3H5ZA

Crystal structure of leishmania major n-myristoyltransferase with bound myristoyl-coa
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycylpeptide N-tetradecanoyltransferase
publication title N-myristoyltransferase inhibitors as new leads to treat sleeping sickness.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 123
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3h5zA00
3H5ZA 4B12A 3JTKA 4A95A 4C7IA 4CYOA 4CGMA 4B11A 4A33A 4UCNA 4A30A 4CGOA 4CYQA 5AG7A 4CYPA 4CGPA 4A32A 4C7HA 4UFVA 4B13A 5AG5A 5AG4A 5G21A 5G1ZA 5A27A 5AG6A 2YNCC 3IU1A 4CGNA 2WSAA 2YNDA 4A31A 4CYNA 4B14A 4C2ZA 4CAFA 3IWEA 4BBHA 4B10A 4UFWA 5AGEA 5G20A 4CAEA 2WUUA 4C2YA 4CGLA 5A28A 5G22A 4UCPA 4C2XA 3IU2A 4C68A 2YNEA 2YNCA 4UCMA 4A2ZA 4UFXA
chains in the Genus database with same CATH superfamily
1Z8TA 2WYRA 3B8GA 3IGRA 1XEBA 4E2AA 4OAEA 1Y7EA 3KGQA 3D2MA 5FVJA 4B11A 5DS0A 1M4DA 3MRUA 2BSWA 2IJZA 3PGPA 2ZEMA 5D8NA 3D7FA 3KHXA 5K8OA 2OH1A 3VARA 4UFVA 4R57A 3KHZA 4P4DA 4MHYA 1Q7LA 2FXFA 4MFZA 2QIRA 3LACA 1LFWA 1ZG8A 1IB1E 1CJWA 2K5TA 2PJAA 3P2FA 1K4JA 3FVLA 4K30A 3PEIA 4MFKA 1Z8LA 3D3SA 3EXNA 3HLPA 4G1PA 2JBJA 5HVHA 4IAVA 1Y0RA 4PXCA 3S9MA 2DPTA 2PVWA 4NGRA 1NMTA 4GM5A 2IMOA 5HVGA 2B5GA 4NGTA 4NGPA 2WPXA 1MJAA 4MHNA 2CTCA 2PR8A 3R9GA 2OB0A 4XPDB 3D7HA 4UCNA 2I3CA 1TF9A 2Q04A 1TIQA 2Q4ZA 2QECA 4P4EA 4TNUA 2ZOGA 1LAPA 4B13A 4KORA 4JYWA 1M4LA 4UF4A 3D4UA 3SJFA 4BMHA 1IOIA 1YQEA 2ZXVA 2B5GB 2VBQA 4KVOE 3NE8A 2YNCC 4KVME 4NF1A 7CPAA 1XF8A 3FF3A 3IU1A 2HQYA 1VIXA 3PFOA 4JXRA 2Z11A 3IO1A 4KOUA 4NGQA 4I49A 3NH4A 2AFSA 4ZBGA 1AYEA 5GCNA 3OWCA 4OP4A 4KOWA 2R8VA 1MJBA 3P2HA 1EE3P 4XPKA 3D2PA 5HVFA 4II9A 3IWGA 1RO5A 1XOVA 4MCQA 4OIWA 4P4IA 3I9SA 3I1UA 5I0CA 4ZX8A 3PRTA 3TO9A 3EO4A 1ARMA 4ONWA 1Q2CA 2DF5A 2ZEDA 3CZXA 2AFMA 4LX9A 4MY3A 5AG7A 2J8NA 3V7ZA 4LQGA 1LRZA 4AG9A 2GLFA 4EWTA 4NJRA 3PBBA 4KOSA 2JLMA 4IF5A 4AG7A 1I21A 2AFXA 3W6SA 1DTDA 3V8IA 1BO4A 2ZW6A 1ZG9A 2BUEA 2PC1A 2VZZA 3TCVA 4JXQA 4RUHA 2JDDA 4FWUA 4MY0A 2REEA 4KLWA 3VATA 4A39A 4AXVA 3K2KA 4B5PB 2P6EA 2V8GA 4KSAA 2AE6A 4KUBA 1YW6A 5JM6A 2Q7BA 4UFWA 5AGEA 3LWUA 4XNHC 3VH9A 5A28A 2PSWA 3CT9A 1TKHA 5JQ4A 2BL1A 2D4PA 1QSMA 2HB6A 2OZGA 2ZW4A 3FECA 4C7IA 3PZJA 3TX8A 3ZJ0A 1FNOA 4CGOA 4CPAA 3TOAA 4M3SA 3BI1A 1FY7A 1MJ9A 5K8MA 2P6FA 5THWA 3B3VA 2QVPA 2V8VA 3H4QA 2B3VA 2QJ8A 3H8FA 1TF8A 4RN7A 4CAVA 2XEGA 5F47A 3GYAA 2VXKA 5CNPA 5ISVA 2FIWA 3KKWA 4YRHA 4DJLA 3WC6A 1CG2A 2FE7A 3GLJA 2QMLA 4X2TA 3WR7A 2EWBA 3F5BA 3GKRA 4P44A 3K9TA 1R57A 4OKOA 3R9EA 4FAIA 4P4FA 1Y9KA 1YVOA 2C1CA 4M6GA 5F48A 4MHPA 4QBJA 1OBRA 3KI9A 4UWIA 3SI0A 2V8DA 4UA3A 1S7KA 4YU9A 1CM0A 2Q43A 4DNCA 2ARHA 3DDDA 2P0WA 3GB0A 3JTKA 1I12A 3FIXA 4Y49B 5IX3A 2O4HA 2B4DA 1VHSA 2GE3A 2ZOFA 3G8WA 4RI1A 4OC5A 4PQAA 4PXBA 1NSAA 3T90A 3ISXA 5IV0A 2GREA 1KUYA 4GS4A 4H89A 1IIDA 4OC1A 5EC4A 1NSLA 4A38A 5KTCA 2Z3MA 2G0BA 4HNWB 4JWPA 3S9NA 2PVVA 1Z4EA 4FBEA 4OC0A 3F0AA 3RO0A 2DEAA 3W91A 4A31A 1Y7RA 3L2NA 1LANA 2F5IA 4R87A 4B10A 2ZEPA 4BINA 3FH4A 2Z3KA 2ATRA 2Q0YA 3R95A 1PYTB 4A95A 5HXDA 1V0CA 5DWNA 2DXQA 4R8FA 4UEZA 3WC5A 2GFQA 1RTQA 6CPAA 4CYQA 2G9DA 1ZLIA 3LODA 1YLOA 1FT7A 4AB7A 1MK4A 1J4JA 3IEHA 3MN8A 2Z3PA 1HDUA 4JZ0A 1AMPA 5LYIA 5CBMA 2HC9A 3IIBA 1M4IA 3TC8A 2BO9A 3BJ7A 3QNVA 3RYOA 3VWEA 2O53A 5JH9A 2PIZA 3TFYA 2RFHA 2RB7A 4HKFA 4MCRA 4P10A 2V77A 4HNXB 1N71A 1P0HA 2GLJA 1S7FA 2D4OA 3KR5A 3SXOA 1CP7A 4P6YA 1QSOA 1IICA 1QSRA 2BEIA 4CGMA 5EMIA 1XMTA 4UEEA 1ELMP 3RBUA 1ELLP 4ZGYB 4NEXA 1U6MA 2GIVA 3BXMA 2Q44A 4KUAA 4FD6A 5H84A 3DLJA 1RXTA 4X8IA 2JEVA 3KZWA 4F9UA 1XRYA 3F8KA 4FD4A 4P4JA 4KZTA 4ZX9A 4CAWA 1XE4A 3DR8A 4YFJA 1YW4A 2CXAA 2EK9A 4OC3A 2O28A 4OIDA 3IFEA 4MFQA 4PXEA 2VQYA 3QAYA 4XNHB 1ZLHA 5DWMA 2ZELA 3NA6A 2IL4A 3PB9X 3CPAA 3N5FA 3B35A 2R7HA 4R9MA 2CNTA 1YK3A 5CPAA 4B5PA 4ZY0A 1YMEA 4MBUA 4OC4A 5HMNA 1Q2DA 3KL9A 4WWVA 1B6BA 4KSIA 5H86A 3R96A 1XJOA 4TWEA 4YWYA 1BLLE 2AFZA 1HEEA 2PR1A 2XEFA 2EK8A 4MRIA 2WPWA 1WK4A 1VGYA 1IY7A 4UEFA 2EBJA 2WSAA 3TTHA 1QMUA 1CBXA 2ZEGA 4B14A 4CAFA 3IWEA 3G3SA 3ZZIA 4Q7AA 2OOTA 5J1QA 1ON0A 3PP9A 2Q4YA 5J8FA 2Z3OA 3EFAA 4KLVA 1VHEA 3H8GA 3SJXA 1F2PA 2R1IA 4U9ZA 1QQ9A 4XPDC 3VWDA 3PB6X 1YR0A 3PBEA 1DE4C 4UWJA 3T8WA 4A33A 3DR6A 4F9VA 1YSJA 3B3TA 2R98A 1LOKA 1IYLA 1KUXA 2RC4A 2VEZA 3WABA 2REFA 3EY5A 3S9LA 1LCPA 5G21A 5G1ZA 3PB7X 3NFZA 2ZPAA 4E0AA 2J9AA 4IK2A 2B58A 2F8HA 2CY2A 2ZEEA 5ELYA 4KOVA 4AVAA 2PDOA 4MXUA 3D68A 5IB9A 2PJ4A 3PB8X 4Q36A 2F7VA 2PJ2A 4ONUA 4FD5A 3RAMA 4K3NA 3BHXA 2Z10A 4NJQA 5F09A 5LYLA 2Q51A 3B2YA 4NGSA 4OLLA 3SJEA 3TE4A 4CRZB 3H8EA 4EVYA 1XIXA 3BLNA 4GXHA 1XMBA 4B6ZA 2BOAA 1CX8A 4A30A 3BJ8A 3JVNA 1TXRA 3R9FA 2DPSA 3I3GA 4QB9A 4CS0B 1GYTA 1CP6A 4P4BA 4IUSA 1IU8A 1IGBA 1F2OA 1ZG7A 4MHDA 8CPAA 1VKCA 5J8CA 2CNMA 3D7GA 2WZNA 4RS2A 2P6GA 2Q4VA 4IHMA 5JGFA 1R3NA 3B7IA 4CRYB 2YNDA 2OR4A 4CYNA 4ZY1A 2NYQA 2AFOA 3QB8A 4F8ZA 4F0YA 2WUUA 2G3AA 2ZW5A 5KTDA 3FEEA 2JDCA 1X12A 2B3UA 2EUIA 2V8HA 2YNCA 2FS5A 4A2ZA 4FD7A 3ISZA 4PSXA 5F49A 2GANA 3SXNA 2PJCA 1A2ZA 3LMSA 2J8RA 2NSMA 2VI7A 3CXPA 4O23A 4PV6A 2QYVA 4E8OA 2YGWA 3FB3A 4NXYA 1B87A 4PK3A 1NE9A 3FXTA 3TOBA 2AJ6A 4UBRA 3C26A 3KQZA 1Z5RA 1X10A 4M6IA 3TO7A 1L0CA 4PPZA 3PB4X 4PSWA 1Z9UA 4M85A 4A94A 5AG6A 5BWAB 2NMTA 3JRUA 2ZEHA 1KZFA 2VZYA 3IJ3A 3TO6A 2JEWA 1Z8XA 2B4BA 3SI2A 4BBHA 3DGVA 2C27A 4JLYA 3FNCA 5G20A 4CAEA 5G22A 2PJ7A 3EC4A 2CIJA 4HPSA 4P45A 3B3SA 4DUKA 5I4MA 3NE7A 2PJ8A 3TT2A 2FSRA 4UCMA 5E96A 2Q7SA 4B12A 3CXSA 4Y49C 1BOBA 5C82A 2CTBA 4NGNA 3N7ZA 1GHEA 4H2KA 1S7LA 3D7DA 3GIUA 2HUZA 4JJXA 2PJ3A 3RZAA 4KS9A 4CAXA 1UFHA 4QC6A 1IOFA 1VHOA 2H5MA 3IC1A 2XEIA 3JUWA 5AG5A 2Z3NA 5AG4A 3HUVA 2HV2A 5D29A 4Z65A 3IWWA 3D66A 1HDQA 2PRBA 1IYKA 1XBUA 4LUAA 1KWMA 4EMEA 5A27A 4KSFA 3R1KA 1TKFA 2VL1A 3PFEA 1XFOA 4QUSA 3K9UA 3FX6A 4C2ZA 2EVNA 4EFDA 1M4GA 2GU2A 3NH5A 4MI4A 4C2XA 4UIBA 2PJBA 2ZW7A 4H6UA 1LAMA 3FEDA 1WWZA 3T9YA 2X7BA 2CNSA 3A9LA 3WC7A 4BD9A 1CPXA 3D67A 3CPXA 4B5OA 3D8PA 1Q2YA 1YVKA 5LRJA 3SJGA 5F46A 1PCAA 4ORFA 5EBVA 1S3ZA 4C7HA 4F6AA 1YGHA 1YREA 5LYFA 2AFUA 4R7MA 1S7NA 1P4NA 2I00A 4KOXA 1QSTA 2ZEOA 3FYNA 3B3CA 2ZENA 3W6XA 4FUUA 5LRGA 3NH8A 5C88A 1Z8WA 5K8PA 2FVGA 1BPNA 2J8MA 2IQ6A 2PJ1A 1Z4RA 4MJ8A 4NGMA 2PCUA 3FRMA 1OZPA 4U9YA 4MCSA 2JBKA 3H5ZA 1F57A 2PIYA 3LD2A 4CYOA 3FJUA 1Y9WA 2EO8A 5LRKA 2PE3A 3DSBA 5KTAA 4MFPA 3FMCA 1JQGA 4AVBA 3FBUA 2C6PA 4MFLA 4NSQA 3E0KA 1M1DA 2PJ0A 3KASA 1BPMA 1PUAA 1JWQA 1ZO0A 1CPSA 4CGNA 5JPHA 2KCWA 4MFJA 4ZI6A 4YGOA 4M6HA 4DYOA 2CF4A 4QVTA 2PJ5A 5LYDA 2ODFA 4C2YA 4CGLA 4L89A 4UCPA 4NFRA 4U5YA 4C68A 3GY9A 4OADA 1UWYA 3B3WA 4UFXA 4XPLA 4R6TA 1S60A 4KOYA 2OZHA 4X3RA 4R76A 4H6ZA 2OZUA 2Z0ZA 1BAVA 1TKJA 2I79A 4R3LA 1ARLA 2FT0A 4WJBA 4CYPA 4A32A 3BI0A 3KR4A 4F0XA 1AUGA 5HH1A 4PXDA 2C6GA 5K8NA 2PRQA 4MCPA 3DNSA 1QSNA 2PQ8A 3S6KA 5IB0A 2POKA 2ZEFA 4AVCA 2BCOA 2G3TA 4HNYB 3SHPA 3UY5A 4X5KA 2FIAA 2Z3LA 3IU2A 1M44A 2YNEA 3KQXA 4R3KA 3WT4A 1SQHA 1YX0A 4LQ6A 3RNZA 3V38A 4OMEA 4PK2A 2FL4A 4MHZA 4NCZA 4ZYQA 3SI1A 3CXQA 4OC2A 4L8AA 1Y0YA 2C6CA 4CGPA 2Y0MA 3CDXA 1I1DA 4ZY2A 4UIAA 2ABZA 4KOTA 4JD6A 1PU9A 1R43A 1S5KA 3GUXA 3S6FA 2A4NA 4A37A 4W9YA 2PJ6A 1H8LA 3MGDA 3S6HA 2OU2A 2FCKA 2ANPA 2B4DB 2PJ9A 4J3GA 4MMOA 3S6GA 4KVXA 3QAHA 4Q38A 2AFWA 1KUVA 2XEJA 1YLEA 1Z2LA
chains in the Genus database with same CATH topology
3B8GA 4E2AA 3IGRA 1XEBA 4OAEA 3D2MA 5FVJA 4B11A 1M4DA 2BSWA 3PGPA 2OH1A 4UFVA 4R57A 2FXFA 4MFZA 2QIRA 1IB1E 1CJWA 2K5TA 3P2FA 1K4JA 4K30A 4MFKA 3D3SA 3EXNA 2DPTA 1NMTA 2B5GA 2WPXA 1MJAA 2PR8A 3R9GA 2OB0A 4XPDB 4UCNA 2Q04A 1TIQA 2QECA 4B13A 4KORA 4BMHA 2ZXVA 2B5GB 2VBQA 4KVOE 4KVME 2YNCC 4NF1A 1XF8A 3IU1A 4KOUA 2HQYA 4JXRA 2Z11A 4I49A 4ZBGA 5GCNA 3OWCA 4KOWA 1MJBA 3P2HA 4XPKA 3D2PA 4II9A 3IWGA 1RO5A 5I0CA 3I9SA 3TO9A 3EO4A 1Q2CA 5AG7A 4LX9A 4MY3A 2J8NA 1LRZA 4AG9A 4KOSA 2JLMA 4IF5A 4AG7A 1I21A 3W6SA 3V8IA 1BO4A 2ZW6A 2BUEA 2PC1A 2VZZA 3TCVA 4JXQA 2JDDA 4MY0A 2REEA 4KLWA 4B5PB 2P6EA 4KSAA 2AE6A 4KUBA 2Q7BA 4UFWA 5AGEA 4XNHC 5A28A 2PSWA 5JQ4A 2BL1A 2D4PA 1QSMA 2ZW4A 2OZGA 4C7IA 3PZJA 3ZJ0A 4CGOA 3TOAA 4M3SA 1FY7A 1MJ9A 2P6FA 4CAVA 3H4QA 2B3VA 5F47A 3GYAA 2VXKA 5CNPA 5ISVA 2FIWA 3KKWA 4YRHA 2FE7A 2QMLA 3WR7A 3F5BA 3GKRA 1R57A 3R9EA 1Y9KA 1YVOA 5F48A 4QBJA 4UWIA 4UA3A 1S7KA 1CM0A 4DNCA 2ARHA 3DDDA 2P0WA 3JTKA 4Y49B 1I12A 3FIXA 5IX3A 2B4DA 1VHSA 2GE3A 3G8WA 4RI1A 3T90A 5IV0A 5EC4A 1KUYA 4GS4A 4H89A 1IIDA 1NSLA 5KTCA 2Z3MA 2G0BA 4HNWB 4JWPA 1Z4EA 3F0AA 3W91A 4A31A 1Y7RA 4R87A 2F5IA 4B10A 2Z3KA 2ATRA 2Q0YA 3R95A 4A95A 1V0CA 5DWNA 2DXQA 4CYQA 3LODA 4AB7A 1MK4A 1J4JA 2Z3PA 1M4IA 3BJ7A 3RYOA 3VWEA 3TFYA 4HKFA 4HNXB 1N71A 1P0HA 1S7FA 2D4OA 3SXOA 1QSOA 1IICA 1QSRA 2BEIA 4CGMA 1XMTA 4ZGYB 4NEXA 1U6MA 2GIVA 2Q44A 4KUAA 4FD6A 5H84A 1RXTA 2JEVA 3F8KA 4FD4A 4KZTA 4CAWA 1XE4A 3DR8A 4YFJA 2CXAA 2O28A 4MFQA 2VQYA 4XNHB 5DWMA 2IL4A 4R9MA 2R7HA 2CNTA 1YK3A 4B5PA 4MBUA 5HMNA 1Q2DA 1B6BA 5H86A 3R96A 2PR1A 2WPWA 1WK4A 2WSAA 3TTHA 4B14A 4CAFA 3IWEA 3G3SA 3ZZIA 1ON0A 3PP9A 2Q4YA 5J8FA 2Z3OA 3EFAA 4KLVA 2R1IA 4U9ZA 3VWDA 4XPDC 1YR0A 4UWJA 4A33A 3DR6A 2R98A 1IYLA 1KUXA 2RC4A 2VEZA 2REFA 3EY5A 5G21A 5G1ZA 4E0AA 2ZPAA 2B58A 2CY2A 4KOVA 4AVAA 2PDOA 4Q36A 4ONUA 4FD5A 2Z10A 4OLLA 3TE4A 4CRZB 4EVYA 1XIXA 3BLNA 4A30A 3BJ8A 3JVNA 3R9FA 2DPSA 3I3GA 4QB9A 4CS0B 4IUSA 4MHDA 5J8CA 1VKCA 2CNMA 4RS2A 2P6GA 2Q4VA 4CRYB 2YNDA 4CYNA 3QB8A 4F0YA 2WUUA 2G3AA 2ZW5A 5KTDA 2JDCA 2B3UA 2EUIA 2YNCA 2FS5A 4A2ZA 4FD7A 4PSXA 5F49A 2GANA 3SXNA 2J8RA 2VI7A 3CXPA 4PV6A 4E8OA 2YGWA 3FB3A 4NXYA 1B87A 4PK3A 1NE9A 3FXTA 3TOBA 2AJ6A 4UBRA 3C26A 3TO7A 1L0CA 4PSWA 1Z9UA 4M85A 5AG6A 5BWAB 2NMTA 1KZFA 2VZYA 3TO6A 2B4BA 4BBHA 5G20A 2C27A 4JLYA 3FNCA 4CAEA 5G22A 3EC4A 3NE7A 3TT2A 2FSRA 4UCMA 5E96A 4B12A 3CXSA 4Y49C 1BOBA 5C82A 3N7ZA 1GHEA 1S7LA 2HUZA 4JJXA 4CAXA 4KS9A 1UFHA 4QC6A 5AG5A 2H5MA 5AG4A 3JUWA 2Z3NA 2HV2A 2PRBA 1IYKA 4LUAA 5A27A 4KSFA 3R1KA 4QUSA 3K9UA 4C2ZA 2EVNA 1M4GA 4MI4A 4C2XA 4H6UA 2ZW7A 1WWZA 3T9YA 3A9LA 2X7BA 2CNSA 4B5OA 3D8PA 1Q2YA 1YVKA 5F46A 4ORFA 5EBVA 1S3ZA 4C7HA 4F6AA 1YGHA 1YREA 1S7NA 1P4NA 2I00A 4KOXA 1QSTA 3FYNA 3W6XA 5C88A 2J8MA 4MJ8A 1Z4RA 3FRMA 1OZPA 4U9YA 3H5ZA 3LD2A 4CYOA 1Y9WA 5KTAA 3DSBA 4MFPA 4AVBA 3FBUA 4MFLA 4NSQA 3E0KA 1M1DA 1PUAA 1ZO0A 4CGNA 5JPHA 2KCWA 4MFJA 4YGOA 4QVTA 4CGLA 4C2YA 4L89A 4UCPA 4U5YA 4C68A 3GY9A 4OADA 4XPLA 4UFXA 1S60A 4KOYA 2OZHA 4H6ZA 2OZUA 2Z0ZA 2I79A 4R3LA 2FT0A 4CYPA 4A32A 4F0XA 5HH1A 3DNSA 1QSNA 2PQ8A 3S6KA 5IB0A 4AVCA 2G3TA 4HNYB 3SHPA 3UY5A 4X5KA 2FIAA 2Z3LA 3IU2A 1M44A 2YNEA 4R3KA 1SQHA 1YX0A 4PK2A 2FL4A 4NCZA 3CXQA 4L8AA 4CGPA 2Y0MA 1I1DA 4KOTA 4JD6A 1PU9A 1S5KA 3S6FA 2A4NA 3MGDA 3S6HA 2OU2A 2FCKA 4J3GA 2B4DB 3S6GA 4KVXA 3QAHA 4Q38A 1KUVA 1YLEA 2R8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H5Z A;  4B12 A;  3JTK A;  4A95 A;  4C7I A;  4CYO A;  4CGM A;  4B11 A;  4A33 A;  4UCN A;  4A30 A;  4CGO A;  4CYQ A;  5AG7 A;  4CYP A;  4CGP A;  4A32 A;  4C7H A;  4UFV A;  4B13 A;  5AG5 A;  5AG4 A;  5G21 A;  5G1Z A;  5A27 A;  5AG6 A;  2YNC C;  3IU1 A;  4CGN A;  2WSA A;  2YND A;  4A31 A;  4CYN A;  4B14 A;  4C2Z A;  4CAF A;  3IWE A;  4BBH A;  4B10 A;  4UFW A;  5AGE A;  5G20 A;  4CAE A;  2WUU A;  4C2Y A;  4CGL A;  5A28 A;  5G22 A;  4UCP A;  4C2X A;  3IU2 A;  4C68 A;  2YNE A;  2YNC A;  4UCM A;  4A2Z A;  4UFX A; 
#chains in the Genus database with same CATH topology
 1Z8T A;  2WYR A;  3B8G A;  3IGR A;  1XEB A;  4E2A A;  4OAE A;  1Y7E A;  3KGQ A;  3D2M A;  5FVJ A;  4B11 A;  5DS0 A;  1M4D A;  3MRU A;  2BSW A;  2IJZ A;  3PGP A;  2ZEM A;  5D8N A;  3D7F A;  3KHX A;  5K8O A;  2OH1 A;  3VAR A;  4UFV A;  4R57 A;  3KHZ A;  4P4D A;  4MHY A;  1Q7L A;  2FXF A;  4MFZ A;  2QIR A;  3LAC A;  1LFW A;  1ZG8 A;  1IB1 E;  1CJW A;  2K5T A;  2PJA A;  3P2F A;  1K4J A;  3FVL A;  4K30 A;  3PEI A;  4MFK A;  1Z8L A;  3D3S A;  3EXN A;  3HLP A;  4G1P A;  2JBJ A;  5HVH A;  4IAV A;  1Y0R A;  4PXC A;  3S9M A;  2DPT A;  2PVW A;  4NGR A;  1NMT A;  4GM5 A;  2IMO A;  5HVG A;  2B5G A;  4NGT A;  4NGP A;  2WPX A;  1MJA A;  4MHN A;  2CTC A;  2PR8 A;  3R9G A;  2OB0 A;  4XPD B;  3D7H A;  4UCN A;  2I3C A;  1TF9 A;  2Q04 A;  1TIQ A;  2Q4Z A;  2QEC A;  4P4E A;  4TNU A;  2ZOG A;  1LAP A;  4B13 A;  4KOR A;  4JYW A;  1M4L A;  4UF4 A;  3D4U A;  3SJF A;  4BMH A;  1IOI A;  1YQE A;  2ZXV A;  2B5G B;  2VBQ A;  4KVO E;  3NE8 A;  2YNC C;  4KVM E;  4NF1 A;  7CPA A;  1XF8 A;  3FF3 A;  3IU1 A;  2HQY A;  1VIX A;  3PFO A;  4JXR A;  2Z11 A;  3IO1 A;  4KOU A;  4NGQ A;  4I49 A;  3NH4 A;  2AFS A;  4ZBG A;  1AYE A;  5GCN A;  3OWC A;  4OP4 A;  4KOW A;  2R8V A;  1MJB A;  3P2H A;  1EE3 P;  4XPK A;  3D2P A;  5HVF A;  4II9 A;  3IWG A;  1RO5 A;  1XOV A;  4MCQ A;  4OIW A;  4P4I A;  3I9S A;  3I1U A;  5I0C A;  4ZX8 A;  3PRT A;  3TO9 A;  3EO4 A;  1ARM A;  4ONW A;  1Q2C A;  2DF5 A;  2ZED A;  3CZX A;  2AFM A;  4LX9 A;  4MY3 A;  5AG7 A;  2J8N A;  3V7Z A;  4LQG A;  1LRZ A;  4AG9 A;  2GLF A;  4EWT A;  4NJR A;  3PBB A;  4KOS A;  2JLM A;  4IF5 A;  4AG7 A;  1I21 A;  2AFX A;  3W6S A;  1DTD A;  3V8I A;  1BO4 A;  2ZW6 A;  1ZG9 A;  2BUE A;  2PC1 A;  2VZZ A;  3TCV A;  4JXQ A;  4RUH A;  2JDD A;  4FWU A;  4MY0 A;  2REE A;  4KLW A;  3VAT A;  4A39 A;  4AXV A;  3K2K A;  4B5P B;  2P6E A;  2V8G A;  4KSA A;  2AE6 A;  4KUB A;  1YW6 A;  5JM6 A;  2Q7B A;  4UFW A;  5AGE A;  3LWU A;  4XNH C;  3VH9 A;  5A28 A;  2PSW A;  3CT9 A;  1TKH A;  5JQ4 A;  2BL1 A;  2D4P A;  1QSM A;  2HB6 A;  2OZG A;  2ZW4 A;  3FEC A;  4C7I A;  3PZJ A;  3TX8 A;  3ZJ0 A;  1FNO A;  4CGO A;  4CPA A;  3TOA A;  4M3S A;  3BI1 A;  1FY7 A;  1MJ9 A;  5K8M A;  2P6F A;  5THW A;  3B3V A;  2QVP A;  2V8V A;  3H4Q A;  2B3V A;  2QJ8 A;  3H8F A;  1TF8 A;  4RN7 A;  4CAV A;  2XEG A;  5F47 A;  3GYA A;  2VXK A;  5CNP A;  5ISV A;  2FIW A;  3KKW A;  4YRH A;  4DJL A;  3WC6 A;  1CG2 A;  2FE7 A;  3GLJ A;  2QML A;  4X2T A;  3WR7 A;  2EWB A;  3F5B A;  3GKR A;  4P44 A;  3K9T A;  1R57 A;  4OKO A;  3R9E A;  4FAI A;  4P4F A;  1Y9K A;  1YVO A;  2C1C A;  4M6G A;  5F48 A;  4MHP A;  4QBJ A;  1OBR A;  3KI9 A;  4UWI A;  3SI0 A;  2V8D A;  4UA3 A;  1S7K A;  4YU9 A;  1CM0 A;  2Q43 A;  4DNC A;  2ARH A;  3DDD A;  2P0W A;  3GB0 A;  3JTK A;  1I12 A;  3FIX A;  4Y49 B;  5IX3 A;  2O4H A;  2B4D A;  1VHS A;  2GE3 A;  2ZOF A;  3G8W A;  4RI1 A;  4OC5 A;  4PQA A;  4PXB A;  1NSA A;  3T90 A;  3ISX A;  5IV0 A;  2GRE A;  1KUY A;  4GS4 A;  4H89 A;  1IID A;  4OC1 A;  5EC4 A;  1NSL A;  4A38 A;  5KTC A;  2Z3M A;  2G0B A;  4HNW B;  4JWP A;  3S9N A;  2PVV A;  1Z4E A;  4FBE A;  4OC0 A;  3F0A A;  3RO0 A;  2DEA A;  3W91 A;  4A31 A;  1Y7R A;  3L2N A;  1LAN A;  2F5I A;  4R87 A;  4B10 A;  2ZEP A;  4BIN A;  3FH4 A;  2Z3K A;  2ATR A;  2Q0Y A;  3R95 A;  1PYT B;  4A95 A;  5HXD A;  1V0C A;  5DWN A;  2DXQ A;  4R8F A;  4UEZ A;  3WC5 A;  2GFQ A;  1RTQ A;  6CPA A;  4CYQ A;  2G9D A;  1ZLI A;  3LOD A;  1YLO A;  1FT7 A;  4AB7 A;  1MK4 A;  1J4J A;  3IEH A;  3MN8 A;  2Z3P A;  1HDU A;  4JZ0 A;  1AMP A;  5LYI A;  5CBM A;  2HC9 A;  3IIB A;  1M4I A;  3TC8 A;  2BO9 A;  3BJ7 A;  3QNV A;  3RYO A;  3VWE A;  2O53 A;  5JH9 A;  2PIZ A;  3TFY A;  2RFH A;  2RB7 A;  4HKF A;  4MCR A;  4P10 A;  2V77 A;  4HNX B;  1N71 A;  1P0H A;  2GLJ A;  1S7F A;  2D4O A;  3KR5 A;  3SXO A;  1CP7 A;  4P6Y A;  1QSO A;  1IIC A;  1QSR A;  2BEI A;  4CGM A;  5EMI A;  1XMT A;  4UEE A;  1ELM P;  3RBU A;  1ELL P;  4ZGY B;  4NEX A;  1U6M A;  2GIV A;  3BXM A;  2Q44 A;  4KUA A;  4FD6 A;  5H84 A;  3DLJ A;  1RXT A;  4X8I A;  2JEV A;  3KZW A;  4F9U A;  1XRY A;  3F8K A;  4FD4 A;  4P4J A;  4KZT A;  4ZX9 A;  4CAW A;  1XE4 A;  3DR8 A;  4YFJ A;  1YW4 A;  2CXA A;  2EK9 A;  4OC3 A;  2O28 A;  4OID A;  3IFE A;  4MFQ A;  4PXE A;  2VQY A;  3QAY A;  4XNH B;  1ZLH A;  5DWM A;  2ZEL A;  3NA6 A;  2IL4 A;  3PB9 X;  3CPA A;  3N5F A;  3B35 A;  2R7H A;  4R9M A;  2CNT A;  1YK3 A;  5CPA A;  4B5P A;  4ZY0 A;  1YME A;  4MBU A;  4OC4 A;  5HMN A;  1Q2D A;  3KL9 A;  4WWV A;  1B6B A;  4KSI A;  5H86 A;  3R96 A;  1XJO A;  4TWE A;  4YWY A;  1BLL E;  2AFZ A;  1HEE A;  2PR1 A;  2XEF A;  2EK8 A;  4MRI A;  2WPW A;  1WK4 A;  1VGY A;  1IY7 A;  4UEF A;  2EBJ A;  2WSA A;  3TTH A;  1QMU A;  1CBX A;  2ZEG A;  4B14 A;  4CAF A;  3IWE A;  3G3S A;  3ZZI A;  4Q7A A;  2OOT A;  5J1Q A;  1ON0 A;  3PP9 A;  2Q4Y A;  5J8F A;  2Z3O A;  3EFA A;  4KLV A;  1VHE A;  3H8G A;  3SJX A;  1F2P A;  2R1I A;  4U9Z A;  1QQ9 A;  4XPD C;  3VWD A;  3PB6 X;  1YR0 A;  3PBE A;  1DE4 C;  4UWJ A;  3T8W A;  4A33 A;  3DR6 A;  4F9V A;  1YSJ A;  3B3T A;  2R98 A;  1LOK A;  1IYL A;  1KUX A;  2RC4 A;  2VEZ A;  3WAB A;  2REF A;  3EY5 A;  3S9L A;  1LCP A;  5G21 A;  5G1Z A;  3PB7 X;  3NFZ A;  2ZPA A;  4E0A A;  2J9A A;  4IK2 A;  2B58 A;  2F8H A;  2CY2 A;  2ZEE A;  5ELY A;  4KOV A;  4AVA A;  2PDO A;  4MXU A;  3D68 A;  5IB9 A;  2PJ4 A;  3PB8 X;  4Q36 A;  2F7V A;  2PJ2 A;  4ONU A;  4FD5 A;  3RAM A;  4K3N A;  3BHX A;  2Z10 A;  4NJQ A;  5F09 A;  5LYL A;  2Q51 A;  3B2Y A;  4NGS A;  4OLL A;  3SJE A;  3TE4 A;  4CRZ B;  3H8E A;  4EVY A;  1XIX A;  3BLN A;  4GXH A;  1XMB A;  4B6Z A;  2BOA A;  1CX8 A;  4A30 A;  3BJ8 A;  3JVN A;  1TXR A;  3R9F A;  2DPS A;  3I3G A;  4QB9 A;  4CS0 B;  1GYT A;  1CP6 A;  4P4B A;  4IUS A;  1IU8 A;  1IGB A;  1F2O A;  1ZG7 A;  4MHD A;  8CPA A;  1VKC A;  5J8C A;  2CNM A;  3D7G A;  2WZN A;  4RS2 A;  2P6G A;  2Q4V A;  4IHM A;  5JGF A;  1R3N A;  3B7I A;  4CRY B;  2YND A;  2OR4 A;  4CYN A;  4ZY1 A;  2NYQ A;  2AFO A;  3QB8 A;  4F8Z A;  4F0Y A;  2WUU A;  2G3A A;  2ZW5 A;  5KTD A;  3FEE A;  2JDC A;  1X12 A;  2B3U A;  2EUI A;  2V8H A;  2YNC A;  2FS5 A;  4A2Z A;  4FD7 A;  3ISZ A;  4PSX A;  5F49 A;  2GAN A;  3SXN A;  2PJC A;  1A2Z A;  3LMS A;  2J8R A;  2NSM A;  2VI7 A;  3CXP A;  4O23 A;  4PV6 A;  2QYV A;  4E8O A;  2YGW A;  3FB3 A;  4NXY A;  1B87 A;  4PK3 A;  1NE9 A;  3FXT A;  3TOB A;  2AJ6 A;  4UBR A;  3C26 A;  3KQZ A;  1Z5R A;  1X10 A;  4M6I A;  3TO7 A;  1L0C A;  4PPZ A;  3PB4 X;  4PSW A;  1Z9U A;  4M85 A;  4A94 A;  5AG6 A;  5BWA B;  2NMT A;  3JRU A;  2ZEH A;  1KZF A;  2VZY A;  3IJ3 A;  3TO6 A;  2JEW A;  1Z8X A;  2B4B A;  3SI2 A;  4BBH A;  3DGV A;  2C27 A;  4JLY A;  3FNC A;  5G20 A;  4CAE A;  5G22 A;  2PJ7 A;  3EC4 A;  2CIJ A;  4HPS A;  4P45 A;  3B3S A;  4DUK A;  5I4M A;  3NE7 A;  2PJ8 A;  3TT2 A;  2FSR A;  4UCM A;  5E96 A;  2Q7S A;  4B12 A;  3CXS A;  4Y49 C;  1BOB A;  5C82 A;  2CTB A;  4NGN A;  3N7Z A;  1GHE A;  4H2K A;  1S7L A;  3D7D A;  3GIU A;  2HUZ A;  4JJX A;  2PJ3 A;  3RZA A;  4KS9 A;  4CAX A;  1UFH A;  4QC6 A;  1IOF A;  1VHO A;  2H5M A;  3IC1 A;  2XEI A;  3JUW A;  5AG5 A;  2Z3N A;  5AG4 A;  3HUV A;  2HV2 A;  5D29 A;  4Z65 A;  3IWW A;  3D66 A;  1HDQ A;  2PRB A;  1IYK A;  1XBU A;  4LUA A;  1KWM A;  4EME A;  5A27 A;  4KSF A;  3R1K A;  1TKF A;  2VL1 A;  3PFE A;  1XFO A;  4QUS A;  3K9U A;  3FX6 A;  4C2Z A;  2EVN A;  4EFD A;  1M4G A;  2GU2 A;  3NH5 A;  4MI4 A;  4C2X A;  4UIB A;  2PJB A;  2ZW7 A;  4H6U A;  1LAM A;  3FED A;  1WWZ A;  3T9Y A;  2X7B A;  2CNS A;  3A9L A;  3WC7 A;  4BD9 A;  1CPX A;  3D67 A;  3CPX A;  4B5O A;  3D8P A;  1Q2Y A;  1YVK A;  5LRJ A;  3SJG A;  5F46 A;  1PCA A;  4ORF A;  5EBV A;  1S3Z A;  4C7H A;  4F6A A;  1YGH A;  1YRE A;  5LYF A;  2AFU A;  4R7M A;  1S7N A;  1P4N A;  2I00 A;  4KOX A;  1QST A;  2ZEO A;  3FYN A;  3B3C A;  2ZEN A;  3W6X A;  4FUU A;  5LRG A;  3NH8 A;  5C88 A;  1Z8W A;  5K8P A;  2FVG A;  1BPN A;  2J8M A;  2IQ6 A;  2PJ1 A;  1Z4R A;  4MJ8 A;  4NGM A;  2PCU A;  3FRM A;  1OZP A;  4U9Y A;  4MCS A;  2JBK A;  3H5Z A;  1F57 A;  2PIY A;  3LD2 A;  4CYO A;  3FJU A;  1Y9W A;  2EO8 A;  5LRK A;  2PE3 A;  3DSB A;  5KTA A;  4MFP A;  3FMC A;  1JQG A;  4AVB A;  3FBU A;  2C6P A;  4MFL A;  4NSQ A;  3E0K A;  1M1D A;  2PJ0 A;  3KAS A;  1BPM A;  1PUA A;  1JWQ A;  1ZO0 A;  1CPS A;  4CGN A;  5JPH A;  2KCW A;  4MFJ A;  4ZI6 A;  4YGO A;  4M6H A;  4DYO A;  2CF4 A;  4QVT A;  2PJ5 A;  5LYD A;  2ODF A;  4C2Y A;  4CGL A;  4L89 A;  4UCP A;  4NFR A;  4U5Y A;  4C68 A;  3GY9 A;  4OAD A;  1UWY A;  3B3W A;  4UFX A;  4XPL A;  4R6T A;  1S60 A;  4KOY A;  2OZH A;  4X3R A;  4R76 A;  4H6Z A;  2OZU A;  2Z0Z A;  1BAV A;  1TKJ A;  2I79 A;  4R3L A;  1ARL A;  2FT0 A;  4WJB A;  4CYP A;  4A32 A;  3BI0 A;  3KR4 A;  4F0X A;  1AUG A;  5HH1 A;  4PXD A;  2C6G A;  5K8N A;  2PRQ A;  4MCP A;  3DNS A;  1QSN A;  2PQ8 A;  3S6K A;  5IB0 A;  2POK A;  2ZEF A;  4AVC A;  2BCO A;  2G3T A;  4HNY B;  3SHP A;  3UY5 A;  4X5K A;  2FIA A;  2Z3L A;  3IU2 A;  1M44 A;  2YNE A;  3KQX A;  4R3K A;  3WT4 A;  1SQH A;  1YX0 A;  4LQ6 A;  3RNZ A;  3V38 A;  4OME A;  4PK2 A;  2FL4 A;  4MHZ A;  4NCZ A;  4ZYQ A;  3SI1 A;  3CXQ A;  4OC2 A;  4L8A A;  1Y0Y A;  2C6C A;  4CGP A;  2Y0M A;  3CDX A;  1I1D A;  4ZY2 A;  4UIA A;  2ABZ A;  4KOT A;  4JD6 A;  1PU9 A;  1R43 A;  1S5K A;  3GUX A;  3S6F A;  2A4N A;  4A37 A;  4W9Y A;  2PJ6 A;  1H8L A;  3MGD A;  3S6H A;  2OU2 A;  2FCK A;  2ANP A;  2B4D B;  2PJ9 A;  4J3G A;  4MMO A;  3S6G A;  4KVX A;  3QAH A;  4Q38 A;  2AFW A;  1KUV A;  2XEJ A;  1YLE A;  1Z2L A; 
#chains in the Genus database with same CATH homology
 3B8G A;  4E2A A;  3IGR A;  1XEB A;  4OAE A;  3D2M A;  5FVJ A;  4B11 A;  1M4D A;  2BSW A;  3PGP A;  2OH1 A;  4UFV A;  4R57 A;  2FXF A;  4MFZ A;  2QIR A;  1IB1 E;  1CJW A;  2K5T A;  3P2F A;  1K4J A;  4K30 A;  4MFK A;  3D3S A;  3EXN A;  2DPT A;  1NMT A;  2B5G A;  2WPX A;  1MJA A;  2PR8 A;  3R9G A;  2OB0 A;  4XPD B;  4UCN A;  2Q04 A;  1TIQ A;  2QEC A;  4B13 A;  4KOR A;  4BMH A;  2ZXV A;  2B5G B;  2VBQ A;  4KVO E;  4KVM E;  2YNC C;  4NF1 A;  1XF8 A;  3IU1 A;  4KOU A;  2HQY A;  4JXR A;  2Z11 A;  4I49 A;  4ZBG A;  5GCN A;  3OWC A;  4KOW A;  1MJB A;  3P2H A;  4XPK A;  3D2P A;  4II9 A;  3IWG A;  1RO5 A;  5I0C A;  3I9S A;  3TO9 A;  3EO4 A;  1Q2C A;  5AG7 A;  4LX9 A;  4MY3 A;  2J8N A;  1LRZ A;  4AG9 A;  4KOS A;  2JLM A;  4IF5 A;  4AG7 A;  1I21 A;  3W6S A;  3V8I A;  1BO4 A;  2ZW6 A;  2BUE A;  2PC1 A;  2VZZ A;  3TCV A;  4JXQ A;  2JDD A;  4MY0 A;  2REE A;  4KLW A;  4B5P B;  2P6E A;  4KSA A;  2AE6 A;  4KUB A;  2Q7B A;  4UFW A;  5AGE A;  4XNH C;  5A28 A;  2PSW A;  5JQ4 A;  2BL1 A;  2D4P A;  1QSM A;  2ZW4 A;  2OZG A;  4C7I A;  3PZJ A;  3ZJ0 A;  4CGO A;  3TOA A;  4M3S A;  1FY7 A;  1MJ9 A;  2P6F A;  4CAV A;  3H4Q A;  2B3V A;  5F47 A;  3GYA A;  2VXK A;  5CNP A;  5ISV A;  2FIW A;  3KKW A;  4YRH A;  2FE7 A;  2QML A;  3WR7 A;  3F5B A;  3GKR A;  1R57 A;  3R9E A;  1Y9K A;  1YVO A;  5F48 A;  4QBJ A;  4UWI A;  4UA3 A;  1S7K A;  1CM0 A;  4DNC A;  2ARH A;  3DDD A;  2P0W A;  3JTK A;  4Y49 B;  1I12 A;  3FIX A;  5IX3 A;  2B4D A;  1VHS A;  2GE3 A;  3G8W A;  4RI1 A;  3T90 A;  5IV0 A;  5EC4 A;  1KUY A;  4GS4 A;  4H89 A;  1IID A;  1NSL A;  5KTC A;  2Z3M A;  2G0B A;  4HNW B;  4JWP A;  1Z4E A;  3F0A A;  3W91 A;  4A31 A;  1Y7R A;  4R87 A;  2F5I A;  4B10 A;  2Z3K A;  2ATR A;  2Q0Y A;  3R95 A;  4A95 A;  1V0C A;  5DWN A;  2DXQ A;  4CYQ A;  3LOD A;  4AB7 A;  1MK4 A;  1J4J A;  2Z3P A;  1M4I A;  3BJ7 A;  3RYO A;  3VWE A;  3TFY A;  4HKF A;  4HNX B;  1N71 A;  1P0H A;  1S7F A;  2D4O A;  3SXO A;  1QSO A;  1IIC A;  1QSR A;  2BEI A;  4CGM A;  1XMT A;  4ZGY B;  4NEX A;  1U6M A;  2GIV A;  2Q44 A;  4KUA A;  4FD6 A;  5H84 A;  1RXT A;  2JEV A;  3F8K A;  4FD4 A;  4KZT A;  4CAW A;  1XE4 A;  3DR8 A;  4YFJ A;  2CXA A;  2O28 A;  4MFQ A;  2VQY A;  4XNH B;  5DWM A;  2IL4 A;  4R9M A;  2R7H A;  2CNT A;  1YK3 A;  4B5P A;  4MBU A;  5HMN A;  1Q2D A;  1B6B A;  5H86 A;  3R96 A;  2PR1 A;  2WPW A;  1WK4 A;  2WSA A;  3TTH A;  4B14 A;  4CAF A;  3IWE A;  3G3S A;  3ZZI A;  1ON0 A;  3PP9 A;  2Q4Y A;  5J8F A;  2Z3O A;  3EFA A;  4KLV A;  2R1I A;  4U9Z A;  3VWD A;  4XPD C;  1YR0 A;  4UWJ A;  4A33 A;  3DR6 A;  2R98 A;  1IYL A;  1KUX A;  2RC4 A;  2VEZ A;  2REF A;  3EY5 A;  5G21 A;  5G1Z A;  4E0A A;  2ZPA A;  2B58 A;  2CY2 A;  4KOV A;  4AVA A;  2PDO A;  4Q36 A;  4ONU A;  4FD5 A;  2Z10 A;  4OLL A;  3TE4 A;  4CRZ B;  4EVY A;  1XIX A;  3BLN A;  4A30 A;  3BJ8 A;  3JVN A;  3R9F A;  2DPS A;  3I3G A;  4QB9 A;  4CS0 B;  4IUS A;  4MHD A;  5J8C A;  1VKC A;  2CNM A;  4RS2 A;  2P6G A;  2Q4V A;  4CRY B;  2YND A;  4CYN A;  3QB8 A;  4F0Y A;  2WUU A;  2G3A A;  2ZW5 A;  5KTD A;  2JDC A;  2B3U A;  2EUI A;  2YNC A;  2FS5 A;  4A2Z A;  4FD7 A;  4PSX A;  5F49 A;  2GAN A;  3SXN A;  2J8R A;  2VI7 A;  3CXP A;  4PV6 A;  4E8O A;  2YGW A;  3FB3 A;  4NXY A;  1B87 A;  4PK3 A;  1NE9 A;  3FXT A;  3TOB A;  2AJ6 A;  4UBR A;  3C26 A;  3TO7 A;  1L0C A;  4PSW A;  1Z9U A;  4M85 A;  5AG6 A;  5BWA B;  2NMT A;  1KZF A;  2VZY A;  3TO6 A;  2B4B A;  4BBH A;  5G20 A;  2C27 A;  4JLY A;  3FNC A;  4CAE A;  5G22 A;  3EC4 A;  3NE7 A;  3TT2 A;  2FSR A;  4UCM A;  5E96 A;  4B12 A;  3CXS A;  4Y49 C;  1BOB A;  5C82 A;  3N7Z A;  1GHE A;  1S7L A;  2HUZ A;  4JJX A;  4CAX A;  4KS9 A;  1UFH A;  4QC6 A;  5AG5 A;  2H5M A;  5AG4 A;  3JUW A;  2Z3N A;  2HV2 A;  2PRB A;  1IYK A;  4LUA A;  5A27 A;  4KSF A;  3R1K A;  4QUS A;  3K9U A;  4C2Z A;  2EVN A;  1M4G A;  4MI4 A;  4C2X A;  4H6U A;  2ZW7 A;  1WWZ A;  3T9Y A;  3A9L A;  2X7B A;  2CNS A;  4B5O A;  3D8P A;  1Q2Y A;  1YVK A;  5F46 A;  4ORF A;  5EBV A;  1S3Z A;  4C7H A;  4F6A A;  1YGH A;  1YRE A;  1S7N A;  1P4N A;  2I00 A;  4KOX A;  1QST A;  3FYN A;  3W6X A;  5C88 A;  2J8M A;  4MJ8 A;  1Z4R A;  3FRM A;  1OZP A;  4U9Y A;  3H5Z A;  3LD2 A;  4CYO A;  1Y9W A;  5KTA A;  3DSB A;  4MFP A;  4AVB A;  3FBU A;  4MFL A;  4NSQ A;  3E0K A;  1M1D A;  1PUA A;  1ZO0 A;  4CGN A;  5JPH A;  2KCW A;  4MFJ A;  4YGO A;  4QVT A;  4CGL A;  4C2Y A;  4L89 A;  4UCP A;  4U5Y A;  4C68 A;  3GY9 A;  4OAD A;  4XPL A;  4UFX A;  1S60 A;  4KOY A;  2OZH A;  4H6Z A;  2OZU A;  2Z0Z A;  2I79 A;  4R3L A;  2FT0 A;  4CYP A;  4A32 A;  4F0X A;  5HH1 A;  3DNS A;  1QSN A;  2PQ8 A;  3S6K A;  5IB0 A;  4AVC A;  2G3T A;  4HNY B;  3SHP A;  3UY5 A;  4X5K A;  2FIA A;  2Z3L A;  3IU2 A;  1M44 A;  2YNE A;  4R3K A;  1SQH A;  1YX0 A;  4PK2 A;  2FL4 A;  4NCZ A;  3CXQ A;  4L8A A;  4CGP A;  2Y0M A;  1I1D A;  4KOT A;  4JD6 A;  1PU9 A;  1S5K A;  3S6F A;  2A4N A;  3MGD A;  3S6H A;  2OU2 A;  2FCK A;  4J3G A;  2B4D B;  3S6G A;  4KVX A;  3QAH A;  4Q38 A;  1KUV A;  1YLE A;  2R8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...