4KVXA

Crystal structure of naa10 (ard1) bound to accoa
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
152
structure length
152
Chain Sequence
b'DIRPARISDLTGMQNCNLHNLPENYQLKYYLYHAISWPMLSYVATDPKGRVVGYVLAKMEEEPKDGIPHGHITSVSVMRSYRHLGLAKRLMVQSQRAMVEVYGAKYMSLHVRKSNRAAIHLYRDTLQFDVQGIESKYYADGEDAYAMHKDFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-terminal acetyltransferase A complex catalytic subunit ard
publication title Molecular basis for N-terminal acetylation by the heterodimeric NatA complex.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 36
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2013-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kvxA00
4OLLA 4FD7A 2K5TA 5H86A 4AG7A 4BMHA 4RI1A 2P6GA 2PRBA 4IF5A 1YREA 1S60A 1Z9UA 4RS2A 3W91A 4NEXA 1Y9WA 1VHSA 1GHEA 4KOWA 3UY5A 2Q4VA 3WR7A 4KUAA 2B4DB 2H5MA 4U5YA 2FSRA 3D2MA 5C88A 2ZW6A 4MBUA 2P6EA 1Y7RA 1ON0A 2JDDA 3CXPA 1QSRA 2DXQA 4E0AA 1IICA 1VKCA 4KOVA 1UFHA 2RC4A 3EFAA 2IL4A 3FB3A 4F0YA 1M1DA 2OZUA 3S6HA 2C27A 1V0CA 2VQYA 5F46A 1S7FA 2G3TA 3F8KA 3QB8A 4CAXA 2JEVA 4UBRA 1MJBA 3SXNA 1YX0A 1IB1E 4NSQA 2J8RA 4KOSA 4ONUA 3EY5A 2Q4YA 4M3SA 3I3GA 1TIQA 1KUXA 2EUIA 2CNSA 1Q2CA 3R1KA 4KORA 1PU9A 2G3AA 1S5KA 3FRMA 2GANA 2QMLA 4AVBA 2J8NA 4MJ8A 4QC6A 3EXNA 1CJWA 5DWMA 1M4GA 3PGPA 4B5PB 4KOUA 4LX9A 3DR6A 4CS0B 2VXKA 3GKRA 2R8VA 5J8CA 2GE3A 2CY2A 4U9ZA 3H4QA 2PC1A 3CXQA 4QVTA 5EC4A 3TOAA 1PUAA 2Q0YA 4R3KA 2F5IA 3R9GA 3D3SA 5KTCA 4XNHB 2B58A 3TOBA 2ATRA 4CAVA 3ZJ0A 4L8AA 1MJ9A 1S7LA 4CRYB 4XNHC 3DSBA 2ZXVA 4HNWB 4I49A 2B5GB 5IB0A 4Y49B 4FD5A 2R7HA 1R57A 4OAEA 3S6GA 3BJ7A 2REEA 4XPKA 2Y0MA 5GCNA 1KZFA 2B3VA 4Y49C 1K4JA 2B4BA 2REFA 2JLMA 3RYOA 2FE7A 2HV2A 4MHDA 1M4DA 2FT0A 1I12A 4QBJA 4JXRA 3F0AA 4E8OA 5IX3A 2ZPAA 3QAHA 3TT2A 4HNXB 4K30A 2AE6A 1S3ZA 1QSNA 2P6FA 2QIRA 2Q04A 1NMTA 2FS5A 2HUZA 2CNTA 3K9UA 1YVOA 1U6MA 4YFJA 3B8GA 1P0HA 2NMTA 2PSWA 4B5OA 3DR8A 2VZYA 3DDDA 1M4IA 1CM0A 4KUBA 4OADA 2KCWA 1KUVA 4H6UA 3P2FA 2OB0A 4PV6A 4CRZB 3IWGA 3KKWA 4MI4A 2R1IA 3TO9A 4AVAA 1XE4A 5HH1A 4MY3A 5CNPA 2Z11A 2B3UA 4B5PA 4LUAA 1MK4A 2HQYA 4PSWA 3FBUA 1MJAA 1S7NA 2A4NA 5ISVA 4J3GA 3TE4A 1J4JA 5IV0A 3W6XA 2I00A 4M85A 2X7BA 1I1DA 2FXFA 4XPLA 2GIVA 3SXOA 4FD4A 4HNYB 3V8IA 2ZW5A 4NXYA 1XMTA 4KOYA 3LD2A 4AB7A 3G8WA 4UWJA 4JLYA 4KVXA 3G3SA 4E2AA 2G0BA 3TTHA 1XEBA 4JXQA 4PK3A 4YGOA 3EC4A 4MY0A 3FXTA 2BEIA 3FIXA 3T9YA 4IUSA 2CNMA 4R9MA 2ARHA 2FIWA 1IIDA 2BUEA 4JJXA 3VWEA 4R3LA 3ZZIA 4R57A 2VEZA 2OU2A 4DNCA 3NE7A 2BL1A 2FL4A 4KVME 4NCZA 5H84A 3T90A 4UWIA 5F48A 2ZW4A 3R96A 4H6ZA 2B4DA 1S7KA 4H89A 4KLWA 5HMNA 3TCVA 4QB9A 3C26A 3CXSA 4R87A 4ZBGA 2Z0ZA 3PP9A 1IYKA 3I9SA 5F47A 2ZW7A 4JWPA 2VI7A 2FCKA 1Z4EA 4KVOE 3FYNA 4YRHA 4AVCA 5C82A 2PDOA 2JDCA 1NSLA 3TO7A 1QSTA 2D4OA 2OZHA 4CAWA 3FNCA 2QECA 2J8MA 2Z10A 3OWCA 1KUYA 4KZTA 3EO4A 2PR8A 2FIAA 4AG9A 1Q2YA 1M44A 4F6AA 1XIXA 1IYLA 4FD6A 5KTDA 1YGHA 5E96A 2AJ6A 1Q2DA 2WPXA 1LRZA 5I0CA 4PK2A 4HKFA 3S6FA 3F5BA 2BSWA 4L89A 3SHPA 3BLNA 4U9YA 2P0WA 4JD6A 2PR1A 3R9FA 1QSMA 1RO5A 1P4NA 2Q7BA 1XF8A 3S6KA 4PSXA 2D4PA 2VBQA 4ORFA 1YLEA 4KOTA 5JPHA 5JQ4A 2I79A 1BO4A 2VZZA 2B5GA 5FVJA 3W6SA 1B6BA 2WPWA 3LODA 1YK3A 3D2PA 4KOXA 5KTAA 5EBVA 1Y9KA 3VWDA 3GYAA 3TO6A 3IGRA 3PZJA 4EVYA 2R98A 2Q44A 5F49A 2OH1A 3TFYA 3BJ8A 1FY7A 1WK4A 4UA3A 3MGDA 4XPDB 1BOBA 1WWZA 5J8FA 3R95A 2OZGA 1NE9A 1RXTA 1YR0A 5DWNA 1Z4RA 3DNSA 4XPDC 3GY9A 1N71A 1OZPA 2O28A 4KLVA 4QUSA 1I21A 1L0CA 1SQHA 2PQ8A 2EVNA 3D8PA 1B87A 3E0KA 3P2HA 4NF1A 4II9A 1YVKA 3JUWA 4GS4A 3N7ZA 1QSOA 3R9EA 4X5KA 3JVNA
chains in the Genus database with same CATH superfamily
4OLLA 4FD7A 2K5TA 2ANPA 3KHZA 5H86A 4AG7A 1CP7A 2C1CA 4BMHA 3D68A 4P4BA 2P6GA 2PRBA 4IF5A 1YREA 1S60A 1Z9UA 4RI1A 3PEIA 1Z8XA 4RS2A 2JBKA 2IJZA 3W91A 4NEXA 1Y9WA 2RFHA 4UF4A 1VHSA 1GHEA 4UCMA 4KOWA 4M6HA 3UY5A 3SJXA 2Q4VA 2ZOFA 4B5PB 3TC8A 3WR7A 3B3CA 1F57A 4KUAA 2B4DB 2CF4A 1R43A 2H5MA 4U5YA 2FSRA 3RAMA 3D2MA 5C88A 2ZW6A 4MBUA 2P6EA 1R3NA 1AYEA 1ON0A 1Y7RA 2JDDA 3CXPA 4W9YA 1QSRA 2DXQA 2ZENA 3FECA 5A28A 4OIWA 4E0AA 3K2KA 4OC4A 1IICA 2I3CA 4EWTA 2YNCA 1VKCA 4KOVA 4NGTA 1CPSA 1UFHA 2RC4A 3A9LA 3EFAA 2IL4A 1JQGA 3FB3A 4DUKA 4EMEA 4F0YA 1M1DA 2OZUA 4OMEA 3S6HA 4AXVA 3CT9A 2CTCA 1A2ZA 1CG2A 1NSAA 1UWYA 2C27A 2BCOA 1V0CA 2VQYA 2DPTA 5F46A 2EBJA 1S7FA 2G3TA 4NGSA 3WC6A 1CP6A 2CTBA 2OOTA 2Z3OA 4P4JA 2C6PA 3F8KA 2ZEDA 3QB8A 4A95A 4CAXA 3FJUA 2JEVA 1Z5RA 4UBRA 1MJBA 3SXNA 1YX0A 1IB1E 4NSQA 4CAEA 2J8RA 3B3VA 4KOSA 1IGBA 4R7MA 2VL1A 4ONUA 4A31A 4TWEA 3V7ZA 1PCAA 3EY5A 2PRQA 4MFJA 3D7HA 3PB8X 5HVGA 2Q4YA 4M3SA 3I3GA 4NGMA 4OC1A 1TIQA 1LAPA 1TXRA 4MCRA 4A38A 4CGLA 1KUXA 3TX8A 2EUIA 2CNSA 5D8NA 1Q2CA 4F0XA 1VHOA 2PJ2A 3GIUA 4P4IA 2PJ3A 4KS9A 3R1KA 4MRIA 1ZG7A 4MCQA 4KORA 1PU9A 2G3AA 1S5KA 2ZOGA 4FBEA 2F7VA 4ZY1A 4FWUA 3FRMA 3PB4X 4X3RA 3S9MA 3NH5A 2GANA 1YMEA 1ARMA 2QMLA 4AVBA 2J8NA 3S9LA 2PJCA 4MJ8A 4CAFA 4H2KA 2IMOA 3H5ZA 2WYRA 4QC6A 3EXNA 1CJWA 5DWMA 1M4GA 3CPXA 3PGPA 4KOUA 4LX9A 3DR6A 4MFKA 1OBRA 2VXKA 2PJ5A 3GKRA 3ISXA 2R8VA 2PCUA 2GE3A 3B3TA 3D7FA 3MRUA 3NH8A 4P10A 5J8CA 2CY2A 4U9ZA 5K8OA 3H4QA 2PC1A 3CXQA 2ZEPA 4QVTA 5EC4A 3NH4A 3TOAA 1PUAA 2FVGA 1VIXA 2Q0YA 2F5IA 3PB9X 4R3KA 4MXUA 3D3SA 3IFEA 4MCSA 3R9GA 4B12A 2GLJA 4MFPA 5KTCA 4WJBA 4XNHB 4P4EA 2B58A 3TOBA 3I1UA 2ATRA 4CAVA 4NFRA 3ZJ0A 4L8AA 4MFZA 4MHZA 3VH9A 1MJ9A 2AFZA 1S7LA 1ZO0A 2ZELA 3KR4A 4CRYB 1AUGA 4XNHC 3DSBA 2J9AA 1TKHA 4PXBA 4R8FA 2ZXVA 5G22A 3D66A 4Q7AA 4HNWB 4LQGA 4I49A 3PRTA 5AGEA 4BD9A 4UEZA 3IJ3A 2B5GB 4UIAA 5IB0A 2Z3KA 4Y49B 1YQEA 2PIYA 3KR5A 4FD5A 4YWYA 5K8MA 2R7HA 4P4FA 4X8IA 2C6GA 4MHYA 5LRJA 2AFOA 1R57A 4OAEA 3S6GA 3BJ7A 3IEHA 4P45A 1DE4C 2REEA 4XPKA 2Y0MA 5GCNA 1KZFA 3JTKA 2B3VA 3B35A 4NGQA 4Y49C 1K4JA 2B4BA 2HC9A 1YSJA 2REFA 3GB0A 1IOFA 2Q4ZA 2JLMA 3H8GA 1HDUA 3QNVA 4OP4A 3RYOA 1LANA 5G21A 2FE7A 2HV2A 1ARLA 2GLFA 1ZLHA 4RN7A 4MHDA 1LOKA 5LYIA 2CXAA 3IIBA 1TKJA 1M4DA 2FT0A 1KWMA 3FMCA 1I12A 4QBJA 4JXRA 3F0AA 4E8OA 5IX3A 2ZPAA 3QAHA 3S9NA 3IU1A 3NFZA 5AG5A 3WC7A 3TT2A 4HNXB 4K30A 4M6GA 2AE6A 1S3ZA 1QSNA 2P6FA 2QIRA 2Q04A 4CGOA 1NMTA 2FS5A 1F2OA 2HUZA 5I4MA 3BI1A 4GXHA 4CGNA 4CYNA 2QYVA 5JM6A 2CNTA 3K9UA 1YVOA 1U6MA 1YLOA 4YFJA 3B8GA 5HVFA 3IWEA 1P0HA 2NMTA 2PSWA 1JWQA 2AFUA 2EK8A 4ONWA 2AFMA 2YNDA 4X2TA 3PFEA 3DR8A 2ZEOA 4B5OA 2VZYA 3DDDA 1M4IA 1CM0A 2OR4A 4P6YA 4A30A 4KUBA 1X12A 2Z3LA 4OADA 2WSAA 4A32A 2XEFA 4JZ0A 2KCWA 5AG6A 5AG4A 1LFWA 4RUHA 1KUVA 4H6UA 3P2FA 4R6TA 2OB0A 5LYFA 1TF9A 4ZI6A 4PV6A 4CRZB 3IWGA 3KKWA 4PXEA 5BWAB 4IHMA 5EMIA 4MI4A 3PB7X 4BINA 2ZEFA 4ZX9A 3SI2A 4IK2A 4A33A 1HEEA 4BBHA 2DEAA 2R1IA 4OC2A 4WWVA 3TO9A 5AG7A 4AVAA 2O4HA 3B7IA 1XE4A 5HH1A 2EWBA 4MY3A 5CNPA 4MMOA 4ZX8A 4CYPA 6CPAA 4NJQA 2Z11A 2B3UA 2XEJA 4MHPA 4B5PA 2Q43A 4A39A 4LUAA 1MK4A 2HQYA 4PSWA 3FBUA 5A27A 1MJAA 1S7NA 4M6IA 2A4NA 5ISVA 4OC5A 5F09A 4J3GA 2Z3MA 3D7DA 3FX6A 4MHNA 1J4JA 4CPAA 2PJ7A 3TE4A 3V38A 5IV0A 1ELMP 4FUUA 3W6XA 2I00A 4M85A 2X7BA 5K8NA 1Y7EA 1I1DA 2FXFA 4ZY2A 2WUUA 2GIVA 4XPLA 3SXOA 4FD4A 2EO8A 2QJ8A 4G1PA 5LRKA 4HNYB 2YNCC 4C2YA 4Z65A 3V8IA 2ZW5A 4NXYA 1IY7A 1XMTA 4KOYA 2V77A 3B3WA 3LD2A 4AB7A 3G8WA 3RNZA 3LACA 4UWJA 2POKA 4JLYA 2JEWA 4KVXA 1ZG8A 2O53A 4UFVA 4B6ZA 2AFSA 3G3SA 4E2AA 2G0BA 3DLJA 3KL9A 3TTHA 3BHXA 1XEBA 3GLJA 4Q38A 1XJOA 4JXQA 4PK3A 4YGOA 3EC4A 4ZY0A 4MY0A 3IO1A 3FXTA 2PVWA 1IOIA 1XRYA 1YW4A 2BEIA 1FNOA 2F8HA 3D4UA 3FIXA 3FEEA 3RZAA 3SJGA 4TNUA 5JGFA 1BLLE 4IUSA 2V8VA 2V8HA 2CNMA 4R9MA 2ARHA 1Q7LA 2FIWA 3SI1A 2PJ8A 1IIDA 2BUEA 4JJXA 3SJEA 2EK9A 4R3LA 3VWEA 3ZZIA 4B11A 5IB9A 3FVLA 2NSMA 4R57A 1LCPA 7CPAA 2IQ6A 2VEZA 1BPMA 2OU2A 1Y0YA 5HVHA 4NGPA 5G1ZA 4DNCA 2GU2A 3NE7A 3L2NA 4F8ZA 2BL1A 3KZWA 2CIJA 2FL4A 3T9YA 4KVME 4NCZA 5CPAA 5H84A 3T90A 4UWIA 1TF8A 2ZW4A 4NGRA 5F48A 3R96A 4PXDA 4H6ZA 2B4DA 1S7KA 4H89A 3FEDA 4ZYQA 3LMSA 4KLWA 5HMNA 2PJAA 3HUVA 3TCVA 4P4DA 3B2YA 4QB9A 3KASA 4NJRA 4FAIA 5LYLA 2AFWA 3C26A 3CXSA 3IWWA 4Q36A 4R87A 3MN8A 1ZG9A 3D7GA 4ZBGA 5CBMA 3CZXA 1VHEA 1RTQA 1ZLIA 2C6CA 5LYDA 5HXDA 2RB7A 2Z0ZA 3PP9A 1IYKA 2NYQA 3I9SA 1TKFA 1XFOA 1CPXA 3BXMA 4PPZA 5F47A 2ZW7A 4JWPA 2VI7A 2FCKA 5G20A 1Z4EA 4KVOE 3FYNA 2ZEMA 3RO0A 4OC0A 4YRHA 4AVCA 4MFLA 5C82A 2PDOA 2JDCA 1NSLA 3TO7A 5K8PA 1XOVA 1QSTA 2D4OA 4P44A 2OZHA 2PIZA 3H8FA 2ABZA 4UFXA 3CPAA 2YGWA 4CAWA 1Y0RA 2AFXA 3KQZA 3NE8A 5D29A 3FNCA 1BPNA 1GYTA 4O23A 2QECA 3FH4A 2J8MA 2V8DA 3QAYA 1QMUA 2Q51A 2Z10A 3ISZA 3OWCA 3RBUA 1KUYA 4KZTA 5LRGA 4UFWA 2DF5A 3EO4A 1CBXA 1BAVA 2PR8A 4K3NA 4PQAA 2FIAA 4C2ZA 1HDQA 4AG9A 3WABA 1Q2YA 1M4LA 4UCPA 2Z3PA 4UEFA 4NGNA 4A37A 4KSIA 3PB6X 1M44A 3H8EA 4F6AA 4CS0B 3SJFA 2PVVA 1XIXA 4F9VA 1IYLA 4FD6A 4IAVA 4C7HA 5KTDA 2JBJA 1YGHA 2PJ4A 3IU2A 4KSAA 4PXCA 1EE3P 5E96A 2AJ6A 4B10A 1Z2LA 3N5FA 1Q2DA 4GM5A 4EFDA 2WPXA 1CX8A 4ZGYB 1XMBA 1LRZA 2GFQA 2G9DA 4CGMA 3BI0A 5I0CA 4MFQA 2Z3NA 3LWUA 4PK2A 4UEEA 4HKFA 1PYTB 3S6FA 5ELYA 4UIBA 3F5BA 4YU9A 2BSWA 1IU8A 1F2PA 4L89A 3SHPA 3BLNA 4U9YA 2P0WA 3KHXA 3WC5A 3PFOA 2BOAA 4JD6A 5JH9A 4UCNA 4R76A 1Z8TA 2PR1A 3DGVA 1QSMA 3R9FA 1RO5A 5J1QA 1P4NA 2Q7BA 1XF8A 3S6KA 4PSXA 2D4PA 4JYWA 3IC1A 3NA6A 2VBQA 4CYOA 2PJBA 4ORFA 1H8LA 1YLEA 4KOTA 5JPHA 5JQ4A 1QQ9A 2I79A 1BO4A 2VZZA 2B5GA 5FVJA 3W6SA 4CGPA 1B6BA 2PJ0A 2WPWA 3SI0A 3VATA 4C7IA 1DTDA 3LODA 4F9UA 2XEIA 1YK3A 3CDXA 4DJLA 3D2PA 4MCPA 3D67A 2HB6A 1Z8WA 4KOXA 5KTAA 2QVPA 4CYQA 5EBVA 1Y9KA 2ODFA 1ELLP 3VWDA 3GYAA 3TO6A 4A94A 8CPAA 2GREA 3IGRA 2ZEHA 3B3SA 3T8WA 4C68A 3PZJA 2YNEA 4EVYA 2R98A 1Z8LA 3K9TA 4C2XA 2Q44A 2WZNA 3PBEA 4HPSA 5F49A 2OH1A 1FT7A 2BO9A 2XEGA 1AMPA 3TFYA 4LQ6A 3BJ8A 2ZEEA 4OC3A 5DS0A 1FY7A 2PE3A 4DYOA 1WK4A 2PJ1A 4UA3A 4KSFA 3MGDA 4XPDB 1BOBA 2Q7SA 1WWZA 5J8FA 3R95A 2OZGA 1XBUA 1NE9A 3WT4A 1RXTA 1YR0A 4B13A 3GUXA 2DPSA 5DWNA 1Z4RA 2V8GA 2PJ9A 3DNSA 4XPDC 5THWA 3GY9A 1N71A 1OZPA 2O28A 4KLVA 3KGQA 3KI9A 4QUSA 3PBBA 3JRUA 1X10A 4OIDA 4OKOA 1I21A 1L0CA 1SQHA 2PQ8A 2EVNA 3VARA 3D8PA 1B87A 3E0KA 1YW6A 3P2HA 4NF1A 4II9A 1YVKA 2ZEGA 3JUWA 4GS4A 3N7ZA 1QSOA 3KQXA 4B14A 1LAMA 4A2ZA 1VGYA 3HLPA 2PJ6A 3R9EA 4X5KA 3JVNA 3FF3A
chains in the Genus database with same CATH topology
4OLLA 4FD7A 2K5TA 5H86A 4AG7A 4BMHA 4RI1A 2P6GA 2PRBA 4IF5A 1YREA 1S60A 1Z9UA 4RS2A 3W91A 4NEXA 1Y9WA 1VHSA 1GHEA 4UCMA 4KOWA 3UY5A 2Q4VA 3WR7A 4KUAA 2B4DB 2H5MA 4U5YA 2FSRA 3D2MA 5C88A 2ZW6A 4MBUA 2P6EA 1Y7RA 1ON0A 2JDDA 3CXPA 1QSRA 2DXQA 5A28A 4E0AA 1IICA 2YNCA 1VKCA 4KOVA 1UFHA 2RC4A 3A9LA 3EFAA 2IL4A 3FB3A 4F0YA 1M1DA 2OZUA 3S6HA 2C27A 1V0CA 2VQYA 2DPTA 5F46A 1S7FA 2G3TA 2Z3OA 3F8KA 3QB8A 4A95A 4CAXA 2JEVA 4UBRA 1MJBA 3SXNA 1YX0A 1IB1E 4NSQA 4CAEA 2J8RA 4KOSA 4ONUA 4A31A 3EY5A 4MFJA 2Q4YA 4M3SA 3I3GA 1TIQA 4CGLA 1KUXA 2EUIA 2CNSA 1Q2CA 4F0XA 4KS9A 3R1KA 4KORA 1PU9A 2G3AA 1S5KA 3FRMA 2GANA 2QMLA 4AVBA 2J8NA 4MJ8A 4CAFA 3H5ZA 4QC6A 3EXNA 1CJWA 5DWMA 1M4GA 3PGPA 4MFKA 4KOUA 4LX9A 3DR6A 4B5PB 4CS0B 2VXKA 3GKRA 2R8VA 5J8CA 2GE3A 2CY2A 4U9ZA 3H4QA 2PC1A 3CXQA 4QVTA 5EC4A 3TOAA 1PUAA 2Q0YA 4R3KA 2F5IA 3R9GA 3D3SA 4B12A 4MFPA 5KTCA 4XNHB 2B58A 3TOBA 2ATRA 4CAVA 3ZJ0A 4L8AA 4MFZA 1MJ9A 1S7LA 1ZO0A 4CRYB 4XNHC 3DSBA 2ZXVA 5G22A 4HNWB 4I49A 5AGEA 2B5GB 5IB0A 2Z3KA 4Y49B 4FD5A 2R7HA 1R57A 4OAEA 3S6GA 3BJ7A 2REEA 4XPKA 2Y0MA 5GCNA 1KZFA 3JTKA 2B3VA 4Y49C 1K4JA 2B4BA 2REFA 2JLMA 3RYOA 5G21A 2FE7A 2HV2A 4MHDA 2CXAA 1M4DA 2FT0A 1I12A 4QBJA 4JXRA 3F0AA 4E8OA 5IX3A 2ZPAA 3QAHA 3IU1A 5AG5A 3TT2A 4HNXB 4K30A 2AE6A 1S3ZA 1QSNA 2P6FA 2QIRA 2Q04A 4CGOA 1NMTA 2FS5A 2HUZA 4CGNA 4CYNA 2CNTA 3K9UA 1YVOA 1U6MA 4YFJA 3B8GA 3IWEA 1P0HA 2NMTA 2PSWA 2YNDA 4B5OA 3DR8A 2VZYA 3DDDA 1M4IA 1CM0A 4A30A 4KUBA 2Z3LA 4OADA 2WSAA 4A32A 2KCWA 5AG6A 5AG4A 1KUVA 4H6UA 3P2FA 2OB0A 4PV6A 4CRZB 3IWGA 3KKWA 5BWAB 4MI4A 4BBHA 4A33A 2R1IA 3TO9A 5AG7A 4AVAA 1XE4A 5HH1A 4CYPA 4MY3A 5CNPA 2Z11A 2B3UA 4B5PA 4LUAA 1MK4A 2HQYA 4PSWA 3FBUA 5A27A 1MJAA 1S7NA 2A4NA 5ISVA 4J3GA 2Z3MA 3TE4A 1J4JA 5IV0A 3W6XA 2I00A 4M85A 2X7BA 1I1DA 2FXFA 2WUUA 2GIVA 4XPLA 3SXOA 4FD4A 4HNYB 2YNCC 4C2YA 3V8IA 2ZW5A 4NXYA 1XMTA 4KOYA 3LD2A 4AB7A 3G8WA 4UWJA 4JLYA 4KVXA 4UFVA 3G3SA 4E2AA 2G0BA 3TTHA 1XEBA 4Q38A 4JXQA 4PK3A 4YGOA 3EC4A 4MY0A 3FXTA 2BEIA 3FIXA 3T9YA 4IUSA 2CNMA 4R9MA 2ARHA 2FIWA 1IIDA 2BUEA 4JJXA 3VWEA 4R3LA 3ZZIA 4B11A 4R57A 2VEZA 2OU2A 5G1ZA 4DNCA 3NE7A 2BL1A 2FL4A 4KVME 4NCZA 5H84A 3T90A 4UWIA 5F48A 2ZW4A 3R96A 4H6ZA 2B4DA 1S7KA 4H89A 4KLWA 5HMNA 3TCVA 4QB9A 3C26A 3CXSA 4Q36A 4R87A 4ZBGA 2Z0ZA 3PP9A 1IYKA 3I9SA 5F47A 2ZW7A 4JWPA 2VI7A 2FCKA 5G20A 1Z4EA 4KVOE 3FYNA 4YRHA 4AVCA 4MFLA 5C82A 2PDOA 2JDCA 1NSLA 3TO7A 1QSTA 2D4OA 2OZHA 4UFXA 4CAWA 2YGWA 3FNCA 2QECA 2J8MA 2Z10A 3OWCA 1KUYA 4KZTA 4UFWA 3EO4A 2PR8A 2FIAA 4C2ZA 4AG9A 1Q2YA 4UCPA 2Z3PA 1M44A 4F6AA 1XIXA 1IYLA 4FD6A 5KTDA 1YGHA 3IU2A 4KSAA 5E96A 2AJ6A 4B10A 1Q2DA 2WPXA 4ZGYB 1LRZA 4CGMA 5I0CA 4MFQA 2Z3NA 4PK2A 4HKFA 3S6FA 3F5BA 2BSWA 4L89A 3SHPA 3BLNA 4U9YA 2P0WA 4JD6A 4UCNA 2PR1A 3R9FA 1QSMA 1RO5A 1P4NA 2Q7BA 1XF8A 3S6KA 4PSXA 2D4PA 2VBQA 4CYOA 4ORFA 1YLEA 4KOTA 5JPHA 5JQ4A 2I79A 1BO4A 2VZZA 2B5GA 5FVJA 3W6SA 4CGPA 1B6BA 2WPWA 4C7IA 3LODA 1YK3A 3D2PA 4KOXA 5KTAA 4CYQA 5EBVA 1Y9KA 3VWDA 3GYAA 3TO6A 3IGRA 4C68A 3PZJA 2YNEA 4EVYA 2R98A 4C2XA 2Q44A 5F49A 2OH1A 3TFYA 3BJ8A 1FY7A 1WK4A 4UA3A 4KSFA 3MGDA 4XPDB 1BOBA 1WWZA 5J8FA 3R95A 2OZGA 1NE9A 1RXTA 1YR0A 4B13A 2DPSA 5DWNA 1Z4RA 3DNSA 4XPDC 3GY9A 1N71A 1OZPA 2O28A 4KLVA 4QUSA 1I21A 1L0CA 1SQHA 2PQ8A 2EVNA 3D8PA 1B87A 3E0KA 3P2HA 4NF1A 4II9A 1YVKA 3JUWA 4GS4A 3N7ZA 1QSOA 4B14A 4A2ZA 3R9EA 4X5KA 3JVNA 4C7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OLL A;  4FD7 A;  2K5T A;  5H86 A;  4AG7 A;  4BMH A;  4RI1 A;  2P6G A;  2PRB A;  4IF5 A;  1YRE A;  1S60 A;  1Z9U A;  4RS2 A;  3W91 A;  4NEX A;  1Y9W A;  1VHS A;  1GHE A;  4KOW A;  3UY5 A;  2Q4V A;  3WR7 A;  4KUA A;  2B4D B;  2H5M A;  4U5Y A;  2FSR A;  3D2M A;  5C88 A;  2ZW6 A;  4MBU A;  2P6E A;  1Y7R A;  1ON0 A;  2JDD A;  3CXP A;  1QSR A;  2DXQ A;  4E0A A;  1IIC A;  1VKC A;  4KOV A;  1UFH A;  2RC4 A;  3EFA A;  2IL4 A;  3FB3 A;  4F0Y A;  1M1D A;  2OZU A;  3S6H A;  2C27 A;  1V0C A;  2VQY A;  5F46 A;  1S7F A;  2G3T A;  3F8K A;  3QB8 A;  4CAX A;  2JEV A;  4UBR A;  1MJB A;  3SXN A;  1YX0 A;  1IB1 E;  4NSQ A;  2J8R A;  4KOS A;  4ONU A;  3EY5 A;  2Q4Y A;  4M3S A;  3I3G A;  1TIQ A;  1KUX A;  2EUI A;  2CNS A;  1Q2C A;  3R1K A;  4KOR A;  1PU9 A;  2G3A A;  1S5K A;  3FRM A;  2GAN A;  2QML A;  4AVB A;  2J8N A;  4MJ8 A;  4QC6 A;  3EXN A;  1CJW A;  5DWM A;  1M4G A;  3PGP A;  4B5P B;  4KOU A;  4LX9 A;  3DR6 A;  4CS0 B;  2VXK A;  3GKR A;  2R8V A;  5J8C A;  2GE3 A;  2CY2 A;  4U9Z A;  3H4Q A;  2PC1 A;  3CXQ A;  4QVT A;  5EC4 A;  3TOA A;  1PUA A;  2Q0Y A;  4R3K A;  2F5I A;  3R9G A;  3D3S A;  5KTC A;  4XNH B;  2B58 A;  3TOB A;  2ATR A;  4CAV A;  3ZJ0 A;  4L8A A;  1MJ9 A;  1S7L A;  4CRY B;  4XNH C;  3DSB A;  2ZXV A;  4HNW B;  4I49 A;  2B5G B;  5IB0 A;  4Y49 B;  4FD5 A;  2R7H A;  1R57 A;  4OAE A;  3S6G A;  3BJ7 A;  2REE A;  4XPK A;  2Y0M A;  5GCN A;  1KZF A;  2B3V A;  4Y49 C;  1K4J A;  2B4B A;  2REF A;  2JLM A;  3RYO A;  2FE7 A;  2HV2 A;  4MHD A;  1M4D A;  2FT0 A;  1I12 A;  4QBJ A;  4JXR A;  3F0A A;  4E8O A;  5IX3 A;  2ZPA A;  3QAH A;  3TT2 A;  4HNX B;  4K30 A;  2AE6 A;  1S3Z A;  1QSN A;  2P6F A;  2QIR A;  2Q04 A;  1NMT A;  2FS5 A;  2HUZ A;  2CNT A;  3K9U A;  1YVO A;  1U6M A;  4YFJ A;  3B8G A;  1P0H A;  2NMT A;  2PSW A;  4B5O A;  3DR8 A;  2VZY A;  3DDD A;  1M4I A;  1CM0 A;  4KUB A;  4OAD A;  2KCW A;  1KUV A;  4H6U A;  3P2F A;  2OB0 A;  4PV6 A;  4CRZ B;  3IWG A;  3KKW A;  4MI4 A;  2R1I A;  3TO9 A;  4AVA A;  1XE4 A;  5HH1 A;  4MY3 A;  5CNP A;  2Z11 A;  2B3U A;  4B5P A;  4LUA A;  1MK4 A;  2HQY A;  4PSW A;  3FBU A;  1MJA A;  1S7N A;  2A4N A;  5ISV A;  4J3G A;  3TE4 A;  1J4J A;  5IV0 A;  3W6X A;  2I00 A;  4M85 A;  2X7B A;  1I1D A;  2FXF A;  4XPL A;  2GIV A;  3SXO A;  4FD4 A;  4HNY B;  3V8I A;  2ZW5 A;  4NXY A;  1XMT A;  4KOY A;  3LD2 A;  4AB7 A;  3G8W A;  4UWJ A;  4JLY A;  4KVX A;  3G3S A;  4E2A A;  2G0B A;  3TTH A;  1XEB A;  4JXQ A;  4PK3 A;  4YGO A;  3EC4 A;  4MY0 A;  3FXT A;  2BEI A;  3FIX A;  3T9Y A;  4IUS A;  2CNM A;  4R9M A;  2ARH A;  2FIW A;  1IID A;  2BUE A;  4JJX A;  3VWE A;  4R3L A;  3ZZI A;  4R57 A;  2VEZ A;  2OU2 A;  4DNC A;  3NE7 A;  2BL1 A;  2FL4 A;  4KVM E;  4NCZ A;  5H84 A;  3T90 A;  4UWI A;  5F48 A;  2ZW4 A;  3R96 A;  4H6Z A;  2B4D A;  1S7K A;  4H89 A;  4KLW A;  5HMN A;  3TCV A;  4QB9 A;  3C26 A;  3CXS A;  4R87 A;  4ZBG A;  2Z0Z A;  3PP9 A;  1IYK A;  3I9S A;  5F47 A;  2ZW7 A;  4JWP A;  2VI7 A;  2FCK A;  1Z4E A;  4KVO E;  3FYN A;  4YRH A;  4AVC A;  5C82 A;  2PDO A;  2JDC A;  1NSL A;  3TO7 A;  1QST A;  2D4O A;  2OZH A;  4CAW A;  3FNC A;  2QEC A;  2J8M A;  2Z10 A;  3OWC A;  1KUY A;  4KZT A;  3EO4 A;  2PR8 A;  2FIA A;  4AG9 A;  1Q2Y A;  1M44 A;  4F6A A;  1XIX A;  1IYL A;  4FD6 A;  5KTD A;  1YGH A;  5E96 A;  2AJ6 A;  1Q2D A;  2WPX A;  1LRZ A;  5I0C A;  4PK2 A;  4HKF A;  3S6F A;  3F5B A;  2BSW A;  4L89 A;  3SHP A;  3BLN A;  4U9Y A;  2P0W A;  4JD6 A;  2PR1 A;  3R9F A;  1QSM A;  1RO5 A;  1P4N A;  2Q7B A;  1XF8 A;  3S6K A;  4PSX A;  2D4P A;  2VBQ A;  4ORF A;  1YLE A;  4KOT A;  5JPH A;  5JQ4 A;  2I79 A;  1BO4 A;  2VZZ A;  2B5G A;  5FVJ A;  3W6S A;  1B6B A;  2WPW A;  3LOD A;  1YK3 A;  3D2P A;  4KOX A;  5KTA A;  5EBV A;  1Y9K A;  3VWD A;  3GYA A;  3TO6 A;  3IGR A;  3PZJ A;  4EVY A;  2R98 A;  2Q44 A;  5F49 A;  2OH1 A;  3TFY A;  3BJ8 A;  1FY7 A;  1WK4 A;  4UA3 A;  3MGD A;  4XPD B;  1BOB A;  1WWZ A;  5J8F A;  3R95 A;  2OZG A;  1NE9 A;  1RXT A;  1YR0 A;  5DWN A;  1Z4R A;  3DNS A;  4XPD C;  3GY9 A;  1N71 A;  1OZP A;  2O28 A;  4KLV A;  4QUS A;  1I21 A;  1L0C A;  1SQH A;  2PQ8 A;  2EVN A;  3D8P A;  1B87 A;  3E0K A;  3P2H A;  4NF1 A;  4II9 A;  1YVK A;  3JUW A;  4GS4 A;  3N7Z A;  1QSO A;  3R9E A;  4X5K A;  3JVN A; 
#chains in the Genus database with same CATH topology
 4OLL A;  4FD7 A;  2K5T A;  2ANP A;  3KHZ A;  5H86 A;  4AG7 A;  1CP7 A;  2C1C A;  4BMH A;  3D68 A;  4P4B A;  2P6G A;  2PRB A;  4IF5 A;  1YRE A;  1S60 A;  1Z9U A;  4RI1 A;  3PEI A;  1Z8X A;  4RS2 A;  2JBK A;  2IJZ A;  3W91 A;  4NEX A;  1Y9W A;  2RFH A;  4UF4 A;  1VHS A;  1GHE A;  4UCM A;  4KOW A;  4M6H A;  3UY5 A;  3SJX A;  2Q4V A;  2ZOF A;  4B5P B;  3TC8 A;  3WR7 A;  3B3C A;  1F57 A;  4KUA A;  2B4D B;  2CF4 A;  1R43 A;  2H5M A;  4U5Y A;  2FSR A;  3RAM A;  3D2M A;  5C88 A;  2ZW6 A;  4MBU A;  2P6E A;  1R3N A;  1AYE A;  1ON0 A;  1Y7R A;  2JDD A;  3CXP A;  4W9Y A;  1QSR A;  2DXQ A;  2ZEN A;  3FEC A;  5A28 A;  4OIW A;  4E0A A;  3K2K A;  4OC4 A;  1IIC A;  2I3C A;  4EWT A;  2YNC A;  1VKC A;  4KOV A;  4NGT A;  1CPS A;  1UFH A;  2RC4 A;  3A9L A;  3EFA A;  2IL4 A;  1JQG A;  3FB3 A;  4DUK A;  4EME A;  4F0Y A;  1M1D A;  2OZU A;  4OME A;  3S6H A;  4AXV A;  3CT9 A;  2CTC A;  1A2Z A;  1CG2 A;  1NSA A;  1UWY A;  2C27 A;  2BCO A;  1V0C A;  2VQY A;  2DPT A;  5F46 A;  2EBJ A;  1S7F A;  2G3T A;  4NGS A;  3WC6 A;  1CP6 A;  2CTB A;  2OOT A;  2Z3O A;  4P4J A;  2C6P A;  3F8K A;  2ZED A;  3QB8 A;  4A95 A;  4CAX A;  3FJU A;  2JEV A;  1Z5R A;  4UBR A;  1MJB A;  3SXN A;  1YX0 A;  1IB1 E;  4NSQ A;  4CAE A;  2J8R A;  3B3V A;  4KOS A;  1IGB A;  4R7M A;  2VL1 A;  4ONU A;  4A31 A;  4TWE A;  3V7Z A;  1PCA A;  3EY5 A;  2PRQ A;  4MFJ A;  3D7H A;  3PB8 X;  5HVG A;  2Q4Y A;  4M3S A;  3I3G A;  4NGM A;  4OC1 A;  1TIQ A;  1LAP A;  1TXR A;  4MCR A;  4A38 A;  4CGL A;  1KUX A;  3TX8 A;  2EUI A;  2CNS A;  5D8N A;  1Q2C A;  4F0X A;  1VHO A;  2PJ2 A;  3GIU A;  4P4I A;  2PJ3 A;  4KS9 A;  3R1K A;  4MRI A;  1ZG7 A;  4MCQ A;  4KOR A;  1PU9 A;  2G3A A;  1S5K A;  2ZOG A;  4FBE A;  2F7V A;  4ZY1 A;  4FWU A;  3FRM A;  3PB4 X;  4X3R A;  3S9M A;  3NH5 A;  2GAN A;  1YME A;  1ARM A;  2QML A;  4AVB A;  2J8N A;  3S9L A;  2PJC A;  4MJ8 A;  4CAF A;  4H2K A;  2IMO A;  3H5Z A;  2WYR A;  4QC6 A;  3EXN A;  1CJW A;  5DWM A;  1M4G A;  3CPX A;  3PGP A;  4KOU A;  4LX9 A;  3DR6 A;  4MFK A;  1OBR A;  2VXK A;  2PJ5 A;  3GKR A;  3ISX A;  2R8V A;  2PCU A;  2GE3 A;  3B3T A;  3D7F A;  3MRU A;  3NH8 A;  4P10 A;  5J8C A;  2CY2 A;  4U9Z A;  5K8O A;  3H4Q A;  2PC1 A;  3CXQ A;  2ZEP A;  4QVT A;  5EC4 A;  3NH4 A;  3TOA A;  1PUA A;  2FVG A;  1VIX A;  2Q0Y A;  2F5I A;  3PB9 X;  4R3K A;  4MXU A;  3D3S A;  3IFE A;  4MCS A;  3R9G A;  4B12 A;  2GLJ A;  4MFP A;  5KTC A;  4WJB A;  4XNH B;  4P4E A;  2B58 A;  3TOB A;  3I1U A;  2ATR A;  4CAV A;  4NFR A;  3ZJ0 A;  4L8A A;  4MFZ A;  4MHZ A;  3VH9 A;  1MJ9 A;  2AFZ A;  1S7L A;  1ZO0 A;  2ZEL A;  3KR4 A;  4CRY B;  1AUG A;  4XNH C;  3DSB A;  2J9A A;  1TKH A;  4PXB A;  4R8F A;  2ZXV A;  5G22 A;  3D66 A;  4Q7A A;  4HNW B;  4LQG A;  4I49 A;  3PRT A;  5AGE A;  4BD9 A;  4UEZ A;  3IJ3 A;  2B5G B;  4UIA A;  5IB0 A;  2Z3K A;  4Y49 B;  1YQE A;  2PIY A;  3KR5 A;  4FD5 A;  4YWY A;  5K8M A;  2R7H A;  4P4F A;  4X8I A;  2C6G A;  4MHY A;  5LRJ A;  2AFO A;  1R57 A;  4OAE A;  3S6G A;  3BJ7 A;  3IEH A;  4P45 A;  1DE4 C;  2REE A;  4XPK A;  2Y0M A;  5GCN A;  1KZF A;  3JTK A;  2B3V A;  3B35 A;  4NGQ A;  4Y49 C;  1K4J A;  2B4B A;  2HC9 A;  1YSJ A;  2REF A;  3GB0 A;  1IOF A;  2Q4Z A;  2JLM A;  3H8G A;  1HDU A;  3QNV A;  4OP4 A;  3RYO A;  1LAN A;  5G21 A;  2FE7 A;  2HV2 A;  1ARL A;  2GLF A;  1ZLH A;  4RN7 A;  4MHD A;  1LOK A;  5LYI A;  2CXA A;  3IIB A;  1TKJ A;  1M4D A;  2FT0 A;  1KWM A;  3FMC A;  1I12 A;  4QBJ A;  4JXR A;  3F0A A;  4E8O A;  5IX3 A;  2ZPA A;  3QAH A;  3S9N A;  3IU1 A;  3NFZ A;  5AG5 A;  3WC7 A;  3TT2 A;  4HNX B;  4K30 A;  4M6G A;  2AE6 A;  1S3Z A;  1QSN A;  2P6F A;  2QIR A;  2Q04 A;  4CGO A;  1NMT A;  2FS5 A;  1F2O A;  2HUZ A;  5I4M A;  3BI1 A;  4GXH A;  4CGN A;  4CYN A;  2QYV A;  5JM6 A;  2CNT A;  3K9U A;  1YVO A;  1U6M A;  1YLO A;  4YFJ A;  3B8G A;  5HVF A;  3IWE A;  1P0H A;  2NMT A;  2PSW A;  1JWQ A;  2AFU A;  2EK8 A;  4ONW A;  2AFM A;  2YND A;  4X2T A;  3PFE A;  3DR8 A;  2ZEO A;  4B5O A;  2VZY A;  3DDD A;  1M4I A;  1CM0 A;  2OR4 A;  4P6Y A;  4A30 A;  4KUB A;  1X12 A;  2Z3L A;  4OAD A;  2WSA A;  4A32 A;  2XEF A;  4JZ0 A;  2KCW A;  5AG6 A;  5AG4 A;  1LFW A;  4RUH A;  1KUV A;  4H6U A;  3P2F A;  4R6T A;  2OB0 A;  5LYF A;  1TF9 A;  4ZI6 A;  4PV6 A;  4CRZ B;  3IWG A;  3KKW A;  4PXE A;  5BWA B;  4IHM A;  5EMI A;  4MI4 A;  3PB7 X;  4BIN A;  2ZEF A;  4ZX9 A;  3SI2 A;  4IK2 A;  4A33 A;  1HEE A;  4BBH A;  2DEA A;  2R1I A;  4OC2 A;  4WWV A;  3TO9 A;  5AG7 A;  4AVA A;  2O4H A;  3B7I A;  1XE4 A;  5HH1 A;  2EWB A;  4MY3 A;  5CNP A;  4MMO A;  4ZX8 A;  4CYP A;  6CPA A;  4NJQ A;  2Z11 A;  2B3U A;  2XEJ A;  4MHP A;  4B5P A;  2Q43 A;  4A39 A;  4LUA A;  1MK4 A;  2HQY A;  4PSW A;  3FBU A;  5A27 A;  1MJA A;  1S7N A;  4M6I A;  2A4N A;  5ISV A;  4OC5 A;  5F09 A;  4J3G A;  2Z3M A;  3D7D A;  3FX6 A;  4MHN A;  1J4J A;  4CPA A;  2PJ7 A;  3TE4 A;  3V38 A;  5IV0 A;  1ELM P;  4FUU A;  3W6X A;  2I00 A;  4M85 A;  2X7B A;  5K8N A;  1Y7E A;  1I1D A;  2FXF A;  4ZY2 A;  2WUU A;  2GIV A;  4XPL A;  3SXO A;  4FD4 A;  2EO8 A;  2QJ8 A;  4G1P A;  5LRK A;  4HNY B;  2YNC C;  4C2Y A;  4Z65 A;  3V8I A;  2ZW5 A;  4NXY A;  1IY7 A;  1XMT A;  4KOY A;  2V77 A;  3B3W A;  3LD2 A;  4AB7 A;  3G8W A;  3RNZ A;  3LAC A;  4UWJ A;  2POK A;  4JLY A;  2JEW A;  4KVX A;  1ZG8 A;  2O53 A;  4UFV A;  4B6Z A;  2AFS A;  3G3S A;  4E2A A;  2G0B A;  3DLJ A;  3KL9 A;  3TTH A;  3BHX A;  1XEB A;  3GLJ A;  4Q38 A;  1XJO A;  4JXQ A;  4PK3 A;  4YGO A;  3EC4 A;  4ZY0 A;  4MY0 A;  3IO1 A;  3FXT A;  2PVW A;  1IOI A;  1XRY A;  1YW4 A;  2BEI A;  1FNO A;  2F8H A;  3D4U A;  3FIX A;  3FEE A;  3RZA A;  3SJG A;  4TNU A;  5JGF A;  1BLL E;  4IUS A;  2V8V A;  2V8H A;  2CNM A;  4R9M A;  2ARH A;  1Q7L A;  2FIW A;  3SI1 A;  2PJ8 A;  1IID A;  2BUE A;  4JJX A;  3SJE A;  2EK9 A;  4R3L A;  3VWE A;  3ZZI A;  4B11 A;  5IB9 A;  3FVL A;  2NSM A;  4R57 A;  1LCP A;  7CPA A;  2IQ6 A;  2VEZ A;  1BPM A;  2OU2 A;  1Y0Y A;  5HVH A;  4NGP A;  5G1Z A;  4DNC A;  2GU2 A;  3NE7 A;  3L2N A;  4F8Z A;  2BL1 A;  3KZW A;  2CIJ A;  2FL4 A;  3T9Y A;  4KVM E;  4NCZ A;  5CPA A;  5H84 A;  3T90 A;  4UWI A;  1TF8 A;  2ZW4 A;  4NGR A;  5F48 A;  3R96 A;  4PXD A;  4H6Z A;  2B4D A;  1S7K A;  4H89 A;  3FED A;  4ZYQ A;  3LMS A;  4KLW A;  5HMN A;  2PJA A;  3HUV A;  3TCV A;  4P4D A;  3B2Y A;  4QB9 A;  3KAS A;  4NJR A;  4FAI A;  5LYL A;  2AFW A;  3C26 A;  3CXS A;  3IWW A;  4Q36 A;  4R87 A;  3MN8 A;  1ZG9 A;  3D7G A;  4ZBG A;  5CBM A;  3CZX A;  1VHE A;  1RTQ A;  1ZLI A;  2C6C A;  5LYD A;  5HXD A;  2RB7 A;  2Z0Z A;  3PP9 A;  1IYK A;  2NYQ A;  3I9S A;  1TKF A;  1XFO A;  1CPX A;  3BXM A;  4PPZ A;  5F47 A;  2ZW7 A;  4JWP A;  2VI7 A;  2FCK A;  5G20 A;  1Z4E A;  4KVO E;  3FYN A;  2ZEM A;  3RO0 A;  4OC0 A;  4YRH A;  4AVC A;  4MFL A;  5C82 A;  2PDO A;  2JDC A;  1NSL A;  3TO7 A;  5K8P A;  1XOV A;  1QST A;  2D4O A;  4P44 A;  2OZH A;  2PIZ A;  3H8F A;  2ABZ A;  4UFX A;  3CPA A;  2YGW A;  4CAW A;  1Y0R A;  2AFX A;  3KQZ A;  3NE8 A;  5D29 A;  3FNC A;  1BPN A;  1GYT A;  4O23 A;  2QEC A;  3FH4 A;  2J8M A;  2V8D A;  3QAY A;  1QMU A;  2Q51 A;  2Z10 A;  3ISZ A;  3OWC A;  3RBU A;  1KUY A;  4KZT A;  5LRG A;  4UFW A;  2DF5 A;  3EO4 A;  1CBX A;  1BAV A;  2PR8 A;  4K3N A;  4PQA A;  2FIA A;  4C2Z A;  1HDQ A;  4AG9 A;  3WAB A;  1Q2Y A;  1M4L A;  4UCP A;  2Z3P A;  4UEF A;  4NGN A;  4A37 A;  4KSI A;  3PB6 X;  1M44 A;  3H8E A;  4F6A A;  4CS0 B;  3SJF A;  2PVV A;  1XIX A;  4F9V A;  1IYL A;  4FD6 A;  4IAV A;  4C7H A;  5KTD A;  2JBJ A;  1YGH A;  2PJ4 A;  3IU2 A;  4KSA A;  4PXC A;  1EE3 P;  5E96 A;  2AJ6 A;  4B10 A;  1Z2L A;  3N5F A;  1Q2D A;  4GM5 A;  4EFD A;  2WPX A;  1CX8 A;  4ZGY B;  1XMB A;  1LRZ A;  2GFQ A;  2G9D A;  4CGM A;  3BI0 A;  5I0C A;  4MFQ A;  2Z3N A;  3LWU A;  4PK2 A;  4UEE A;  4HKF A;  1PYT B;  3S6F A;  5ELY A;  4UIB A;  3F5B A;  4YU9 A;  2BSW A;  1IU8 A;  1F2P A;  4L89 A;  3SHP A;  3BLN A;  4U9Y A;  2P0W A;  3KHX A;  3WC5 A;  3PFO A;  2BOA A;  4JD6 A;  5JH9 A;  4UCN A;  4R76 A;  1Z8T A;  2PR1 A;  3DGV A;  1QSM A;  3R9F A;  1RO5 A;  5J1Q A;  1P4N A;  2Q7B A;  1XF8 A;  3S6K A;  4PSX A;  2D4P A;  4JYW A;  3IC1 A;  3NA6 A;  2VBQ A;  4CYO A;  2PJB A;  4ORF A;  1H8L A;  1YLE A;  4KOT A;  5JPH A;  5JQ4 A;  1QQ9 A;  2I79 A;  1BO4 A;  2VZZ A;  2B5G A;  5FVJ A;  3W6S A;  4CGP A;  1B6B A;  2PJ0 A;  2WPW A;  3SI0 A;  3VAT A;  4C7I A;  1DTD A;  3LOD A;  4F9U A;  2XEI A;  1YK3 A;  3CDX A;  4DJL A;  3D2P A;  4MCP A;  3D67 A;  2HB6 A;  1Z8W A;  4KOX A;  5KTA A;  2QVP A;  4CYQ A;  5EBV A;  1Y9K A;  2ODF A;  1ELL P;  3VWD A;  3GYA A;  3TO6 A;  4A94 A;  8CPA A;  2GRE A;  3IGR A;  2ZEH A;  3B3S A;  3T8W A;  4C68 A;  3PZJ A;  2YNE A;  4EVY A;  2R98 A;  1Z8L A;  3K9T A;  4C2X A;  2Q44 A;  2WZN A;  3PBE A;  4HPS A;  5F49 A;  2OH1 A;  1FT7 A;  2BO9 A;  2XEG A;  1AMP A;  3TFY A;  4LQ6 A;  3BJ8 A;  2ZEE A;  4OC3 A;  5DS0 A;  1FY7 A;  2PE3 A;  4DYO A;  1WK4 A;  2PJ1 A;  4UA3 A;  4KSF A;  3MGD A;  4XPD B;  1BOB A;  2Q7S A;  1WWZ A;  5J8F A;  3R95 A;  2OZG A;  1XBU A;  1NE9 A;  3WT4 A;  1RXT A;  1YR0 A;  4B13 A;  3GUX A;  2DPS A;  5DWN A;  1Z4R A;  2V8G A;  2PJ9 A;  3DNS A;  4XPD C;  5THW A;  3GY9 A;  1N71 A;  1OZP A;  2O28 A;  4KLV A;  3KGQ A;  3KI9 A;  4QUS A;  3PBB A;  3JRU A;  1X10 A;  4OID A;  4OKO A;  1I21 A;  1L0C A;  1SQH A;  2PQ8 A;  2EVN A;  3VAR A;  3D8P A;  1B87 A;  3E0K A;  1YW6 A;  3P2H A;  4NF1 A;  4II9 A;  1YVK A;  2ZEG A;  3JUW A;  4GS4 A;  3N7Z A;  1QSO A;  3KQX A;  4B14 A;  1LAM A;  4A2Z A;  1VGY A;  3HLP A;  2PJ6 A;  3R9E A;  4X5K A;  3JVN A;  3FF3 A; 
#chains in the Genus database with same CATH homology
 4OLL A;  4FD7 A;  2K5T A;  5H86 A;  4AG7 A;  4BMH A;  4RI1 A;  2P6G A;  2PRB A;  4IF5 A;  1YRE A;  1S60 A;  1Z9U A;  4RS2 A;  3W91 A;  4NEX A;  1Y9W A;  1VHS A;  1GHE A;  4UCM A;  4KOW A;  3UY5 A;  2Q4V A;  3WR7 A;  4KUA A;  2B4D B;  2H5M A;  4U5Y A;  2FSR A;  3D2M A;  5C88 A;  2ZW6 A;  4MBU A;  2P6E A;  1Y7R A;  1ON0 A;  2JDD A;  3CXP A;  1QSR A;  2DXQ A;  5A28 A;  4E0A A;  1IIC A;  2YNC A;  1VKC A;  4KOV A;  1UFH A;  2RC4 A;  3A9L A;  3EFA A;  2IL4 A;  3FB3 A;  4F0Y A;  1M1D A;  2OZU A;  3S6H A;  2C27 A;  1V0C A;  2VQY A;  2DPT A;  5F46 A;  1S7F A;  2G3T A;  2Z3O A;  3F8K A;  3QB8 A;  4A95 A;  4CAX A;  2JEV A;  4UBR A;  1MJB A;  3SXN A;  1YX0 A;  1IB1 E;  4NSQ A;  4CAE A;  2J8R A;  4KOS A;  4ONU A;  4A31 A;  3EY5 A;  4MFJ A;  2Q4Y A;  4M3S A;  3I3G A;  1TIQ A;  4CGL A;  1KUX A;  2EUI A;  2CNS A;  1Q2C A;  4F0X A;  4KS9 A;  3R1K A;  4KOR A;  1PU9 A;  2G3A A;  1S5K A;  3FRM A;  2GAN A;  2QML A;  4AVB A;  2J8N A;  4MJ8 A;  4CAF A;  3H5Z A;  4QC6 A;  3EXN A;  1CJW A;  5DWM A;  1M4G A;  3PGP A;  4MFK A;  4KOU A;  4LX9 A;  3DR6 A;  4B5P B;  4CS0 B;  2VXK A;  3GKR A;  2R8V A;  5J8C A;  2GE3 A;  2CY2 A;  4U9Z A;  3H4Q A;  2PC1 A;  3CXQ A;  4QVT A;  5EC4 A;  3TOA A;  1PUA A;  2Q0Y A;  4R3K A;  2F5I A;  3R9G A;  3D3S A;  4B12 A;  4MFP A;  5KTC A;  4XNH B;  2B58 A;  3TOB A;  2ATR A;  4CAV A;  3ZJ0 A;  4L8A A;  4MFZ A;  1MJ9 A;  1S7L A;  1ZO0 A;  4CRY B;  4XNH C;  3DSB A;  2ZXV A;  5G22 A;  4HNW B;  4I49 A;  5AGE A;  2B5G B;  5IB0 A;  2Z3K A;  4Y49 B;  4FD5 A;  2R7H A;  1R57 A;  4OAE A;  3S6G A;  3BJ7 A;  2REE A;  4XPK A;  2Y0M A;  5GCN A;  1KZF A;  3JTK A;  2B3V A;  4Y49 C;  1K4J A;  2B4B A;  2REF A;  2JLM A;  3RYO A;  5G21 A;  2FE7 A;  2HV2 A;  4MHD A;  2CXA A;  1M4D A;  2FT0 A;  1I12 A;  4QBJ A;  4JXR A;  3F0A A;  4E8O A;  5IX3 A;  2ZPA A;  3QAH A;  3IU1 A;  5AG5 A;  3TT2 A;  4HNX B;  4K30 A;  2AE6 A;  1S3Z A;  1QSN A;  2P6F A;  2QIR A;  2Q04 A;  4CGO A;  1NMT A;  2FS5 A;  2HUZ A;  4CGN A;  4CYN A;  2CNT A;  3K9U A;  1YVO A;  1U6M A;  4YFJ A;  3B8G A;  3IWE A;  1P0H A;  2NMT A;  2PSW A;  2YND A;  4B5O A;  3DR8 A;  2VZY A;  3DDD A;  1M4I A;  1CM0 A;  4A30 A;  4KUB A;  2Z3L A;  4OAD A;  2WSA A;  4A32 A;  2KCW A;  5AG6 A;  5AG4 A;  1KUV A;  4H6U A;  3P2F A;  2OB0 A;  4PV6 A;  4CRZ B;  3IWG A;  3KKW A;  5BWA B;  4MI4 A;  4BBH A;  4A33 A;  2R1I A;  3TO9 A;  5AG7 A;  4AVA A;  1XE4 A;  5HH1 A;  4CYP A;  4MY3 A;  5CNP A;  2Z11 A;  2B3U A;  4B5P A;  4LUA A;  1MK4 A;  2HQY A;  4PSW A;  3FBU A;  5A27 A;  1MJA A;  1S7N A;  2A4N A;  5ISV A;  4J3G A;  2Z3M A;  3TE4 A;  1J4J A;  5IV0 A;  3W6X A;  2I00 A;  4M85 A;  2X7B A;  1I1D A;  2FXF A;  2WUU A;  2GIV A;  4XPL A;  3SXO A;  4FD4 A;  4HNY B;  2YNC C;  4C2Y A;  3V8I A;  2ZW5 A;  4NXY A;  1XMT A;  4KOY A;  3LD2 A;  4AB7 A;  3G8W A;  4UWJ A;  4JLY A;  4KVX A;  4UFV A;  3G3S A;  4E2A A;  2G0B A;  3TTH A;  1XEB A;  4Q38 A;  4JXQ A;  4PK3 A;  4YGO A;  3EC4 A;  4MY0 A;  3FXT A;  2BEI A;  3FIX A;  3T9Y A;  4IUS A;  2CNM A;  4R9M A;  2ARH A;  2FIW A;  1IID A;  2BUE A;  4JJX A;  3VWE A;  4R3L A;  3ZZI A;  4B11 A;  4R57 A;  2VEZ A;  2OU2 A;  5G1Z A;  4DNC A;  3NE7 A;  2BL1 A;  2FL4 A;  4KVM E;  4NCZ A;  5H84 A;  3T90 A;  4UWI A;  5F48 A;  2ZW4 A;  3R96 A;  4H6Z A;  2B4D A;  1S7K A;  4H89 A;  4KLW A;  5HMN A;  3TCV A;  4QB9 A;  3C26 A;  3CXS A;  4Q36 A;  4R87 A;  4ZBG A;  2Z0Z A;  3PP9 A;  1IYK A;  3I9S A;  5F47 A;  2ZW7 A;  4JWP A;  2VI7 A;  2FCK A;  5G20 A;  1Z4E A;  4KVO E;  3FYN A;  4YRH A;  4AVC A;  4MFL A;  5C82 A;  2PDO A;  2JDC A;  1NSL A;  3TO7 A;  1QST A;  2D4O A;  2OZH A;  4UFX A;  4CAW A;  2YGW A;  3FNC A;  2QEC A;  2J8M A;  2Z10 A;  3OWC A;  1KUY A;  4KZT A;  4UFW A;  3EO4 A;  2PR8 A;  2FIA A;  4C2Z A;  4AG9 A;  1Q2Y A;  4UCP A;  2Z3P A;  1M44 A;  4F6A A;  1XIX A;  1IYL A;  4FD6 A;  5KTD A;  1YGH A;  3IU2 A;  4KSA A;  5E96 A;  2AJ6 A;  4B10 A;  1Q2D A;  2WPX A;  4ZGY B;  1LRZ A;  4CGM A;  5I0C A;  4MFQ A;  2Z3N A;  4PK2 A;  4HKF A;  3S6F A;  3F5B A;  2BSW A;  4L89 A;  3SHP A;  3BLN A;  4U9Y A;  2P0W A;  4JD6 A;  4UCN A;  2PR1 A;  3R9F A;  1QSM A;  1RO5 A;  1P4N A;  2Q7B A;  1XF8 A;  3S6K A;  4PSX A;  2D4P A;  2VBQ A;  4CYO A;  4ORF A;  1YLE A;  4KOT A;  5JPH A;  5JQ4 A;  2I79 A;  1BO4 A;  2VZZ A;  2B5G A;  5FVJ A;  3W6S A;  4CGP A;  1B6B A;  2WPW A;  4C7I A;  3LOD A;  1YK3 A;  3D2P A;  4KOX A;  5KTA A;  4CYQ A;  5EBV A;  1Y9K A;  3VWD A;  3GYA A;  3TO6 A;  3IGR A;  4C68 A;  3PZJ A;  2YNE A;  4EVY A;  2R98 A;  4C2X A;  2Q44 A;  5F49 A;  2OH1 A;  3TFY A;  3BJ8 A;  1FY7 A;  1WK4 A;  4UA3 A;  4KSF A;  3MGD A;  4XPD B;  1BOB A;  1WWZ A;  5J8F A;  3R95 A;  2OZG A;  1NE9 A;  1RXT A;  1YR0 A;  4B13 A;  2DPS A;  5DWN A;  1Z4R A;  3DNS A;  4XPD C;  3GY9 A;  1N71 A;  1OZP A;  2O28 A;  4KLV A;  4QUS A;  1I21 A;  1L0C A;  1SQH A;  2PQ8 A;  2EVN A;  3D8P A;  1B87 A;  3E0K A;  3P2H A;  4NF1 A;  4II9 A;  1YVK A;  3JUW A;  4GS4 A;  3N7Z A;  1QSO A;  4B14 A;  4A2Z A;  3R9E A;  4X5K A;  3JVN A;  4C7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...