1PU9A

Crystal structure of tetrahymena gcn5 with bound coenzyme a and a 19-residue histone h3 peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
163
structure length
163
Chain Sequence
LLDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/structural protein
molecule keywords HAT A1
publication title Structural basis for histone and phospho-histone binding by the GCN5 histone acetyltransferase
pubmed doi rcsb
source organism Tetrahymena thermophila
total genus 44
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2003-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1pu9A00
3GKRA 2CY2A 3G3SA 2ARHA 3QAHA 5KTDA 4XPKA 3RYOA 1PU9A 3PP9A 1YGHA 2ATRA 1XF8A 5ISVA 1Z9UA 1KUXA 4XPDC 4AVCA 4R57A 5KTAA 3JVNA 1IIDA 3DR6A 4KZTA 5C88A 2VZZA 3SXOA 3R1KA 2FIWA 3EO4A 3LODA 2VEZA 3S6KA 2PR8A 4B5PB 4KLWA 4AB7A 2FE7A 2O28A 1I12A 3FIXA 3EFAA 4AVAA 4EVYA 5J8CA 4ZBGA 4KOVA 1WWZA 2GE3A 4Y49B 4MY3A 3D2MA 3SXNA 3GYAA 3BLNA 3G8WA 4AVBA 3K9UA 4KORA 2EUIA 1Z4RA 3B8GA 3D2PA 4QUSA 4U5YA 2OU2A 5HH1A 3VWDA 3P2HA 3OWCA 1Z4EA 3TOBA 4L8AA 2VZYA 2P6FA 1Q2CA 4MJ8A 2ZW7A 1QSTA 4R87A 2VI7A 1XIXA 1M4IA 4KUBA 4KOYA 4ORFA 4IF5A 2Q04A 4F6AA 3TE4A 5E96A 2F5IA 4JJXA 3TCVA 2B4DB 1IICA 4RI1A 1ON0A 4RS2A 2HQYA 2OZUA 4KVME 1MJAA 3R9FA 4PSWA 2AJ6A 2JLMA 3QB8A 2FCKA 1BOBA 3FYNA 2WPXA 4K30A 2G3AA 4M3SA 4MHDA 4YRHA 2PDOA 4U9YA 3DR8A 5F48A 2CNSA 2B5GB 4I49A 5IB0A 4OAEA 1YX0A 3R9EA 5F46A 3F0AA 4PK3A 4KOXA 2GANA 5KTCA 2RC4A 1VKCA 2OH1A 4CAVA 2JDDA 5H84A 1QSRA 4E2AA 4FD7A 2VXKA 1N71A 3GY9A 4UWJA 3TO9A 4FD5A 4MBUA 4MI4A 4HKFA 1QSNA 3EC4A 3R9GA 1Q2YA 3W91A 4X5KA 4J3GA 1VHSA 2D4PA 5DWMA 3DSBA 2Q0YA 1GHEA 2B58A 5C82A 3W6XA 1XEBA 3T90A 3TT2A 5DWNA 1B87A 4NEXA 4JLYA 1IYKA 3I3GA 2ZW4A 4H6ZA 2H5MA 4DNCA 3FNCA 3S6GA 3FB3A 2REFA 1QSOA 1NSLA 2FSRA 4FD6A 4AG9A 4LUAA 3CXPA 2J8MA 2Y0MA 1IYLA 4LX9A 3ZJ0A 2C27A 2K5TA 4XPLA 1SQHA 4XNHB 1L0CA 1IB1E 2ZPAA 2BL1A 3F5BA 2A4NA 2PRBA 2FS5A 1K4JA 2CNMA 5H86A 2Q7BA 2GIVA 4PSXA 3T9YA 4Y49C 3TO7A 3LD2A 1XMTA 5F49A 4KVXA 2P6GA 1U6MA 2OZGA 1KUYA 3ZZIA 2J8RA 4BMHA 1YLEA 5JQ4A 5IX3A 4NSQA 4CRZB 2AE6A 3BJ7A 3KKWA 2I00A 3EXNA 3TOAA 2ZW6A 4UBRA 4L89A 3DDDA 3NE7A 1NE9A 5FVJA 1CJWA 1YVKA 3WR7A 2QMLA 1S7LA 4F0YA 2R8VA 3S6HA 2IL4A 2G3TA 3S6FA 1YVOA 2P0WA 4NCZA 3TTHA 3V8IA 1YR0A 2BUEA 4UA3A 1MJ9A 4KOUA 5J8FA 1XE4A 4KOWA 3P2FA 1KZFA 2PSWA 4KOSA 1KUVA 1V0CA 1P0HA 4B5PA 1M44A 1RO5A 3R95A 4NF1A 4MY0A 3FBUA 4GS4A 4OADA 3PZJA 2OZHA 2PR1A 2HUZA 1FY7A 2OB0A 2R7HA 1I1DA 1MJBA 3TO6A 1S7NA 2I79A 2PC1A 4M85A 2Z11A 2Q4VA 2FL4A 1J4JA 4NXYA 4JWPA 2DXQA 2FIAA 4YGOA 4R3KA 3TFYA 2BSWA 2EVNA 3I9SA 1S7FA 1S3ZA 2FXFA 2X7BA 4YFJA 3FXTA 2Z0ZA 1BO4A 3CXSA 4IUSA 2G0BA 1NMTA 4U9ZA 4R9MA 3FRMA 1OZPA 1CM0A 4H6UA 4QBJA 4B5OA 2J8NA 3R96A 5CNPA 1MK4A 4ONUA 4PK2A 4AG7A 1LRZA 3EY5A 4QVTA 4JD6A 3IGRA 1UFHA 2JEVA 2B4DA 3F8KA 2FT0A 2Q4YA 4KLVA 4R3LA 2D4OA 1Y9WA 3E0KA 3DNSA 3JUWA 2Z10A 3CXQA 4CAWA 2VBQA 2VQYA 4CRYB 2B3VA 1S60A 2QIRA 1P4NA 4PV6A 1RXTA 1TIQA 4KVOE 4XNHC 2ZXVA 3W6SA 2B5GA 2ZW5A 1B6BA 4UWIA 2R1IA 4KOTA 3VWEA 1I21A 5JPHA 1S7KA 3SHPA 1QSMA 4E0AA 4HNWB 2REEA 1YK3A 4H89A 1Q2DA 2NMTA 5EBVA 2HV2A 2QECA 1Y9KA 2P6EA 1S5KA 2PQ8A 4CS0B 4QB9A 1M4DA 2B4BA 4JXRA 1WK4A 5EC4A 4JXQA 1M1DA 4FD4A 3UY5A 2WPWA 1R57A 2B3UA 3BJ8A 2BEIA 2JDCA 2KCWA 3IWGA 3N7ZA 2CNTA 1M4GA 4E8OA 1YREA 5GCNA 4QC6A 3D3SA 3PGPA 5F47A 3D8PA 4KUAA 1Y7RA 2Q44A 5I0CA 4II9A 4XPDB 4HNXB 4HNYB 4CAXA 3MGDA 5HMNA 5IV0A 1PUAA 2R98A 3H4QA 3C26A 4OLLA
chains in the Genus database with same CATH superfamily
3GKRA 2CY2A 2AFOA 2PJ1A 3CPAA 3G3SA 2ARHA 3QAHA 5HVHA 4MCSA 2CIJA 5KTDA 2WZNA 4XPKA 3RYOA 2ZOGA 4R7MA 1LAMA 1PU9A 3PP9A 2JBJA 4MXUA 4Q36A 4MFPA 3KGQA 3SJXA 1YGHA 4A94A 2ATRA 1XF8A 1X12A 2EWBA 1ELLP 5ISVA 4CYPA 1Z9UA 4GXHA 2NSMA 1KUXA 2Z3PA 3KHXA 4XPDC 4NJRA 3RAMA 4AVCA 2JEWA 2V77A 2XEGA 5AGEA 4OC2A 4OP4A 1YW4A 1Y0RA 3PB9X 1VHOA 2PJ8A 4PXCA 1LCPA 4R57A 3JVNA 1CPXA 3FH4A 1IIDA 3SJGA 1ELMP 3DR6A 4KZTA 1CX8A 4FBEA 2VZZA 3SXOA 5C88A 2XEJA 3R1KA 2FIWA 3EO4A 3LODA 2VEZA 3S6KA 3CZXA 4B6ZA 5A27A 2PR8A 4NGNA 5KTAA 1BPMA 3WC7A 4B5PB 1LAPA 5J1QA 1TXRA 1XFOA 4KLWA 4AB7A 2FE7A 4X8IA 3B3WA 4AXVA 4IHMA 2O28A 1I12A 2FVGA 3EFAA 3FIXA 2Z3MA 3S9MA 4A2ZA 2ANPA 4A31A 4AVAA 4GM5A 4M6GA 1XBUA 2ZEFA 5CPAA 4EVYA 4PXBA 2DPSA 4ZBGA 1Z8XA 4C7IA 5J8CA 4KOVA 1WWZA 2GE3A 4Y49B 2ZENA 4MY3A 3D2MA 5LYIA 3SXNA 4KS9A 5BWAB 3GYAA 3BLNA 3G8WA 4NJQA 4AVBA 3K9UA 2DEAA 1Z8LA 3RNZA 4KORA 2EUIA 1A2ZA 1Z4RA 3B8GA 3IU1A 1ZG9A 4PPZA 3D2PA 3T8WA 2PJ0A 4QUSA 3BI1A 4U5YA 2OU2A 5HH1A 3VWDA 3P2HA 4IAVA 2Z3KA 4OC0A 3OWCA 1Z4EA 3TOBA 4L8AA 4CYOA 2VZYA 2P6FA 1Q2CA 3RZAA 3RO0A 4MJ8A 2CF4A 1KWMA 1YLOA 2ZW7A 2ZEPA 1QSTA 1NSAA 4R87A 2VI7A 1XIXA 3FEEA 1M4IA 5G21A 4KUBA 4KOYA 4KSIA 4ORFA 3PB4X 4IF5A 2Q04A 4F6AA 3VATA 3TE4A 5E96A 3MN8A 2F5IA 2PJ2A 3RBUA 3B3SA 4JJXA 3TCVA 2B4DB 5I4MA 5K8PA 4CGOA 4NGTA 1IICA 1ZG7A 4RI1A 4DJLA 1ON0A 3D66A 4UFXA 1LOKA 2ZOFA 1BAVA 1Z8TA 1IY7A 2YNCC 4C2XA 1FNOA 4RS2A 2HQYA 5IB9A 2OZUA 4KVME 1TF9A 1MJAA 3TC8A 1F2OA 4F0XA 4C68A 1Z5RA 1ZLHA 3NA6A 1IOIA 3D68A 4PSWA 3R9FA 1TKJA 3KZWA 1CG2A 3B3TA 7CPAA 2EK8A 6CPAA 4CYQA 1IGBA 2AJ6A 2POKA 2JLMA 2QYVA 3QAYA 1R43A 4A39A 1M4LA 3D7HA 3QB8A 2FCKA 1BOBA 3HUVA 4OC3A 2O53A 3FYNA 2WPXA 4K30A 4O23A 4P10A 4F9UA 2OR4A 4P44A 4UEFA 3LMSA 2G3AA 4M3SA 4MHDA 4YRHA 1Z2LA 2ZEOA 2PDOA 2QJ8A 2C1CA 4U9YA 1QMUA 3DR8A 5F48A 3WABA 2CNSA 2B5GB 1CPSA 4R76A 4K3NA 4I49A 5IB0A 3FX6A 3BI0A 4MHNA 4OAEA 1YX0A 3R9EA 5F46A 3F0AA 4MHYA 4OKOA 4PK3A 4KOXA 3ISXA 5LYFA 1ZLIA 2V8DA 5DS0A 1UWYA 2GANA 2PVVA 4MCRA 5A28A 2Z3NA 5LRKA 1YMEA 2WSAA 5KTCA 2RC4A 1VKCA 2OH1A 4LQ6A 4CAVA 2JDDA 5H84A 1XJOA 1QSRA 4E2AA 2GFQA 4UEZA 4FD7A 2VXKA 3IWWA 3HLPA 1N71A 3GY9A 4UWJA 3TO9A 1X10A 4FD5A 4P4IA 4MBUA 4MRIA 4MI4A 1ARLA 4HKFA 2VL1A 2Z3OA 3KQZA 1QSNA 1AYEA 1YSJA 3EC4A 3S9LA 3KL9A 3R9GA 4BD9A 3H8GA 1Q2YA 4CPAA 1QQ9A 4X5KA 4J3GA 3W91A 5JM6A 3A9LA 4CAFA 5G1ZA 1VHSA 2D4PA 5DWMA 3DSBA 4CGLA 1VGYA 2Q0YA 1GHEA 4OC4A 2B58A 4NGRA 4OC1A 5C82A 3W6XA 1ZG8A 5G22A 1XEBA 1R3NA 2DPTA 3T90A 1F2PA 5DWNA 3TT2A 3K9TA 1B87A 4Q7AA 4NEXA 3H8EA 4MFKA 3CPXA 1IYKA 4JLYA 3I3GA 3NFZA 1DTDA 3GB0A 2ZW4A 3LACA 4H6ZA 4UFVA 2H5MA 2Q4ZA 1TKFA 4DNCA 3FNCA 3S6GA 2AFWA 3FB3A 4JYWA 2G9DA 1PCAA 2REFA 1JWQA 4MCQA 4IK2A 4BBHA 2PJ5A 2Z3LA 4DUKA 1QSOA 3KR5A 4MMOA 1NSLA 1YW6A 2FSRA 4FD6A 4X3RA 4AG9A 4DYOA 5JGFA 4ZX9A 4LUAA 3CXPA 2V8GA 2J8MA 2Y0MA 1IYLA 1H8LA 4LX9A 4A30A 3ZJ0A 4B12A 2C27A 2K5TA 4OIWA 4XPLA 2PIYA 1SQHA 4XNHB 1L0CA 1IB1E 2AFXA 2PRQA 3QNVA 2GREA 2ZPAA 3GIUA 3FF3A 5HVFA 4P4FA 4FAIA 2BL1A 4P4DA 2C6PA 3F5BA 4ZI6A 4B10A 2A4NA 4OMEA 2PRBA 3KI9A 3PFOA 1DE4C 3DLJA 2FS5A 3B7IA 1K4JA 2PVWA 2CNMA 5H86A 2Q7BA 2NYQA 3PBBA 4UF4A 2GIVA 4PSXA 3T9YA 4Y49C 2YNEA 3TO7A 1FT7A 1OBRA 3LD2A 3D7FA 1XMTA 5F49A 4TNUA 4ZGYB 4ZY1A 4A95A 4M6HA 4KVXA 4UIBA 2P6GA 1U6MA 2OZGA 2PJCA 4ZY0A 1KUYA 3ZZIA 2PJ7A 2J8RA 4MFLA 3WC5A 4BMHA 3PB8X 1F57A 1YLEA 2F8HA 3JRUA 4X2TA 5JQ4A 5IX3A 4EWTA 4MHPA 4NSQA 2ABZA 3KR4A 4CRZB 2AE6A 2AFUA 3BJ7A 3KKWA 3PB6X 3K2KA 2I00A 2EK9A 3EXNA 2ZW6A 4HPSA 3TOAA 4UBRA 4L89A 3D4UA 3SI2A 4OIDA 3DDDA 4R8FA 2ODFA 3NE7A 1NE9A 4C7HA 5FVJA 3NH4A 4MHZA 3CT9A 3KASA 4CGMA 1TKHA 5K8MA 1CJWA 4ONWA 1ARMA 4A33A 3VARA 2Q7SA 1YVKA 3WR7A 4MFQA 2QMLA 1S7LA 4WWVA 3D67A 2ZEMA 3B35A 4F0YA 2R8VA 2CTCA 2IL4A 3IEHA 2G3TA 2J9AA 3S6HA 3ISZA 4JZ0A 3S6FA 3SI0A 1Z8WA 2GLJA 4A38A 1YVOA 5THWA 4TWEA 4UCMA 5CBMA 2DF5A 2P0WA 3DGVA 4NCZA 4P4JA 3TTHA 1ZO0A 3V8IA 1YR0A 2BUEA 4CYNA 1HDUA 4RN7A 4UA3A 1CBXA 2ZEHA 3NH5A 3S9NA 2QVPA 5AG7A 4B14A 1MJ9A 4KOUA 4P4BA 4P6YA 4Z65A 2Q51A 5J8FA 1XE4A 3H8FA 4NGPA 3PEIA 4KOWA 4RUHA 3P2FA 1KZFA 2PSWA 3IC1A 4KSAA 4WJBA 4B13A 4NGQA 4KOSA 1XMBA 1KUVA 4MFZA 1V0CA 4F9VA 1VHEA 2IJZA 2PJ3A 1P0HA 3SJEA 4B5PA 1M44A 1RO5A 2GU2A 1JQGA 4UFWA 4NF1A 3R95A 4MY0A 5JH9A 3WT4A 3FBUA 5AG5A 4GS4A 3NH8A 4OADA 2IMOA 2OZHA 3PZJA 2PJ4A 4YWYA 2PR1A 1Y0YA 1FY7A 2HUZA 2OB0A 2R7HA 1I1DA 3L2NA 2WYRA 1MJBA 2CXAA 3TO6A 1S7NA 2EBJA 2I79A 4A32A 2HC9A 2PC1A 4M85A 5ELYA 2Z11A 1VIXA 2Q4VA 2FL4A 1J4JA 1AUGA 4NXYA 4JWPA 2DXQA 2FIAA 4PQAA 1AMPA 3I1UA 2RB7A 3KQXA 4YGOA 2F7VA 5HXDA 4R3KA 3TFYA 2BSWA 4NFRA 2EVNA 2AFSA 3I9SA 1S7FA 3D7DA 1S3ZA 2FXFA 2X7BA 2XEFA 3BHXA 3FXTA 4PXDA 2Z0ZA 1BO4A 3WC6A 4YFJA 2PJAA 3CXSA 4IUSA 2G0BA 2ZEEA 1NMTA 5LRGA 4U9ZA 3FMCA 4R9MA 3FRMA 2YNCA 3LWUA 3TX8A 2GLFA 1OZPA 3NE8A 1CM0A 4H6UA 2OOTA 1HDQA 4QBJA 3PRTA 4B5OA 2YGWA 2ZEDA 2J8NA 3IFEA 3R96A 4P45A 2PJBA 5CNPA 1IU8A 5F09A 1MK4A 4ONUA 4PK2A 2BCOA 4AG7A 2V8HA 1LRZA 3EY5A 4Q38A 4QVTA 4JD6A 4BINA 3IGRA 1LFWA 1UFHA 3B3VA 4UCPA 2JEVA 2JBKA 1XRYA 2B4DA 1Y7EA 2RFHA 2PJ6A 4F8ZA 1Q7LA 3V7ZA 2I3CA 3IO1A 3F8KA 2FT0A 2Q4YA 4KLVA 4R3LA 4YU9A 3VH9A 2PE3A 3FJUA 5G20A 8CPAA 2D4OA 1Y9WA 3D7GA 3E0KA 3DNSA 4KSFA 5AG6A 3V38A 2CTBA 3JUWA 2Z10A 3CXQA 4CGNA 2PCUA 5LYDA 4FUUA 2VBQA 4CAWA 2VQYA 2YNDA 3FEDA 1IOFA 4CRYB 1HEEA 5K8NA 4C2ZA 2PJ9A 2B3VA 2BO9A 4NGMA 1S60A 2QIRA 4OC5A 1P4NA 2ZEGA 5EMIA 4PV6A 1RXTA 3GLJA 4LQGA 2O4HA 4UIAA 1TIQA 5HVGA 4KVOE 4XNHC 1LANA 2ZXVA 4FWUA 4ZY2A 4PXEA 3W6SA 2B5GA 4UEEA 4C2YA 2ZW5A 4ZYQA 1B6BA 2XEIA 4R6TA 2AFMA 4UWIA 2R1IA 4KOTA 3SI1A 4G1PA 2C6CA 4M6IA 3VWEA 1I21A 2V8VA 4MFJA 5JPHA 1S7KA 3H5ZA 2PIZA 3SHPA 2HB6A 3PFEA 1QSMA 4P4EA 2WUUA 4E0AA 4HNWB 2REEA 1YK3A 4H89A 1Q2DA 1PYTB 5D29A 2NMTA 2Q43A 2HV2A 5EBVA 5LRJA 1YQEA 2QECA 4MCPA 4H2KA 1TF8A 1Y9KA 2P6EA 4B11A 1CP6A 1S5KA 2PQ8A 4CS0B 4QB9A 1M4DA 3FECA 2B4BA 4EFDA 5LYLA 3PB7X 1WK4A 3BXMA 4JXRA 4NGSA 5EC4A 4ZX8A 4JXQA 3B2YA 3B3CA 2EO8A 1M1DA 4UCNA 1BLLE 4FD4A 3UY5A 2WPWA 1R57A 2B3UA 3BJ8A 3PBEA 2BEIA 2C6GA 3IIBA 2AFZA 2JDCA 2KCWA 3IWGA 3IWEA 3N7ZA 2CNTA 3IU2A 1M4GA 3FVLA 2BOAA 3GUXA 4E8OA 1YREA 5GCNA 4QC6A 3D3SA 2ZELA 1RTQA 3CDXA 3PGPA 4CGPA 5F47A 3D8PA 3MRUA 4KUAA 4W9YA 5D8NA 1BPNA 4CAEA 1Y7RA 3KHZA 1GYTA 4A37A 2Q44A 2IQ6A 5AG4A 5I0CA 4EMEA 4II9A 4XPDB 4HNXB 4HNYB 4CAXA 1CP7A 3JTKA 3MGDA 5HMNA 5IV0A 1PUAA 1EE3P 5K8OA 2R98A 1XOVA 3H4QA 4OLLA 3SJFA 3C26A 3N5FA 3IJ3A
chains in the Genus database with same CATH topology
3GKRA 2CY2A 3G3SA 2ARHA 3QAHA 5KTDA 4XPKA 3RYOA 1PU9A 3PP9A 4Q36A 4MFPA 1YGHA 2ATRA 1XF8A 5ISVA 4CYPA 1Z9UA 1KUXA 2Z3PA 4XPDC 4AVCA 5AGEA 4R57A 5KTAA 3JVNA 1IIDA 3DR6A 4KZTA 5C88A 2VZZA 3SXOA 3R1KA 2FIWA 3EO4A 3LODA 2VEZA 3S6KA 5A27A 2PR8A 4B5PB 4KLWA 4AB7A 2FE7A 2O28A 1I12A 3FIXA 3EFAA 4A2ZA 2Z3MA 4A31A 4AVAA 4EVYA 2DPSA 4ZBGA 4C7IA 5J8CA 4KOVA 1WWZA 2GE3A 4Y49B 4MY3A 3D2MA 3SXNA 4KS9A 5BWAB 3GYAA 3BLNA 3G8WA 4AVBA 3K9UA 4KORA 2EUIA 1Z4RA 3B8GA 3IU1A 3D2PA 4QUSA 4U5YA 2OU2A 5HH1A 3VWDA 3P2HA 2Z3KA 3OWCA 1Z4EA 3TOBA 4L8AA 4CYOA 2VZYA 2P6FA 1Q2CA 4MJ8A 2ZW7A 1QSTA 4R87A 2VI7A 1XIXA 1M4IA 5G21A 4KUBA 4KOYA 4ORFA 4IF5A 2Q04A 4F6AA 3TE4A 5E96A 2F5IA 4JJXA 3TCVA 2B4DB 4CGOA 1IICA 4RI1A 1ON0A 4UFXA 2YNCC 4C2XA 4RS2A 2HQYA 2OZUA 4KVME 1MJAA 4F0XA 4C68A 3R9FA 4PSWA 4CYQA 2AJ6A 2JLMA 3QB8A 2FCKA 1BOBA 3FYNA 2WPXA 4K30A 2G3AA 4M3SA 4MHDA 4YRHA 2PDOA 4U9YA 3DR8A 5F48A 2CNSA 2B5GB 4I49A 5IB0A 4OAEA 1YX0A 3R9EA 5F46A 3F0AA 4PK3A 4KOXA 2GANA 5A28A 2Z3NA 2WSAA 5KTCA 2RC4A 1VKCA 2OH1A 4CAVA 2JDDA 5H84A 1QSRA 4E2AA 4FD7A 2VXKA 1N71A 3GY9A 4UWJA 3TO9A 4FD5A 4MBUA 4MI4A 4HKFA 2Z3OA 1QSNA 3EC4A 3R9GA 1Q2YA 3W91A 4X5KA 4J3GA 3A9LA 4CAFA 5G1ZA 1VHSA 2D4PA 5DWMA 3DSBA 4CGLA 2Q0YA 1GHEA 2B58A 5C82A 3W6XA 5G22A 1XEBA 3T90A 2DPTA 3TT2A 5DWNA 1B87A 4NEXA 4MFKA 4JLYA 1IYKA 3I3GA 2ZW4A 4H6ZA 4UFVA 2H5MA 4DNCA 3FNCA 3S6GA 3FB3A 2REFA 2Z3LA 1QSOA 1NSLA 2FSRA 4FD6A 4AG9A 4LUAA 3CXPA 2J8MA 2Y0MA 1IYLA 4LX9A 4A30A 3ZJ0A 4B12A 2C27A 2K5TA 4XPLA 1SQHA 4XNHB 1L0CA 1IB1E 2ZPAA 2BL1A 3F5BA 4B10A 2A4NA 2PRBA 2FS5A 1K4JA 2CNMA 5H86A 2Q7BA 2GIVA 4PSXA 3T9YA 4Y49C 2YNEA 3TO7A 3LD2A 1XMTA 5F49A 4ZGYB 4A95A 4KVXA 2P6GA 1U6MA 2OZGA 1KUYA 3ZZIA 2J8RA 4MFLA 4BMHA 1YLEA 5JQ4A 5IX3A 4NSQA 4CRZB 2AE6A 3BJ7A 3KKWA 2I00A 3EXNA 3TOAA 2ZW6A 4UBRA 4L89A 3DDDA 3NE7A 1NE9A 4C7HA 5FVJA 4CGMA 1CJWA 4A33A 1YVKA 3WR7A 4MFQA 2QMLA 1S7LA 4F0YA 2R8VA 3S6HA 2IL4A 2G3TA 3S6FA 1YVOA 4UCMA 2P0WA 4NCZA 3TTHA 1ZO0A 3V8IA 1YR0A 2BUEA 4CYNA 4UA3A 5AG7A 4B14A 1MJ9A 4KOUA 5J8FA 1XE4A 4KOWA 3P2FA 1KZFA 2PSWA 4KSAA 4B13A 4KOSA 1KUVA 4MFZA 1V0CA 1P0HA 4B5PA 1M44A 1RO5A 4UFWA 3R95A 4NF1A 4MY0A 3FBUA 5AG5A 4GS4A 4OADA 3PZJA 2OZHA 2PR1A 2HUZA 1FY7A 2OB0A 2R7HA 1I1DA 1MJBA 2CXAA 3TO6A 1S7NA 2I79A 4A32A 2PC1A 4M85A 2Z11A 2Q4VA 2FL4A 1J4JA 4NXYA 4JWPA 2DXQA 2FIAA 4YGOA 4R3KA 3TFYA 2BSWA 2EVNA 3I9SA 1S7FA 4BBHA 1S3ZA 2FXFA 2X7BA 4YFJA 3FXTA 2Z0ZA 1BO4A 3CXSA 4IUSA 2G0BA 1NMTA 4U9ZA 4R9MA 3FRMA 2YNCA 1OZPA 1CM0A 4H6UA 4QBJA 4B5OA 2YGWA 2J8NA 3R96A 5CNPA 1MK4A 4ONUA 4PK2A 4AG7A 1LRZA 3EY5A 4Q38A 4QVTA 4JD6A 3IGRA 1UFHA 4UCPA 2JEVA 2B4DA 3F8KA 2FT0A 2Q4YA 4KLVA 4R3LA 5G20A 2D4OA 1Y9WA 5AG6A 3E0KA 3DNSA 4KSFA 3JUWA 2Z10A 3CXQA 4CGNA 4CAWA 2VBQA 2VQYA 2YNDA 4CRYB 4C2ZA 2B3VA 1S60A 2QIRA 1P4NA 4PV6A 1RXTA 1TIQA 4KVOE 4XNHC 2ZXVA 3W6SA 2B5GA 4C2YA 2ZW5A 1B6BA 4UWIA 2R1IA 4KOTA 3VWEA 1I21A 4MFJA 5JPHA 1S7KA 3H5ZA 3SHPA 1QSMA 4E0AA 2WUUA 4HNWB 2REEA 1YK3A 4H89A 1Q2DA 2NMTA 5EBVA 2HV2A 2QECA 1Y9KA 2P6EA 4B11A 1S5KA 2PQ8A 4CS0B 4QB9A 1M4DA 2B4BA 4JXRA 1WK4A 5EC4A 4JXQA 4UCNA 1M1DA 4FD4A 3UY5A 2WPWA 1R57A 2B3UA 3BJ8A 2BEIA 3IWEA 2JDCA 2KCWA 3IWGA 3N7ZA 2CNTA 3IU2A 1M4GA 4E8OA 1YREA 5GCNA 4QC6A 3D3SA 3PGPA 4CGPA 5F47A 3D8PA 4CAEA 4KUAA 1Y7RA 2Q44A 5AG4A 5I0CA 4II9A 4XPDB 4HNXB 4HNYB 4CAXA 3JTKA 3MGDA 5HMNA 5IV0A 1PUAA 2R98A 3H4QA 3C26A 4OLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GKR A;  2CY2 A;  3G3S A;  2ARH A;  3QAH A;  5KTD A;  4XPK A;  3RYO A;  1PU9 A;  3PP9 A;  1YGH A;  2ATR A;  1XF8 A;  5ISV A;  1Z9U A;  1KUX A;  4XPD C;  4AVC A;  4R57 A;  5KTA A;  3JVN A;  1IID A;  3DR6 A;  4KZT A;  5C88 A;  2VZZ A;  3SXO A;  3R1K A;  2FIW A;  3EO4 A;  3LOD A;  2VEZ A;  3S6K A;  2PR8 A;  4B5P B;  4KLW A;  4AB7 A;  2FE7 A;  2O28 A;  1I12 A;  3FIX A;  3EFA A;  4AVA A;  4EVY A;  5J8C A;  4ZBG A;  4KOV A;  1WWZ A;  2GE3 A;  4Y49 B;  4MY3 A;  3D2M A;  3SXN A;  3GYA A;  3BLN A;  3G8W A;  4AVB A;  3K9U A;  4KOR A;  2EUI A;  1Z4R A;  3B8G A;  3D2P A;  4QUS A;  4U5Y A;  2OU2 A;  5HH1 A;  3VWD A;  3P2H A;  3OWC A;  1Z4E A;  3TOB A;  4L8A A;  2VZY A;  2P6F A;  1Q2C A;  4MJ8 A;  2ZW7 A;  1QST A;  4R87 A;  2VI7 A;  1XIX A;  1M4I A;  4KUB A;  4KOY A;  4ORF A;  4IF5 A;  2Q04 A;  4F6A A;  3TE4 A;  5E96 A;  2F5I A;  4JJX A;  3TCV A;  2B4D B;  1IIC A;  4RI1 A;  1ON0 A;  4RS2 A;  2HQY A;  2OZU A;  4KVM E;  1MJA A;  3R9F A;  4PSW A;  2AJ6 A;  2JLM A;  3QB8 A;  2FCK A;  1BOB A;  3FYN A;  2WPX A;  4K30 A;  2G3A A;  4M3S A;  4MHD A;  4YRH A;  2PDO A;  4U9Y A;  3DR8 A;  5F48 A;  2CNS A;  2B5G B;  4I49 A;  5IB0 A;  4OAE A;  1YX0 A;  3R9E A;  5F46 A;  3F0A A;  4PK3 A;  4KOX A;  2GAN A;  5KTC A;  2RC4 A;  1VKC A;  2OH1 A;  4CAV A;  2JDD A;  5H84 A;  1QSR A;  4E2A A;  4FD7 A;  2VXK A;  1N71 A;  3GY9 A;  4UWJ A;  3TO9 A;  4FD5 A;  4MBU A;  4MI4 A;  4HKF A;  1QSN A;  3EC4 A;  3R9G A;  1Q2Y A;  3W91 A;  4X5K A;  4J3G A;  1VHS A;  2D4P A;  5DWM A;  3DSB A;  2Q0Y A;  1GHE A;  2B58 A;  5C82 A;  3W6X A;  1XEB A;  3T90 A;  3TT2 A;  5DWN A;  1B87 A;  4NEX A;  4JLY A;  1IYK A;  3I3G A;  2ZW4 A;  4H6Z A;  2H5M A;  4DNC A;  3FNC A;  3S6G A;  3FB3 A;  2REF A;  1QSO A;  1NSL A;  2FSR A;  4FD6 A;  4AG9 A;  4LUA A;  3CXP A;  2J8M A;  2Y0M A;  1IYL A;  4LX9 A;  3ZJ0 A;  2C27 A;  2K5T A;  4XPL A;  1SQH A;  4XNH B;  1L0C A;  1IB1 E;  2ZPA A;  2BL1 A;  3F5B A;  2A4N A;  2PRB A;  2FS5 A;  1K4J A;  2CNM A;  5H86 A;  2Q7B A;  2GIV A;  4PSX A;  3T9Y A;  4Y49 C;  3TO7 A;  3LD2 A;  1XMT A;  5F49 A;  4KVX A;  2P6G A;  1U6M A;  2OZG A;  1KUY A;  3ZZI A;  2J8R A;  4BMH A;  1YLE A;  5JQ4 A;  5IX3 A;  4NSQ A;  4CRZ B;  2AE6 A;  3BJ7 A;  3KKW A;  2I00 A;  3EXN A;  3TOA A;  2ZW6 A;  4UBR A;  4L89 A;  3DDD A;  3NE7 A;  1NE9 A;  5FVJ A;  1CJW A;  1YVK A;  3WR7 A;  2QML A;  1S7L A;  4F0Y A;  2R8V A;  3S6H A;  2IL4 A;  2G3T A;  3S6F A;  1YVO A;  2P0W A;  4NCZ A;  3TTH A;  3V8I A;  1YR0 A;  2BUE A;  4UA3 A;  1MJ9 A;  4KOU A;  5J8F A;  1XE4 A;  4KOW A;  3P2F A;  1KZF A;  2PSW A;  4KOS A;  1KUV A;  1V0C A;  1P0H A;  4B5P A;  1M44 A;  1RO5 A;  3R95 A;  4NF1 A;  4MY0 A;  3FBU A;  4GS4 A;  4OAD A;  3PZJ A;  2OZH A;  2PR1 A;  2HUZ A;  1FY7 A;  2OB0 A;  2R7H A;  1I1D A;  1MJB A;  3TO6 A;  1S7N A;  2I79 A;  2PC1 A;  4M85 A;  2Z11 A;  2Q4V A;  2FL4 A;  1J4J A;  4NXY A;  4JWP A;  2DXQ A;  2FIA A;  4YGO A;  4R3K A;  3TFY A;  2BSW A;  2EVN A;  3I9S A;  1S7F A;  1S3Z A;  2FXF A;  2X7B A;  4YFJ A;  3FXT A;  2Z0Z A;  1BO4 A;  3CXS A;  4IUS A;  2G0B A;  1NMT A;  4U9Z A;  4R9M A;  3FRM A;  1OZP A;  1CM0 A;  4H6U A;  4QBJ A;  4B5O A;  2J8N A;  3R96 A;  5CNP A;  1MK4 A;  4ONU A;  4PK2 A;  4AG7 A;  1LRZ A;  3EY5 A;  4QVT A;  4JD6 A;  3IGR A;  1UFH A;  2JEV A;  2B4D A;  3F8K A;  2FT0 A;  2Q4Y A;  4KLV A;  4R3L A;  2D4O A;  1Y9W A;  3E0K A;  3DNS A;  3JUW A;  2Z10 A;  3CXQ A;  4CAW A;  2VBQ A;  2VQY A;  4CRY B;  2B3V A;  1S60 A;  2QIR A;  1P4N A;  4PV6 A;  1RXT A;  1TIQ A;  4KVO E;  4XNH C;  2ZXV A;  3W6S A;  2B5G A;  2ZW5 A;  1B6B A;  4UWI A;  2R1I A;  4KOT A;  3VWE A;  1I21 A;  5JPH A;  1S7K A;  3SHP A;  1QSM A;  4E0A A;  4HNW B;  2REE A;  1YK3 A;  4H89 A;  1Q2D A;  2NMT A;  5EBV A;  2HV2 A;  2QEC A;  1Y9K A;  2P6E A;  1S5K A;  2PQ8 A;  4CS0 B;  4QB9 A;  1M4D A;  2B4B A;  4JXR A;  1WK4 A;  5EC4 A;  4JXQ A;  1M1D A;  4FD4 A;  3UY5 A;  2WPW A;  1R57 A;  2B3U A;  3BJ8 A;  2BEI A;  2JDC A;  2KCW A;  3IWG A;  3N7Z A;  2CNT A;  1M4G A;  4E8O A;  1YRE A;  5GCN A;  4QC6 A;  3D3S A;  3PGP A;  5F47 A;  3D8P A;  4KUA A;  1Y7R A;  2Q44 A;  5I0C A;  4II9 A;  4XPD B;  4HNX B;  4HNY B;  4CAX A;  3MGD A;  5HMN A;  5IV0 A;  1PUA A;  2R98 A;  3H4Q A;  3C26 A;  4OLL A; 
#chains in the Genus database with same CATH topology
 3GKR A;  2CY2 A;  2AFO A;  2PJ1 A;  3CPA A;  3G3S A;  2ARH A;  3QAH A;  5HVH A;  4MCS A;  2CIJ A;  5KTD A;  2WZN A;  4XPK A;  3RYO A;  2ZOG A;  4R7M A;  1LAM A;  1PU9 A;  3PP9 A;  2JBJ A;  4MXU A;  4Q36 A;  4MFP A;  3KGQ A;  3SJX A;  1YGH A;  4A94 A;  2ATR A;  1XF8 A;  1X12 A;  2EWB A;  1ELL P;  5ISV A;  4CYP A;  1Z9U A;  4GXH A;  2NSM A;  1KUX A;  2Z3P A;  3KHX A;  4XPD C;  4NJR A;  3RAM A;  4AVC A;  2JEW A;  2V77 A;  2XEG A;  5AGE A;  4OC2 A;  4OP4 A;  1YW4 A;  1Y0R A;  3PB9 X;  1VHO A;  2PJ8 A;  4PXC A;  1LCP A;  4R57 A;  3JVN A;  1CPX A;  3FH4 A;  1IID A;  3SJG A;  1ELM P;  3DR6 A;  4KZT A;  1CX8 A;  4FBE A;  2VZZ A;  3SXO A;  5C88 A;  2XEJ A;  3R1K A;  2FIW A;  3EO4 A;  3LOD A;  2VEZ A;  3S6K A;  3CZX A;  4B6Z A;  5A27 A;  2PR8 A;  4NGN A;  5KTA A;  1BPM A;  3WC7 A;  4B5P B;  1LAP A;  5J1Q A;  1TXR A;  1XFO A;  4KLW A;  4AB7 A;  2FE7 A;  4X8I A;  3B3W A;  4AXV A;  4IHM A;  2O28 A;  1I12 A;  2FVG A;  3EFA A;  3FIX A;  2Z3M A;  3S9M A;  4A2Z A;  2ANP A;  4A31 A;  4AVA A;  4GM5 A;  4M6G A;  1XBU A;  2ZEF A;  5CPA A;  4EVY A;  4PXB A;  2DPS A;  4ZBG A;  1Z8X A;  4C7I A;  5J8C A;  4KOV A;  1WWZ A;  2GE3 A;  4Y49 B;  2ZEN A;  4MY3 A;  3D2M A;  5LYI A;  3SXN A;  4KS9 A;  5BWA B;  3GYA A;  3BLN A;  3G8W A;  4NJQ A;  4AVB A;  3K9U A;  2DEA A;  1Z8L A;  3RNZ A;  4KOR A;  2EUI A;  1A2Z A;  1Z4R A;  3B8G A;  3IU1 A;  1ZG9 A;  4PPZ A;  3D2P A;  3T8W A;  2PJ0 A;  4QUS A;  3BI1 A;  4U5Y A;  2OU2 A;  5HH1 A;  3VWD A;  3P2H A;  4IAV A;  2Z3K A;  4OC0 A;  3OWC A;  1Z4E A;  3TOB A;  4L8A A;  4CYO A;  2VZY A;  2P6F A;  1Q2C A;  3RZA A;  3RO0 A;  4MJ8 A;  2CF4 A;  1KWM A;  1YLO A;  2ZW7 A;  2ZEP A;  1QST A;  1NSA A;  4R87 A;  2VI7 A;  1XIX A;  3FEE A;  1M4I A;  5G21 A;  4KUB A;  4KOY A;  4KSI A;  4ORF A;  3PB4 X;  4IF5 A;  2Q04 A;  4F6A A;  3VAT A;  3TE4 A;  5E96 A;  3MN8 A;  2F5I A;  2PJ2 A;  3RBU A;  3B3S A;  4JJX A;  3TCV A;  2B4D B;  5I4M A;  5K8P A;  4CGO A;  4NGT A;  1IIC A;  1ZG7 A;  4RI1 A;  4DJL A;  1ON0 A;  3D66 A;  4UFX A;  1LOK A;  2ZOF A;  1BAV A;  1Z8T A;  1IY7 A;  2YNC C;  4C2X A;  1FNO A;  4RS2 A;  2HQY A;  5IB9 A;  2OZU A;  4KVM E;  1TF9 A;  1MJA A;  3TC8 A;  1F2O A;  4F0X A;  4C68 A;  1Z5R A;  1ZLH A;  3NA6 A;  1IOI A;  3D68 A;  4PSW A;  3R9F A;  1TKJ A;  3KZW A;  1CG2 A;  3B3T A;  7CPA A;  2EK8 A;  6CPA A;  4CYQ A;  1IGB A;  2AJ6 A;  2POK A;  2JLM A;  2QYV A;  3QAY A;  1R43 A;  4A39 A;  1M4L A;  3D7H A;  3QB8 A;  2FCK A;  1BOB A;  3HUV A;  4OC3 A;  2O53 A;  3FYN A;  2WPX A;  4K30 A;  4O23 A;  4P10 A;  4F9U A;  2OR4 A;  4P44 A;  4UEF A;  3LMS A;  2G3A A;  4M3S A;  4MHD A;  4YRH A;  1Z2L A;  2ZEO A;  2PDO A;  2QJ8 A;  2C1C A;  4U9Y A;  1QMU A;  3DR8 A;  5F48 A;  3WAB A;  2CNS A;  2B5G B;  1CPS A;  4R76 A;  4K3N A;  4I49 A;  5IB0 A;  3FX6 A;  3BI0 A;  4MHN A;  4OAE A;  1YX0 A;  3R9E A;  5F46 A;  3F0A A;  4MHY A;  4OKO A;  4PK3 A;  4KOX A;  3ISX A;  5LYF A;  1ZLI A;  2V8D A;  5DS0 A;  1UWY A;  2GAN A;  2PVV A;  4MCR A;  5A28 A;  2Z3N A;  5LRK A;  1YME A;  2WSA A;  5KTC A;  2RC4 A;  1VKC A;  2OH1 A;  4LQ6 A;  4CAV A;  2JDD A;  5H84 A;  1XJO A;  1QSR A;  4E2A A;  2GFQ A;  4UEZ A;  4FD7 A;  2VXK A;  3IWW A;  3HLP A;  1N71 A;  3GY9 A;  4UWJ A;  3TO9 A;  1X10 A;  4FD5 A;  4P4I A;  4MBU A;  4MRI A;  4MI4 A;  1ARL A;  4HKF A;  2VL1 A;  2Z3O A;  3KQZ A;  1QSN A;  1AYE A;  1YSJ A;  3EC4 A;  3S9L A;  3KL9 A;  3R9G A;  4BD9 A;  3H8G A;  1Q2Y A;  4CPA A;  1QQ9 A;  4X5K A;  4J3G A;  3W91 A;  5JM6 A;  3A9L A;  4CAF A;  5G1Z A;  1VHS A;  2D4P A;  5DWM A;  3DSB A;  4CGL A;  1VGY A;  2Q0Y A;  1GHE A;  4OC4 A;  2B58 A;  4NGR A;  4OC1 A;  5C82 A;  3W6X A;  1ZG8 A;  5G22 A;  1XEB A;  1R3N A;  2DPT A;  3T90 A;  1F2P A;  5DWN A;  3TT2 A;  3K9T A;  1B87 A;  4Q7A A;  4NEX A;  3H8E A;  4MFK A;  3CPX A;  1IYK A;  4JLY A;  3I3G A;  3NFZ A;  1DTD A;  3GB0 A;  2ZW4 A;  3LAC A;  4H6Z A;  4UFV A;  2H5M A;  2Q4Z A;  1TKF A;  4DNC A;  3FNC A;  3S6G A;  2AFW A;  3FB3 A;  4JYW A;  2G9D A;  1PCA A;  2REF A;  1JWQ A;  4MCQ A;  4IK2 A;  4BBH A;  2PJ5 A;  2Z3L A;  4DUK A;  1QSO A;  3KR5 A;  4MMO A;  1NSL A;  1YW6 A;  2FSR A;  4FD6 A;  4X3R A;  4AG9 A;  4DYO A;  5JGF A;  4ZX9 A;  4LUA A;  3CXP A;  2V8G A;  2J8M A;  2Y0M A;  1IYL A;  1H8L A;  4LX9 A;  4A30 A;  3ZJ0 A;  4B12 A;  2C27 A;  2K5T A;  4OIW A;  4XPL A;  2PIY A;  1SQH A;  4XNH B;  1L0C A;  1IB1 E;  2AFX A;  2PRQ A;  3QNV A;  2GRE A;  2ZPA A;  3GIU A;  3FF3 A;  5HVF A;  4P4F A;  4FAI A;  2BL1 A;  4P4D A;  2C6P A;  3F5B A;  4ZI6 A;  4B10 A;  2A4N A;  4OME A;  2PRB A;  3KI9 A;  3PFO A;  1DE4 C;  3DLJ A;  2FS5 A;  3B7I A;  1K4J A;  2PVW A;  2CNM A;  5H86 A;  2Q7B A;  2NYQ A;  3PBB A;  4UF4 A;  2GIV A;  4PSX A;  3T9Y A;  4Y49 C;  2YNE A;  3TO7 A;  1FT7 A;  1OBR A;  3LD2 A;  3D7F A;  1XMT A;  5F49 A;  4TNU A;  4ZGY B;  4ZY1 A;  4A95 A;  4M6H A;  4KVX A;  4UIB A;  2P6G A;  1U6M A;  2OZG A;  2PJC A;  4ZY0 A;  1KUY A;  3ZZI A;  2PJ7 A;  2J8R A;  4MFL A;  3WC5 A;  4BMH A;  3PB8 X;  1F57 A;  1YLE A;  2F8H A;  3JRU A;  4X2T A;  5JQ4 A;  5IX3 A;  4EWT A;  4MHP A;  4NSQ A;  2ABZ A;  3KR4 A;  4CRZ B;  2AE6 A;  2AFU A;  3BJ7 A;  3KKW A;  3PB6 X;  3K2K A;  2I00 A;  2EK9 A;  3EXN A;  2ZW6 A;  4HPS A;  3TOA A;  4UBR A;  4L89 A;  3D4U A;  3SI2 A;  4OID A;  3DDD A;  4R8F A;  2ODF A;  3NE7 A;  1NE9 A;  4C7H A;  5FVJ A;  3NH4 A;  4MHZ A;  3CT9 A;  3KAS A;  4CGM A;  1TKH A;  5K8M A;  1CJW A;  4ONW A;  1ARM A;  4A33 A;  3VAR A;  2Q7S A;  1YVK A;  3WR7 A;  4MFQ A;  2QML A;  1S7L A;  4WWV A;  3D67 A;  2ZEM A;  3B35 A;  4F0Y A;  2R8V A;  2CTC A;  2IL4 A;  3IEH A;  2G3T A;  2J9A A;  3S6H A;  3ISZ A;  4JZ0 A;  3S6F A;  3SI0 A;  1Z8W A;  2GLJ A;  4A38 A;  1YVO A;  5THW A;  4TWE A;  4UCM A;  5CBM A;  2DF5 A;  2P0W A;  3DGV A;  4NCZ A;  4P4J A;  3TTH A;  1ZO0 A;  3V8I A;  1YR0 A;  2BUE A;  4CYN A;  1HDU A;  4RN7 A;  4UA3 A;  1CBX A;  2ZEH A;  3NH5 A;  3S9N A;  2QVP A;  5AG7 A;  4B14 A;  1MJ9 A;  4KOU A;  4P4B A;  4P6Y A;  4Z65 A;  2Q51 A;  5J8F A;  1XE4 A;  3H8F A;  4NGP A;  3PEI A;  4KOW A;  4RUH A;  3P2F A;  1KZF A;  2PSW A;  3IC1 A;  4KSA A;  4WJB A;  4B13 A;  4NGQ A;  4KOS A;  1XMB A;  1KUV A;  4MFZ A;  1V0C A;  4F9V A;  1VHE A;  2IJZ A;  2PJ3 A;  1P0H A;  3SJE A;  4B5P A;  1M44 A;  1RO5 A;  2GU2 A;  1JQG A;  4UFW A;  4NF1 A;  3R95 A;  4MY0 A;  5JH9 A;  3WT4 A;  3FBU A;  5AG5 A;  4GS4 A;  3NH8 A;  4OAD A;  2IMO A;  2OZH A;  3PZJ A;  2PJ4 A;  4YWY A;  2PR1 A;  1Y0Y A;  1FY7 A;  2HUZ A;  2OB0 A;  2R7H A;  1I1D A;  3L2N A;  2WYR A;  1MJB A;  2CXA A;  3TO6 A;  1S7N A;  2EBJ A;  2I79 A;  4A32 A;  2HC9 A;  2PC1 A;  4M85 A;  5ELY A;  2Z11 A;  1VIX A;  2Q4V A;  2FL4 A;  1J4J A;  1AUG A;  4NXY A;  4JWP A;  2DXQ A;  2FIA A;  4PQA A;  1AMP A;  3I1U A;  2RB7 A;  3KQX A;  4YGO A;  2F7V A;  5HXD A;  4R3K A;  3TFY A;  2BSW A;  4NFR A;  2EVN A;  2AFS A;  3I9S A;  1S7F A;  3D7D A;  1S3Z A;  2FXF A;  2X7B A;  2XEF A;  3BHX A;  3FXT A;  4PXD A;  2Z0Z A;  1BO4 A;  3WC6 A;  4YFJ A;  2PJA A;  3CXS A;  4IUS A;  2G0B A;  2ZEE A;  1NMT A;  5LRG A;  4U9Z A;  3FMC A;  4R9M A;  3FRM A;  2YNC A;  3LWU A;  3TX8 A;  2GLF A;  1OZP A;  3NE8 A;  1CM0 A;  4H6U A;  2OOT A;  1HDQ A;  4QBJ A;  3PRT A;  4B5O A;  2YGW A;  2ZED A;  2J8N A;  3IFE A;  3R96 A;  4P45 A;  2PJB A;  5CNP A;  1IU8 A;  5F09 A;  1MK4 A;  4ONU A;  4PK2 A;  2BCO A;  4AG7 A;  2V8H A;  1LRZ A;  3EY5 A;  4Q38 A;  4QVT A;  4JD6 A;  4BIN A;  3IGR A;  1LFW A;  1UFH A;  3B3V A;  4UCP A;  2JEV A;  2JBK A;  1XRY A;  2B4D A;  1Y7E A;  2RFH A;  2PJ6 A;  4F8Z A;  1Q7L A;  3V7Z A;  2I3C A;  3IO1 A;  3F8K A;  2FT0 A;  2Q4Y A;  4KLV A;  4R3L A;  4YU9 A;  3VH9 A;  2PE3 A;  3FJU A;  5G20 A;  8CPA A;  2D4O A;  1Y9W A;  3D7G A;  3E0K A;  3DNS A;  4KSF A;  5AG6 A;  3V38 A;  2CTB A;  3JUW A;  2Z10 A;  3CXQ A;  4CGN A;  2PCU A;  5LYD A;  4FUU A;  2VBQ A;  4CAW A;  2VQY A;  2YND A;  3FED A;  1IOF A;  4CRY B;  1HEE A;  5K8N A;  4C2Z A;  2PJ9 A;  2B3V A;  2BO9 A;  4NGM A;  1S60 A;  2QIR A;  4OC5 A;  1P4N A;  2ZEG A;  5EMI A;  4PV6 A;  1RXT A;  3GLJ A;  4LQG A;  2O4H A;  4UIA A;  1TIQ A;  5HVG A;  4KVO E;  4XNH C;  1LAN A;  2ZXV A;  4FWU A;  4ZY2 A;  4PXE A;  3W6S A;  2B5G A;  4UEE A;  4C2Y A;  2ZW5 A;  4ZYQ A;  1B6B A;  2XEI A;  4R6T A;  2AFM A;  4UWI A;  2R1I A;  4KOT A;  3SI1 A;  4G1P A;  2C6C A;  4M6I A;  3VWE A;  1I21 A;  2V8V A;  4MFJ A;  5JPH A;  1S7K A;  3H5Z A;  2PIZ A;  3SHP A;  2HB6 A;  3PFE A;  1QSM A;  4P4E A;  2WUU A;  4E0A A;  4HNW B;  2REE A;  1YK3 A;  4H89 A;  1Q2D A;  1PYT B;  5D29 A;  2NMT A;  2Q43 A;  2HV2 A;  5EBV A;  5LRJ A;  1YQE A;  2QEC A;  4MCP A;  4H2K A;  1TF8 A;  1Y9K A;  2P6E A;  4B11 A;  1CP6 A;  1S5K A;  2PQ8 A;  4CS0 B;  4QB9 A;  1M4D A;  3FEC A;  2B4B A;  4EFD A;  5LYL A;  3PB7 X;  1WK4 A;  3BXM A;  4JXR A;  4NGS A;  5EC4 A;  4ZX8 A;  4JXQ A;  3B2Y A;  3B3C A;  2EO8 A;  1M1D A;  4UCN A;  1BLL E;  4FD4 A;  3UY5 A;  2WPW A;  1R57 A;  2B3U A;  3BJ8 A;  3PBE A;  2BEI A;  2C6G A;  3IIB A;  2AFZ A;  2JDC A;  2KCW A;  3IWG A;  3IWE A;  3N7Z A;  2CNT A;  3IU2 A;  1M4G A;  3FVL A;  2BOA A;  3GUX A;  4E8O A;  1YRE A;  5GCN A;  4QC6 A;  3D3S A;  2ZEL A;  1RTQ A;  3CDX A;  3PGP A;  4CGP A;  5F47 A;  3D8P A;  3MRU A;  4KUA A;  4W9Y A;  5D8N A;  1BPN A;  4CAE A;  1Y7R A;  3KHZ A;  1GYT A;  4A37 A;  2Q44 A;  2IQ6 A;  5AG4 A;  5I0C A;  4EME A;  4II9 A;  4XPD B;  4HNX B;  4HNY B;  4CAX A;  1CP7 A;  3JTK A;  3MGD A;  5HMN A;  5IV0 A;  1PUA A;  1EE3 P;  5K8O A;  2R98 A;  1XOV A;  3H4Q A;  4OLL A;  3SJF A;  3C26 A;  3N5F A;  3IJ3 A; 
#chains in the Genus database with same CATH homology
 3GKR A;  2CY2 A;  3G3S A;  2ARH A;  3QAH A;  5KTD A;  4XPK A;  3RYO A;  1PU9 A;  3PP9 A;  4Q36 A;  4MFP A;  1YGH A;  2ATR A;  1XF8 A;  5ISV A;  4CYP A;  1Z9U A;  1KUX A;  2Z3P A;  4XPD C;  4AVC A;  5AGE A;  4R57 A;  5KTA A;  3JVN A;  1IID A;  3DR6 A;  4KZT A;  5C88 A;  2VZZ A;  3SXO A;  3R1K A;  2FIW A;  3EO4 A;  3LOD A;  2VEZ A;  3S6K A;  5A27 A;  2PR8 A;  4B5P B;  4KLW A;  4AB7 A;  2FE7 A;  2O28 A;  1I12 A;  3FIX A;  3EFA A;  4A2Z A;  2Z3M A;  4A31 A;  4AVA A;  4EVY A;  2DPS A;  4ZBG A;  4C7I A;  5J8C A;  4KOV A;  1WWZ A;  2GE3 A;  4Y49 B;  4MY3 A;  3D2M A;  3SXN A;  4KS9 A;  5BWA B;  3GYA A;  3BLN A;  3G8W A;  4AVB A;  3K9U A;  4KOR A;  2EUI A;  1Z4R A;  3B8G A;  3IU1 A;  3D2P A;  4QUS A;  4U5Y A;  2OU2 A;  5HH1 A;  3VWD A;  3P2H A;  2Z3K A;  3OWC A;  1Z4E A;  3TOB A;  4L8A A;  4CYO A;  2VZY A;  2P6F A;  1Q2C A;  4MJ8 A;  2ZW7 A;  1QST A;  4R87 A;  2VI7 A;  1XIX A;  1M4I A;  5G21 A;  4KUB A;  4KOY A;  4ORF A;  4IF5 A;  2Q04 A;  4F6A A;  3TE4 A;  5E96 A;  2F5I A;  4JJX A;  3TCV A;  2B4D B;  4CGO A;  1IIC A;  4RI1 A;  1ON0 A;  4UFX A;  2YNC C;  4C2X A;  4RS2 A;  2HQY A;  2OZU A;  4KVM E;  1MJA A;  4F0X A;  4C68 A;  3R9F A;  4PSW A;  4CYQ A;  2AJ6 A;  2JLM A;  3QB8 A;  2FCK A;  1BOB A;  3FYN A;  2WPX A;  4K30 A;  2G3A A;  4M3S A;  4MHD A;  4YRH A;  2PDO A;  4U9Y A;  3DR8 A;  5F48 A;  2CNS A;  2B5G B;  4I49 A;  5IB0 A;  4OAE A;  1YX0 A;  3R9E A;  5F46 A;  3F0A A;  4PK3 A;  4KOX A;  2GAN A;  5A28 A;  2Z3N A;  2WSA A;  5KTC A;  2RC4 A;  1VKC A;  2OH1 A;  4CAV A;  2JDD A;  5H84 A;  1QSR A;  4E2A A;  4FD7 A;  2VXK A;  1N71 A;  3GY9 A;  4UWJ A;  3TO9 A;  4FD5 A;  4MBU A;  4MI4 A;  4HKF A;  2Z3O A;  1QSN A;  3EC4 A;  3R9G A;  1Q2Y A;  3W91 A;  4X5K A;  4J3G A;  3A9L A;  4CAF A;  5G1Z A;  1VHS A;  2D4P A;  5DWM A;  3DSB A;  4CGL A;  2Q0Y A;  1GHE A;  2B58 A;  5C82 A;  3W6X A;  5G22 A;  1XEB A;  3T90 A;  2DPT A;  3TT2 A;  5DWN A;  1B87 A;  4NEX A;  4MFK A;  4JLY A;  1IYK A;  3I3G A;  2ZW4 A;  4H6Z A;  4UFV A;  2H5M A;  4DNC A;  3FNC A;  3S6G A;  3FB3 A;  2REF A;  2Z3L A;  1QSO A;  1NSL A;  2FSR A;  4FD6 A;  4AG9 A;  4LUA A;  3CXP A;  2J8M A;  2Y0M A;  1IYL A;  4LX9 A;  4A30 A;  3ZJ0 A;  4B12 A;  2C27 A;  2K5T A;  4XPL A;  1SQH A;  4XNH B;  1L0C A;  1IB1 E;  2ZPA A;  2BL1 A;  3F5B A;  4B10 A;  2A4N A;  2PRB A;  2FS5 A;  1K4J A;  2CNM A;  5H86 A;  2Q7B A;  2GIV A;  4PSX A;  3T9Y A;  4Y49 C;  2YNE A;  3TO7 A;  3LD2 A;  1XMT A;  5F49 A;  4ZGY B;  4A95 A;  4KVX A;  2P6G A;  1U6M A;  2OZG A;  1KUY A;  3ZZI A;  2J8R A;  4MFL A;  4BMH A;  1YLE A;  5JQ4 A;  5IX3 A;  4NSQ A;  4CRZ B;  2AE6 A;  3BJ7 A;  3KKW A;  2I00 A;  3EXN A;  3TOA A;  2ZW6 A;  4UBR A;  4L89 A;  3DDD A;  3NE7 A;  1NE9 A;  4C7H A;  5FVJ A;  4CGM A;  1CJW A;  4A33 A;  1YVK A;  3WR7 A;  4MFQ A;  2QML A;  1S7L A;  4F0Y A;  2R8V A;  3S6H A;  2IL4 A;  2G3T A;  3S6F A;  1YVO A;  4UCM A;  2P0W A;  4NCZ A;  3TTH A;  1ZO0 A;  3V8I A;  1YR0 A;  2BUE A;  4CYN A;  4UA3 A;  5AG7 A;  4B14 A;  1MJ9 A;  4KOU A;  5J8F A;  1XE4 A;  4KOW A;  3P2F A;  1KZF A;  2PSW A;  4KSA A;  4B13 A;  4KOS A;  1KUV A;  4MFZ A;  1V0C A;  1P0H A;  4B5P A;  1M44 A;  1RO5 A;  4UFW A;  3R95 A;  4NF1 A;  4MY0 A;  3FBU A;  5AG5 A;  4GS4 A;  4OAD A;  3PZJ A;  2OZH A;  2PR1 A;  2HUZ A;  1FY7 A;  2OB0 A;  2R7H A;  1I1D A;  1MJB A;  2CXA A;  3TO6 A;  1S7N A;  2I79 A;  4A32 A;  2PC1 A;  4M85 A;  2Z11 A;  2Q4V A;  2FL4 A;  1J4J A;  4NXY A;  4JWP A;  2DXQ A;  2FIA A;  4YGO A;  4R3K A;  3TFY A;  2BSW A;  2EVN A;  3I9S A;  1S7F A;  4BBH A;  1S3Z A;  2FXF A;  2X7B A;  4YFJ A;  3FXT A;  2Z0Z A;  1BO4 A;  3CXS A;  4IUS A;  2G0B A;  1NMT A;  4U9Z A;  4R9M A;  3FRM A;  2YNC A;  1OZP A;  1CM0 A;  4H6U A;  4QBJ A;  4B5O A;  2YGW A;  2J8N A;  3R96 A;  5CNP A;  1MK4 A;  4ONU A;  4PK2 A;  4AG7 A;  1LRZ A;  3EY5 A;  4Q38 A;  4QVT A;  4JD6 A;  3IGR A;  1UFH A;  4UCP A;  2JEV A;  2B4D A;  3F8K A;  2FT0 A;  2Q4Y A;  4KLV A;  4R3L A;  5G20 A;  2D4O A;  1Y9W A;  5AG6 A;  3E0K A;  3DNS A;  4KSF A;  3JUW A;  2Z10 A;  3CXQ A;  4CGN A;  4CAW A;  2VBQ A;  2VQY A;  2YND A;  4CRY B;  4C2Z A;  2B3V A;  1S60 A;  2QIR A;  1P4N A;  4PV6 A;  1RXT A;  1TIQ A;  4KVO E;  4XNH C;  2ZXV A;  3W6S A;  2B5G A;  4C2Y A;  2ZW5 A;  1B6B A;  4UWI A;  2R1I A;  4KOT A;  3VWE A;  1I21 A;  4MFJ A;  5JPH A;  1S7K A;  3H5Z A;  3SHP A;  1QSM A;  4E0A A;  2WUU A;  4HNW B;  2REE A;  1YK3 A;  4H89 A;  1Q2D A;  2NMT A;  5EBV A;  2HV2 A;  2QEC A;  1Y9K A;  2P6E A;  4B11 A;  1S5K A;  2PQ8 A;  4CS0 B;  4QB9 A;  1M4D A;  2B4B A;  4JXR A;  1WK4 A;  5EC4 A;  4JXQ A;  4UCN A;  1M1D A;  4FD4 A;  3UY5 A;  2WPW A;  1R57 A;  2B3U A;  3BJ8 A;  2BEI A;  3IWE A;  2JDC A;  2KCW A;  3IWG A;  3N7Z A;  2CNT A;  3IU2 A;  1M4G A;  4E8O A;  1YRE A;  5GCN A;  4QC6 A;  3D3S A;  3PGP A;  4CGP A;  5F47 A;  3D8P A;  4CAE A;  4KUA A;  1Y7R A;  2Q44 A;  5AG4 A;  5I0C A;  4II9 A;  4XPD B;  4HNX B;  4HNY B;  4CAX A;  3JTK A;  3MGD A;  5HMN A;  5IV0 A;  1PUA A;  2R98 A;  3H4Q A;  3C26 A;  4OLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...