4F9V A;  3MN8 A;  3PB8 X; 
#chains in the Genus database with same CATH topology
 4JW0 A;  2K14 A;  1GO3 E;  1JT8 A;  2ZM6 L;  1LTA D;  4GOP A;  5C44 B;  3VWD A;  4AQY L;  1PV4 A;  1EIY B;  5JEA J;  2HCI A;  2EUI A;  1KNA A;  4C68 A;  2B2W C;  3SJG A;  5LHY 1;  1PHJ A;  4RH6 A;  5BN5 A;  2ZW5 A;  3K7U C;  5K8M A;  2WB1 G;  1NMF A;  4QQB X;  1K83 B;  4LF9 L;  1C0A A;  3H5Z A;  4DAY B;  1M1D A;  4RFB A;  2Q2T A;  3S1N B;  2WB1 E;  3OMG A;  4A3B H;  1HR0 L;  3BHX A;  3P2F A;  3PFE A;  4OC4 A;  1SBB B;  3LD2 A;  3PIO A;  3DLJ A;  5M3M G;  3S1M B;  5ELC A;  4DNT B;  3C3L A;  1O7I A;  1SMX A;  2QCP X;  5EPK A;  2HUZ A;  3RAM A;  3I90 A;  4P74 A;  3VWE A;  1YZ6 A;  4WJ4 A;  2E2J H;  3DHQ A;  2A6E C;  3PB7 X;  3IFT A;  2J4X A;  1XWE A;  5ISV A;  1KAB A;  1HDU A;  4JI4 Q;  2RHQ B;  2K52 A;  4DV2 L;  2AFS A;  2DPT A;  1TKW B;  4U9Z A;  1A62 A;  4AXV A;  1O78 A;  2A19 A;  3IAY A;  2FMC A;  2K6A A;  4B9X A;  2RB7 A;  2V77 A;  5I4D A;  1YVC A;  2DNC A;  1OBR A;  3F8T A;  4K2K A;  1X10 A;  2QEC A;  1WCM B;  1VQK A;  2ID0 A;  4E2A A;  3UY5 A;  2WFW A;  4A3K G;  3V38 A;  3A8I E;  2KCN A;  5CR3 A;  3FPU B;  5EBC A;  5C82 A;  3CCJ A;  1HEE A;  3J7Z C;  1YVK A;  4OO1 I;  2N55 A;  1MSG A;  5LYI A;  3KLS A;  1QNK A;  3E3X A;  2NMT A;  3R9F A;  3ZJ0 A;  3K59 A;  4FXG C;  2HD3 A;  1A6X A;  4IOA A;  2PJC A;  3WAB A;  3WC7 A;  1YJ9 A;  2F0W A;  3B7I A;  4C2M B;  1PYB A;  2Q7B A;  1RIP A;  4JI2 L;  2XEG A;  4WFN 3;  4IHM A;  3S6F A;  2LXJ A;  1PTO F;  1HNZ Q;  1ESF A;  4DR1 L;  1PLF A;  2KCC A;  4P72 A;  3OWF A;  5ELO A;  3BS1 A;  2EXD A;  4NXM L;  3TO7 A;  1LAB A;  2Q2H A;  1S60 A;  2V1C C;  2N8N A;  4JG2 A;  2F0J A;  1LYL A;  3SK5 A;  4A30 A;  4JC0 A;  2EIF A;  1WVL A;  4P73 A;  5IB9 A;  3KFU A;  3TP6 A;  5M5X H;  3HKZ G;  1TWA H;  1VQ5 A;  3A55 A;  4DR5 L;  3R1K A;  4DR3 Q;  4Y49 B;  3H0G G;  4GKJ L;  1HNW Q;  2UU9 Q;  4BWG B;  3WOE A;  4A3B B;  1PTO H;  4R9M A;  4G7H C;  4A75 A;  4A37 A;  1JIC A;  1N33 Q;  4A3E H;  5A35 A;  3U58 A;  2R98 A;  3FEE A;  3F8K A;  4OON A;  4DR4 L;  3L9A X;  3GTK H;  3KR5 A;  2EVN A;  2O28 A;  1Y9W A;  3PGP A;  2EO8 A;  2MJ8 A;  2YYZ A;  3FHW A;  3S9M A;  2C9O A;  1SE2 A;  2Q0Y A;  3K9U A;  2GVA A;  4JD6 A;  3D0F A;  2EY6 A;  2IY5 B;  5KYI A;  3TE4 A;  3Q6S A;  5IP9 H;  2K4K A;  4UHV A;  2YGW A;  2ASB A;  4DV1 L;  2Q8R E;  4DV6 Q;  1XEB A;  1WTX A;  2BOA A;  4OIW A;  3G7L A;  2NVX H;  2VZZ A;  2HQE A;  3A9L A;  4HJA A;  4A76 A;  3K0X A;  4P75 A;  2UXB L;  1ZLI A;  1IBM Q;  1TII D;  3DM1 A;  4APV A;  1ET9 A;  3TFY A;  1V8Q A;  1H9M A;  3W1B A;  2Z1C A;  4IPD A;  5DLQ E;  4Z9C B;  5G3L D;  5HY6 A;  2CH4 A;  3DWP A;  2MP1 A;  3QOL A;  4DV7 Q;  3M85 A;  1BQQ T;  4DUK A;  4DN4 M;  4R9W A;  4B14 A;  3NTH A;  3OTO L;  2HIX A;  4MFJ A;  4N8F A;  1QG7 A;  4UIB A;  4LX9 A;  3IFE A;  4H13 C;  4UY8 C;  5A27 A;  2PVV A;  1YRE A;  5CBE E;  1WD1 A;  1PH2 A;  3A7L A;  1M4I A;  2QEJ C;  1NNX A;  2HIV A;  2I5H A;  1D8L A;  2PZW A;  3NTI A;  3TSS A;  3MHB A;  3I70 A;  1HR0 W;  4UP9 A;  3K7A H;  3CCM A;  1Y0Y A;  3N7Z A;  1KDC A;  3IGR A;  4X5K A;  1JB3 A;  1Y1V B;  4EQP A;  5A2Q L;  4OGQ C;  3I3G A;  2KQ3 A;  3PO3 H;  1H8L A;  1TWA B;  1K0S A;  2F0G A;  3DEP A;  1E0B A;  3BZC A;  4NB3 A;  2Q44 A;  2XRQ D;  2B4D B;  1L2F A;  3D7F A;  2ENB A;  4AYB B;  2PW7 A;  1C8C A;  4NFR A;  1TS3 A;  1RHP A;  1IBL L;  1Z8T A;  3ULL A;  3RR5 A;  1EU4 A;  3QB3 A;  5D65 A;  1PH1 A;  4RUH A;  4JI8 L;  1U4R A;  1BAV A;  2AJ6 A;  2R93 B;  2K1B A;  3GTK B;  1BOS A;  4BY1 H;  2LXK A;  5JEA G;  4F6A A;  1AZP A;  2OR4 A;  3SGI A;  4NMZ A;  5M9O A;  2F8H A;  3IO1 A;  2FIA A;  4XQJ A;  2B63 B;  2F7V A;  1DJR D;  1IGB A;  1YNN C;  1I4Q A;  1Q1E A;  4IUS A;  1S40 A;  1CSP A;  4CJ1 B;  4KTA A;  4DA2 A;  4K0K Q;  1BXT A;  4R7M A;  4KUA A;  4UAI A;  5IT9 E;  4HJ8 A;  2XGT A;  2WPW A;  4IAL A;  5J1Q A;  4OC1 A;  1CM9 A;  1Y8N B;  3WDN A;  4AG9 A;  2C35 B;  5E4W C;  4MHY A;  3FDT A;  3TO6 A;  3M4O H;  4ZUJ A;  1VQD A;  3V8I A;  1BDO A;  4G57 A;  2RA4 A;  1UE1 A;  4F88 A;  1KAW A;  1LTG D;  5IOD A;  2XWB B;  4XPD C;  3PIO 3;  5JJI A;  4ZQ3 A;  2OOT A;  4YY3 Q;  4A3K H;  2EY5 A;  1EWH A;  2WZN A;  1EEF D;  5JQ4 A;  2CTC A;  3D31 A;  3B35 A;  4JWP A;  4PXC A;  5KIX A;  2J7Z A;  1XPO A;  2M2L A;  5BN3 A;  1F2Y A;  3I7F A;  2EY1 A;  3OW7 A;  1PRT C;  2ZEL A;  3ZYY X;  3OYY A;  3M7N A;  3D3S A;  2K28 A;  3PO2 B;  1I3Q H;  2I3C A;  1QE6 A;  1UUP A;  1XTC D;  4K8J A;  1YIJ A;  3NSW A;  1R9T B;  2KHJ A;  3M4Y A;  3A5U A;  4K3N A;  4AB7 A;  2I07 B;  1X56 A;  2JA6 B;  4QUF A;  2F0K A;  3EY5 A;  2C6C A;  3EFA A;  1S5B D;  4A3F G;  2Z9H A;  3S2H B;  4B13 A;  2K5V A;  3GTJ H;  1HZC A;  4UWJ A;  2K50 A;  4KOX A;  3NK9 A;  4R1J A;  3SK4 A;  5LRG A;  2EK9 A;  1JOR A;  4BBR H;  1SYB A;  4BY1 B;  2MHV A;  4BBS B;  1JOK A;  3OWC A;  2CKZ B;  3H0G H;  1NSA A;  3CME A;  3S6K A;  1KIX A;  1YBY A;  3HOZ B;  3W1G A;  2VUM B;  2D5D A;  3NEL A;  2Z3L A;  3KHZ A;  4R8F A;  4FD7 A;  1O7Y A;  3D68 A;  1FY7 A;  1YR0 A;  1MIU A;  1I12 A;  4CYP A;  4YWY A;  2PQE A;  1HDQ A;  2R7H A;  3J7A F;  4K5W A;  4N8X 1;  2MO0 A;  3DDD A;  3MC0 B;  2PJ1 A;  2RKS A;  1EZ6 A;  3H15 A;  1QJO A;  2RQX A;  3IIB A;  1S72 A;  2L55 A;  4F0X A;  3UDI A;  5BR8 Q;  3I55 A;  1RTQ A;  1YNX A;  2R6G A;  3BJ7 A;  4X2T A;  2D0O A;  2F3I A;  4FF3 A;  3Q23 A;  4DUY Q;  1D7Q A;  4NXY A;  1S4Z A;  3FRM A;  5EAY A;  4JI4 L;  4L6T B;  1HQM C;  5KNC A;  3HOV B;  1Z2L A;  4P2C B;  4DPG A;  4WJ3 M;  3ULP A;  1EEI D;  1OXU A;  1HXY D;  4FD5 A;  4BS9 A;  4WRD A;  2A6E D;  1IYJ B;  1CKO A;  2ZTE A;  5COR A;  5T1G A;  2VB2 X;  2Q8T A;  1QSO A;  4UCN A;  1FD7 D;  3OIP A;  1EY4 A;  3PZJ A;  3I4N B;  5IYD G;  1SDF A;  3TS0 A;  5KRU A;  4CS0 B;  5C88 A;  1DE4 C;  1F2L A;  4I7Z C;  4P10 A;  1I50 H;  4C1N K;  4FDB A;  4LNQ A;  3AYH B;  4NGT A;  1FGU A;  2NVY H;  4UA3 A;  3KLW A;  5IB0 A;  1IOI A;  1BO4 A;  1D1K A;  4A93 G;  5C3X A;  3QB8 A;  1B3A A;  1B1Z A;  2UXC Q;  1JCK B;  3GTJ B;  5IP7 H;  2KEE A;  3BI1 A;  2D4O A;  1G91 A;  2JE6 I;  5C4J H;  2I79 A;  4KSI A;  1V1P A;  4KHP Q;  5C44 G;  5G21 A;  3N52 A;  1JE4 A;  3VAT A;  3R95 A;  1HNZ L;  2AWN A;  3WOF A;  3UE0 A;  1LAN A;  4X3K A;  4BBR B;  1Z8W A;  2QVP A;  4FWU A;  4IOC A;  3ONA B;  1PH3 A;  1G6Z A;  4JLY A;  5KGU A;  1EUJ A;  5M5W B;  4ZK9 B;  3CXS A;  2ZEH A;  4KZT A;  3TRE A;  1TWF B;  2ZJQ A;  4LQG A;  1B8A A;  4E0A A;  4CBV A;  4MCR A;  2K5Q A;  4CRZ B;  1KAA A;  1KZF A;  2PZT A;  4PSW A;  4LJZ C;  1Q90 A;  4J6H A;  1NCV A;  1A15 A;  4K14 A;  3I2Z A;  3I73 A;  1L0Y B;  3D4W A;  1E2V A;  4DR3 L;  3J7A V;  2P6F A;  1HNW L;  1X54 A;  2EVB A;  1II3 A;  1V9P A;  1B44 D;  1PZI D;  4RMF A;  3GUX A;  2BL1 A;  2WPX A;  1N33 L;  2Z4H A;  2ZEP A;  1TWH H;  3IU1 A;  4UCM A;  3A5Z B;  4NJR A;  2G9H D;  4HED A;  2IMO A;  1PMR A;  2CQA A;  2HT1 A;  2IJZ A;  1BVS A;  3HG9 A;  2R61 A;  1JC7 A;  3NEM A;  2VZA A;  3B3V A;  4KHZ A;  1SR3 A;  3TN2 A;  5IGE A;  2AKW B;  3BLN A;  4CHT B;  1EY0 A;  1SYD A;  2UUC Q;  1Q8K A;  1PU9 A;  4BY7 B;  5LMU Q;  1TVX A;  1A2T A;  1O80 A;  3CF5 A;  4OID A;  4DV6 L;  1T5E A;  4QB9 A;  2K75 A;  1KDA A;  1Q8I A;  4W9Y A;  3VR3 A;  1S7N A;  5GCN A;  3E9I A;  1YME A;  2WP8 J;  2JA7 B;  1TR5 A;  5D3I B;  2IX3 A;  1ELL P;  3J81 c;  2CIJ A;  2BA0 A;  1SNP A;  4LUZ A;  3TOA A;  3J80 i;  1XMB A;  1YQE A;  1J5E L;  1VQ6 A;  1X65 A;  3SXN A;  2KHS A;  2K04 A;  4CYO A;  1W6K A;  2NVY B;  4LW1 A;  4A3D H;  1AE2 A;  1YLE A;  1HTL D;  3Q0A A;  2Z6K A;  5H84 A;  4M8A A;  4P44 A;  3VR5 A;  2V8H A;  3BXM A;  2QF7 A;  2XRS D;  2PCU A;  3LX0 A;  1EYC A;  3OHX C;  4GNX C;  4A2Z A;  2RC4 A;  4EGV A;  3G6E A;  1X32 A;  4BBH A;  1VQF A;  1H9K A;  1AMP A;  1PDQ A;  4K30 A;  2CW0 C;  2VI7 A;  1E7Z A;  5JPN C;  1F77 A;  1Y8P B;  4PPZ A;  2PNR C;  3TS2 A;  2NUC A;  5LYF A;  3CCV A;  1YVO A;  4NPS A;  1UWY A;  5J1Z A;  1KTK A;  3PSI A;  5M5Y H;  1OXS C;  1VHE A;  4H7B A;  4OC5 A;  4R87 A;  1KL9 A;  1HA5 A;  4CYQ A;  1TQO A;  4OME A;  4A3B G;  2A1A A;  3PV0 A;  3S17 H;  2JA9 A;  1RTN A;  3LWE A;  1HPC A;  2QEX A;  2HHH Q;  4UEE A;  1GUN A;  2F0M A;  3DR8 A;  4OEM B;  4ODG A;  2N3S A;  4DAP A;  1BBW A;  3DM3 A;  1BPM A;  4KN7 C;  1LAM A;  4IPC A;  4OIK A;  4RKL A;  3MN8 A;  1ZKO A;  1MI2 A;  4ILW A;  4KI0 A;  3PCO B;  4HSP A;  1R4Q B;  3S16 H;  2PZU A;  2K5W A;  4C3H B;  4XDX A;  3DR6 A;  4MMO A;  1EIF A;  1XJV A;  1D6E C;  1HZB A;  1VKC A;  1VDZ A;  5LYD A;  1Y69 U;  1GVP A;  4YWL A;  2EPB A;  2RSO A;  2M9V A;  1YEZ A;  4ZGY B;  2GLJ A;  3M3Y B;  1UNS A;  2L1B A;  4LQ6 A;  1LTL A;  1NMG A;  1IYU A;  4PMW A;  3ZJY C;  4O42 A;  1BO0 A;  4PV6 A;  5JGF A;  3HP3 A;  4HJ5 A;  1PVO A;  5C3E B;  4JVZ A;  3IWW A;  1A63 A;  4K0K L;  1QWY A;  3TEH B;  5CC4 A;  5FLM G;  4IF5 A;  2TSS A;  4PV1 C;  2PRQ A;  3PB4 X;  4X8I A;  4XTC S;  1QST A;  5IX3 A;  1IOF A;  1YNN D;  3F2U A;  2JP1 A;  1R43 A;  2PJ6 A;  4DNR B;  3PUW A;  3CCQ A;  5C4X B;  7CPA A;  5GQO A;  2NTT A;  4Y52 H;  4II9 A;  2DN8 A;  1KUX A;  4IPG A;  3VR6 A;  2Y0S E;  4NGP A;  1DOL A;  3GTP B;  3FPP A;  1D2B A;  1C48 A;  1XBU A;  1Q7Y C;  1LRZ A;  3KUP A;  2QJ8 A;  1PYS B;  3D6W A;  3HGB A;  3TP7 A;  4GM5 A;  1CUK A;  4LF7 L;  2IW3 A;  1S3Z A;  2VXK A;  2SEB D;  2B5G A;  2FVG A;  1Y1V G;  1Q12 A;  2A73 B;  1CSQ A;  1Y1W H;  4FD4 A;  2I5M X;  3GY9 A;  2F0Q A;  4A3C H;  1QZH A;  2N49 A;  1X3Q A;  5M5Y B;  4C3I H;  4B3S Q;  1BUV T;  3EIV A;  1CI3 M;  4HNW B;  4KKS A;  4AYB G;  2VNU D;  3H8F A;  4C2X A;  2ZJP A;  5A2Q E;  3S17 B;  3HUV A;  4PZ7 A;  3NXW A;  1KLU D;  1PRT D;  5EKI A;  5C44 H;  4NGM A;  2HB6 A;  4AYB E;  3RLF A;  4Q38 A;  4JOI C;  4JI5 Q;  1KXL A;  4Q7A A;  2R93 G;  2NVT B;  1EYG A;  1S7K A;  1WTW A;  1N71 A;  3FMC A;  1XMO Q;  2BDN A;  1ICF B;  3S1Q B;  1KRS A;  1VQN A;  5DEH A;  1BOB A;  3NH8 A;  3S1N H;  2OU2 A;  4CAE A;  1DYQ A;  2Z3M A;  4KOS A;  5IP9 G;  2B63 G;  2PR1 A;  1L1O B;  4P6Y A;  2RHS B;  1O7Z A;  2JQO A;  2G3A A;  2HQY A;  4I65 A;  3S1M H;  3HOW B;  4QJF A;  1E1O A;  1DOM A;  3K2K A;  4GOP B;  1YLO A;  2EWB A;  3D2M A;  3DEO A;  3V7Z A;  1RTO A;  4P45 A;  5H1S E;  3CCR A;  1IL8 A;  2RVL A;  4AG7 A;  1AYE A;  3MGD A;  3NTK A;  2PJ8 A;  4Y7N H;  2KED A;  4FF4 A;  3TO9 A;  1U9R A;  1Y7E A;  1LM0 A;  5K5P A;  4UFW A;  3H8G A;  4H6U A;  1WCM H;  2PMZ B;  1KUV A;  2AQ3 B;  2ZPA A;  3OOC A;  3HEJ A;  1CQF A;  4QIW E;  2ZEO A;  2FJ2 A;  4DUY L;  1PYT B;  3FX6 A;  4ZYS A;  5J22 A;  3MEF A;  2BEI A;  4IUT A;  3C46 A;  3I1U A;  3SHL A;  4JI0 L;  4FYD A;  1VMP A;  3D8P A;  2EXZ A;  3Q22 A;  4IFD J;  4PSX A;  3IRB A;  3EO4 A;  4KLW A;  1STB A;  1JB7 A;  3A7A B;  2ABZ A;  3MFG A;  4C2M H;  2ZW4 A;  2NVQ H;  5D14 A;  1QVG A;  2Q4Y A;  3IL8 A;  1XXG A;  2JA6 G;  1KUY A;  3U9S A;  3FH4 A;  4GN3 B;  5HVH A;  3A8J E;  4A3L H;  3PUZ A;  5FLX c;  5EJW A;  2GLF A;  2D9U A;  3M7G A;  1K8O A;  1I6V C;  2ZEM A;  4CAX A;  1A3T A;  1FL0 A;  3G3S A;  2B2U C;  2VQE Q;  2UXC L;  1A3U A;  3QNV A;  3CPF A;  3HRZ C;  4BY1 G;  5LL6 S;  4BBS G;  5EMI A;  4KHP L;  1B6B A;  4AH6 A;  4DR6 Q;  2Z3P A;  4LMQ D;  1G51 A;  1J4J A;  2BO9 A;  4R76 A;  5G1Z A;  1PTO C;  4LF4 L;  2E8G A;  2VUM G;  1PH5 A;  1NY4 A;  3HOZ G;  1XPU A;  3ZZI A;  3F2C A;  3BDC A;  1IW7 C;  4JXQ A;  4HTH A;  4KJO A;  4RG1 A;  1BPN A;  1FNW A;  1TXY A;  2B29 A;  1ARL A;  2X6L A;  3F5B A;  4DKA C;  3KAS A;  2B2T A;  1LTT D;  2B8G A;  1Q2Y A;  5LRJ A;  4JPB W;  4KOR A;  2FXQ A;  4PG3 A;  5DWM A;  3G8W A;  1D1I A;  4GLV B;  1XPR A;  3I3C A;  2F0S A;  4Y7N B;  3KR4 A;  2PJ3 A;  1NUC A;  1S5K A;  2NBF A;  5CPA A;  3WT4 A;  5JH9 A;  1PA6 A;  1CK1 A;  2L5T A;  4Z65 A;  1FJG Q;  2JA5 H;  3HOV G;  1EFI D;  2O2L D;  3L2P A;  5T1I A;  1Q1B A;  4MXU A;  1PFB A;  1EZ8 A;  2EYF A;  1HUN A;  1DM0 B;  3OW2 A;  6CPA A;  4GNX A;  3SJF A;  1M90 C;  2FT0 A;  3D6C A;  2KCW A;  3RN2 A;  1VQJ A;  4J1M A;  5I2X A;  3I4N G;  2JJQ A;  1CP7 A;  5CV6 A;  2UUC L;  4R4O A;  4ONW A;  5FLM H;  5LMU L;  1P4N A;  1VQP A;  4FF2 A;  3GLJ A;  2ZTC A;  2RCF A;  3RZD H;  2V8V A;  2NVQ B;  5KND A;  1H9S A;  4XYQ A;  1T9H A;  1X3P A;  3K5M A;  5F49 A;  3H4Q A;  5FJ8 H;  4LFB Q;  5AG6 A;  3T1Y L;  3HS0 C;  1SN8 A;  3JAM L;  5FLX L;  3PF5 A;  4U5Y A;  3SVM A;  1A8V A;  4AVC A;  5DNF A;  1Y1V H;  4A32 A;  4DV3 Q;  1I4G A;  4IAV A;  5G20 A;  4BBR G;  1Q7L A;  2ZTD A;  2B4B A;  2F0N A;  2AUJ D;  2Q2I A;  2OQ0 A;  2KHI A;  2ICE C;  3MZ5 A;  2REE A;  2HCC A;  3AFQ A;  3HKZ E;  4JK1 C;  4RCN A;  2DPS A;  5J3B A;  4EVY A;  4ZX8 A;  3NQI A;  3GKR A;  1VS0 A;  4BA1 I;  1QNU A;  2F0D A;  1IBK Q;  4PK3 A;  4XPL A;  4CKE A;  1STH A;  2OWO A;  2R93 H;  1G2S A;  1STY A;  3I4O A;  1ILP A;  2MUY A;  1J8I A;  2OB0 A;  4OAD A;  1AW7 A;  4JI3 Q;  2HHH L;  2DY7 A;  1A2Z A;  4OKO A;  4F7X A;  4MFK A;  3TME A;  2EYL A;  3VR2 A;  2O5I C;  4JI6 Q;  1AE3 A;  4JCV E;  3QAY A;  5EKL A;  4DR7 Q;  1CKM A;  3SE0 A;  2MO1 A;  2PJ5 A;  5IGF A;  2B63 H;  3KF6 A;  2Q7S A;  1CG2 A;  5K36 H;  4C3J B;  2WAC A;  5FKA C;  2JA5 B;  1SQH A;  4YCW A;  3FBU A;  4LF8 Q;  2LKV A;  2CF4 A;  2UUB L;  1VQH A;  2J8M A;  4L5S A;  2MQH A;  4ZAI A;  5D8N A;  1DGS A;  1N36 L;  4BY7 G;  3CC4 A;  4JV5 Q;  1FNU A;  5G22 A;  1ZG9 A;  4POF A;  2KA7 A;  4B3M Q;  3FED A;  4RGM A;  4P4E A;  1EQV A;  1RD9 D;  1X9N A;  1QQ9 A;  1RXT A;  3PGZ A;  2ZOG A;  3OIQ A;  1QVC A;  3D8G A;  1VQC A;  5I6W A;  3RZD B;  2PE3 A;  4K8I A;  1HZ9 A;  1U4P A;  2SNS A;  4KOW A;  5IP7 G;  4O2D A;  3EC4 A;  4A3I B;  4DYO A;  4A39 A;  2XVS A;  2PJ9 A;  3PO2 H;  1E3P A;  2P0W A;  4JOI A;  3ICE A;  1J9O A;  1PZK D;  4G7Z C;  2YTX A;  4IFD G;  1R9T H;  1IZ6 A;  3E0J A;  3GTM H;  4GXH A;  2YNC C;  2K5T A;  2A6H C;  1JWS D;  1ML0 D;  2ATW A;  2DUD A;  2JA6 H;  1N32 Q;  1PH7 A;  2C6G A;  4JI7 Q;  5J8C A;  1XF8 A;  3EQL C;  3R93 A;  3S2H H;  3ISX A;  4N9T A;  1NE3 A;  1MJB A;  4KVO E;  1P16 A;  1LT3 D;  1GUT A;  1K9M C;  2EDG A;  4KSF A;  5LMN Q;  3CCL A;  2KUM A;  4B3S L;  3PB9 X;  4E8O A;  3BVM A;  5IGB A;  1P0H A;  1LT4 D;  4IQZ A;  4MTK A;  1WWZ A;  3KDF A;  4BBS H;  4PXB A;  1B53 A;  1U0L A;  1Y8O B;  4CGY B;  5CV8 A;  2Z3K A;  3HOX H;  1CZG A;  3PUY A;  4C3H G;  4CJ0 B;  1KWM A;  4MIU A;  2VUM H;  3HOZ H;  1XMT A;  3CRK C;  3BI0 A;  3KF8 A;  3L0O A;  3UDG A;  2DXQ A;  3ISZ A;  1I21 A;  1XMO L;  1V1O A;  4KY7 A;  3HOY H;  1BCP B;  1G2T A;  1U4L A;  5IY0 A;  3AQQ A;  5LL6 X;  1VQO A;  4U9Y A;  3S14 B;  3BVZ A;  2XNA C;  2IWH A;  3J80 E;  3S9N A;  5K8N A;  3KK7 A;  3MEH A;  2GIV A;  3EVQ A;  4XT3 B;  2GU2 A;  4RGT A;  1H9R A;  5E3F A;  2XTI A;  4FF1 A;  2FHT A;  1N34 Q;  2FCK A;  4U68 A;  5C3E G;  3ERO A;  1Z9F A;  2CH4 W;  1HNX Q;  2RDH A;  3HOV H;  3VYS A;  4UP8 A;  1QMU A;  5J39 A;  4A38 A;  4A3D G;  4M85 A;  1NBW A;  4X64 Q;  5C4X G;  1DCZ A;  1RL2 A;  3QJY A;  4EQO A;  3U4V A;  4OX9 L;  3MRU A;  4P4J A;  2F4I A;  3SK6 A;  1CP6 A;  2JN4 A;  4IFD I;  1LTB D;  3I4N H;  3EFX D;  4H02 A;  2ZJR A;  1VF7 A;  2L0C A;  1J6Q A;  4DAV A;  2B2W A;  2B2U A;  2IHF A;  3IU2 A;  1BBX C;  4RN7 A;  4QF4 A;  2HQL A;  3GTM B;  3HZX A;  2B4D A;  1QVF A;  4DV5 Q;  1SND A;  3SK8 A;  2JA8 H;  1SJE D;  2NZO A;  3D4R A;  5IIF A;  1TWG B;  1VGY A;  3LGJ A;  3S6H A;  4MCS A;  4HMJ A;  2FSR A;  1VQ9 A;  4LF6 Q;  2JXM B;  3CMA A;  1EFW A;  1LCP A;  4H44 C;  2EE1 A;  4UFV A;  1EY9 A;  1WD0 A;  3GV3 A;  1VQL A;  3JTK A;  5M5W H;  1SYG A;  1TWF H;  4L8A A;  3HOX B;  5ELE A;  2DF5 A;  3E0E A;  3PIP A;  1MBY A;  1CBX A;  2VQE L;  2Z3O A;  3B8G A;  2BH8 A;  3W91 A;  1F2P A;  2L12 A;  3BZD B;  1S7F A;  2ZT9 C;  3LNN A;  4DR6 L;  3K57 A;  3HOY B;  3HOW G;  4NGR A;  4X65 Q;  1V1Q A;  3K58 A;  5M3F H;  4C7H A;  1VQM A;  1PH9 A;  4JI1 Q;  3L7Z C;  1K28 A;  1Z5R A;  2WB1 B;  1QIL A;  3Q24 A;  1PTO D;  3JUW A;  4DAM A;  5KNB A;  4HAE A;  1MKH A;  1IID A;  1L0W A;  2GFQ A;  1IW7 D;  1IYV A;  1D5X C;  5IWA Q;  1SNC A;  2Z4I A;  3R2I A;  1EY6 A;  4K6D A;  1PH8 A;  4CKC A;  3PB8 X;  1WTR A;  1GUW A;  1QCB D;  3NQT A;  1VQB A;  1Z9U A;  3L2N A;  4BY7 H;  2HC9 A;  2PMZ E;  1O7L A;  4PMC A;  4TRD A;  2RDG A;  2K32 A;  3VR4 A;  3K5O A;  3I91 A;  3FB3 A;  1K73 C;  1SYE A;  1HCZ A;  5HXD A;  3BG3 A;  1WJJ A;  2A4N A;  2JA7 H;  3NE5 B;  1BF4 A;  3TRZ A;  4MY0 A;  2XSC A;  5KTC A;  1LO5 D;  1QSN A;  1Y1W G;  3CPW A;  4KJN A;  4B9W A;  4FNF A;  2Q43 A;  4A3C G;  4MFQ A;  1R57 A;  5F2D A;  1EQT A;  1NE9 A;  4JYA Q;  4IO9 A;  2MFI A;  4GLA C;  2F5I A;  1ROD A;  1JOQ A;  2DEA A;  4C3I G;  1JJG A;  5IYC H;  3FEC A;  2JA8 B;  8CPA A;  3SI2 A;  2K5D A;  4JBJ A;  1RDP D;  1MSH A;  2PSW A;  4OL7 A;  4RGO S;  1WK4 A;  5E4X A;  2F4V Q;  2LS0 1;  2BSW A;  3NWS A;  3TC8 A;  1OXT A;  4LFB L;  4J3G A;  4CAV A;  3GP7 A;  3ERS X;  1VHS A;  4IFD H;  2E74 C;  3DWQ A;  4FD6 A;  1ASZ A;  1F2Z A;  3C1E A;  2ZM6 Q;  5F47 A;  4OC0 A;  5HH1 A;  2PYK A;  5EGT A;  3CCE A;  4DV3 L;  4AQY Q;  3FKI H;  2FE7 A;  3MWY W;  3H8E A;  4RA8 A;  5K8P A;  2QKI C;  2B3G A;  5ELF A;  1GUO A;  2AE6 A;  2B8F A;  1SSO A;  1AH9 A;  1VQ4 A;  4X66 Q;  2BH2 A;  3BJU A;  2UU9 L;  1LOK A;  4LF9 Q;  3F2B A;  5M3F B;  2R7D A;  4BA2 I;  5F48 A;  2CNS A;  3OMC A;  3SJE A;  4C3H H;  4R4Q A;  4R3L A;  4WWV A;  4B5O A;  4HPS A;  4PQA A;  4UBR A;  4CGP A;  5HGT A;  4J8Q A;  4KVM E;  1CPS A;  5BWA B;  2NYZ D;  2VY3 A;  2R3Z A;  4YCV A;  3OSO A;  5JJK A;  1WCM G;  3G71 A;  4GOP C;  4M1U B;  1B3Q A;  1K4J A;  4DR7 L;  2PVW A;  1SFO B;  2HDL A;  1JJ2 A;  3M3Y H;  1XOV A;  3MVV A;  4X3S A;  2DJG C;  2I5L X;  3D7H A;  3GQB A;  1MJ9 A;  2NYQ A;  1K8M A;  4ZBG A;  1CKN A;  5F46 A;  4KLV A;  3KQZ A;  4LF8 L;  3CCS A;  5C3E H;  3FJU A;  4A94 A;  3Q8D A;  2PQA B;  4HCS A;  5IGG A;  4MTN A;  1IBM L;  3CD6 A;  2KVM A;  5AGE A;  5C4H A;  5IT9 c;  4HIM A;  1I5F A;  1YJN A;  1GUG A;  4B3M L;  2YNC A;  5C4X H;  1EQQ A;  3SI1 A;  4DV7 L;  1PZJ D;  4QBJ A;  2XEJ A;  2RDF A;  4LK1 C;  4XPD B;  4F8M A;  2PI2 E;  3GTP H;  4A3L G;  5DM6 3;  2N78 A;  4G1P A;  4A3G B;  1Z4R A;  2UUA Q;  2B39 A;  1YX0 A;  2LMC B;  1CHP D;  3CKI B;  1OTC A;  3E6Z X;  2E5L Q;  4PXE A;  2R7F A;  1HFG A;  1PRT B;  3NBH A;  2HDM A;  3EN2 A;  3T4A C;  4UDU C;  4NJQ A;  3JAM E;  4WOR A;  4NXM Q;  2EZV A;  1FYC A;  3QAH A;  1HJP A;  1UEA B;  1EQR A;  3FYN A;  2H1E A;  2EY2 A;  2E76 C;  1F2M A;  2G5D A;  1XTD A;  3FVL A;  3FKI B;  3MXU A;  4QB4 A;  3TTH A;  4DJL A;  4UF4 A;  2FXF A;  5JPM C;  3KJP A;  2R1I A;  4OIJ A;  4XYO A;  1CFM A;  1MHW C;  1GHJ A;  2A68 C;  1B9M A;  1Z8X A;  4XPK A;  3J81 j;  2ZEG A;  3IKJ A;  4MHZ A;  5D29 A;  3PUV A;  4JI7 L;  3S9W A;  3AEV A;  4R8N A;  3UE1 A;  3N5F A;  1AEX A;  2NVT H;  1DTD A;  4LUA A;  2AFX A;  2D2C C;  2K01 A;  4KOT A;  2OEO A;  1QUQ A;  2B5G B;  2PW5 A;  3RBU A;  3SR1 A;  5LMN L;  1Z47 A;  1A2U A;  2A6H D;  1B70 B;  3S1Q H;  2GRE A;  3CZX A;  1ESR A;  1A0I A;  2J0T D;  3BZK A;  4RGN A;  4CYN A;  4GKK Q;  3LAC A;  4BD9 A;  2X7B A;  1BBU A;  5CNP A;  1JQY D;  5IV0 A;  2CWP A;  3UDF A;  1ILQ A;  4OEL B;  3NE8 A;  3HOW H;  1JQG A;  1ZYR C;  2EYO A;  4OXP A;  2JA5 G;  1QSR A;  2WUU A;  2EYP A;  4UFX A;  3C2P A;  4MY3 A;  5C5M A;  2IT1 A;  4CDE C;  5JPH A;  4DF7 A;  3FVQ A;  4PK2 A;  4C7I A;  1IB1 E;  4OC2 A;  3QOJ A;  5CGK A;  2H5M A;  1STA A;  4U67 3;  4IUN A;  2PJ7 A;  1OXX K;  4DUZ Q;  2PJ0 A;  5GRO A;  3BYT B;  2UXB Q;  3PIP 3;  3J81 L;  5IT9 L;  1NMT A;  4ZKC B;  4BIN A;  1JOO A;  1X3F A;  2A69 C;  4IZ8 A;  1HRJ A;  3V96 A;  2EYJ A;  3TP8 A;  1TKH A;  5FJ8 G;  2D62 A;  1HNX L;  2WKD A;  3PQI A;  3RLO A;  1UE5 A;  1KC8 C;  4YY3 L;  4A3I G;  4H2K A;  4X64 L;  3JRU A;  4NP5 A;  3VA7 A;  2ZXR A;  3U50 C;  1UEB A;  2BA1 A;  3I4M B;  5D3D A;  1YNJ C;  2C27 A;  2POK A;  2IL8 A;  2NSM A;  2IQ6 A;  3KLR A;  3P2H A;  1X6O A;  1YW6 A;  2OCE A;  1CPX A;  3G48 A;  1UAP A;  5ELD A;  5ELY A;  2SNM A;  2MPM A;  3C26 A;  1VQA A;  3QR8 A;  1IYK A;  3R8B A;  1M8A A;  1KRT A;  4XNH B;  2IX1 A;  3H94 A;  4KHV A;  5FOB B;  4DR2 Q;  4DV5 L;  3KLS X;  3P7J A;  1C9O A;  1SAP A;  3MTS A;  3CRL C;  4ULL A;  1AFP A;  3P1H A;  3M9B A;  1RJT A;  2IJ0 A;  1S5E D;  3SXH A;  1DZ1 A;  2BOS A;  1IXR A;  2AFZ A;  4L63 B;  4Y49 C;  1MJE A;  1IBL Q;  2NTS A;  3S9L A;  4DNC A;  4F9U A;  1LTS D;  2Q51 A;  5CV7 A;  2C5C A;  2BCO A;  5G3L F;  5JJZ A;  4A3F B;  4CAF A;  2R7Z B;  3IWE A;  2O53 A;  3SJX A;  1WOC A;  5K36 G;  2EK8 A;  3T53 B;  5HGQ A;  3MXN A;  5HUR A;  1HFN A;  4ZRZ A;  3DSB A;  3J7Y W;  2Z6B A;  1PFS A;  1I6H B;  1IHZ A;  1EL0 A;  5H86 A;  4F0Y A;  1EWI A;  2L11 A;  2OZH A;  1U6M A;  1WTO A;  5EBV A;  1F9S A;  5KEE A;  4NXN Q;  2R92 B;  4QL5 A;  2KJX A;  1EWC A;  3DWA A;  5C0X J;  2B3V A;  4O23 A;  3HOU H;  1JWU D;  3STB C;  1Z4E A;  5EKK A;  4V0B A;  4NDX A;  2QDL A;  1VIX A;  1XNQ Q;  4ABN A;  4FUU A;  2AFW A;  5BR8 L;  3ULJ A;  1PFN A;  1Q86 C;  4WJB A;  4IJL A;  4F8Z A;  4B3T Q;  2NB0 A;  2Q8I B;  1LT5 D;  1I1D A;  5IWA L;  2G3T A;  1KDB A;  4HNX B;  4GLX A;  1WTH A;  2ARH A;  2DGY A;  3T1H Q;  4OWT B;  1ET6 A;  4M6G A;  5LYL A;  4JJX A;  3PO2 G;  1C7Y A;  1TF8 A;  4X3R A;  1TY2 A;  4OHJ A;  4J15 A;  4DGZ A;  2OTL A;  1GHE A;  1M4D A;  4AVA A;  5A28 A;  5AG4 A;  3S24 A;  3UI2 A;  2CHB D;  2OT2 A;  3E9H A;  4UPA A;  5CV5 A;  1M1K C;  5JM6 A;  3SHP A;  4LUV A;  1Y9K A;  5LMN W;  1CHQ D;  3DGV A;  3E0K A;  4K2L A;  4NW2 A;  4UIA A;  1HA6 A;  4G7O C;  1N8R C;  2IX0 A;  3PEI A;  4B12 A;  2PCF B;  2YNE A;  5GAD C;  1TS5 A;  3K5L A;  1ZO0 A;  4O0A A;  4A3M B;  5DS0 A;  4GNX B;  1IKL A;  4L89 A;  3F1Z A;  2XIW A;  1T5X D;  4JBW A;  4DU9 A;  4DV0 Q;  4YFJ A;  4KUB A;  2Q4Z A;  4NKL A;  1K8A C;  3HOX G;  4B5P A;  1SLJ A;  3I9S A;  4KKT A;  2GAN A;  2QDB A;  1CTM A;  1H9S B;  1XRY A;  1CA5 A;  3PF4 A;  3VH9 A;  1YK3 A;  4KKU A;  2JEW A;  1D5M C;  3KOJ A;  5FK9 C;  2P6G A;  1XNR Q;  3FNC A;  3JAM i;  1TWC B;  3CW2 C;  2WYR A;  1SEB D;  2WIN B;  3HOY G;  5K8O A;  4CDD C;  1SRU A;  2E2D C;  4KLK A;  3GTG H;  3UDX A;  2PRB A;  2MGS A;  2R8V A;  2LSS A;  2F0L A;  1YHQ A;  1XIX A;  1B2T A;  3IWG A;  4BMH A;  4X66 L;  3FP9 A;  2LY7 A;  1GHK A;  3I56 A;  4I7A A;  5IGC A;  2CXA A;  1WI5 A;  1F2O A;  1LUZ A;  1EE3 P;  3HOU B;  3F0A A;  4JZ0 A;  4EFD A;  2VB3 X;  2DJF C;  3ND8 A;  4IN3 A;  3X3M A;  3CC7 A;  3B3S A;  1BCP C;  3G6J B;  3R2T A;  2ALY B;  4C3J H;  2F0F A;  4X62 Q;  2IPK D;  3KBX A;  2ANP A;  4ZY0 A;  4HJ7 A;  2RCN A;  4DK6 C;  2V4D A;  1WFQ A;  4N9P A;  2YU9 H;  3B3C A;  3FXT A;  2KEC A;  3RZO B;  2JDC A;  2B58 A;  4NGQ A;  3VA5 A;  2E2H B;  1F57 A;  2BE5 C;  4K5X A;  1S7L A;  2F0I A;  2A8V A;  2L15 A;  2Z0Z A;  4H6Z A;  2O4H A;  2OXP A;  4RCO A;  4M6H A;  4Q36 A;  4EWT A;  2AWO A;  3IFD A;  1YIT A;  1VCI A;  1HTP A;  1W6J A;  2KEN A;  3MFY A;  3CCU A;  1H9J A;  2F0E A;  2QW7 A;  2Z8L A;  2EYM A;  4X3T A;  1ASY A;  1TKJ A;  4P4F A;  3KF6 B;  2K5H A;  3MAQ A;  3H3V H;  4UEZ A;  2Q04 A;  2B2Y C;  4GZY C;  2OF1 A;  4IUP A;  4XXE A;  3GDE A;  4GN5 A;  1RKN A;  1QOH A;  5COY A;  3X3N A;  4R8I A;  1P8L A;  1QZG A;  2ES2 A;  4QMG A;  2Z11 A;  3CDX A;  4PXD A;  3A54 A;  2P5Z X;  5C4Z A;  4A3I H;  4CAW A;  4RKB A;  2D0P A;  3V2T A;  2QYV A;  1Z6H A;  1AP0 A;  2AFU A;  2PJ2 A;  5JVG 3;  1BKB A;  3LOD A;  4OP4 A;  3H6M A;  1NJI C;  5E96 A;  1GOZ A;  1SNO A;  2J8R A;  1B9N A;  3VYU A;  3T8W A;  4V19 0;  1EY5 A;  2Z3N A;  3AMU A;  1GD7 A;  3MA2 B;  4DAY A;  2UUA L;  4LWC A;  4EQ5 A;  2E5L L;  2WII B;  1WTQ A;  1EIH A;  2CY2 A;  2ZXP A;  4IUR A;  3VDY A;  1I4H A;  3D7D A;  2PO4 A;  1CJW A;  2CCZ A;  1BCP F;  3CXQ A;  3N6R A;  4TQU S;  1NAP A;  3CPA A;  4KMU C;  1VHO A;  2OZU A;  2CW0 D;  3R96 A;  1KQS A;  4ONU A;  2PPB C;  4HN7 A;  3GTG B;  3ND9 A;  5M3F G;  5CBM A;  2ZEF A;  1MD2 D;  2K33 A;  1FGB D;  4DXG A;  4YCU A;  2VL1 A;  1TS4 A;  1RO5 A;  3PMF A;  1H95 A;  3IC1 A;  4MHD A;  4A31 A;  1RCV D;  2KCM A;  3SEB A;  2A74 C;  2LFN A;  3P20 A;  4LFA Q;  1JWM D;  1ELM P;  2RF4 A;  4MHP A;  1W2B A;  1TXR A;  4EX5 A;  2L4N A;  4CDF C;  2A68 D;  1XFO A;  4B6Z A;  3GD7 A;  1ZXT A;  2Q2U A;  4A3J H;  3R3O A;  4GKK L;  1S5F D;  3S14 H;  2YU9 B;  1TF9 A;  4JYW A;  1YI2 A;  4RHS A;  1SMY C;  2F0P A;  4BXX H;  2E2J B;  4HKF A;  4JBM A;  4NSQ A;  1I4X A;  2NN6 G;  1NSN S;  4ZLT F;  1LTI D;  3IEH A;  3KDF B;  1RF2 D;  2ICI A;  1MJA A;  1LV9 A;  1SYC A;  3W2D A;  2E2I H;  3TP5 A;  4C56 C;  1B4O A;  1ARM A;  5I0C A;  2JA7 G;  3RN5 A;  4TVA B;  4CGL A;  3C1F A;  3FIX A;  1LTR D;  2F0H A;  2K03 A;  2PI2 A;  2K7V A;  5C0X G;  1X55 A;  3D67 A;  4CDC C;  3A56 A;  3KF8 B;  3V05 A;  1L0X B;  1ZYR D;  3BYY B;  2EJF C;  1DD2 A;  4DUZ L;  4G4K A;  4ZKB B;  1SRO A;  2O4X A;  1ON0 A;  3RUZ A;  4A4I A;  5IYC G;  4FP5 D;  2ZXV A;  4AVB A;  1B87 A;  2CNT A;  4MFL A;  4F9V A;  1Q2D A;  4TSS A;  1J5E Q;  1LT6 D;  3U9O A;  5JVH 3;  3TCV A;  4L8J A;  4A3G G;  2H4O A;  4XT1 B;  2VQF Q;  3W6X A;  2QA4 A;  3HKS A;  2BDO A;  2L9H A;  4POG A;  1Q2C A;  3D2P A;  5E7N A;  5AG7 A;  3RYO A;  2Y0S B;  4CGO A;  1S5C D;  2A69 D;  2GVB A;  3T90 A;  2QGQ A;  1SXT A;  4QGU A;  1B7Y B;  1TIQ A;  3I72 A;  4FVM A;  4A95 A;  1YHA A;  3FKI G;  1JWQ A;  3CP0 A;  1TWG H;  1OZP A;  5I9O A;  1YJW A;  2J8N A;  1IYL A;  2SDF A;  3FRP B;  2Y0M A;  4B3R Q;  4ME5 A;  2VBQ A;  3K80 C;  4ZY2 A;  3CQZ H;  1WTV A;  3WC6 A;  3K8A A;  1PH4 A;  4L5R C;  1YNJ D;  1EY7 A;  3T51 B;  2RSN A;  4DK3 C;  2HUG A;  4OO1 H;  2UXD Q;  2AFM A;  2JBJ A;  4MCQ A;  4DR2 L;  5M5X B;  4QY7 A;  3F2D A;  4M6I A;  4LFC Q;  1HUM A;  5JOB A;  3J7A 5;  4TWE A;  4C2Y A;  1Y7R A;  1IIC A;  1E22 A;  2YND A;  3KKW A;  4TNU A;  2Z6K C;  4JI5 L;  4XQQ A;  2PIY A;  5I2Y A;  3AU7 A;  2JYO A;  5CV4 A;  2PDO A;  3KI9 A;  2FIW A;  1GYT A;  4MI4 A;  1VMC A;  1PTO B;  3WWV A;  3JVN A;  1GKH A;  1V0C A;  2JEB I;  1PUA A;  2PIZ A;  4A3E B;  1XMQ Q;  2NN6 I;  1EYA A;  4KD3 A;  5EBD A;  5AJ3 Q;  5ELN A;  3QWN A;  5FO7 B;  4A3J B;  1C4Q A;  4KOU A;  1NR2 A;  4P71 A;  4QC6 A;  3NPP A;  4KVX A;  5C0X I;  1TY0 A;  2C6P A;  4I49 A;  3B3W A;  2I0Q A;  3NEN A;  4P4D A;  2E2I B;  4FAI A;  5KTA A;  3K5N A;  4R4I A;  4LUO A;  4NXN L;  2CWA A;  2JEA I;  4K6L A;  5M3M H;  3LMS A;  4JXR A;  3WC5 A;  4H0L C;  1CZW A;  2NVX B;  3IJ3 A;  1WYD A;  4X3U A;  4F87 A;  1B50 A;  3A8K E;  1I4P A;  3TX8 A;  3H91 A;  3W5O A;  4MFP A;  3S1R H;  3KL9 A;  4YGO A;  1XNQ L;  3J81 E;  3RNU A;  1CT1 D;  1SE8 A;  5GAE C;  1NTG A;  2ZXO A;  5EPL A;  3GTL H;  2PJ4 A;  3L3O C;  2CFM A;  3ITP A;  4B3T L;  2VL6 A;  4UWI A;  2AFO A;  5KTD A;  3STB D;  2WAQ B;  4MBU A;  1JJC B;  5TSS A;  3I4M G;  1ZEQ X;  2ZEN A;  4QIW B;  2Z0S A;  4PQX A;  3T1H L;  1AN8 A;  2AQ2 B;  5AFW A;  2XWJ B;  2B2V C;  4L5Q A;  2YTV A;  3QIA A;  1XJO A;  4LF7 Q;  1YW4 A;  4IK2 A;  3SI0 A;  4CGM A;  2ZW6 A;  3FF3 A;  4UEF A;  3NP8 A;  1W3S A;  2NZH A;  4R3K A;  1E2Z A;  4HMI A;  4ZUI A;  4MZ9 A;  4OAE A;  1Q3L A;  3K7A B;  1NR4 A;  2F0V A;  4OLL A;  3CQZ B;  1IKM A;  1VQ7 A;  3PO3 B;  2OH1 A;  1EOT A;  2WKC A;  1HQR D;  2QIR A;  5EPJ A;  5IE8 A;  1E2W A;  1ENC A;  3PBB A;  4HSV A;  2KOL A;  3SDZ A;  3GTQ H;  5L37 A;  1N9W A;  3KHX A;  1FVI A;  2I46 A;  2E75 C;  4KY6 A;  4DV0 L;  4HCE A;  2R7Z G;  3TOB A;  4LAA A;  3HFZ B;  5I4M A;  2NZ1 D;  3K6O A;  2F0O A;  4Q5V A;  1V1P B;  3GIU A;  1GUS A;  2J9A A;  1PXU A;  5C3W A;  2JBK A;  1E24 A;  2REF A;  1XNR L;  5HMN A;  1S3O A;  2R92 G;  1FR3 A;  3E5S A;  1JE5 A;  4O1N A;  3CC2 A;  1YSJ A;  4CGN A;  4LF5 Q;  5EQ0 A;  1DXM A;  3NWT A;  2D4P A;  1UWV A;  3D66 A;  4IPH A;  1GJX A;  2PC1 A;  4RI1 A;  1YHB A;  5IGD A;  4RS2 A;  5M3M B;  1ENA A;  1Z8L A;  1SFO H;  1QB5 D;  3A74 A;  2MNA A;  5DWN A;  3AFP A;  3PUX A;  1FT7 A;  5THW A;  2B2Y A;  3LWU A;  3EJI A;  2YV5 A;  3B3T A;  2AHO B;  5FVJ A;  3S1R B;  2Q4V A;  3W6S A;  4B10 A;  3NE7 A;  2NN6 H;  4X62 L;  4KD4 A;  4ZX9 A;  2N88 A;  1A3V A;  1FJG L;  1I94 Q;  4ZYQ A;  3GTL B;  2G0B A;  2QML A;  1K3B C;  2ZOF A;  3WR7 A;  5HVG A;  1PRT F;  1LAP A;  2PNH A;  1HZA A;  3T56 B;  2NWG A;  5C0X H;  3S6G A;  1KNE A;  1BCP D;  3DMU A;  1VQE A;  3M4O B;  3KYH C;  1ICW A;  4HIO A;  4YWM A;  4KY5 A;  3GB0 A;  1U5K A;  3KZW A;  4KS9 A;  4JI0 Q;  4A3K B;  2YTY A;  2JSO A;  4KV6 A;  3NH5 A;  5CYU A;  4YHH Q;  4H89 A;  1SYF A;  1GXD C;  4DV4 Q;  3T13 A;  4A3G H;  2BE5 D;  2JLM A;  4A3M G;  4DNI A;  3GO5 A;  4MJ8 A;  4P4B A;  1CKN B;  1CM0 A;  2K05 A;  4FXD A;  1I3Q B;  2OTJ A;  2FMM A;  1EY8 A;  3I4L A;  3TZD A;  4ID6 A;  3RNZ A;  1X3G A;  2ATR A;  4NEX A;  2ZED A;  4CJ2 C;  3BVG A;  1STE A;  1FNO A;  3KJO A;  2Z10 A;  3GYA A;  3TQY A;  3GTQ B;  4XNH C;  5BN4 A;  2F0T A;  2RBM A;  4EVO A;  2FS5 A;  1UE7 A;  5C5L A;  1M4L A;  3OWE B;  1DOK A;  1M4V A;  1PH6 A;  3CU7 A;  4XIG S;  4DXF A;  4R4C A;  4EQN A;  2F03 A;  1SE4 A;  4OWX B;  4LF4 Q;  1PYW D;  3SXO A;  1D5Z C;  1HR0 Q;  3HKZ B;  1ZG7 A;  1IBK L;  2EJM A;  4QVT A;  3K0Y A;  2ZW7 A;  1IY7 A;  3CAM A;  3NBH B;  4ZI6 A;  3H0G B;  4NCZ A;  1SE3 A;  1L1O C;  3HOU G;  1FNV A;  4JI3 L;  2OQK A;  4EME A;  2JA8 G;  4JI6 L;  3QO2 A;  3PFO A;  5I6Y A;  3BDL A;  4X6A H;  4QCL A;  4DV2 Q;  1Y0R A;  1R4P B;  4LFA L;  1SNM A;  1I4R A;  4K5V A;  1TT2 A;  2QIL A;  2FIN B;  5JEA H;  1VF5 C;  1EU3 A;  1BNZ A;  1K3R A;  4IJH A;  3CT9 A;  1AZQ A;  3NHH A;  1QUQ B;  1KLG D;  2DY8 A;  1MJC A;  1CQV A;  2A5H A;  5DAU A;  3J80 c;  3S15 H;  4HIK A;  4JV5 L;  3KQX A;  3R9E A;  5J8F A;  3KBG A;  2XN9 C;  3FEW X;  3BU2 A;  3S2D H;  4MCP A;  1EIG A;  4R6T A;  4YRH A;  2FFK B;  2EOT A;  1MGS A;  3CHB D;  1KD1 C;  3A0J A;  2B2T C;  3PP9 A;  2F3W A;  5LRK A;  2F0U A;  1UFH A;  5FO9 B;  1Q81 C;  1SMY D;  3B2Y A;  1Q82 C;  3U4Z A;  2VXW A;  3NFZ A;  3NBI A;  2G9D A;  4L5T A;  1STG A;  4JI2 Q;  2F3V A;  3P75 A;  1JR0 D;  1GM5 A;  2JEV A;  3T9Y A;  4P4I A;  3I4M H;  1TS2 A;  4ZY1 A;  1I50 B;  4DR1 Q;  3T1Y Q;  4RWS C;  5I9P A;  3TZU A;  3BDO A;  5FLX E;  3J81 i;  2VQF L;  3TT2 A;  4E6I A;  5IYB G;  1K8G A;  2RFH A;  3BJ8 A;  2X6G A;  3DXJ C;  3EBE A;  1DON A;  1ENF A;  1JMC A;  1ZG8 A;  5EC4 A;  5C4J B;  1Y14 B;  4MN3 A;  3TDQ A;  1N32 L;  2M00 A;  4DR5 Q;  1V43 A;  1STN A;  4HR7 B;  1G29 1;  4GKJ Q;  2JDD A;  3K9T A;  3GV6 A;  3T16 A;  1EOV A;  1LAC A;  2KBN A;  4M3S A;  4IUQ A;  2IHE A;  1M4G A;  4B3R L;  1TKF A;  1LLR D;  1CX8 A;  2EBJ A;  1X12 A;  5ELB A;  2UXD L;  4A3F H;  1OO9 B;  1SNQ A;  2R7Z H;  1X3E A;  4DR4 Q;  4KK7 A;  4LFC L;  4ALP A;  3CPX A;  4C3J G;  3G4S A;  3B6Y A;  1TU2 B;  4KSA A;  2F52 A;  3TBI B;  3DNS A;  4HJ9 A;  1I6H H;  5KYL A;  1R3N A;  4C2Z A;  4S3S A;  4AIM A;  4HID A;  2AUK A;  2R92 H;  2AMC B;  4DV1 Q;  1EYD A;  1K0R A;  1TWH B;  1XMQ L;  4B11 A;  2PQA A;  5AJ3 L;  1OXV A;  3J80 L;  5DM7 3;  3S15 B;  2UUB Q;  2WSA A;  3O13 A;  5CMD A;  4UCP A;  3VAR A;  2IL4 A;  1N36 Q;  1YGH A;  2C1C A;  2HV2 A;  2K5N A;  5AG5 A;  3S2D B;  3URY A;  1N34 L;  2B2V A;  2XEI A;  3H09 A;  3GTO H;  3MXN B;  4RAU C;  2X69 A;  1ZLH A;  2VQY A;  3NH4 A;  1HH2 P;  4PZ6 A;  5GAH C;  1HHV A;  1Z7T A;  3OTO Q;  2PR8 A;  3CXC A;  2H5X A;  1LFW A;  5F09 A;  4QUS A;  1XYI A;  2VEZ A;  4IUU A;  4NGN A;  2ODF A;  2PJB A;  4JBK A;  3D4U A;  3R9G A;  1UE6 A;  2VZY A;  1F9Q A;  4NGS A;  2Y0S G;  2CTB A;  1SJH D;  3QG1 A;  4A3D B;  1F9R A;  1VQI A;  5IOC A;  4HNY B;  4ORF A;  1BR9 A;  4PNY A;  4QUC A;  3RMH A;  1MK4 A;  4OC3 A;  3EA6 A;  1QSM A;  2AQ1 B;  2CQO A;  4B08 A;  1E1T A;  3I8Z A;  2VW9 A;  4ZCK A;  2SOB A;  4A3M H;  3PBE A;  5IYD H;  4CPA A;  1G8Z D;  1IU8 A;  1KHI A;  4UP7 A;  4WJW A;  3DUZ A;  3DLL A;  1U4M A;  4R57 A;  4LF6 L;  3NA6 A;  2ZEE A;  4Q0F A;  3M4P A;  4YU9 A;  1WTP A;  4A93 H;  2B3U A;  1CA6 A;  4JI8 Q;  1G6P A;  2CVR A;  2I00 A;  5C6A A;  1TWC H;  4A3E G;  4FXK C;  3ERQ A;  5E1F A;  1ONL A;  4RHR A;  4XQN A;  4PZ8 A;  5FO8 B;  4DK1 A;  5GAG C;  4A3J G;  4MRI A;  4IUV A;  4BXX G;  1VQG A;  5HVF A;  5JJL A;  2WV6 D;  2PQ8 A;  3RLN A;  3S16 B;  3M4Q A;  3D7G A;  2XEF A;  4C1N I;  2GA4 B;  1L0C A;  3NUC A;  2V8G A;  2JK8 A;  4X65 L;  4FO2 A;  1K83 H;  3RD4 A;  4GS3 A;  1S5D D;  3H3V I;  3KGQ A;  4GS4 A;  5JAV A;  4OWW B;  1BLL E;  4A33 A;  1M44 A;  4JI1 L;  4B5P B;  4GN4 B;  1F9P A;  1PCA A;  1NSL A;  4FBE A;  4LF5 L;  2PJA A;  2GE3 A;  2BUE A;  3GTO B;  4MNO A;  5NUC A;  3MXG A;  2EYH A;  3RZO H;  2KCT A;  2E2H H;  3HLP A;  4CKB A;  3PRT A;  2TMP A;  3W3A A;  3D4D A;  3RO0 A;  2WAQ G;  1VQ8 A;  3MXP A;  2VS1 A;  3VYR A;  3H3V C;  4R4T A;  1I94 L;  4YIJ A;  4OX9 Q;  2GN5 A;  4KOV A;  4DFA A;  1AUG A;  2WAQ E;  3JC6 6;  4MHN A;  2EQS A;  4ME3 A;  5ISR A;  2EJG C;  4KOY A;  2DNE A;  5CV9 A;  1XE4 A;  4JYA L;  1XX8 A;  3CXP A;  4MFZ A;  2CNM A;  2V8D A;  2P6E A;  3D3R A;  4YHH L;  3OPO A;  5CBA E;  3VYT A;  4DV4 L;  4DK0 A;  2F1M A;  4OO1 G;  1Y1W B;  4KN4 C;  4YWK A;  3PO3 G;  1IL2 A;  4TKO B;  3RZA A;  4NF1 A;  4CRY B;  2FL4 A;  3ER0 A;  4PMB A;  3EXN A;  2F4V L;  3PB6 X;  5IYB H;  1PFM A;  2OZG A;  4A93 B;  3K81 C;  4C3I B;  3AB9 A;  1Q46 A;  1L1O A;  2O5J C;  4MHE A;  3JAM c; 
#chains in the Genus database with same CATH homology
 1LTA D;  5C44 B;  5JEA J;  2HCI A;  1KNA A;  2B2W C;  3SJG A;  5LHY 1;  4RH6 A;  5BN5 A;  5K8M A;  1K83 B;  4RFB A;  3BHX A;  3S1N B;  3PFE A;  3OMG A;  4OC4 A;  1SBB B;  3DLJ A;  3S1M B;  5ELC A;  4DNT B;  3C3L A;  2QCP X;  5EPK A;  3RAM A;  3I90 A;  3DHQ A;  2A6E C;  3PB7 X;  3IFT A;  2J4X A;  1XWE A;  1KAB A;  1HDU A;  2AFS A;  1TKW B;  4AXV A;  1O78 A;  3IAY A;  2FMC A;  2K6A A;  4B9X A;  2RB7 A;  2V77 A;  5I4D A;  2DNC A;  1OBR A;  4K2K A;  1WCM B;  2ID0 A;  3V38 A;  3A8I E;  2KCN A;  5CR3 A;  3FPU B;  5EBC A;  1HEE A;  4OO1 I;  2N55 A;  1MSG A;  5LYI A;  3KLS A;  1QNK A;  3K59 A;  4FXG C;  1A6X A;  2PJC A;  3WAB A;  3WC7 A;  2F0W A;  3B7I A;  4C2M B;  2XEG A;  4WFN 3;  4IHM A;  1PTO F;  1ESF A;  1PLF A;  2KCC A;  3BS1 A;  3OWF A;  1LAB A;  2F0J A;  3SK5 A;  1WVL A;  5IB9 A;  3TP6 A;  3A55 A;  4BWG B;  3WOE A;  4A3B B;  1PTO H;  4G7H C;  4A37 A;  1JIC A;  5A35 A;  3FEE A;  3L9A X;  3KR5 A;  2MJ8 A;  2YYZ A;  3S9M A;  2C9O A;  1SE2 A;  2EY6 A;  5KYI A;  3Q6S A;  2Q8R E;  2BOA A;  1WTX A;  4OIW A;  3G7L A;  2HQE A;  1ZLI A;  1TII D;  3DM1 A;  1ET9 A;  1V8Q A;  1H9M A;  2Z1C A;  4Z9C B;  5G3L D;  3DWP A;  2MP1 A;  3QOL A;  3M85 A;  1BQQ T;  4DUK A;  4DN4 M;  4R9W A;  3NTH A;  1QG7 A;  4UIB A;  3IFE A;  4H13 C;  2PVV A;  5CBE E;  1WD1 A;  3A7L A;  2QEJ C;  2PZW A;  3TSS A;  3NTI A;  3MHB A;  3I70 A;  1Y0Y A;  1KDC A;  1JB3 A;  1Y1V B;  4EQP A;  5A2Q L;  4OGQ C;  2KQ3 A;  1H8L A;  1TWA B;  2F0G A;  3DEP A;  1E0B A;  2XRQ D;  3D7F A;  2ENB A;  4AYB B;  2PW7 A;  1C8C A;  4NFR A;  1TS3 A;  1RHP A;  1EU4 A;  3QB3 A;  5D65 A;  4RUH A;  1U4R A;  1BAV A;  2R93 B;  2K1B A;  3GTK B;  1BOS A;  5JEA G;  1AZP A;  2OR4 A;  4NMZ A;  5M9O A;  2F8H A;  3IO1 A;  4XQJ A;  2B63 B;  2F7V A;  1DJR D;  1IGB A;  1YNN C;  1I4Q A;  1Q1E A;  4CJ1 B;  4KTA A;  4DA2 A;  1BXT A;  4R7M A;  4UAI A;  5IT9 E;  4IAL A;  5J1Q A;  4OC1 A;  1CM9 A;  1Y8N B;  3WDN A;  5E4W C;  4MHY A;  3FDT A;  4ZUJ A;  1BDO A;  4G57 A;  2RA4 A;  4F88 A;  1LTG D;  5IOD A;  2XWB B;  3PIO 3;  2OOT A;  4ZQ3 A;  2WZN A;  2EY5 A;  1EWH A;  1EEF D;  2CTC A;  3D31 A;  3B35 A;  4PXC A;  5KIX A;  2J7Z A;  2M2L A;  5BN3 A;  1F2Y A;  2EY1 A;  3OW7 A;  1PRT C;  2ZEL A;  3ZYY X;  3M7N A;  2K28 A;  3PO2 B;  2I3C A;  1QE6 A;  1UUP A;  1XTC D;  4K8J A;  3NSW A;  1R9T B;  3M4Y A;  4K3N A;  2I07 B;  2JA6 B;  4QUF A;  2F0K A;  2C6C A;  1S5B D;  3S2H B;  3NK9 A;  5LRG A;  3SK4 A;  2EK9 A;  1JOR A;  1SYB A;  4BY1 B;  2MHV A;  4BBS B;  1JOK A;  1NSA A;  2VUM B;  3HOZ B;  2D5D A;  3KHZ A;  4R8F A;  1O7Y A;  3D68 A;  4YWY A;  2PQE A;  1HDQ A;  3J7A F;  4K5W A;  3MC0 B;  2PJ1 A;  2RKS A;  1EZ6 A;  1QJO A;  2RQX A;  3IIB A;  2L55 A;  1RTQ A;  2R6G A;  4X2T A;  4FF3 A;  3Q23 A;  1S4Z A;  4L6T B;  1HQM C;  5KNC A;  3HOV B;  1Z2L A;  4P2C B;  1EEI D;  1OXU A;  1HXY D;  4BS9 A;  4WRD A;  2A6E D;  5COR A;  5T1G A;  2VB2 X;  2Q8T A;  1FD7 D;  3OIP A;  1EY4 A;  3I4N B;  1SDF A;  5KRU A;  1DE4 C;  1F2L A;  4I7Z C;  4P10 A;  4C1N K;  4NGT A;  1D1K A;  5C3X A;  1B3A A;  1B1Z A;  1JCK B;  3GTJ B;  3BI1 A;  2KEE A;  1G91 A;  2JE6 I;  4KSI A;  1V1P A;  3N52 A;  1JE4 A;  3VAT A;  2AWN A;  3WOF A;  1LAN A;  4X3K A;  4BBR B;  2QVP A;  4FWU A;  3ONA B;  1G6Z A;  5KGU A;  4LQG A;  5M5W B;  4ZK9 B;  2ZEH A;  1TWF B;  4CBV A;  4MCR A;  2K5Q A;  1KAA A;  2PZT A;  4LJZ C;  1Q90 A;  4J6H A;  1NCV A;  1A15 A;  4K14 A;  3D4W A;  1L0Y B;  3I73 A;  1E2V A;  3J7A V;  2EVB A;  1II3 A;  1B44 D;  1PZI D;  3GUX A;  2Z4H A;  2ZEP A;  4NJR A;  2G9H D;  4HED A;  2IMO A;  1PMR A;  2CQA A;  2IJZ A;  3HG9 A;  2R61 A;  1JC7 A;  3B3V A;  4KHZ A;  3TN2 A;  5IGE A;  4CHT B;  1EY0 A;  1SYD A;  4BY7 B;  1TVX A;  1A2T A;  1O80 A;  4OID A;  1T5E A;  1KDA A;  1Q8I A;  4W9Y A;  3VR3 A;  1YME A;  2WP8 J;  2JA7 B;  1TR5 A;  5D3I B;  2IX3 A;  1ELL P;  2CIJ A;  2BA0 A;  1SNP A;  1XMB A;  2KHS A;  2K04 A;  1W6K A;  2NVY B;  1HTL D;  3Q0A A;  4M8A A;  4P44 A;  3VR5 A;  2V8H A;  3BXM A;  2QF7 A;  2XRS D;  2PCU A;  3LX0 A;  1EYC A;  3OHX C;  4EGV A;  1X32 A;  1H9K A;  1AMP A;  1PDQ A;  2CW0 C;  5JPN C;  1F77 A;  1Y8P B;  4PPZ A;  2PNR C;  5LYF A;  2NUC A;  1UWY A;  5J1Z A;  1KTK A;  1OXS C;  1VHE A;  4H7B A;  4OC5 A;  1HA5 A;  1TQO A;  4OME A;  3PV0 A;  1RTN A;  3LWE A;  1HPC A;  4UEE A;  1GUN A;  2F0M A;  4ODG A;  4DAP A;  1BPM A;  4KN7 C;  1LAM A;  4OIK A;  4RKL A;  3MN8 A;  1ZKO A;  1MI2 A;  4ILW A;  4KI0 A;  4HSP A;  1R4Q B;  2PZU A;  2K5W A;  4C3H B;  4XDX A;  4MMO A;  1D6E C;  1VDZ A;  5LYD A;  1Y69 U;  2EPB A;  2RSO A;  2M9V A;  2GLJ A;  3M3Y B;  1UNS A;  2L1B A;  1IYU A;  4PMW A;  4O42 A;  1BO0 A;  5JGF A;  3HP3 A;  5C3E B;  3IWW A;  1QWY A;  5CC4 A;  4X8I A;  2TSS A;  4PV1 C;  2PRQ A;  3PB4 X;  4XTC S;  1YNN D;  3F2U A;  2JP1 A;  1R43 A;  2PJ6 A;  4DNR B;  3PUW A;  5C4X B;  7CPA A;  2NTT A;  2DN8 A;  3VR6 A;  4NGP A;  1DOL A;  3GTP B;  3FPP A;  1D2B A;  1C48 A;  1XBU A;  3KUP A;  2QJ8 A;  3D6W A;  3HGB A;  3TP7 A;  4GM5 A;  2IW3 A;  2SEB D;  2FVG A;  1Q12 A;  2A73 B;  2F0Q A;  1X3Q A;  5M5Y B;  1BUV T;  1CI3 M;  4KKS A;  2VNU D;  3H8F A;  5A2Q E;  3S17 B;  3HUV A;  3NXW A;  1KLU D;  1PRT D;  5EKI A;  4NGM A;  2HB6 A;  3RLF A;  4Q7A A;  2NVT B;  1WTW A;  3FMC A;  2BDN A;  3S1Q B;  5DEH A;  3NH8 A;  1DYQ A;  4P6Y A;  1O7Z A;  4I65 A;  3HOW B;  1DOM A;  3K2K A;  1YLO A;  2EWB A;  3DEO A;  3V7Z A;  1RTO A;  4P45 A;  1IL8 A;  2RVL A;  1AYE A;  3NTK A;  2PJ8 A;  4FF4 A;  2KED A;  1U9R A;  1Y7E A;  5K5P A;  3H8G A;  2PMZ B;  2AQ3 B;  3OOC A;  3HEJ A;  1CQF A;  2ZEO A;  2FJ2 A;  1PYT B;  3FX6 A;  4ZYS A;  5J22 A;  4IUT A;  3C46 A;  3I1U A;  3SHL A;  4FYD A;  1VMP A;  2EXZ A;  3Q22 A;  4IFD J;  1STB A;  3A7A B;  2ABZ A;  3MFG A;  5D14 A;  3IL8 A;  1XXG A;  3U9S A;  3FH4 A;  5HVH A;  3A8J E;  3PUZ A;  5EJW A;  2GLF A;  2D9U A;  3M7G A;  1K8O A;  1I6V C;  2ZEM A;  1A3T A;  2B2U C;  1A3U A;  3QNV A;  3HRZ C;  5LL6 S;  4R76 A;  4LMQ D;  2BO9 A;  1PTO C;  3BDC A;  1IW7 C;  4HTH A;  4KJO A;  1BPN A;  1FNW A;  1ARL A;  2X6L A;  3KAS A;  2B2T A;  1LTT D;  2B8G A;  5LRJ A;  1D1I A;  3I3C A;  2F0S A;  4Y7N B;  3KR4 A;  2PJ3 A;  1NUC A;  2NBF A;  5CPA A;  3WT4 A;  5JH9 A;  1CK1 A;  2L5T A;  4Z65 A;  1EFI D;  2O2L D;  5T1I A;  1Q1B A;  4MXU A;  1PFB A;  1EZ8 A;  2EYF A;  1HUN A;  1DM0 B;  6CPA A;  3SJF A;  3D6C A;  4J1M A;  5I2X A;  1CP7 A;  5CV6 A;  4ONW A;  4FF2 A;  3GLJ A;  2V8V A;  2NVQ B;  5KND A;  1H9S A;  4XYQ A;  1X3P A;  3K5M A;  3HS0 C;  3JAM L;  5FLX L;  3SVM A;  5DNF A;  1I4G A;  4IAV A;  1Q7L A;  2F0N A;  2AUJ D;  3MZ5 A;  2ICE C;  2HCC A;  4JK1 C;  4RCN A;  4ZX8 A;  3NQI A;  4BA1 I;  1QNU A;  2F0D A;  4CKE A;  1STH A;  1G2S A;  1STY A;  1ILP A;  2MUY A;  1J8I A;  1AW7 A;  2DY7 A;  4OKO A;  4F7X A;  3TME A;  2EYL A;  3VR2 A;  2O5I C;  5EKL A;  3SE0 A;  2PJ5 A;  5IGF A;  1CG2 A;  5K36 H;  4C3J B;  2WAC A;  5FKA C;  2JA5 B;  2LKV A;  2CF4 A;  4ZAI A;  5D8N A;  1FNU A;  1ZG9 A;  2KA7 A;  3FED A;  4RGM A;  4P4E A;  1EQV A;  1RD9 D;  1QQ9 A;  2ZOG A;  3OIQ A;  3D8G A;  5I6W A;  3RZD B;  2PE3 A;  4K8I A;  1U4P A;  2SNS A;  4A3I B;  4DYO A;  4A39 A;  2XVS A;  2PJ9 A;  1J9O A;  1PZK D;  4G7Z C;  4IFD G;  3E0J A;  2A6H C;  1JWS D;  1ML0 D;  2C6G A;  3EQL C;  3R93 A;  3ISX A;  4N9T A;  1LT3 D;  1GUT A;  2EDG A;  2KUM A;  3PB9 X;  3BVM A;  5IGB A;  1LT4 D;  4IQZ A;  4PXB A;  1B53 A;  1Y8O B;  4CGY B;  5CV8 A;  1CZG A;  3PUY A;  4C3H G;  4CJ0 B;  1KWM A;  4MIU A;  3CRK C;  3BI0 A;  3KF8 A;  3ISZ A;  1V1O A;  4KY7 A;  1BCP B;  1G2T A;  1U4L A;  5LL6 X;  3S14 B;  2IWH A;  2XNA C;  3BVZ A;  3J80 E;  3S9N A;  5K8N A;  3KK7 A;  3MEH A;  3EVQ A;  4XT3 B;  2GU2 A;  4RGT A;  1H9R A;  5E3F A;  4FF1 A;  2FHT A;  4U68 A;  3ERO A;  2RDH A;  3VYS A;  1QMU A;  5J39 A;  4A38 A;  1DCZ A;  3QJY A;  4EQO A;  3MRU A;  4P4J A;  2F4I A;  3SK6 A;  1CP6 A;  4IFD I;  1LTB D;  3EFX D;  1VF7 A;  2L0C A;  4DAV A;  2B2W A;  2B2U A;  1BBX C;  4QF4 A;  3GTM B;  3HZX A;  1SND A;  3SK8 A;  1SJE D;  3D4R A;  5IIF A;  1TWG B;  1VGY A;  4MCS A;  4HMJ A;  2JXM B;  1LCP A;  4H44 C;  2EE1 A;  1EY9 A;  1WD0 A;  3GV3 A;  1SYG A;  3HOX B;  5ELE A;  1MBY A;  1CBX A;  1F2P A;  2L12 A;  3BZD B;  2ZT9 C;  3LNN A;  3K57 A;  3HOY B;  4NGR A;  3K58 A;  3L7Z C;  1Z5R A;  2WB1 B;  1QIL A;  3Q24 A;  1PTO D;  5KNB A;  4HAE A;  1IW7 D;  1IYV A;  1D5X C;  1SNC A;  2Z4I A;  1EY6 A;  3R2I A;  4K6D A;  4CKC A;  3PB8 X;  1WTR A;  1GUW A;  1QCB D;  3NQT A;  3L2N A;  2HC9 A;  1O7L A;  4PMC A;  4TRD A;  2RDG A;  2K32 A;  3VR4 A;  3K5O A;  3I91 A;  1SYE A;  1HCZ A;  5HXD A;  3BG3 A;  3NE5 B;  1BF4 A;  2XSC A;  1LO5 D;  4KJN A;  4B9W A;  4FNF A;  2Q43 A;  5F2D A;  1EQT A;  1ROD A;  1JOQ A;  2DEA A;  4C3I G;  3FEC A;  8CPA A;  2JA8 B;  3SI2 A;  2K5D A;  1RDP D;  1MSH A;  4OL7 A;  4RGO S;  5E4X A;  2LS0 1;  3TC8 A;  3NWS A;  1OXT A;  3GP7 A;  4IFD H;  2E74 C;  3DWQ A;  1F2Z A;  3C1E A;  4OC0 A;  2PYK A;  5EGT A;  3MWY W;  3H8E A;  4RA8 A;  5K8P A;  2QKI C;  5ELF A;  1GUO A;  2B8F A;  1SSO A;  1LOK A;  5M3F B;  4BA2 I;  3OMC A;  3SJE A;  4WWV A;  4PQA A;  5HGT A;  4J8Q A;  1CPS A;  2NYZ D;  2R3Z A;  3OSO A;  4M1U B;  2PVW A;  1SFO B;  2HDL A;  3MVV A;  4X3S A;  3D7H A;  3GQB A;  2NYQ A;  1K8M A;  3KQZ A;  3FJU A;  4A94 A;  4HCS A;  5IGG A;  2KVM A;  5C4H A;  1GUG A;  3SI1 A;  1PZJ D;  2XEJ A;  2RDF A;  4LK1 C;  4F8M A;  5DM6 3;  4G1P A;  4A3G B;  2B39 A;  4PXE A;  2LMC B;  1CHP D;  3CKI B;  3E6Z X;  1HFG A;  1PRT B;  3NBH A;  2HDM A;  3T4A C;  4UDU C;  4NJQ A;  3JAM E;  4WOR A;  2EZV A;  1FYC A;  1UEA B;  2H1E A;  2EY2 A;  2E76 C;  1F2M A;  3FVL A;  3FKI B;  3MXU A;  4QB4 A;  4DJL A;  4UF4 A;  5JPM C;  4OIJ A;  4XYO A;  1CFM A;  2A68 C;  1GHJ A;  1B9M A;  2ZEG A;  3IKJ A;  4MHZ A;  5D29 A;  3PUV A;  3S9W A;  4R8N A;  3N5F A;  1AEX A;  1DTD A;  2AFX A;  2D2C C;  2K01 A;  2OEO A;  2PW5 A;  3RBU A;  3SR1 A;  1Z47 A;  1A2U A;  2A6H D;  2GRE A;  1ESR A;  2J0T D;  4RGN A;  4BD9 A;  1JQY D;  1ILQ A;  1JQG A;  1ZYR C;  2EYO A;  2EYP A;  3C2P A;  5C5M A;  2IT1 A;  4DF7 A;  3FVQ A;  4OC2 A;  3QOJ A;  5CGK A;  1STA A;  4U67 3;  4IUN A;  2PJ7 A;  1OXX K;  2PJ0 A;  3BYT B;  3PIP 3;  3J81 L;  5IT9 L;  4ZKC B;  1JOO A;  4IZ8 A;  2A69 C;  1HRJ A;  3V96 A;  2EYJ A;  3TP8 A;  1TKH A;  2D62 A;  2WKD A;  4H2K A;  3JRU A;  4NP5 A;  3VA7 A;  2ZXR A;  2BA1 A;  3I4M B;  5D3D A;  1YNJ C;  2POK A;  2IL8 A;  2NSM A;  2IQ6 A;  3KLR A;  1YW6 A;  1CPX A;  1UAP A;  5ELD A;  5ELY A;  2SNM A;  2MPM A;  3R8B A;  1M8A A;  2IX1 A;  3H94 A;  4KHV A;  5FOB B;  3KLS X;  3P7J A;  1SAP A;  3MTS A;  3CRL C;  4ULL A;  1AFP A;  3P1H A;  1DZ1 A;  1RJT A;  2IJ0 A;  1S5E D;  3SXH A;  2AFZ A;  2BOS A;  4L63 B;  2NTS A;  3S9L A;  4F9U A;  1LTS D;  2Q51 A;  5CV7 A;  2C5C A;  2BCO A;  5G3L F;  5JJZ A;  4A3F B;  2R7Z B;  2O53 A;  3SJX A;  5K36 G;  2EK8 A;  3T53 B;  3MXN A;  5HUR A;  1HFN A;  4ZRZ A;  3J7Y W;  1I6H B;  1IHZ A;  1EL0 A;  2L11 A;  1WTO A;  1F9S A;  5KEE A;  2R92 B;  2KJX A;  1EWC A;  3DWA A;  5C0X J;  4O23 A;  1JWU D;  5EKK A;  4V0B A;  4NDX A;  1VIX A;  4ABN A;  4FUU A;  2AFW A;  1PFN A;  4WJB A;  4F8Z A;  2NB0 A;  2Q8I B;  1LT5 D;  1KDB A;  1ET6 A;  5LYL A;  1TF8 A;  4X3R A;  1TY2 A;  4OHJ A;  4DGZ A;  3UI2 A;  2CHB D;  2OT2 A;  5JM6 A;  5CV5 A;  3DGV A;  1CHQ D;  4K2L A;  4NW2 A;  4UIA A;  1HA6 A;  4G7O C;  2IX0 A;  3PEI A;  2PCF B;  5DS0 A;  3K5L A;  1TS5 A;  4A3M B;  1IKL A;  2XIW A;  1T5X D;  4JBW A;  4DU9 A;  2Q4Z A;  4NKL A;  4KKT A;  2QDB A;  1CTM A;  1H9S B;  1XRY A;  1CA5 A;  3VH9 A;  4KKU A;  2JEW A;  1D5M C;  5FK9 C;  1TWC B;  2WYR A;  1SEB D;  2WIN B;  5K8O A;  2E2D C;  2MGS A;  2F0L A;  1B2T A;  2LY7 A;  1GHK A;  5IGC A;  1F2O A;  1EE3 P;  3HOU B;  4JZ0 A;  4EFD A;  2VB3 X;  3ND8 A;  4IN3 A;  3X3M A;  3B3S A;  1BCP C;  3G6J B;  3R2T A;  2F0F A;  2IPK D;  3KBX A;  2ANP A;  4ZY0 A;  2V4D A;  4N9P A;  3B3C A;  2KEC A;  3RZO B;  4NGQ A;  3VA5 A;  2E2H B;  1F57 A;  2BE5 C;  4K5X A;  2F0I A;  2O4H A;  2OXP A;  4RCO A;  4EWT A;  2AWO A;  3IFD A;  1VCI A;  1HTP A;  1W6J A;  3MFY A;  1TKJ A;  1H9J A;  2F0E A;  2Z8L A;  4X3T A;  2EYM A;  4P4F A;  3MAQ A;  4UEZ A;  2B2Y C;  4GZY C;  2OF1 A;  4IUP A;  4XXE A;  1RKN A;  1QOH A;  5COY A;  3X3N A;  4R8I A;  4PXD A;  3CDX A;  4QMG A;  3A54 A;  5C4Z A;  4RKB A;  3V2T A;  2QYV A;  1Z6H A;  1AP0 A;  2AFU A;  2PJ2 A;  5JVG 3;  4OP4 A;  3H6M A;  1GOZ A;  1SNO A;  1B9N A;  3VYU A;  3T8W A;  4V19 0;  1EY5 A;  3AMU A;  3MA2 B;  4DAY A;  2WII B;  1WTQ A;  1EIH A;  2ZXP A;  4IUR A;  1I4H A;  3D7D A;  2PO4 A;  1BCP F;  3N6R A;  4TQU S;  1NAP A;  3CPA A;  4KMU C;  1VHO A;  2CW0 D;  2PPB C;  4HN7 A;  3GTG B;  3ND9 A;  5CBM A;  2ZEF A;  1MD2 D;  2K33 A;  1FGB D;  4DXG A;  2VL1 A;  1TS4 A;  3PMF A;  3IC1 A;  1RCV D;  3SEB A;  2A74 C;  2LFN A;  3P20 A;  1JWM D;  1ELM P;  4MHP A;  1TXR A;  2L4N A;  2A68 D;  1XFO A;  4B6Z A;  3GD7 A;  1ZXT A;  1TF9 A;  3R3O A;  4JYW A;  1S5F D;  2YU9 B;  4RHS A;  1SMY C;  2F0P A;  2E2J B;  1I4X A;  2NN6 G;  1NSN S;  4ZLT F;  1LTI D;  3IEH A;  1RF2 D;  2ICI A;  1LV9 A;  1SYC A;  3W2D A;  3TP5 A;  4C56 C;  1B4O A;  1ARM A;  3C1F A;  1LTR D;  2F0H A;  2K03 A;  5C0X G;  2K7V A;  3D67 A;  3A56 A;  3V05 A;  1L0X B;  1ZYR D;  3BYY B;  2EJF C;  1DD2 A;  4G4K A;  4ZKB B;  2O4X A;  3RUZ A;  4FP5 D;  4F9V A;  4TSS A;  1LT6 D;  3U9O A;  5JVH 3;  4L8J A;  2H4O A;  4XT1 B;  2BDO A;  2L9H A;  2Y0S B;  1S5C D;  2A69 D;  1SXT A;  3I72 A;  4FVM A;  5I9O A;  2SDF A;  3FRP B;  4ME5 A;  4ZY2 A;  1WTV A;  3WC6 A;  4OO1 H;  1YNJ D;  1EY7 A;  3T51 B;  2RSN A;  2AFM A;  2HUG A;  2JBJ A;  4MCQ A;  5M5X B;  1HUM A;  5JOB A;  4TWE A;  4TNU A;  4XQQ A;  2PIY A;  5I2Y A;  3AU7 A;  2JYO A;  5CV4 A;  3KI9 A;  1GYT A;  1VMC A;  1PTO B;  2JEB I;  2PIZ A;  4A3E B;  2NN6 I;  1EYA A;  4KD3 A;  5EBD A;  3QWN A;  5FO7 B;  4A3J B;  1C4Q A;  1NR2 A;  3NPP A;  5C0X I;  1TY0 A;  2C6P A;  3B3W A;  4P4D A;  2E2I B;  4FAI A;  3K5N A;  2JEA I;  4K6L A;  3LMS A;  3WC5 A;  4H0L C;  1CZW A;  2NVX B;  3IJ3 A;  4X3U A;  4F87 A;  1B50 A;  3A8K E;  1I4P A;  3TX8 A;  3H91 A;  3KL9 A;  3J81 E;  1CT1 D;  2ZXO A;  5EPL A;  2PJ4 A;  3L3O C;  3ITP A;  2AFO A;  2WAQ B;  5TSS A;  1ZEQ X;  2ZEN A;  4QIW B;  4PQX A;  1AN8 A;  2AQ2 B;  5AFW A;  2XWJ B;  2B2V C;  3QIA A;  1XJO A;  1YW4 A;  4IK2 A;  3SI0 A;  3FF3 A;  4UEF A;  3NP8 A;  1E2Z A;  4HMI A;  4ZUI A;  1Q3L A;  3K7A B;  1NR4 A;  2F0V A;  3CQZ B;  1IKM A;  3PO3 B;  1EOT A;  2WKC A;  1HQR D;  5EPJ A;  1E2W A;  1ENC A;  3PBB A;  4HSV A;  2KOL A;  3SDZ A;  3KHX A;  2I46 A;  2E75 C;  4KY6 A;  4HCE A;  4LAA A;  5I4M A;  2NZ1 D;  3K6O A;  2F0O A;  4Q5V A;  1V1P B;  1GUS A;  2J9A A;  1PXU A;  5C3W A;  2JBK A;  1FR3 A;  3E5S A;  4O1N A;  1YSJ A;  5EQ0 A;  1DXM A;  3NWT A;  3D66 A;  1GJX A;  5IGD A;  5M3M B;  1ENA A;  1Z8L A;  1QB5 D;  5THW A;  1FT7 A;  3PUX A;  2B2Y A;  3LWU A;  3EJI A;  3B3T A;  3S1R B;  2NN6 H;  4ZX9 A;  4KD4 A;  4ZYQ A;  2N88 A;  1A3V A;  3GTL B;  2ZOF A;  5HVG A;  1PRT F;  1LAP A;  3T56 B;  2NWG A;  5C0X H;  1KNE A;  1BCP D;  3DMU A;  3M4O B;  1ICW A;  3GB0 A;  4KY5 A;  3KZW A;  4A3K B;  4KV6 A;  2JSO A;  3NH5 A;  5CYU A;  1SYF A;  1GXD C;  3T13 A;  2BE5 D;  3GO5 A;  4P4B A;  2K05 A;  4FXD A;  1I3Q B;  2FMM A;  1EY8 A;  3I4L A;  3TZD A;  4ID6 A;  2ZED A;  4CJ2 C;  3BVG A;  1STE A;  1FNO A;  3GTQ B;  5BN4 A;  2F0T A;  2RBM A;  4EVO A;  5C5L A;  1M4L A;  3OWE B;  1DOK A;  1M4V A;  3CU7 A;  4XIG S;  4DXF A;  4EQN A;  2F03 A;  1SE4 A;  1PYW D;  1D5Z C;  1ZG7 A;  3HKZ B;  2EJM A;  3K0Y A;  1IY7 A;  4ZI6 A;  3H0G B;  1SE3 A;  1FNV A;  4EME A;  3PFO A;  3QO2 A;  5I6Y A;  3BDL A;  4QCL A;  1Y0R A;  1R4P B;  1SNM A;  1I4R A;  4K5V A;  1TT2 A;  2QIL A;  2FIN B;  5JEA H;  1VF5 C;  1EU3 A;  1BNZ A;  3CT9 A;  1AZQ A;  3NHH A;  1KLG D;  2DY8 A;  1CQV A;  2A5H A;  5DAU A;  3KQX A;  3KBG A;  2XN9 C;  3FEW X;  4MCP A;  4R6T A;  1EIG A;  2FFK B;  2EOT A;  1MGS A;  3CHB D;  2B2T C;  2F3W A;  5LRK A;  2F0U A;  5FO9 B;  3B2Y A;  1SMY D;  3NFZ A;  2VXW A;  3NBI A;  2G9D A;  1STG A;  2F3V A;  3P75 A;  1JR0 D;  4P4I A;  1TS2 A;  4ZY1 A;  1I50 B;  4RWS C;  5I9P A;  3TZU A;  3BDO A;  5FLX E;  4E6I A;  2RFH A;  2X6G A;  3DXJ C;  1DON A;  1ENF A;  1ZG8 A;  5C4J B;  4MN3 A;  3TDQ A;  2M00 A;  1V43 A;  1STN A;  4HR7 B;  1G29 1;  3K9T A;  3GV6 A;  3T16 A;  1LAC A;  4IUQ A;  1TKF A;  1LLR D;  1CX8 A;  5ELB A;  1OO9 B;  1SNQ A;  4KK7 A;  3CPX A;  4C3J G;  1TU2 B;  3TBI B;  5KYL A;  1R3N A;  4S3S A;  2AUK A;  1EYD A;  1TWH B;  1OXV A;  3J80 L;  5DM7 3;  3S15 B;  3O13 A;  5CMD A;  3VAR A;  2C1C A;  3S2D B;  3URY A;  2B2V A;  2XEI A;  3H09 A;  4RAU C;  2X69 A;  1ZLH A;  3NH4 A;  1HHV A;  1Z7T A;  1LFW A;  5F09 A;  4IUU A;  4NGN A;  2PJB A;  3D4U A;  1F9Q A;  4NGS A;  2CTB A;  1SJH D;  3QG1 A;  4A3D B;  1F9R A;  5IOC A;  1BR9 A;  4PNY A;  4QUC A;  3RMH A;  4OC3 A;  3EA6 A;  2AQ1 B;  4B08 A;  3I8Z A;  2SOB A;  3PBE A;  4CPA A;  1G8Z D;  4WJW A;  3DUZ A;  1U4M A;  3NA6 A;  2ZEE A;  4Q0F A;  4YU9 A;  1WTP A;  1CA6 A;  2CVR A;  5C6A A;  4FXK C;  3ERQ A;  5E1F A;  1ONL A;  4RHR A;  4XQN A;  5FO8 B;  4DK1 A;  4MRI A;  4IUV A;  5HVF A;  2WV6 D;  3S16 B;  3D7G A;  2XEF A;  4C1N I;  2GA4 B;  3NUC A;  2V8G A;  4FO2 A;  3RD4 A;  1S5D D;  3KGQ A;  5JAV A;  1BLL E;  1F9P A;  1PCA A;  4FBE A;  2PJA A;  3GTO B;  5NUC A;  3MXG A;  2EYH A;  3HLP A;  4CKB A;  3PRT A;  2TMP A;  3W3A A;  3D4D A;  3MXP A;  3H3V C;  3VYR A;  4YIJ A;  4DFA A;  4MHN A;  5ISR A;  2EJG C;  2DNE A;  5CV9 A;  1XX8 A;  2V8D A;  3D3R A;  3OPO A;  5CBA E;  3VYT A;  4DK0 A;  2F1M A;  4OO1 G;  1Y1W B;  4KN4 C;  3RZA A;  4TKO B;  4PMB A;  3PB6 X;  1PFM A;  4A93 B;  4C3I B;  3AB9 A;  2O5J C;  4MHE A;  1XYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...