4KVXA

Crystal structure of naa10 (ard1) bound to accoa
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
152
structure length
152
Chain Sequence
DIRPARISDLTGMQNCNLHNLPENYQLKYYLYHAISWPMLSYVATDPKGRVVGYVLAKMEEEPKDGIPHGHITSVSVMRSYRHLGLAKRLMVQSQRAMVEVYGAKYMSLHVRKSNRAAIHLYRDTLQFDVQGIESKYYADGEDAYAMHKDFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-terminal acetyltransferase A complex catalytic subunit ard
publication title Molecular basis for N-terminal acetylation by the heterodimeric NatA complex.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 36
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2013-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kvxA00
4JJXA 1IICA 4F0YA 4GS4A 4R57A 2WPWA 1NE9A 4II9A 1I12A 3TOBA 3D3SA 3D2PA 3R1KA 3B8GA 1M4IA 2R7HA 2VEZA 2B3VA 2NMTA 2VQYA 4E2AA 4MI4A 1Q2CA 3FB3A 2J8RA 1S3ZA 3EXNA 1VKCA 2ZXVA 2WPXA 1M4DA 2ZW7A 1VHSA 3I3GA 3QB8A 2P6FA 3BJ8A 1IIDA 1P4NA 4U5YA 2R98A 4DNCA 2B4DB 3R95A 4JWPA 3TT2A 1B6BA 1XF8A 1V0CA 2QECA 2GE3A 4QBJA 1J4JA 2Q44A 4M3SA 3EFAA 5F48A 2FCKA 2Z0ZA 4RI1A 2D4PA 4MJ8A 1Y9WA 1TIQA 4KLWA 2Z11A 2F5IA 3N7ZA 2VBQA 3EC4A 4KOUA 2FSRA 4NXYA 3P2FA 1BOBA 3R9GA 2I00A 2HUZA 4KVME 1RO5A 2OU2A 5E96A 1WWZA 1IYKA 3GKRA 5KTAA 1XIXA 2FIAA 5GCNA 4NCZA 3TO6A 2C27A 3F5BA 3V8IA 4U9ZA 2Q4VA 3CXQA 3W6SA 4CAXA 5I0CA 1L0CA 5F46A 2J8MA 2P6GA 5HMNA 2OB0A 1GHEA 2FXFA 3R96A 5C82A 3SXOA 1RXTA 3S6HA 4JLYA 2G3AA 5ISVA 4AVCA 3UY5A 4OADA 2OZHA 4KZTA 2OZUA 2H5MA 4KVOE 3DDDA 1Z9UA 3R9EA 3JVNA 2KCWA 3T90A 3ZZIA 4IF5A 4QVTA 2P0WA 4AG9A 4PSWA 5CNPA 1MJBA 4AVAA 2QMLA 2K5TA 3W91A 2ATRA 1YREA 2CNSA 2HV2A 4OLLA 3GY9A 4CAWA 3D2MA 4B5OA 2R1IA 3OWCA 4KUBA 1QSNA 1Z4RA 3F0AA 4JXRA 3GYAA 2A4NA 4IUSA 2D4OA 4XNHB 4CS0B 2JDDA 2Q4YA 3S6KA 4MY3A 1CM0A 4KLVA 4Y49B 3ZJ0A 1M1DA 2EVNA 4RS2A 3E0KA 4UWIA 2Y0MA 4UBRA 4LX9A 4EVYA 1XE4A 3TCVA 4FD5A 1XEBA 2REFA 5KTCA 2AE6A 2G0BA 1NMTA 1FY7A 4FD4A 2B3UA 4LUAA 1YR0A 2QIRA 1MJ9A 2CY2A 5F47A 1KUVA 3IWGA 3IGRA 3G3SA 3H4QA 3TTHA 2GIVA 4KOSA 1MK4A 2IL4A 4NSQA 2JEVA 4XPKA 2ARHA 4KOYA 5IX3A 2Z10A 3C26A 2PR8A 4PSXA 4CAVA 2B4DA 4HNYB 4MBUA 5J8CA 2FL4A 2JLMA 2BUEA 2GANA 3CXSA 1Q2YA 3R9FA 2PC1A 4L8AA 4MHDA 4KOXA 2EUIA 2Q0YA 2DXQA 2HQYA 3S6FA 1UFHA 1KZFA 4B5PA 2R8VA 1S7NA 4AVBA 4U9YA 3FRMA 3VWEA 4NF1A 4NEXA 3TOAA 2B5GA 3TE4A 4BMHA 4PK3A 3QAHA 2VI7A 2O28A 4M85A 2BL1A 2RC4A 3TFYA 3PZJA 1KUYA 1SQHA 2FT0A 2OZGA 3JUWA 1YK3A 2Q7BA 4XNHC 4AG7A 3S6GA 4L89A 1B87A 1I21A 2B4BA 3K9UA 1ON0A 3T9YA 2ZW4A 2Q04A 3FNCA 2JDCA 2FIWA 5H84A 1S60A 4CRZB 3EO4A 5J8FA 2PQ8A 4PK2A 5IB0A 1NSLA 4JXQA 1XMTA 4FD7A 4H6ZA 3MGDA 4ZBGA 1YLEA 3DSBA 3VWDA 3I9SA 4XPDB 1I1DA 4CRYB 3DR8A 3TO9A 1QSOA 4R87A 4QB9A 2AJ6A 1QSTA 3TO7A 3FBUA 4XPLA 1CJWA 5EBVA 3G8WA 5EC4A 2J8NA 4R9MA 4K30A 5FVJA 3KKWA 1S7KA 2REEA 2CNTA 5F49A 1N71A 3DNSA 3EY5A 3BLNA 3FIXA 4KOTA 4KUAA 3RYOA 1OZPA 1YX0A 1QSRA 5IV0A 5HH1A 4E0AA 1IYLA 1KUXA 3P2HA 2BSWA 2ZW5A 4YFJA 5DWMA 4QUSA 3FYNA 4F6AA 2ZW6A 4OAEA 4AB7A 4KVXA 4QC6A 2X7BA 1IB1E 5H86A 1U6MA 4MY0A 4B5PB 3F8KA 4R3KA 2PRBA 1YVKA 2B5GB 1Y9KA 4KORA 4X5KA 4KOVA 5KTDA 1P0HA 3SXNA 2FE7A 1PUAA 2P6EA 3PP9A 4UWJA 2VZYA 1S5KA 2BEIA 3LD2A 2B58A 5DWNA 3SHPA 4HNWB 1BO4A 2PSWA 1YVOA 2CNMA 1M4GA 4H6UA 3PGPA 4FD6A 2G3TA 1MJAA 1PU9A 4H89A 1S7FA 2VZZA 5JQ4A 1S7LA 4HNXB 1Y7RA 1Z4EA 1YGHA 2OH1A 3CXPA 4XPDC 1M44A 1Q2DA 4R3LA 1K4JA 4YRHA 1WK4A 3NE7A 2PDOA 5JPHA 4I49A 4JD6A 4ONUA 4PV6A 4YGOA 4Y49C 1R57A 2I79A 4E8OA 1QSMA 4ORFA 2PR1A 3W6XA 2FS5A 2ZPAA 2VXKA 3FXTA 4KOWA 4J3GA 1LRZA 3LODA 4UA3A 3BJ7A 3WR7A 3DR6A 5C88A 3D8PA 4HKFA
chains in the Genus database with same CATH superfamily
4BINA 1ELLP 4JJXA 2WZNA 1IICA 1YW4A 4F0YA 4GS4A 3IC1A 4R57A 2WPWA 1NE9A 3JTKA 1I12A 2YGWA 5HVHA 3TOBA 4II9A 3D3SA 3D2PA 3FECA 3R1KA 3B8GA 2Z3KA 1QMUA 4P4IA 1M4IA 2R7HA 2V77A 2VEZA 2B3VA 5LYIA 2NMTA 2VQYA 4E2AA 4MI4A 1Q2CA 4ZY2A 2Z3OA 3FB3A 4F0XA 3B3SA 2J8RA 1S3ZA 3EXNA 1VKCA 3VATA 8CPAA 2ZXVA 4MHZA 2WPXA 2QJ8A 1M4DA 2ZW7A 1VHSA 3CDXA 3I3GA 1TF8A 3B3WA 3QB8A 2P6FA 3BJ8A 1IIDA 1P4NA 4NGSA 4U5YA 2R98A 2BOAA 3WT4A 5LRKA 5AG7A 4DNCA 1TKJA 2B4DB 5HXDA 4C2ZA 1R43A 2RFHA 2Z3NA 2Q7SA 3R95A 2ZENA 5K8MA 4JWPA 4R8FA 2AFWA 3TT2A 3JRUA 1B6BA 4A95A 1XF8A 1V0CA 2QECA 4Q38A 4UCMA 1F2OA 2GE3A 4MFZA 1YQEA 4PXEA 4QBJA 1J4JA 2DEAA 2Q44A 3EFAA 4M3SA 5F48A 5JGFA 4P4JA 2FCKA 2Z0ZA 3KQXA 3D7GA 4UFXA 1CPXA 1GYTA 3SI2A 3PEIA 4RI1A 2Z3PA 2D4PA 3KR4A 4MJ8A 1Y9WA 4B12A 1TIQA 5LYLA 4KSIA 1ZG8A 2BCOA 4KLWA 5F09A 2Z11A 4X3RA 2F5IA 2PJ2A 3N7ZA 2VBQA 3EC4A 4KOUA 2FSRA 4NXYA 4NGMA 2PVWA 3P2FA 4ZX9A 1Y0RA 1BOBA 4OIDA 1OBRA 3R9GA 3N5FA 2EO8A 2I00A 3B2YA 2HUZA 2PE3A 3BI0A 1RO5A 3IU2A 4KVME 4W9YA 5DS0A 5HVGA 2OU2A 2GLFA 5E96A 1WWZA 1KWMA 5THWA 3NE8A 1IYKA 3L2NA 3GKRA 2CTCA 5KTAA 1XIXA 4KSFA 2FIAA 5GCNA 1BPNA 4NCZA 3KGQA 2V8HA 3FEDA 3TO6A 2CF4A 1JWQA 2AFOA 3B3TA 2C6PA 3KQZA 2IMOA 2C27A 3F5BA 2WUUA 3IFEA 4PXBA 3V8IA 2RB7A 3FF3A 4A38A 1ZLIA 4U9ZA 3GLJA 2Q4VA 3B3CA 3CXQA 4UF4A 3W6SA 3RNZA 4CAXA 5I0CA 3IWEA 1L0CA 2G9DA 2F8HA 4C2YA 5F46A 1ELMP 2DPSA 2EBJA 2Z3MA 2J8MA 2P6GA 4NGTA 2OB0A 5HMNA 1GHEA 2FXFA 4UEZA 3R96A 5C82A 3ISZA 1LANA 2AFXA 5LYFA 3D66A 1F57A 1RXTA 3NA6A 4FWUA 3SXOA 3S6HA 4JLYA 2G3AA 5ISVA 4AVCA 3UY5A 4RN7A 2AFZA 5G1ZA 4UFWA 5J1QA 2PJ8A 3IO1A 2OZHA 4OADA 4KZTA 2PJCA 4CGOA 5D29A 2C6CA 2OZUA 2H5MA 4KVOE 3DDDA 1Z9UA 4LQ6A 4A2ZA 1DE4C 2GFQA 4A39A 3NH8A 3JVNA 3R9EA 3V7ZA 3S9LA 2KCWA 3T90A 3D67A 1Z8TA 4ZX8A 4WJBA 1TF9A 3ZZIA 4IF5A 1CP7A 1IGBA 3KHXA 5CBMA 2XEFA 4QVTA 4RUHA 1IOFA 1ZO0A 2P0WA 4AG9A 4PSWA 2ZEMA 2IJZA 5CNPA 4UCNA 1MJBA 3WC5A 2Q4ZA 2EK9A 3QAYA 4OMEA 4AVAA 2QMLA 2K5TA 4P4DA 3BI1A 5AG4A 2V8DA 4OC0A 1CG2A 1LAMA 3KASA 1LOKA 1Z5RA 2F7VA 3KHZA 4IHMA 4P4EA 2ABZA 4B6ZA 4A94A 3D7DA 3W91A 2ATRA 1YREA 4FUUA 2CNSA 3PB7X 2HV2A 4MHPA 3V38A 2CXAA 4OLLA 1CX8A 1H8LA 3GY9A 3PB4X 4CAWA 3D2MA 1YSJA 3K9TA 4B5OA 2R1IA 4UCPA 3OWCA 4ZY0A 4KUBA 1CPSA 1QSNA 3MN8A 4CGNA 4OC4A 5HVFA 1LCPA 1Z4RA 3F0AA 4NGRA 4UIBA 4JXRA 5LRJA 4NGQA 1Z2LA 4P4FA 5K8OA 1AYEA 2A4NA 3GYAA 4OKOA 4IUSA 2PVVA 4MMOA 4OC3A 1IOIA 3PBBA 2D4OA 4JYWA 4XNHB 4CS0B 2JDDA 2Q4YA 3S6KA 3DGVA 4MY3A 4NGPA 1VIXA 3PFEA 1CM0A 2PRQA 4KLVA 2YNCC 4Y49B 1CP6A 2GREA 2PJ0A 3ZJ0A 7CPAA 1M1DA 2EVNA 4R76A 3E0KA 4RS2A 4UWIA 4WWVA 5LRGA 2CTBA 2DPTA 2Y0MA 4UBRA 4A30A 1VHEA 4LX9A 3TX8A 4X2TA 4EVYA 4UEFA 3WC6A 1XE4A 3TCVA 4FD5A 4CAFA 3VARA 1XEBA 2REFA 5KTCA 2AE6A 2G0BA 1NMTA 3PB6X 2ZEDA 4MCRA 2OOTA 5ELYA 1XFOA 2ZOGA 3HLPA 3SJGA 2PJ9A 1FY7A 4FD4A 4PXCA 4UEEA 4CGMA 2B3UA 4F9UA 4LUAA 1YR0A 2QIRA 1MJ9A 3IIBA 1NSAA 2CY2A 5F47A 1XMBA 1IY7A 3ISXA 1KUVA 1A2ZA 3D7FA 3IWGA 3IGRA 4PQAA 2Z3LA 3G3SA 3H4QA 3TTHA 1BLLE 2GIVA 2PJ1A 4KOSA 4DYOA 2CIJA 1MK4A 2IL4A 3MRUA 4NSQA 2ZEPA 2JEVA 3VH9A 4XPKA 4P4BA 1M4LA 3IEHA 1AUGA 2ARHA 4KOYA 5IX3A 2Z10A 2GLJA 3SI0A 3FEEA 4F8ZA 4ZI6A 1EE3P 3C26A 2PR8A 1JQGA 2PJ3A 1LAPA 4P45A 4PSXA 4CAVA 2B4DA 4HNYB 4MBUA 5J8CA 3S9MA 1CBXA 2FL4A 3SJXA 4EFDA 4A31A 4ZYQA 2JLMA 2BUEA 2AFUA 2GANA 2PJ7A 5D8NA 3CXSA 1Q2YA 1XBUA 3R9FA 2PC1A 4R6TA 3PBEA 4L8AA 4P44A 4OIWA 4GXHA 4MHDA 4MCPA 3CT9A 4KOXA 2EUIA 4KS9A 2Q0YA 2PJ4A 4NGNA 2DXQA 3CPXA 6CPAA 2HQYA 3S6FA 5CPAA 5EMIA 3S9NA 2ZEEA 4B10A 1UFHA 1KZFA 2ZELA 4B5PA 2R8VA 3NH4A 1S7NA 2QVPA 2PIZA 2ZEHA 4AVBA 4U9YA 3FRMA 3RAMA 3FMCA 4YWYA 3VWEA 1XJOA 1YLOA 3H5ZA 4NF1A 4NEXA 4NJQA 4X8IA 2B5GA 3I1UA 3TOAA 4A33A 4BMHA 2YNEA 3TE4A 3RBUA 4PK3A 3QAHA 3FVLA 4OC5A 2VI7A 2O28A 3D7HA 4OC1A 4M85A 2BL1A 2RC4A 5K8PA 2YNCA 2HB6A 3TFYA 3PZJA 1KUYA 1SQHA 4CAEA 2FT0A 2OZGA 3JUWA 1TKHA 1YK3A 2J9AA 5LYDA 2Q7BA 3LWUA 4XNHC 4AG7A 3S6GA 4L89A 4ONWA 1B87A 1I21A 1Z8WA 5JM6A 1UWYA 2B4BA 4M6IA 3K9UA 4B13A 1ON0A 3T9YA 4CYQA 2ZOFA 2Q04A 2ZW4A 4MFQA 4BBHA 1BAVA 3FNCA 3CZXA 2JDCA 3KZWA 2FIWA 4PXDA 5H84A 5BWAB 4B14A 2ZEOA 1S60A 4G1PA 4CRZB 4JZ0A 4CPAA 2ANPA 3EO4A 4H2KA 2PQ8A 5J8FA 2JBJA 4PK2A 1NSLA 5IB0A 4JXQA 2GU2A 2C1CA 3PFOA 3B35A 1HEEA 1XMTA 3K2KA 4FD7A 3FX6A 3IWWA 2V8GA 3IJ3A 3MGDA 4H6ZA 4O23A 2NYQA 4OP4A 3H8GA 4MHNA 4ZBGA 1YLEA 1VHOA 1Z8XA 4KSAA 3KL9A 4Z65A 4MFPA 5AGEA 2JEWA 3DSBA 3VWDA 3WABA 2BO9A 1AMPA 1ZLHA 3I9SA 4XPDB 2DF5A 1I1DA 3QNVA 2Q51A 4B11A 3SJFA 4CRYB 2QYVA 3DR8A 3TO9A 1RTQA 1QSOA 4GM5A 4QB9A 4R87A 2AJ6A 4BD9A 1QSTA 3PB8X 3TO7A 3FBUA 3KI9A 4XPLA 1CJWA 5EBVA 4M6HA 3G8WA 5EC4A 2J8NA 4R9MA 5I4MA 4K30A 5FVJA 3KKWA 1ZG7A 1S7KA 2REEA 3PRTA 2CNTA 5F49A 1X10A 4K3NA 2EWBA 5A27A 1N71A 2AFSA 3DNSA 5G20A 3EY5A 3BLNA 4EMEA 1Y7EA 3FIXA 3PB9X 4KOTA 4KUAA 4UFVA 3RYOA 2YNDA 2ODFA 1OZPA 1YX0A 3BHXA 1QSRA 3TC8A 1ARLA 1FNOA 1YW6A 3RZAA 4EWTA 1X12A 5IV0A 3SI1A 5HH1A 4E0AA 1IYLA 5AG5A 1KUXA 3P2HA 2BSWA 2ZW5A 4FBEA 4YFJA 4M6GA 5DWMA 4QUSA 3FYNA 2OR4A 5G21A 4F6AA 4A37A 2ZW6A 3GB0A 5IB9A 4ZGYB 4OAEA 1F2PA 4KVXA 4AB7A 4CGPA 4QC6A 2WSAA 1IB1E 2X7BA 4CYOA 5H86A 1ARMA 4FAIA 3LMSA 3T8WA 4CGLA 1U6MA 4MY0A 2IQ6A 1LFWA 4B5PB 4NFRA 3F8KA 4R3KA 2ZEGA 5G22A 4C7HA 2PJ6A 3D4UA 3HUVA 4MHYA 3LACA 4MCSA 1TKFA 1TXRA 1ZG9A 5K8NA 1QQ9A 4R7MA 5A28A 2PRBA 1YVKA 2B5GB 2ZEFA 2AFMA 1Y9KA 4PPZA 2XEGA 1XOVA 2NSMA 3B3VA 4KORA 4X5KA 4KOVA 5KTDA 4C2XA 4CYPA 4AXVA 2Q43A 1IU8A 1P0HA 3SXNA 4MFLA 3GIUA 2FE7A 1Q7LA 3SJEA 1PUAA 2P6EA 3PP9A 1HDUA 2JBKA 4UWJA 4ZY1A 4A32A 2VZYA 1S5KA 2BEIA 2PJ5A 2C6GA 2WYRA 2B58A 2PJBA 3LD2A 4OC2A 5DWNA 3SHPA 1XRYA 4IAVA 4MRIA 4HNWB 4MCQA 4P6YA 4UIAA 1BO4A 2PSWA 1YVOA 1PYTB 2CNMA 2EK8A 1M4GA 3DLJA 2O4HA 3BXMA 4MXUA 4H6UA 3PGPA 4FD6A 2G3TA 5JH9A 1MJAA 1PU9A 4H89A 3RO0A 2XEIA 1S7FA 2VZZA 5JQ4A 1HDQA 4MFJA 1YMEA 4NJRA 1S7LA 4HNXB 3H8EA 1Y7RA 3GUXA 1Z4EA 3KR5A 1YGHA 2OH1A 4DUKA 2O53A 3CXPA 4P10A 4XPDC 1VGYA 1M44A 1Q2DA 2PCUA 1BPMA 4IK2A 4R3LA 1K4JA 2XEJA 4YRHA 4TNUA 1WK4A 3FH4A 3NE7A 2PDOA 4MFKA 5JPHA 4I49A 4CYNA 4JD6A 3FJUA 2V8VA 3NFZA 1DTDA 4ONUA 1R57A 4PV6A 4Y49C 4YGOA 4DJLA 2I79A 3A9LA 4Q36A 4E8OA 1QSMA 4ORFA 2FVGA 3CPAA 2HC9A 1PCAA 2POKA 4C68A 2PR1A 4YU9A 3W6XA 2FS5A 3B7IA 3D68A 4C7IA 3H8FA 1Y0YA 2PJAA 2VXKA 2ZPAA 3FXTA 2PIYA 4KOWA 4J3GA 1FT7A 3IU1A 5AG6A 1LRZA 4F9VA 1R3NA 1Z8LA 3LODA 4LQGA 4Q7AA 4HPSA 2VL1A 4UA3A 3NH5A 3BJ7A 4TWEA 3WR7A 3DR6A 5C88A 3D8PA 4HKFA 2I3CA 3WC7A
chains in the Genus database with same CATH topology
4JJXA 1IICA 4F0YA 4GS4A 4R57A 2WPWA 1NE9A 3JTKA 1I12A 2YGWA 4II9A 3TOBA 3D3SA 3D2PA 3R1KA 3B8GA 2Z3KA 1M4IA 2R7HA 2VEZA 2B3VA 2NMTA 2VQYA 4E2AA 4MI4A 1Q2CA 2Z3OA 3FB3A 4F0XA 2J8RA 1S3ZA 3EXNA 1VKCA 2ZXVA 2WPXA 1M4DA 2ZW7A 1VHSA 3I3GA 3QB8A 2P6FA 3BJ8A 1IIDA 1P4NA 4U5YA 2R98A 5AG7A 4DNCA 2B4DB 4C2ZA 2Z3NA 3R95A 4JWPA 3TT2A 1B6BA 4A95A 1XF8A 1V0CA 2QECA 4Q38A 4UCMA 2GE3A 4MFZA 4QBJA 1J4JA 2Q44A 4M3SA 3EFAA 5F48A 2FCKA 2Z0ZA 4UFXA 4RI1A 2Z3PA 2D4PA 4MJ8A 1Y9WA 1TIQA 4KLWA 2Z11A 2F5IA 3N7ZA 2VBQA 3EC4A 4KOUA 2FSRA 4NXYA 3P2FA 1BOBA 3R9GA 2I00A 3IU2A 2HUZA 4KVME 1RO5A 2OU2A 5E96A 1WWZA 1IYKA 3GKRA 5KTAA 1XIXA 4KSFA 2FIAA 5GCNA 4NCZA 3TO6A 2C27A 3F5BA 2WUUA 3V8IA 4U9ZA 2Q4VA 3CXQA 3W6SA 4CAXA 5I0CA 3IWEA 1L0CA 4C2YA 5F46A 2DPSA 2Z3MA 2J8MA 2P6GA 5HMNA 2OB0A 1GHEA 2FXFA 3R96A 5C82A 3SXOA 1RXTA 3S6HA 4JLYA 2G3AA 5ISVA 4AVCA 3UY5A 5G1ZA 4UFWA 4OADA 2OZHA 4KZTA 4CGOA 2OZUA 2H5MA 4KVOE 3DDDA 1Z9UA 4A2ZA 3R9EA 3JVNA 2KCWA 3T90A 3ZZIA 4IF5A 4QVTA 1ZO0A 2P0WA 4AG9A 4PSWA 5CNPA 4UCNA 1MJBA 4AVAA 2QMLA 2K5TA 5AG4A 3W91A 2ATRA 1YREA 2CNSA 2HV2A 2CXAA 4OLLA 3GY9A 4CAWA 3D2MA 4B5OA 2R1IA 4UCPA 3OWCA 4KUBA 1QSNA 4CGNA 1Z4RA 3F0AA 4JXRA 3GYAA 2A4NA 4IUSA 2D4OA 4XNHB 4CS0B 2JDDA 2Q4YA 3S6KA 4MY3A 1CM0A 4KLVA 2YNCC 4Y49B 3ZJ0A 1M1DA 2EVNA 4RS2A 3E0KA 4UWIA 2DPTA 2Y0MA 4UBRA 4A30A 4LX9A 4EVYA 1XE4A 3TCVA 4FD5A 4CAFA 1XEBA 2REFA 5KTCA 2AE6A 2G0BA 1NMTA 1FY7A 4FD4A 4CGMA 2B3UA 4LUAA 1YR0A 2QIRA 1MJ9A 2CY2A 5F47A 1KUVA 3IWGA 3IGRA 2Z3LA 3G3SA 3H4QA 3TTHA 2GIVA 4KOSA 1MK4A 2IL4A 4NSQA 2JEVA 4XPKA 2ARHA 4KOYA 5IX3A 2Z10A 3C26A 2PR8A 4PSXA 4CAVA 2B4DA 4HNYB 4MBUA 5J8CA 2FL4A 4A31A 2JLMA 2BUEA 2GANA 3CXSA 1Q2YA 3R9FA 2PC1A 4L8AA 4MHDA 4KOXA 2EUIA 4KS9A 2Q0YA 2DXQA 2HQYA 3S6FA 4B10A 1UFHA 1KZFA 4B5PA 2R8VA 1S7NA 4AVBA 4U9YA 3FRMA 3VWEA 3H5ZA 4NF1A 4NEXA 3TOAA 2B5GA 4A33A 3TE4A 4BMHA 2YNEA 4PK3A 3QAHA 2VI7A 2O28A 4M85A 2BL1A 2RC4A 2YNCA 3TFYA 3PZJA 1KUYA 1SQHA 4CAEA 2FT0A 2OZGA 3JUWA 1YK3A 2Q7BA 4XNHC 4AG7A 3S6GA 4L89A 1B87A 1I21A 2B4BA 3K9UA 4B13A 1ON0A 3T9YA 4CYQA 2ZW4A 2Q04A 4MFQA 4BBHA 3FNCA 2JDCA 2FIWA 5H84A 5BWAB 4B14A 1S60A 4CRZB 3EO4A 5J8FA 2PQ8A 4PK2A 5IB0A 1NSLA 4JXQA 1XMTA 4FD7A 4H6ZA 3MGDA 4ZBGA 4B12A 1YLEA 4KSAA 4MFPA 5AGEA 3DSBA 3VWDA 3I9SA 4XPDB 1I1DA 4B11A 4CRYB 3DR8A 3TO9A 1QSOA 4R87A 4QB9A 2AJ6A 1QSTA 3TO7A 3FBUA 4XPLA 1CJWA 5EBVA 3G8WA 5EC4A 2J8NA 4R9MA 4K30A 5FVJA 3KKWA 1S7KA 2REEA 2CNTA 5F49A 5A27A 1N71A 3DNSA 5G20A 3EY5A 3BLNA 3FIXA 4KOTA 4KUAA 4UFVA 3RYOA 2YNDA 1OZPA 1YX0A 1QSRA 5IV0A 5HH1A 4E0AA 1IYLA 5AG5A 1KUXA 3P2HA 2BSWA 2ZW5A 4YFJA 5DWMA 4QUSA 3FYNA 5G21A 4F6AA 2ZW6A 4ZGYB 4OAEA 4AB7A 4KVXA 4CGPA 4CYOA 4QC6A 2WSAA 1IB1E 2X7BA 5H86A 4CGLA 1U6MA 4MY0A 4B5PB 3F8KA 4R3KA 5G22A 4C7HA 5A28A 2PRBA 1YVKA 2B5GB 1Y9KA 4KORA 4X5KA 4KOVA 5KTDA 4C2XA 1P0HA 3SXNA 4MFLA 2FE7A 1PUAA 2P6EA 3PP9A 4UWJA 4A32A 2VZYA 1S5KA 2BEIA 3LD2A 2B58A 5DWNA 3SHPA 4HNWB 1BO4A 2PSWA 1YVOA 2CNMA 1M4GA 4H6UA 3PGPA 4FD6A 2G3TA 1MJAA 1PU9A 4H89A 1S7FA 2VZZA 5JQ4A 4MFJA 1S7LA 4HNXB 1Y7RA 1Z4EA 1YGHA 2OH1A 3CXPA 4XPDC 1M44A 1Q2DA 4R3LA 1K4JA 4YRHA 1WK4A 3NE7A 2PDOA 4MFKA 5JPHA 4I49A 4CYNA 4JD6A 4ONUA 4PV6A 4YGOA 4Y49C 1R57A 2I79A 3A9LA 4Q36A 4E8OA 1QSMA 4ORFA 4C68A 2PR1A 3W6XA 2FS5A 4C7IA 2ZPAA 2VXKA 3FXTA 4KOWA 4J3GA 5AG6A 3IU1A 1LRZA 3LODA 4UA3A 4CYPA 3BJ7A 3WR7A 3DR6A 5C88A 3D8PA 4HKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JJX A;  1IIC A;  4F0Y A;  4GS4 A;  4R57 A;  2WPW A;  1NE9 A;  4II9 A;  1I12 A;  3TOB A;  3D3S A;  3D2P A;  3R1K A;  3B8G A;  1M4I A;  2R7H A;  2VEZ A;  2B3V A;  2NMT A;  2VQY A;  4E2A A;  4MI4 A;  1Q2C A;  3FB3 A;  2J8R A;  1S3Z A;  3EXN A;  1VKC A;  2ZXV A;  2WPX A;  1M4D A;  2ZW7 A;  1VHS A;  3I3G A;  3QB8 A;  2P6F A;  3BJ8 A;  1IID A;  1P4N A;  4U5Y A;  2R98 A;  4DNC A;  2B4D B;  3R95 A;  4JWP A;  3TT2 A;  1B6B A;  1XF8 A;  1V0C A;  2QEC A;  2GE3 A;  4QBJ A;  1J4J A;  2Q44 A;  4M3S A;  3EFA A;  5F48 A;  2FCK A;  2Z0Z A;  4RI1 A;  2D4P A;  4MJ8 A;  1Y9W A;  1TIQ A;  4KLW A;  2Z11 A;  2F5I A;  3N7Z A;  2VBQ A;  3EC4 A;  4KOU A;  2FSR A;  4NXY A;  3P2F A;  1BOB A;  3R9G A;  2I00 A;  2HUZ A;  4KVM E;  1RO5 A;  2OU2 A;  5E96 A;  1WWZ A;  1IYK A;  3GKR A;  5KTA A;  1XIX A;  2FIA A;  5GCN A;  4NCZ A;  3TO6 A;  2C27 A;  3F5B A;  3V8I A;  4U9Z A;  2Q4V A;  3CXQ A;  3W6S A;  4CAX A;  5I0C A;  1L0C A;  5F46 A;  2J8M A;  2P6G A;  5HMN A;  2OB0 A;  1GHE A;  2FXF A;  3R96 A;  5C82 A;  3SXO A;  1RXT A;  3S6H A;  4JLY A;  2G3A A;  5ISV A;  4AVC A;  3UY5 A;  4OAD A;  2OZH A;  4KZT A;  2OZU A;  2H5M A;  4KVO E;  3DDD A;  1Z9U A;  3R9E A;  3JVN A;  2KCW A;  3T90 A;  3ZZI A;  4IF5 A;  4QVT A;  2P0W A;  4AG9 A;  4PSW A;  5CNP A;  1MJB A;  4AVA A;  2QML A;  2K5T A;  3W91 A;  2ATR A;  1YRE A;  2CNS A;  2HV2 A;  4OLL A;  3GY9 A;  4CAW A;  3D2M A;  4B5O A;  2R1I A;  3OWC A;  4KUB A;  1QSN A;  1Z4R A;  3F0A A;  4JXR A;  3GYA A;  2A4N A;  4IUS A;  2D4O A;  4XNH B;  4CS0 B;  2JDD A;  2Q4Y A;  3S6K A;  4MY3 A;  1CM0 A;  4KLV A;  4Y49 B;  3ZJ0 A;  1M1D A;  2EVN A;  4RS2 A;  3E0K A;  4UWI A;  2Y0M A;  4UBR A;  4LX9 A;  4EVY A;  1XE4 A;  3TCV A;  4FD5 A;  1XEB A;  2REF A;  5KTC A;  2AE6 A;  2G0B A;  1NMT A;  1FY7 A;  4FD4 A;  2B3U A;  4LUA A;  1YR0 A;  2QIR A;  1MJ9 A;  2CY2 A;  5F47 A;  1KUV A;  3IWG A;  3IGR A;  3G3S A;  3H4Q A;  3TTH A;  2GIV A;  4KOS A;  1MK4 A;  2IL4 A;  4NSQ A;  2JEV A;  4XPK A;  2ARH A;  4KOY A;  5IX3 A;  2Z10 A;  3C26 A;  2PR8 A;  4PSX A;  4CAV A;  2B4D A;  4HNY B;  4MBU A;  5J8C A;  2FL4 A;  2JLM A;  2BUE A;  2GAN A;  3CXS A;  1Q2Y A;  3R9F A;  2PC1 A;  4L8A A;  4MHD A;  4KOX A;  2EUI A;  2Q0Y A;  2DXQ A;  2HQY A;  3S6F A;  1UFH A;  1KZF A;  4B5P A;  2R8V A;  1S7N A;  4AVB A;  4U9Y A;  3FRM A;  3VWE A;  4NF1 A;  4NEX A;  3TOA A;  2B5G A;  3TE4 A;  4BMH A;  4PK3 A;  3QAH A;  2VI7 A;  2O28 A;  4M85 A;  2BL1 A;  2RC4 A;  3TFY A;  3PZJ A;  1KUY A;  1SQH A;  2FT0 A;  2OZG A;  3JUW A;  1YK3 A;  2Q7B A;  4XNH C;  4AG7 A;  3S6G A;  4L89 A;  1B87 A;  1I21 A;  2B4B A;  3K9U A;  1ON0 A;  3T9Y A;  2ZW4 A;  2Q04 A;  3FNC A;  2JDC A;  2FIW A;  5H84 A;  1S60 A;  4CRZ B;  3EO4 A;  5J8F A;  2PQ8 A;  4PK2 A;  5IB0 A;  1NSL A;  4JXQ A;  1XMT A;  4FD7 A;  4H6Z A;  3MGD A;  4ZBG A;  1YLE A;  3DSB A;  3VWD A;  3I9S A;  4XPD B;  1I1D A;  4CRY B;  3DR8 A;  3TO9 A;  1QSO A;  4R87 A;  4QB9 A;  2AJ6 A;  1QST A;  3TO7 A;  3FBU A;  4XPL A;  1CJW A;  5EBV A;  3G8W A;  5EC4 A;  2J8N A;  4R9M A;  4K30 A;  5FVJ A;  3KKW A;  1S7K A;  2REE A;  2CNT A;  5F49 A;  1N71 A;  3DNS A;  3EY5 A;  3BLN A;  3FIX A;  4KOT A;  4KUA A;  3RYO A;  1OZP A;  1YX0 A;  1QSR A;  5IV0 A;  5HH1 A;  4E0A A;  1IYL A;  1KUX A;  3P2H A;  2BSW A;  2ZW5 A;  4YFJ A;  5DWM A;  4QUS A;  3FYN A;  4F6A A;  2ZW6 A;  4OAE A;  4AB7 A;  4KVX A;  4QC6 A;  2X7B A;  1IB1 E;  5H86 A;  1U6M A;  4MY0 A;  4B5P B;  3F8K A;  4R3K A;  2PRB A;  1YVK A;  2B5G B;  1Y9K A;  4KOR A;  4X5K A;  4KOV A;  5KTD A;  1P0H A;  3SXN A;  2FE7 A;  1PUA A;  2P6E A;  3PP9 A;  4UWJ A;  2VZY A;  1S5K A;  2BEI A;  3LD2 A;  2B58 A;  5DWN A;  3SHP A;  4HNW B;  1BO4 A;  2PSW A;  1YVO A;  2CNM A;  1M4G A;  4H6U A;  3PGP A;  4FD6 A;  2G3T A;  1MJA A;  1PU9 A;  4H89 A;  1S7F A;  2VZZ A;  5JQ4 A;  1S7L A;  4HNX B;  1Y7R A;  1Z4E A;  1YGH A;  2OH1 A;  3CXP A;  4XPD C;  1M44 A;  1Q2D A;  4R3L A;  1K4J A;  4YRH A;  1WK4 A;  3NE7 A;  2PDO A;  5JPH A;  4I49 A;  4JD6 A;  4ONU A;  4PV6 A;  4YGO A;  4Y49 C;  1R57 A;  2I79 A;  4E8O A;  1QSM A;  4ORF A;  2PR1 A;  3W6X A;  2FS5 A;  2ZPA A;  2VXK A;  3FXT A;  4KOW A;  4J3G A;  1LRZ A;  3LOD A;  4UA3 A;  3BJ7 A;  3WR7 A;  3DR6 A;  5C88 A;  3D8P A;  4HKF A; 
#chains in the Genus database with same CATH topology
 4BIN A;  1ELL P;  4JJX A;  2WZN A;  1IIC A;  1YW4 A;  4F0Y A;  4GS4 A;  3IC1 A;  4R57 A;  2WPW A;  1NE9 A;  3JTK A;  1I12 A;  2YGW A;  5HVH A;  3TOB A;  4II9 A;  3D3S A;  3D2P A;  3FEC A;  3R1K A;  3B8G A;  2Z3K A;  1QMU A;  4P4I A;  1M4I A;  2R7H A;  2V77 A;  2VEZ A;  2B3V A;  5LYI A;  2NMT A;  2VQY A;  4E2A A;  4MI4 A;  1Q2C A;  4ZY2 A;  2Z3O A;  3FB3 A;  4F0X A;  3B3S A;  2J8R A;  1S3Z A;  3EXN A;  1VKC A;  3VAT A;  8CPA A;  2ZXV A;  4MHZ A;  2WPX A;  2QJ8 A;  1M4D A;  2ZW7 A;  1VHS A;  3CDX A;  3I3G A;  1TF8 A;  3B3W A;  3QB8 A;  2P6F A;  3BJ8 A;  1IID A;  1P4N A;  4NGS A;  4U5Y A;  2R98 A;  2BOA A;  3WT4 A;  5LRK A;  5AG7 A;  4DNC A;  1TKJ A;  2B4D B;  5HXD A;  4C2Z A;  1R43 A;  2RFH A;  2Z3N A;  2Q7S A;  3R95 A;  2ZEN A;  5K8M A;  4JWP A;  4R8F A;  2AFW A;  3TT2 A;  3JRU A;  1B6B A;  4A95 A;  1XF8 A;  1V0C A;  2QEC A;  4Q38 A;  4UCM A;  1F2O A;  2GE3 A;  4MFZ A;  1YQE A;  4PXE A;  4QBJ A;  1J4J A;  2DEA A;  2Q44 A;  3EFA A;  4M3S A;  5F48 A;  5JGF A;  4P4J A;  2FCK A;  2Z0Z A;  3KQX A;  3D7G A;  4UFX A;  1CPX A;  1GYT A;  3SI2 A;  3PEI A;  4RI1 A;  2Z3P A;  2D4P A;  3KR4 A;  4MJ8 A;  1Y9W A;  4B12 A;  1TIQ A;  5LYL A;  4KSI A;  1ZG8 A;  2BCO A;  4KLW A;  5F09 A;  2Z11 A;  4X3R A;  2F5I A;  2PJ2 A;  3N7Z A;  2VBQ A;  3EC4 A;  4KOU A;  2FSR A;  4NXY A;  4NGM A;  2PVW A;  3P2F A;  4ZX9 A;  1Y0R A;  1BOB A;  4OID A;  1OBR A;  3R9G A;  3N5F A;  2EO8 A;  2I00 A;  3B2Y A;  2HUZ A;  2PE3 A;  3BI0 A;  1RO5 A;  3IU2 A;  4KVM E;  4W9Y A;  5DS0 A;  5HVG A;  2OU2 A;  2GLF A;  5E96 A;  1WWZ A;  1KWM A;  5THW A;  3NE8 A;  1IYK A;  3L2N A;  3GKR A;  2CTC A;  5KTA A;  1XIX A;  4KSF A;  2FIA A;  5GCN A;  1BPN A;  4NCZ A;  3KGQ A;  2V8H A;  3FED A;  3TO6 A;  2CF4 A;  1JWQ A;  2AFO A;  3B3T A;  2C6P A;  3KQZ A;  2IMO A;  2C27 A;  3F5B A;  2WUU A;  3IFE A;  4PXB A;  3V8I A;  2RB7 A;  3FF3 A;  4A38 A;  1ZLI A;  4U9Z A;  3GLJ A;  2Q4V A;  3B3C A;  3CXQ A;  4UF4 A;  3W6S A;  3RNZ A;  4CAX A;  5I0C A;  3IWE A;  1L0C A;  2G9D A;  2F8H A;  4C2Y A;  5F46 A;  1ELM P;  2DPS A;  2EBJ A;  2Z3M A;  2J8M A;  2P6G A;  4NGT A;  2OB0 A;  5HMN A;  1GHE A;  2FXF A;  4UEZ A;  3R96 A;  5C82 A;  3ISZ A;  1LAN A;  2AFX A;  5LYF A;  3D66 A;  1F57 A;  1RXT A;  3NA6 A;  4FWU A;  3SXO A;  3S6H A;  4JLY A;  2G3A A;  5ISV A;  4AVC A;  3UY5 A;  4RN7 A;  2AFZ A;  5G1Z A;  4UFW A;  5J1Q A;  2PJ8 A;  3IO1 A;  2OZH A;  4OAD A;  4KZT A;  2PJC A;  4CGO A;  5D29 A;  2C6C A;  2OZU A;  2H5M A;  4KVO E;  3DDD A;  1Z9U A;  4LQ6 A;  4A2Z A;  1DE4 C;  2GFQ A;  4A39 A;  3NH8 A;  3JVN A;  3R9E A;  3V7Z A;  3S9L A;  2KCW A;  3T90 A;  3D67 A;  1Z8T A;  4ZX8 A;  4WJB A;  1TF9 A;  3ZZI A;  4IF5 A;  1CP7 A;  1IGB A;  3KHX A;  5CBM A;  2XEF A;  4QVT A;  4RUH A;  1IOF A;  1ZO0 A;  2P0W A;  4AG9 A;  4PSW A;  2ZEM A;  2IJZ A;  5CNP A;  4UCN A;  1MJB A;  3WC5 A;  2Q4Z A;  2EK9 A;  3QAY A;  4OME A;  4AVA A;  2QML A;  2K5T A;  4P4D A;  3BI1 A;  5AG4 A;  2V8D A;  4OC0 A;  1CG2 A;  1LAM A;  3KAS A;  1LOK A;  1Z5R A;  2F7V A;  3KHZ A;  4IHM A;  4P4E A;  2ABZ A;  4B6Z A;  4A94 A;  3D7D A;  3W91 A;  2ATR A;  1YRE A;  4FUU A;  2CNS A;  3PB7 X;  2HV2 A;  4MHP A;  3V38 A;  2CXA A;  4OLL A;  1CX8 A;  1H8L A;  3GY9 A;  3PB4 X;  4CAW A;  3D2M A;  1YSJ A;  3K9T A;  4B5O A;  2R1I A;  4UCP A;  3OWC A;  4ZY0 A;  4KUB A;  1CPS A;  1QSN A;  3MN8 A;  4CGN A;  4OC4 A;  5HVF A;  1LCP A;  1Z4R A;  3F0A A;  4NGR A;  4UIB A;  4JXR A;  5LRJ A;  4NGQ A;  1Z2L A;  4P4F A;  5K8O A;  1AYE A;  2A4N A;  3GYA A;  4OKO A;  4IUS A;  2PVV A;  4MMO A;  4OC3 A;  1IOI A;  3PBB A;  2D4O A;  4JYW A;  4XNH B;  4CS0 B;  2JDD A;  2Q4Y A;  3S6K A;  3DGV A;  4MY3 A;  4NGP A;  1VIX A;  3PFE A;  1CM0 A;  2PRQ A;  4KLV A;  2YNC C;  4Y49 B;  1CP6 A;  2GRE A;  2PJ0 A;  3ZJ0 A;  7CPA A;  1M1D A;  2EVN A;  4R76 A;  3E0K A;  4RS2 A;  4UWI A;  4WWV A;  5LRG A;  2CTB A;  2DPT A;  2Y0M A;  4UBR A;  4A30 A;  1VHE A;  4LX9 A;  3TX8 A;  4X2T A;  4EVY A;  4UEF A;  3WC6 A;  1XE4 A;  3TCV A;  4FD5 A;  4CAF A;  3VAR A;  1XEB A;  2REF A;  5KTC A;  2AE6 A;  2G0B A;  1NMT A;  3PB6 X;  2ZED A;  4MCR A;  2OOT A;  5ELY A;  1XFO A;  2ZOG A;  3HLP A;  3SJG A;  2PJ9 A;  1FY7 A;  4FD4 A;  4PXC A;  4UEE A;  4CGM A;  2B3U A;  4F9U A;  4LUA A;  1YR0 A;  2QIR A;  1MJ9 A;  3IIB A;  1NSA A;  2CY2 A;  5F47 A;  1XMB A;  1IY7 A;  3ISX A;  1KUV A;  1A2Z A;  3D7F A;  3IWG A;  3IGR A;  4PQA A;  2Z3L A;  3G3S A;  3H4Q A;  3TTH A;  1BLL E;  2GIV A;  2PJ1 A;  4KOS A;  4DYO A;  2CIJ A;  1MK4 A;  2IL4 A;  3MRU A;  4NSQ A;  2ZEP A;  2JEV A;  3VH9 A;  4XPK A;  4P4B A;  1M4L A;  3IEH A;  1AUG A;  2ARH A;  4KOY A;  5IX3 A;  2Z10 A;  2GLJ A;  3SI0 A;  3FEE A;  4F8Z A;  4ZI6 A;  1EE3 P;  3C26 A;  2PR8 A;  1JQG A;  2PJ3 A;  1LAP A;  4P45 A;  4PSX A;  4CAV A;  2B4D A;  4HNY B;  4MBU A;  5J8C A;  3S9M A;  1CBX A;  2FL4 A;  3SJX A;  4EFD A;  4A31 A;  4ZYQ A;  2JLM A;  2BUE A;  2AFU A;  2GAN A;  2PJ7 A;  5D8N A;  3CXS A;  1Q2Y A;  1XBU A;  3R9F A;  2PC1 A;  4R6T A;  3PBE A;  4L8A A;  4P44 A;  4OIW A;  4GXH A;  4MHD A;  4MCP A;  3CT9 A;  4KOX A;  2EUI A;  4KS9 A;  2Q0Y A;  2PJ4 A;  4NGN A;  2DXQ A;  3CPX A;  6CPA A;  2HQY A;  3S6F A;  5CPA A;  5EMI A;  3S9N A;  2ZEE A;  4B10 A;  1UFH A;  1KZF A;  2ZEL A;  4B5P A;  2R8V A;  3NH4 A;  1S7N A;  2QVP A;  2PIZ A;  2ZEH A;  4AVB A;  4U9Y A;  3FRM A;  3RAM A;  3FMC A;  4YWY A;  3VWE A;  1XJO A;  1YLO A;  3H5Z A;  4NF1 A;  4NEX A;  4NJQ A;  4X8I A;  2B5G A;  3I1U A;  3TOA A;  4A33 A;  4BMH A;  2YNE A;  3TE4 A;  3RBU A;  4PK3 A;  3QAH A;  3FVL A;  4OC5 A;  2VI7 A;  2O28 A;  3D7H A;  4OC1 A;  4M85 A;  2BL1 A;  2RC4 A;  5K8P A;  2YNC A;  2HB6 A;  3TFY A;  3PZJ A;  1KUY A;  1SQH A;  4CAE A;  2FT0 A;  2OZG A;  3JUW A;  1TKH A;  1YK3 A;  2J9A A;  5LYD A;  2Q7B A;  3LWU A;  4XNH C;  4AG7 A;  3S6G A;  4L89 A;  4ONW A;  1B87 A;  1I21 A;  1Z8W A;  5JM6 A;  1UWY A;  2B4B A;  4M6I A;  3K9U A;  4B13 A;  1ON0 A;  3T9Y A;  4CYQ A;  2ZOF A;  2Q04 A;  2ZW4 A;  4MFQ A;  4BBH A;  1BAV A;  3FNC A;  3CZX A;  2JDC A;  3KZW A;  2FIW A;  4PXD A;  5H84 A;  5BWA B;  4B14 A;  2ZEO A;  1S60 A;  4G1P A;  4CRZ B;  4JZ0 A;  4CPA A;  2ANP A;  3EO4 A;  4H2K A;  2PQ8 A;  5J8F A;  2JBJ A;  4PK2 A;  1NSL A;  5IB0 A;  4JXQ A;  2GU2 A;  2C1C A;  3PFO A;  3B35 A;  1HEE A;  1XMT A;  3K2K A;  4FD7 A;  3FX6 A;  3IWW A;  2V8G A;  3IJ3 A;  3MGD A;  4H6Z A;  4O23 A;  2NYQ A;  4OP4 A;  3H8G A;  4MHN A;  4ZBG A;  1YLE A;  1VHO A;  1Z8X A;  4KSA A;  3KL9 A;  4Z65 A;  4MFP A;  5AGE A;  2JEW A;  3DSB A;  3VWD A;  3WAB A;  2BO9 A;  1AMP A;  1ZLH A;  3I9S A;  4XPD B;  2DF5 A;  1I1D A;  3QNV A;  2Q51 A;  4B11 A;  3SJF A;  4CRY B;  2QYV A;  3DR8 A;  3TO9 A;  1RTQ A;  1QSO A;  4GM5 A;  4QB9 A;  4R87 A;  2AJ6 A;  4BD9 A;  1QST A;  3PB8 X;  3TO7 A;  3FBU A;  3KI9 A;  4XPL A;  1CJW A;  5EBV A;  4M6H A;  3G8W A;  5EC4 A;  2J8N A;  4R9M A;  5I4M A;  4K30 A;  5FVJ A;  3KKW A;  1ZG7 A;  1S7K A;  2REE A;  3PRT A;  2CNT A;  5F49 A;  1X10 A;  4K3N A;  2EWB A;  5A27 A;  1N71 A;  2AFS A;  3DNS A;  5G20 A;  3EY5 A;  3BLN A;  4EME A;  1Y7E A;  3FIX A;  3PB9 X;  4KOT A;  4KUA A;  4UFV A;  3RYO A;  2YND A;  2ODF A;  1OZP A;  1YX0 A;  3BHX A;  1QSR A;  3TC8 A;  1ARL A;  1FNO A;  1YW6 A;  3RZA A;  4EWT A;  1X12 A;  5IV0 A;  3SI1 A;  5HH1 A;  4E0A A;  1IYL A;  5AG5 A;  1KUX A;  3P2H A;  2BSW A;  2ZW5 A;  4FBE A;  4YFJ A;  4M6G A;  5DWM A;  4QUS A;  3FYN A;  2OR4 A;  5G21 A;  4F6A A;  4A37 A;  2ZW6 A;  3GB0 A;  5IB9 A;  4ZGY B;  4OAE A;  1F2P A;  4KVX A;  4AB7 A;  4CGP A;  4QC6 A;  2WSA A;  1IB1 E;  2X7B A;  4CYO A;  5H86 A;  1ARM A;  4FAI A;  3LMS A;  3T8W A;  4CGL A;  1U6M A;  4MY0 A;  2IQ6 A;  1LFW A;  4B5P B;  4NFR A;  3F8K A;  4R3K A;  2ZEG A;  5G22 A;  4C7H A;  2PJ6 A;  3D4U A;  3HUV A;  4MHY A;  3LAC A;  4MCS A;  1TKF A;  1TXR A;  1ZG9 A;  5K8N A;  1QQ9 A;  4R7M A;  5A28 A;  2PRB A;  1YVK A;  2B5G B;  2ZEF A;  2AFM A;  1Y9K A;  4PPZ A;  2XEG A;  1XOV A;  2NSM A;  3B3V A;  4KOR A;  4X5K A;  4KOV A;  5KTD A;  4C2X A;  4CYP A;  4AXV A;  2Q43 A;  1IU8 A;  1P0H A;  3SXN A;  4MFL A;  3GIU A;  2FE7 A;  1Q7L A;  3SJE A;  1PUA A;  2P6E A;  3PP9 A;  1HDU A;  2JBK A;  4UWJ A;  4ZY1 A;  4A32 A;  2VZY A;  1S5K A;  2BEI A;  2PJ5 A;  2C6G A;  2WYR A;  2B58 A;  2PJB A;  3LD2 A;  4OC2 A;  5DWN A;  3SHP A;  1XRY A;  4IAV A;  4MRI A;  4HNW B;  4MCQ A;  4P6Y A;  4UIA A;  1BO4 A;  2PSW A;  1YVO A;  1PYT B;  2CNM A;  2EK8 A;  1M4G A;  3DLJ A;  2O4H A;  3BXM A;  4MXU A;  4H6U A;  3PGP A;  4FD6 A;  2G3T A;  5JH9 A;  1MJA A;  1PU9 A;  4H89 A;  3RO0 A;  2XEI A;  1S7F A;  2VZZ A;  5JQ4 A;  1HDQ A;  4MFJ A;  1YME A;  4NJR A;  1S7L A;  4HNX B;  3H8E A;  1Y7R A;  3GUX A;  1Z4E A;  3KR5 A;  1YGH A;  2OH1 A;  4DUK A;  2O53 A;  3CXP A;  4P10 A;  4XPD C;  1VGY A;  1M44 A;  1Q2D A;  2PCU A;  1BPM A;  4IK2 A;  4R3L A;  1K4J A;  2XEJ A;  4YRH A;  4TNU A;  1WK4 A;  3FH4 A;  3NE7 A;  2PDO A;  4MFK A;  5JPH A;  4I49 A;  4CYN A;  4JD6 A;  3FJU A;  2V8V A;  3NFZ A;  1DTD A;  4ONU A;  1R57 A;  4PV6 A;  4Y49 C;  4YGO A;  4DJL A;  2I79 A;  3A9L A;  4Q36 A;  4E8O A;  1QSM A;  4ORF A;  2FVG A;  3CPA A;  2HC9 A;  1PCA A;  2POK A;  4C68 A;  2PR1 A;  4YU9 A;  3W6X A;  2FS5 A;  3B7I A;  3D68 A;  4C7I A;  3H8F A;  1Y0Y A;  2PJA A;  2VXK A;  2ZPA A;  3FXT A;  2PIY A;  4KOW A;  4J3G A;  1FT7 A;  3IU1 A;  5AG6 A;  1LRZ A;  4F9V A;  1R3N A;  1Z8L A;  3LOD A;  4LQG A;  4Q7A A;  4HPS A;  2VL1 A;  4UA3 A;  3NH5 A;  3BJ7 A;  4TWE A;  3WR7 A;  3DR6 A;  5C88 A;  3D8P A;  4HKF A;  2I3C A;  3WC7 A; 
#chains in the Genus database with same CATH homology
 4JJX A;  1IIC A;  4F0Y A;  4GS4 A;  4R57 A;  2WPW A;  1NE9 A;  3JTK A;  1I12 A;  2YGW A;  4II9 A;  3TOB A;  3D3S A;  3D2P A;  3R1K A;  3B8G A;  2Z3K A;  1M4I A;  2R7H A;  2VEZ A;  2B3V A;  2NMT A;  2VQY A;  4E2A A;  4MI4 A;  1Q2C A;  2Z3O A;  3FB3 A;  4F0X A;  2J8R A;  1S3Z A;  3EXN A;  1VKC A;  2ZXV A;  2WPX A;  1M4D A;  2ZW7 A;  1VHS A;  3I3G A;  3QB8 A;  2P6F A;  3BJ8 A;  1IID A;  1P4N A;  4U5Y A;  2R98 A;  5AG7 A;  4DNC A;  2B4D B;  4C2Z A;  2Z3N A;  3R95 A;  4JWP A;  3TT2 A;  1B6B A;  4A95 A;  1XF8 A;  1V0C A;  2QEC A;  4Q38 A;  4UCM A;  2GE3 A;  4MFZ A;  4QBJ A;  1J4J A;  2Q44 A;  4M3S A;  3EFA A;  5F48 A;  2FCK A;  2Z0Z A;  4UFX A;  4RI1 A;  2Z3P A;  2D4P A;  4MJ8 A;  1Y9W A;  1TIQ A;  4KLW A;  2Z11 A;  2F5I A;  3N7Z A;  2VBQ A;  3EC4 A;  4KOU A;  2FSR A;  4NXY A;  3P2F A;  1BOB A;  3R9G A;  2I00 A;  3IU2 A;  2HUZ A;  4KVM E;  1RO5 A;  2OU2 A;  5E96 A;  1WWZ A;  1IYK A;  3GKR A;  5KTA A;  1XIX A;  4KSF A;  2FIA A;  5GCN A;  4NCZ A;  3TO6 A;  2C27 A;  3F5B A;  2WUU A;  3V8I A;  4U9Z A;  2Q4V A;  3CXQ A;  3W6S A;  4CAX A;  5I0C A;  3IWE A;  1L0C A;  4C2Y A;  5F46 A;  2DPS A;  2Z3M A;  2J8M A;  2P6G A;  5HMN A;  2OB0 A;  1GHE A;  2FXF A;  3R96 A;  5C82 A;  3SXO A;  1RXT A;  3S6H A;  4JLY A;  2G3A A;  5ISV A;  4AVC A;  3UY5 A;  5G1Z A;  4UFW A;  4OAD A;  2OZH A;  4KZT A;  4CGO A;  2OZU A;  2H5M A;  4KVO E;  3DDD A;  1Z9U A;  4A2Z A;  3R9E A;  3JVN A;  2KCW A;  3T90 A;  3ZZI A;  4IF5 A;  4QVT A;  1ZO0 A;  2P0W A;  4AG9 A;  4PSW A;  5CNP A;  4UCN A;  1MJB A;  4AVA A;  2QML A;  2K5T A;  5AG4 A;  3W91 A;  2ATR A;  1YRE A;  2CNS A;  2HV2 A;  2CXA A;  4OLL A;  3GY9 A;  4CAW A;  3D2M A;  4B5O A;  2R1I A;  4UCP A;  3OWC A;  4KUB A;  1QSN A;  4CGN A;  1Z4R A;  3F0A A;  4JXR A;  3GYA A;  2A4N A;  4IUS A;  2D4O A;  4XNH B;  4CS0 B;  2JDD A;  2Q4Y A;  3S6K A;  4MY3 A;  1CM0 A;  4KLV A;  2YNC C;  4Y49 B;  3ZJ0 A;  1M1D A;  2EVN A;  4RS2 A;  3E0K A;  4UWI A;  2DPT A;  2Y0M A;  4UBR A;  4A30 A;  4LX9 A;  4EVY A;  1XE4 A;  3TCV A;  4FD5 A;  4CAF A;  1XEB A;  2REF A;  5KTC A;  2AE6 A;  2G0B A;  1NMT A;  1FY7 A;  4FD4 A;  4CGM A;  2B3U A;  4LUA A;  1YR0 A;  2QIR A;  1MJ9 A;  2CY2 A;  5F47 A;  1KUV A;  3IWG A;  3IGR A;  2Z3L A;  3G3S A;  3H4Q A;  3TTH A;  2GIV A;  4KOS A;  1MK4 A;  2IL4 A;  4NSQ A;  2JEV A;  4XPK A;  2ARH A;  4KOY A;  5IX3 A;  2Z10 A;  3C26 A;  2PR8 A;  4PSX A;  4CAV A;  2B4D A;  4HNY B;  4MBU A;  5J8C A;  2FL4 A;  4A31 A;  2JLM A;  2BUE A;  2GAN A;  3CXS A;  1Q2Y A;  3R9F A;  2PC1 A;  4L8A A;  4MHD A;  4KOX A;  2EUI A;  4KS9 A;  2Q0Y A;  2DXQ A;  2HQY A;  3S6F A;  4B10 A;  1UFH A;  1KZF A;  4B5P A;  2R8V A;  1S7N A;  4AVB A;  4U9Y A;  3FRM A;  3VWE A;  3H5Z A;  4NF1 A;  4NEX A;  3TOA A;  2B5G A;  4A33 A;  3TE4 A;  4BMH A;  2YNE A;  4PK3 A;  3QAH A;  2VI7 A;  2O28 A;  4M85 A;  2BL1 A;  2RC4 A;  2YNC A;  3TFY A;  3PZJ A;  1KUY A;  1SQH A;  4CAE A;  2FT0 A;  2OZG A;  3JUW A;  1YK3 A;  2Q7B A;  4XNH C;  4AG7 A;  3S6G A;  4L89 A;  1B87 A;  1I21 A;  2B4B A;  3K9U A;  4B13 A;  1ON0 A;  3T9Y A;  4CYQ A;  2ZW4 A;  2Q04 A;  4MFQ A;  4BBH A;  3FNC A;  2JDC A;  2FIW A;  5H84 A;  5BWA B;  4B14 A;  1S60 A;  4CRZ B;  3EO4 A;  5J8F A;  2PQ8 A;  4PK2 A;  5IB0 A;  1NSL A;  4JXQ A;  1XMT A;  4FD7 A;  4H6Z A;  3MGD A;  4ZBG A;  4B12 A;  1YLE A;  4KSA A;  4MFP A;  5AGE A;  3DSB A;  3VWD A;  3I9S A;  4XPD B;  1I1D A;  4B11 A;  4CRY B;  3DR8 A;  3TO9 A;  1QSO A;  4R87 A;  4QB9 A;  2AJ6 A;  1QST A;  3TO7 A;  3FBU A;  4XPL A;  1CJW A;  5EBV A;  3G8W A;  5EC4 A;  2J8N A;  4R9M A;  4K30 A;  5FVJ A;  3KKW A;  1S7K A;  2REE A;  2CNT A;  5F49 A;  5A27 A;  1N71 A;  3DNS A;  5G20 A;  3EY5 A;  3BLN A;  3FIX A;  4KOT A;  4KUA A;  4UFV A;  3RYO A;  2YND A;  1OZP A;  1YX0 A;  1QSR A;  5IV0 A;  5HH1 A;  4E0A A;  1IYL A;  5AG5 A;  1KUX A;  3P2H A;  2BSW A;  2ZW5 A;  4YFJ A;  5DWM A;  4QUS A;  3FYN A;  5G21 A;  4F6A A;  2ZW6 A;  4ZGY B;  4OAE A;  4AB7 A;  4KVX A;  4CGP A;  4CYO A;  4QC6 A;  2WSA A;  1IB1 E;  2X7B A;  5H86 A;  4CGL A;  1U6M A;  4MY0 A;  4B5P B;  3F8K A;  4R3K A;  5G22 A;  4C7H A;  5A28 A;  2PRB A;  1YVK A;  2B5G B;  1Y9K A;  4KOR A;  4X5K A;  4KOV A;  5KTD A;  4C2X A;  1P0H A;  3SXN A;  4MFL A;  2FE7 A;  1PUA A;  2P6E A;  3PP9 A;  4UWJ A;  4A32 A;  2VZY A;  1S5K A;  2BEI A;  3LD2 A;  2B58 A;  5DWN A;  3SHP A;  4HNW B;  1BO4 A;  2PSW A;  1YVO A;  2CNM A;  1M4G A;  4H6U A;  3PGP A;  4FD6 A;  2G3T A;  1MJA A;  1PU9 A;  4H89 A;  1S7F A;  2VZZ A;  5JQ4 A;  4MFJ A;  1S7L A;  4HNX B;  1Y7R A;  1Z4E A;  1YGH A;  2OH1 A;  3CXP A;  4XPD C;  1M44 A;  1Q2D A;  4R3L A;  1K4J A;  4YRH A;  1WK4 A;  3NE7 A;  2PDO A;  4MFK A;  5JPH A;  4I49 A;  4CYN A;  4JD6 A;  4ONU A;  4PV6 A;  4YGO A;  4Y49 C;  1R57 A;  2I79 A;  3A9L A;  4Q36 A;  4E8O A;  1QSM A;  4ORF A;  4C68 A;  2PR1 A;  3W6X A;  2FS5 A;  4C7I A;  2ZPA A;  2VXK A;  3FXT A;  4KOW A;  4J3G A;  5AG6 A;  3IU1 A;  1LRZ A;  3LOD A;  4UA3 A;  4CYP A;  3BJ7 A;  3WR7 A;  3DR6 A;  5C88 A;  3D8P A;  4HKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...