3ZJ0A

The human o-glcnacase c-terminal domain is a pseudo histone acetyltransferase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
202
structure length
202
Chain Sequence
SEVVIRRATAADHGDLCRVCLLTGDSGRDASSREDDPTLLGMIYAVPYQVGAPDFAFVLEDAEGVCGYLLGAPDTLSFQHFLEKEWLPPLRAGLTDPGPDPAAWQGSDWARDAIHRPPALPPIDLAAYPAHGHIDLLPRAQGRGVGSRAMDHLEAALAAAGAPGMHLQVSPENPRALGFYEHRGFRELCRSEDEVVVGRRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ACETYLTRANSFERASE
publication title Structure of a Bacterial Putative Acetyltransferase Defines the Fold of the Human O-Glcnacase C-Terminal Domain.
pubmed doi rcsb
source organism Oceanicola granulosus
total genus 60
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2013-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3zj0A00
1OZPA 1YX0A 4CRYB 4II9A 2VBQA 2OZUA 4H6UA 3TO7A 3F8KA 3S6FA 1TIQA 3H4QA 4B5PA 2Q7BA 2Y0MA 4MI4A 1XF8A 4UWJA 4MY0A 2B5GB 2DXQA 2Q4YA 1PU9A 1S60A 2X7BA 1QSRA 5C88A 3GYAA 3R96A 2B4DB 4E8OA 3G8WA 4ORFA 2JEVA 1NSLA 2REFA 2Z11A 2OB0A 3D3SA 4PSXA 4OAEA 3SXNA 1WWZA 3W6SA 5IB0A 2C27A 4KLVA 2PR1A 3G3SA 1KUYA 4E0AA 3R9FA 2HQYA 5HH1A 1YVOA 3SXOA 2FIAA 4X5KA 1S7KA 4Y49B 1QSOA 4JJXA 3DSBA 4CRZB 4R57A 3R1KA 2PRBA 4Y49C 3S6GA 2QMLA 4U9ZA 4NF1A 4NSQA 1CM0A 3TOAA 4KOVA 4AG7A 4NEXA 4CAWA 3RYOA 1RXTA 5FVJA 3TFYA 4H89A 5GCNA 2Q4VA 1Q2CA 2B58A 2ZXVA 3GKRA 1YREA 3CXQA 1N71A 4IUSA 2Q04A 1Y9KA 4MY3A 1IYKA 1Z4EA 4H6ZA 1QSMA 4AG9A 4UA3A 2FE7A 2GE3A 3FXTA 2GANA 1K4JA 4KOWA 1B87A 3BLNA 1IYLA 2VZZA 3NE7A 2B3VA 1BO4A 2ZW6A 1UFHA 4FD5A 3C26A 3DR6A 4KOTA 2P6FA 4K30A 2WPWA 3R95A 5IX3A 5IV0A 2P6GA 4AVCA 4XPDC 3T90A 2BUEA 2HV2A 4LUAA 3EO4A 4KVXA 4HNYB 3OWCA 3JVNA 4QUSA 3ZZIA 3EC4A 4YGOA 2K5TA 3D2MA 3F0AA 4KOUA 4PSWA 1L0CA 4CAXA 3I9SA 1J4JA 4JWPA 3CXPA 4XPKA 1SQHA 4EVYA 5KTCA 2OH1A 3CXSA 4QB9A 4KORA 5C82A 2R8VA 1XE4A 1I21A 3VWEA 1IICA 3TE4A 3B8GA 1Q2DA 2Q44A 1I1DA 5H86A 2VI7A 2ZPAA 2A4NA 3UY5A 2B5GA 2J8MA 1ON0A 3FRMA 4JD6A 1YGHA 3BJ8A 3LD2A 2ATRA 4IF5A 2BEIA 2ZW7A 2RC4A 2IL4A 4OADA 2JLMA 1R57A 3FB3A 3TTHA 2QIRA 2Q0YA 3TT2A 2B4DA 3W91A 3QB8A 4OLLA 1YK3A 3EFAA 2REEA 4XNHB 1Z9UA 4NXYA 2PC1A 4HKFA 2OZHA 4JXQA 4KOXA 2NMTA 1S3ZA 4KOSA 5HMNA 2CNSA 3JUWA 4R87A 4KLWA 3S6HA 2I00A 3FYNA 4QC6A 4DNCA 1MJAA 4CS0B 5I0CA 1NMTA 3PGPA 3TO9A 4UBRA 4J3GA 1YVKA 1IB1E 5E96A 2EVNA 5JPHA 4PK2A 2H5MA 4L89A 1Z4RA 2GIVA 1Q2YA 2WPXA 4R3LA 4L8AA 2QECA 4FD4A 2F5IA 1XIXA 1Y7RA 1S5KA 2FSRA 5F48A 4HNWB 4RS2A 1M4GA 3E0KA 4B5PB 2ZW4A 1YR0A 3PP9A 4KUBA 4YFJA 1U6MA 2VQYA 3TO6A 3I3GA 1RO5A 2BSWA 4M3SA 3N7ZA 1V0CA 4XPLA 5JQ4A 3SHPA 2ARHA 1S7LA 1S7FA 1IIDA 1P0HA 1QSNA 3W6XA 4NCZA 3GY9A 4AB7A 3S6KA 2G3AA 2O28A 1VKCA 1QSTA 2JDDA 2HUZA 1MK4A 1KUXA 1PUAA 4QVTA 1M44A 2AE6A 3DDDA 2PSWA 2Z10A 4KZTA 1S7NA 4JLYA 5J8CA 2D4PA 2FIWA 5H84A 3TCVA 1YLEA 4UWIA 5DWMA 2FCKA 2G3TA 2FXFA 3LODA 4ZBGA 3EXNA 2P6EA 3IWGA 4PK3A 2G0BA 3P2FA 2BL1A 1M4IA 2FL4A 3EY5A 1GHEA 4AVBA 4F6AA 3ZJ0A 1I12A 4B5OA 2CNTA 2FS5A 4F0YA 1M1DA 1B6BA 2Z0ZA 1VHSA 3BJ7A 4I49A 3IGRA 4ONUA 4GS4A 5KTAA 1XMTA 3VWDA 1Y9WA 4JXRA 4FD6A 5F49A 2D4OA 4FD7A 3DNSA 2R1IA 3K9UA 4CAVA 1NE9A 3DR8A 3F5BA 5KTDA 2CNMA 5DWNA 4XNHC 2PR8A 2J8NA 2VZYA 4RI1A 4R9MA 4QBJA 3T9YA 1M4DA 2P0WA 2KCWA 1BOBA 5EC4A 3FNCA 4MHDA 2VEZA 1LRZA 1FY7A 4KVOE 3FBUA 3KKWA 2R98A 1XEBA 5CNPA 2J8RA 2AJ6A 5J8FA 5EBVA 5F46A 2OZGA 2EUIA 2FT0A 1KZFA 3R9GA 3D2PA 4PV6A 1MJBA 1MJ9A 5ISVA 2CY2A 1WK4A 2ZW5A 1KUVA 4R3KA 4KOYA 2PQ8A 3FIXA 4YRHA 1CJWA 4U5YA 4BMHA 4AVAA 2B4BA 2R7HA 3V8IA 1P4NA 2B3UA 3D8PA 3MGDA 3P2HA 4M85A 4E2AA 4KUAA 3TOBA 3PZJA 5F47A 2JDCA 2VXKA 4HNXB 2PDOA 4LX9A 3QAHA 2OU2A 4MBUA 4MJ8A 4XPDB 3R9EA 4U9YA 3WR7A 2I79A 4KVME
chains in the Genus database with same CATH superfamily
1Z5RA 2ZEPA 1OZPA 4KS9A 1YX0A 1IY7A 4CRYB 4II9A 4CYPA 3BI1A 2VBQA 2OZUA 4H6UA 3TO7A 4NJRA 4CPAA 1BAVA 3F8KA 3S6FA 1TIQA 3H4QA 4P45A 4OP4A 4WWVA 2Q7BA 4B5PA 2Q43A 4C7IA 2Y0MA 3SJEA 4NJQA 4MI4A 4ZY2A 2JEWA 4R8FA 3IFEA 1XF8A 4UWJA 4MY0A 2B5GB 2DXQA 2Q4YA 1ZG8A 3FMCA 4MHPA 1LCPA 4A37A 1PU9A 1S60A 2YNEA 4CGPA 1ELLP 2OOTA 2X7BA 1QSRA 3GUXA 4EFDA 3V38A 5C88A 4MCRA 3GYAA 4F9VA 5I4MA 5HXDA 3R96A 2V8DA 4IHMA 1ARMA 2B4DB 4C2XA 1VHEA 3CPAA 4E8OA 3G8WA 4ORFA 2JEVA 1NSLA 2V8HA 5AG7A 2Z3LA 3B2YA 1UWYA 5HVHA 2REFA 1BLLE 2V77A 2Z11A 4A2ZA 2OB0A 4FUUA 4KSIA 1YLOA 4UEEA 3D3SA 4MFZA 4PSXA 3VH9A 2QJ8A 4LQGA 4A95A 1HEEA 2XEIA 4IAVA 2AFUA 3KQZA 4OAEA 3SXNA 1WWZA 2DPSA 3W6SA 5IB0A 2C27A 2PJ6A 4KLVA 4OC0A 2PR1A 3G3SA 1JWQA 2WZNA 1KUYA 3RZAA 5EMIA 1H8LA 4P4FA 4IK2A 3MRUA 3PEIA 4NFRA 4E0AA 4HPSA 4F0XA 4WJBA 3R9FA 4H2KA 2Z3MA 2PJ4A 2HQYA 5HH1A 4ZI6A 1YVOA 3SXOA 4LQ6A 2FIAA 5LYIA 3JTKA 4X5KA 1S7KA 3KZWA 3CDXA 5G21A 2BCOA 4Y49B 2DEAA 1QSOA 1ZG7A 3DSBA 4JJXA 3B3VA 4CRZB 3PRTA 4R57A 5CBMA 3R1KA 4RUHA 1CPXA 2PRBA 4Y49C 3S6GA 2QMLA 4OIWA 4PQAA 4U9ZA 3S9NA 4NF1A 4P10A 3FH4A 1M4LA 4NSQA 5ELYA 1CM0A 3TOAA 1CPSA 2DPTA 5K8NA 4KOVA 1A2ZA 3KI9A 4UCMA 4AG7A 4NEXA 2PRQA 4CAWA 3RYOA 3KR4A 2AFMA 4EMEA 3D7HA 3SJFA 1RXTA 4KSFA 5FVJA 3TFYA 3B7IA 1BPMA 4JZ0A 4H89A 5GCNA 1CG2A 2Q4VA 1Q2CA 2B58A 4YU9A 3H8FA 3SI1A 2ZXVA 3GKRA 1YREA 3CXQA 3WT4A 1N71A 1KWMA 4IUSA 2Q04A 4UFXA 1Y9KA 1Z8XA 4NGMA 4ZGYB 4MY3A 1IYKA 2YGWA 4R6TA 1Z4EA 4H6ZA 2CF4A 1QSMA 2POKA 4AG9A 4UA3A 2FE7A 4MMOA 4P4IA 2GE3A 3FXTA 1F57A 2Z3PA 2GANA 3ISZA 1K4JA 2AFXA 1X12A 2BOAA 1B87A 4KOWA 1ARLA 4DYOA 3BLNA 6CPAA 2OR4A 1X10A 2CIJA 1IYLA 3GB0A 2VZZA 3NE7A 2B3VA 4BINA 1HDUA 1BO4A 1Y0YA 2PVVA 2ZW6A 1UFHA 1CX8A 4PXCA 4FD5A 3C26A 3DR6A 4KOTA 2P6FA 4X3RA 1TKHA 2EBJA 4K30A 2NSMA 2PJ0A 2WPWA 7CPAA 3R95A 3HUVA 5IX3A 5IV0A 2P6GA 3T8WA 4AVCA 4NGSA 4R76A 4BBHA 1LAMA 1XFOA 4MCQA 4XPDC 1FT7A 3T90A 4A38A 1EE3P 4UFVA 1YSJA 2BUEA 5K8OA 4UF4A 2CTBA 3TX8A 2HV2A 4P4DA 4LUAA 3EO4A 4KVXA 3L2NA 4HNYB 4OC4A 3OWCA 3JVNA 4QUSA 3ZZIA 4P4BA 3EC4A 5CPAA 2K5TA 4YGOA 1ELMP 1Z8LA 2WYRA 3D2MA 3BHXA 1TKJA 3F0AA 1YW4A 3ISXA 2Z3OA 3KR5A 1YW6A 3NA6A 1L0CA 2ODFA 3FVLA 4KOUA 4PSWA 4ZX9A 4CAXA 1Q7LA 5LYLA 3I9SA 4PXDA 3H5ZA 1J4JA 5A28A 4JWPA 4EWTA 3CXPA 1AMPA 1OBRA 3D4UA 4XPKA 1SQHA 4EVYA 2VL1A 2BO9A 5KTCA 4TNUA 4Z65A 2OH1A 4MFQA 4FWUA 3DLJA 4ONWA 2C6GA 1YMEA 2ZOGA 3CXSA 1LFWA 1ZG9A 4OIDA 4KORA 4QB9A 5C82A 3FEDA 2R8VA 1XE4A 3HLPA 1I21A 3VWEA 1IICA 2PJ5A 3TE4A 3B8GA 4X2TA 1Q2DA 2Q44A 4M6IA 4KVME 1GYTA 1I1DA 1FNOA 2ABZA 5H86A 5LYDA 3RBUA 4GM5A 2VI7A 2HB6A 3IJ3A 1R43A 2ZPAA 4OMEA 4OC2A 3CZXA 3D7DA 4K3NA 3KASA 5LRKA 2A4NA 2AFZA 3B3SA 3KHXA 1IGBA 2CXAA 2B5GA 3UY5A 2J9AA 5G22A 3PB9X 2J8MA 3D7FA 1TF8A 4MCPA 3JRUA 1ON0A 2PJ9A 3FRMA 1YGHA 4JD6A 2PVWA 3BJ8A 3LD2A 2ATRA 4IF5A 2BEIA 2ZW7A 2RC4A 2IL4A 4OADA 2JLMA 1R57A 3FB3A 3TTHA 2QIRA 1BPNA 1JQGA 2Q0YA 3TT2A 2B4DA 3W91A 3QB8A 4OLLA 1YK3A 1QQ9A 3EFAA 2REEA 4XNHB 1Z9UA 2PJ2A 4NXYA 4F9UA 4OC1A 4X8IA 4G1PA 1CP7A 2PC1A 4HKFA 2IMOA 2GU2A 2I3CA 2OZHA 4JXQA 4A30A 3PB4X 4KOXA 4Q38A 4FAIA 3CPXA 2NMTA 1S3ZA 4KOSA 4BD9A 3DGVA 5HMNA 2V8VA 2CNSA 2ZEHA 3JUWA 3IO1A 3IC1A 3SI0A 4R87A 3V7ZA 4KLWA 3S6HA 2I00A 3D7GA 3GIUA 4UEZA 4UCPA 3FYNA 3D68A 4QC6A 4DNCA 1MJAA 3VARA 2RB7A 4C2YA 5K8MA 5LRGA 2PJAA 4CS0B 2C6CA 5I0CA 1NMTA 2ZOFA 3PGPA 4NGTA 4M6HA 3NH8A 3PB7X 5D8NA 3QNVA 3TO9A 2YNDA 3FECA 3N5FA 4ZYQA 4UBRA 3MN8A 4CGMA 4ZY1A 4J3GA 1YVKA 1IB1E 4P6YA 5E96A 2EVNA 4KSAA 5JPHA 4DUKA 3A9LA 4OC3A 2H5MA 4PK2A 4L89A 1Z4RA 2GIVA 1Q2YA 2WPXA 3IIBA 4R3LA 4L8AA 2QECA 4FD4A 4RN7A 2O4HA 2F5IA 2GREA 1IU8A 2ZEGA 1ZLIA 1XIXA 8CPAA 1Y7RA 1LOKA 1S5KA 2FSRA 4A39A 3VATA 1LANA 2GLFA 2F8HA 4Q7AA 5F48A 4HNWB 4RS2A 1M4GA 3GLJA 3E0KA 3IU2A 4MFKA 1VGYA 4UIBA 4B5PB 2Q7SA 2ZW4A 1YR0A 3KHZA 3D67A 3PP9A 2PCUA 4KUBA 4YFJA 1U6MA 2VQYA 5THWA 2AFSA 3TO6A 2XEJA 2YNCC 3I3GA 4C68A 1RO5A 2BSWA 4M3SA 2XEFA 2PIYA 3N7ZA 4B6ZA 3CT9A 1V0CA 1Y7EA 2EWBA 2FVGA 4UCNA 4TWEA 4JYWA 4XPLA 4B12A 3SHPA 5IB9A 5JQ4A 5AG5A 4MHNA 2Z3NA 1ZO0A 2ZELA 2ARHA 1S7LA 1S7FA 1IIDA 1P0HA 1PYTB 1F2PA 1QSNA 1XJOA 3W6XA 4FBEA 4MFLA 4B11A 3H8EA 3BXMA 2JBKA 3GY9A 4NCZA 3KL9A 3LWUA 3RO0A 4AB7A 3S6KA 3WC7A 2G3AA 2O28A 1AYEA 4AXVA 5JH9A 2CTCA 4B13A 4C7HA 2QVPA 1VKCA 1IOFA 1F2OA 1QSTA 2EK9A 2JDDA 2QYVA 3QAYA 5AG4A 2HUZA 3SJXA 5D29A 1MK4A 1TF9A 1KUXA 4CYNA 2YNCA 3WC6A 4B10A 1Z2LA 1PUAA 4QVTA 1M44A 2AE6A 4PXEA 3DDDA 2PSWA 2Z10A 1S7NA 2PJ3A 4KZTA 4PPZA 5K8PA 3PBEA 4UEFA 4CGNA 4JLYA 3TC8A 1NSAA 5J8CA 3FF3A 3S9MA 2D4PA 2FIWA 2IQ6A 2EO8A 3B3WA 4P4EA 5H84A 1CBXA 2PJBA 1YLEA 4UWIA 3TCVA 2C1CA 1VIXA 5DWMA 4MXUA 2FCKA 2G3TA 4M6GA 2FXFA 3LODA 4ZBGA 3EXNA 2P6EA 3IWGA 1DE4C 4PK3A 4ZY0A 2G0BA 3P2FA 2BL1A 1M4IA 3WABA 5AGEA 2FL4A 2G9DA 2WSAA 3EY5A 2EK8A 1GHEA 2Q4ZA 4AVBA 4OKOA 4F6AA 3ZJ0A 5LYFA 1I12A 5JM6A 5J1QA 5AG6A 4B5OA 2CNTA 2V8GA 2FS5A 4F0YA 1M1DA 1B6BA 1QMUA 1TXRA 3BI0A 4CGOA 3B3TA 4CYOA 3WC5A 2HC9A 2Z0ZA 4MFJA 1VHSA 3BJ7A 3S9LA 4I49A 3IGRA 4ONUA 4P4JA 4GS4A 5KTAA 1XMTA 2JBJA 1TKFA 3K2KA 3VWDA 3I1UA 1Y9WA 4JXRA 3IEHA 4FD6A 1RTQA 5F49A 2ZEFA 5G20A 4OC5A 5HVFA 4F8ZA 2D4OA 4FD7A 1Z8TA 2R1IA 3DNSA 3K9UA 5BWAB 4CAVA 1NE9A 4A32A 3DR8A 3F5BA 3RAMA 5KTDA 2CNMA 5DWNA 2GFQA 4XNHC 2O53A 1R3NA 2PR8A 3LMSA 5HVGA 2PJ8A 3NH5A 2J8NA 4CAFA 1DTDA 2VZYA 4RI1A 4CAEA 5DS0A 3IWWA 2Q51A 3D66A 5F09A 2F7VA 4R9MA 3SI2A 2IJZA 2PIZA 3PFEA 4QBJA 3T9YA 2C6PA 1M4DA 1HDQA 3FJUA 2P0WA 2KCWA 2WUUA 4UIAA 4W9YA 1BOBA 5EC4A 4YWYA 3FNCA 3H8GA 2ZENA 2VEZA 4MHDA 2ZEEA 1LRZA 1FY7A 4NGQA 4KVOE 2ZEMA 4A31A 3FBUA 3B35A 1Z8WA 3IU1A 3KKWA 4NGNA 3KGQA 2R98A 2ANPA 1XEBA 4ZX8A 4A33A 5CNPA 4Q36A 2J8RA 2RFHA 2AJ6A 5J8FA 5EBVA 5F46A 2OZGA 1YQEA 2GLJA 2EUIA 2FT0A 4MCSA 2PE3A 3NFZA 1KZFA 4O23A 4CYQA 3R9GA 3RNZA 2XEGA 3D2PA 5JGFA 5A27A 4MFPA 1MJBA 4PV6A 4A94A 2AFWA 1MJ9A 5ISVA 2ZEOA 1Y0RA 3SJGA 2CY2A 4GXHA 4CGLA 1WK4A 2ZW5A 1KUVA 3NH4A 3IWEA 4R3KA 1LAPA 3PFOA 4KOYA 2PQ8A 3FIXA 1PCAA 4YRHA 1ZLHA 2PJ7A 1CJWA 2Z3KA 4U5YA 4UFWA 4BMHA 4AVAA 2B4BA 4B14A 2R7HA 4PXBA 3PB6X 3V8IA 1P4NA 2B3UA 4NGPA 2PJCA 1XOVA 3NE8A 3D8PA 2PJ1A 4NGRA 1XBUA 2NYQA 3MGDA 3P2HA 4M85A 3LACA 5LRJA 4DJLA 4E2AA 3FEEA 4KUAA 4C2ZA 3TOBA 1AUGA 3PZJA 4MHZA 5F47A 4MHYA 1CP6A 2JDCA 2VXKA 1XMBA 1XRYA 2DF5A 5G1ZA 4HNXB 2PDOA 3FX6A 4R7MA 4LX9A 1VHOA 3PBBA 3KQXA 3QAHA 2OU2A 4MBUA 3PB8X 4MJ8A 4P44A 4MRIA 4XPDB 3K9TA 2ZEDA 3R9EA 2AFOA 4U9YA 3WR7A 2I79A 3B3CA 1IOIA
chains in the Genus database with same CATH topology
1OZPA 4KS9A 1YX0A 4CRYB 4II9A 4CYPA 2VBQA 2OZUA 4H6UA 3TO7A 3F8KA 3S6FA 1TIQA 3H4QA 4B5PA 2Q7BA 4C7IA 2Y0MA 4MI4A 1XF8A 4UWJA 4MY0A 2B5GB 2DXQA 2Q4YA 1PU9A 1S60A 2YNEA 4CGPA 2X7BA 1QSRA 5C88A 3GYAA 3R96A 2B4DB 4C2XA 4E8OA 3G8WA 4ORFA 2JEVA 1NSLA 5AG7A 2Z3LA 2REFA 2Z11A 4A2ZA 2OB0A 3D3SA 4MFZA 4PSXA 4A95A 4OAEA 3SXNA 1WWZA 2DPSA 3W6SA 5IB0A 2C27A 4KLVA 2PR1A 3G3SA 1KUYA 4E0AA 4F0XA 3R9FA 2Z3MA 2HQYA 5HH1A 1YVOA 3SXOA 2FIAA 3JTKA 4X5KA 1S7KA 5G21A 4Y49B 1QSOA 4JJXA 3DSBA 4CRZB 4R57A 3R1KA 2PRBA 4Y49C 3S6GA 2QMLA 4U9ZA 4NF1A 4NSQA 1CM0A 3TOAA 2DPTA 4KOVA 4UCMA 4AG7A 4NEXA 4CAWA 3RYOA 1RXTA 4KSFA 5FVJA 3TFYA 4H89A 5GCNA 2Q4VA 1Q2CA 2B58A 2ZXVA 3GKRA 1YREA 3CXQA 1N71A 4IUSA 2Q04A 4UFXA 1Y9KA 4ZGYB 4MY3A 1IYKA 2YGWA 1Z4EA 4H6ZA 1QSMA 4AG9A 4UA3A 2FE7A 2GE3A 3FXTA 2Z3PA 2GANA 1K4JA 4KOWA 1B87A 3BLNA 1IYLA 2VZZA 3NE7A 2B3VA 1BO4A 2ZW6A 1UFHA 4FD5A 3C26A 3DR6A 4KOTA 2P6FA 4K30A 2WPWA 3R95A 5IX3A 5IV0A 2P6GA 4AVCA 4BBHA 4XPDC 3T90A 4UFVA 2BUEA 2HV2A 4LUAA 3EO4A 4KVXA 4HNYB 3OWCA 3JVNA 4QUSA 3ZZIA 3EC4A 4YGOA 2K5TA 3D2MA 3F0AA 4KOUA 2Z3OA 4C2ZA 4PSWA 1L0CA 4CAXA 3I9SA 3H5ZA 1J4JA 5A28A 4JWPA 3CXPA 4XPKA 1SQHA 4EVYA 5KTCA 2OH1A 4MFQA 3CXSA 4QB9A 4KORA 5C82A 2R8VA 1XE4A 1I21A 3VWEA 1IICA 3TE4A 3B8GA 1Q2DA 2Q44A 1I1DA 5H86A 2VI7A 2ZPAA 2A4NA 2CXAA 2B5GA 3UY5A 5G22A 2J8MA 1ON0A 3FRMA 4JD6A 1YGHA 3BJ8A 3LD2A 2ATRA 4IF5A 2BEIA 2ZW7A 2RC4A 2IL4A 4OADA 2JLMA 1R57A 3FB3A 3TTHA 2QIRA 2Q0YA 3TT2A 2B4DA 3W91A 3QB8A 4OLLA 1YK3A 3EFAA 2REEA 4XNHB 1Z9UA 4NXYA 2PC1A 4HKFA 2OZHA 4JXQA 4A30A 4KOXA 4Q38A 2NMTA 1S3ZA 4KOSA 5HMNA 2CNSA 3JUWA 4R87A 4KLWA 3S6HA 2I00A 4UCPA 3FYNA 4QC6A 4DNCA 1MJAA 4C2YA 4CS0B 5I0CA 1NMTA 3PGPA 3TO9A 2YNDA 4UBRA 4CGMA 4J3GA 1YVKA 1IB1E 5E96A 2EVNA 4KSAA 5JPHA 3A9LA 4PK2A 2H5MA 4L89A 1Z4RA 2GIVA 1Q2YA 2WPXA 4R3LA 4L8AA 2QECA 4FD4A 2F5IA 1XIXA 1Y7RA 1S5KA 2FSRA 5F48A 4HNWB 4RS2A 1M4GA 3E0KA 3IU2A 4MFKA 4B5PB 2ZW4A 1YR0A 3PP9A 4KUBA 4YFJA 1U6MA 2VQYA 3TO6A 2YNCC 3I3GA 4C68A 1RO5A 2BSWA 4M3SA 3N7ZA 1V0CA 4XPLA 4B12A 4UCNA 5JQ4A 3SHPA 5AG5A 2Z3NA 1ZO0A 2ARHA 1S7LA 1S7FA 1IIDA 1P0HA 1QSNA 3W6XA 4MFLA 4B11A 4NCZA 3GY9A 4AB7A 3S6KA 2G3AA 2O28A 4B13A 4C7HA 1VKCA 1QSTA 2JDDA 5AG4A 2HUZA 1MK4A 1KUXA 4CYNA 2YNCA 4B10A 1PUAA 4QVTA 1M44A 2AE6A 3DDDA 2PSWA 2Z10A 1S7NA 4KZTA 4CGNA 4JLYA 5J8CA 2D4PA 2FIWA 5H84A 3TCVA 1YLEA 4UWIA 5DWMA 2FCKA 2G3TA 2FXFA 3LODA 4ZBGA 3EXNA 2P6EA 3IWGA 4PK3A 2G0BA 3P2FA 2BL1A 1M4IA 5AGEA 2FL4A 3EY5A 2WSAA 1GHEA 4AVBA 4F6AA 3ZJ0A 1I12A 5AG6A 4B5OA 2CNTA 2FS5A 4F0YA 1M1DA 1B6BA 4CGOA 4CYOA 2Z0ZA 4MFJA 1VHSA 3BJ7A 4I49A 3IGRA 4ONUA 4GS4A 5KTAA 1XMTA 3VWDA 1Y9WA 4JXRA 4FD6A 5F49A 5G20A 2D4OA 4FD7A 3DNSA 2R1IA 3K9UA 5BWAB 4CAVA 1NE9A 4A32A 3DR8A 3F5BA 5KTDA 2CNMA 5DWNA 4XNHC 2PR8A 2J8NA 4CAFA 2VZYA 4RI1A 4CAEA 4R9MA 4QBJA 3T9YA 1M4DA 2P0WA 2KCWA 2WUUA 1BOBA 5EC4A 3FNCA 4MHDA 2VEZA 1LRZA 1FY7A 4KVOE 4A31A 3FBUA 3IU1A 3KKWA 2R98A 4A33A 1XEBA 5CNPA 4Q36A 2J8RA 2AJ6A 5J8FA 5EBVA 5F46A 2OZGA 2EUIA 2FT0A 1KZFA 4CYQA 3R9GA 3D2PA 5A27A 4MFPA 1MJBA 4PV6A 1MJ9A 5ISVA 2CY2A 4CGLA 1WK4A 2ZW5A 1KUVA 3IWEA 4R3KA 4KOYA 2PQ8A 3FIXA 4YRHA 2Z3KA 1CJWA 4U5YA 4UFWA 4BMHA 4AVAA 2B4BA 4B14A 2R7HA 3V8IA 1P4NA 2B3UA 3D8PA 3MGDA 3P2HA 4M85A 4E2AA 4KUAA 3TOBA 3PZJA 5F47A 2JDCA 2VXKA 5G1ZA 4HNXB 2PDOA 4LX9A 3QAHA 2OU2A 4MBUA 4MJ8A 4XPDB 3R9EA 4U9YA 3WR7A 2I79A 4KVME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OZP A;  1YX0 A;  4CRY B;  4II9 A;  2VBQ A;  2OZU A;  4H6U A;  3TO7 A;  3F8K A;  3S6F A;  1TIQ A;  3H4Q A;  4B5P A;  2Q7B A;  2Y0M A;  4MI4 A;  1XF8 A;  4UWJ A;  4MY0 A;  2B5G B;  2DXQ A;  2Q4Y A;  1PU9 A;  1S60 A;  2X7B A;  1QSR A;  5C88 A;  3GYA A;  3R96 A;  2B4D B;  4E8O A;  3G8W A;  4ORF A;  2JEV A;  1NSL A;  2REF A;  2Z11 A;  2OB0 A;  3D3S A;  4PSX A;  4OAE A;  3SXN A;  1WWZ A;  3W6S A;  5IB0 A;  2C27 A;  4KLV A;  2PR1 A;  3G3S A;  1KUY A;  4E0A A;  3R9F A;  2HQY A;  5HH1 A;  1YVO A;  3SXO A;  2FIA A;  4X5K A;  1S7K A;  4Y49 B;  1QSO A;  4JJX A;  3DSB A;  4CRZ B;  4R57 A;  3R1K A;  2PRB A;  4Y49 C;  3S6G A;  2QML A;  4U9Z A;  4NF1 A;  4NSQ A;  1CM0 A;  3TOA A;  4KOV A;  4AG7 A;  4NEX A;  4CAW A;  3RYO A;  1RXT A;  5FVJ A;  3TFY A;  4H89 A;  5GCN A;  2Q4V A;  1Q2C A;  2B58 A;  2ZXV A;  3GKR A;  1YRE A;  3CXQ A;  1N71 A;  4IUS A;  2Q04 A;  1Y9K A;  4MY3 A;  1IYK A;  1Z4E A;  4H6Z A;  1QSM A;  4AG9 A;  4UA3 A;  2FE7 A;  2GE3 A;  3FXT A;  2GAN A;  1K4J A;  4KOW A;  1B87 A;  3BLN A;  1IYL A;  2VZZ A;  3NE7 A;  2B3V A;  1BO4 A;  2ZW6 A;  1UFH A;  4FD5 A;  3C26 A;  3DR6 A;  4KOT A;  2P6F A;  4K30 A;  2WPW A;  3R95 A;  5IX3 A;  5IV0 A;  2P6G A;  4AVC A;  4XPD C;  3T90 A;  2BUE A;  2HV2 A;  4LUA A;  3EO4 A;  4KVX A;  4HNY B;  3OWC A;  3JVN A;  4QUS A;  3ZZI A;  3EC4 A;  4YGO A;  2K5T A;  3D2M A;  3F0A A;  4KOU A;  4PSW A;  1L0C A;  4CAX A;  3I9S A;  1J4J A;  4JWP A;  3CXP A;  4XPK A;  1SQH A;  4EVY A;  5KTC A;  2OH1 A;  3CXS A;  4QB9 A;  4KOR A;  5C82 A;  2R8V A;  1XE4 A;  1I21 A;  3VWE A;  1IIC A;  3TE4 A;  3B8G A;  1Q2D A;  2Q44 A;  1I1D A;  5H86 A;  2VI7 A;  2ZPA A;  2A4N A;  3UY5 A;  2B5G A;  2J8M A;  1ON0 A;  3FRM A;  4JD6 A;  1YGH A;  3BJ8 A;  3LD2 A;  2ATR A;  4IF5 A;  2BEI A;  2ZW7 A;  2RC4 A;  2IL4 A;  4OAD A;  2JLM A;  1R57 A;  3FB3 A;  3TTH A;  2QIR A;  2Q0Y A;  3TT2 A;  2B4D A;  3W91 A;  3QB8 A;  4OLL A;  1YK3 A;  3EFA A;  2REE A;  4XNH B;  1Z9U A;  4NXY A;  2PC1 A;  4HKF A;  2OZH A;  4JXQ A;  4KOX A;  2NMT A;  1S3Z A;  4KOS A;  5HMN A;  2CNS A;  3JUW A;  4R87 A;  4KLW A;  3S6H A;  2I00 A;  3FYN A;  4QC6 A;  4DNC A;  1MJA A;  4CS0 B;  5I0C A;  1NMT A;  3PGP A;  3TO9 A;  4UBR A;  4J3G A;  1YVK A;  1IB1 E;  5E96 A;  2EVN A;  5JPH A;  4PK2 A;  2H5M A;  4L89 A;  1Z4R A;  2GIV A;  1Q2Y A;  2WPX A;  4R3L A;  4L8A A;  2QEC A;  4FD4 A;  2F5I A;  1XIX A;  1Y7R A;  1S5K A;  2FSR A;  5F48 A;  4HNW B;  4RS2 A;  1M4G A;  3E0K A;  4B5P B;  2ZW4 A;  1YR0 A;  3PP9 A;  4KUB A;  4YFJ A;  1U6M A;  2VQY A;  3TO6 A;  3I3G A;  1RO5 A;  2BSW A;  4M3S A;  3N7Z A;  1V0C A;  4XPL A;  5JQ4 A;  3SHP A;  2ARH A;  1S7L A;  1S7F A;  1IID A;  1P0H A;  1QSN A;  3W6X A;  4NCZ A;  3GY9 A;  4AB7 A;  3S6K A;  2G3A A;  2O28 A;  1VKC A;  1QST A;  2JDD A;  2HUZ A;  1MK4 A;  1KUX A;  1PUA A;  4QVT A;  1M44 A;  2AE6 A;  3DDD A;  2PSW A;  2Z10 A;  4KZT A;  1S7N A;  4JLY A;  5J8C A;  2D4P A;  2FIW A;  5H84 A;  3TCV A;  1YLE A;  4UWI A;  5DWM A;  2FCK A;  2G3T A;  2FXF A;  3LOD A;  4ZBG A;  3EXN A;  2P6E A;  3IWG A;  4PK3 A;  2G0B A;  3P2F A;  2BL1 A;  1M4I A;  2FL4 A;  3EY5 A;  1GHE A;  4AVB A;  4F6A A;  3ZJ0 A;  1I12 A;  4B5O A;  2CNT A;  2FS5 A;  4F0Y A;  1M1D A;  1B6B A;  2Z0Z A;  1VHS A;  3BJ7 A;  4I49 A;  3IGR A;  4ONU A;  4GS4 A;  5KTA A;  1XMT A;  3VWD A;  1Y9W A;  4JXR A;  4FD6 A;  5F49 A;  2D4O A;  4FD7 A;  3DNS A;  2R1I A;  3K9U A;  4CAV A;  1NE9 A;  3DR8 A;  3F5B A;  5KTD A;  2CNM A;  5DWN A;  4XNH C;  2PR8 A;  2J8N A;  2VZY A;  4RI1 A;  4R9M A;  4QBJ A;  3T9Y A;  1M4D A;  2P0W A;  2KCW A;  1BOB A;  5EC4 A;  3FNC A;  4MHD A;  2VEZ A;  1LRZ A;  1FY7 A;  4KVO E;  3FBU A;  3KKW A;  2R98 A;  1XEB A;  5CNP A;  2J8R A;  2AJ6 A;  5J8F A;  5EBV A;  5F46 A;  2OZG A;  2EUI A;  2FT0 A;  1KZF A;  3R9G A;  3D2P A;  4PV6 A;  1MJB A;  1MJ9 A;  5ISV A;  2CY2 A;  1WK4 A;  2ZW5 A;  1KUV A;  4R3K A;  4KOY A;  2PQ8 A;  3FIX A;  4YRH A;  1CJW A;  4U5Y A;  4BMH A;  4AVA A;  2B4B A;  2R7H A;  3V8I A;  1P4N A;  2B3U A;  3D8P A;  3MGD A;  3P2H A;  4M85 A;  4E2A A;  4KUA A;  3TOB A;  3PZJ A;  5F47 A;  2JDC A;  2VXK A;  4HNX B;  2PDO A;  4LX9 A;  3QAH A;  2OU2 A;  4MBU A;  4MJ8 A;  4XPD B;  3R9E A;  4U9Y A;  3WR7 A;  2I79 A;  4KVM E; 
#chains in the Genus database with same CATH topology
 1Z5R A;  2ZEP A;  1OZP A;  4KS9 A;  1YX0 A;  1IY7 A;  4CRY B;  4II9 A;  4CYP A;  3BI1 A;  2VBQ A;  2OZU A;  4H6U A;  3TO7 A;  4NJR A;  4CPA A;  1BAV A;  3F8K A;  3S6F A;  1TIQ A;  3H4Q A;  4P45 A;  4OP4 A;  4WWV A;  2Q7B A;  4B5P A;  2Q43 A;  4C7I A;  2Y0M A;  3SJE A;  4NJQ A;  4MI4 A;  4ZY2 A;  2JEW A;  4R8F A;  3IFE A;  1XF8 A;  4UWJ A;  4MY0 A;  2B5G B;  2DXQ A;  2Q4Y A;  1ZG8 A;  3FMC A;  4MHP A;  1LCP A;  4A37 A;  1PU9 A;  1S60 A;  2YNE A;  4CGP A;  1ELL P;  2OOT A;  2X7B A;  1QSR A;  3GUX A;  4EFD A;  3V38 A;  5C88 A;  4MCR A;  3GYA A;  4F9V A;  5I4M A;  5HXD A;  3R96 A;  2V8D A;  4IHM A;  1ARM A;  2B4D B;  4C2X A;  1VHE A;  3CPA A;  4E8O A;  3G8W A;  4ORF A;  2JEV A;  1NSL A;  2V8H A;  5AG7 A;  2Z3L A;  3B2Y A;  1UWY A;  5HVH A;  2REF A;  1BLL E;  2V77 A;  2Z11 A;  4A2Z A;  2OB0 A;  4FUU A;  4KSI A;  1YLO A;  4UEE A;  3D3S A;  4MFZ A;  4PSX A;  3VH9 A;  2QJ8 A;  4LQG A;  4A95 A;  1HEE A;  2XEI A;  4IAV A;  2AFU A;  3KQZ A;  4OAE A;  3SXN A;  1WWZ A;  2DPS A;  3W6S A;  5IB0 A;  2C27 A;  2PJ6 A;  4KLV A;  4OC0 A;  2PR1 A;  3G3S A;  1JWQ A;  2WZN A;  1KUY A;  3RZA A;  5EMI A;  1H8L A;  4P4F A;  4IK2 A;  3MRU A;  3PEI A;  4NFR A;  4E0A A;  4HPS A;  4F0X A;  4WJB A;  3R9F A;  4H2K A;  2Z3M A;  2PJ4 A;  2HQY A;  5HH1 A;  4ZI6 A;  1YVO A;  3SXO A;  4LQ6 A;  2FIA A;  5LYI A;  3JTK A;  4X5K A;  1S7K A;  3KZW A;  3CDX A;  5G21 A;  2BCO A;  4Y49 B;  2DEA A;  1QSO A;  1ZG7 A;  3DSB A;  4JJX A;  3B3V A;  4CRZ B;  3PRT A;  4R57 A;  5CBM A;  3R1K A;  4RUH A;  1CPX A;  2PRB A;  4Y49 C;  3S6G A;  2QML A;  4OIW A;  4PQA A;  4U9Z A;  3S9N A;  4NF1 A;  4P10 A;  3FH4 A;  1M4L A;  4NSQ A;  5ELY A;  1CM0 A;  3TOA A;  1CPS A;  2DPT A;  5K8N A;  4KOV A;  1A2Z A;  3KI9 A;  4UCM A;  4AG7 A;  4NEX A;  2PRQ A;  4CAW A;  3RYO A;  3KR4 A;  2AFM A;  4EME A;  3D7H A;  3SJF A;  1RXT A;  4KSF A;  5FVJ A;  3TFY A;  3B7I A;  1BPM A;  4JZ0 A;  4H89 A;  5GCN A;  1CG2 A;  2Q4V A;  1Q2C A;  2B58 A;  4YU9 A;  3H8F A;  3SI1 A;  2ZXV A;  3GKR A;  1YRE A;  3CXQ A;  3WT4 A;  1N71 A;  1KWM A;  4IUS A;  2Q04 A;  4UFX A;  1Y9K A;  1Z8X A;  4NGM A;  4ZGY B;  4MY3 A;  1IYK A;  2YGW A;  4R6T A;  1Z4E A;  4H6Z A;  2CF4 A;  1QSM A;  2POK A;  4AG9 A;  4UA3 A;  2FE7 A;  4MMO A;  4P4I A;  2GE3 A;  3FXT A;  1F57 A;  2Z3P A;  2GAN A;  3ISZ A;  1K4J A;  2AFX A;  1X12 A;  2BOA A;  1B87 A;  4KOW A;  1ARL A;  4DYO A;  3BLN A;  6CPA A;  2OR4 A;  1X10 A;  2CIJ A;  1IYL A;  3GB0 A;  2VZZ A;  3NE7 A;  2B3V A;  4BIN A;  1HDU A;  1BO4 A;  1Y0Y A;  2PVV A;  2ZW6 A;  1UFH A;  1CX8 A;  4PXC A;  4FD5 A;  3C26 A;  3DR6 A;  4KOT A;  2P6F A;  4X3R A;  1TKH A;  2EBJ A;  4K30 A;  2NSM A;  2PJ0 A;  2WPW A;  7CPA A;  3R95 A;  3HUV A;  5IX3 A;  5IV0 A;  2P6G A;  3T8W A;  4AVC A;  4NGS A;  4R76 A;  4BBH A;  1LAM A;  1XFO A;  4MCQ A;  4XPD C;  1FT7 A;  3T90 A;  4A38 A;  1EE3 P;  4UFV A;  1YSJ A;  2BUE A;  5K8O A;  4UF4 A;  2CTB A;  3TX8 A;  2HV2 A;  4P4D A;  4LUA A;  3EO4 A;  4KVX A;  3L2N A;  4HNY B;  4OC4 A;  3OWC A;  3JVN A;  4QUS A;  3ZZI A;  4P4B A;  3EC4 A;  5CPA A;  2K5T A;  4YGO A;  1ELM P;  1Z8L A;  2WYR A;  3D2M A;  3BHX A;  1TKJ A;  3F0A A;  1YW4 A;  3ISX A;  2Z3O A;  3KR5 A;  1YW6 A;  3NA6 A;  1L0C A;  2ODF A;  3FVL A;  4KOU A;  4PSW A;  4ZX9 A;  4CAX A;  1Q7L A;  5LYL A;  3I9S A;  4PXD A;  3H5Z A;  1J4J A;  5A28 A;  4JWP A;  4EWT A;  3CXP A;  1AMP A;  1OBR A;  3D4U A;  4XPK A;  1SQH A;  4EVY A;  2VL1 A;  2BO9 A;  5KTC A;  4TNU A;  4Z65 A;  2OH1 A;  4MFQ A;  4FWU A;  3DLJ A;  4ONW A;  2C6G A;  1YME A;  2ZOG A;  3CXS A;  1LFW A;  1ZG9 A;  4OID A;  4KOR A;  4QB9 A;  5C82 A;  3FED A;  2R8V A;  1XE4 A;  3HLP A;  1I21 A;  3VWE A;  1IIC A;  2PJ5 A;  3TE4 A;  3B8G A;  4X2T A;  1Q2D A;  2Q44 A;  4M6I A;  4KVM E;  1GYT A;  1I1D A;  1FNO A;  2ABZ A;  5H86 A;  5LYD A;  3RBU A;  4GM5 A;  2VI7 A;  2HB6 A;  3IJ3 A;  1R43 A;  2ZPA A;  4OME A;  4OC2 A;  3CZX A;  3D7D A;  4K3N A;  3KAS A;  5LRK A;  2A4N A;  2AFZ A;  3B3S A;  3KHX A;  1IGB A;  2CXA A;  2B5G A;  3UY5 A;  2J9A A;  5G22 A;  3PB9 X;  2J8M A;  3D7F A;  1TF8 A;  4MCP A;  3JRU A;  1ON0 A;  2PJ9 A;  3FRM A;  1YGH A;  4JD6 A;  2PVW A;  3BJ8 A;  3LD2 A;  2ATR A;  4IF5 A;  2BEI A;  2ZW7 A;  2RC4 A;  2IL4 A;  4OAD A;  2JLM A;  1R57 A;  3FB3 A;  3TTH A;  2QIR A;  1BPN A;  1JQG A;  2Q0Y A;  3TT2 A;  2B4D A;  3W91 A;  3QB8 A;  4OLL A;  1YK3 A;  1QQ9 A;  3EFA A;  2REE A;  4XNH B;  1Z9U A;  2PJ2 A;  4NXY A;  4F9U A;  4OC1 A;  4X8I A;  4G1P A;  1CP7 A;  2PC1 A;  4HKF A;  2IMO A;  2GU2 A;  2I3C A;  2OZH A;  4JXQ A;  4A30 A;  3PB4 X;  4KOX A;  4Q38 A;  4FAI A;  3CPX A;  2NMT A;  1S3Z A;  4KOS A;  4BD9 A;  3DGV A;  5HMN A;  2V8V A;  2CNS A;  2ZEH A;  3JUW A;  3IO1 A;  3IC1 A;  3SI0 A;  4R87 A;  3V7Z A;  4KLW A;  3S6H A;  2I00 A;  3D7G A;  3GIU A;  4UEZ A;  4UCP A;  3FYN A;  3D68 A;  4QC6 A;  4DNC A;  1MJA A;  3VAR A;  2RB7 A;  4C2Y A;  5K8M A;  5LRG A;  2PJA A;  4CS0 B;  2C6C A;  5I0C A;  1NMT A;  2ZOF A;  3PGP A;  4NGT A;  4M6H A;  3NH8 A;  3PB7 X;  5D8N A;  3QNV A;  3TO9 A;  2YND A;  3FEC A;  3N5F A;  4ZYQ A;  4UBR A;  3MN8 A;  4CGM A;  4ZY1 A;  4J3G A;  1YVK A;  1IB1 E;  4P6Y A;  5E96 A;  2EVN A;  4KSA A;  5JPH A;  4DUK A;  3A9L A;  4OC3 A;  2H5M A;  4PK2 A;  4L89 A;  1Z4R A;  2GIV A;  1Q2Y A;  2WPX A;  3IIB A;  4R3L A;  4L8A A;  2QEC A;  4FD4 A;  4RN7 A;  2O4H A;  2F5I A;  2GRE A;  1IU8 A;  2ZEG A;  1ZLI A;  1XIX A;  8CPA A;  1Y7R A;  1LOK A;  1S5K A;  2FSR A;  4A39 A;  3VAT A;  1LAN A;  2GLF A;  2F8H A;  4Q7A A;  5F48 A;  4HNW B;  4RS2 A;  1M4G A;  3GLJ A;  3E0K A;  3IU2 A;  4MFK A;  1VGY A;  4UIB A;  4B5P B;  2Q7S A;  2ZW4 A;  1YR0 A;  3KHZ A;  3D67 A;  3PP9 A;  2PCU A;  4KUB A;  4YFJ A;  1U6M A;  2VQY A;  5THW A;  2AFS A;  3TO6 A;  2XEJ A;  2YNC C;  3I3G A;  4C68 A;  1RO5 A;  2BSW A;  4M3S A;  2XEF A;  2PIY A;  3N7Z A;  4B6Z A;  3CT9 A;  1V0C A;  1Y7E A;  2EWB A;  2FVG A;  4UCN A;  4TWE A;  4JYW A;  4XPL A;  4B12 A;  3SHP A;  5IB9 A;  5JQ4 A;  5AG5 A;  4MHN A;  2Z3N A;  1ZO0 A;  2ZEL A;  2ARH A;  1S7L A;  1S7F A;  1IID A;  1P0H A;  1PYT B;  1F2P A;  1QSN A;  1XJO A;  3W6X A;  4FBE A;  4MFL A;  4B11 A;  3H8E A;  3BXM A;  2JBK A;  3GY9 A;  4NCZ A;  3KL9 A;  3LWU A;  3RO0 A;  4AB7 A;  3S6K A;  3WC7 A;  2G3A A;  2O28 A;  1AYE A;  4AXV A;  5JH9 A;  2CTC A;  4B13 A;  4C7H A;  2QVP A;  1VKC A;  1IOF A;  1F2O A;  1QST A;  2EK9 A;  2JDD A;  2QYV A;  3QAY A;  5AG4 A;  2HUZ A;  3SJX A;  5D29 A;  1MK4 A;  1TF9 A;  1KUX A;  4CYN A;  2YNC A;  3WC6 A;  4B10 A;  1Z2L A;  1PUA A;  4QVT A;  1M44 A;  2AE6 A;  4PXE A;  3DDD A;  2PSW A;  2Z10 A;  1S7N A;  2PJ3 A;  4KZT A;  4PPZ A;  5K8P A;  3PBE A;  4UEF A;  4CGN A;  4JLY A;  3TC8 A;  1NSA A;  5J8C A;  3FF3 A;  3S9M A;  2D4P A;  2FIW A;  2IQ6 A;  2EO8 A;  3B3W A;  4P4E A;  5H84 A;  1CBX A;  2PJB A;  1YLE A;  4UWI A;  3TCV A;  2C1C A;  1VIX A;  5DWM A;  4MXU A;  2FCK A;  2G3T A;  4M6G A;  2FXF A;  3LOD A;  4ZBG A;  3EXN A;  2P6E A;  3IWG A;  1DE4 C;  4PK3 A;  4ZY0 A;  2G0B A;  3P2F A;  2BL1 A;  1M4I A;  3WAB A;  5AGE A;  2FL4 A;  2G9D A;  2WSA A;  3EY5 A;  2EK8 A;  1GHE A;  2Q4Z A;  4AVB A;  4OKO A;  4F6A A;  3ZJ0 A;  5LYF A;  1I12 A;  5JM6 A;  5J1Q A;  5AG6 A;  4B5O A;  2CNT A;  2V8G A;  2FS5 A;  4F0Y A;  1M1D A;  1B6B A;  1QMU A;  1TXR A;  3BI0 A;  4CGO A;  3B3T A;  4CYO A;  3WC5 A;  2HC9 A;  2Z0Z A;  4MFJ A;  1VHS A;  3BJ7 A;  3S9L A;  4I49 A;  3IGR A;  4ONU A;  4P4J A;  4GS4 A;  5KTA A;  1XMT A;  2JBJ A;  1TKF A;  3K2K A;  3VWD A;  3I1U A;  1Y9W A;  4JXR A;  3IEH A;  4FD6 A;  1RTQ A;  5F49 A;  2ZEF A;  5G20 A;  4OC5 A;  5HVF A;  4F8Z A;  2D4O A;  4FD7 A;  1Z8T A;  2R1I A;  3DNS A;  3K9U A;  5BWA B;  4CAV A;  1NE9 A;  4A32 A;  3DR8 A;  3F5B A;  3RAM A;  5KTD A;  2CNM A;  5DWN A;  2GFQ A;  4XNH C;  2O53 A;  1R3N A;  2PR8 A;  3LMS A;  5HVG A;  2PJ8 A;  3NH5 A;  2J8N A;  4CAF A;  1DTD A;  2VZY A;  4RI1 A;  4CAE A;  5DS0 A;  3IWW A;  2Q51 A;  3D66 A;  5F09 A;  2F7V A;  4R9M A;  3SI2 A;  2IJZ A;  2PIZ A;  3PFE A;  4QBJ A;  3T9Y A;  2C6P A;  1M4D A;  1HDQ A;  3FJU A;  2P0W A;  2KCW A;  2WUU A;  4UIA A;  4W9Y A;  1BOB A;  5EC4 A;  4YWY A;  3FNC A;  3H8G A;  2ZEN A;  2VEZ A;  4MHD A;  2ZEE A;  1LRZ A;  1FY7 A;  4NGQ A;  4KVO E;  2ZEM A;  4A31 A;  3FBU A;  3B35 A;  1Z8W A;  3IU1 A;  3KKW A;  4NGN A;  3KGQ A;  2R98 A;  2ANP A;  1XEB A;  4ZX8 A;  4A33 A;  5CNP A;  4Q36 A;  2J8R A;  2RFH A;  2AJ6 A;  5J8F A;  5EBV A;  5F46 A;  2OZG A;  1YQE A;  2GLJ A;  2EUI A;  2FT0 A;  4MCS A;  2PE3 A;  3NFZ A;  1KZF A;  4O23 A;  4CYQ A;  3R9G A;  3RNZ A;  2XEG A;  3D2P A;  5JGF A;  5A27 A;  4MFP A;  1MJB A;  4PV6 A;  4A94 A;  2AFW A;  1MJ9 A;  5ISV A;  2ZEO A;  1Y0R A;  3SJG A;  2CY2 A;  4GXH A;  4CGL A;  1WK4 A;  2ZW5 A;  1KUV A;  3NH4 A;  3IWE A;  4R3K A;  1LAP A;  3PFO A;  4KOY A;  2PQ8 A;  3FIX A;  1PCA A;  4YRH A;  1ZLH A;  2PJ7 A;  1CJW A;  2Z3K A;  4U5Y A;  4UFW A;  4BMH A;  4AVA A;  2B4B A;  4B14 A;  2R7H A;  4PXB A;  3PB6 X;  3V8I A;  1P4N A;  2B3U A;  4NGP A;  2PJC A;  1XOV A;  3NE8 A;  3D8P A;  2PJ1 A;  4NGR A;  1XBU A;  2NYQ A;  3MGD A;  3P2H A;  4M85 A;  3LAC A;  5LRJ A;  4DJL A;  4E2A A;  3FEE A;  4KUA A;  4C2Z A;  3TOB A;  1AUG A;  3PZJ A;  4MHZ A;  5F47 A;  4MHY A;  1CP6 A;  2JDC A;  2VXK A;  1XMB A;  1XRY A;  2DF5 A;  5G1Z A;  4HNX B;  2PDO A;  3FX6 A;  4R7M A;  4LX9 A;  1VHO A;  3PBB A;  3KQX A;  3QAH A;  2OU2 A;  4MBU A;  3PB8 X;  4MJ8 A;  4P44 A;  4MRI A;  4XPD B;  3K9T A;  2ZED A;  3R9E A;  2AFO A;  4U9Y A;  3WR7 A;  2I79 A;  3B3C A;  1IOI A; 
#chains in the Genus database with same CATH homology
 1OZP A;  4KS9 A;  1YX0 A;  4CRY B;  4II9 A;  4CYP A;  2VBQ A;  2OZU A;  4H6U A;  3TO7 A;  3F8K A;  3S6F A;  1TIQ A;  3H4Q A;  4B5P A;  2Q7B A;  4C7I A;  2Y0M A;  4MI4 A;  1XF8 A;  4UWJ A;  4MY0 A;  2B5G B;  2DXQ A;  2Q4Y A;  1PU9 A;  1S60 A;  2YNE A;  4CGP A;  2X7B A;  1QSR A;  5C88 A;  3GYA A;  3R96 A;  2B4D B;  4C2X A;  4E8O A;  3G8W A;  4ORF A;  2JEV A;  1NSL A;  5AG7 A;  2Z3L A;  2REF A;  2Z11 A;  4A2Z A;  2OB0 A;  3D3S A;  4MFZ A;  4PSX A;  4A95 A;  4OAE A;  3SXN A;  1WWZ A;  2DPS A;  3W6S A;  5IB0 A;  2C27 A;  4KLV A;  2PR1 A;  3G3S A;  1KUY A;  4E0A A;  4F0X A;  3R9F A;  2Z3M A;  2HQY A;  5HH1 A;  1YVO A;  3SXO A;  2FIA A;  3JTK A;  4X5K A;  1S7K A;  5G21 A;  4Y49 B;  1QSO A;  4JJX A;  3DSB A;  4CRZ B;  4R57 A;  3R1K A;  2PRB A;  4Y49 C;  3S6G A;  2QML A;  4U9Z A;  4NF1 A;  4NSQ A;  1CM0 A;  3TOA A;  2DPT A;  4KOV A;  4UCM A;  4AG7 A;  4NEX A;  4CAW A;  3RYO A;  1RXT A;  4KSF A;  5FVJ A;  3TFY A;  4H89 A;  5GCN A;  2Q4V A;  1Q2C A;  2B58 A;  2ZXV A;  3GKR A;  1YRE A;  3CXQ A;  1N71 A;  4IUS A;  2Q04 A;  4UFX A;  1Y9K A;  4ZGY B;  4MY3 A;  1IYK A;  2YGW A;  1Z4E A;  4H6Z A;  1QSM A;  4AG9 A;  4UA3 A;  2FE7 A;  2GE3 A;  3FXT A;  2Z3P A;  2GAN A;  1K4J A;  4KOW A;  1B87 A;  3BLN A;  1IYL A;  2VZZ A;  3NE7 A;  2B3V A;  1BO4 A;  2ZW6 A;  1UFH A;  4FD5 A;  3C26 A;  3DR6 A;  4KOT A;  2P6F A;  4K30 A;  2WPW A;  3R95 A;  5IX3 A;  5IV0 A;  2P6G A;  4AVC A;  4BBH A;  4XPD C;  3T90 A;  4UFV A;  2BUE A;  2HV2 A;  4LUA A;  3EO4 A;  4KVX A;  4HNY B;  3OWC A;  3JVN A;  4QUS A;  3ZZI A;  3EC4 A;  4YGO A;  2K5T A;  3D2M A;  3F0A A;  4KOU A;  2Z3O A;  4C2Z A;  4PSW A;  1L0C A;  4CAX A;  3I9S A;  3H5Z A;  1J4J A;  5A28 A;  4JWP A;  3CXP A;  4XPK A;  1SQH A;  4EVY A;  5KTC A;  2OH1 A;  4MFQ A;  3CXS A;  4QB9 A;  4KOR A;  5C82 A;  2R8V A;  1XE4 A;  1I21 A;  3VWE A;  1IIC A;  3TE4 A;  3B8G A;  1Q2D A;  2Q44 A;  1I1D A;  5H86 A;  2VI7 A;  2ZPA A;  2A4N A;  2CXA A;  2B5G A;  3UY5 A;  5G22 A;  2J8M A;  1ON0 A;  3FRM A;  4JD6 A;  1YGH A;  3BJ8 A;  3LD2 A;  2ATR A;  4IF5 A;  2BEI A;  2ZW7 A;  2RC4 A;  2IL4 A;  4OAD A;  2JLM A;  1R57 A;  3FB3 A;  3TTH A;  2QIR A;  2Q0Y A;  3TT2 A;  2B4D A;  3W91 A;  3QB8 A;  4OLL A;  1YK3 A;  3EFA A;  2REE A;  4XNH B;  1Z9U A;  4NXY A;  2PC1 A;  4HKF A;  2OZH A;  4JXQ A;  4A30 A;  4KOX A;  4Q38 A;  2NMT A;  1S3Z A;  4KOS A;  5HMN A;  2CNS A;  3JUW A;  4R87 A;  4KLW A;  3S6H A;  2I00 A;  4UCP A;  3FYN A;  4QC6 A;  4DNC A;  1MJA A;  4C2Y A;  4CS0 B;  5I0C A;  1NMT A;  3PGP A;  3TO9 A;  2YND A;  4UBR A;  4CGM A;  4J3G A;  1YVK A;  1IB1 E;  5E96 A;  2EVN A;  4KSA A;  5JPH A;  3A9L A;  4PK2 A;  2H5M A;  4L89 A;  1Z4R A;  2GIV A;  1Q2Y A;  2WPX A;  4R3L A;  4L8A A;  2QEC A;  4FD4 A;  2F5I A;  1XIX A;  1Y7R A;  1S5K A;  2FSR A;  5F48 A;  4HNW B;  4RS2 A;  1M4G A;  3E0K A;  3IU2 A;  4MFK A;  4B5P B;  2ZW4 A;  1YR0 A;  3PP9 A;  4KUB A;  4YFJ A;  1U6M A;  2VQY A;  3TO6 A;  2YNC C;  3I3G A;  4C68 A;  1RO5 A;  2BSW A;  4M3S A;  3N7Z A;  1V0C A;  4XPL A;  4B12 A;  4UCN A;  5JQ4 A;  3SHP A;  5AG5 A;  2Z3N A;  1ZO0 A;  2ARH A;  1S7L A;  1S7F A;  1IID A;  1P0H A;  1QSN A;  3W6X A;  4MFL A;  4B11 A;  4NCZ A;  3GY9 A;  4AB7 A;  3S6K A;  2G3A A;  2O28 A;  4B13 A;  4C7H A;  1VKC A;  1QST A;  2JDD A;  5AG4 A;  2HUZ A;  1MK4 A;  1KUX A;  4CYN A;  2YNC A;  4B10 A;  1PUA A;  4QVT A;  1M44 A;  2AE6 A;  3DDD A;  2PSW A;  2Z10 A;  1S7N A;  4KZT A;  4CGN A;  4JLY A;  5J8C A;  2D4P A;  2FIW A;  5H84 A;  3TCV A;  1YLE A;  4UWI A;  5DWM A;  2FCK A;  2G3T A;  2FXF A;  3LOD A;  4ZBG A;  3EXN A;  2P6E A;  3IWG A;  4PK3 A;  2G0B A;  3P2F A;  2BL1 A;  1M4I A;  5AGE A;  2FL4 A;  3EY5 A;  2WSA A;  1GHE A;  4AVB A;  4F6A A;  3ZJ0 A;  1I12 A;  5AG6 A;  4B5O A;  2CNT A;  2FS5 A;  4F0Y A;  1M1D A;  1B6B A;  4CGO A;  4CYO A;  2Z0Z A;  4MFJ A;  1VHS A;  3BJ7 A;  4I49 A;  3IGR A;  4ONU A;  4GS4 A;  5KTA A;  1XMT A;  3VWD A;  1Y9W A;  4JXR A;  4FD6 A;  5F49 A;  5G20 A;  2D4O A;  4FD7 A;  3DNS A;  2R1I A;  3K9U A;  5BWA B;  4CAV A;  1NE9 A;  4A32 A;  3DR8 A;  3F5B A;  5KTD A;  2CNM A;  5DWN A;  4XNH C;  2PR8 A;  2J8N A;  4CAF A;  2VZY A;  4RI1 A;  4CAE A;  4R9M A;  4QBJ A;  3T9Y A;  1M4D A;  2P0W A;  2KCW A;  2WUU A;  1BOB A;  5EC4 A;  3FNC A;  4MHD A;  2VEZ A;  1LRZ A;  1FY7 A;  4KVO E;  4A31 A;  3FBU A;  3IU1 A;  3KKW A;  2R98 A;  4A33 A;  1XEB A;  5CNP A;  4Q36 A;  2J8R A;  2AJ6 A;  5J8F A;  5EBV A;  5F46 A;  2OZG A;  2EUI A;  2FT0 A;  1KZF A;  4CYQ A;  3R9G A;  3D2P A;  5A27 A;  4MFP A;  1MJB A;  4PV6 A;  1MJ9 A;  5ISV A;  2CY2 A;  4CGL A;  1WK4 A;  2ZW5 A;  1KUV A;  3IWE A;  4R3K A;  4KOY A;  2PQ8 A;  3FIX A;  4YRH A;  2Z3K A;  1CJW A;  4U5Y A;  4UFW A;  4BMH A;  4AVA A;  2B4B A;  4B14 A;  2R7H A;  3V8I A;  1P4N A;  2B3U A;  3D8P A;  3MGD A;  3P2H A;  4M85 A;  4E2A A;  4KUA A;  3TOB A;  3PZJ A;  5F47 A;  2JDC A;  2VXK A;  5G1Z A;  4HNX B;  2PDO A;  4LX9 A;  3QAH A;  2OU2 A;  4MBU A;  4MJ8 A;  4XPD B;  3R9E A;  4U9Y A;  3WR7 A;  2I79 A;  4KVM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...