3ZJ0A

The human o-glcnacase c-terminal domain is a pseudo histone acetyltransferase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
202
structure length
202
Chain Sequence
b'SEVVIRRATAADHGDLCRVCLLTGDSGRDASSREDDPTLLGMIYAVPYQVGAPDFAFVLEDAEGVCGYLLGAPDTLSFQHFLEKEWLPPLRAGLTDPGPDPAAWQGSDWARDAIHRPPALPPIDLAAYPAHGHIDLLPRAQGRGVGSRAMDHLEAALAAAGAPGMHLQVSPENPRALGFYEHRGFRELCRSEDEVVVGRRLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLTRANSFERASE
publication title Structure of a Bacterial Putative Acetyltransferase Defines the Fold of the Human O-Glcnacase C-Terminal Domain.
pubmed doi rcsb
source organism Oceanicola granulosus
molecule tags Transferase
total genus 60
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2013-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3zj0A00
1CM0A 4NCZA 1K4JA 5KTDA 2JEVA 1IYLA 2FSRA 2EUIA 5E96A 4NXYA 1SQHA 3OWCA 1QSNA 3R9GA 3D2PA 2QECA 1PU9A 1NMTA 2B4DB 3VWEA 4EVYA 1N71A 2ATRA 1VKCA 4JJXA 3S6HA 1YK3A 3EFAA 3F5BA 3N7ZA 1Y9KA 2GANA 4GS4A 4RI1A 1S7LA 2J8RA 3S6FA 1UFHA 3FXTA 3FRMA 4YFJA 4PK3A 3H4QA 5HH1A 1ON0A 4PSWA 2BSWA 4L89A 1GHEA 1RO5A 4FD6A 1QSOA 1R57A 1WWZA 4H6UA 1XE4A 4MY0A 1KZFA 3DR8A 4XNHB 3E0KA 2PRBA 4IUSA 2ARHA 4JLYA 1YLEA 4KZTA 1P4NA 5DWMA 2PC1A 3W6XA 4AG9A 1J4JA 1QSMA 2C27A 1B6BA 4QVTA 5IB0A 4OADA 4UWJA 3FYNA 2CNTA 4YRHA 3TO9A 1NE9A 4XNHC 3B8GA 4AB7A 1XF8A 1YREA 3P2FA 3UY5A 3SXNA 1FY7A 4KOSA 4E2AA 1M4DA 4KOUA 2QMLA 3R9FA 2Q04A 4R87A 3SHPA 2ZW4A 2WPXA 2VBQA 5H86A 3BJ8A 2H5MA 2FL4A 2P0WA 1TIQA 3EO4A 2FXFA 4JWPA 4KOYA 2D4PA 2O28A 4X5KA 2REEA 3FNCA 4KVXA 3KKWA 4JD6A 3BJ7A 2CY2A 2CNSA 2HQYA 1KUYA 4IF5A 4JXRA 2Q4YA 5EC4A 2DXQA 2GE3A 3QAHA 2R98A 2VXKA 1Z4EA 1NSLA 4AVBA 3BLNA 5F46A 1M4IA 2FCKA 3I3GA 3TE4A 2AJ6A 1MJAA 2Q44A 2PDOA 2BEIA 3K9UA 4KUAA 1QSTA 4R9MA 1PUAA 5KTCA 2JDDA 5JQ4A 4KUBA 4CAWA 4MBUA 5DWNA 4H6ZA 4FD7A 4B5PA 2KCWA 4KOXA 5F47A 4CAXA 5H84A 4AVAA 1KUVA 2FT0A 4PSXA 3TCVA 4ORFA 5J8FA 3S6KA 3JVNA 2ZW5A 2QIRA 5HMNA 2G3TA 1QSRA 3LODA 4ONUA 1WK4A 2Q0YA 5ISVA 1LRZA 2P6EA 2PQ8A 1I12A 4M85A 4K30A 3EC4A 4M3SA 4AVCA 4OAEA 1S7KA 4NEXA 4KORA 3TFYA 1I21A 4CRYB 1M4GA 4AG7A 4U9ZA 4E0AA 4FD4A 3W6SA 2JLMA 1S3ZA 1S60A 2ZPAA 2ZW6A 1Y9WA 3FBUA 4UBRA 2G0BA 3MGDA 2J8MA 1IB1E 3GYAA 1VHSA 2HV2A 2BL1A 3D3SA 5EBVA 4B5PB 1YR0A 4FD5A 1YVOA 1MK4A 2P6GA 2OB0A 1KUXA 4I49A 3R96A 2OZGA 2B3UA 4LX9A 2I79A 2B4BA 1Q2DA 5JPHA 2FE7A 5IX3A 1IIDA 4UWIA 3S6GA 3T9YA 3IGRA 2OU2A 1BOBA 3WR7A 4HNWB 2Q4VA 1RXTA 2VZZA 3EXNA 4PK2A 5FVJA 2PSWA 3TOBA 2FIAA 1L0CA 4E8OA 5IV0A 3JUWA 3FB3A 4QB9A 2B5GA 4F0YA 1IYKA 3PP9A 4R57A 2PR8A 4ZBGA 4NF1A 3T90A 3DR6A 1Z4RA 1YGHA 3G8WA 4NSQA 4U5YA 1IICA 2K5TA 2X7BA 3I9SA 1XIXA 2CNMA 2RC4A 4MHDA 2OH1A 5I0CA 4KVME 3GY9A 5F49A 2G3AA 3IWGA 4F6AA 3EY5A 2GIVA 3DSBA 1MJBA 4HKFA 3SXOA 2VEZA 4CS0B 3C26A 2JDCA 1YX0A 3F8KA 2Q7BA 1Z9UA 1B87A 4R3KA 2PR1A 3D8PA 4MY3A 3R9EA 3QB8A 2FS5A 1Y7RA 4DNCA 2Z11A 2A4NA 4Y49B 4BMHA 4LUAA 2B5GB 2B3VA 2B58A 1S7FA 1P0HA 3R1KA 3PZJA 2J8NA 4QUSA 2BUEA 2R1IA 3V8IA 2F5IA 4YGOA 1M1DA 5C88A 2Z10A 3TO7A 1V0CA 2I00A 2VZYA 4L8AA 4JXQA 4Y49C 2IL4A 2OZHA 2VI7A 2VQYA 4XPDB 2HUZA 4KVOE 5CNPA 3TO6A 1I1DA 4HNXB 1BO4A 4II9A 2OZUA 2REFA 2AE6A 5F48A 2ZXVA 3F0AA 3ZZIA 4HNYB 2EVNA 3TOAA 2P6FA 4RS2A 1MJ9A 4XPDC 3FIXA 3GKRA 2Z0ZA 2R7HA 3DNSA 4OLLA 3CXSA 3P2HA 2B4DA 3NE7A 5GCNA 3D2MA 3VWDA 2ZW7A 4XPLA 4KOTA 1U6MA 1S7NA 4XPKA 5KTAA 1M44A 3PGPA 2R8VA 3G3SA 5C82A 1OZPA 3RYOA 4B5OA 2D4OA 4CAVA 4QBJA 3TTHA 1Q2CA 4KOWA 5J8CA 2FIWA 3ZJ0A 3DDDA 3LD2A 2WPWA 4MI4A 4U9YA 1Q2YA 3CXPA 4QC6A 4KLVA 3W91A 4R3LA 1CJWA 1S5KA 4MJ8A 4CRZB 4H89A 1XEBA 4J3GA 4PV6A 3R95A 2NMTA 3CXQA 4KLWA 1XMTA 4UA3A 4KOVA 3TT2A 2Y0MA 1YVKA
chains in the Genus database with same CATH superfamily
1CM0A 1DTDA 1F2PA 1K4JA 4NCZA 5KTDA 4UCNA 5LRKA 2JEVA 1IYLA 2FSRA 2EUIA 4R76A 4W9YA 5E96A 3TC8A 4NXYA 2V8VA 1SQHA 3OWCA 4RUHA 1X10A 1QSNA 1Q7LA 3R9GA 1AUGA 2CXAA 3D2PA 2QECA 1PU9A 1NMTA 2V8GA 1YSJA 2B4DB 3VWEA 4EVYA 4ZY1A 4P10A 1BLLE 2Q43A 2EWBA 3L2NA 2GFQA 2PVVA 1N71A 2ATRA 1VKCA 3FH4A 4JJXA 1XOVA 3S6HA 4H2KA 1YK3A 1HEEA 5HVFA 3EFAA 3F5BA 3N7ZA 1Y9KA 2GANA 4GS4A 4RI1A 4UFVA 4ZY2A 4IAVA 1S7LA 2J8RA 3IIBA 4NFRA 3S6FA 1Z8LA 1UFHA 1TKFA 3FRMA 3FXTA 4YFJA 4PK3A 4CPAA 1RTQA 3H4QA 4NGSA 4DYOA 1QMUA 5HH1A 1ON0A 4PSWA 2WSAA 3JRUA 3RNZA 2BSWA 2PJ4A 4L89A 1GHEA 1RO5A 4FD6A 4OP4A 1QSOA 4MFPA 5JH9A 4C7HA 2HC9A 1R57A 1WWZA 3B3TA 1TKHA 4H6UA 1XE4A 4MY0A 1ZO0A 1KZFA 3CPAA 3DR8A 4XNHB 2C6CA 2YNDA 3D67A 4C2ZA 3E0KA 5AG4A 4CYOA 1KWMA 4FUUA 2PRBA 4IUSA 1PCAA 4F0XA 4OC1A 5LYLA 2ARHA 4JLYA 1YLEA 1YLOA 4KZTA 6CPAA 1P4NA 5DWMA 2PC1A 4UEZA 1H8LA 3DLJA 5G1ZA 3W6XA 2GU2A 4AG9A 3NE8A 1J4JA 1QSMA 2C27A 4P4JA 4UCMA 2EK8A 2EK9A 4A31A 3WC5A 1ELLP 1B6BA 1Y0YA 4R8FA 4QVTA 5IB0A 4OADA 4UIBA 3ISZA 4UWJA 1CPSA 2RFHA 2CNTA 1IU8A 3FYNA 3K9TA 1XJOA 1NE9A 4XNHC 4YRHA 3S9MA 1F2OA 3B8GA 4AB7A 3RZAA 3VH9A 1XF8A 1YREA 2PJ0A 4UCPA 3P2FA 3UY5A 3SXNA 2QVPA 1FY7A 4KOSA 4MCSA 4NGTA 4E2AA 1M4DA 4KOUA 4CGOA 2JBJA 2PJ1A 2QMLA 2Z3KA 2Q04A 3HUVA 4KSAA 4P4IA 4R87A 3R9FA 2ZW4A 2WPXA 2AFOA 2G9DA 2VBQA 2V8HA 4P4FA 5H86A 3BJ8A 3BHXA 3IJ3A 3TO9A 2H5MA 2FL4A 2DEAA 4RN7A 3QNVA 4AXVA 4P4BA 2OR4A 2BCOA 2P0WA 1CX8A 2JEWA 1TIQA 3EO4A 2Z3PA 2FXFA 4NGRA 2PVWA 1R3NA 3IWWA 4JWPA 1LOKA 4KOYA 2D4PA 2O28A 4CAEA 5LRGA 1IGBA 4X5KA 2REEA 1OBRA 3PFOA 4GM5A 4PXBA 3FNCA 5CPAA 4ZX9A 4FBEA 3K2KA 4KVXA 3KKWA 3B3CA 3CPXA 2PJ9A 3BJ7A 4JD6A 3B2YA 2C1CA 1GYTA 2CY2A 4A33A 2CNSA 2HQYA 1EE3P 1KUYA 4OIDA 4IF5A 1CP6A 2WYRA 3FX6A 1A2ZA 4JXRA 2ZELA 2Q4YA 3H8GA 5EC4A 2DXQA 2GE3A 2ZENA 1Z2LA 3B3SA 3BI0A 3QAHA 2R98A 2VXKA 1Z4EA 3KHXA 1QQ9A 3GIUA 2PJBA 1NSLA 4AVBA 2POKA 1HDUA 3BLNA 5LYDA 1M4IA 4TWEA 3RBUA 3SI1A 3V7ZA 5F46A 2FCKA 4R7MA 3I3GA 4NJQA 2IJZA 3TE4A 2AJ6A 4ZI6A 1MJAA 2QYVA 2Q44A 2PJ8A 2PDOA 1NSAA 2ZEHA 1ELMP 3D7FA 4GXHA 2BEIA 2DPTA 3D7HA 3BXMA 3K9UA 4KUAA 4ZX8A 5EMIA 1QSTA 4R9MA 3H8EA 1PUAA 3SJFA 1YQEA 4KS9A 3LWUA 5KTCA 2JDDA 4OIWA 2CIJA 2Z3NA 5G21A 4Z65A 5JQ4A 2EO8A 2GREA 4KUBA 3H5ZA 4MBUA 5DWNA 4CAWA 5BWAB 4H6ZA 4G1PA 4CGNA 4FD7A 4B5PA 2KCWA 4KOXA 5F47A 3SJXA 4CAXA 5H84A 4AVAA 2JBKA 2PJ3A 1KUVA 2FT0A 3RAMA 4PSXA 3TCVA 1Z8WA 4ORFA 3B7IA 4A94A 2XEGA 4FAIA 5J8FA 5J1QA 2PE3A 3NFZA 4PQAA 3JVNA 3S6KA 2GLJA 2ZW5A 7CPAA 2QIRA 1ZLHA 5HMNA 4P6YA 3PBBA 2G3TA 4UF4A 1QSRA 5CBMA 3LODA 3PB8X 4ONUA 4B14A 1WK4A 2Q51A 4MFLA 2Q0YA 1Y7EA 1XFOA 5ISVA 4F9UA 3VARA 4X3RA 1LRZA 4A32A 2PJ6A 2P6EA 2NYQA 3IC1A 1LANA 4KSIA 5JGFA 3NH4A 2PQ8A 1I12A 2YGWA 4PXDA 4B6ZA 2QJ8A 4MXUA 4OC4A 1CPXA 4M85A 2ZEMA 4NGMA 4K30A 3D7DA 3EC4A 4CYNA 4M3SA 1ARMA 4AVCA 2GLFA 4CYPA 4YWYA 4OAEA 1S7KA 1TF8A 4KORA 4NEXA 3TFYA 1I21A 4CRYB 1M4GA 5AG6A 4AG7A 4U9ZA 2FVGA 4ONWA 3PFEA 5AGEA 4DUKA 4E0AA 3QAYA 4FD4A 3ISXA 3W6SA 2JLMA 4UEEA 1S3ZA 3B3VA 1S60A 2ZPAA 4BINA 2ZW6A 4P45A 1Y9WA 4CGPA 3KQZA 3FBUA 4UBRA 1TF9A 5HVGA 3NH8A 4MCPA 2G0BA 4OC3A 4BBHA 3CT9A 4A95A 3MGDA 2NSMA 2O4HA 3KR4A 2J8MA 3VATA 3WABA 1IB1E 2ZEEA 3GYAA 1VHSA 2HV2A 5F09A 2IMOA 2ABZA 2ZOGA 2BL1A 3D3SA 5EBVA 4K3NA 4M6IA 4MFJA 3DGVA 4B5PB 1YR0A 4FD5A 1YVOA 3FEEA 1MK4A 2ODFA 2P6GA 3FEDA 3SI2A 2OB0A 1KUXA 4I49A 3R96A 4MRIA 2ANPA 1BPNA 4M6GA 1M4LA 2OZGA 3SHPA 1JWQA 2B3UA 4UIAA 2ZEOA 4LX9A 5ELYA 2I79A 2B4BA 1Q2DA 4P44A 4IHMA 1BAVA 2YNEA 5JPHA 4C2XA 4UEFA 2FE7A 5IX3A 1IIDA 2CTBA 5A27A 5LYIA 5A28A 4MCQA 4PXEA 3D4UA 4UWIA 5K8NA 3CDXA 2Z3MA 4NJRA 3S6GA 4CGLA 3IO1A 3T9YA 3IGRA 2OU2A 4BD9A 1BOBA 4JZ0A 4B13A 2PCUA 5DS0A 2WZNA 4OKOA 4B11A 4ZGYB 2PIYA 4UFXA 3WR7A 4HNWB 2Q4VA 1RXTA 2VZZA 3EXNA 4PK2A 5D29A 2Q7SA 5FVJA 2PSWA 4YU9A 4Q7AA 3TOBA 2BO9A 2FIAA 3T8WA 1L0CA 4ZYQA 4E8OA 5IV0A 3JUWA 4WWVA 3FB3A 1FNOA 3JTKA 2B5GA 4QB9A 3FECA 4EMEA 3IEHA 5LRJA 4O23A 4F0YA 1IYKA 3KHZA 3KL9A 1XRYA 3PP9A 1Y0RA 2O53A 2PJ2A 3S9LA 4R57A 4LQ6A 2PR8A 5G22A 5AG5A 2AFSA 4OMEA 4X8IA 4ZBGA 4NF1A 1ZLIA 5JM6A 2C6GA 3WC7A 5HXDA 3T90A 3DR6A 4EFDA 1Z4RA 4Q38A 2WUUA 3KASA 4B12A 1YGHA 3G8WA 4NSQA 1XBUA 4U5YA 1IICA 4C7IA 3KGQA 1LCPA 2K5TA 2X7BA 3I9SA 1XIXA 2CNMA 2RC4A 1JQGA 4MHDA 2PRQA 2OH1A 3D7GA 5THWA 2DPSA 5I0CA 4KVME 3GY9A 1DE4C 2PJ5A 5F49A 1XMBA 2F7VA 2G3AA 4CYQA 3A9LA 3PB7X 2XEIA 3IWGA 4F6AA 5G20A 3EY5A 1VHEA 4NGQA 2GIVA 3DSBA 3FF3A 1MJBA 1TXRA 2PIZA 3IU2A 3NH5A 3PB9X 2VL1A 4HKFA 3SXOA 4MCRA 2J9AA 4PXCA 2VEZA 4CS0B 3C26A 2PJAA 3SI0A 2JDCA 1BPMA 3KR5A 4F9VA 1X12A 4MHPA 1YX0A 3F8KA 2AFZA 1Z5RA 2Q7BA 1TKJA 4MMOA 5IB9A 1Z9UA 1B87A 4MFKA 4R3KA 1ZG8A 2PR1A 3D8PA 3HLPA 4MY3A 3R9EA 3QB8A 4P4DA 2FS5A 4ZY0A 1Y7RA 3S9NA 3MN8A 4DNCA 2Z11A 2A4NA 4Q36A 4Y49B 3WC6A 4LUAA 4BMHA 4C2YA 4CAFA 1AYEA 2B5GB 2Z3LA 3LMSA 2B3VA 4OC5A 5I4MA 2B58A 4UFWA 1S7FA 1YW4A 4PPZA 1ZG9A 1P0HA 1VGYA 3R1KA 3PZJA 2J8NA 4QUSA 4MHYA 2BUEA 2R1IA 2XEFA 3V8IA 2F5IA 1CBXA 4YGOA 1M1DA 5C88A 2Z10A 2XEJA 3TO7A 3PBEA 1V0CA 2I00A 4MFQA 2VZYA 1ARLA 4NGNA 4L8AA 4JXQA 4M6HA 4A39A 1IY7A 1LAPA 3IWEA 4Y49C 2IL4A 2PJCA 4A2ZA 4OC0A 3WT4A 2OZHA 2VI7A 2VQYA 2ZEFA 5K8OA 3BI1A 4XPDB 3GUXA 3D68A 2HUZA 3MRUA 4KVOE 3B3WA 5CNPA 1VIXA 5K8MA 4X2TA 5AG7A 4WJBA 1I1DA 3TO6A 1PYTB 3LACA 4F8ZA 1YW6A 4HNXB 1BO4A 1ZG7A 2AFWA 4NGPA 4A30A 2HB6A 2OZUA 3FJUA 4R6TA 5HVHA 4II9A 3V38A 2REFA 2AE6A 2ZOFA 5K8PA 2IQ6A 3GLJA 5F48A 2ZXVA 1IOFA 2V8DA 3F0AA 3FMCA 3ZZIA 4KSFA 4HNYB 4C68A 4DJLA 2C6PA 2EVNA 3TOAA 1HDQA 2AFUA 1CP7A 1Z8TA 2P6FA 4EWTA 5LYFA 3H8FA 4RS2A 1MJ9A 4FWUA 2ZEDA 4IK2A 4XPDC 3SJEA 3D66A 3TX8A 8CPAA 2F8HA 3FIXA 3GKRA 2OOTA 4A38A 1FT7A 2Z0ZA 2R7HA 2Z3OA 3DNSA 2BOAA 4OLLA 1UWYA 3CZXA 2YNCC 3PEIA 2CTCA 2V77A 3CXSA 3P2HA 4MFZA 4TNUA 3SJGA 2B4DA 3NE7A 4P4EA 5GCNA 2Q4ZA 3D2MA 3IU1A 3VWDA 2ZW7A 5D8NA 4XPLA 4KOTA 1VHOA 2I3CA 1R43A 1U6MA 1S7NA 4XPKA 5KTAA 1F57A 1M44A 3KI9A 2R8VA 3FVLA 3PGPA 3G3SA 4B10A 4MHZA 1IOIA 1AMPA 5C82A 3B35A 1OZPA 3RYOA 3PB6X 2D4OA 3GB0A 3RO0A 4B5OA 4CAVA 3KZWA 4OC2A 4QBJA 3TTHA 1Q2CA 4KOWA 3I1UA 5J8CA 4MHNA 2FIWA 1YMEA 2DF5A 3ZJ0A 3DDDA 3NA6A 3LD2A 4A37A 2WPWA 3IFEA 4CGMA 4MI4A 4U9YA 1Q2YA 3CXPA 4QC6A 4KLVA 2AFXA 3W91A 1CG2A 1LFWA 4R3LA 1CJWA 1Z8XA 3PB4X 1S5KA 4HPSA 4MJ8A 4CRZB 4H89A 1XEBA 4LQGA 3N5FA 4J3GA 4PV6A 2ZEGA 3R95A 2NMTA 3CXQA 2AFMA 3PRTA 2PJ7A 4KLWA 4JYWA 1XMTA 2YNCA 2EBJA 4UA3A 2ZEPA 4KOVA 3KQXA 2RB7A 1LAMA 3TT2A 2CF4A 2Y0MA 1YVKA
chains in the Genus database with same CATH topology
1CM0A 4NCZA 1K4JA 5KTDA 4UCNA 2JEVA 1IYLA 2FSRA 2EUIA 5E96A 4NXYA 1SQHA 3OWCA 1QSNA 3R9GA 2CXAA 3D2PA 2QECA 1PU9A 1NMTA 2B4DB 3VWEA 4EVYA 1N71A 2ATRA 1VKCA 4JJXA 3S6HA 1YK3A 3EFAA 3F5BA 3N7ZA 1Y9KA 2GANA 4GS4A 4RI1A 4UFVA 1S7LA 2J8RA 3S6FA 1UFHA 3FXTA 3FRMA 4YFJA 4PK3A 3H4QA 5HH1A 1ON0A 4PSWA 2WSAA 2BSWA 4L89A 1GHEA 1RO5A 4FD6A 1QSOA 4MFPA 4C7HA 1R57A 1WWZA 4H6UA 1XE4A 4MY0A 1ZO0A 1KZFA 3DR8A 4XNHB 2YNDA 4C2ZA 3E0KA 5AG4A 4CYOA 2PRBA 4IUSA 4F0XA 2ARHA 4JLYA 1YLEA 4KZTA 1P4NA 5DWMA 2PC1A 5G1ZA 3W6XA 4AG9A 1J4JA 1QSMA 2C27A 4UCMA 4A31A 1B6BA 4QVTA 5IB0A 4OADA 4UWJA 3FYNA 2CNTA 4YRHA 3TO9A 1NE9A 4XNHC 3B8GA 4AB7A 1XF8A 1YREA 4UCPA 3P2FA 3UY5A 3SXNA 1FY7A 4KOSA 4E2AA 1M4DA 4KOUA 4CGOA 2QMLA 2Z3KA 4KSAA 3R9FA 2Q04A 4R87A 3SHPA 2ZW4A 2WPXA 2VBQA 5H86A 3BJ8A 2H5MA 2FL4A 2P0WA 1TIQA 3EO4A 2Z3PA 2FXFA 4JWPA 4KOYA 2D4PA 2O28A 4CAEA 4X5KA 2REEA 3FNCA 4KVXA 3KKWA 4JD6A 3BJ7A 4A33A 2CY2A 2CNSA 2HQYA 1KUYA 4IF5A 4JXRA 2Q4YA 5EC4A 2DXQA 2GE3A 3QAHA 2R98A 2VXKA 1Z4EA 1NSLA 4AVBA 3BLNA 5F46A 1M4IA 2FCKA 3I3GA 3TE4A 2AJ6A 1MJAA 2Q44A 2PDOA 2BEIA 2DPTA 3K9UA 4KUAA 1QSTA 4R9MA 1PUAA 4KS9A 5KTCA 2JDDA 2Z3NA 5G21A 5JQ4A 4KUBA 4CAWA 3H5ZA 4MBUA 5DWNA 5BWAB 4H6ZA 4CGNA 4FD7A 4B5PA 2KCWA 4KOXA 5F47A 4CAXA 5H84A 4AVAA 1KUVA 2FT0A 4PSXA 3TCVA 4ORFA 5J8FA 3S6KA 3JVNA 2ZW5A 2QIRA 5HMNA 2G3TA 1QSRA 3LODA 4ONUA 4B14A 1WK4A 4MFLA 2Q0YA 5ISVA 1LRZA 4A32A 2P6EA 2PQ8A 1I12A 2YGWA 4M85A 4K30A 3EC4A 4CYNA 4M3SA 4CYPA 4AVCA 4OAEA 1S7KA 4NEXA 4KORA 3TFYA 1I21A 4CRYB 1M4GA 5AG6A 4AG7A 4U9ZA 5AGEA 4E0AA 4FD4A 3W6SA 2JLMA 1S3ZA 1S60A 2ZPAA 2ZW6A 1Y9WA 4CGPA 3FBUA 4UBRA 2G0BA 4BBHA 4A95A 3MGDA 2J8MA 1IB1E 3GYAA 1VHSA 2HV2A 2BL1A 3D3SA 5EBVA 4MFJA 4B5PB 1YR0A 4FD5A 1YVOA 1MK4A 2P6GA 2OB0A 1KUXA 4I49A 3R96A 2OZGA 2B3UA 4LX9A 2I79A 2B4BA 1Q2DA 2YNEA 5JPHA 4C2XA 2FE7A 5IX3A 1IIDA 5A27A 5A28A 4UWIA 2Z3MA 3S6GA 4CGLA 3T9YA 3IGRA 2OU2A 1BOBA 4B13A 4B11A 4ZGYB 4UFXA 3WR7A 4HNWB 2Q4VA 1RXTA 2VZZA 3EXNA 4PK2A 5FVJA 2PSWA 3TOBA 2FIAA 1L0CA 4E8OA 5IV0A 3JUWA 3FB3A 3JTKA 2B5GA 4QB9A 4F0YA 1IYKA 3PP9A 4R57A 2PR8A 5G22A 5AG5A 4ZBGA 4NF1A 3T90A 3DR6A 1Z4RA 4Q38A 2WUUA 4B12A 1YGHA 3G8WA 4NSQA 4U5YA 4C7IA 1IICA 2K5TA 2X7BA 3I9SA 1XIXA 2CNMA 2RC4A 4MHDA 2OH1A 2DPSA 5I0CA 4KVME 3GY9A 5F49A 2G3AA 4CYQA 3A9LA 3IWGA 4F6AA 5G20A 3EY5A 2GIVA 3DSBA 3IU2A 1MJBA 4HKFA 3SXOA 2VEZA 4CS0B 3C26A 2JDCA 1YX0A 3F8KA 2Q7BA 1Z9UA 1B87A 4MFKA 4R3KA 2PR1A 3D8PA 4MY3A 3R9EA 3QB8A 2FS5A 1Y7RA 4DNCA 2Z11A 2A4NA 4Q36A 4Y49B 4BMHA 4LUAA 4C2YA 4CAFA 2B5GB 2Z3LA 2B3VA 2B58A 4UFWA 1S7FA 1P0HA 3R1KA 3PZJA 2J8NA 4QUSA 2BUEA 2R1IA 3V8IA 2F5IA 4YGOA 1M1DA 5C88A 2Z10A 3TO7A 1V0CA 2I00A 4MFQA 2VZYA 4L8AA 4JXQA 4Y49C 3IWEA 2IL4A 4A2ZA 2OZHA 2VI7A 2VQYA 4XPDB 2HUZA 4KVOE 5CNPA 5AG7A 3TO6A 1I1DA 4HNXB 1BO4A 4A30A 4II9A 2OZUA 2REFA 2AE6A 5F48A 2ZXVA 3F0AA 3ZZIA 4KSFA 4HNYB 4C68A 2EVNA 3TOAA 2P6FA 4RS2A 1MJ9A 4XPDC 3FIXA 3GKRA 2Z0ZA 2R7HA 2Z3OA 3DNSA 4OLLA 2YNCC 4MFZA 3CXSA 3P2HA 2B4DA 3NE7A 5GCNA 3D2MA 3IU1A 3VWDA 2ZW7A 4XPLA 4KOTA 1U6MA 1S7NA 4XPKA 5KTAA 1M44A 3PGPA 2R8VA 3G3SA 4B10A 5C82A 1OZPA 3RYOA 4B5OA 2D4OA 4CAVA 4QBJA 3TTHA 1Q2CA 4KOWA 5J8CA 2FIWA 3ZJ0A 3DDDA 3LD2A 2WPWA 4CGMA 4MI4A 4U9YA 1Q2YA 3CXPA 4QC6A 4KLVA 3W91A 4R3LA 1CJWA 1S5KA 4MJ8A 4CRZB 4H89A 1XEBA 4J3GA 4PV6A 3R95A 2NMTA 3CXQA 4KLWA 1XMTA 2YNCA 4UA3A 4KOVA 3TT2A 2Y0MA 1YVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CM0 A;  4NCZ A;  1K4J A;  5KTD A;  2JEV A;  1IYL A;  2FSR A;  2EUI A;  5E96 A;  4NXY A;  1SQH A;  3OWC A;  1QSN A;  3R9G A;  3D2P A;  2QEC A;  1PU9 A;  1NMT A;  2B4D B;  3VWE A;  4EVY A;  1N71 A;  2ATR A;  1VKC A;  4JJX A;  3S6H A;  1YK3 A;  3EFA A;  3F5B A;  3N7Z A;  1Y9K A;  2GAN A;  4GS4 A;  4RI1 A;  1S7L A;  2J8R A;  3S6F A;  1UFH A;  3FXT A;  3FRM A;  4YFJ A;  4PK3 A;  3H4Q A;  5HH1 A;  1ON0 A;  4PSW A;  2BSW A;  4L89 A;  1GHE A;  1RO5 A;  4FD6 A;  1QSO A;  1R57 A;  1WWZ A;  4H6U A;  1XE4 A;  4MY0 A;  1KZF A;  3DR8 A;  4XNH B;  3E0K A;  2PRB A;  4IUS A;  2ARH A;  4JLY A;  1YLE A;  4KZT A;  1P4N A;  5DWM A;  2PC1 A;  3W6X A;  4AG9 A;  1J4J A;  1QSM A;  2C27 A;  1B6B A;  4QVT A;  5IB0 A;  4OAD A;  4UWJ A;  3FYN A;  2CNT A;  4YRH A;  3TO9 A;  1NE9 A;  4XNH C;  3B8G A;  4AB7 A;  1XF8 A;  1YRE A;  3P2F A;  3UY5 A;  3SXN A;  1FY7 A;  4KOS A;  4E2A A;  1M4D A;  4KOU A;  2QML A;  3R9F A;  2Q04 A;  4R87 A;  3SHP A;  2ZW4 A;  2WPX A;  2VBQ A;  5H86 A;  3BJ8 A;  2H5M A;  2FL4 A;  2P0W A;  1TIQ A;  3EO4 A;  2FXF A;  4JWP A;  4KOY A;  2D4P A;  2O28 A;  4X5K A;  2REE A;  3FNC A;  4KVX A;  3KKW A;  4JD6 A;  3BJ7 A;  2CY2 A;  2CNS A;  2HQY A;  1KUY A;  4IF5 A;  4JXR A;  2Q4Y A;  5EC4 A;  2DXQ A;  2GE3 A;  3QAH A;  2R98 A;  2VXK A;  1Z4E A;  1NSL A;  4AVB A;  3BLN A;  5F46 A;  1M4I A;  2FCK A;  3I3G A;  3TE4 A;  2AJ6 A;  1MJA A;  2Q44 A;  2PDO A;  2BEI A;  3K9U A;  4KUA A;  1QST A;  4R9M A;  1PUA A;  5KTC A;  2JDD A;  5JQ4 A;  4KUB A;  4CAW A;  4MBU A;  5DWN A;  4H6Z A;  4FD7 A;  4B5P A;  2KCW A;  4KOX A;  5F47 A;  4CAX A;  5H84 A;  4AVA A;  1KUV A;  2FT0 A;  4PSX A;  3TCV A;  4ORF A;  5J8F A;  3S6K A;  3JVN A;  2ZW5 A;  2QIR A;  5HMN A;  2G3T A;  1QSR A;  3LOD A;  4ONU A;  1WK4 A;  2Q0Y A;  5ISV A;  1LRZ A;  2P6E A;  2PQ8 A;  1I12 A;  4M85 A;  4K30 A;  3EC4 A;  4M3S A;  4AVC A;  4OAE A;  1S7K A;  4NEX A;  4KOR A;  3TFY A;  1I21 A;  4CRY B;  1M4G A;  4AG7 A;  4U9Z A;  4E0A A;  4FD4 A;  3W6S A;  2JLM A;  1S3Z A;  1S60 A;  2ZPA A;  2ZW6 A;  1Y9W A;  3FBU A;  4UBR A;  2G0B A;  3MGD A;  2J8M A;  1IB1 E;  3GYA A;  1VHS A;  2HV2 A;  2BL1 A;  3D3S A;  5EBV A;  4B5P B;  1YR0 A;  4FD5 A;  1YVO A;  1MK4 A;  2P6G A;  2OB0 A;  1KUX A;  4I49 A;  3R96 A;  2OZG A;  2B3U A;  4LX9 A;  2I79 A;  2B4B A;  1Q2D A;  5JPH A;  2FE7 A;  5IX3 A;  1IID A;  4UWI A;  3S6G A;  3T9Y A;  3IGR A;  2OU2 A;  1BOB A;  3WR7 A;  4HNW B;  2Q4V A;  1RXT A;  2VZZ A;  3EXN A;  4PK2 A;  5FVJ A;  2PSW A;  3TOB A;  2FIA A;  1L0C A;  4E8O A;  5IV0 A;  3JUW A;  3FB3 A;  4QB9 A;  2B5G A;  4F0Y A;  1IYK A;  3PP9 A;  4R57 A;  2PR8 A;  4ZBG A;  4NF1 A;  3T90 A;  3DR6 A;  1Z4R A;  1YGH A;  3G8W A;  4NSQ A;  4U5Y A;  1IIC A;  2K5T A;  2X7B A;  3I9S A;  1XIX A;  2CNM A;  2RC4 A;  4MHD A;  2OH1 A;  5I0C A;  4KVM E;  3GY9 A;  5F49 A;  2G3A A;  3IWG A;  4F6A A;  3EY5 A;  2GIV A;  3DSB A;  1MJB A;  4HKF A;  3SXO A;  2VEZ A;  4CS0 B;  3C26 A;  2JDC A;  1YX0 A;  3F8K A;  2Q7B A;  1Z9U A;  1B87 A;  4R3K A;  2PR1 A;  3D8P A;  4MY3 A;  3R9E A;  3QB8 A;  2FS5 A;  1Y7R A;  4DNC A;  2Z11 A;  2A4N A;  4Y49 B;  4BMH A;  4LUA A;  2B5G B;  2B3V A;  2B58 A;  1S7F A;  1P0H A;  3R1K A;  3PZJ A;  2J8N A;  4QUS A;  2BUE A;  2R1I A;  3V8I A;  2F5I A;  4YGO A;  1M1D A;  5C88 A;  2Z10 A;  3TO7 A;  1V0C A;  2I00 A;  2VZY A;  4L8A A;  4JXQ A;  4Y49 C;  2IL4 A;  2OZH A;  2VI7 A;  2VQY A;  4XPD B;  2HUZ A;  4KVO E;  5CNP A;  3TO6 A;  1I1D A;  4HNX B;  1BO4 A;  4II9 A;  2OZU A;  2REF A;  2AE6 A;  5F48 A;  2ZXV A;  3F0A A;  3ZZI A;  4HNY B;  2EVN A;  3TOA A;  2P6F A;  4RS2 A;  1MJ9 A;  4XPD C;  3FIX A;  3GKR A;  2Z0Z A;  2R7H A;  3DNS A;  4OLL A;  3CXS A;  3P2H A;  2B4D A;  3NE7 A;  5GCN A;  3D2M A;  3VWD A;  2ZW7 A;  4XPL A;  4KOT A;  1U6M A;  1S7N A;  4XPK A;  5KTA A;  1M44 A;  3PGP A;  2R8V A;  3G3S A;  5C82 A;  1OZP A;  3RYO A;  4B5O A;  2D4O A;  4CAV A;  4QBJ A;  3TTH A;  1Q2C A;  4KOW A;  5J8C A;  2FIW A;  3ZJ0 A;  3DDD A;  3LD2 A;  2WPW A;  4MI4 A;  4U9Y A;  1Q2Y A;  3CXP A;  4QC6 A;  4KLV A;  3W91 A;  4R3L A;  1CJW A;  1S5K A;  4MJ8 A;  4CRZ B;  4H89 A;  1XEB A;  4J3G A;  4PV6 A;  3R95 A;  2NMT A;  3CXQ A;  4KLW A;  1XMT A;  4UA3 A;  4KOV A;  3TT2 A;  2Y0M A;  1YVK A; 
#chains in the Genus database with same CATH topology
 1CM0 A;  1DTD A;  1F2P A;  1K4J A;  4NCZ A;  5KTD A;  4UCN A;  5LRK A;  2JEV A;  1IYL A;  2FSR A;  2EUI A;  4R76 A;  4W9Y A;  5E96 A;  3TC8 A;  4NXY A;  2V8V A;  1SQH A;  3OWC A;  4RUH A;  1X10 A;  1QSN A;  1Q7L A;  3R9G A;  1AUG A;  2CXA A;  3D2P A;  2QEC A;  1PU9 A;  1NMT A;  2V8G A;  1YSJ A;  2B4D B;  3VWE A;  4EVY A;  4ZY1 A;  4P10 A;  1BLL E;  2Q43 A;  2EWB A;  3L2N A;  2GFQ A;  2PVV A;  1N71 A;  2ATR A;  1VKC A;  3FH4 A;  4JJX A;  1XOV A;  3S6H A;  4H2K A;  1YK3 A;  1HEE A;  5HVF A;  3EFA A;  3F5B A;  3N7Z A;  1Y9K A;  2GAN A;  4GS4 A;  4RI1 A;  4UFV A;  4ZY2 A;  4IAV A;  1S7L A;  2J8R A;  3IIB A;  4NFR A;  3S6F A;  1Z8L A;  1UFH A;  1TKF A;  3FRM A;  3FXT A;  4YFJ A;  4PK3 A;  4CPA A;  1RTQ A;  3H4Q A;  4NGS A;  4DYO A;  1QMU A;  5HH1 A;  1ON0 A;  4PSW A;  2WSA A;  3JRU A;  3RNZ A;  2BSW A;  2PJ4 A;  4L89 A;  1GHE A;  1RO5 A;  4FD6 A;  4OP4 A;  1QSO A;  4MFP A;  5JH9 A;  4C7H A;  2HC9 A;  1R57 A;  1WWZ A;  3B3T A;  1TKH A;  4H6U A;  1XE4 A;  4MY0 A;  1ZO0 A;  1KZF A;  3CPA A;  3DR8 A;  4XNH B;  2C6C A;  2YND A;  3D67 A;  4C2Z A;  3E0K A;  5AG4 A;  4CYO A;  1KWM A;  4FUU A;  2PRB A;  4IUS A;  1PCA A;  4F0X A;  4OC1 A;  5LYL A;  2ARH A;  4JLY A;  1YLE A;  1YLO A;  4KZT A;  6CPA A;  1P4N A;  5DWM A;  2PC1 A;  4UEZ A;  1H8L A;  3DLJ A;  5G1Z A;  3W6X A;  2GU2 A;  4AG9 A;  3NE8 A;  1J4J A;  1QSM A;  2C27 A;  4P4J A;  4UCM A;  2EK8 A;  2EK9 A;  4A31 A;  3WC5 A;  1ELL P;  1B6B A;  1Y0Y A;  4R8F A;  4QVT A;  5IB0 A;  4OAD A;  4UIB A;  3ISZ A;  4UWJ A;  1CPS A;  2RFH A;  2CNT A;  1IU8 A;  3FYN A;  3K9T A;  1XJO A;  1NE9 A;  4XNH C;  4YRH A;  3S9M A;  1F2O A;  3B8G A;  4AB7 A;  3RZA A;  3VH9 A;  1XF8 A;  1YRE A;  2PJ0 A;  4UCP A;  3P2F A;  3UY5 A;  3SXN A;  2QVP A;  1FY7 A;  4KOS A;  4MCS A;  4NGT A;  4E2A A;  1M4D A;  4KOU A;  4CGO A;  2JBJ A;  2PJ1 A;  2QML A;  2Z3K A;  2Q04 A;  3HUV A;  4KSA A;  4P4I A;  4R87 A;  3R9F A;  2ZW4 A;  2WPX A;  2AFO A;  2G9D A;  2VBQ A;  2V8H A;  4P4F A;  5H86 A;  3BJ8 A;  3BHX A;  3IJ3 A;  3TO9 A;  2H5M A;  2FL4 A;  2DEA A;  4RN7 A;  3QNV A;  4AXV A;  4P4B A;  2OR4 A;  2BCO A;  2P0W A;  1CX8 A;  2JEW A;  1TIQ A;  3EO4 A;  2Z3P A;  2FXF A;  4NGR A;  2PVW A;  1R3N A;  3IWW A;  4JWP A;  1LOK A;  4KOY A;  2D4P A;  2O28 A;  4CAE A;  5LRG A;  1IGB A;  4X5K A;  2REE A;  1OBR A;  3PFO A;  4GM5 A;  4PXB A;  3FNC A;  5CPA A;  4ZX9 A;  4FBE A;  3K2K A;  4KVX A;  3KKW A;  3B3C A;  3CPX A;  2PJ9 A;  3BJ7 A;  4JD6 A;  3B2Y A;  2C1C A;  1GYT A;  2CY2 A;  4A33 A;  2CNS A;  2HQY A;  1EE3 P;  1KUY A;  4OID A;  4IF5 A;  1CP6 A;  2WYR A;  3FX6 A;  1A2Z A;  4JXR A;  2ZEL A;  2Q4Y A;  3H8G A;  5EC4 A;  2DXQ A;  2GE3 A;  2ZEN A;  1Z2L A;  3B3S A;  3BI0 A;  3QAH A;  2R98 A;  2VXK A;  1Z4E A;  3KHX A;  1QQ9 A;  3GIU A;  2PJB A;  1NSL A;  4AVB A;  2POK A;  1HDU A;  3BLN A;  5LYD A;  1M4I A;  4TWE A;  3RBU A;  3SI1 A;  3V7Z A;  5F46 A;  2FCK A;  4R7M A;  3I3G A;  4NJQ A;  2IJZ A;  3TE4 A;  2AJ6 A;  4ZI6 A;  1MJA A;  2QYV A;  2Q44 A;  2PJ8 A;  2PDO A;  1NSA A;  2ZEH A;  1ELM P;  3D7F A;  4GXH A;  2BEI A;  2DPT A;  3D7H A;  3BXM A;  3K9U A;  4KUA A;  4ZX8 A;  5EMI A;  1QST A;  4R9M A;  3H8E A;  1PUA A;  3SJF A;  1YQE A;  4KS9 A;  3LWU A;  5KTC A;  2JDD A;  4OIW A;  2CIJ A;  2Z3N A;  5G21 A;  4Z65 A;  5JQ4 A;  2EO8 A;  2GRE A;  4KUB A;  3H5Z A;  4MBU A;  5DWN A;  4CAW A;  5BWA B;  4H6Z A;  4G1P A;  4CGN A;  4FD7 A;  4B5P A;  2KCW A;  4KOX A;  5F47 A;  3SJX A;  4CAX A;  5H84 A;  4AVA A;  2JBK A;  2PJ3 A;  1KUV A;  2FT0 A;  3RAM A;  4PSX A;  3TCV A;  1Z8W A;  4ORF A;  3B7I A;  4A94 A;  2XEG A;  4FAI A;  5J8F A;  5J1Q A;  2PE3 A;  3NFZ A;  4PQA A;  3JVN A;  3S6K A;  2GLJ A;  2ZW5 A;  7CPA A;  2QIR A;  1ZLH A;  5HMN A;  4P6Y A;  3PBB A;  2G3T A;  4UF4 A;  1QSR A;  5CBM A;  3LOD A;  3PB8 X;  4ONU A;  4B14 A;  1WK4 A;  2Q51 A;  4MFL A;  2Q0Y A;  1Y7E A;  1XFO A;  5ISV A;  4F9U A;  3VAR A;  4X3R A;  1LRZ A;  4A32 A;  2PJ6 A;  2P6E A;  2NYQ A;  3IC1 A;  1LAN A;  4KSI A;  5JGF A;  3NH4 A;  2PQ8 A;  1I12 A;  2YGW A;  4PXD A;  4B6Z A;  2QJ8 A;  4MXU A;  4OC4 A;  1CPX A;  4M85 A;  2ZEM A;  4NGM A;  4K30 A;  3D7D A;  3EC4 A;  4CYN A;  4M3S A;  1ARM A;  4AVC A;  2GLF A;  4CYP A;  4YWY A;  4OAE A;  1S7K A;  1TF8 A;  4KOR A;  4NEX A;  3TFY A;  1I21 A;  4CRY B;  1M4G A;  5AG6 A;  4AG7 A;  4U9Z A;  2FVG A;  4ONW A;  3PFE A;  5AGE A;  4DUK A;  4E0A A;  3QAY A;  4FD4 A;  3ISX A;  3W6S A;  2JLM A;  4UEE A;  1S3Z A;  3B3V A;  1S60 A;  2ZPA A;  4BIN A;  2ZW6 A;  4P45 A;  1Y9W A;  4CGP A;  3KQZ A;  3FBU A;  4UBR A;  1TF9 A;  5HVG A;  3NH8 A;  4MCP A;  2G0B A;  4OC3 A;  4BBH A;  3CT9 A;  4A95 A;  3MGD A;  2NSM A;  2O4H A;  3KR4 A;  2J8M A;  3VAT A;  3WAB A;  1IB1 E;  2ZEE A;  3GYA A;  1VHS A;  2HV2 A;  5F09 A;  2IMO A;  2ABZ A;  2ZOG A;  2BL1 A;  3D3S A;  5EBV A;  4K3N A;  4M6I A;  4MFJ A;  3DGV A;  4B5P B;  1YR0 A;  4FD5 A;  1YVO A;  3FEE A;  1MK4 A;  2ODF A;  2P6G A;  3FED A;  3SI2 A;  2OB0 A;  1KUX A;  4I49 A;  3R96 A;  4MRI A;  2ANP A;  1BPN A;  4M6G A;  1M4L A;  2OZG A;  3SHP A;  1JWQ A;  2B3U A;  4UIA A;  2ZEO A;  4LX9 A;  5ELY A;  2I79 A;  2B4B A;  1Q2D A;  4P44 A;  4IHM A;  1BAV A;  2YNE A;  5JPH A;  4C2X A;  4UEF A;  2FE7 A;  5IX3 A;  1IID A;  2CTB A;  5A27 A;  5LYI A;  5A28 A;  4MCQ A;  4PXE A;  3D4U A;  4UWI A;  5K8N A;  3CDX A;  2Z3M A;  4NJR A;  3S6G A;  4CGL A;  3IO1 A;  3T9Y A;  3IGR A;  2OU2 A;  4BD9 A;  1BOB A;  4JZ0 A;  4B13 A;  2PCU A;  5DS0 A;  2WZN A;  4OKO A;  4B11 A;  4ZGY B;  2PIY A;  4UFX A;  3WR7 A;  4HNW B;  2Q4V A;  1RXT A;  2VZZ A;  3EXN A;  4PK2 A;  5D29 A;  2Q7S A;  5FVJ A;  2PSW A;  4YU9 A;  4Q7A A;  3TOB A;  2BO9 A;  2FIA A;  3T8W A;  1L0C A;  4ZYQ A;  4E8O A;  5IV0 A;  3JUW A;  4WWV A;  3FB3 A;  1FNO A;  3JTK A;  2B5G A;  4QB9 A;  3FEC A;  4EME A;  3IEH A;  5LRJ A;  4O23 A;  4F0Y A;  1IYK A;  3KHZ A;  3KL9 A;  1XRY A;  3PP9 A;  1Y0R A;  2O53 A;  2PJ2 A;  3S9L A;  4R57 A;  4LQ6 A;  2PR8 A;  5G22 A;  5AG5 A;  2AFS A;  4OME A;  4X8I A;  4ZBG A;  4NF1 A;  1ZLI A;  5JM6 A;  2C6G A;  3WC7 A;  5HXD A;  3T90 A;  3DR6 A;  4EFD A;  1Z4R A;  4Q38 A;  2WUU A;  3KAS A;  4B12 A;  1YGH A;  3G8W A;  4NSQ A;  1XBU A;  4U5Y A;  1IIC A;  4C7I A;  3KGQ A;  1LCP A;  2K5T A;  2X7B A;  3I9S A;  1XIX A;  2CNM A;  2RC4 A;  1JQG A;  4MHD A;  2PRQ A;  2OH1 A;  3D7G A;  5THW A;  2DPS A;  5I0C A;  4KVM E;  3GY9 A;  1DE4 C;  2PJ5 A;  5F49 A;  1XMB A;  2F7V A;  2G3A A;  4CYQ A;  3A9L A;  3PB7 X;  2XEI A;  3IWG A;  4F6A A;  5G20 A;  3EY5 A;  1VHE A;  4NGQ A;  2GIV A;  3DSB A;  3FF3 A;  1MJB A;  1TXR A;  2PIZ A;  3IU2 A;  3NH5 A;  3PB9 X;  2VL1 A;  4HKF A;  3SXO A;  4MCR A;  2J9A A;  4PXC A;  2VEZ A;  4CS0 B;  3C26 A;  2PJA A;  3SI0 A;  2JDC A;  1BPM A;  3KR5 A;  4F9V A;  1X12 A;  4MHP A;  1YX0 A;  3F8K A;  2AFZ A;  1Z5R A;  2Q7B A;  1TKJ A;  4MMO A;  5IB9 A;  1Z9U A;  1B87 A;  4MFK A;  4R3K A;  1ZG8 A;  2PR1 A;  3D8P A;  3HLP A;  4MY3 A;  3R9E A;  3QB8 A;  4P4D A;  2FS5 A;  4ZY0 A;  1Y7R A;  3S9N A;  3MN8 A;  4DNC A;  2Z11 A;  2A4N A;  4Q36 A;  4Y49 B;  3WC6 A;  4LUA A;  4BMH A;  4C2Y A;  4CAF A;  1AYE A;  2B5G B;  2Z3L A;  3LMS A;  2B3V A;  4OC5 A;  5I4M A;  2B58 A;  4UFW A;  1S7F A;  1YW4 A;  4PPZ A;  1ZG9 A;  1P0H A;  1VGY A;  3R1K A;  3PZJ A;  2J8N A;  4QUS A;  4MHY A;  2BUE A;  2R1I A;  2XEF A;  3V8I A;  2F5I A;  1CBX A;  4YGO A;  1M1D A;  5C88 A;  2Z10 A;  2XEJ A;  3TO7 A;  3PBE A;  1V0C A;  2I00 A;  4MFQ A;  2VZY A;  1ARL A;  4NGN A;  4L8A A;  4JXQ A;  4M6H A;  4A39 A;  1IY7 A;  1LAP A;  3IWE A;  4Y49 C;  2IL4 A;  2PJC A;  4A2Z A;  4OC0 A;  3WT4 A;  2OZH A;  2VI7 A;  2VQY A;  2ZEF A;  5K8O A;  3BI1 A;  4XPD B;  3GUX A;  3D68 A;  2HUZ A;  3MRU A;  4KVO E;  3B3W A;  5CNP A;  1VIX A;  5K8M A;  4X2T A;  5AG7 A;  4WJB A;  1I1D A;  3TO6 A;  1PYT B;  3LAC A;  4F8Z A;  1YW6 A;  4HNX B;  1BO4 A;  1ZG7 A;  2AFW A;  4NGP A;  4A30 A;  2HB6 A;  2OZU A;  3FJU A;  4R6T A;  5HVH A;  4II9 A;  3V38 A;  2REF A;  2AE6 A;  2ZOF A;  5K8P A;  2IQ6 A;  3GLJ A;  5F48 A;  2ZXV A;  1IOF A;  2V8D A;  3F0A A;  3FMC A;  3ZZI A;  4KSF A;  4HNY B;  4C68 A;  4DJL A;  2C6P A;  2EVN A;  3TOA A;  1HDQ A;  2AFU A;  1CP7 A;  1Z8T A;  2P6F A;  4EWT A;  5LYF A;  3H8F A;  4RS2 A;  1MJ9 A;  4FWU A;  2ZED A;  4IK2 A;  4XPD C;  3SJE A;  3D66 A;  3TX8 A;  8CPA A;  2F8H A;  3FIX A;  3GKR A;  2OOT A;  4A38 A;  1FT7 A;  2Z0Z A;  2R7H A;  2Z3O A;  3DNS A;  2BOA A;  4OLL A;  1UWY A;  3CZX A;  2YNC C;  3PEI A;  2CTC A;  2V77 A;  3CXS A;  3P2H A;  4MFZ A;  4TNU A;  3SJG A;  2B4D A;  3NE7 A;  4P4E A;  5GCN A;  2Q4Z A;  3D2M A;  3IU1 A;  3VWD A;  2ZW7 A;  5D8N A;  4XPL A;  4KOT A;  1VHO A;  2I3C A;  1R43 A;  1U6M A;  1S7N A;  4XPK A;  5KTA A;  1F57 A;  1M44 A;  3KI9 A;  2R8V A;  3FVL A;  3PGP A;  3G3S A;  4B10 A;  4MHZ A;  1IOI A;  1AMP A;  5C82 A;  3B35 A;  1OZP A;  3RYO A;  3PB6 X;  2D4O A;  3GB0 A;  3RO0 A;  4B5O A;  4CAV A;  3KZW A;  4OC2 A;  4QBJ A;  3TTH A;  1Q2C A;  4KOW A;  3I1U A;  5J8C A;  4MHN A;  2FIW A;  1YME A;  2DF5 A;  3ZJ0 A;  3DDD A;  3NA6 A;  3LD2 A;  4A37 A;  2WPW A;  3IFE A;  4CGM A;  4MI4 A;  4U9Y A;  1Q2Y A;  3CXP A;  4QC6 A;  4KLV A;  2AFX A;  3W91 A;  1CG2 A;  1LFW A;  4R3L A;  1CJW A;  1Z8X A;  3PB4 X;  1S5K A;  4HPS A;  4MJ8 A;  4CRZ B;  4H89 A;  1XEB A;  4LQG A;  3N5F A;  4J3G A;  4PV6 A;  2ZEG A;  3R95 A;  2NMT A;  3CXQ A;  2AFM A;  3PRT A;  2PJ7 A;  4KLW A;  4JYW A;  1XMT A;  2YNC A;  2EBJ A;  4UA3 A;  2ZEP A;  4KOV A;  3KQX A;  2RB7 A;  1LAM A;  3TT2 A;  2CF4 A;  2Y0M A;  1YVK A; 
#chains in the Genus database with same CATH homology
 1CM0 A;  4NCZ A;  1K4J A;  5KTD A;  4UCN A;  2JEV A;  1IYL A;  2FSR A;  2EUI A;  5E96 A;  4NXY A;  1SQH A;  3OWC A;  1QSN A;  3R9G A;  2CXA A;  3D2P A;  2QEC A;  1PU9 A;  1NMT A;  2B4D B;  3VWE A;  4EVY A;  1N71 A;  2ATR A;  1VKC A;  4JJX A;  3S6H A;  1YK3 A;  3EFA A;  3F5B A;  3N7Z A;  1Y9K A;  2GAN A;  4GS4 A;  4RI1 A;  4UFV A;  1S7L A;  2J8R A;  3S6F A;  1UFH A;  3FXT A;  3FRM A;  4YFJ A;  4PK3 A;  3H4Q A;  5HH1 A;  1ON0 A;  4PSW A;  2WSA A;  2BSW A;  4L89 A;  1GHE A;  1RO5 A;  4FD6 A;  1QSO A;  4MFP A;  4C7H A;  1R57 A;  1WWZ A;  4H6U A;  1XE4 A;  4MY0 A;  1ZO0 A;  1KZF A;  3DR8 A;  4XNH B;  2YND A;  4C2Z A;  3E0K A;  5AG4 A;  4CYO A;  2PRB A;  4IUS A;  4F0X A;  2ARH A;  4JLY A;  1YLE A;  4KZT A;  1P4N A;  5DWM A;  2PC1 A;  5G1Z A;  3W6X A;  4AG9 A;  1J4J A;  1QSM A;  2C27 A;  4UCM A;  4A31 A;  1B6B A;  4QVT A;  5IB0 A;  4OAD A;  4UWJ A;  3FYN A;  2CNT A;  4YRH A;  3TO9 A;  1NE9 A;  4XNH C;  3B8G A;  4AB7 A;  1XF8 A;  1YRE A;  4UCP A;  3P2F A;  3UY5 A;  3SXN A;  1FY7 A;  4KOS A;  4E2A A;  1M4D A;  4KOU A;  4CGO A;  2QML A;  2Z3K A;  4KSA A;  3R9F A;  2Q04 A;  4R87 A;  3SHP A;  2ZW4 A;  2WPX A;  2VBQ A;  5H86 A;  3BJ8 A;  2H5M A;  2FL4 A;  2P0W A;  1TIQ A;  3EO4 A;  2Z3P A;  2FXF A;  4JWP A;  4KOY A;  2D4P A;  2O28 A;  4CAE A;  4X5K A;  2REE A;  3FNC A;  4KVX A;  3KKW A;  4JD6 A;  3BJ7 A;  4A33 A;  2CY2 A;  2CNS A;  2HQY A;  1KUY A;  4IF5 A;  4JXR A;  2Q4Y A;  5EC4 A;  2DXQ A;  2GE3 A;  3QAH A;  2R98 A;  2VXK A;  1Z4E A;  1NSL A;  4AVB A;  3BLN A;  5F46 A;  1M4I A;  2FCK A;  3I3G A;  3TE4 A;  2AJ6 A;  1MJA A;  2Q44 A;  2PDO A;  2BEI A;  2DPT A;  3K9U A;  4KUA A;  1QST A;  4R9M A;  1PUA A;  4KS9 A;  5KTC A;  2JDD A;  2Z3N A;  5G21 A;  5JQ4 A;  4KUB A;  4CAW A;  3H5Z A;  4MBU A;  5DWN A;  5BWA B;  4H6Z A;  4CGN A;  4FD7 A;  4B5P A;  2KCW A;  4KOX A;  5F47 A;  4CAX A;  5H84 A;  4AVA A;  1KUV A;  2FT0 A;  4PSX A;  3TCV A;  4ORF A;  5J8F A;  3S6K A;  3JVN A;  2ZW5 A;  2QIR A;  5HMN A;  2G3T A;  1QSR A;  3LOD A;  4ONU A;  4B14 A;  1WK4 A;  4MFL A;  2Q0Y A;  5ISV A;  1LRZ A;  4A32 A;  2P6E A;  2PQ8 A;  1I12 A;  2YGW A;  4M85 A;  4K30 A;  3EC4 A;  4CYN A;  4M3S A;  4CYP A;  4AVC A;  4OAE A;  1S7K A;  4NEX A;  4KOR A;  3TFY A;  1I21 A;  4CRY B;  1M4G A;  5AG6 A;  4AG7 A;  4U9Z A;  5AGE A;  4E0A A;  4FD4 A;  3W6S A;  2JLM A;  1S3Z A;  1S60 A;  2ZPA A;  2ZW6 A;  1Y9W A;  4CGP A;  3FBU A;  4UBR A;  2G0B A;  4BBH A;  4A95 A;  3MGD A;  2J8M A;  1IB1 E;  3GYA A;  1VHS A;  2HV2 A;  2BL1 A;  3D3S A;  5EBV A;  4MFJ A;  4B5P B;  1YR0 A;  4FD5 A;  1YVO A;  1MK4 A;  2P6G A;  2OB0 A;  1KUX A;  4I49 A;  3R96 A;  2OZG A;  2B3U A;  4LX9 A;  2I79 A;  2B4B A;  1Q2D A;  2YNE A;  5JPH A;  4C2X A;  2FE7 A;  5IX3 A;  1IID A;  5A27 A;  5A28 A;  4UWI A;  2Z3M A;  3S6G A;  4CGL A;  3T9Y A;  3IGR A;  2OU2 A;  1BOB A;  4B13 A;  4B11 A;  4ZGY B;  4UFX A;  3WR7 A;  4HNW B;  2Q4V A;  1RXT A;  2VZZ A;  3EXN A;  4PK2 A;  5FVJ A;  2PSW A;  3TOB A;  2FIA A;  1L0C A;  4E8O A;  5IV0 A;  3JUW A;  3FB3 A;  3JTK A;  2B5G A;  4QB9 A;  4F0Y A;  1IYK A;  3PP9 A;  4R57 A;  2PR8 A;  5G22 A;  5AG5 A;  4ZBG A;  4NF1 A;  3T90 A;  3DR6 A;  1Z4R A;  4Q38 A;  2WUU A;  4B12 A;  1YGH A;  3G8W A;  4NSQ A;  4U5Y A;  4C7I A;  1IIC A;  2K5T A;  2X7B A;  3I9S A;  1XIX A;  2CNM A;  2RC4 A;  4MHD A;  2OH1 A;  2DPS A;  5I0C A;  4KVM E;  3GY9 A;  5F49 A;  2G3A A;  4CYQ A;  3A9L A;  3IWG A;  4F6A A;  5G20 A;  3EY5 A;  2GIV A;  3DSB A;  3IU2 A;  1MJB A;  4HKF A;  3SXO A;  2VEZ A;  4CS0 B;  3C26 A;  2JDC A;  1YX0 A;  3F8K A;  2Q7B A;  1Z9U A;  1B87 A;  4MFK A;  4R3K A;  2PR1 A;  3D8P A;  4MY3 A;  3R9E A;  3QB8 A;  2FS5 A;  1Y7R A;  4DNC A;  2Z11 A;  2A4N A;  4Q36 A;  4Y49 B;  4BMH A;  4LUA A;  4C2Y A;  4CAF A;  2B5G B;  2Z3L A;  2B3V A;  2B58 A;  4UFW A;  1S7F A;  1P0H A;  3R1K A;  3PZJ A;  2J8N A;  4QUS A;  2BUE A;  2R1I A;  3V8I A;  2F5I A;  4YGO A;  1M1D A;  5C88 A;  2Z10 A;  3TO7 A;  1V0C A;  2I00 A;  4MFQ A;  2VZY A;  4L8A A;  4JXQ A;  4Y49 C;  3IWE A;  2IL4 A;  4A2Z A;  2OZH A;  2VI7 A;  2VQY A;  4XPD B;  2HUZ A;  4KVO E;  5CNP A;  5AG7 A;  3TO6 A;  1I1D A;  4HNX B;  1BO4 A;  4A30 A;  4II9 A;  2OZU A;  2REF A;  2AE6 A;  5F48 A;  2ZXV A;  3F0A A;  3ZZI A;  4KSF A;  4HNY B;  4C68 A;  2EVN A;  3TOA A;  2P6F A;  4RS2 A;  1MJ9 A;  4XPD C;  3FIX A;  3GKR A;  2Z0Z A;  2R7H A;  2Z3O A;  3DNS A;  4OLL A;  2YNC C;  4MFZ A;  3CXS A;  3P2H A;  2B4D A;  3NE7 A;  5GCN A;  3D2M A;  3IU1 A;  3VWD A;  2ZW7 A;  4XPL A;  4KOT A;  1U6M A;  1S7N A;  4XPK A;  5KTA A;  1M44 A;  3PGP A;  2R8V A;  3G3S A;  4B10 A;  5C82 A;  1OZP A;  3RYO A;  4B5O A;  2D4O A;  4CAV A;  4QBJ A;  3TTH A;  1Q2C A;  4KOW A;  5J8C A;  2FIW A;  3ZJ0 A;  3DDD A;  3LD2 A;  2WPW A;  4CGM A;  4MI4 A;  4U9Y A;  1Q2Y A;  3CXP A;  4QC6 A;  4KLV A;  3W91 A;  4R3L A;  1CJW A;  1S5K A;  4MJ8 A;  4CRZ B;  4H89 A;  1XEB A;  4J3G A;  4PV6 A;  3R95 A;  2NMT A;  3CXQ A;  4KLW A;  1XMT A;  2YNC A;  4UA3 A;  4KOV A;  3TT2 A;  2Y0M A;  1YVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...