3H5ZA

Crystal structure of leishmania major n-myristoyltransferase with bound myristoyl-coa
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycylpeptide N-tetradecanoyltransferase
publication title N-myristoyltransferase inhibitors as new leads to treat sleeping sickness.
pubmed doi rcsb
source organism Leishmania major
total genus 123
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3h5zA00
2WUUA 4C7IA 4C2YA 2YNEA 3IWEA 4UCPA 5G21A 5AGEA 4B10A 5AG4A 4CAFA 3IU2A 3H5ZA 4C68A 4CGNA 4A33A 5G22A 4C2XA 5G20A 4CGMA 2YNDA 4CYOA 5A27A 2YNCA 5AG5A 4A31A 4B11A 4UCMA 4C2ZA 4B12A 4A95A 5AG7A 4C7HA 4A30A 5G1ZA 5AG6A 4UCNA 4CYPA 4CGOA 5A28A 4A2ZA 4UFVA 4CYNA 4CYQA 2YNCC 4UFWA 4BBHA 4B13A 3JTKA 4CGLA 4A32A 3IU1A 4CAEA 4B14A 4CGPA 4UFXA 2WSAA
chains in the Genus database with same CATH superfamily
1I1DA 2QECA 3TO7A 4ONUA 3RO0A 1YREA 3WC5A 3B3TA 5G21A 4LQGA 1ZO0A 2PJ9A 2AFXA 3H8FA 4AXVA 3D7GA 4BD9A 2D4PA 1IOIA 1M4DA 1BPNA 4HNYB 2YGWA 3PB6X 3FIXA 3GYAA 2Z3KA 2B3UA 3IO1A 1S3ZA 4ZGYB 4A31A 4GS4A 4AG9A 2HUZA 3NH8A 2PRQA 3T9YA 4A95A 1XMBA 2ZEFA 4MJ8A 2PJ7A 4OC5A 3TC8A 4OP4A 2VZYA 4A94A 4O23A 2ZEDA 2PR8A 2GIVA 4MCPA 4MFZA 4FD7A 1IOFA 1Z2LA 2C1CA 2OZUA 5F09A 4PSXA 4BBHA 4MFPA 1ZLIA 1I12A 4KUBA 4P4EA 2DF5A 1PUAA 3FXTA 5IV0A 3R95A 2NSMA 4MXUA 4MHZA 2Q4ZA 4NFRA 4OIWA 1UFHA 2R7HA 4AVAA 5K8OA 3QB8A 4MHPA 3EO4A 4KSIA 4OC4A 5KTAA 1CM0A 2FVGA 2AE6A 3V8IA 4CS0B 3FYNA 4WWVA 2ZW6A 3F8KA 4CGNA 3DDDA 4EMEA 3BI1A 3KGQA 3KI9A 1U6MA 1Z9UA 1YQEA 3IJ3A 4YGOA 1X10A 1MK4A 4I49A 4YU9A 4F0XA 5JGFA 5KTDA 2FXFA 1OZPA 3LMSA 2FIAA 2C27A 5THWA 1VHSA 3BJ7A 4UFVA 1TKHA 4RUHA 1H8LA 2OOTA 1Z4EA 1ARLA 3B35A 4PXEA 4HNWB 2ZEMA 4LQ6A 4E0AA 4E8OA 2JEVA 2V8VA 1BLLE 3KZWA 1WK4A 3SJXA 4R8FA 4ZBGA 2WUUA 2ZOGA 4IAVA 3W91A 4CRYB 2ZEOA 1QSOA 2EBJA 2O53A 2PJ3A 3CXPA 4MI4A 4MCSA 1F2PA 3RYOA 5G22A 3S6FA 3FF3A 1I21A 1KZFA 3D7HA 2ZW4A 5LYFA 1R57A 1Q2CA 2XEJA 5AG7A 3QNVA 4Q7AA 5AG6A 3QAYA 1OBRA 2Z11A 3D7FA 5ELYA 4CYPA 1XBUA 1YR0A 2PQ8A 4A2ZA 3TT2A 2DPSA 4UEEA 4F6AA 1QMUA 2B3VA 2PDOA 2ODFA 4BINA 4CGPA 1PYTB 5HVGA 1NSAA 2P6FA 3EY5A 3IWGA 2P0WA 2G3TA 2R98A 5DWNA 3W6SA 1Y0RA 2GANA 4NGQA 2GU2A 4UCPA 4OC3A 2G9DA 2RC4A 3R9EA 3G3SA 4PK3A 3BLNA 2CF4A 1ZG7A 4FD6A 4DUKA 3L2NA 3S6KA 4QUSA 1KUYA 5LYIA 3MN8A 2ZW5A 4ZX8A 4B5OA 4JXQA 1M4LA 4HPSA 4MY0A 2RB7A 4JZ0A 1YGHA 2ZEGA 3PB8X 2DPTA 1YW6A 4UCNA 2ZEHA 4UIAA 1F2OA 4FUUA 4UBRA 4B13A 2JDCA 3JTKA 4MBUA 5HXDA 2PVWA 4NGTA 1CJWA 3I9SA 3PP9A 4OC1A 4C7IA 2Q43A 1YVKA 3DNSA 4H6ZA 1ELMP 1IY7A 4R6TA 4NSQA 2I00A 2F8HA 1B6BA 1YW4A 2G0BA 4Q38A 4YWYA 4C2XA 4CGMA 2YNDA 4NCZA 1NSLA 1RTQA 3KASA 2CNTA 3B8GA 4UCMA 3FMCA 4U9YA 3FH4A 2Q7BA 3LD2A 1LFWA 4Y49B 1R3NA 1XIXA 1Z5RA 2B4BA 2BCOA 2BL1A 4OMEA 1ZG8A 4R87A 5LRKA 3H8EA 2O28A 3WC7A 2WZNA 4R76A 1Y7RA 2A4NA 3T8WA 2PE3A 3SI0A 3CZXA 3PRTA 3GLJA 4JXRA 3ZZIA 2ABZA 5EMIA 4A32A 4CAEA 2PJ0A 1LCPA 1NE9A 2FS5A 1QSRA 2YNEA 2VI7A 5HVFA 3IEHA 4KVXA 3FEDA 3F0AA 4DJLA 2EK8A 4IF5A 4Y49C 5CNPA 3SI2A 4ZY1A 2XEIA 2CNSA 2AFSA 1HEEA 1Q2YA 3IWWA 2D4OA 3TO9A 3S9LA 4MMOA 3EFAA 1YVOA 4ZY2A 4PXBA 4OKOA 3HLPA 2F7VA 3H8GA 3N7ZA 1GYTA 2PJ8A 3D68A 3OWCA 4PV6A 2XEGA 4UEFA 1LANA 4MRIA 5LYLA 2NMTA 1IYKA 3NFZA 2EWBA 3FBUA 3FEEA 2CIJA 4E2AA 5H86A 1PU9A 3D67A 3I1UA 4KOVA 3ISZA 3S9NA 1TIQA 2WSAA 3TX8A 2B5GA 4H2KA 2Q4YA 4P45A 1Q2DA 1IYLA 5DWMA 3FNCA 1VIXA 2Z3MA 4WJBA 4NGMA 4F0YA 2IQ6A 1P0HA 4L8AA 4KUAA 2PJBA 1Y0YA 2F5IA 4A37A 2PJCA 1IGBA 5D8NA 1KWMA 2IL4A 2Z3LA 3B3CA 1CG2A 4A30A 4KZTA 1WWZA 1AYEA 3RZAA 4FWUA 4CGOA 5F49A 2PC1A 2EUIA 3T90A 4QB9A 2R1IA 3DR6A 2H5MA 4CYNA 2JLMA 4EFDA 4MHNA 3TFYA 5CBMA 3PBBA 4KLVA 3TE4A 3JVNA 4GM5A 4CPAA 2AFMA 2K5TA 1CX8A 2IJZA 4ZY0A 3EC4A 2Q44A 1IB1E 3D4UA 3GIUA 3I3GA 1CP6A 1TF9A 2REFA 5LRJA 1BO4A 3VWEA 4F8ZA 2FCKA 2WYRA 3G8WA 4R9MA 1A2ZA 5AGEA 4II9A 1MJAA 2Z0ZA 3MGDA 4XPDB 2ZEEA 3S9MA 2QVPA 3D2MA 3DGVA 3NA6A 4AG7A 4W9YA 3ZJ0A 5K8MA 2P6GA 4ORFA 3SJFA 2JBJA 2WPWA 1Z8LA 2Y0MA 2YNCA 2DXQA 2JBKA 3NH4A 3R9FA 5D29A 4C7HA 1M44A 1S7LA 3JUWA 3CDXA 2ARHA 4GXHA 3NE7A 2OZHA 4OC0A 5K8PA 1S7KA 4M3SA 5ISVA 4YFJA 1CPSA 1M4IA 2PR1A 2Z3OA 3H4QA 4XPLA 1S7FA 1K4JA 1ARMA 1VHOA 1YSJA 2DEAA 2PJ4A 4P4IA 4XPDC 4B14A 4P4JA 1DE4C 2VL1A 2QJ8A 1TXRA 4MCQA 2V8DA 4AVBA 3DLJA 1FY7A 1S7NA 1Y9KA 2PCUA 2Z10A 2EK9A 4H89A 2HV2A 5IB9A 5H84A 4CAVA 3WT4A 2AFOA 2V8HA 2FIWA 3SXOA 2WPXA 1XOVA 3BXMA 4P4BA 4CAXA 4MY3A 2QYVA 3S6GA 3WR7A 4A38A 4KS9A 4Z65A 3NH5A 4PK2A 4ZYQA 5F46A 2PSWA 1M1DA 4DYOA 1MJBA 4DNCA 4NXYA 2IMOA 3S6HA 3DSBA 3LACA 3PB7X 1NMTA 3KR4A 4KSFA 1R43A 4XNHB 2ZXVA 4J3GA 4MFLA 2BUEA 4M6HA 4IHMA 4AB7A 4MFQA 2PJ5A 2G3AA 3UY5A 2PIYA 4R7MA 4LX9A 2Z3PA 2EVNA 2FL4A 4OADA 5J8FA 1LOKA 1SQHA 3P2HA 2R8VA 4OAEA 3RBUA 4TNUA 2JEWA 3A9LA 4K30A 4M6GA 5JPHA 5J1QA 2AFUA 5I0CA 2ATRA 3KQZA 3FJUA 4IK2A 1N71A 3PZJA 4KOTA 1LRZA 1XRYA 2B5GB 2PRBA 4M6IA 2FSRA 4XNHC 2ANPA 4UFWA 2BSWA 3SJGA 2FE7A 3PB4X 4UWIA 2B58A 4UA3A 3SI1A 3IU1A 4QBJA 1YMEA 3SJEA 1XJOA 1QSTA 4F9VA 1XF8A 1TKFA 4CRZB 4OC2A 5K8NA 2OR4A 4L89A 3TCVA 3KHXA 3B7IA 2VZZA 4ONWA 3VATA 3VARA 2ZOFA 1BAVA 4QVTA 4A33A 5BWAB 3CT9A 2VXKA 1Z8TA 2Q04A 1JQGA 4B11A 3P2FA 4MHDA 2XEFA 4NJRA 1V0CA 3PFEA 3F5BA 4P6YA 4P10A 1YLOA 1FT7A 5HMNA 1TF8A 3IGRA 4H6UA 3R96A 3CXQA 1LAMA 3PFOA 5HVHA 4JD6A 5JH9A 4U9ZA 6CPAA 4PPZA 2GE3A 3FX6A 1AMPA 1S60A 4NGRA 2Q0YA 3N5FA 4KOSA 5E96A 4C2YA 4MCRA 4PXCA 4NGSA 3TTHA 5DS0A 3ISXA 4MFJA 2OB0A 4CAFA 1Z8XA 1Y9WA 2CXAA 1XFOA 4PXDA 4X3RA 2AJ6A 2RFHA 2Q7SA 3GUXA 2Z3NA 1AUGA 3B2YA 4KVOE 2BO9A 2HC9A 2Q51A 4UF4A 5EC4A 2B4DA 4B12A 1GHEA 3PB9X 3BHXA 4UEZA 4B5PA 2VQYA 2QIRA 4LUAA 1RXTA 1XEBA 1ZLHA 1XMTA 4CYQA 2YNCC 4JJXA 2BEIA 4KLWA 4QC6A 3CXSA 3C26A 4EVYA 4CGLA 4U5YA 4KVME 4P4DA 2P6EA 4HKFA 4UFXA 4CAWA 5JM6A 2CNMA 1Z4RA 4RN7A 4KOUA 1HDQA 1Q7LA 1ZG9A 3NE8A 2OH1A 1CPXA 4G1PA 3QAHA 4P44A 3BJ8A 2QMLA 2J8NA 2PVVA 3R9GA 4BMHA 3CPAA 1VKCA 3V7ZA 1CBXA 2GLJA 4KORA 3VWDA 5GCNA 2VEZA 1QSNA 1Y7EA 3JRUA 5AG5A 5EBVA 4C2ZA 2PJ1A 3GB0A 2NYQA 4EWTA 2OU2A 5C82A 1ELLP 4UIBA 2REEA 3W6XA 2EO8A 1VGYA 2GLFA 1M4GA 4R57A 3SXNA 1IICA 4JLYA 2FT0A 5LRGA 1IIDA 3B3WA 4IUSA 4ZX9A 3WC6A 2PJAA 2ZPAA 3KR5A 2JDDA 5J8CA 1S5KA 3D8PA 4HNXB 3IWEA 3K9TA 4JWPA 1BOBA 2OZGA 4OIDA 4X5KA 3WABA 2O4HA 5AG4A 3D2PA 3H5ZA 2I3CA 2J8RA 4C68A 5HH1A 5C88A 1F57A 1TKJA 4KOYA 1ON0A 4NGPA 2KCWA 4P4FA 2C6GA 7CPAA 3B3VA 2PIZA 3PEIA 5IB0A 1YX0A 4X2TA 5IX3A 3SHPA 4NEXA 2AFWA 1KUXA 2AFZA 2C6PA 2I79A 1B87A 4OLLA 3HUVA 2CY2A 4K3NA 4KOXA 4RS2A 5I4MA 3TOAA 1DTDA 5CPAA 2X7BA 1HDUA 3LWUA 3FB3A 4PSWA 3EXNA 1RO5A 3MRUA 4NJQA 3KHZA 1IU8A 1J4JA 4M85A 3KQXA 4B6ZA 5JQ4A 3K2KA 2ZENA 2V77A 4TWEA 5F48A 1QQ9A 2ZEPA 3KL9A 2VBQA 4R3KA 3V38A 3GKRA 4YRHA 4ZI6A 2C6CA 3RAMA 3BI0A 4MHYA 3FECA 3PBEA 3R1KA 4MFKA 2CTBA 4A39A 1L0CA 5G1ZA 4F9UA 2PJ2A 3FVLA 1FNOA 4NF1A 5A28A 8CPAA 1KUVA 5F47A 4UWJA 1UWYA 1XE4A 1YLEA 4FBEA 2J9AA 3RNZA 5LYDA 1CP7A 3K9UA 5KTCA 3VH9A 3IFEA 1P4NA 2BOAA 3KKWA 3B3SA 4JYWA 3GY9A 3TOBA 4B10A 4RI1A 3IU2A 2J8MA 2B4DB 2Q4VA 4KSAA 1BPMA 2ZELA 3LODA 4Q36A 4B5PB 2HB6A 3PGPA 1Z8WA 3E0KA 5A27A 5G20A 2V8GA 4CYOA 4FAIA 4AVCA 4FD4A 3D3SA 1VHEA 4PQAA 2POKA 3D66A 1LAPA 4XPKA 1YK3A 3IC1A 3D7DA 2GREA 4R3LA 4X8IA 3FRMA 2ZW7A 1MJ9A 5FVJA 1EE3P 1X12A 1QSMA 1PCAA 4NGNA 3CPXA 2CTCA 3DR8A 2HQYA 2GFQA 3IIBA 4KOWA 4FD5A 1JWQA 2PJ6A 3TO6A
chains in the Genus database with same CATH topology
1I1DA 2QECA 3TO7A 4ONUA 1YREA 5G21A 1ZO0A 2D4PA 1M4DA 4HNYB 2YGWA 3FIXA 3GYAA 2Z3KA 2B3UA 1S3ZA 4ZGYB 4A31A 4GS4A 4AG9A 2HUZA 3T9YA 4A95A 4MJ8A 2VZYA 2PR8A 2GIVA 4MFZA 4FD7A 2OZUA 4PSXA 4BBHA 4MFPA 1I12A 4KUBA 1PUAA 3FXTA 3R95A 4AVAA 1UFHA 2R7HA 3QB8A 3EO4A 5KTAA 1CM0A 2AE6A 3V8IA 4CS0B 3FYNA 2ZW6A 3F8KA 4CGNA 3DDDA 1U6MA 1Z9UA 4YGOA 1MK4A 4I49A 4F0XA 5KTDA 2FXFA 1OZPA 2FIAA 2C27A 1VHSA 3BJ7A 4UFVA 1Z4EA 4HNWB 4E0AA 4E8OA 2JEVA 1WK4A 4ZBGA 2WUUA 3W91A 4CRYB 1QSOA 3CXPA 4MI4A 3RYOA 5G22A 3S6FA 1I21A 1KZFA 2ZW4A 1R57A 1Q2CA 5AG7A 5AG6A 2Z11A 4CYPA 1YR0A 2PQ8A 4A2ZA 3TT2A 2DPSA 4F6AA 2B3VA 2PDOA 4CGPA 2P6FA 3EY5A 3IWGA 2P0WA 2G3TA 2R98A 5DWNA 3W6SA 2GANA 4UCPA 2RC4A 3R9EA 3G3SA 4PK3A 3BLNA 4FD6A 3S6KA 4QUSA 1KUYA 2ZW5A 4B5OA 4JXQA 4MY0A 1YGHA 2DPTA 4UCNA 4UBRA 4B13A 2JDCA 3JTKA 4MBUA 1CJWA 3I9SA 3PP9A 4C7IA 1YVKA 3DNSA 4H6ZA 4NSQA 2I00A 1B6BA 2G0BA 4Q38A 4C2XA 4CGMA 4F0YA 2YNDA 4NCZA 1NSLA 2CNTA 3B8GA 4UCMA 4U9YA 2Q7BA 3LD2A 4Y49B 1XIXA 2B4BA 2BL1A 4R87A 2O28A 1Y7RA 2A4NA 4JXRA 3ZZIA 4A32A 4CAEA 1NE9A 2FS5A 1QSRA 2YNEA 2VI7A 4KVXA 3F0AA 4Y49C 4IF5A 5CNPA 2CNSA 1Q2YA 2D4OA 3TO9A 3EFAA 1YVOA 3OWCA 3N7ZA 4PV6A 2NMTA 1IYKA 3FBUA 4E2AA 5H86A 1PU9A 4KOVA 1TIQA 2WSAA 2B5GA 2Q4YA 1Q2DA 1IYLA 3FNCA 2Z3MA 1P0HA 4L8AA 4KUAA 2F5IA 2IL4A 2Z3LA 4A30A 4KZTA 1WWZA 4CGOA 5F49A 2PC1A 2EUIA 3T90A 4QB9A 2R1IA 3DR6A 2H5MA 4CYNA 2JLMA 3TFYA 4KLVA 3TE4A 3JVNA 2K5TA 3EC4A 2Q44A 1IB1E 3I3GA 3VWEA 2REFA 1BO4A 2FCKA 3G8WA 4R9MA 5AGEA 4II9A 1MJAA 2Z0ZA 3MGDA 4XPDB 3D2MA 4AG7A 3ZJ0A 2P6GA 4ORFA 2WPWA 2Y0MA 2YNCA 2DXQA 3R9FA 4C7HA 1M44A 1S7LA 3JUWA 2ARHA 3NE7A 2OZHA 1S7KA 4M3SA 5ISVA 4YFJA 2PR1A 1M4IA 3H4QA 2Z3OA 4XPLA 1S7FA 1K4JA 4XPDC 4B14A 4AVBA 1FY7A 1S7NA 1Y9KA 2Z10A 4H89A 2HV2A 5H84A 4CAVA 2FIWA 3SXOA 2WPXA 4CAXA 4MY3A 3S6GA 3WR7A 4KS9A 4PK2A 5F46A 2PSWA 1M1DA 1MJBA 4DNCA 4NXYA 3S6HA 3DSBA 1NMTA 4KSFA 4XNHB 2ZXVA 4J3GA 4MFLA 2BUEA 4AB7A 4MFQA 2G3AA 3UY5A 4LX9A 2Z3PA 2EVNA 2FL4A 4OADA 5J8FA 1SQHA 3P2HA 2R8VA 4OAEA 3A9LA 4K30A 5JPHA 5I0CA 2ATRA 5DWMA 1N71A 3PZJA 4KOTA 1LRZA 5IV0A 2B5GB 2PRBA 4XNHC 2FSRA 4UFWA 2BSWA 2FE7A 4UWIA 2B58A 4UA3A 3IU1A 4QBJA 1QSTA 1XF8A 4CRZB 4L89A 3TCVA 2VZZA 4QVTA 4A33A 5BWAB 2VXKA 2Q04A 4B11A 3P2FA 4MHDA 1V0CA 3F5BA 5HMNA 3IGRA 4H6UA 3R96A 3CXQA 4JD6A 4U9ZA 2GE3A 1S60A 2Q0YA 4KOSA 5E96A 4C2YA 3TTHA 4MFJA 2OB0A 4CAFA 1Y9WA 2CXAA 2AJ6A 2Z3NA 4KVOE 5EC4A 4B12A 2B4DA 1GHEA 4B5PA 2VQYA 2QIRA 4LUAA 1RXTA 1XEBA 1XMTA 4CYQA 2YNCC 4JJXA 2BEIA 4KLWA 4QC6A 3CXSA 3C26A 4EVYA 4CGLA 4U5YA 4KVME 2P6EA 4HKFA 4UFXA 4CAWA 2CNMA 1Z4RA 4KOUA 2OH1A 3QAHA 3BJ8A 2QMLA 2J8NA 3R9GA 4BMHA 1VKCA 4KORA 3VWDA 5GCNA 2VEZA 1QSNA 5AG5A 5EBVA 4C2ZA 2OU2A 5C82A 2REEA 3W6XA 1M4GA 4R57A 3SXNA 1IICA 4JLYA 2FT0A 1IIDA 4IUSA 2ZPAA 2JDDA 5J8CA 1S5KA 3D8PA 4HNXB 3IWEA 4JWPA 1BOBA 2OZGA 4X5KA 5AG4A 3D2PA 3H5ZA 2J8RA 4C68A 5HH1A 5C88A 4KOYA 1ON0A 2KCWA 5IB0A 1YX0A 5IX3A 3SHPA 4NEXA 1KUXA 2I79A 1B87A 4OLLA 2CY2A 4KOXA 4RS2A 3TOAA 2X7BA 4PSWA 3FB3A 3EXNA 1RO5A 1J4JA 4M85A 5JQ4A 5F48A 2VBQA 4R3KA 3GKRA 4YRHA 3R1KA 4MFKA 1L0CA 5G1ZA 5A28A 4NF1A 1KUVA 5F47A 4UWJA 1XE4A 1YLEA 3K9UA 5KTCA 1P4NA 3KKWA 3GY9A 3TOBA 4B10A 4RI1A 3IU2A 2J8MA 2B4DB 2Q4VA 4KSAA 3LODA 4Q36A 4B5PB 3PGPA 3E0KA 5A27A 5G20A 4CYOA 4AVCA 4FD4A 3D3SA 4XPKA 1YK3A 4R3LA 3FRMA 1MJ9A 5FVJA 1QSMA 3DR8A 2HQYA 4KOWA 4FD5A 2ZW7A 3TO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WUU A;  4C7I A;  4C2Y A;  2YNE A;  3IWE A;  4UCP A;  5G21 A;  5AGE A;  4B10 A;  5AG4 A;  4CAF A;  3IU2 A;  3H5Z A;  4C68 A;  4CGN A;  4A33 A;  5G22 A;  4C2X A;  5G20 A;  4CGM A;  2YND A;  4CYO A;  5A27 A;  2YNC A;  5AG5 A;  4A31 A;  4B11 A;  4UCM A;  4C2Z A;  4B12 A;  4A95 A;  5AG7 A;  4C7H A;  4A30 A;  5G1Z A;  5AG6 A;  4UCN A;  4CYP A;  4CGO A;  5A28 A;  4A2Z A;  4UFV A;  4CYN A;  4CYQ A;  2YNC C;  4UFW A;  4BBH A;  4B13 A;  3JTK A;  4CGL A;  4A32 A;  3IU1 A;  4CAE A;  4B14 A;  4CGP A;  4UFX A;  2WSA A; 
#chains in the Genus database with same CATH topology
 1I1D A;  2QEC A;  3TO7 A;  4ONU A;  3RO0 A;  1YRE A;  3WC5 A;  3B3T A;  5G21 A;  4LQG A;  1ZO0 A;  2PJ9 A;  2AFX A;  3H8F A;  4AXV A;  3D7G A;  4BD9 A;  2D4P A;  1IOI A;  1M4D A;  1BPN A;  4HNY B;  2YGW A;  3PB6 X;  3FIX A;  3GYA A;  2Z3K A;  2B3U A;  3IO1 A;  1S3Z A;  4ZGY B;  4A31 A;  4GS4 A;  4AG9 A;  2HUZ A;  3NH8 A;  2PRQ A;  3T9Y A;  4A95 A;  1XMB A;  2ZEF A;  4MJ8 A;  2PJ7 A;  4OC5 A;  3TC8 A;  4OP4 A;  2VZY A;  4A94 A;  4O23 A;  2ZED A;  2PR8 A;  2GIV A;  4MCP A;  4MFZ A;  4FD7 A;  1IOF A;  1Z2L A;  2C1C A;  2OZU A;  5F09 A;  4PSX A;  4BBH A;  4MFP A;  1ZLI A;  1I12 A;  4KUB A;  4P4E A;  2DF5 A;  1PUA A;  3FXT A;  5IV0 A;  3R95 A;  2NSM A;  4MXU A;  4MHZ A;  2Q4Z A;  4NFR A;  4OIW A;  1UFH A;  2R7H A;  4AVA A;  5K8O A;  3QB8 A;  4MHP A;  3EO4 A;  4KSI A;  4OC4 A;  5KTA A;  1CM0 A;  2FVG A;  2AE6 A;  3V8I A;  4CS0 B;  3FYN A;  4WWV A;  2ZW6 A;  3F8K A;  4CGN A;  3DDD A;  4EME A;  3BI1 A;  3KGQ A;  3KI9 A;  1U6M A;  1Z9U A;  1YQE A;  3IJ3 A;  4YGO A;  1X10 A;  1MK4 A;  4I49 A;  4YU9 A;  4F0X A;  5JGF A;  5KTD A;  2FXF A;  1OZP A;  3LMS A;  2FIA A;  2C27 A;  5THW A;  1VHS A;  3BJ7 A;  4UFV A;  1TKH A;  4RUH A;  1H8L A;  2OOT A;  1Z4E A;  1ARL A;  3B35 A;  4PXE A;  4HNW B;  2ZEM A;  4LQ6 A;  4E0A A;  4E8O A;  2JEV A;  2V8V A;  1BLL E;  3KZW A;  1WK4 A;  3SJX A;  4R8F A;  4ZBG A;  2WUU A;  2ZOG A;  4IAV A;  3W91 A;  4CRY B;  2ZEO A;  1QSO A;  2EBJ A;  2O53 A;  2PJ3 A;  3CXP A;  4MI4 A;  4MCS A;  1F2P A;  3RYO A;  5G22 A;  3S6F A;  3FF3 A;  1I21 A;  1KZF A;  3D7H A;  2ZW4 A;  5LYF A;  1R57 A;  1Q2C A;  2XEJ A;  5AG7 A;  3QNV A;  4Q7A A;  5AG6 A;  3QAY A;  1OBR A;  2Z11 A;  3D7F A;  5ELY A;  4CYP A;  1XBU A;  1YR0 A;  2PQ8 A;  4A2Z A;  3TT2 A;  2DPS A;  4UEE A;  4F6A A;  1QMU A;  2B3V A;  2PDO A;  2ODF A;  4BIN A;  4CGP A;  1PYT B;  5HVG A;  1NSA A;  2P6F A;  3EY5 A;  3IWG A;  2P0W A;  2G3T A;  2R98 A;  5DWN A;  3W6S A;  1Y0R A;  2GAN A;  4NGQ A;  2GU2 A;  4UCP A;  4OC3 A;  2G9D A;  2RC4 A;  3R9E A;  3G3S A;  4PK3 A;  3BLN A;  2CF4 A;  1ZG7 A;  4FD6 A;  4DUK A;  3L2N A;  3S6K A;  4QUS A;  1KUY A;  5LYI A;  3MN8 A;  2ZW5 A;  4ZX8 A;  4B5O A;  4JXQ A;  1M4L A;  4HPS A;  4MY0 A;  2RB7 A;  4JZ0 A;  1YGH A;  2ZEG A;  3PB8 X;  2DPT A;  1YW6 A;  4UCN A;  2ZEH A;  4UIA A;  1F2O A;  4FUU A;  4UBR A;  4B13 A;  2JDC A;  3JTK A;  4MBU A;  5HXD A;  2PVW A;  4NGT A;  1CJW A;  3I9S A;  3PP9 A;  4OC1 A;  4C7I A;  2Q43 A;  1YVK A;  3DNS A;  4H6Z A;  1ELM P;  1IY7 A;  4R6T A;  4NSQ A;  2I00 A;  2F8H A;  1B6B A;  1YW4 A;  2G0B A;  4Q38 A;  4YWY A;  4C2X A;  4CGM A;  2YND A;  4NCZ A;  1NSL A;  1RTQ A;  3KAS A;  2CNT A;  3B8G A;  4UCM A;  3FMC A;  4U9Y A;  3FH4 A;  2Q7B A;  3LD2 A;  1LFW A;  4Y49 B;  1R3N A;  1XIX A;  1Z5R A;  2B4B A;  2BCO A;  2BL1 A;  4OME A;  1ZG8 A;  4R87 A;  5LRK A;  3H8E A;  2O28 A;  3WC7 A;  2WZN A;  4R76 A;  1Y7R A;  2A4N A;  3T8W A;  2PE3 A;  3SI0 A;  3CZX A;  3PRT A;  3GLJ A;  4JXR A;  3ZZI A;  2ABZ A;  5EMI A;  4A32 A;  4CAE A;  2PJ0 A;  1LCP A;  1NE9 A;  2FS5 A;  1QSR A;  2YNE A;  2VI7 A;  5HVF A;  3IEH A;  4KVX A;  3FED A;  3F0A A;  4DJL A;  2EK8 A;  4IF5 A;  4Y49 C;  5CNP A;  3SI2 A;  4ZY1 A;  2XEI A;  2CNS A;  2AFS A;  1HEE A;  1Q2Y A;  3IWW A;  2D4O A;  3TO9 A;  3S9L A;  4MMO A;  3EFA A;  1YVO A;  4ZY2 A;  4PXB A;  4OKO A;  3HLP A;  2F7V A;  3H8G A;  3N7Z A;  1GYT A;  2PJ8 A;  3D68 A;  3OWC A;  4PV6 A;  2XEG A;  4UEF A;  1LAN A;  4MRI A;  5LYL A;  2NMT A;  1IYK A;  3NFZ A;  2EWB A;  3FBU A;  3FEE A;  2CIJ A;  4E2A A;  5H86 A;  1PU9 A;  3D67 A;  3I1U A;  4KOV A;  3ISZ A;  3S9N A;  1TIQ A;  2WSA A;  3TX8 A;  2B5G A;  4H2K A;  2Q4Y A;  4P45 A;  1Q2D A;  1IYL A;  5DWM A;  3FNC A;  1VIX A;  2Z3M A;  4WJB A;  4NGM A;  4F0Y A;  2IQ6 A;  1P0H A;  4L8A A;  4KUA A;  2PJB A;  1Y0Y A;  2F5I A;  4A37 A;  2PJC A;  1IGB A;  5D8N A;  1KWM A;  2IL4 A;  2Z3L A;  3B3C A;  1CG2 A;  4A30 A;  4KZT A;  1WWZ A;  1AYE A;  3RZA A;  4FWU A;  4CGO A;  5F49 A;  2PC1 A;  2EUI A;  3T90 A;  4QB9 A;  2R1I A;  3DR6 A;  2H5M A;  4CYN A;  2JLM A;  4EFD A;  4MHN A;  3TFY A;  5CBM A;  3PBB A;  4KLV A;  3TE4 A;  3JVN A;  4GM5 A;  4CPA A;  2AFM A;  2K5T A;  1CX8 A;  2IJZ A;  4ZY0 A;  3EC4 A;  2Q44 A;  1IB1 E;  3D4U A;  3GIU A;  3I3G A;  1CP6 A;  1TF9 A;  2REF A;  5LRJ A;  1BO4 A;  3VWE A;  4F8Z A;  2FCK A;  2WYR A;  3G8W A;  4R9M A;  1A2Z A;  5AGE A;  4II9 A;  1MJA A;  2Z0Z A;  3MGD A;  4XPD B;  2ZEE A;  3S9M A;  2QVP A;  3D2M A;  3DGV A;  3NA6 A;  4AG7 A;  4W9Y A;  3ZJ0 A;  5K8M A;  2P6G A;  4ORF A;  3SJF A;  2JBJ A;  2WPW A;  1Z8L A;  2Y0M A;  2YNC A;  2DXQ A;  2JBK A;  3NH4 A;  3R9F A;  5D29 A;  4C7H A;  1M44 A;  1S7L A;  3JUW A;  3CDX A;  2ARH A;  4GXH A;  3NE7 A;  2OZH A;  4OC0 A;  5K8P A;  1S7K A;  4M3S A;  5ISV A;  4YFJ A;  1CPS A;  1M4I A;  2PR1 A;  2Z3O A;  3H4Q A;  4XPL A;  1S7F A;  1K4J A;  1ARM A;  1VHO A;  1YSJ A;  2DEA A;  2PJ4 A;  4P4I A;  4XPD C;  4B14 A;  4P4J A;  1DE4 C;  2VL1 A;  2QJ8 A;  1TXR A;  4MCQ A;  2V8D A;  4AVB A;  3DLJ A;  1FY7 A;  1S7N A;  1Y9K A;  2PCU A;  2Z10 A;  2EK9 A;  4H89 A;  2HV2 A;  5IB9 A;  5H84 A;  4CAV A;  3WT4 A;  2AFO A;  2V8H A;  2FIW A;  3SXO A;  2WPX A;  1XOV A;  3BXM A;  4P4B A;  4CAX A;  4MY3 A;  2QYV A;  3S6G A;  3WR7 A;  4A38 A;  4KS9 A;  4Z65 A;  3NH5 A;  4PK2 A;  4ZYQ A;  5F46 A;  2PSW A;  1M1D A;  4DYO A;  1MJB A;  4DNC A;  4NXY A;  2IMO A;  3S6H A;  3DSB A;  3LAC A;  3PB7 X;  1NMT A;  3KR4 A;  4KSF A;  1R43 A;  4XNH B;  2ZXV A;  4J3G A;  4MFL A;  2BUE A;  4M6H A;  4IHM A;  4AB7 A;  4MFQ A;  2PJ5 A;  2G3A A;  3UY5 A;  2PIY A;  4R7M A;  4LX9 A;  2Z3P A;  2EVN A;  2FL4 A;  4OAD A;  5J8F A;  1LOK A;  1SQH A;  3P2H A;  2R8V A;  4OAE A;  3RBU A;  4TNU A;  2JEW A;  3A9L A;  4K30 A;  4M6G A;  5JPH A;  5J1Q A;  2AFU A;  5I0C A;  2ATR A;  3KQZ A;  3FJU A;  4IK2 A;  1N71 A;  3PZJ A;  4KOT A;  1LRZ A;  1XRY A;  2B5G B;  2PRB A;  4M6I A;  2FSR A;  4XNH C;  2ANP A;  4UFW A;  2BSW A;  3SJG A;  2FE7 A;  3PB4 X;  4UWI A;  2B58 A;  4UA3 A;  3SI1 A;  3IU1 A;  4QBJ A;  1YME A;  3SJE A;  1XJO A;  1QST A;  4F9V A;  1XF8 A;  1TKF A;  4CRZ B;  4OC2 A;  5K8N A;  2OR4 A;  4L89 A;  3TCV A;  3KHX A;  3B7I A;  2VZZ A;  4ONW A;  3VAT A;  3VAR A;  2ZOF A;  1BAV A;  4QVT A;  4A33 A;  5BWA B;  3CT9 A;  2VXK A;  1Z8T A;  2Q04 A;  1JQG A;  4B11 A;  3P2F A;  4MHD A;  2XEF A;  4NJR A;  1V0C A;  3PFE A;  3F5B A;  4P6Y A;  4P10 A;  1YLO A;  1FT7 A;  5HMN A;  1TF8 A;  3IGR A;  4H6U A;  3R96 A;  3CXQ A;  1LAM A;  3PFO A;  5HVH A;  4JD6 A;  5JH9 A;  4U9Z A;  6CPA A;  4PPZ A;  2GE3 A;  3FX6 A;  1AMP A;  1S60 A;  4NGR A;  2Q0Y A;  3N5F A;  4KOS A;  5E96 A;  4C2Y A;  4MCR A;  4PXC A;  4NGS A;  3TTH A;  5DS0 A;  3ISX A;  4MFJ A;  2OB0 A;  4CAF A;  1Z8X A;  1Y9W A;  2CXA A;  1XFO A;  4PXD A;  4X3R A;  2AJ6 A;  2RFH A;  2Q7S A;  3GUX A;  2Z3N A;  1AUG A;  3B2Y A;  4KVO E;  2BO9 A;  2HC9 A;  2Q51 A;  4UF4 A;  5EC4 A;  2B4D A;  4B12 A;  1GHE A;  3PB9 X;  3BHX A;  4UEZ A;  4B5P A;  2VQY A;  2QIR A;  4LUA A;  1RXT A;  1XEB A;  1ZLH A;  1XMT A;  4CYQ A;  2YNC C;  4JJX A;  2BEI A;  4KLW A;  4QC6 A;  3CXS A;  3C26 A;  4EVY A;  4CGL A;  4U5Y A;  4KVM E;  4P4D A;  2P6E A;  4HKF A;  4UFX A;  4CAW A;  5JM6 A;  2CNM A;  1Z4R A;  4RN7 A;  4KOU A;  1HDQ A;  1Q7L A;  1ZG9 A;  3NE8 A;  2OH1 A;  1CPX A;  4G1P A;  3QAH A;  4P44 A;  3BJ8 A;  2QML A;  2J8N A;  2PVV A;  3R9G A;  4BMH A;  3CPA A;  1VKC A;  3V7Z A;  1CBX A;  2GLJ A;  4KOR A;  3VWD A;  5GCN A;  2VEZ A;  1QSN A;  1Y7E A;  3JRU A;  5AG5 A;  5EBV A;  4C2Z A;  2PJ1 A;  3GB0 A;  2NYQ A;  4EWT A;  2OU2 A;  5C82 A;  1ELL P;  4UIB A;  2REE A;  3W6X A;  2EO8 A;  1VGY A;  2GLF A;  1M4G A;  4R57 A;  3SXN A;  1IIC A;  4JLY A;  2FT0 A;  5LRG A;  1IID A;  3B3W A;  4IUS A;  4ZX9 A;  3WC6 A;  2PJA A;  2ZPA A;  3KR5 A;  2JDD A;  5J8C A;  1S5K A;  3D8P A;  4HNX B;  3IWE A;  3K9T A;  4JWP A;  1BOB A;  2OZG A;  4OID A;  4X5K A;  3WAB A;  2O4H A;  5AG4 A;  3D2P A;  3H5Z A;  2I3C A;  2J8R A;  4C68 A;  5HH1 A;  5C88 A;  1F57 A;  1TKJ A;  4KOY A;  1ON0 A;  4NGP A;  2KCW A;  4P4F A;  2C6G A;  7CPA A;  3B3V A;  2PIZ A;  3PEI A;  5IB0 A;  1YX0 A;  4X2T A;  5IX3 A;  3SHP A;  4NEX A;  2AFW A;  1KUX A;  2AFZ A;  2C6P A;  2I79 A;  1B87 A;  4OLL A;  3HUV A;  2CY2 A;  4K3N A;  4KOX A;  4RS2 A;  5I4M A;  3TOA A;  1DTD A;  5CPA A;  2X7B A;  1HDU A;  3LWU A;  3FB3 A;  4PSW A;  3EXN A;  1RO5 A;  3MRU A;  4NJQ A;  3KHZ A;  1IU8 A;  1J4J A;  4M85 A;  3KQX A;  4B6Z A;  5JQ4 A;  3K2K A;  2ZEN A;  2V77 A;  4TWE A;  5F48 A;  1QQ9 A;  2ZEP A;  3KL9 A;  2VBQ A;  4R3K A;  3V38 A;  3GKR A;  4YRH A;  4ZI6 A;  2C6C A;  3RAM A;  3BI0 A;  4MHY A;  3FEC A;  3PBE A;  3R1K A;  4MFK A;  2CTB A;  4A39 A;  1L0C A;  5G1Z A;  4F9U A;  2PJ2 A;  3FVL A;  1FNO A;  4NF1 A;  5A28 A;  8CPA A;  1KUV A;  5F47 A;  4UWJ A;  1UWY A;  1XE4 A;  1YLE A;  4FBE A;  2J9A A;  3RNZ A;  5LYD A;  1CP7 A;  3K9U A;  5KTC A;  3VH9 A;  3IFE A;  1P4N A;  2BOA A;  3KKW A;  3B3S A;  4JYW A;  3GY9 A;  3TOB A;  4B10 A;  4RI1 A;  3IU2 A;  2J8M A;  2B4D B;  2Q4V A;  4KSA A;  1BPM A;  2ZEL A;  3LOD A;  4Q36 A;  4B5P B;  2HB6 A;  3PGP A;  1Z8W A;  3E0K A;  5A27 A;  5G20 A;  2V8G A;  4CYO A;  4FAI A;  4AVC A;  4FD4 A;  3D3S A;  1VHE A;  4PQA A;  2POK A;  3D66 A;  1LAP A;  4XPK A;  1YK3 A;  3IC1 A;  3D7D A;  2GRE A;  4R3L A;  4X8I A;  3FRM A;  2ZW7 A;  1MJ9 A;  5FVJ A;  1EE3 P;  1X12 A;  1QSM A;  1PCA A;  4NGN A;  3CPX A;  2CTC A;  3DR8 A;  2HQY A;  2GFQ A;  3IIB A;  4KOW A;  4FD5 A;  1JWQ A;  2PJ6 A;  3TO6 A; 
#chains in the Genus database with same CATH homology
 1I1D A;  2QEC A;  3TO7 A;  4ONU A;  1YRE A;  5G21 A;  1ZO0 A;  2D4P A;  1M4D A;  4HNY B;  2YGW A;  3FIX A;  3GYA A;  2Z3K A;  2B3U A;  1S3Z A;  4ZGY B;  4A31 A;  4GS4 A;  4AG9 A;  2HUZ A;  3T9Y A;  4A95 A;  4MJ8 A;  2VZY A;  2PR8 A;  2GIV A;  4MFZ A;  4FD7 A;  2OZU A;  4PSX A;  4BBH A;  4MFP A;  1I12 A;  4KUB A;  1PUA A;  3FXT A;  3R95 A;  4AVA A;  1UFH A;  2R7H A;  3QB8 A;  3EO4 A;  5KTA A;  1CM0 A;  2AE6 A;  3V8I A;  4CS0 B;  3FYN A;  2ZW6 A;  3F8K A;  4CGN A;  3DDD A;  1U6M A;  1Z9U A;  4YGO A;  1MK4 A;  4I49 A;  4F0X A;  5KTD A;  2FXF A;  1OZP A;  2FIA A;  2C27 A;  1VHS A;  3BJ7 A;  4UFV A;  1Z4E A;  4HNW B;  4E0A A;  4E8O A;  2JEV A;  1WK4 A;  4ZBG A;  2WUU A;  3W91 A;  4CRY B;  1QSO A;  3CXP A;  4MI4 A;  3RYO A;  5G22 A;  3S6F A;  1I21 A;  1KZF A;  2ZW4 A;  1R57 A;  1Q2C A;  5AG7 A;  5AG6 A;  2Z11 A;  4CYP A;  1YR0 A;  2PQ8 A;  4A2Z A;  3TT2 A;  2DPS A;  4F6A A;  2B3V A;  2PDO A;  4CGP A;  2P6F A;  3EY5 A;  3IWG A;  2P0W A;  2G3T A;  2R98 A;  5DWN A;  3W6S A;  2GAN A;  4UCP A;  2RC4 A;  3R9E A;  3G3S A;  4PK3 A;  3BLN A;  4FD6 A;  3S6K A;  4QUS A;  1KUY A;  2ZW5 A;  4B5O A;  4JXQ A;  4MY0 A;  1YGH A;  2DPT A;  4UCN A;  4UBR A;  4B13 A;  2JDC A;  3JTK A;  4MBU A;  1CJW A;  3I9S A;  3PP9 A;  4C7I A;  1YVK A;  3DNS A;  4H6Z A;  4NSQ A;  2I00 A;  1B6B A;  2G0B A;  4Q38 A;  4C2X A;  4CGM A;  4F0Y A;  2YND A;  4NCZ A;  1NSL A;  2CNT A;  3B8G A;  4UCM A;  4U9Y A;  2Q7B A;  3LD2 A;  4Y49 B;  1XIX A;  2B4B A;  2BL1 A;  4R87 A;  2O28 A;  1Y7R A;  2A4N A;  4JXR A;  3ZZI A;  4A32 A;  4CAE A;  1NE9 A;  2FS5 A;  1QSR A;  2YNE A;  2VI7 A;  4KVX A;  3F0A A;  4Y49 C;  4IF5 A;  5CNP A;  2CNS A;  1Q2Y A;  2D4O A;  3TO9 A;  3EFA A;  1YVO A;  3OWC A;  3N7Z A;  4PV6 A;  2NMT A;  1IYK A;  3FBU A;  4E2A A;  5H86 A;  1PU9 A;  4KOV A;  1TIQ A;  2WSA A;  2B5G A;  2Q4Y A;  1Q2D A;  1IYL A;  3FNC A;  2Z3M A;  1P0H A;  4L8A A;  4KUA A;  2F5I A;  2IL4 A;  2Z3L A;  4A30 A;  4KZT A;  1WWZ A;  4CGO A;  5F49 A;  2PC1 A;  2EUI A;  3T90 A;  4QB9 A;  2R1I A;  3DR6 A;  2H5M A;  4CYN A;  2JLM A;  3TFY A;  4KLV A;  3TE4 A;  3JVN A;  2K5T A;  3EC4 A;  2Q44 A;  1IB1 E;  3I3G A;  3VWE A;  2REF A;  1BO4 A;  2FCK A;  3G8W A;  4R9M A;  5AGE A;  4II9 A;  1MJA A;  2Z0Z A;  3MGD A;  4XPD B;  3D2M A;  4AG7 A;  3ZJ0 A;  2P6G A;  4ORF A;  2WPW A;  2Y0M A;  2YNC A;  2DXQ A;  3R9F A;  4C7H A;  1M44 A;  1S7L A;  3JUW A;  2ARH A;  3NE7 A;  2OZH A;  1S7K A;  4M3S A;  5ISV A;  4YFJ A;  2PR1 A;  1M4I A;  3H4Q A;  2Z3O A;  4XPL A;  1S7F A;  1K4J A;  4XPD C;  4B14 A;  4AVB A;  1FY7 A;  1S7N A;  1Y9K A;  2Z10 A;  4H89 A;  2HV2 A;  5H84 A;  4CAV A;  2FIW A;  3SXO A;  2WPX A;  4CAX A;  4MY3 A;  3S6G A;  3WR7 A;  4KS9 A;  4PK2 A;  5F46 A;  2PSW A;  1M1D A;  1MJB A;  4DNC A;  4NXY A;  3S6H A;  3DSB A;  1NMT A;  4KSF A;  4XNH B;  2ZXV A;  4J3G A;  4MFL A;  2BUE A;  4AB7 A;  4MFQ A;  2G3A A;  3UY5 A;  4LX9 A;  2Z3P A;  2EVN A;  2FL4 A;  4OAD A;  5J8F A;  1SQH A;  3P2H A;  2R8V A;  4OAE A;  3A9L A;  4K30 A;  5JPH A;  5I0C A;  2ATR A;  5DWM A;  1N71 A;  3PZJ A;  4KOT A;  1LRZ A;  5IV0 A;  2B5G B;  2PRB A;  4XNH C;  2FSR A;  4UFW A;  2BSW A;  2FE7 A;  4UWI A;  2B58 A;  4UA3 A;  3IU1 A;  4QBJ A;  1QST A;  1XF8 A;  4CRZ B;  4L89 A;  3TCV A;  2VZZ A;  4QVT A;  4A33 A;  5BWA B;  2VXK A;  2Q04 A;  4B11 A;  3P2F A;  4MHD A;  1V0C A;  3F5B A;  5HMN A;  3IGR A;  4H6U A;  3R96 A;  3CXQ A;  4JD6 A;  4U9Z A;  2GE3 A;  1S60 A;  2Q0Y A;  4KOS A;  5E96 A;  4C2Y A;  3TTH A;  4MFJ A;  2OB0 A;  4CAF A;  1Y9W A;  2CXA A;  2AJ6 A;  2Z3N A;  4KVO E;  5EC4 A;  4B12 A;  2B4D A;  1GHE A;  4B5P A;  2VQY A;  2QIR A;  4LUA A;  1RXT A;  1XEB A;  1XMT A;  4CYQ A;  2YNC C;  4JJX A;  2BEI A;  4KLW A;  4QC6 A;  3CXS A;  3C26 A;  4EVY A;  4CGL A;  4U5Y A;  4KVM E;  2P6E A;  4HKF A;  4UFX A;  4CAW A;  2CNM A;  1Z4R A;  4KOU A;  2OH1 A;  3QAH A;  3BJ8 A;  2QML A;  2J8N A;  3R9G A;  4BMH A;  1VKC A;  4KOR A;  3VWD A;  5GCN A;  2VEZ A;  1QSN A;  5AG5 A;  5EBV A;  4C2Z A;  2OU2 A;  5C82 A;  2REE A;  3W6X A;  1M4G A;  4R57 A;  3SXN A;  1IIC A;  4JLY A;  2FT0 A;  1IID A;  4IUS A;  2ZPA A;  2JDD A;  5J8C A;  1S5K A;  3D8P A;  4HNX B;  3IWE A;  4JWP A;  1BOB A;  2OZG A;  4X5K A;  5AG4 A;  3D2P A;  3H5Z A;  2J8R A;  4C68 A;  5HH1 A;  5C88 A;  4KOY A;  1ON0 A;  2KCW A;  5IB0 A;  1YX0 A;  5IX3 A;  3SHP A;  4NEX A;  1KUX A;  2I79 A;  1B87 A;  4OLL A;  2CY2 A;  4KOX A;  4RS2 A;  3TOA A;  2X7B A;  4PSW A;  3FB3 A;  3EXN A;  1RO5 A;  1J4J A;  4M85 A;  5JQ4 A;  5F48 A;  2VBQ A;  4R3K A;  3GKR A;  4YRH A;  3R1K A;  4MFK A;  1L0C A;  5G1Z A;  5A28 A;  4NF1 A;  1KUV A;  5F47 A;  4UWJ A;  1XE4 A;  1YLE A;  3K9U A;  5KTC A;  1P4N A;  3KKW A;  3GY9 A;  3TOB A;  4B10 A;  4RI1 A;  3IU2 A;  2J8M A;  2B4D B;  2Q4V A;  4KSA A;  3LOD A;  4Q36 A;  4B5P B;  3PGP A;  3E0K A;  5A27 A;  5G20 A;  4CYO A;  4AVC A;  4FD4 A;  3D3S A;  4XPK A;  1YK3 A;  4R3L A;  3FRM A;  1MJ9 A;  5FVJ A;  1QSM A;  3DR8 A;  2HQY A;  4KOW A;  4FD5 A;  2ZW7 A;  3TO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...