3ZJ0A

The human o-glcnacase c-terminal domain is a pseudo histone acetyltransferase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
202
structure length
202
Chain Sequence
SEVVIRRATAADHGDLCRVCLLTGDSGRDASSREDDPTLLGMIYAVPYQVGAPDFAFVLEDAEGVCGYLLGAPDTLSFQHFLEKEWLPPLRAGLTDPGPDPAAWQGSDWARDAIHRPPALPPIDLAAYPAHGHIDLLPRAQGRGVGSRAMDHLEAALAAAGAPGMHLQVSPENPRALGFYEHRGFRELCRSEDEVVVGRRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Bacterial Putative Acetyltransferase Defines the Fold of the Human O-Glcnacase C-Terminal Domain.
pubmed doi rcsb
source organism Oceanicola granulosus
molecule tags Transferase
molecule keywords ACETYLTRANSFERASE
total genus 60
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2013-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3zj0A00
2JEVA 1YX0A 2PR1A 1QSNA 2OB0A 2VZYA 4MY3A 5KTAA 1M4IA 3TT2A 2ATRA 1S3ZA 1L0CA 2PQ8A 3P2HA 3P2FA 2GE3A 2I00A 3OWCA 3DSBA 1OZPA 5J8CA 3FYNA 4FD6A 4YRHA 4PK2A 2WPXA 1XMTA 4PSWA 3R9GA 2R7HA 3TCVA 3TO9A 2BSWA 2FE7A 1YR0A 2B3VA 2ZW6A 2ZW7A 4M85A 3G3SA 3R9EA 1RO5A 1ON0A 4H6ZA 2I79A 4CAWA 2G3TA 3DDDA 1IICA 2PSWA 3D2MA 1S7LA 1NMTA 5DWNA 4XPLA 1YK3A 2P0WA 4FD4A 3LODA 2DXQA 2ZXVA 3H4QA 4K30A 4LUAA 2ARHA 4OLLA 4DNCA 3GYAA 4CS0B 3IWGA 3GY9A 1PUAA 4II9A 2P6EA 1MJBA 3QAHA 4CRZB 2EVNA 2QIRA 4NSQA 3C26A 1RXTA 3WR7A 5J8FA 2P6GA 2J8RA 2VI7A 4E2AA 3R9FA 4UBRA 4FD7A 3TOAA 2IL4A 4QUSA 2AJ6A 3W6SA 4AG7A 2R1IA 2ZPAA 2VEZA 4I49A 2GIVA 5IX3A 3TOBA 3UY5A 4XPDB 2BEIA 4JJXA 4MI4A 1CM0A 2HUZA 2AE6A 2O28A 2Q4YA 4M3SA 3S6FA 1B87A 4ZBGA 4L89A 1Z9UA 1WK4A 4PK3A 3S6GA 3F0AA 4RI1A 3F8KA 5CNPA 4KORA 3W6XA 2RC4A 4FD5A 5IV0A 3BJ7A 2Z10A 3EC4A 5HH1A 2VXKA 4NXYA 2J8MA 4JD6A 3ZZIA 1QSMA 2OZGA 3K9UA 3SHPA 4CRYB 2K5TA 2Q44A 1KUYA 1N71A 5H86A 1J4JA 4ONUA 5KTDA 1BO4A 2J8NA 4AVBA 4MBUA 1LRZA 2BL1A 4X5KA 2Q4VA 4KVXA 4KUBA 4F0YA 5EBVA 4UWIA 3QB8A 2FSRA 4KZTA 1S7KA 2CNMA 1YLEA 2OU2A 2VZZA 4MY0A 1I1DA 1VHSA 4KOYA 1QSRA 4BMHA 4KOVA 4PSXA 3T9YA 1Z4RA 1M44A 4LX9A 2B58A 3RYOA 5I0CA 4QC6A 1XF8A 4B5PB 2REFA 4R9MA 3NE7A 4XNHC 1YVKA 2B4DB 4KOTA 2FXFA 2KCWA 2FL4A 2PRBA 1S7NA 2R98A 4NF1A 4AVCA 3TE4A 1M4DA 3FB3A 2REEA 3CXSA 4QBJA 5FVJA 2B5GA 5GCNA 1IYKA 4CAXA 4QB9A 3S6KA 1B6BA 5HMNA 3TO6A 4MJ8A 3TFYA 3W91A 2G0BA 4UWJA 4KLWA 4JWPA 3V8IA 4XPDC 3D2PA 4HNYB 1XIXA 1IB1E 1MK4A 1Q2CA 2ZW4A 4H89A 4YGOA 5F49A 1KUVA 1K4JA 4KVME 1Y9WA 2PR8A 2G3AA 1Y9KA 5JQ4A 2HV2A 4R3LA 2EUIA 5IB0A 4B5OA 4JLYA 4NEXA 2F5IA 4E0AA 4OADA 3R96A 4R3KA 2VBQA 1KUXA 1Y7RA 4RS2A 3BLNA 3E0KA 5KTCA 1Q2DA 1YVOA 5F47A 2B5GB 3B8GA 3KKWA 2OZHA 2QECA 1S5KA 5EC4A 2D4OA 5JPHA 4IF5A 4EVYA 1P0HA 1P4NA 5F48A 2FIWA 3PZJA 3EO4A 1M4GA 1XEBA 4KOUA 3EY5A 4U9YA 1V0CA 2OZUA 2A4NA 3FBUA 3FIXA 4R57A 1PU9A 1UFHA 4UA3A 4B5PA 4PV6A 1BOBA 3TTHA 3T90A 1I12A 2B4DA 4KUAA 3R1KA 5H84A 3S6HA 2JDDA 1MJ9A 2B3UA 1M1DA 1QSOA 4KOSA 3I9SA 4R87A 3ZJ0A 3F5BA 1KZFA 3N7ZA 2JDCA 2Q0YA 3BJ8A 4Y49C 1MJAA 4OAEA 5C82A 2VQYA 2ZW5A 2Z11A 2FT0A 5ISVA 4HNXB 3G8WA 4Y49B 2B4BA 2CNTA 2HQYA 5E96A 1YGHA 3SXOA 1Q2YA 4KOWA 1U6MA 2Q04A 1IYLA 3GKRA 4U5YA 2Z0ZA 3EXNA 4J3GA 3D8PA 2GANA 3DR8A 3R95A 4U9ZA 1S60A 2BUEA 4HKFA 1TIQA 1VKCA 3LD2A 1SQHA 4AB7A 2FIAA 2PC1A 3FNCA 1NSLA 3IGRA 4XNHB 4AVAA 3I3GA 1QSTA 4IUSA 1I21A 4JXRA 1CJWA 3DNSA 3TO7A 3SXNA 4L8AA 2X7BA 3PGPA 1NE9A 4NCZA 2P6FA 4YFJA 3MGDA 4JXQA 2NMTA 3FXTA 3CXPA 3JUWA 1XE4A 2WPWA 1Z4EA 4QVTA 3FRMA 2FS5A 4ORFA 3VWDA 4CAVA 2R8VA 3CXQA 1S7FA 4HNWB 2FCKA 5C88A 4XPKA 2QMLA 4KLVA 4KOXA 4H6UA 4AG9A 3VWEA 4MHDA 3EFAA 2PDOA 2CY2A 2C27A 2Y0MA 4KVOE 3D3SA 2JLMA 3DR6A 1WWZA 2D4PA 4E8OA 4GS4A 3JVNA 2Q7BA 5F46A 1IIDA 4F6AA 2OH1A 2H5MA 5DWMA 1R57A 2CNSA 1GHEA 1FY7A 3PP9A 1YREA
chains in the Genus database with same CATH superfamily
2JEVA 1YX0A 2PR1A 5HVHA 4ZY2A 1QSNA 3D7DA 2OB0A 3S9NA 2VZYA 3B7IA 2AFZA 4MY3A 5KTAA 1M4IA 2PJ5A 4WJBA 8CPAA 3TT2A 2ATRA 1S3ZA 1L0CA 2PQ8A 2YNEA 2PJAA 3P2HA 3P2FA 2GE3A 2I00A 3B3WA 3OWCA 3DSBA 1OZPA 1RTQA 1FNOA 3RAMA 4A33A 3VARA 4MMOA 5CPAA 4CGPA 5J8CA 3FYNA 4FD6A 4YRHA 5LRJA 1YLOA 3CPAA 5AG6A 4R6TA 3PB6X 3CPXA 4ZX9A 4PK2A 2WPXA 4UFWA 2Q43A 1XMTA 4PSWA 3R9GA 1XBUA 2R7HA 3T8WA 3IEHA 3TCVA 5IB9A 1F2PA 3B2YA 3TO9A 1VIXA 2BSWA 2FE7A 1Q7LA 1YR0A 2B3VA 2ZW6A 2ZW7A 3PB7X 3G3SA 4M85A 4NGRA 3R9EA 4CGLA 4NJRA 1RO5A 3PFEA 1ON0A 3B3CA 3PBEA 3GUXA 4OC0A 1ZO0A 5K8MA 1F2OA 4H6ZA 2I79A 2Q7SA 3FF3A 4P45A 3SI0A 4CAWA 2G3TA 2PJ4A 3DDDA 1IICA 2PSWA 3D2MA 1S7LA 4NJQA 2GU2A 2ZEDA 1NMTA 5DWNA 2GLFA 4XPLA 1YK3A 2P0WA 4FD4A 4C7HA 4RN7A 5F09A 3LODA 4IK2A 2DXQA 4BD9A 4KS9A 1Z8XA 1YW4A 2ZXVA 3H4QA 3QAYA 4K30A 3S9LA 3H8GA 1LAPA 4P4IA 4LUAA 2ARHA 4OLLA 3K2KA 2XEJA 4DNCA 3GYAA 3L2NA 4Q38A 4A30A 3IWGA 4B14A 4CS0B 3GY9A 1PUAA 4II9A 4UCNA 4G1PA 2P6EA 4X3RA 1MJBA 1Z8TA 3QAHA 4GM5A 4KSAA 5D8NA 4CRZB 2EVNA 2QIRA 2QYVA 6CPAA 2PJBA 4NSQA 3C26A 5K8PA 5AG7A 1ZG9A 1RXTA 2AFOA 3WR7A 2ZEMA 2DPTA 4OP4A 2V8GA 5J8FA 2PE3A 3VH9A 1GYTA 4A39A 2ZEHA 2P6GA 4PQAA 1AMPA 2EK9A 2J8RA 2VI7A 3PEIA 1ELLP 4OC2A 4W9YA 4M6HA 4CGOA 4E2AA 3R9FA 4LQGA 3WC7A 4UBRA 1HEEA 2O53A 4FD7A 3CZXA 4NFRA 3TOAA 2IL4A 2OOTA 4QUSA 2AJ6A 3KL9A 1H8LA 1TKFA 2DEAA 4IAVA 3W6SA 3V38A 3KQZA 2ZEEA 4LQ6A 4AG7A 2R1IA 2ZPAA 2VEZA 3B35A 2GIVA 3D68A 4I49A 2ZEFA 4P4DA 3TOBA 3UY5A 5A27A 5IX3A 4XPDB 3SJXA 1BPNA 2BEIA 3PB4X 4JJXA 4MI4A 1CM0A 2F7VA 2HUZA 2AE6A 2O28A 1XOVA 2Q4YA 3WC5A 2PJ2A 4M3SA 4OKOA 7CPAA 1TKHA 2PJCA 3S6FA 1B87A 1AYEA 3IC1A 4ZBGA 4A31A 4CAEA 2C6GA 4FWUA 1IOIA 4O23A 4L89A 3KR5A 1IGBA 1Z9UA 2XEGA 3LMSA 3LACA 1WK4A 4PK3A 1IU8A 3S6GA 1TF9A 1DTDA 4R8FA 3F0AA 2POKA 3H8EA 4RI1A 2RFHA 4MFZA 4PXEA 5EMIA 3F8KA 4OC4A 5CNPA 4KORA 3SJFA 3W6XA 2RC4A 1TKJA 2CXAA 4FD5A 4PPZA 3WC6A 5IV0A 3BJ7A 2O4HA 1DE4C 5AG5A 2Z10A 3EC4A 5HH1A 2VXKA 3MRUA 3FEEA 3NH4A 4NXYA 2J8MA 1Y0RA 4JD6A 4TNUA 3ZZIA 3H8FA 4EWTA 2IQ6A 4RUHA 1QSMA 4K3NA 4EMEA 4OIWA 5J1QA 2OZGA 3V7ZA 4MCPA 4PXDA 3K9UA 3DLJA 3SHPA 5JH9A 2QJ8A 4CRYB 2K5TA 4MFJA 2Q44A 1XRYA 4R7MA 1KUYA 1N71A 4WWVA 5H86A 4A38A 2PJ7A 1BAVA 1J4JA 4ONUA 3KASA 5BWAB 2ZELA 3N5FA 4MFQA 4MCQA 5KTDA 4CYOA 1BO4A 3RBUA 4ZY0A 2J8NA 4AVBA 4KSFA 4UFXA 4MBUA 1LRZA 4ZY1A 2BL1A 4X5KA 2Q4VA 2J9AA 2ZEPA 4KVXA 4B12A 4UEFA 4KUBA 4ZGYB 4X8IA 4F0YA 5EBVA 4MRIA 4CGNA 4FUUA 3QNVA 4UWIA 3QB8A 3B3VA 5AGEA 2HC9A 2FSRA 1LOKA 2WSAA 2Z3MA 1S7KA 3PB9X 4KZTA 2WUUA 2CNMA 3KZWA 3KQXA 1YLEA 2AFUA 2OU2A 2ZEGA 3RZAA 4CPAA 2VZZA 4MY0A 1I1DA 1Z8WA 2EBJA 3FJUA 4DUKA 1Y7EA 4CGMA 1VHSA 4KOYA 2NYQA 1YQEA 4UCPA 3CDXA 1QSRA 4H2KA 4BMHA 2AFSA 4KOVA 4PSXA 3T9YA 1Z4RA 1M44A 4LX9A 2NSMA 2FVGA 4A94A 1QQ9A 1M4LA 1VHOA 2B58A 2YNCA 5THWA 3RYOA 4UIBA 5I0CA 4QC6A 1A2ZA 3H5ZA 2IMOA 5K8OA 1CP6A 1XF8A 4B5PB 2REFA 4MHYA 1ZLIA 4R9MA 2Z3PA 3IU1A 4UFVA 3NE7A 4UIAA 4XNHC 3HLPA 1YVKA 3KGQA 4NGMA 1PCAA 5CBMA 2B4DB 4KOTA 2FXFA 2Q51A 3NH8A 4F9VA 2F8HA 1YSJA 2KCWA 3NE8A 2CF4A 5G21A 4A37A 2FL4A 2AFMA 2PRBA 3BI1A 1S7NA 2R98A 4NF1A 2BO9A 4AVCA 3TE4A 1M4DA 2PJ6A 4A95A 3PFOA 4PXBA 5G20A 1VHEA 2PIZA 3FB3A 2REEA 3CXSA 4QBJA 5FVJA 4ZYQA 2B5GA 2Z3OA 1IYKA 4NGNA 5GCNA 5ELYA 5G1ZA 5AG4A 4CAXA 4QB9A 2PVVA 4C2YA 3S9MA 1PYTB 3S6KA 4OC5A 2Z3LA 1B6BA 5HMNA 3TO6A 1CP7A 4MJ8A 3TFYA 3W91A 2PJ0A 2G0BA 4CYPA 4UWJA 3KHZA 2G9DA 4CYNA 4KLWA 4JWPA 3V8IA 4MFLA 4XPDC 1ARLA 2ZEOA 4OC3A 3BXMA 3RO0A 2CTBA 3D2PA 5HXDA 5LYDA 4A2ZA 2WZNA 4HNYB 3FX6A 4Q7AA 1XIXA 1IB1E 2ABZA 1MK4A 3D66A 3IU2A 4NGSA 3HUVA 4P6YA 1Q2CA 4P10A 2Z3KA 2C6CA 3IWEA 5K8NA 2ZW4A 3IIBA 4H89A 4YGOA 4BINA 5F49A 1KUVA 3FECA 1K4JA 4KVME 1HDQA 1Y9WA 1AUGA 1BPMA 2PR8A 2YNDA 2G3AA 4F9UA 5D29A 1Y9KA 5JQ4A 2HV2A 2YNCC 1CG2A 4R3LA 2EUIA 5IB0A 2I3CA 3D7GA 5LRKA 4B5OA 1EE3P 3B3SA 1Z8LA 1YW6A 3GB0A 4JLYA 2F5IA 4NEXA 4Q36A 1ELMP 4AXVA 1XFOA 4CAFA 1IOFA 4P4FA 4E0AA 4OADA 3R96A 4R3KA 2CTCA 1KUXA 2VBQA 4OIDA 3NH5A 1Y7RA 2Z3NA 4RS2A 3BLNA 3E0KA 3JRUA 5KTCA 2PCUA 3B3TA 1Q2DA 4Z65A 1YVOA 5F47A 2B5GB 3B8GA 3KKWA 5LYLA 2OZHA 2QECA 1S5KA 1ZLHA 5LYIA 3RNZA 1UWYA 2BOAA 4P4EA 4TWEA 2D4OA 3FVLA 4MCSA 5EC4A 5JPHA 4IF5A 3KR4A 4EVYA 1P0HA 1P4NA 5JGFA 5F48A 2FIWA 4OC1A 2EO8A 3PZJA 4C2XA 3EO4A 3NA6A 1M4GA 5LYFA 1XEBA 3D7HA 3FEDA 4KOUA 1XMBA 4DJLA 3EY5A 4U9YA 1V0CA 2OZUA 2A4NA 2Q4ZA 1JQGA 1F57A 3FBUA 3FIXA 4R57A 1PU9A 1UFHA 1CPSA 4UA3A 4B5PA 4C2ZA 1R43A 4PV6A 1X12A 1BOBA 3ISXA 4UCMA 1BLLE 4C68A 1LAMA 3TTHA 3T90A 5I4MA 1I12A 4P4JA 2AFXA 2B4DA 4KUAA 3R1KA 5H84A 3S6HA 2JDDA 1MJ9A 4PXCA 4FAIA 2PRQA 4YWYA 4UF4A 4B11A 3FMCA 2B3UA 1M1DA 1QSOA 4KOSA 3GIUA 2YGWA 4JYWA 3I9SA 4R87A 3ZJ0A 3F5BA 1KZFA 4EFDA 3K9TA 3N7ZA 2JDCA 2Q0YA 3I1UA 2ODFA 3BJ8A 4MFKA 1MJAA 4OAEA 4Y49C 2V77A 4NGQA 1Z5RA 1LCPA 2PJ3A 4P44A 1TF8A 5C82A 2VQYA 4B6ZA 1XJOA 4A32A 2ZW5A 2V8HA 2AFWA 5JM6A 2ZOGA 3BI0A 3IFEA 1X10A 2GFQA 1Y0YA 2Z11A 2BCOA 3DGVA 2JBKA 1LFWA 1ZG7A 4MHPA 2HB6A 2RB7A 4KSIA 2FT0A 4NGPA 3SJEA 5ISVA 3G8WA 4HNXB 4Y49B 1FT7A 2B4BA 2ANPA 2CNTA 5LRGA 2HQYA 5E96A 1YGHA 2V8DA 3SXOA 3KI9A 4OMEA 1Q2YA 3PB8X 4M6IA 4B13A 4KOWA 1U6MA 2Q04A 1IYLA 3FH4A 3GKRA 1CBXA 5HVGA 1VGYA 4U5YA 2Z0ZA 2ZENA 3EXNA 4J3GA 3D8PA 2GANA 2V8VA 4MXUA 3DR8A 3VATA 3R95A 4B10A 5A28A 4U9ZA 1S60A 2BUEA 4HKFA 1OBRA 1HDUA 2IJZA 1ZG8A 1R3NA 1TIQA 3PRTA 1VKCA 4MHNA 4JZ0A 2DF5A 3BHXA 3LD2A 1SQHA 4AB7A 3IJ3A 2FIAA 5DS0A 2PC1A 4F0XA 1IY7A 3FNCA 1NSLA 3IGRA 2GREA 4X2TA 4ZX8A 2VL1A 3NFZA 4R76A 4XNHB 3I3GA 1QSTA 4AVAA 4IUSA 4NGTA 2QVPA 1I21A 4JXRA 1CJWA 4FBEA 3DNSA 3TO7A 3D67A 1CX8A 3SXNA 4L8AA 2X7BA 3PGPA 2PJ8A 3ISZA 5G22A 1NE9A 3GLJA 4NCZA 3JTKA 3CT9A 3SI2A 3MN8A 3TX8A 2EWBA 2P6FA 4YFJA 4MFPA 1JWQA 2XEFA 2JEWA 3MGDA 4JXQA 2JBJA 4UEEA 2NMTA 3FXTA 3CXPA 1QMUA 3JUWA 4M6GA 4HPSA 1XE4A 2WPWA 1TXRA 1Z4EA 2OR4A 4IHMA 4QVTA 4P4BA 3SJGA 3SI1A 3FRMA 2FS5A 4ORFA 4GXHA 3TC8A 3VWDA 4DYOA 4YU9A 4CAVA 2DPSA 1LANA 1S7FA 2R8VA 3CXQA 4HNWB 2FCKA 4C7IA 5C88A 3PBBA 4XPKA 2QMLA 2EK8A 3D4UA 3IWWA 2PIYA 3IO1A 2PJ1A 4KLVA 4KOXA 4CYQA 4H6UA 4AG9A 3VWEA 4MHDA 2WYRA 3EFAA 5HVFA 2PDOA 2GLJA 1Z2LA 2CY2A 2C1CA 4MCRA 2C27A 2Y0MA 4KVOE 3D7FA 4MHZA 1ARMA 1NSAA 3D3SA 3KHXA 3WT4A 2JLMA 2PJ9A 3DR6A 1WWZA 2XEIA 2D4PA 2PVWA 4F8ZA 4E8OA 3WABA 4GS4A 4ZI6A 3JVNA 3LWUA 2Q7BA 5F46A 4BBHA 1IIDA 3A9LA 1CPXA 1KWMA 1YMEA 4F6AA 2OH1A 2H5MA 5DWMA 1R57A 2CNSA 2ZOFA 4ONWA 1GHEA 1FY7A 4UEZA 3PP9A 2CIJA 1YREA 2C6PA
chains in the Genus database with same CATH topology
2JEVA 1YX0A 2PR1A 1QSNA 2OB0A 2VZYA 4MY3A 5KTAA 1M4IA 3TT2A 2ATRA 1S3ZA 1L0CA 2PQ8A 2YNEA 3P2HA 3P2FA 2GE3A 2I00A 3OWCA 3DSBA 1OZPA 5J8CA 4A33A 4CGPA 3FYNA 4FD6A 4YRHA 5AG6A 4PK2A 2WPXA 4UFWA 1XMTA 4PSWA 3R9GA 2R7HA 3TCVA 3TO9A 2BSWA 2FE7A 1YR0A 2B3VA 2ZW6A 2ZW7A 4M85A 3G3SA 3R9EA 4CGLA 1RO5A 1ON0A 1ZO0A 4H6ZA 2I79A 4CAWA 2G3TA 3DDDA 1IICA 2PSWA 3D2MA 1S7LA 1NMTA 5DWNA 4XPLA 1YK3A 2P0WA 4FD4A 4C7HA 3LODA 2DXQA 4KS9A 2ZXVA 3H4QA 4K30A 4LUAA 2ARHA 4OLLA 4DNCA 3GYAA 4A30A 4Q38A 4B14A 3IWGA 4CS0B 3GY9A 1PUAA 4II9A 4UCNA 2P6EA 1MJBA 3QAHA 4KSAA 4CRZB 2EVNA 2QIRA 4NSQA 3C26A 5AG7A 1RXTA 3WR7A 2DPTA 5J8FA 2P6GA 2J8RA 2VI7A 4CGOA 4E2AA 3R9FA 4UBRA 4FD7A 3TOAA 2IL4A 4QUSA 2AJ6A 3W6SA 4AG7A 2R1IA 2ZPAA 2VEZA 4I49A 2GIVA 5A27A 3TOBA 5IX3A 3UY5A 4XPDB 2BEIA 4JJXA 4MI4A 1CM0A 4CYQA 2HUZA 2AE6A 2O28A 2Q4YA 4M3SA 3S6FA 1B87A 4ZBGA 4A31A 4CAEA 4L89A 1Z9UA 1WK4A 4PK3A 3S6GA 3F0AA 4RI1A 4MFZA 3F8KA 5CNPA 4KORA 3W6XA 2RC4A 2CXAA 4FD5A 5IV0A 3BJ7A 5AG5A 2Z10A 3EC4A 5HH1A 2VXKA 4NXYA 2J8MA 4JD6A 3ZZIA 1QSMA 2OZGA 3K9UA 3SHPA 4CRYB 2K5TA 4MFJA 2Q44A 1KUYA 1N71A 5H86A 1J4JA 4ONUA 5BWAB 4MFQA 5KTDA 4CYOA 1BO4A 2J8NA 4AVBA 4KSFA 4UFXA 4MBUA 1LRZA 2BL1A 4X5KA 2Q4VA 4KVXA 4B12A 4KUBA 4ZGYB 4F0YA 5EBVA 4CGNA 4UWIA 3QB8A 5AGEA 2WSAA 2FSRA 2Z3MA 4KZTA 1S7KA 2WUUA 2CNMA 1YLEA 2OU2A 2VZZA 4MY0A 1I1DA 4CGMA 1VHSA 4KOYA 4UCPA 1QSRA 4BMHA 4KOVA 4PSXA 3T9YA 1Z4RA 1M44A 4LX9A 2B58A 2YNCA 3RYOA 5I0CA 4QC6A 3H5ZA 1XF8A 4B5PB 2REFA 4R9MA 2Z3PA 3IU1A 4UFVA 3NE7A 4XNHC 1YVKA 2B4DB 4KOTA 2FXFA 2KCWA 5G21A 2FL4A 2PRBA 1S7NA 2R98A 4NF1A 4AVCA 3TE4A 1M4DA 4A95A 5G20A 3FB3A 2REEA 3CXSA 4QBJA 5FVJA 2B5GA 2Z3OA 1IYKA 5GCNA 5AG4A 5G1ZA 4CAXA 4QB9A 4C2YA 3S6KA 2Z3LA 1B6BA 5HMNA 3TO6A 4MJ8A 3TFYA 3W91A 2G0BA 4CYPA 4UWJA 4CYNA 4KLWA 4JWPA 3V8IA 4MFLA 4XPDC 3D2PA 4A2ZA 4HNYB 1XIXA 1IB1E 1MK4A 3IU2A 1Q2CA 2Z3KA 3IWEA 2ZW4A 4H89A 4YGOA 5F49A 1KUVA 1K4JA 4KVME 1Y9WA 2YNDA 2PR8A 2G3AA 1Y9KA 5JQ4A 2HV2A 2YNCC 4R3LA 2EUIA 5IB0A 4B5OA 4JLYA 4NEXA 2F5IA 4Q36A 4CAFA 4E0AA 4OADA 3R96A 4R3KA 2VBQA 1KUXA 1Y7RA 2Z3NA 4RS2A 3BLNA 3E0KA 5KTCA 1Q2DA 1YVOA 5F47A 2B5GB 3B8GA 3KKWA 2OZHA 2QECA 1S5KA 5EC4A 2D4OA 5JPHA 4IF5A 4EVYA 1P0HA 1P4NA 5F48A 2FIWA 3PZJA 4C2XA 3EO4A 1M4GA 1XEBA 4KOUA 3EY5A 4U9YA 1V0CA 2OZUA 2A4NA 3FBUA 3FIXA 4R57A 1PU9A 1UFHA 4UA3A 4B5PA 4C2ZA 4PV6A 1BOBA 4UCMA 4C68A 3TTHA 3T90A 1I12A 2B4DA 4KUAA 3R1KA 5H84A 3S6HA 2JDDA 1MJ9A 4B11A 2B3UA 1M1DA 1QSOA 4KOSA 2YGWA 3I9SA 4R87A 3ZJ0A 3F5BA 1KZFA 3N7ZA 2JDCA 2Q0YA 3BJ8A 4MFKA 1MJAA 4OAEA 4Y49C 5C82A 2VQYA 4A32A 2ZW5A 2Z11A 2FT0A 5ISVA 4HNXB 3G8WA 4Y49B 2B4BA 2CNTA 2HQYA 5E96A 1YGHA 3SXOA 1Q2YA 4B13A 4KOWA 1U6MA 2Q04A 1IYLA 3GKRA 4U5YA 2Z0ZA 3EXNA 4J3GA 3D8PA 2GANA 3DR8A 3R95A 4B10A 5A28A 4U9ZA 1S60A 2BUEA 4HKFA 1TIQA 1VKCA 3LD2A 1SQHA 4AB7A 2FIAA 2PC1A 4F0XA 3FNCA 1NSLA 3IGRA 4XNHB 4AVAA 3I3GA 1QSTA 4IUSA 1I21A 4JXRA 1CJWA 3DNSA 3TO7A 3SXNA 4L8AA 2X7BA 3PGPA 5G22A 1NE9A 4NCZA 3JTKA 2P6FA 4YFJA 4MFPA 3MGDA 4JXQA 2NMTA 3FXTA 3CXPA 3JUWA 1XE4A 2WPWA 1Z4EA 4QVTA 3FRMA 2FS5A 4ORFA 3VWDA 4CAVA 2DPSA 2R8VA 1S7FA 3CXQA 4C7IA 4HNWB 2FCKA 5C88A 4XPKA 2QMLA 4KLVA 4KOXA 4H6UA 4AG9A 3VWEA 4MHDA 3EFAA 2PDOA 2CY2A 2C27A 2Y0MA 4KVOE 3D3SA 2JLMA 3DR6A 1WWZA 2D4PA 4E8OA 4GS4A 3JVNA 2Q7BA 5F46A 4BBHA 1IIDA 3A9LA 4F6AA 2OH1A 2H5MA 5DWMA 1R57A 2CNSA 1GHEA 1FY7A 3PP9A 1YREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JEV A;  1YX0 A;  2PR1 A;  1QSN A;  2OB0 A;  2VZY A;  4MY3 A;  5KTA A;  1M4I A;  3TT2 A;  2ATR A;  1S3Z A;  1L0C A;  2PQ8 A;  3P2H A;  3P2F A;  2GE3 A;  2I00 A;  3OWC A;  3DSB A;  1OZP A;  5J8C A;  3FYN A;  4FD6 A;  4YRH A;  4PK2 A;  2WPX A;  1XMT A;  4PSW A;  3R9G A;  2R7H A;  3TCV A;  3TO9 A;  2BSW A;  2FE7 A;  1YR0 A;  2B3V A;  2ZW6 A;  2ZW7 A;  4M85 A;  3G3S A;  3R9E A;  1RO5 A;  1ON0 A;  4H6Z A;  2I79 A;  4CAW A;  2G3T A;  3DDD A;  1IIC A;  2PSW A;  3D2M A;  1S7L A;  1NMT A;  5DWN A;  4XPL A;  1YK3 A;  2P0W A;  4FD4 A;  3LOD A;  2DXQ A;  2ZXV A;  3H4Q A;  4K30 A;  4LUA A;  2ARH A;  4OLL A;  4DNC A;  3GYA A;  4CS0 B;  3IWG A;  3GY9 A;  1PUA A;  4II9 A;  2P6E A;  1MJB A;  3QAH A;  4CRZ B;  2EVN A;  2QIR A;  4NSQ A;  3C26 A;  1RXT A;  3WR7 A;  5J8F A;  2P6G A;  2J8R A;  2VI7 A;  4E2A A;  3R9F A;  4UBR A;  4FD7 A;  3TOA A;  2IL4 A;  4QUS A;  2AJ6 A;  3W6S A;  4AG7 A;  2R1I A;  2ZPA A;  2VEZ A;  4I49 A;  2GIV A;  5IX3 A;  3TOB A;  3UY5 A;  4XPD B;  2BEI A;  4JJX A;  4MI4 A;  1CM0 A;  2HUZ A;  2AE6 A;  2O28 A;  2Q4Y A;  4M3S A;  3S6F A;  1B87 A;  4ZBG A;  4L89 A;  1Z9U A;  1WK4 A;  4PK3 A;  3S6G A;  3F0A A;  4RI1 A;  3F8K A;  5CNP A;  4KOR A;  3W6X A;  2RC4 A;  4FD5 A;  5IV0 A;  3BJ7 A;  2Z10 A;  3EC4 A;  5HH1 A;  2VXK A;  4NXY A;  2J8M A;  4JD6 A;  3ZZI A;  1QSM A;  2OZG A;  3K9U A;  3SHP A;  4CRY B;  2K5T A;  2Q44 A;  1KUY A;  1N71 A;  5H86 A;  1J4J A;  4ONU A;  5KTD A;  1BO4 A;  2J8N A;  4AVB A;  4MBU A;  1LRZ A;  2BL1 A;  4X5K A;  2Q4V A;  4KVX A;  4KUB A;  4F0Y A;  5EBV A;  4UWI A;  3QB8 A;  2FSR A;  4KZT A;  1S7K A;  2CNM A;  1YLE A;  2OU2 A;  2VZZ A;  4MY0 A;  1I1D A;  1VHS A;  4KOY A;  1QSR A;  4BMH A;  4KOV A;  4PSX A;  3T9Y A;  1Z4R A;  1M44 A;  4LX9 A;  2B58 A;  3RYO A;  5I0C A;  4QC6 A;  1XF8 A;  4B5P B;  2REF A;  4R9M A;  3NE7 A;  4XNH C;  1YVK A;  2B4D B;  4KOT A;  2FXF A;  2KCW A;  2FL4 A;  2PRB A;  1S7N A;  2R98 A;  4NF1 A;  4AVC A;  3TE4 A;  1M4D A;  3FB3 A;  2REE A;  3CXS A;  4QBJ A;  5FVJ A;  2B5G A;  5GCN A;  1IYK A;  4CAX A;  4QB9 A;  3S6K A;  1B6B A;  5HMN A;  3TO6 A;  4MJ8 A;  3TFY A;  3W91 A;  2G0B A;  4UWJ A;  4KLW A;  4JWP A;  3V8I A;  4XPD C;  3D2P A;  4HNY B;  1XIX A;  1IB1 E;  1MK4 A;  1Q2C A;  2ZW4 A;  4H89 A;  4YGO A;  5F49 A;  1KUV A;  1K4J A;  4KVM E;  1Y9W A;  2PR8 A;  2G3A A;  1Y9K A;  5JQ4 A;  2HV2 A;  4R3L A;  2EUI A;  5IB0 A;  4B5O A;  4JLY A;  4NEX A;  2F5I A;  4E0A A;  4OAD A;  3R96 A;  4R3K A;  2VBQ A;  1KUX A;  1Y7R A;  4RS2 A;  3BLN A;  3E0K A;  5KTC A;  1Q2D A;  1YVO A;  5F47 A;  2B5G B;  3B8G A;  3KKW A;  2OZH A;  2QEC A;  1S5K A;  5EC4 A;  2D4O A;  5JPH A;  4IF5 A;  4EVY A;  1P0H A;  1P4N A;  5F48 A;  2FIW A;  3PZJ A;  3EO4 A;  1M4G A;  1XEB A;  4KOU A;  3EY5 A;  4U9Y A;  1V0C A;  2OZU A;  2A4N A;  3FBU A;  3FIX A;  4R57 A;  1PU9 A;  1UFH A;  4UA3 A;  4B5P A;  4PV6 A;  1BOB A;  3TTH A;  3T90 A;  1I12 A;  2B4D A;  4KUA A;  3R1K A;  5H84 A;  3S6H A;  2JDD A;  1MJ9 A;  2B3U A;  1M1D A;  1QSO A;  4KOS A;  3I9S A;  4R87 A;  3ZJ0 A;  3F5B A;  1KZF A;  3N7Z A;  2JDC A;  2Q0Y A;  3BJ8 A;  4Y49 C;  1MJA A;  4OAE A;  5C82 A;  2VQY A;  2ZW5 A;  2Z11 A;  2FT0 A;  5ISV A;  4HNX B;  3G8W A;  4Y49 B;  2B4B A;  2CNT A;  2HQY A;  5E96 A;  1YGH A;  3SXO A;  1Q2Y A;  4KOW A;  1U6M A;  2Q04 A;  1IYL A;  3GKR A;  4U5Y A;  2Z0Z A;  3EXN A;  4J3G A;  3D8P A;  2GAN A;  3DR8 A;  3R95 A;  4U9Z A;  1S60 A;  2BUE A;  4HKF A;  1TIQ A;  1VKC A;  3LD2 A;  1SQH A;  4AB7 A;  2FIA A;  2PC1 A;  3FNC A;  1NSL A;  3IGR A;  4XNH B;  4AVA A;  3I3G A;  1QST A;  4IUS A;  1I21 A;  4JXR A;  1CJW A;  3DNS A;  3TO7 A;  3SXN A;  4L8A A;  2X7B A;  3PGP A;  1NE9 A;  4NCZ A;  2P6F A;  4YFJ A;  3MGD A;  4JXQ A;  2NMT A;  3FXT A;  3CXP A;  3JUW A;  1XE4 A;  2WPW A;  1Z4E A;  4QVT A;  3FRM A;  2FS5 A;  4ORF A;  3VWD A;  4CAV A;  2R8V A;  3CXQ A;  1S7F A;  4HNW B;  2FCK A;  5C88 A;  4XPK A;  2QML A;  4KLV A;  4KOX A;  4H6U A;  4AG9 A;  3VWE A;  4MHD A;  3EFA A;  2PDO A;  2CY2 A;  2C27 A;  2Y0M A;  4KVO E;  3D3S A;  2JLM A;  3DR6 A;  1WWZ A;  2D4P A;  4E8O A;  4GS4 A;  3JVN A;  2Q7B A;  5F46 A;  1IID A;  4F6A A;  2OH1 A;  2H5M A;  5DWM A;  1R57 A;  2CNS A;  1GHE A;  1FY7 A;  3PP9 A;  1YRE A; 
#chains in the Genus database with same CATH topology
 2JEV A;  1YX0 A;  2PR1 A;  5HVH A;  4ZY2 A;  1QSN A;  3D7D A;  2OB0 A;  3S9N A;  2VZY A;  3B7I A;  2AFZ A;  4MY3 A;  5KTA A;  1M4I A;  2PJ5 A;  4WJB A;  8CPA A;  3TT2 A;  2ATR A;  1S3Z A;  1L0C A;  2PQ8 A;  2YNE A;  2PJA A;  3P2H A;  3P2F A;  2GE3 A;  2I00 A;  3B3W A;  3OWC A;  3DSB A;  1OZP A;  1RTQ A;  1FNO A;  3RAM A;  4A33 A;  3VAR A;  4MMO A;  5CPA A;  4CGP A;  5J8C A;  3FYN A;  4FD6 A;  4YRH A;  5LRJ A;  1YLO A;  3CPA A;  5AG6 A;  4R6T A;  3PB6 X;  3CPX A;  4ZX9 A;  4PK2 A;  2WPX A;  4UFW A;  2Q43 A;  1XMT A;  4PSW A;  3R9G A;  1XBU A;  2R7H A;  3T8W A;  3IEH A;  3TCV A;  5IB9 A;  1F2P A;  3B2Y A;  3TO9 A;  1VIX A;  2BSW A;  2FE7 A;  1Q7L A;  1YR0 A;  2B3V A;  2ZW6 A;  2ZW7 A;  3PB7 X;  3G3S A;  4M85 A;  4NGR A;  3R9E A;  4CGL A;  4NJR A;  1RO5 A;  3PFE A;  1ON0 A;  3B3C A;  3PBE A;  3GUX A;  4OC0 A;  1ZO0 A;  5K8M A;  1F2O A;  4H6Z A;  2I79 A;  2Q7S A;  3FF3 A;  4P45 A;  3SI0 A;  4CAW A;  2G3T A;  2PJ4 A;  3DDD A;  1IIC A;  2PSW A;  3D2M A;  1S7L A;  4NJQ A;  2GU2 A;  2ZED A;  1NMT A;  5DWN A;  2GLF A;  4XPL A;  1YK3 A;  2P0W A;  4FD4 A;  4C7H A;  4RN7 A;  5F09 A;  3LOD A;  4IK2 A;  2DXQ A;  4BD9 A;  4KS9 A;  1Z8X A;  1YW4 A;  2ZXV A;  3H4Q A;  3QAY A;  4K30 A;  3S9L A;  3H8G A;  1LAP A;  4P4I A;  4LUA A;  2ARH A;  4OLL A;  3K2K A;  2XEJ A;  4DNC A;  3GYA A;  3L2N A;  4Q38 A;  4A30 A;  3IWG A;  4B14 A;  4CS0 B;  3GY9 A;  1PUA A;  4II9 A;  4UCN A;  4G1P A;  2P6E A;  4X3R A;  1MJB A;  1Z8T A;  3QAH A;  4GM5 A;  4KSA A;  5D8N A;  4CRZ B;  2EVN A;  2QIR A;  2QYV A;  6CPA A;  2PJB A;  4NSQ A;  3C26 A;  5K8P A;  5AG7 A;  1ZG9 A;  1RXT A;  2AFO A;  3WR7 A;  2ZEM A;  2DPT A;  4OP4 A;  2V8G A;  5J8F A;  2PE3 A;  3VH9 A;  1GYT A;  4A39 A;  2ZEH A;  2P6G A;  4PQA A;  1AMP A;  2EK9 A;  2J8R A;  2VI7 A;  3PEI A;  1ELL P;  4OC2 A;  4W9Y A;  4M6H A;  4CGO A;  4E2A A;  3R9F A;  4LQG A;  3WC7 A;  4UBR A;  1HEE A;  2O53 A;  4FD7 A;  3CZX A;  4NFR A;  3TOA A;  2IL4 A;  2OOT A;  4QUS A;  2AJ6 A;  3KL9 A;  1H8L A;  1TKF A;  2DEA A;  4IAV A;  3W6S A;  3V38 A;  3KQZ A;  2ZEE A;  4LQ6 A;  4AG7 A;  2R1I A;  2ZPA A;  2VEZ A;  3B35 A;  2GIV A;  3D68 A;  4I49 A;  2ZEF A;  4P4D A;  3TOB A;  3UY5 A;  5A27 A;  5IX3 A;  4XPD B;  3SJX A;  1BPN A;  2BEI A;  3PB4 X;  4JJX A;  4MI4 A;  1CM0 A;  2F7V A;  2HUZ A;  2AE6 A;  2O28 A;  1XOV A;  2Q4Y A;  3WC5 A;  2PJ2 A;  4M3S A;  4OKO A;  7CPA A;  1TKH A;  2PJC A;  3S6F A;  1B87 A;  1AYE A;  3IC1 A;  4ZBG A;  4A31 A;  4CAE A;  2C6G A;  4FWU A;  1IOI A;  4O23 A;  4L89 A;  3KR5 A;  1IGB A;  1Z9U A;  2XEG A;  3LMS A;  3LAC A;  1WK4 A;  4PK3 A;  1IU8 A;  3S6G A;  1TF9 A;  1DTD A;  4R8F A;  3F0A A;  2POK A;  3H8E A;  4RI1 A;  2RFH A;  4MFZ A;  4PXE A;  5EMI A;  3F8K A;  4OC4 A;  5CNP A;  4KOR A;  3SJF A;  3W6X A;  2RC4 A;  1TKJ A;  2CXA A;  4FD5 A;  4PPZ A;  3WC6 A;  5IV0 A;  3BJ7 A;  2O4H A;  1DE4 C;  5AG5 A;  2Z10 A;  3EC4 A;  5HH1 A;  2VXK A;  3MRU A;  3FEE A;  3NH4 A;  4NXY A;  2J8M A;  1Y0R A;  4JD6 A;  4TNU A;  3ZZI A;  3H8F A;  4EWT A;  2IQ6 A;  4RUH A;  1QSM A;  4K3N A;  4EME A;  4OIW A;  5J1Q A;  2OZG A;  3V7Z A;  4MCP A;  4PXD A;  3K9U A;  3DLJ A;  3SHP A;  5JH9 A;  2QJ8 A;  4CRY B;  2K5T A;  4MFJ A;  2Q44 A;  1XRY A;  4R7M A;  1KUY A;  1N71 A;  4WWV A;  5H86 A;  4A38 A;  2PJ7 A;  1BAV A;  1J4J A;  4ONU A;  3KAS A;  5BWA B;  2ZEL A;  3N5F A;  4MFQ A;  4MCQ A;  5KTD A;  4CYO A;  1BO4 A;  3RBU A;  4ZY0 A;  2J8N A;  4AVB A;  4KSF A;  4UFX A;  4MBU A;  1LRZ A;  4ZY1 A;  2BL1 A;  4X5K A;  2Q4V A;  2J9A A;  2ZEP A;  4KVX A;  4B12 A;  4UEF A;  4KUB A;  4ZGY B;  4X8I A;  4F0Y A;  5EBV A;  4MRI A;  4CGN A;  4FUU A;  3QNV A;  4UWI A;  3QB8 A;  3B3V A;  5AGE A;  2HC9 A;  2FSR A;  1LOK A;  2WSA A;  2Z3M A;  1S7K A;  3PB9 X;  4KZT A;  2WUU A;  2CNM A;  3KZW A;  3KQX A;  1YLE A;  2AFU A;  2OU2 A;  2ZEG A;  3RZA A;  4CPA A;  2VZZ A;  4MY0 A;  1I1D A;  1Z8W A;  2EBJ A;  3FJU A;  4DUK A;  1Y7E A;  4CGM A;  1VHS A;  4KOY A;  2NYQ A;  1YQE A;  4UCP A;  3CDX A;  1QSR A;  4H2K A;  4BMH A;  2AFS A;  4KOV A;  4PSX A;  3T9Y A;  1Z4R A;  1M44 A;  4LX9 A;  2NSM A;  2FVG A;  4A94 A;  1QQ9 A;  1M4L A;  1VHO A;  2B58 A;  2YNC A;  5THW A;  3RYO A;  4UIB A;  5I0C A;  4QC6 A;  1A2Z A;  3H5Z A;  2IMO A;  5K8O A;  1CP6 A;  1XF8 A;  4B5P B;  2REF A;  4MHY A;  1ZLI A;  4R9M A;  2Z3P A;  3IU1 A;  4UFV A;  3NE7 A;  4UIA A;  4XNH C;  3HLP A;  1YVK A;  3KGQ A;  4NGM A;  1PCA A;  5CBM A;  2B4D B;  4KOT A;  2FXF A;  2Q51 A;  3NH8 A;  4F9V A;  2F8H A;  1YSJ A;  2KCW A;  3NE8 A;  2CF4 A;  5G21 A;  4A37 A;  2FL4 A;  2AFM A;  2PRB A;  3BI1 A;  1S7N A;  2R98 A;  4NF1 A;  2BO9 A;  4AVC A;  3TE4 A;  1M4D A;  2PJ6 A;  4A95 A;  3PFO A;  4PXB A;  5G20 A;  1VHE A;  2PIZ A;  3FB3 A;  2REE A;  3CXS A;  4QBJ A;  5FVJ A;  4ZYQ A;  2B5G A;  2Z3O A;  1IYK A;  4NGN A;  5GCN A;  5ELY A;  5G1Z A;  5AG4 A;  4CAX A;  4QB9 A;  2PVV A;  4C2Y A;  3S9M A;  1PYT B;  3S6K A;  4OC5 A;  2Z3L A;  1B6B A;  5HMN A;  3TO6 A;  1CP7 A;  4MJ8 A;  3TFY A;  3W91 A;  2PJ0 A;  2G0B A;  4CYP A;  4UWJ A;  3KHZ A;  2G9D A;  4CYN A;  4KLW A;  4JWP A;  3V8I A;  4MFL A;  4XPD C;  1ARL A;  2ZEO A;  4OC3 A;  3BXM A;  3RO0 A;  2CTB A;  3D2P A;  5HXD A;  5LYD A;  4A2Z A;  2WZN A;  4HNY B;  3FX6 A;  4Q7A A;  1XIX A;  1IB1 E;  2ABZ A;  1MK4 A;  3D66 A;  3IU2 A;  4NGS A;  3HUV A;  4P6Y A;  1Q2C A;  4P10 A;  2Z3K A;  2C6C A;  3IWE A;  5K8N A;  2ZW4 A;  3IIB A;  4H89 A;  4YGO A;  4BIN A;  5F49 A;  1KUV A;  3FEC A;  1K4J A;  4KVM E;  1HDQ A;  1Y9W A;  1AUG A;  1BPM A;  2PR8 A;  2YND A;  2G3A A;  4F9U A;  5D29 A;  1Y9K A;  5JQ4 A;  2HV2 A;  2YNC C;  1CG2 A;  4R3L A;  2EUI A;  5IB0 A;  2I3C A;  3D7G A;  5LRK A;  4B5O A;  1EE3 P;  3B3S A;  1Z8L A;  1YW6 A;  3GB0 A;  4JLY A;  2F5I A;  4NEX A;  4Q36 A;  1ELM P;  4AXV A;  1XFO A;  4CAF A;  1IOF A;  4P4F A;  4E0A A;  4OAD A;  3R96 A;  4R3K A;  2CTC A;  1KUX A;  2VBQ A;  4OID A;  3NH5 A;  1Y7R A;  2Z3N A;  4RS2 A;  3BLN A;  3E0K A;  3JRU A;  5KTC A;  2PCU A;  3B3T A;  1Q2D A;  4Z65 A;  1YVO A;  5F47 A;  2B5G B;  3B8G A;  3KKW A;  5LYL A;  2OZH A;  2QEC A;  1S5K A;  1ZLH A;  5LYI A;  3RNZ A;  1UWY A;  2BOA A;  4P4E A;  4TWE A;  2D4O A;  3FVL A;  4MCS A;  5EC4 A;  5JPH A;  4IF5 A;  3KR4 A;  4EVY A;  1P0H A;  1P4N A;  5JGF A;  5F48 A;  2FIW A;  4OC1 A;  2EO8 A;  3PZJ A;  4C2X A;  3EO4 A;  3NA6 A;  1M4G A;  5LYF A;  1XEB A;  3D7H A;  3FED A;  4KOU A;  1XMB A;  4DJL A;  3EY5 A;  4U9Y A;  1V0C A;  2OZU A;  2A4N A;  2Q4Z A;  1JQG A;  1F57 A;  3FBU A;  3FIX A;  4R57 A;  1PU9 A;  1UFH A;  1CPS A;  4UA3 A;  4B5P A;  4C2Z A;  1R43 A;  4PV6 A;  1X12 A;  1BOB A;  3ISX A;  4UCM A;  1BLL E;  4C68 A;  1LAM A;  3TTH A;  3T90 A;  5I4M A;  1I12 A;  4P4J A;  2AFX A;  2B4D A;  4KUA A;  3R1K A;  5H84 A;  3S6H A;  2JDD A;  1MJ9 A;  4PXC A;  4FAI A;  2PRQ A;  4YWY A;  4UF4 A;  4B11 A;  3FMC A;  2B3U A;  1M1D A;  1QSO A;  4KOS A;  3GIU A;  2YGW A;  4JYW A;  3I9S A;  4R87 A;  3ZJ0 A;  3F5B A;  1KZF A;  4EFD A;  3K9T A;  3N7Z A;  2JDC A;  2Q0Y A;  3I1U A;  2ODF A;  3BJ8 A;  4MFK A;  1MJA A;  4OAE A;  4Y49 C;  2V77 A;  4NGQ A;  1Z5R A;  1LCP A;  2PJ3 A;  4P44 A;  1TF8 A;  5C82 A;  2VQY A;  4B6Z A;  1XJO A;  4A32 A;  2ZW5 A;  2V8H A;  2AFW A;  5JM6 A;  2ZOG A;  3BI0 A;  3IFE A;  1X10 A;  2GFQ A;  1Y0Y A;  2Z11 A;  2BCO A;  3DGV A;  2JBK A;  1LFW A;  1ZG7 A;  4MHP A;  2HB6 A;  2RB7 A;  4KSI A;  2FT0 A;  4NGP A;  3SJE A;  5ISV A;  3G8W A;  4HNX B;  4Y49 B;  1FT7 A;  2B4B A;  2ANP A;  2CNT A;  5LRG A;  2HQY A;  5E96 A;  1YGH A;  2V8D A;  3SXO A;  3KI9 A;  4OME A;  1Q2Y A;  3PB8 X;  4M6I A;  4B13 A;  4KOW A;  1U6M A;  2Q04 A;  1IYL A;  3FH4 A;  3GKR A;  1CBX A;  5HVG A;  1VGY A;  4U5Y A;  2Z0Z A;  2ZEN A;  3EXN A;  4J3G A;  3D8P A;  2GAN A;  2V8V A;  4MXU A;  3DR8 A;  3VAT A;  3R95 A;  4B10 A;  5A28 A;  4U9Z A;  1S60 A;  2BUE A;  4HKF A;  1OBR A;  1HDU A;  2IJZ A;  1ZG8 A;  1R3N A;  1TIQ A;  3PRT A;  1VKC A;  4MHN A;  4JZ0 A;  2DF5 A;  3BHX A;  3LD2 A;  1SQH A;  4AB7 A;  3IJ3 A;  2FIA A;  5DS0 A;  2PC1 A;  4F0X A;  1IY7 A;  3FNC A;  1NSL A;  3IGR A;  2GRE A;  4X2T A;  4ZX8 A;  2VL1 A;  3NFZ A;  4R76 A;  4XNH B;  3I3G A;  1QST A;  4AVA A;  4IUS A;  4NGT A;  2QVP A;  1I21 A;  4JXR A;  1CJW A;  4FBE A;  3DNS A;  3TO7 A;  3D67 A;  1CX8 A;  3SXN A;  4L8A A;  2X7B A;  3PGP A;  2PJ8 A;  3ISZ A;  5G22 A;  1NE9 A;  3GLJ A;  4NCZ A;  3JTK A;  3CT9 A;  3SI2 A;  3MN8 A;  3TX8 A;  2EWB A;  2P6F A;  4YFJ A;  4MFP A;  1JWQ A;  2XEF A;  2JEW A;  3MGD A;  4JXQ A;  2JBJ A;  4UEE A;  2NMT A;  3FXT A;  3CXP A;  1QMU A;  3JUW A;  4M6G A;  4HPS A;  1XE4 A;  2WPW A;  1TXR A;  1Z4E A;  2OR4 A;  4IHM A;  4QVT A;  4P4B A;  3SJG A;  3SI1 A;  3FRM A;  2FS5 A;  4ORF A;  4GXH A;  3TC8 A;  3VWD A;  4DYO A;  4YU9 A;  4CAV A;  2DPS A;  1LAN A;  1S7F A;  2R8V A;  3CXQ A;  4HNW B;  2FCK A;  4C7I A;  5C88 A;  3PBB A;  4XPK A;  2QML A;  2EK8 A;  3D4U A;  3IWW A;  2PIY A;  3IO1 A;  2PJ1 A;  4KLV A;  4KOX A;  4CYQ A;  4H6U A;  4AG9 A;  3VWE A;  4MHD A;  2WYR A;  3EFA A;  5HVF A;  2PDO A;  2GLJ A;  1Z2L A;  2CY2 A;  2C1C A;  4MCR A;  2C27 A;  2Y0M A;  4KVO E;  3D7F A;  4MHZ A;  1ARM A;  1NSA A;  3D3S A;  3KHX A;  3WT4 A;  2JLM A;  2PJ9 A;  3DR6 A;  1WWZ A;  2XEI A;  2D4P A;  2PVW A;  4F8Z A;  4E8O A;  3WAB A;  4GS4 A;  4ZI6 A;  3JVN A;  3LWU A;  2Q7B A;  5F46 A;  4BBH A;  1IID A;  3A9L A;  1CPX A;  1KWM A;  1YME A;  4F6A A;  2OH1 A;  2H5M A;  5DWM A;  1R57 A;  2CNS A;  2ZOF A;  4ONW A;  1GHE A;  1FY7 A;  4UEZ A;  3PP9 A;  2CIJ A;  1YRE A;  2C6P A; 
#chains in the Genus database with same CATH homology
 2JEV A;  1YX0 A;  2PR1 A;  1QSN A;  2OB0 A;  2VZY A;  4MY3 A;  5KTA A;  1M4I A;  3TT2 A;  2ATR A;  1S3Z A;  1L0C A;  2PQ8 A;  2YNE A;  3P2H A;  3P2F A;  2GE3 A;  2I00 A;  3OWC A;  3DSB A;  1OZP A;  5J8C A;  4A33 A;  4CGP A;  3FYN A;  4FD6 A;  4YRH A;  5AG6 A;  4PK2 A;  2WPX A;  4UFW A;  1XMT A;  4PSW A;  3R9G A;  2R7H A;  3TCV A;  3TO9 A;  2BSW A;  2FE7 A;  1YR0 A;  2B3V A;  2ZW6 A;  2ZW7 A;  4M85 A;  3G3S A;  3R9E A;  4CGL A;  1RO5 A;  1ON0 A;  1ZO0 A;  4H6Z A;  2I79 A;  4CAW A;  2G3T A;  3DDD A;  1IIC A;  2PSW A;  3D2M A;  1S7L A;  1NMT A;  5DWN A;  4XPL A;  1YK3 A;  2P0W A;  4FD4 A;  4C7H A;  3LOD A;  2DXQ A;  4KS9 A;  2ZXV A;  3H4Q A;  4K30 A;  4LUA A;  2ARH A;  4OLL A;  4DNC A;  3GYA A;  4A30 A;  4Q38 A;  4B14 A;  3IWG A;  4CS0 B;  3GY9 A;  1PUA A;  4II9 A;  4UCN A;  2P6E A;  1MJB A;  3QAH A;  4KSA A;  4CRZ B;  2EVN A;  2QIR A;  4NSQ A;  3C26 A;  5AG7 A;  1RXT A;  3WR7 A;  2DPT A;  5J8F A;  2P6G A;  2J8R A;  2VI7 A;  4CGO A;  4E2A A;  3R9F A;  4UBR A;  4FD7 A;  3TOA A;  2IL4 A;  4QUS A;  2AJ6 A;  3W6S A;  4AG7 A;  2R1I A;  2ZPA A;  2VEZ A;  4I49 A;  2GIV A;  5A27 A;  3TOB A;  5IX3 A;  3UY5 A;  4XPD B;  2BEI A;  4JJX A;  4MI4 A;  1CM0 A;  4CYQ A;  2HUZ A;  2AE6 A;  2O28 A;  2Q4Y A;  4M3S A;  3S6F A;  1B87 A;  4ZBG A;  4A31 A;  4CAE A;  4L89 A;  1Z9U A;  1WK4 A;  4PK3 A;  3S6G A;  3F0A A;  4RI1 A;  4MFZ A;  3F8K A;  5CNP A;  4KOR A;  3W6X A;  2RC4 A;  2CXA A;  4FD5 A;  5IV0 A;  3BJ7 A;  5AG5 A;  2Z10 A;  3EC4 A;  5HH1 A;  2VXK A;  4NXY A;  2J8M A;  4JD6 A;  3ZZI A;  1QSM A;  2OZG A;  3K9U A;  3SHP A;  4CRY B;  2K5T A;  4MFJ A;  2Q44 A;  1KUY A;  1N71 A;  5H86 A;  1J4J A;  4ONU A;  5BWA B;  4MFQ A;  5KTD A;  4CYO A;  1BO4 A;  2J8N A;  4AVB A;  4KSF A;  4UFX A;  4MBU A;  1LRZ A;  2BL1 A;  4X5K A;  2Q4V A;  4KVX A;  4B12 A;  4KUB A;  4ZGY B;  4F0Y A;  5EBV A;  4CGN A;  4UWI A;  3QB8 A;  5AGE A;  2WSA A;  2FSR A;  2Z3M A;  4KZT A;  1S7K A;  2WUU A;  2CNM A;  1YLE A;  2OU2 A;  2VZZ A;  4MY0 A;  1I1D A;  4CGM A;  1VHS A;  4KOY A;  4UCP A;  1QSR A;  4BMH A;  4KOV A;  4PSX A;  3T9Y A;  1Z4R A;  1M44 A;  4LX9 A;  2B58 A;  2YNC A;  3RYO A;  5I0C A;  4QC6 A;  3H5Z A;  1XF8 A;  4B5P B;  2REF A;  4R9M A;  2Z3P A;  3IU1 A;  4UFV A;  3NE7 A;  4XNH C;  1YVK A;  2B4D B;  4KOT A;  2FXF A;  2KCW A;  5G21 A;  2FL4 A;  2PRB A;  1S7N A;  2R98 A;  4NF1 A;  4AVC A;  3TE4 A;  1M4D A;  4A95 A;  5G20 A;  3FB3 A;  2REE A;  3CXS A;  4QBJ A;  5FVJ A;  2B5G A;  2Z3O A;  1IYK A;  5GCN A;  5AG4 A;  5G1Z A;  4CAX A;  4QB9 A;  4C2Y A;  3S6K A;  2Z3L A;  1B6B A;  5HMN A;  3TO6 A;  4MJ8 A;  3TFY A;  3W91 A;  2G0B A;  4CYP A;  4UWJ A;  4CYN A;  4KLW A;  4JWP A;  3V8I A;  4MFL A;  4XPD C;  3D2P A;  4A2Z A;  4HNY B;  1XIX A;  1IB1 E;  1MK4 A;  3IU2 A;  1Q2C A;  2Z3K A;  3IWE A;  2ZW4 A;  4H89 A;  4YGO A;  5F49 A;  1KUV A;  1K4J A;  4KVM E;  1Y9W A;  2YND A;  2PR8 A;  2G3A A;  1Y9K A;  5JQ4 A;  2HV2 A;  2YNC C;  4R3L A;  2EUI A;  5IB0 A;  4B5O A;  4JLY A;  4NEX A;  2F5I A;  4Q36 A;  4CAF A;  4E0A A;  4OAD A;  3R96 A;  4R3K A;  2VBQ A;  1KUX A;  1Y7R A;  2Z3N A;  4RS2 A;  3BLN A;  3E0K A;  5KTC A;  1Q2D A;  1YVO A;  5F47 A;  2B5G B;  3B8G A;  3KKW A;  2OZH A;  2QEC A;  1S5K A;  5EC4 A;  2D4O A;  5JPH A;  4IF5 A;  4EVY A;  1P0H A;  1P4N A;  5F48 A;  2FIW A;  3PZJ A;  4C2X A;  3EO4 A;  1M4G A;  1XEB A;  4KOU A;  3EY5 A;  4U9Y A;  1V0C A;  2OZU A;  2A4N A;  3FBU A;  3FIX A;  4R57 A;  1PU9 A;  1UFH A;  4UA3 A;  4B5P A;  4C2Z A;  4PV6 A;  1BOB A;  4UCM A;  4C68 A;  3TTH A;  3T90 A;  1I12 A;  2B4D A;  4KUA A;  3R1K A;  5H84 A;  3S6H A;  2JDD A;  1MJ9 A;  4B11 A;  2B3U A;  1M1D A;  1QSO A;  4KOS A;  2YGW A;  3I9S A;  4R87 A;  3ZJ0 A;  3F5B A;  1KZF A;  3N7Z A;  2JDC A;  2Q0Y A;  3BJ8 A;  4MFK A;  1MJA A;  4OAE A;  4Y49 C;  5C82 A;  2VQY A;  4A32 A;  2ZW5 A;  2Z11 A;  2FT0 A;  5ISV A;  4HNX B;  3G8W A;  4Y49 B;  2B4B A;  2CNT A;  2HQY A;  5E96 A;  1YGH A;  3SXO A;  1Q2Y A;  4B13 A;  4KOW A;  1U6M A;  2Q04 A;  1IYL A;  3GKR A;  4U5Y A;  2Z0Z A;  3EXN A;  4J3G A;  3D8P A;  2GAN A;  3DR8 A;  3R95 A;  4B10 A;  5A28 A;  4U9Z A;  1S60 A;  2BUE A;  4HKF A;  1TIQ A;  1VKC A;  3LD2 A;  1SQH A;  4AB7 A;  2FIA A;  2PC1 A;  4F0X A;  3FNC A;  1NSL A;  3IGR A;  4XNH B;  4AVA A;  3I3G A;  1QST A;  4IUS A;  1I21 A;  4JXR A;  1CJW A;  3DNS A;  3TO7 A;  3SXN A;  4L8A A;  2X7B A;  3PGP A;  5G22 A;  1NE9 A;  4NCZ A;  3JTK A;  2P6F A;  4YFJ A;  4MFP A;  3MGD A;  4JXQ A;  2NMT A;  3FXT A;  3CXP A;  3JUW A;  1XE4 A;  2WPW A;  1Z4E A;  4QVT A;  3FRM A;  2FS5 A;  4ORF A;  3VWD A;  4CAV A;  2DPS A;  2R8V A;  1S7F A;  3CXQ A;  4C7I A;  4HNW B;  2FCK A;  5C88 A;  4XPK A;  2QML A;  4KLV A;  4KOX A;  4H6U A;  4AG9 A;  3VWE A;  4MHD A;  3EFA A;  2PDO A;  2CY2 A;  2C27 A;  2Y0M A;  4KVO E;  3D3S A;  2JLM A;  3DR6 A;  1WWZ A;  2D4P A;  4E8O A;  4GS4 A;  3JVN A;  2Q7B A;  5F46 A;  4BBH A;  1IID A;  3A9L A;  4F6A A;  2OH1 A;  2H5M A;  5DWM A;  1R57 A;  2CNS A;  1GHE A;  1FY7 A;  3PP9 A;  1YRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...