3H5ZA

Crystal structure of leishmania major n-myristoyltransferase with bound myristoyl-coa
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N-myristoyltransferase inhibitors as new leads to treat sleeping sickness.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords Glycylpeptide N-tetradecanoyltransferase
total genus 123
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3h5zA00
4CYNA 3JTKA 4CGOA 4CYOA 4A32A 4B11A 4A31A 4C7IA 2YNCC 4BBHA 4C68A 5G20A 4CGLA 3IWEA 4CAEA 4UFVA 2WUUA 4CYQA 3IU2A 4CGMA 4UCMA 5AG7A 5G21A 4B13A 5AG6A 4UCNA 4C2ZA 4C2YA 4CAFA 4A30A 4A33A 5G22A 4CGNA 2YNDA 5AGEA 2YNEA 4B12A 3IU1A 4A95A 4C2XA 4CGPA 5G1ZA 4UCPA 4UFWA 4B10A 4B14A 2WSAA 4A2ZA 4C7HA 5A28A 5AG4A 3H5ZA 2YNCA 4CYPA 4UFXA 5AG5A 5A27A
chains in the Genus database with same CATH superfamily
3FJUA 1A2ZA 1NMTA 1S60A 2DF5A 2Z3MA 1IB1E 4H6ZA 3C26A 3D68A 4OADA 3ZZIA 4JLYA 2C6CA 4KVOE 2B3UA 2CTCA 2PJ2A 3FYNA 3CXPA 3LMSA 4IHMA 4KSIA 4M3SA 1B87A 3D67A 4FD7A 4HNWB 2Z3PA 2PQ8A 5AG6A 4KLVA 4OMEA 8CPAA 1VGYA 4K3NA 4U9ZA 3CXSA 4NGTA 4XNHC 3JVNA 2ARHA 2Q51A 4PK2A 3LD2A 3B3VA 3TOAA 1ARMA 2WSAA 2VI7A 1YGHA 4EFDA 1I21A 1Y0RA 4OIWA 3NE7A 2B5GB 4QC6A 3R9GA 3DLJA 4JZ0A 2GFQA 2Q4YA 2P6GA 3W6SA 4XNHB 5LRKA 3BXMA 3PB4X 4FUUA 4A31A 2DPTA 4CRYB 2PIZA 2YNCC 1MJAA 1QSMA 2B5GA 1IGBA 1S7NA 2AFMA 3IWEA 4BMHA 5IV0A 1XE4A 1ELLP 4E2AA 4MFJA 3I3GA 4CGMA 1CPXA 4A37A 1IOIA 4IUSA 2AFOA 1FY7A 2WPWA 3QNVA 4C2YA 3CT9A 4G1PA 2G9DA 4PSWA 4ZX9A 4KOUA 2ZEPA 4HPSA 1FNOA 3BLNA 4NCZA 2OU2A 1TF8A 1LRZA 3D7DA 4P4IA 5F46A 5AG4A 2CXAA 4UF4A 1Y9KA 2Z3KA 3EC4A 4EMEA 1AYEA 5A27A 1R57A 2WPXA 2VBQA 2IL4A 2OZGA 2JDCA 3G3SA 2PC1A 3L2NA 4LUAA 5ISVA 3GKRA 4QBJA 1YREA 5JM6A 2P6FA 1S7LA 1CPSA 1LANA 2GLFA 4PV6A 1XRYA 3B2YA 2K5TA 3BI1A 1S7KA 3EFAA 3FXTA 4ZY2A 3S6FA 4Y49B 3FX6A 3IC1A 1YK3A 3I9SA 2BOAA 3SJGA 5JQ4A 2FE7A 2EK8A 3PFOA 4UCNA 3V8IA 4A38A 2FXFA 3V38A 5G22A 2QIRA 3LACA 1M44A 3KI9A 2JEVA 4OKOA 4FD5A 2VZZA 3RO0A 3TTHA 2O4HA 2PJ9A 4A95A 1UWYA 5LYDA 2ZENA 2ZEOA 1Y7RA 2Q43A 5CBMA 1BAVA 2AJ6A 1YMEA 4ZY1A 4KOWA 1GYTA 3DR6A 5D8NA 5IB0A 4FBEA 2XEIA 4NGRA 1V0CA 4MHYA 2NYQA 4CAXA 4L89A 4B11A 3GLJA 4AVBA 5K8OA 1MJ9A 5IB9A 2JDDA 2GIVA 4PXEA 4GM5A 2J8NA 2EBJA 2D4OA 2VQYA 4JYWA 5EC4A 1TKHA 1X10A 1LCPA 2Z3LA 3R1KA 4II9A 1QSNA 4MCPA 4R9MA 3RAMA 2QJ8A 2AFWA 1Z4RA 4BINA 4CAVA 4NFRA 5J8CA 4AVAA 1JQGA 2H5MA 1TIQA 4MXUA 3RBUA 5A28A 4KVME 2POKA 1BO4A 1CM0A 3BI0A 4MCSA 3TO7A 5FVJA 3GB0A 5AG5A 5K8MA 4NGQA 4AB7A 3H8GA 3KR4A 1H8LA 2PJ5A 2AE6A 2ZELA 2JEWA 1OBRA 2Z10A 3NFZA 3F0AA 4DYOA 4A32A 3CPAA 3E0KA 1QQ9A 3V7ZA 2Q0YA 5G20A 4UBRA 2GANA 3JRUA 4YU9A 2ZW6A 2CNTA 2Z3NA 5AG7A 2OB0A 2Z0ZA 1IY7A 1SQHA 4C2ZA 2Y0MA 1M4IA 1ON0A 3FBUA 1XOVA 4J3GA 2PSWA 4JXQA 1F2PA 3GYAA 3KKWA 4LX9A 4KOSA 2BO9A 2XEFA 1M1DA 4B5PB 2B3VA 2BEIA 2C6GA 5HXDA 2XEGA 1YVOA 2J8RA 3GY9A 1OZPA 1VIXA 3MN8A 1PUAA 3WC7A 1CG2A 4KORA 5KTCA 4CGOA 2AFZA 2OZHA 4MCQA 4XPDC 4FD6A 2DEAA 5LRGA 5DS0A 3SHPA 2OZUA 2R7HA 3T8WA 4NJRA 2KCWA 2R8VA 4FD4A 1Z2LA 4MJ8A 3MGDA 4P4BA 5F48A 4EWTA 2DXQA 3WT4A 4UCMA 3TFYA 3OWCA 1YLEA 3CPXA 4OLLA 2J8MA 2V8DA 4QUSA 4KSAA 4UA3A 4XPKA 2FL4A 3S6GA 4YFJA 4GXHA 2RFHA 3D7HA 4HNXB 4F9VA 2F8HA 3PFEA 1U6MA 1AUGA 1DTDA 4A2ZA 2EWBA 2PVVA 1KUYA 4PQAA 2EK9A 4HKFA 4JWPA 4R7MA 3WABA 4KZTA 4FWUA 4R8FA 1Y0YA 3IWGA 5J8FA 3FVLA 1YR0A 3VATA 3F8KA 1KWMA 2ANPA 2PJCA 3HLPA 3HUVA 4RS2A 3DNSA 3TC8A 5K8NA 2CTBA 1S7FA 3FH4A 1L0CA 4MMOA 3S6HA 5I0CA 4ZBGA 3FRMA 3TX8A 4M6GA 3K9TA 3PZJA 3H8EA 4MBUA 4LQGA 2D4PA 2WZNA 1IU8A 3F5BA 2Q7BA 5AGEA 3ZJ0A 4OC5A 2R1IA 4UWIA 3SXOA 1VKCA 4CGPA 2CNSA 5G1ZA 3IGRA 3FB3A 5HH1A 4L8AA 1TXRA 3N5FA 2CIJA 4MHNA 2R98A 1ZG8A 3KR5A 4P4FA 4XPLA 2JBJA 2AFSA 4UEZA 4JXRA 4QVTA 1TF9A 1ZG7A 2HB6A 2BSWA 3D7FA 2FSRA 5GCNA 1ZO0A 4P10A 4KSFA 5K8PA 1XMBA 4NGSA 3PBEA 3R9FA 4NF1A 1KUVA 1Z8XA 2CNMA 4R3KA 4AXVA 1LFWA 3FNCA 4B5PA 3DSBA 1Z8TA 2ZW5A 4ONWA 1CP6A 4YWYA 3FECA 3W6XA 1S3ZA 3GIUA 4P44A 3R96A 2EVNA 2ZXVA 2QECA 3IJ3A 4F8ZA 2VXKA 2G0BA 3RNZA 4X2TA 1MJBA 4OAEA 1TKJA 2B58A 4P4JA 4C7HA 2EO8A 2JBKA 3PRTA 2REFA 3S9NA 4OC2A 4ZX8A 3R9EA 3SJEA 2ATRA 1Z9UA 5EMIA 4XPDB 3N7ZA 3CZXA 1BPNA 2CF4A 3NH4A 1K4JA 1NE9A 1QSTA 4PSXA 2I00A 2ODFA 2REEA 3PB8X 4KVXA 4OC3A 2PJ8A 1CBXA 3SI1A 4R3LA 2GE3A 1DE4C 2NMTA 2ZOFA 1HDQA 2PJ0A 2B4BA 3FMCA 4A33A 3W91A 3VWEA 2AFUA 3IU1A 3TOBA 4ZY0A 3WC5A 1UFHA 4C2XA 4B6ZA 4UCPA 4LQ6A 4PXDA 5JGFA 2OH1A 1Q2CA 2Q4ZA 3G8WA 3PP9A 3RYOA 2X7BA 2I3CA 2IQ6A 1P0HA 3KL9A 2BCOA 5D29A 3SI2A 5F09A 5LYLA 2G3TA 3D8PA 3FIXA 2GLJA 1BOBA 3S9LA 2F7VA 3NH5A 2RC4A 1LAPA 3RZAA 2PCUA 1R3NA 1Z8WA 2QMLA 2ZEHA 3B35A 4MFZA 3FF3A 3TCVA 3B7IA 4CYQA 3B3TA 1IYKA 4TNUA 1HDUA 2OOTA 3K2KA 5HMNA 4UWJA 1EE3P 1IICA 1PU9A 2Z11A 2J9AA 7CPAA 1HEEA 3CDXA 3IO1A 4M85A 3PBBA 2A4NA 4PPZA 4UFWA 1XJOA 5H86A 1P4NA 2FCKA 4KLWA 4NXYA 6CPAA 3VH9A 5E96A 4KOYA 4ONUA 4OP4A 1LOKA 1X12A 4UIAA 2V8GA 4HNYB 4E8OA 3LWUA 4MHDA 1PCAA 4E0AA 2P0WA 1ELMP 2NSMA 1Q2YA 3H4QA 3NE8A 4MY3A 3SXNA 4MRIA 4K30A 5LYIA 1XEBA 2PRBA 3FEEA 3I1UA 2PJ3A 4NGNA 1R43A 2FIAA 1NSLA 2FT0A 2CY2A 3KQXA 4MI4A 1TKFA 3KASA 3KQZA 4WJBA 5LRJA 4KOXA 2ZEFA 4KOTA 1AMPA 4PXCA 3EXNA 2ABZA 2Z3OA 2P6EA 3SJFA 2BL1A 4OC1A 1CP7A 1VHEA 2DPSA 3PEIA 4MHZA 4NGMA 4OC0A 4Q36A 4CPAA 5HVGA 2PJBA 1QSRA 2PJ7A 3PB9X 2B4DB 3EO4A 1PYTB 3GUXA 3JTKA 3PGPA 3IEHA 4R57A 3BJ7A 4DNCA 1IYLA 4C68A 1M4LA 4IF5A 2O53A 1Z4EA 4CGLA 4BD9A 2ZOGA 1YQEA 1B6BA 3PB7X 4MFLA 4QB9A 2C1CA 3R95A 3D2PA 1ZG9A 2PJ6A 2ZPAA 4AVCA 3S9MA 4YRHA 4B5OA 4P6YA 3TE4A 4UEEA 2ZEGA 2GREA 2FIWA 4CGNA 4UIBA 4NEXA 2OR4A 1S5KA 2YNEA 4KUAA 3P2FA 3KHXA 2Q4VA 2ZEDA 1YVKA 4KS9A 2WYRA 1GHEA 4I49A 4Q7AA 4B10A 4F6AA 5JH9A 4B14A 1IOFA 4JD6A 1ZLHA 4IK2A 2BUEA 3D3SA 3H5ZA 2PIYA 3KGQA 4H89A 1I12A 4PK3A 3A9LA 1MK4A 2PE3A 3D2MA 4A94A 4DJLA 4U9YA 4KUBA 4C7IA 4X5KA 1XMTA 3KZWA 4RUHA 2C6PA 1VHOA 4CRZB 2Q04A 4MFPA 3WR7A 4AG9A 5EBVA 4P45A 4CAEA 2WUUA 3PB6X 4Z65A 1FT7A 2PJ1A 4Y49C 5LYFA 3S6KA 5G21A 2QYVA 2VZYA 4M6HA 4X8IA 2PDOA 2VL1A 1QSOA 1RTQA 4A30A 4MCRA 4ORFA 3JUWA 1YSJA 2F5IA 4O23A 3B8GA 1J4JA 4MY0A 4R76A 4M6IA 2G3AA 4UEFA 4PXBA 3TO6A 4AG7A 1XBUA 2YGWA 3IIBA 4KOVA 1NSAA 5CPAA 1WWZA 5HVFA 4UFXA 3NA6A 2PR8A 2V77A 2ZEEA 3IFEA 2HQYA 4FAIA 4WWVA 4ZGYB 4ZI6A 1BLLE 1RO5A 4IAVA 5I4MA 3FEDA 1CJWA 4BBHA 1KUXA 2VEZA 3QB8A 5F49A 3T90A 2PVWA 3EY5A 1ZLIA 1Y7EA 1VHSA 1XFOA 3DGVA 4W9YA 2C27A 3B3WA 4B13A 3IWWA 2ZW4A 4X3RA 5IX3A 1XF8A 4F0XA 4YGOA 2PJ4A 2ZW7A 5HVHA 2HC9A 3NH8A 1BPMA 2FVGA 3SJXA 1ARLA 2ZEMA 1WK4A 2Q44A 3ISXA 3MRUA 4H6UA 2V8HA 2YNCA 4CYPA 4JJXA 4MFQA 4CAWA 4TWEA 4F0YA 4R6TA 3QAYA 4CYNA 1LAMA 4OC4A 3TT2A 3SI0A 1XIXA 3WC6A 3VARA 2JLMA 3D7GA 3TO9A 1Z8LA 4GS4A 1Z5RA 5CNPA 4A39A 4H2KA 1YW4A 4Q38A 1KZFA 4UFVA 3IU2A 3BHXA 3ISZA 2Q7SA 2QVPA 3D4UA 2IMOA 5JPHA 1M4GA 1F57A 4F9UA 2V8VA 3QAHA 4CS0B 2IJZA 3CXQA 4OIDA 2HUZA 4B12A 1CX8A 1F2OA 2B4DA 3H8FA 3LODA 4P4DA 3VWDA 5DWNA 2EUIA 1YLOA 5F47A 3D66A 3KHZA 1IIDA 4MHPA 4MFKA 3B3SA 1QMUA 1YX0A 2GU2A 5H84A 3T9YA 2PRQA 2I79A 4CYOA 5J1QA 1M4DA 1N71A 5ELYA 2PR1A 2FS5A 2O28A 4R87A 1JWQA 4DUKA 4NJQA 4P4EA 5DWMA 5C82A 3BJ8A 5THWA 3DR8A 5C88A 2AFXA 4NSQA 4RI1A 4U5YA 5KTAA 4CAFA 1I1DA 1Q7LA 2YNDA 4NGPA 3B3CA 5BWAB 1Q2DA 1Y9WA 4EVYA 3DDDA 3K9UA 3P2HA 3UY5A 4RN7A 1RXTA 1YW6A 4ZYQA 2HV2A 5KTDA 2XEJA 2RB7A 2PJAA
chains in the Genus database with same CATH topology
1NMTA 1S60A 2Z3MA 1IB1E 4H6ZA 3C26A 4OADA 3ZZIA 4JLYA 4KVOE 2B3UA 3FYNA 3CXPA 4M3SA 1B87A 4HNWB 4FD7A 2Z3PA 2PQ8A 5AG6A 4KLVA 4U9ZA 3CXSA 4XNHC 3JVNA 2ARHA 4PK2A 3TOAA 3LD2A 2WSAA 2VI7A 1YGHA 1I21A 3NE7A 2B5GB 4QC6A 3R9GA 2Q4YA 3W6SA 2P6GA 4XNHB 4A31A 4CRYB 2DPTA 2YNCC 1MJAA 1QSMA 2B5GA 1S7NA 3IWEA 4BMHA 5IV0A 1XE4A 4E2AA 4MFJA 3I3GA 4CGMA 4IUSA 1FY7A 2WPWA 4C2YA 4PSWA 4KOUA 4NCZA 3BLNA 2OU2A 1LRZA 5F46A 5AG4A 2CXAA 1Y9KA 2Z3KA 3EC4A 5A27A 1R57A 2WPXA 2VBQA 2IL4A 2OZGA 2JDCA 3G3SA 2PC1A 4LUAA 5ISVA 3GKRA 4QBJA 1YREA 2P6FA 1S7LA 4PV6A 2K5TA 3EFAA 1S7KA 3FXTA 3S6FA 4Y49B 1YK3A 3I9SA 5JQ4A 2FE7A 4UCNA 3V8IA 2FXFA 5G22A 2QIRA 1M44A 2JEVA 3TTHA 4FD5A 2VZZA 4A95A 1Y7RA 2AJ6A 4KOWA 3DR6A 5IB0A 1V0CA 4CAXA 4L89A 4B11A 4AVBA 1MJ9A 2JDDA 2GIVA 2J8NA 2D4OA 2VQYA 5EC4A 3R1KA 2Z3LA 4II9A 1QSNA 4R9MA 1Z4RA 4CAVA 5J8CA 4AVAA 2H5MA 1TIQA 5A28A 4KVME 1BO4A 1CM0A 3TO7A 5FVJA 5AG5A 4AB7A 2AE6A 2Z10A 3F0AA 4A32A 3E0KA 2Q0YA 5G20A 4UBRA 2GANA 2ZW6A 2CNTA 2Z3NA 5AG7A 2OB0A 2Z0ZA 1SQHA 4C2ZA 2Y0MA 1M4IA 1ON0A 3FBUA 4J3GA 4JXQA 2PSWA 3GYAA 3KKWA 4LX9A 4KOSA 1M1DA 4B5PB 2B3VA 2BEIA 1YVOA 2J8RA 3GY9A 1OZPA 1PUAA 4KORA 5KTCA 4CGOA 2OZHA 4XPDC 4FD6A 3SHPA 2OZUA 2R7HA 2KCWA 2R8VA 4FD4A 4MJ8A 5F48A 3MGDA 2DXQA 4UCMA 3TFYA 3OWCA 1YLEA 4OLLA 2J8MA 4QUSA 4KSAA 4UA3A 4XPKA 2FL4A 3S6GA 4YFJA 4HNXB 1U6MA 4A2ZA 1KUYA 4HKFA 4JWPA 4KZTA 3IWGA 5J8FA 1YR0A 3F8KA 4RS2A 3DNSA 1S7FA 3S6HA 1L0CA 5I0CA 4ZBGA 3FRMA 3PZJA 4MBUA 2D4PA 2Q7BA 3F5BA 5AGEA 3ZJ0A 2R1IA 4UWIA 3SXOA 1VKCA 4CGPA 2CNSA 5G1ZA 3IGRA 3FB3A 5HH1A 4L8AA 2R98A 4XPLA 4JXRA 4QVTA 2BSWA 2FSRA 5GCNA 1ZO0A 4KSFA 3R9FA 4NF1A 1KUVA 2CNMA 4R3KA 3FNCA 4B5PA 3DSBA 2ZW5A 3W6XA 1S3ZA 3R96A 2EVNA 2ZXVA 2QECA 2VXKA 2G0BA 1MJBA 4OAEA 2B58A 4C7HA 2REFA 3R9EA 2ATRA 1Z9UA 4XPDB 3N7ZA 1K4JA 1NE9A 1QSTA 4PSXA 2I00A 2REEA 4KVXA 4R3LA 2GE3A 2NMTA 2B4BA 4A33A 3W91A 3VWEA 3IU1A 3TOBA 1UFHA 4C2XA 4UCPA 2OH1A 1Q2CA 3G8WA 3PP9A 3RYOA 2X7BA 1P0HA 2G3TA 3D8PA 3FIXA 1BOBA 2RC4A 2QMLA 4MFZA 3TCVA 4CYQA 1IYKA 5HMNA 4UWJA 1IICA 1PU9A 2Z11A 4M85A 2A4NA 4UFWA 5H86A 1P4NA 2FCKA 4KLWA 4NXYA 5E96A 4KOYA 4ONUA 4HNYB 4E8OA 4MHDA 4E0AA 2P0WA 1Q2YA 3H4QA 4MY3A 3SXNA 4K30A 1XEBA 2PRBA 2FIAA 1NSLA 2FT0A 2CY2A 4MI4A 4KOXA 4KOTA 3EXNA 2Z3OA 2P6EA 2BL1A 2DPSA 4Q36A 1QSRA 2B4DB 3EO4A 3PGPA 3JTKA 4R57A 3BJ7A 4DNCA 1IYLA 4C68A 4IF5A 1Z4EA 4CGLA 4MFLA 1B6BA 4QB9A 4AVCA 3R95A 4B5OA 3D2PA 2ZPAA 3TE4A 4YRHA 2FIWA 4CGNA 4NEXA 4KUAA 1S5KA 4KS9A 3P2FA 2YNEA 2Q4VA 1YVKA 1GHEA 4I49A 4F6AA 4B10A 4B14A 4JD6A 2BUEA 3D3SA 3H5ZA 4PK3A 4H89A 1I12A 3A9LA 1MK4A 3D2MA 4U9YA 4KUBA 4C7IA 4X5KA 1XMTA 4CRZB 2Q04A 4MFPA 3WR7A 4AG9A 5EBVA 4CAEA 2WUUA 4Y49C 3S6KA 5G21A 2VZYA 2PDOA 1QSOA 4A30A 4ORFA 3JUWA 2F5IA 3B8GA 1J4JA 4MY0A 2G3AA 3TO6A 4AG7A 2YGWA 4KOVA 1WWZA 4UFXA 2PR8A 2HQYA 4ZGYB 1RO5A 1CJWA 4BBHA 1KUXA 2VEZA 3QB8A 5F49A 3T90A 3EY5A 1VHSA 2C27A 4B13A 2ZW4A 5IX3A 1XF8A 4F0XA 4YGOA 2ZW7A 1WK4A 2Q44A 4H6UA 2YNCA 4CYPA 4JJXA 4MFQA 4CAWA 4F0YA 4CYNA 3TT2A 1XIXA 2JLMA 3TO9A 4GS4A 5CNPA 4Q38A 1KZFA 4UFVA 3IU2A 5JPHA 1M4GA 4CS0B 3QAHA 3CXQA 2HUZA 4B12A 2B4DA 3LODA 3VWDA 5DWNA 2EUIA 5F47A 1IIDA 4MFKA 1YX0A 5H84A 3T9YA 2I79A 4CYOA 1M4DA 1N71A 2PR1A 2FS5A 2O28A 4R87A 5DWMA 5C82A 3BJ8A 3DR8A 5C88A 4NSQA 4RI1A 4U5YA 5KTAA 4CAFA 1I1DA 2YNDA 5BWAB 1Q2DA 1Y9WA 4EVYA 3DDDA 3K9UA 3P2HA 3UY5A 1RXTA 2HV2A 5KTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYN A;  3JTK A;  4CGO A;  4CYO A;  4A32 A;  4B11 A;  4A31 A;  4C7I A;  2YNC C;  4BBH A;  4C68 A;  5G20 A;  4CGL A;  3IWE A;  4CAE A;  4UFV A;  2WUU A;  4CYQ A;  3IU2 A;  4CGM A;  4UCM A;  5AG7 A;  5G21 A;  4B13 A;  5AG6 A;  4UCN A;  4C2Z A;  4C2Y A;  4CAF A;  4A30 A;  4A33 A;  5G22 A;  4CGN A;  2YND A;  5AGE A;  2YNE A;  4B12 A;  3IU1 A;  4A95 A;  4C2X A;  4CGP A;  5G1Z A;  4UCP A;  4UFW A;  4B10 A;  4B14 A;  2WSA A;  4A2Z A;  4C7H A;  5A28 A;  5AG4 A;  3H5Z A;  2YNC A;  4CYP A;  4UFX A;  5AG5 A;  5A27 A; 
#chains in the Genus database with same CATH topology
 3FJU A;  1A2Z A;  1NMT A;  1S60 A;  2DF5 A;  2Z3M A;  1IB1 E;  4H6Z A;  3C26 A;  3D68 A;  4OAD A;  3ZZI A;  4JLY A;  2C6C A;  4KVO E;  2B3U A;  2CTC A;  2PJ2 A;  3FYN A;  3CXP A;  3LMS A;  4IHM A;  4KSI A;  4M3S A;  1B87 A;  3D67 A;  4FD7 A;  4HNW B;  2Z3P A;  2PQ8 A;  5AG6 A;  4KLV A;  4OME A;  8CPA A;  1VGY A;  4K3N A;  4U9Z A;  3CXS A;  4NGT A;  4XNH C;  3JVN A;  2ARH A;  2Q51 A;  4PK2 A;  3LD2 A;  3B3V A;  3TOA A;  1ARM A;  2WSA A;  2VI7 A;  1YGH A;  4EFD A;  1I21 A;  1Y0R A;  4OIW A;  3NE7 A;  2B5G B;  4QC6 A;  3R9G A;  3DLJ A;  4JZ0 A;  2GFQ A;  2Q4Y A;  2P6G A;  3W6S A;  4XNH B;  5LRK A;  3BXM A;  3PB4 X;  4FUU A;  4A31 A;  2DPT A;  4CRY B;  2PIZ A;  2YNC C;  1MJA A;  1QSM A;  2B5G A;  1IGB A;  1S7N A;  2AFM A;  3IWE A;  4BMH A;  5IV0 A;  1XE4 A;  1ELL P;  4E2A A;  4MFJ A;  3I3G A;  4CGM A;  1CPX A;  4A37 A;  1IOI A;  4IUS A;  2AFO A;  1FY7 A;  2WPW A;  3QNV A;  4C2Y A;  3CT9 A;  4G1P A;  2G9D A;  4PSW A;  4ZX9 A;  4KOU A;  2ZEP A;  4HPS A;  1FNO A;  3BLN A;  4NCZ A;  2OU2 A;  1TF8 A;  1LRZ A;  3D7D A;  4P4I A;  5F46 A;  5AG4 A;  2CXA A;  4UF4 A;  1Y9K A;  2Z3K A;  3EC4 A;  4EME A;  1AYE A;  5A27 A;  1R57 A;  2WPX A;  2VBQ A;  2IL4 A;  2OZG A;  2JDC A;  3G3S A;  2PC1 A;  3L2N A;  4LUA A;  5ISV A;  3GKR A;  4QBJ A;  1YRE A;  5JM6 A;  2P6F A;  1S7L A;  1CPS A;  1LAN A;  2GLF A;  4PV6 A;  1XRY A;  3B2Y A;  2K5T A;  3BI1 A;  1S7K A;  3EFA A;  3FXT A;  4ZY2 A;  3S6F A;  4Y49 B;  3FX6 A;  3IC1 A;  1YK3 A;  3I9S A;  2BOA A;  3SJG A;  5JQ4 A;  2FE7 A;  2EK8 A;  3PFO A;  4UCN A;  3V8I A;  4A38 A;  2FXF A;  3V38 A;  5G22 A;  2QIR A;  3LAC A;  1M44 A;  3KI9 A;  2JEV A;  4OKO A;  4FD5 A;  2VZZ A;  3RO0 A;  3TTH A;  2O4H A;  2PJ9 A;  4A95 A;  1UWY A;  5LYD A;  2ZEN A;  2ZEO A;  1Y7R A;  2Q43 A;  5CBM A;  1BAV A;  2AJ6 A;  1YME A;  4ZY1 A;  4KOW A;  1GYT A;  3DR6 A;  5D8N A;  5IB0 A;  4FBE A;  2XEI A;  4NGR A;  1V0C A;  4MHY A;  2NYQ A;  4CAX A;  4L89 A;  4B11 A;  3GLJ A;  4AVB A;  5K8O A;  1MJ9 A;  5IB9 A;  2JDD A;  2GIV A;  4PXE A;  4GM5 A;  2J8N A;  2EBJ A;  2D4O A;  2VQY A;  4JYW A;  5EC4 A;  1TKH A;  1X10 A;  1LCP A;  2Z3L A;  3R1K A;  4II9 A;  1QSN A;  4MCP A;  4R9M A;  3RAM A;  2QJ8 A;  2AFW A;  1Z4R A;  4BIN A;  4CAV A;  4NFR A;  5J8C A;  4AVA A;  1JQG A;  2H5M A;  1TIQ A;  4MXU A;  3RBU A;  5A28 A;  4KVM E;  2POK A;  1BO4 A;  1CM0 A;  3BI0 A;  4MCS A;  3TO7 A;  5FVJ A;  3GB0 A;  5AG5 A;  5K8M A;  4NGQ A;  4AB7 A;  3H8G A;  3KR4 A;  1H8L A;  2PJ5 A;  2AE6 A;  2ZEL A;  2JEW A;  1OBR A;  2Z10 A;  3NFZ A;  3F0A A;  4DYO A;  4A32 A;  3CPA A;  3E0K A;  1QQ9 A;  3V7Z A;  2Q0Y A;  5G20 A;  4UBR A;  2GAN A;  3JRU A;  4YU9 A;  2ZW6 A;  2CNT A;  2Z3N A;  5AG7 A;  2OB0 A;  2Z0Z A;  1IY7 A;  1SQH A;  4C2Z A;  2Y0M A;  1M4I A;  1ON0 A;  3FBU A;  1XOV A;  4J3G A;  2PSW A;  4JXQ A;  1F2P A;  3GYA A;  3KKW A;  4LX9 A;  4KOS A;  2BO9 A;  2XEF A;  1M1D A;  4B5P B;  2B3V A;  2BEI A;  2C6G A;  5HXD A;  2XEG A;  1YVO A;  2J8R A;  3GY9 A;  1OZP A;  1VIX A;  3MN8 A;  1PUA A;  3WC7 A;  1CG2 A;  4KOR A;  5KTC A;  4CGO A;  2AFZ A;  2OZH A;  4MCQ A;  4XPD C;  4FD6 A;  2DEA A;  5LRG A;  5DS0 A;  3SHP A;  2OZU A;  2R7H A;  3T8W A;  4NJR A;  2KCW A;  2R8V A;  4FD4 A;  1Z2L A;  4MJ8 A;  3MGD A;  4P4B A;  5F48 A;  4EWT A;  2DXQ A;  3WT4 A;  4UCM A;  3TFY A;  3OWC A;  1YLE A;  3CPX A;  4OLL A;  2J8M A;  2V8D A;  4QUS A;  4KSA A;  4UA3 A;  4XPK A;  2FL4 A;  3S6G A;  4YFJ A;  4GXH A;  2RFH A;  3D7H A;  4HNX B;  4F9V A;  2F8H A;  3PFE A;  1U6M A;  1AUG A;  1DTD A;  4A2Z A;  2EWB A;  2PVV A;  1KUY A;  4PQA A;  2EK9 A;  4HKF A;  4JWP A;  4R7M A;  3WAB A;  4KZT A;  4FWU A;  4R8F A;  1Y0Y A;  3IWG A;  5J8F A;  3FVL A;  1YR0 A;  3VAT A;  3F8K A;  1KWM A;  2ANP A;  2PJC A;  3HLP A;  3HUV A;  4RS2 A;  3DNS A;  3TC8 A;  5K8N A;  2CTB A;  1S7F A;  3FH4 A;  1L0C A;  4MMO A;  3S6H A;  5I0C A;  4ZBG A;  3FRM A;  3TX8 A;  4M6G A;  3K9T A;  3PZJ A;  3H8E A;  4MBU A;  4LQG A;  2D4P A;  2WZN A;  1IU8 A;  3F5B A;  2Q7B A;  5AGE A;  3ZJ0 A;  4OC5 A;  2R1I A;  4UWI A;  3SXO A;  1VKC A;  4CGP A;  2CNS A;  5G1Z A;  3IGR A;  3FB3 A;  5HH1 A;  4L8A A;  1TXR A;  3N5F A;  2CIJ A;  4MHN A;  2R98 A;  1ZG8 A;  3KR5 A;  4P4F A;  4XPL A;  2JBJ A;  2AFS A;  4UEZ A;  4JXR A;  4QVT A;  1TF9 A;  1ZG7 A;  2HB6 A;  2BSW A;  3D7F A;  2FSR A;  5GCN A;  1ZO0 A;  4P10 A;  4KSF A;  5K8P A;  1XMB A;  4NGS A;  3PBE A;  3R9F A;  4NF1 A;  1KUV A;  1Z8X A;  2CNM A;  4R3K A;  4AXV A;  1LFW A;  3FNC A;  4B5P A;  3DSB A;  1Z8T A;  2ZW5 A;  4ONW A;  1CP6 A;  4YWY A;  3FEC A;  3W6X A;  1S3Z A;  3GIU A;  4P44 A;  3R96 A;  2EVN A;  2ZXV A;  2QEC A;  3IJ3 A;  4F8Z A;  2VXK A;  2G0B A;  3RNZ A;  4X2T A;  1MJB A;  4OAE A;  1TKJ A;  2B58 A;  4P4J A;  4C7H A;  2EO8 A;  2JBK A;  3PRT A;  2REF A;  3S9N A;  4OC2 A;  4ZX8 A;  3R9E A;  3SJE A;  2ATR A;  1Z9U A;  5EMI A;  4XPD B;  3N7Z A;  3CZX A;  1BPN A;  2CF4 A;  3NH4 A;  1K4J A;  1NE9 A;  1QST A;  4PSX A;  2I00 A;  2ODF A;  2REE A;  3PB8 X;  4KVX A;  4OC3 A;  2PJ8 A;  1CBX A;  3SI1 A;  4R3L A;  2GE3 A;  1DE4 C;  2NMT A;  2ZOF A;  1HDQ A;  2PJ0 A;  2B4B A;  3FMC A;  4A33 A;  3W91 A;  3VWE A;  2AFU A;  3IU1 A;  3TOB A;  4ZY0 A;  3WC5 A;  1UFH A;  4C2X A;  4B6Z A;  4UCP A;  4LQ6 A;  4PXD A;  5JGF A;  2OH1 A;  1Q2C A;  2Q4Z A;  3G8W A;  3PP9 A;  3RYO A;  2X7B A;  2I3C A;  2IQ6 A;  1P0H A;  3KL9 A;  2BCO A;  5D29 A;  3SI2 A;  5F09 A;  5LYL A;  2G3T A;  3D8P A;  3FIX A;  2GLJ A;  1BOB A;  3S9L A;  2F7V A;  3NH5 A;  2RC4 A;  1LAP A;  3RZA A;  2PCU A;  1R3N A;  1Z8W A;  2QML A;  2ZEH A;  3B35 A;  4MFZ A;  3FF3 A;  3TCV A;  3B7I A;  4CYQ A;  3B3T A;  1IYK A;  4TNU A;  1HDU A;  2OOT A;  3K2K A;  5HMN A;  4UWJ A;  1EE3 P;  1IIC A;  1PU9 A;  2Z11 A;  2J9A A;  7CPA A;  1HEE A;  3CDX A;  3IO1 A;  4M85 A;  3PBB A;  2A4N A;  4PPZ A;  4UFW A;  1XJO A;  5H86 A;  1P4N A;  2FCK A;  4KLW A;  4NXY A;  6CPA A;  3VH9 A;  5E96 A;  4KOY A;  4ONU A;  4OP4 A;  1LOK A;  1X12 A;  4UIA A;  2V8G A;  4HNY B;  4E8O A;  3LWU A;  4MHD A;  1PCA A;  4E0A A;  2P0W A;  1ELM P;  2NSM A;  1Q2Y A;  3H4Q A;  3NE8 A;  4MY3 A;  3SXN A;  4MRI A;  4K30 A;  5LYI A;  1XEB A;  2PRB A;  3FEE A;  3I1U A;  2PJ3 A;  4NGN A;  1R43 A;  2FIA A;  1NSL A;  2FT0 A;  2CY2 A;  3KQX A;  4MI4 A;  1TKF A;  3KAS A;  3KQZ A;  4WJB A;  5LRJ A;  4KOX A;  2ZEF A;  4KOT A;  1AMP A;  4PXC A;  3EXN A;  2ABZ A;  2Z3O A;  2P6E A;  3SJF A;  2BL1 A;  4OC1 A;  1CP7 A;  1VHE A;  2DPS A;  3PEI A;  4MHZ A;  4NGM A;  4OC0 A;  4Q36 A;  4CPA A;  5HVG A;  2PJB A;  1QSR A;  2PJ7 A;  3PB9 X;  2B4D B;  3EO4 A;  1PYT B;  3GUX A;  3JTK A;  3PGP A;  3IEH A;  4R57 A;  3BJ7 A;  4DNC A;  1IYL A;  4C68 A;  1M4L A;  4IF5 A;  2O53 A;  1Z4E A;  4CGL A;  4BD9 A;  2ZOG A;  1YQE A;  1B6B A;  3PB7 X;  4MFL A;  4QB9 A;  2C1C A;  3R95 A;  3D2P A;  1ZG9 A;  2PJ6 A;  2ZPA A;  4AVC A;  3S9M A;  4YRH A;  4B5O A;  4P6Y A;  3TE4 A;  4UEE A;  2ZEG A;  2GRE A;  2FIW A;  4CGN A;  4UIB A;  4NEX A;  2OR4 A;  1S5K A;  2YNE A;  4KUA A;  3P2F A;  3KHX A;  2Q4V A;  2ZED A;  1YVK A;  4KS9 A;  2WYR A;  1GHE A;  4I49 A;  4Q7A A;  4B10 A;  4F6A A;  5JH9 A;  4B14 A;  1IOF A;  4JD6 A;  1ZLH A;  4IK2 A;  2BUE A;  3D3S A;  3H5Z A;  2PIY A;  3KGQ A;  4H89 A;  1I12 A;  4PK3 A;  3A9L A;  1MK4 A;  2PE3 A;  3D2M A;  4A94 A;  4DJL A;  4U9Y A;  4KUB A;  4C7I A;  4X5K A;  1XMT A;  3KZW A;  4RUH A;  2C6P A;  1VHO A;  4CRZ B;  2Q04 A;  4MFP A;  3WR7 A;  4AG9 A;  5EBV A;  4P45 A;  4CAE A;  2WUU A;  3PB6 X;  4Z65 A;  1FT7 A;  2PJ1 A;  4Y49 C;  5LYF A;  3S6K A;  5G21 A;  2QYV A;  2VZY A;  4M6H A;  4X8I A;  2PDO A;  2VL1 A;  1QSO A;  1RTQ A;  4A30 A;  4MCR A;  4ORF A;  3JUW A;  1YSJ A;  2F5I A;  4O23 A;  3B8G A;  1J4J A;  4MY0 A;  4R76 A;  4M6I A;  2G3A A;  4UEF A;  4PXB A;  3TO6 A;  4AG7 A;  1XBU A;  2YGW A;  3IIB A;  4KOV A;  1NSA A;  5CPA A;  1WWZ A;  5HVF A;  4UFX A;  3NA6 A;  2PR8 A;  2V77 A;  2ZEE A;  3IFE A;  2HQY A;  4FAI A;  4WWV A;  4ZGY B;  4ZI6 A;  1BLL E;  1RO5 A;  4IAV A;  5I4M A;  3FED A;  1CJW A;  4BBH A;  1KUX A;  2VEZ A;  3QB8 A;  5F49 A;  3T90 A;  2PVW A;  3EY5 A;  1ZLI A;  1Y7E A;  1VHS A;  1XFO A;  3DGV A;  4W9Y A;  2C27 A;  3B3W A;  4B13 A;  3IWW A;  2ZW4 A;  4X3R A;  5IX3 A;  1XF8 A;  4F0X A;  4YGO A;  2PJ4 A;  2ZW7 A;  5HVH A;  2HC9 A;  3NH8 A;  1BPM A;  2FVG A;  3SJX A;  1ARL A;  2ZEM A;  1WK4 A;  2Q44 A;  3ISX A;  3MRU A;  4H6U A;  2V8H A;  2YNC A;  4CYP A;  4JJX A;  4MFQ A;  4CAW A;  4TWE A;  4F0Y A;  4R6T A;  3QAY A;  4CYN A;  1LAM A;  4OC4 A;  3TT2 A;  3SI0 A;  1XIX A;  3WC6 A;  3VAR A;  2JLM A;  3D7G A;  3TO9 A;  1Z8L A;  4GS4 A;  1Z5R A;  5CNP A;  4A39 A;  4H2K A;  1YW4 A;  4Q38 A;  1KZF A;  4UFV A;  3IU2 A;  3BHX A;  3ISZ A;  2Q7S A;  2QVP A;  3D4U A;  2IMO A;  5JPH A;  1M4G A;  1F57 A;  4F9U A;  2V8V A;  3QAH A;  4CS0 B;  2IJZ A;  3CXQ A;  4OID A;  2HUZ A;  4B12 A;  1CX8 A;  1F2O A;  2B4D A;  3H8F A;  3LOD A;  4P4D A;  3VWD A;  5DWN A;  2EUI A;  1YLO A;  5F47 A;  3D66 A;  3KHZ A;  1IID A;  4MHP A;  4MFK A;  3B3S A;  1QMU A;  1YX0 A;  2GU2 A;  5H84 A;  3T9Y A;  2PRQ A;  2I79 A;  4CYO A;  5J1Q A;  1M4D A;  1N71 A;  5ELY A;  2PR1 A;  2FS5 A;  2O28 A;  4R87 A;  1JWQ A;  4DUK A;  4NJQ A;  4P4E A;  5DWM A;  5C82 A;  3BJ8 A;  5THW A;  3DR8 A;  5C88 A;  2AFX A;  4NSQ A;  4RI1 A;  4U5Y A;  5KTA A;  4CAF A;  1I1D A;  1Q7L A;  2YND A;  4NGP A;  3B3C A;  5BWA B;  1Q2D A;  1Y9W A;  4EVY A;  3DDD A;  3K9U A;  3P2H A;  3UY5 A;  4RN7 A;  1RXT A;  1YW6 A;  4ZYQ A;  2HV2 A;  5KTD A;  2XEJ A;  2RB7 A;  2PJA A; 
#chains in the Genus database with same CATH homology
 1NMT A;  1S60 A;  2Z3M A;  1IB1 E;  4H6Z A;  3C26 A;  4OAD A;  3ZZI A;  4JLY A;  4KVO E;  2B3U A;  3FYN A;  3CXP A;  4M3S A;  1B87 A;  4HNW B;  4FD7 A;  2Z3P A;  2PQ8 A;  5AG6 A;  4KLV A;  4U9Z A;  3CXS A;  4XNH C;  3JVN A;  2ARH A;  4PK2 A;  3TOA A;  3LD2 A;  2WSA A;  2VI7 A;  1YGH A;  1I21 A;  3NE7 A;  2B5G B;  4QC6 A;  3R9G A;  2Q4Y A;  3W6S A;  2P6G A;  4XNH B;  4A31 A;  4CRY B;  2DPT A;  2YNC C;  1MJA A;  1QSM A;  2B5G A;  1S7N A;  3IWE A;  4BMH A;  5IV0 A;  1XE4 A;  4E2A A;  4MFJ A;  3I3G A;  4CGM A;  4IUS A;  1FY7 A;  2WPW A;  4C2Y A;  4PSW A;  4KOU A;  4NCZ A;  3BLN A;  2OU2 A;  1LRZ A;  5F46 A;  5AG4 A;  2CXA A;  1Y9K A;  2Z3K A;  3EC4 A;  5A27 A;  1R57 A;  2WPX A;  2VBQ A;  2IL4 A;  2OZG A;  2JDC A;  3G3S A;  2PC1 A;  4LUA A;  5ISV A;  3GKR A;  4QBJ A;  1YRE A;  2P6F A;  1S7L A;  4PV6 A;  2K5T A;  3EFA A;  1S7K A;  3FXT A;  3S6F A;  4Y49 B;  1YK3 A;  3I9S A;  5JQ4 A;  2FE7 A;  4UCN A;  3V8I A;  2FXF A;  5G22 A;  2QIR A;  1M44 A;  2JEV A;  3TTH A;  4FD5 A;  2VZZ A;  4A95 A;  1Y7R A;  2AJ6 A;  4KOW A;  3DR6 A;  5IB0 A;  1V0C A;  4CAX A;  4L89 A;  4B11 A;  4AVB A;  1MJ9 A;  2JDD A;  2GIV A;  2J8N A;  2D4O A;  2VQY A;  5EC4 A;  3R1K A;  2Z3L A;  4II9 A;  1QSN A;  4R9M A;  1Z4R A;  4CAV A;  5J8C A;  4AVA A;  2H5M A;  1TIQ A;  5A28 A;  4KVM E;  1BO4 A;  1CM0 A;  3TO7 A;  5FVJ A;  5AG5 A;  4AB7 A;  2AE6 A;  2Z10 A;  3F0A A;  4A32 A;  3E0K A;  2Q0Y A;  5G20 A;  4UBR A;  2GAN A;  2ZW6 A;  2CNT A;  2Z3N A;  5AG7 A;  2OB0 A;  2Z0Z A;  1SQH A;  4C2Z A;  2Y0M A;  1M4I A;  1ON0 A;  3FBU A;  4J3G A;  4JXQ A;  2PSW A;  3GYA A;  3KKW A;  4LX9 A;  4KOS A;  1M1D A;  4B5P B;  2B3V A;  2BEI A;  1YVO A;  2J8R A;  3GY9 A;  1OZP A;  1PUA A;  4KOR A;  5KTC A;  4CGO A;  2OZH A;  4XPD C;  4FD6 A;  3SHP A;  2OZU A;  2R7H A;  2KCW A;  2R8V A;  4FD4 A;  4MJ8 A;  5F48 A;  3MGD A;  2DXQ A;  4UCM A;  3TFY A;  3OWC A;  1YLE A;  4OLL A;  2J8M A;  4QUS A;  4KSA A;  4UA3 A;  4XPK A;  2FL4 A;  3S6G A;  4YFJ A;  4HNX B;  1U6M A;  4A2Z A;  1KUY A;  4HKF A;  4JWP A;  4KZT A;  3IWG A;  5J8F A;  1YR0 A;  3F8K A;  4RS2 A;  3DNS A;  1S7F A;  3S6H A;  1L0C A;  5I0C A;  4ZBG A;  3FRM A;  3PZJ A;  4MBU A;  2D4P A;  2Q7B A;  3F5B A;  5AGE A;  3ZJ0 A;  2R1I A;  4UWI A;  3SXO A;  1VKC A;  4CGP A;  2CNS A;  5G1Z A;  3IGR A;  3FB3 A;  5HH1 A;  4L8A A;  2R98 A;  4XPL A;  4JXR A;  4QVT A;  2BSW A;  2FSR A;  5GCN A;  1ZO0 A;  4KSF A;  3R9F A;  4NF1 A;  1KUV A;  2CNM A;  4R3K A;  3FNC A;  4B5P A;  3DSB A;  2ZW5 A;  3W6X A;  1S3Z A;  3R96 A;  2EVN A;  2ZXV A;  2QEC A;  2VXK A;  2G0B A;  1MJB A;  4OAE A;  2B58 A;  4C7H A;  2REF A;  3R9E A;  2ATR A;  1Z9U A;  4XPD B;  3N7Z A;  1K4J A;  1NE9 A;  1QST A;  4PSX A;  2I00 A;  2REE A;  4KVX A;  4R3L A;  2GE3 A;  2NMT A;  2B4B A;  4A33 A;  3W91 A;  3VWE A;  3IU1 A;  3TOB A;  1UFH A;  4C2X A;  4UCP A;  2OH1 A;  1Q2C A;  3G8W A;  3PP9 A;  3RYO A;  2X7B A;  1P0H A;  2G3T A;  3D8P A;  3FIX A;  1BOB A;  2RC4 A;  2QML A;  4MFZ A;  3TCV A;  4CYQ A;  1IYK A;  5HMN A;  4UWJ A;  1IIC A;  1PU9 A;  2Z11 A;  4M85 A;  2A4N A;  4UFW A;  5H86 A;  1P4N A;  2FCK A;  4KLW A;  4NXY A;  5E96 A;  4KOY A;  4ONU A;  4HNY B;  4E8O A;  4MHD A;  4E0A A;  2P0W A;  1Q2Y A;  3H4Q A;  4MY3 A;  3SXN A;  4K30 A;  1XEB A;  2PRB A;  2FIA A;  1NSL A;  2FT0 A;  2CY2 A;  4MI4 A;  4KOX A;  4KOT A;  3EXN A;  2Z3O A;  2P6E A;  2BL1 A;  2DPS A;  4Q36 A;  1QSR A;  2B4D B;  3EO4 A;  3PGP A;  3JTK A;  4R57 A;  3BJ7 A;  4DNC A;  1IYL A;  4C68 A;  4IF5 A;  1Z4E A;  4CGL A;  4MFL A;  1B6B A;  4QB9 A;  4AVC A;  3R95 A;  4B5O A;  3D2P A;  2ZPA A;  3TE4 A;  4YRH A;  2FIW A;  4CGN A;  4NEX A;  4KUA A;  1S5K A;  4KS9 A;  3P2F A;  2YNE A;  2Q4V A;  1YVK A;  1GHE A;  4I49 A;  4F6A A;  4B10 A;  4B14 A;  4JD6 A;  2BUE A;  3D3S A;  3H5Z A;  4PK3 A;  4H89 A;  1I12 A;  3A9L A;  1MK4 A;  3D2M A;  4U9Y A;  4KUB A;  4C7I A;  4X5K A;  1XMT A;  4CRZ B;  2Q04 A;  4MFP A;  3WR7 A;  4AG9 A;  5EBV A;  4CAE A;  2WUU A;  4Y49 C;  3S6K A;  5G21 A;  2VZY A;  2PDO A;  1QSO A;  4A30 A;  4ORF A;  3JUW A;  2F5I A;  3B8G A;  1J4J A;  4MY0 A;  2G3A A;  3TO6 A;  4AG7 A;  2YGW A;  4KOV A;  1WWZ A;  4UFX A;  2PR8 A;  2HQY A;  4ZGY B;  1RO5 A;  1CJW A;  4BBH A;  1KUX A;  2VEZ A;  3QB8 A;  5F49 A;  3T90 A;  3EY5 A;  1VHS A;  2C27 A;  4B13 A;  2ZW4 A;  5IX3 A;  1XF8 A;  4F0X A;  4YGO A;  2ZW7 A;  1WK4 A;  2Q44 A;  4H6U A;  2YNC A;  4CYP A;  4JJX A;  4MFQ A;  4CAW A;  4F0Y A;  4CYN A;  3TT2 A;  1XIX A;  2JLM A;  3TO9 A;  4GS4 A;  5CNP A;  4Q38 A;  1KZF A;  4UFV A;  3IU2 A;  5JPH A;  1M4G A;  4CS0 B;  3QAH A;  3CXQ A;  2HUZ A;  4B12 A;  2B4D A;  3LOD A;  3VWD A;  5DWN A;  2EUI A;  5F47 A;  1IID A;  4MFK A;  1YX0 A;  5H84 A;  3T9Y A;  2I79 A;  4CYO A;  1M4D A;  1N71 A;  2PR1 A;  2FS5 A;  2O28 A;  4R87 A;  5DWM A;  5C82 A;  3BJ8 A;  3DR8 A;  5C88 A;  4NSQ A;  4RI1 A;  4U5Y A;  5KTA A;  4CAF A;  1I1D A;  2YND A;  5BWA B;  1Q2D A;  1Y9W A;  4EVY A;  3DDD A;  3K9U A;  3P2H A;  3UY5 A;  1RXT A;  2HV2 A;  5KTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...