1PU9A

Crystal structure of tetrahymena gcn5 with bound coenzyme a and a 19-residue histone h3 peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
163
structure length
163
Chain Sequence
b'LLDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAT A1
publication title Structural basis for histone and phospho-histone binding by the GCN5 histone acetyltransferase
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Transferase/structural protein
total genus 44
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2003-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1pu9A00
3G3SA 1J4JA 2Q04A 3RYOA 3GY9A 2ARHA 1Z4RA 1XIXA 1UFHA 3W6SA 4UWIA 3MGDA 4MY3A 3DR6A 5J8CA 3N7ZA 1XE4A 2Q0YA 2GANA 1N71A 5KTCA 2Z10A 1PUAA 4QC6A 4AG9A 1IIDA 3EO4A 1I12A 2B4DA 3JVNA 4YGOA 2P6FA 3W91A 4KOWA 5H84A 2FIAA 1WWZA 4NSQA 1M4GA 4MI4A 1MK4A 4E0AA 4KOXA 1QSRA 4H6ZA 3FRMA 2R7HA 5JQ4A 1M44A 4Y49B 2PR1A 2Z11A 2O28A 2PC1A 2JLMA 4KOSA 5F47A 2FXFA 2EVNA 2R1IA 1B6BA 3D2PA 4CS0B 1OZPA 4CAWA 2G0BA 5FVJA 1PU9A 2JEVA 3VWDA 3TE4A 1YREA 3CXSA 2J8RA 3D2MA 3LODA 3S6FA 2BSWA 3TO7A 1Y7RA 3FXTA 1IYKA 3TFYA 3EFAA 3R95A 4PK2A 4QB9A 1IYLA 4J3GA 4BMHA 4MY0A 2OZGA 4KOVA 5C82A 4YFJA 2CNMA 4HNXB 1RXTA 1R57A 4QUSA 1I21A 4QBJA 4LUAA 2EUIA 2K5TA 2VBQA 4KUBA 4H89A 4FD6A 4XNHC 1KUXA 2FL4A 4HNYB 2B58A 2KCWA 4F0YA 5H86A 1XEBA 2P6EA 4R57A 2FSRA 4KLVA 3PZJA 2REEA 1BOBA 4RI1A 4OAEA 5KTAA 2FS5A 1I1DA 4R9MA 4KVME 5F48A 3R9EA 3CXQA 1S60A 3E0KA 4CAVA 2PQ8A 1B87A 3FIXA 1VHSA 1Q2CA 3I3GA 3QAHA 4U9ZA 4JD6A 4X5KA 5IB0A 4ZBGA 4E2AA 4MBUA 3SHPA 2QECA 3FB3A 4KORA 1TIQA 3JUWA 3B8GA 1IB1E 4L89A 2OZHA 1M4DA 4PSXA 2HUZA 4B5OA 2J8NA 4QVTA 5EC4A 4EVYA 1XF8A 4AVAA 4PV6A 2AE6A 1Q2YA 3S6HA 2ZXVA 4M3SA 3VWEA 1Z9UA 4FD4A 2ATRA 5ISVA 5F49A 3S6KA 3TOBA 4II9A 2P0WA 5GCNA 2G3TA 2D4PA 1BO4A 4R3KA 4ORFA 4XNHB 4PSWA 1V0CA 5IX3A 1S5KA 1L0CA 1Y9KA 3OWCA 1KUVA 1WK4A 3BJ7A 3H4QA 1FY7A 3ZZIA 2OH1A 4H6UA 2Q44A 2VXKA 4JWPA 4DNCA 2PRBA 2QMLA 3GKRA 3DNSA 5I0CA 2HV2A 1MJBA 1U6MA 4UA3A 3CXPA 3F0AA 3R9GA 2B3UA 1YVOA 3NE7A 1KZFA 3KKWA 1S7NA 4KOUA 3P2FA 4U5YA 2GE3A 3IGRA 4JXRA 2I00A 2I79A 4ONUA 3QB8A 4HKFA 4XPKA 2OB0A 3TCVA 1SQHA 5KTDA 2PSWA 3DR8A 1ON0A 4CRYB 2ZW5A 5IV0A 3EXNA 3D3SA 2ZW4A 2OU2A 3V8IA 5DWNA 2VI7A 5E96A 1MJAA 1P0HA 3PGPA 4AVBA 5J8FA 5JPHA 3DSBA 1YK3A 1QSOA 3EY5A 2VZZA 3W6XA 1KUYA 2BUEA 1S7LA 2G3AA 3EC4A 4I49A 2PR8A 4XPDB 3LD2A 3S6GA 1NE9A 2RC4A 2ZW6A 2A4NA 4IF5A 2AJ6A 2NMTA 2VZYA 1S3ZA 2QIRA 2PDOA 2H5MA 1XMTA 2Q4YA 3SXNA 1Q2DA 4KVOE 4MHDA 2CNSA 3P2HA 4R87A 2C27A 1QSMA 2OZUA 4XPLA 2CNTA 3TT2A 4HNWB 1YR0A 2B3VA 4FD5A 5DWMA 2DXQA 3R96A 2FIWA 4KVXA 2J8MA 4YRHA 2BL1A 2X7BA 3T90A 1K4JA 5EBVA 5F46A 2F5IA 5C88A 4B5PB 3F5BA 4JXQA 3TOAA 3R1KA 1IICA 4FD7A 4KLWA 4NF1A 1S7KA 4NCZA 4U9YA 3UY5A 1RO5A 1YGHA 1NMTA 2B5GB 1LRZA 5HH1A 4L8AA 4XPDC 1YLEA 3TO9A 3BLNA 2CY2A 2WPXA 3FNCA 3DDDA 3C26A 1YX0A 3ZJ0A 4NEXA 2JDDA 2Q4VA 2FT0A 4E8OA 5HMNA 3PP9A 4GS4A 3TTHA 3I9SA 4UWJA 4CRZB 4R3LA 4MJ8A 2VEZA 4AB7A 2R98A 4F6AA 2ZW7A 2P6GA 4NXYA 2R8VA 5CNPA 3TO6A 1YVKA 1M4IA 2B4BA 2D4OA 3G8WA 2Q7BA 3R9FA 4M85A 3SXOA 4JJXA 3T9YA 4OADA 2B4DB 4AVCA 3FYNA 1GHEA 1NSLA 3FBUA 2IL4A 4AG7A 3D8PA 1CJWA 2FE7A 3K9UA 4LX9A 4KOTA 4B5PA 1Y9WA 1MJ9A 3GYAA 4K30A 3IWGA 3BJ8A 2FCKA 1S7FA 1CM0A 4UBRA 2ZPAA 4KUAA 3F8KA 1QSNA 2B5GA 2Y0MA 1M1DA 2GIVA 4PK3A 2WPWA 1P4NA 1Z4EA 4OLLA 4Y49C 4KOYA 4KZTA 2JDCA 4IUSA 4JLYA 2BEIA 3WR7A 1QSTA 4CAXA 2VQYA 2HQYA 2Z0ZA 1VKCA 4RS2A 2REFA
chains in the Genus database with same CATH superfamily
1HDQA 4A38A 4UCPA 2Z3MA 3G3SA 1J4JA 1EE3P 2Q04A 3CDXA 4IAVA 3RYOA 3VATA 5J1QA 3GY9A 5F09A 3CT9A 2ARHA 4OC4A 1Z4RA 1XIXA 1UFHA 2PVVA 3W6SA 4UWIA 1GYTA 3BHXA 1Z8TA 5D8NA 4B6ZA 4C2XA 3QAYA 3RO0A 3MGDA 3PB4X 4MY3A 3DR6A 3IC1A 5J8CA 3N7ZA 1UWYA 1XE4A 1ZG9A 2Q0YA 2DPSA 4MFPA 2GANA 1N71A 4MHYA 5KTCA 5G1ZA 2Z10A 1PUAA 2ZEGA 4QC6A 4ZY2A 4AG9A 1IIDA 1Z5RA 3EO4A 4R76A 4Q7AA 2CTBA 3FECA 2V77A 2ZENA 2AFSA 1I12A 4DUKA 3SJFA 3K2KA 2DPTA 2B4DA 4RN7A 3JVNA 4YGOA 3PBEA 2P6FA 2Q4ZA 3W91A 3RZAA 4KOWA 5H84A 4HPSA 4ONWA 1ZLIA 3RNZA 2FIAA 3GUXA 1ARMA 2Q51A 5CBMA 2ODFA 2CIJA 4R8FA 4X8IA 1WWZA 4NSQA 2JBJA 1CBXA 3KL9A 1M4GA 3B3WA 4MI4A 3V38A 2PJBA 1HDUA 1MK4A 4WJBA 4E0AA 3L2NA 4KOXA 1QSRA 4H6ZA 1VGYA 3FRMA 2R7HA 1R3NA 1M44A 2BO9A 2PR1A 2RFHA 2O28A 2Z11A 4Y49B 2HC9A 2PC1A 1PCAA 2PE3A 2JLMA 4KOSA 5F47A 7CPAA 1TKHA 2FXFA 3SJGA 1H8LA 2EVNA 2R1IA 2YNCC 2PJAA 4P6YA 2C6CA 2HB6A 1B6BA 3D2PA 3PB8X 4CS0B 1OZPA 4CAWA 2G0BA 5FVJA 1PU9A 4M6IA 5DS0A 2PJ5A 1X12A 2JEVA 3VWDA 3TE4A 4YWYA 4CGLA 5HXDA 4NGPA 1YREA 5AG6A 3CXSA 5I4MA 2J8RA 3D2MA 3LODA 4ZX8A 4KSAA 4NGNA 3S6FA 4F0XA 3D7FA 2BSWA 2YNCA 3TO7A 1Y7RA 3FXTA 1IYKA 3KASA 4M6HA 3EFAA 3R95A 3TFYA 4PK2A 3IWEA 4QB9A 5HVFA 4OC3A 1Y0RA 1Z8WA 2Z3PA 1IGBA 4TNUA 5G21A 1IYLA 4J3GA 4BMHA 3KI9A 2PJ7A 4MY0A 3DLJA 2OZGA 4KOVA 5C82A 3K9TA 2WSAA 2CNMA 4YFJA 4HNXB 5LRKA 2I3CA 1RXTA 4MRIA 1R43A 1IOFA 1R57A 4QUSA 4NGQA 2BOAA 4TWEA 5G22A 4YU9A 3KHZA 2POKA 3PEIA 4CYOA 1I21A 4OIDA 2PJ3A 3IIBA 4LQ6A 5D29A 4QBJA 3SI1A 4LUAA 2EUIA 1X10A 2K5TA 3PFEA 4CYPA 4OC0A 2VBQA 4ZGYB 4KUBA 1QMUA 1BAVA 4H89A 4FD6A 2O4HA 4OMEA 4P44A 2AFMA 3RBUA 4XNHC 2ZEHA 1KUXA 2FL4A 2YNEA 4MHNA 4HNYB 3D66A 2J9AA 4BBHA 2ZOFA 2B58A 2KCWA 1CPXA 5H86A 4C2ZA 4F0YA 1Z8XA 1XEBA 2P6EA 4R57A 2FSRA 4KSIA 1Y0YA 2Z3KA 4P4IA 1CPSA 1YLOA 4OC2A 4KLVA 3PZJA 2REEA 4ZI6A 1BOBA 3H8EA 4OKOA 4RI1A 4OAEA 5KTAA 2FS5A 1I1DA 5JGFA 4R9MA 4KVME 2ZOGA 5F48A 3R9EA 3CXQA 4A94A 3TX8A 1LFWA 2GLJA 1S60A 3E0KA 4CAVA 3N5FA 2EWBA 4B10A 2PQ8A 1B87A 1LANA 3FIXA 1VHSA 4M6GA 1Q2CA 5K8PA 4OC1A 3I3GA 3QAHA 4U9ZA 1XBUA 4JD6A 1ELMP 4UEZA 4X5KA 3PRTA 5IB0A 4EWTA 4X3RA 2G9DA 1IY7A 3WABA 1YW4A 5LYLA 2EK9A 2DEAA 3FVLA 4ZYQA 4ZBGA 4E2AA 3CPAA 4PPZA 4UEEA 5K8NA 1Q7LA 4MFQA 3JTKA 4MBUA 3SHPA 1IU8A 2QECA 4A95A 3FB3A 3PFOA 4KORA 3TC8A 3S9MA 4DJLA 2ZEEA 4FWUA 1CX8A 1TIQA 2PCUA 4FUUA 5A28A 4DYOA 3JUWA 3B8GA 1IB1E 4L89A 1HEEA 1M4DA 1VHEA 2HUZA 2OZHA 4MHZA 4PSXA 4B5OA 2CTCA 2J8NA 3VH9A 3B3TA 4QVTA 5EC4A 1XF8A 4C2YA 2BCOA 4EVYA 4AVAA 4PV6A 2AE6A 4UFWA 1Q2YA 3DGVA 3S6HA 2ZXVA 4M3SA 3D7DA 4MFLA 3MN8A 4W9YA 3VWEA 1Z9UA 4MFZA 4FD4A 1NSAA 2ATRA 2QYVA 3NH4A 5F49A 5ISVA 3S6KA 5JQ4A 3TOBA 1XMBA 4II9A 1TF8A 2P0WA 5GCNA 3ISZA 4PQAA 2IJZA 1M4LA 1LAPA 1AUGA 2G3TA 2D4PA 3V7ZA 1BO4A 2PIZA 4R3KA 3KR5A 4ORFA 4B11A 2QJ8A 3NE8A 2AFOA 2ANPA 4XNHB 4PSWA 2JBKA 4P4BA 3IU1A 3S9NA 1V0CA 3B7IA 4B13A 4CPAA 5IX3A 2Z3NA 1PYTB 4MMOA 4NGMA 1S5KA 4UCNA 2C6GA 1F2OA 1OBRA 1TXRA 1L0CA 1Y9KA 3OWCA 4PXDA 1KUVA 1WK4A 1Y7EA 2F7VA 6CPAA 3BJ7A 3H4QA 1FY7A 4PXCA 3B35A 4K3NA 3ZZIA 2OH1A 4H6UA 2Q44A 2VXKA 4JWPA 4DNCA 2PRBA 2QMLA 3GKRA 4WWVA 2ZELA 3DNSA 5I0CA 2QVPA 2HV2A 1TF9A 1BPNA 1MJBA 1U6MA 2V8GA 4UA3A 3CXPA 4ZX9A 3F0AA 4A2ZA 3R9GA 2XEFA 2B3UA 3B3VA 1YVOA 2XEJA 4CGNA 3NE7A 1KZFA 3KKWA 4BINA 1IOIA 1LAMA 1S7NA 4NJRA 1A2ZA 4KOUA 4PXEA 2AFUA 2OR4A 3P2FA 4U5YA 2GE3A 2GFQA 3IGRA 2C6PA 4JXRA 2I00A 5A27A 3B3SA 4BD9A 4CYNA 3PB6X 5BWAB 1XJOA 2I79A 4ONUA 1DE4C 3T8WA 4JYWA 3QB8A 1VIXA 1BPMA 4HKFA 1ZO0A 4XPKA 2OB0A 4CGMA 3TCVA 1SQHA 5KTDA 2PRQA 2PSWA 3DR8A 1ON0A 3H8GA 3KGQA 2ZW5A 4A33A 4CRYB 5IV0A 1Z2LA 3EXNA 2ZEDA 3D3SA 2ZW4A 3LACA 4GXHA 2JEWA 2OU2A 1F57A 3V8IA 5DWNA 4ZY1A 2IQ6A 2VI7A 4UFVA 1FT7A 5E96A 1MJAA 3KR4A 1P0HA 3PGPA 4AVBA 5J8FA 2CF4A 2V8DA 3GIUA 5JPHA 3DSBA 3HLPA 3KQXA 4A39A 4IHMA 1YK3A 5THWA 4C68A 2EO8A 1QSOA 4MHPA 3EY5A 2VZZA 3W6XA 1KUYA 2BUEA 3KZWA 4FBEA 2ZEPA 1S7LA 4O23A 2G3AA 3EC4A 4I49A 2PR8A 4XPDB 4C7HA 5LRJA 4P45A 3LD2A 3S6GA 1NE9A 2RC4A 4CGPA 2ZW6A 2V8VA 2A4NA 4Q38A 4IF5A 1AYEA 2AJ6A 2ZEOA 2NMTA 1Z8LA 2VZYA 1S3ZA 2QIRA 3KHXA 2PDOA 2H5MA 1XMTA 4OIWA 2Q4YA 4CAEA 3SXNA 8CPAA 3IEHA 1Q2DA 2EBJA 2OOTA 4KVOE 2C1CA 1LCPA 2AFWA 4MHDA 2CNSA 1JQGA 3P2HA 3NFZA 4ZY0A 4UCMA 4R87A 4UIAA 2C27A 1QSMA 2OZUA 2WUUA 1YQEA 4XPLA 2CNTA 2PJ9A 3NH8A 4JZ0A 4HNWB 3TT2A 1YR0A 2B3VA 4FD5A 2PJ8A 5DWMA 2DXQA 3R96A 5HVHA 2FIWA 3IJ3A 4KVXA 2J8MA 3IWWA 2BL1A 4YRHA 3WC5A 2X7BA 3T90A 3IFEA 2GLFA 4IK2A 1K4JA 4P4EA 5EBVA 3BI1A 2FVGA 5F46A 2F5IA 1ZG7A 3GB0A 2Z3OA 3NA6A 3SJEA 5C88A 3FEDA 3FX6A 4GM5A 5ELYA 3BXMA 3SJXA 3F5BA 5AG5A 4B5PB 1DTDA 4JXQA 3TOAA 3R1KA 5EMIA 1IICA 4FD7A 4C7IA 4R7MA 1ZLHA 3FEEA 2GU2A 3QNVA 4KLWA 4NF1A 3FMCA 1S7KA 1TKJA 4NCZA 4U9YA 3UY5A 3H5ZA 1RO5A 1YGHA 4A31A 5JH9A 1NMTA 2B5GB 4F9UA 2PJ4A 3I1UA 2GREA 1CG2A 4P4FA 1YMEA 1LOKA 1LRZA 1XFOA 3IU2A 5HH1A 4PXBA 4L8AA 4XPDC 1YLEA 4LQGA 5HVGA 5K8MA 3TO9A 4MFKA 3BLNA 4CAFA 2CY2A 1XRYA 3B2YA 1KWMA 2WPXA 2YNDA 3BI0A 3FNCA 4NJQA 3DDDA 4NGTA 5LYDA 4CGOA 3C26A 4F9VA 3NH5A 1YX0A 4B14A 2NYQA 3ZJ0A 3WT4A 4NEXA 2JDDA 3S9LA 3LWUA 2Q4VA 5AG4A 2FT0A 2Z3LA 4EMEA 2PJ6A 1XOVA 4MFJA 3D67A 4E8OA 3HUVA 3H8FA 3B3CA 5HMNA 3PP9A 3A9LA 3PB7X 4GS4A 3SI0A 3TTHA 3I9SA 3FJUA 3IO1A 1ELLP 4UWJA 4CRZB 4R3LA 4UFXA 4MJ8A 2VEZA 4MCQA 2Q43A 3VARA 4AB7A 4Q36A 2R98A 4UIBA 1JWQA 4F6AA 2PVWA 3JRUA 2ZW7A 2P6GA 3LMSA 5CPAA 4NXYA 2R8VA 5CNPA 3TO6A 4A37A 3WC7A 3CPXA 1YVKA 1F2PA 1FNOA 3PBBA 1M4IA 2B4BA 2PJCA 4A32A 5AGEA 3FH4A 2D4OA 3G8WA 2ABZA 2Q7BA 3R9FA 3WC6A 2IMOA 4M85A 3D7HA 4OP4A 4MCRA 4KSFA 2VL1A 1YSJA 4B12A 3SXOA 2PJ2A 2WYRA 2EK8A 4JJXA 3T9YA 4CYQA 4RUHA 4OADA 2B4DB 4NFRA 2YGWA 4AVCA 3RAMA 3FYNA 1ARLA 1GHEA 2DF5A 3GLJA 3FBUA 4R6TA 2IL4A 2V8HA 3KQZA 1NSLA 5LRGA 4AG7A 3D8PA 4NGRA 1CP7A 1CJWA 2FE7A 3D7GA 3K9UA 4MCSA 2CXAA 4NGSA 4LX9A 4X2TA 4EFDA 4KOTA 4B5PA 2F8HA 1Y9WA 1MJ9A 3GYAA 4MXUA 5LYIA 5K8OA 4K30A 3D4UA 3IWGA 4AXVA 3BJ8A 4UEFA 2FCKA 1S7FA 2Q7SA 1CM0A 4OC5A 4UBRA 2ZPAA 4KUAA 3F8KA 5AG7A 1QSNA 3FF3A 4G1PA 4P10A 4P4DA 2B5GA 1RTQA 2Y0MA 5G20A 2PJ1A 1M1DA 4KS9A 4A30A 5IB9A 2AFZA 2RB7A 1AMPA 1QQ9A 2GIVA 4PK3A 2WPWA 3SI2A 2NSMA 2O53A 1VHOA 1P4NA 1Z4EA 2ZEFA 2XEIA 1TKFA 4OLLA 4KOYA 4Y49C 5LYFA 4KZTA 2JDCA 5JM6A 4IUSA 4UF4A 2ZEMA 2AFXA 4F8ZA 4JLYA 4FAIA 2BEIA 3WR7A 3ISXA 1QSTA 4CAXA 1ZG8A 1BLLE 4Z65A 2VQYA 2HQYA 2XEGA 2Z0ZA 3D68A 1VKCA 3MRUA 2PJ0A 4RS2A 4MCPA 4P4JA 3PB9X 4H2KA 1CP6A 3CZXA 2REFA 2WZNA 2PIYA 1YW6A
chains in the Genus database with same CATH topology
4UCPA 2Z3MA 3G3SA 1J4JA 2Q04A 3RYOA 3GY9A 2ARHA 1Z4RA 1XIXA 1UFHA 3W6SA 4UWIA 4C2XA 3MGDA 4MY3A 3DR6A 5J8CA 3N7ZA 1XE4A 2Q0YA 2DPSA 4MFPA 2GANA 1N71A 5KTCA 5G1ZA 2Z10A 1PUAA 4QC6A 4AG9A 1IIDA 3EO4A 1I12A 2DPTA 2B4DA 3JVNA 4YGOA 2P6FA 3W91A 4KOWA 5H84A 2FIAA 1WWZA 4NSQA 1M4GA 4MI4A 1MK4A 4E0AA 4KOXA 1QSRA 4H6ZA 3FRMA 2R7HA 5JQ4A 1M44A 4Y49B 2PR1A 2Z11A 2O28A 2PC1A 2JLMA 4KOSA 5F47A 2FXFA 2EVNA 2R1IA 2YNCC 1B6BA 3D2PA 4CS0B 1OZPA 4CAWA 2G0BA 5FVJA 1PU9A 2JEVA 3VWDA 3TE4A 4CGLA 1YREA 5AG6A 3CXSA 2J8RA 3D2MA 3LODA 3S6FA 4KSAA 4F0XA 2BSWA 2YNCA 3TO7A 1Y7RA 3FXTA 1IYKA 3TFYA 3EFAA 3R95A 4PK2A 3IWEA 4QB9A 2Z3PA 5G21A 1IYLA 4J3GA 4BMHA 4MY0A 2OZGA 4KOVA 5C82A 2WSAA 2CNMA 4YFJA 4HNXB 1RXTA 1R57A 4QUSA 5G22A 4CYOA 1I21A 4QBJA 4LUAA 2EUIA 2K5TA 4CYPA 2VBQA 4ZGYB 4KUBA 4H89A 4FD6A 4XNHC 1KUXA 2FL4A 2YNEA 4HNYB 4BBHA 2B58A 2KCWA 4F0YA 5H86A 4C2ZA 1XEBA 2P6EA 4R57A 2FSRA 2Z3KA 4KLVA 3PZJA 2REEA 1BOBA 4RI1A 4OAEA 5KTAA 2FS5A 1I1DA 4R9MA 4KVME 5F48A 3R9EA 3CXQA 1S60A 3E0KA 4CAVA 4B10A 2PQ8A 1B87A 3FIXA 1VHSA 1Q2CA 3I3GA 3QAHA 4U9ZA 4JD6A 4X5KA 5IB0A 4ZBGA 4E2AA 4MFQA 3JTKA 4MBUA 3SHPA 4A95A 2QECA 3FB3A 4KORA 1TIQA 5A28A 3JUWA 3B8GA 1IB1E 4L89A 2OZHA 1M4DA 4PSXA 2HUZA 4B5OA 2J8NA 4QVTA 5EC4A 4C2YA 1XF8A 4EVYA 4AVAA 4PV6A 2AE6A 4UFWA 1Q2YA 3S6HA 2ZXVA 4M3SA 4MFLA 3VWEA 1Z9UA 4MFZA 4FD4A 2ATRA 5ISVA 5F49A 3S6KA 3TOBA 4II9A 2P0WA 5GCNA 2G3TA 2D4PA 1BO4A 4R3KA 4ORFA 4B11A 4XNHB 4PSWA 3IU1A 1V0CA 4B13A 5IX3A 2Z3NA 4UCNA 1S5KA 1L0CA 1Y9KA 3OWCA 1KUVA 1WK4A 3BJ7A 3H4QA 1FY7A 3ZZIA 2OH1A 4H6UA 2Q44A 2VXKA 4JWPA 4DNCA 2PRBA 2QMLA 3GKRA 3DNSA 5I0CA 2HV2A 1MJBA 1U6MA 4UA3A 3CXPA 3F0AA 4A2ZA 3R9GA 2B3UA 1YVOA 4CGNA 3NE7A 1KZFA 3KKWA 1S7NA 4KOUA 3P2FA 4U5YA 2GE3A 3IGRA 4JXRA 2I00A 5A27A 4CYNA 5BWAB 2I79A 4ONUA 3QB8A 4HKFA 1ZO0A 4XPKA 2OB0A 4CGMA 3TCVA 1SQHA 5KTDA 2PSWA 3DR8A 1ON0A 4CRYB 2ZW5A 4A33A 5IV0A 3EXNA 3D3SA 2ZW4A 2OU2A 3V8IA 5DWNA 2VI7A 4UFVA 5E96A 1MJAA 1P0HA 3PGPA 4AVBA 5J8FA 5JPHA 3DSBA 1YK3A 4C68A 1QSOA 3EY5A 2VZZA 3W6XA 1KUYA 2BUEA 1S7LA 2G3AA 3EC4A 4I49A 2PR8A 4XPDB 4C7HA 3LD2A 3S6GA 1NE9A 2RC4A 4CGPA 2ZW6A 2A4NA 4Q38A 4IF5A 2AJ6A 2NMTA 2VZYA 1S3ZA 2QIRA 2PDOA 2H5MA 1XMTA 2Q4YA 4CAEA 3SXNA 1Q2DA 4KVOE 4MHDA 2CNSA 3P2HA 4UCMA 4R87A 2C27A 1QSMA 2OZUA 2WUUA 4XPLA 2CNTA 3TT2A 4HNWB 1YR0A 2B3VA 4FD5A 5DWMA 2DXQA 3R96A 2FIWA 4KVXA 2J8MA 4YRHA 2BL1A 2X7BA 3T90A 1K4JA 5EBVA 5F46A 2F5IA 2Z3OA 5C88A 4B5PB 3F5BA 5AG5A 4JXQA 3TOAA 3R1KA 1IICA 4FD7A 4C7IA 4KLWA 4NF1A 1S7KA 4NCZA 4U9YA 3UY5A 3H5ZA 1RO5A 1YGHA 4A31A 1NMTA 2B5GB 1LRZA 3IU2A 5HH1A 4L8AA 4XPDC 1YLEA 3TO9A 4MFKA 3BLNA 4CAFA 2CY2A 2WPXA 2YNDA 3FNCA 3DDDA 4CGOA 3C26A 1YX0A 4B14A 3ZJ0A 4NEXA 2JDDA 2Q4VA 5AG4A 2FT0A 2Z3LA 4MFJA 4E8OA 5HMNA 3PP9A 3A9LA 4GS4A 3TTHA 3I9SA 4UWJA 4CRZB 4R3LA 4UFXA 4MJ8A 2VEZA 4AB7A 4Q36A 2R98A 4F6AA 2ZW7A 2P6GA 4NXYA 2R8VA 5CNPA 3TO6A 1YVKA 1M4IA 2B4BA 4A32A 5AGEA 2D4OA 3G8WA 2Q7BA 3R9FA 4M85A 4KSFA 4B12A 3SXOA 4JJXA 3T9YA 4CYQA 4OADA 2B4DB 2YGWA 4AVCA 3FYNA 1GHEA 1NSLA 3FBUA 2IL4A 4AG7A 3D8PA 1CJWA 2FE7A 3K9UA 2CXAA 4LX9A 4KOTA 4B5PA 1Y9WA 1MJ9A 3GYAA 4K30A 3IWGA 3BJ8A 2FCKA 1S7FA 1CM0A 4UBRA 2ZPAA 4KUAA 3F8KA 5AG7A 1QSNA 2B5GA 2Y0MA 5G20A 4KS9A 1M1DA 4A30A 2GIVA 4PK3A 2WPWA 1P4NA 1Z4EA 4OLLA 4Y49C 4KOYA 4KZTA 2JDCA 4IUSA 4JLYA 2BEIA 3WR7A 1QSTA 4CAXA 2VQYA 2HQYA 2Z0ZA 1VKCA 4RS2A 2REFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G3S A;  1J4J A;  2Q04 A;  3RYO A;  3GY9 A;  2ARH A;  1Z4R A;  1XIX A;  1UFH A;  3W6S A;  4UWI A;  3MGD A;  4MY3 A;  3DR6 A;  5J8C A;  3N7Z A;  1XE4 A;  2Q0Y A;  2GAN A;  1N71 A;  5KTC A;  2Z10 A;  1PUA A;  4QC6 A;  4AG9 A;  1IID A;  3EO4 A;  1I12 A;  2B4D A;  3JVN A;  4YGO A;  2P6F A;  3W91 A;  4KOW A;  5H84 A;  2FIA A;  1WWZ A;  4NSQ A;  1M4G A;  4MI4 A;  1MK4 A;  4E0A A;  4KOX A;  1QSR A;  4H6Z A;  3FRM A;  2R7H A;  5JQ4 A;  1M44 A;  4Y49 B;  2PR1 A;  2Z11 A;  2O28 A;  2PC1 A;  2JLM A;  4KOS A;  5F47 A;  2FXF A;  2EVN A;  2R1I A;  1B6B A;  3D2P A;  4CS0 B;  1OZP A;  4CAW A;  2G0B A;  5FVJ A;  1PU9 A;  2JEV A;  3VWD A;  3TE4 A;  1YRE A;  3CXS A;  2J8R A;  3D2M A;  3LOD A;  3S6F A;  2BSW A;  3TO7 A;  1Y7R A;  3FXT A;  1IYK A;  3TFY A;  3EFA A;  3R95 A;  4PK2 A;  4QB9 A;  1IYL A;  4J3G A;  4BMH A;  4MY0 A;  2OZG A;  4KOV A;  5C82 A;  4YFJ A;  2CNM A;  4HNX B;  1RXT A;  1R57 A;  4QUS A;  1I21 A;  4QBJ A;  4LUA A;  2EUI A;  2K5T A;  2VBQ A;  4KUB A;  4H89 A;  4FD6 A;  4XNH C;  1KUX A;  2FL4 A;  4HNY B;  2B58 A;  2KCW A;  4F0Y A;  5H86 A;  1XEB A;  2P6E A;  4R57 A;  2FSR A;  4KLV A;  3PZJ A;  2REE A;  1BOB A;  4RI1 A;  4OAE A;  5KTA A;  2FS5 A;  1I1D A;  4R9M A;  4KVM E;  5F48 A;  3R9E A;  3CXQ A;  1S60 A;  3E0K A;  4CAV A;  2PQ8 A;  1B87 A;  3FIX A;  1VHS A;  1Q2C A;  3I3G A;  3QAH A;  4U9Z A;  4JD6 A;  4X5K A;  5IB0 A;  4ZBG A;  4E2A A;  4MBU A;  3SHP A;  2QEC A;  3FB3 A;  4KOR A;  1TIQ A;  3JUW A;  3B8G A;  1IB1 E;  4L89 A;  2OZH A;  1M4D A;  4PSX A;  2HUZ A;  4B5O A;  2J8N A;  4QVT A;  5EC4 A;  4EVY A;  1XF8 A;  4AVA A;  4PV6 A;  2AE6 A;  1Q2Y A;  3S6H A;  2ZXV A;  4M3S A;  3VWE A;  1Z9U A;  4FD4 A;  2ATR A;  5ISV A;  5F49 A;  3S6K A;  3TOB A;  4II9 A;  2P0W A;  5GCN A;  2G3T A;  2D4P A;  1BO4 A;  4R3K A;  4ORF A;  4XNH B;  4PSW A;  1V0C A;  5IX3 A;  1S5K A;  1L0C A;  1Y9K A;  3OWC A;  1KUV A;  1WK4 A;  3BJ7 A;  3H4Q A;  1FY7 A;  3ZZI A;  2OH1 A;  4H6U A;  2Q44 A;  2VXK A;  4JWP A;  4DNC A;  2PRB A;  2QML A;  3GKR A;  3DNS A;  5I0C A;  2HV2 A;  1MJB A;  1U6M A;  4UA3 A;  3CXP A;  3F0A A;  3R9G A;  2B3U A;  1YVO A;  3NE7 A;  1KZF A;  3KKW A;  1S7N A;  4KOU A;  3P2F A;  4U5Y A;  2GE3 A;  3IGR A;  4JXR A;  2I00 A;  2I79 A;  4ONU A;  3QB8 A;  4HKF A;  4XPK A;  2OB0 A;  3TCV A;  1SQH A;  5KTD A;  2PSW A;  3DR8 A;  1ON0 A;  4CRY B;  2ZW5 A;  5IV0 A;  3EXN A;  3D3S A;  2ZW4 A;  2OU2 A;  3V8I A;  5DWN A;  2VI7 A;  5E96 A;  1MJA A;  1P0H A;  3PGP A;  4AVB A;  5J8F A;  5JPH A;  3DSB A;  1YK3 A;  1QSO A;  3EY5 A;  2VZZ A;  3W6X A;  1KUY A;  2BUE A;  1S7L A;  2G3A A;  3EC4 A;  4I49 A;  2PR8 A;  4XPD B;  3LD2 A;  3S6G A;  1NE9 A;  2RC4 A;  2ZW6 A;  2A4N A;  4IF5 A;  2AJ6 A;  2NMT A;  2VZY A;  1S3Z A;  2QIR A;  2PDO A;  2H5M A;  1XMT A;  2Q4Y A;  3SXN A;  1Q2D A;  4KVO E;  4MHD A;  2CNS A;  3P2H A;  4R87 A;  2C27 A;  1QSM A;  2OZU A;  4XPL A;  2CNT A;  3TT2 A;  4HNW B;  1YR0 A;  2B3V A;  4FD5 A;  5DWM A;  2DXQ A;  3R96 A;  2FIW A;  4KVX A;  2J8M A;  4YRH A;  2BL1 A;  2X7B A;  3T90 A;  1K4J A;  5EBV A;  5F46 A;  2F5I A;  5C88 A;  4B5P B;  3F5B A;  4JXQ A;  3TOA A;  3R1K A;  1IIC A;  4FD7 A;  4KLW A;  4NF1 A;  1S7K A;  4NCZ A;  4U9Y A;  3UY5 A;  1RO5 A;  1YGH A;  1NMT A;  2B5G B;  1LRZ A;  5HH1 A;  4L8A A;  4XPD C;  1YLE A;  3TO9 A;  3BLN A;  2CY2 A;  2WPX A;  3FNC A;  3DDD A;  3C26 A;  1YX0 A;  3ZJ0 A;  4NEX A;  2JDD A;  2Q4V A;  2FT0 A;  4E8O A;  5HMN A;  3PP9 A;  4GS4 A;  3TTH A;  3I9S A;  4UWJ A;  4CRZ B;  4R3L A;  4MJ8 A;  2VEZ A;  4AB7 A;  2R98 A;  4F6A A;  2ZW7 A;  2P6G A;  4NXY A;  2R8V A;  5CNP A;  3TO6 A;  1YVK A;  1M4I A;  2B4B A;  2D4O A;  3G8W A;  2Q7B A;  3R9F A;  4M85 A;  3SXO A;  4JJX A;  3T9Y A;  4OAD A;  2B4D B;  4AVC A;  3FYN A;  1GHE A;  1NSL A;  3FBU A;  2IL4 A;  4AG7 A;  3D8P A;  1CJW A;  2FE7 A;  3K9U A;  4LX9 A;  4KOT A;  4B5P A;  1Y9W A;  1MJ9 A;  3GYA A;  4K30 A;  3IWG A;  3BJ8 A;  2FCK A;  1S7F A;  1CM0 A;  4UBR A;  2ZPA A;  4KUA A;  3F8K A;  1QSN A;  2B5G A;  2Y0M A;  1M1D A;  2GIV A;  4PK3 A;  2WPW A;  1P4N A;  1Z4E A;  4OLL A;  4Y49 C;  4KOY A;  4KZT A;  2JDC A;  4IUS A;  4JLY A;  2BEI A;  3WR7 A;  1QST A;  4CAX A;  2VQY A;  2HQY A;  2Z0Z A;  1VKC A;  4RS2 A;  2REF A; 
#chains in the Genus database with same CATH topology
 1HDQ A;  4A38 A;  4UCP A;  2Z3M A;  3G3S A;  1J4J A;  1EE3 P;  2Q04 A;  3CDX A;  4IAV A;  3RYO A;  3VAT A;  5J1Q A;  3GY9 A;  5F09 A;  3CT9 A;  2ARH A;  4OC4 A;  1Z4R A;  1XIX A;  1UFH A;  2PVV A;  3W6S A;  4UWI A;  1GYT A;  3BHX A;  1Z8T A;  5D8N A;  4B6Z A;  4C2X A;  3QAY A;  3RO0 A;  3MGD A;  3PB4 X;  4MY3 A;  3DR6 A;  3IC1 A;  5J8C A;  3N7Z A;  1UWY A;  1XE4 A;  1ZG9 A;  2Q0Y A;  2DPS A;  4MFP A;  2GAN A;  1N71 A;  4MHY A;  5KTC A;  5G1Z A;  2Z10 A;  1PUA A;  2ZEG A;  4QC6 A;  4ZY2 A;  4AG9 A;  1IID A;  1Z5R A;  3EO4 A;  4R76 A;  4Q7A A;  2CTB A;  3FEC A;  2V77 A;  2ZEN A;  2AFS A;  1I12 A;  4DUK A;  3SJF A;  3K2K A;  2DPT A;  2B4D A;  4RN7 A;  3JVN A;  4YGO A;  3PBE A;  2P6F A;  2Q4Z A;  3W91 A;  3RZA A;  4KOW A;  5H84 A;  4HPS A;  4ONW A;  1ZLI A;  3RNZ A;  2FIA A;  3GUX A;  1ARM A;  2Q51 A;  5CBM A;  2ODF A;  2CIJ A;  4R8F A;  4X8I A;  1WWZ A;  4NSQ A;  2JBJ A;  1CBX A;  3KL9 A;  1M4G A;  3B3W A;  4MI4 A;  3V38 A;  2PJB A;  1HDU A;  1MK4 A;  4WJB A;  4E0A A;  3L2N A;  4KOX A;  1QSR A;  4H6Z A;  1VGY A;  3FRM A;  2R7H A;  1R3N A;  1M44 A;  2BO9 A;  2PR1 A;  2RFH A;  2O28 A;  2Z11 A;  4Y49 B;  2HC9 A;  2PC1 A;  1PCA A;  2PE3 A;  2JLM A;  4KOS A;  5F47 A;  7CPA A;  1TKH A;  2FXF A;  3SJG A;  1H8L A;  2EVN A;  2R1I A;  2YNC C;  2PJA A;  4P6Y A;  2C6C A;  2HB6 A;  1B6B A;  3D2P A;  3PB8 X;  4CS0 B;  1OZP A;  4CAW A;  2G0B A;  5FVJ A;  1PU9 A;  4M6I A;  5DS0 A;  2PJ5 A;  1X12 A;  2JEV A;  3VWD A;  3TE4 A;  4YWY A;  4CGL A;  5HXD A;  4NGP A;  1YRE A;  5AG6 A;  3CXS A;  5I4M A;  2J8R A;  3D2M A;  3LOD A;  4ZX8 A;  4KSA A;  4NGN A;  3S6F A;  4F0X A;  3D7F A;  2BSW A;  2YNC A;  3TO7 A;  1Y7R A;  3FXT A;  1IYK A;  3KAS A;  4M6H A;  3EFA A;  3R95 A;  3TFY A;  4PK2 A;  3IWE A;  4QB9 A;  5HVF A;  4OC3 A;  1Y0R A;  1Z8W A;  2Z3P A;  1IGB A;  4TNU A;  5G21 A;  1IYL A;  4J3G A;  4BMH A;  3KI9 A;  2PJ7 A;  4MY0 A;  3DLJ A;  2OZG A;  4KOV A;  5C82 A;  3K9T A;  2WSA A;  2CNM A;  4YFJ A;  4HNX B;  5LRK A;  2I3C A;  1RXT A;  4MRI A;  1R43 A;  1IOF A;  1R57 A;  4QUS A;  4NGQ A;  2BOA A;  4TWE A;  5G22 A;  4YU9 A;  3KHZ A;  2POK A;  3PEI A;  4CYO A;  1I21 A;  4OID A;  2PJ3 A;  3IIB A;  4LQ6 A;  5D29 A;  4QBJ A;  3SI1 A;  4LUA A;  2EUI A;  1X10 A;  2K5T A;  3PFE A;  4CYP A;  4OC0 A;  2VBQ A;  4ZGY B;  4KUB A;  1QMU A;  1BAV A;  4H89 A;  4FD6 A;  2O4H A;  4OME A;  4P44 A;  2AFM A;  3RBU A;  4XNH C;  2ZEH A;  1KUX A;  2FL4 A;  2YNE A;  4MHN A;  4HNY B;  3D66 A;  2J9A A;  4BBH A;  2ZOF A;  2B58 A;  2KCW A;  1CPX A;  5H86 A;  4C2Z A;  4F0Y A;  1Z8X A;  1XEB A;  2P6E A;  4R57 A;  2FSR A;  4KSI A;  1Y0Y A;  2Z3K A;  4P4I A;  1CPS A;  1YLO A;  4OC2 A;  4KLV A;  3PZJ A;  2REE A;  4ZI6 A;  1BOB A;  3H8E A;  4OKO A;  4RI1 A;  4OAE A;  5KTA A;  2FS5 A;  1I1D A;  5JGF A;  4R9M A;  4KVM E;  2ZOG A;  5F48 A;  3R9E A;  3CXQ A;  4A94 A;  3TX8 A;  1LFW A;  2GLJ A;  1S60 A;  3E0K A;  4CAV A;  3N5F A;  2EWB A;  4B10 A;  2PQ8 A;  1B87 A;  1LAN A;  3FIX A;  1VHS A;  4M6G A;  1Q2C A;  5K8P A;  4OC1 A;  3I3G A;  3QAH A;  4U9Z A;  1XBU A;  4JD6 A;  1ELM P;  4UEZ A;  4X5K A;  3PRT A;  5IB0 A;  4EWT A;  4X3R A;  2G9D A;  1IY7 A;  3WAB A;  1YW4 A;  5LYL A;  2EK9 A;  2DEA A;  3FVL A;  4ZYQ A;  4ZBG A;  4E2A A;  3CPA A;  4PPZ A;  4UEE A;  5K8N A;  1Q7L A;  4MFQ A;  3JTK A;  4MBU A;  3SHP A;  1IU8 A;  2QEC A;  4A95 A;  3FB3 A;  3PFO A;  4KOR A;  3TC8 A;  3S9M A;  4DJL A;  2ZEE A;  4FWU A;  1CX8 A;  1TIQ A;  2PCU A;  4FUU A;  5A28 A;  4DYO A;  3JUW A;  3B8G A;  1IB1 E;  4L89 A;  1HEE A;  1M4D A;  1VHE A;  2HUZ A;  2OZH A;  4MHZ A;  4PSX A;  4B5O A;  2CTC A;  2J8N A;  3VH9 A;  3B3T A;  4QVT A;  5EC4 A;  1XF8 A;  4C2Y A;  2BCO A;  4EVY A;  4AVA A;  4PV6 A;  2AE6 A;  4UFW A;  1Q2Y A;  3DGV A;  3S6H A;  2ZXV A;  4M3S A;  3D7D A;  4MFL A;  3MN8 A;  4W9Y A;  3VWE A;  1Z9U A;  4MFZ A;  4FD4 A;  1NSA A;  2ATR A;  2QYV A;  3NH4 A;  5F49 A;  5ISV A;  3S6K A;  5JQ4 A;  3TOB A;  1XMB A;  4II9 A;  1TF8 A;  2P0W A;  5GCN A;  3ISZ A;  4PQA A;  2IJZ A;  1M4L A;  1LAP A;  1AUG A;  2G3T A;  2D4P A;  3V7Z A;  1BO4 A;  2PIZ A;  4R3K A;  3KR5 A;  4ORF A;  4B11 A;  2QJ8 A;  3NE8 A;  2AFO A;  2ANP A;  4XNH B;  4PSW A;  2JBK A;  4P4B A;  3IU1 A;  3S9N A;  1V0C A;  3B7I A;  4B13 A;  4CPA A;  5IX3 A;  2Z3N A;  1PYT B;  4MMO A;  4NGM A;  1S5K A;  4UCN A;  2C6G A;  1F2O A;  1OBR A;  1TXR A;  1L0C A;  1Y9K A;  3OWC A;  4PXD A;  1KUV A;  1WK4 A;  1Y7E A;  2F7V A;  6CPA A;  3BJ7 A;  3H4Q A;  1FY7 A;  4PXC A;  3B35 A;  4K3N A;  3ZZI A;  2OH1 A;  4H6U A;  2Q44 A;  2VXK A;  4JWP A;  4DNC A;  2PRB A;  2QML A;  3GKR A;  4WWV A;  2ZEL A;  3DNS A;  5I0C A;  2QVP A;  2HV2 A;  1TF9 A;  1BPN A;  1MJB A;  1U6M A;  2V8G A;  4UA3 A;  3CXP A;  4ZX9 A;  3F0A A;  4A2Z A;  3R9G A;  2XEF A;  2B3U A;  3B3V A;  1YVO A;  2XEJ A;  4CGN A;  3NE7 A;  1KZF A;  3KKW A;  4BIN A;  1IOI A;  1LAM A;  1S7N A;  4NJR A;  1A2Z A;  4KOU A;  4PXE A;  2AFU A;  2OR4 A;  3P2F A;  4U5Y A;  2GE3 A;  2GFQ A;  3IGR A;  2C6P A;  4JXR A;  2I00 A;  5A27 A;  3B3S A;  4BD9 A;  4CYN A;  3PB6 X;  5BWA B;  1XJO A;  2I79 A;  4ONU A;  1DE4 C;  3T8W A;  4JYW A;  3QB8 A;  1VIX A;  1BPM A;  4HKF A;  1ZO0 A;  4XPK A;  2OB0 A;  4CGM A;  3TCV A;  1SQH A;  5KTD A;  2PRQ A;  2PSW A;  3DR8 A;  1ON0 A;  3H8G A;  3KGQ A;  2ZW5 A;  4A33 A;  4CRY B;  5IV0 A;  1Z2L A;  3EXN A;  2ZED A;  3D3S A;  2ZW4 A;  3LAC A;  4GXH A;  2JEW A;  2OU2 A;  1F57 A;  3V8I A;  5DWN A;  4ZY1 A;  2IQ6 A;  2VI7 A;  4UFV A;  1FT7 A;  5E96 A;  1MJA A;  3KR4 A;  1P0H A;  3PGP A;  4AVB A;  5J8F A;  2CF4 A;  2V8D A;  3GIU A;  5JPH A;  3DSB A;  3HLP A;  3KQX A;  4A39 A;  4IHM A;  1YK3 A;  5THW A;  4C68 A;  2EO8 A;  1QSO A;  4MHP A;  3EY5 A;  2VZZ A;  3W6X A;  1KUY A;  2BUE A;  3KZW A;  4FBE A;  2ZEP A;  1S7L A;  4O23 A;  2G3A A;  3EC4 A;  4I49 A;  2PR8 A;  4XPD B;  4C7H A;  5LRJ A;  4P45 A;  3LD2 A;  3S6G A;  1NE9 A;  2RC4 A;  4CGP A;  2ZW6 A;  2V8V A;  2A4N A;  4Q38 A;  4IF5 A;  1AYE A;  2AJ6 A;  2ZEO A;  2NMT A;  1Z8L A;  2VZY A;  1S3Z A;  2QIR A;  3KHX A;  2PDO A;  2H5M A;  1XMT A;  4OIW A;  2Q4Y A;  4CAE A;  3SXN A;  8CPA A;  3IEH A;  1Q2D A;  2EBJ A;  2OOT A;  4KVO E;  2C1C A;  1LCP A;  2AFW A;  4MHD A;  2CNS A;  1JQG A;  3P2H A;  3NFZ A;  4ZY0 A;  4UCM A;  4R87 A;  4UIA A;  2C27 A;  1QSM A;  2OZU A;  2WUU A;  1YQE A;  4XPL A;  2CNT A;  2PJ9 A;  3NH8 A;  4JZ0 A;  4HNW B;  3TT2 A;  1YR0 A;  2B3V A;  4FD5 A;  2PJ8 A;  5DWM A;  2DXQ A;  3R96 A;  5HVH A;  2FIW A;  3IJ3 A;  4KVX A;  2J8M A;  3IWW A;  2BL1 A;  4YRH A;  3WC5 A;  2X7B A;  3T90 A;  3IFE A;  2GLF A;  4IK2 A;  1K4J A;  4P4E A;  5EBV A;  3BI1 A;  2FVG A;  5F46 A;  2F5I A;  1ZG7 A;  3GB0 A;  2Z3O A;  3NA6 A;  3SJE A;  5C88 A;  3FED A;  3FX6 A;  4GM5 A;  5ELY A;  3BXM A;  3SJX A;  3F5B A;  5AG5 A;  4B5P B;  1DTD A;  4JXQ A;  3TOA A;  3R1K A;  5EMI A;  1IIC A;  4FD7 A;  4C7I A;  4R7M A;  1ZLH A;  3FEE A;  2GU2 A;  3QNV A;  4KLW A;  4NF1 A;  3FMC A;  1S7K A;  1TKJ A;  4NCZ A;  4U9Y A;  3UY5 A;  3H5Z A;  1RO5 A;  1YGH A;  4A31 A;  5JH9 A;  1NMT A;  2B5G B;  4F9U A;  2PJ4 A;  3I1U A;  2GRE A;  1CG2 A;  4P4F A;  1YME A;  1LOK A;  1LRZ A;  1XFO A;  3IU2 A;  5HH1 A;  4PXB A;  4L8A A;  4XPD C;  1YLE A;  4LQG A;  5HVG A;  5K8M A;  3TO9 A;  4MFK A;  3BLN A;  4CAF A;  2CY2 A;  1XRY A;  3B2Y A;  1KWM A;  2WPX A;  2YND A;  3BI0 A;  3FNC A;  4NJQ A;  3DDD A;  4NGT A;  5LYD A;  4CGO A;  3C26 A;  4F9V A;  3NH5 A;  1YX0 A;  4B14 A;  2NYQ A;  3ZJ0 A;  3WT4 A;  4NEX A;  2JDD A;  3S9L A;  3LWU A;  2Q4V A;  5AG4 A;  2FT0 A;  2Z3L A;  4EME A;  2PJ6 A;  1XOV A;  4MFJ A;  3D67 A;  4E8O A;  3HUV A;  3H8F A;  3B3C A;  5HMN A;  3PP9 A;  3A9L A;  3PB7 X;  4GS4 A;  3SI0 A;  3TTH A;  3I9S A;  3FJU A;  3IO1 A;  1ELL P;  4UWJ A;  4CRZ B;  4R3L A;  4UFX A;  4MJ8 A;  2VEZ A;  4MCQ A;  2Q43 A;  3VAR A;  4AB7 A;  4Q36 A;  2R98 A;  4UIB A;  1JWQ A;  4F6A A;  2PVW A;  3JRU A;  2ZW7 A;  2P6G A;  3LMS A;  5CPA A;  4NXY A;  2R8V A;  5CNP A;  3TO6 A;  4A37 A;  3WC7 A;  3CPX A;  1YVK A;  1F2P A;  1FNO A;  3PBB A;  1M4I A;  2B4B A;  2PJC A;  4A32 A;  5AGE A;  3FH4 A;  2D4O A;  3G8W A;  2ABZ A;  2Q7B A;  3R9F A;  3WC6 A;  2IMO A;  4M85 A;  3D7H A;  4OP4 A;  4MCR A;  4KSF A;  2VL1 A;  1YSJ A;  4B12 A;  3SXO A;  2PJ2 A;  2WYR A;  2EK8 A;  4JJX A;  3T9Y A;  4CYQ A;  4RUH A;  4OAD A;  2B4D B;  4NFR A;  2YGW A;  4AVC A;  3RAM A;  3FYN A;  1ARL A;  1GHE A;  2DF5 A;  3GLJ A;  3FBU A;  4R6T A;  2IL4 A;  2V8H A;  3KQZ A;  1NSL A;  5LRG A;  4AG7 A;  3D8P A;  4NGR A;  1CP7 A;  1CJW A;  2FE7 A;  3D7G A;  3K9U A;  4MCS A;  2CXA A;  4NGS A;  4LX9 A;  4X2T A;  4EFD A;  4KOT A;  4B5P A;  2F8H A;  1Y9W A;  1MJ9 A;  3GYA A;  4MXU A;  5LYI A;  5K8O A;  4K30 A;  3D4U A;  3IWG A;  4AXV A;  3BJ8 A;  4UEF A;  2FCK A;  1S7F A;  2Q7S A;  1CM0 A;  4OC5 A;  4UBR A;  2ZPA A;  4KUA A;  3F8K A;  5AG7 A;  1QSN A;  3FF3 A;  4G1P A;  4P10 A;  4P4D A;  2B5G A;  1RTQ A;  2Y0M A;  5G20 A;  2PJ1 A;  1M1D A;  4KS9 A;  4A30 A;  5IB9 A;  2AFZ A;  2RB7 A;  1AMP A;  1QQ9 A;  2GIV A;  4PK3 A;  2WPW A;  3SI2 A;  2NSM A;  2O53 A;  1VHO A;  1P4N A;  1Z4E A;  2ZEF A;  2XEI A;  1TKF A;  4OLL A;  4KOY A;  4Y49 C;  5LYF A;  4KZT A;  2JDC A;  5JM6 A;  4IUS A;  4UF4 A;  2ZEM A;  2AFX A;  4F8Z A;  4JLY A;  4FAI A;  2BEI A;  3WR7 A;  3ISX A;  1QST A;  4CAX A;  1ZG8 A;  1BLL E;  4Z65 A;  2VQY A;  2HQY A;  2XEG A;  2Z0Z A;  3D68 A;  1VKC A;  3MRU A;  2PJ0 A;  4RS2 A;  4MCP A;  4P4J A;  3PB9 X;  4H2K A;  1CP6 A;  3CZX A;  2REF A;  2WZN A;  2PIY A;  1YW6 A; 
#chains in the Genus database with same CATH homology
 4UCP A;  2Z3M A;  3G3S A;  1J4J A;  2Q04 A;  3RYO A;  3GY9 A;  2ARH A;  1Z4R A;  1XIX A;  1UFH A;  3W6S A;  4UWI A;  4C2X A;  3MGD A;  4MY3 A;  3DR6 A;  5J8C A;  3N7Z A;  1XE4 A;  2Q0Y A;  2DPS A;  4MFP A;  2GAN A;  1N71 A;  5KTC A;  5G1Z A;  2Z10 A;  1PUA A;  4QC6 A;  4AG9 A;  1IID A;  3EO4 A;  1I12 A;  2DPT A;  2B4D A;  3JVN A;  4YGO A;  2P6F A;  3W91 A;  4KOW A;  5H84 A;  2FIA A;  1WWZ A;  4NSQ A;  1M4G A;  4MI4 A;  1MK4 A;  4E0A A;  4KOX A;  1QSR A;  4H6Z A;  3FRM A;  2R7H A;  5JQ4 A;  1M44 A;  4Y49 B;  2PR1 A;  2Z11 A;  2O28 A;  2PC1 A;  2JLM A;  4KOS A;  5F47 A;  2FXF A;  2EVN A;  2R1I A;  2YNC C;  1B6B A;  3D2P A;  4CS0 B;  1OZP A;  4CAW A;  2G0B A;  5FVJ A;  1PU9 A;  2JEV A;  3VWD A;  3TE4 A;  4CGL A;  1YRE A;  5AG6 A;  3CXS A;  2J8R A;  3D2M A;  3LOD A;  3S6F A;  4KSA A;  4F0X A;  2BSW A;  2YNC A;  3TO7 A;  1Y7R A;  3FXT A;  1IYK A;  3TFY A;  3EFA A;  3R95 A;  4PK2 A;  3IWE A;  4QB9 A;  2Z3P A;  5G21 A;  1IYL A;  4J3G A;  4BMH A;  4MY0 A;  2OZG A;  4KOV A;  5C82 A;  2WSA A;  2CNM A;  4YFJ A;  4HNX B;  1RXT A;  1R57 A;  4QUS A;  5G22 A;  4CYO A;  1I21 A;  4QBJ A;  4LUA A;  2EUI A;  2K5T A;  4CYP A;  2VBQ A;  4ZGY B;  4KUB A;  4H89 A;  4FD6 A;  4XNH C;  1KUX A;  2FL4 A;  2YNE A;  4HNY B;  4BBH A;  2B58 A;  2KCW A;  4F0Y A;  5H86 A;  4C2Z A;  1XEB A;  2P6E A;  4R57 A;  2FSR A;  2Z3K A;  4KLV A;  3PZJ A;  2REE A;  1BOB A;  4RI1 A;  4OAE A;  5KTA A;  2FS5 A;  1I1D A;  4R9M A;  4KVM E;  5F48 A;  3R9E A;  3CXQ A;  1S60 A;  3E0K A;  4CAV A;  4B10 A;  2PQ8 A;  1B87 A;  3FIX A;  1VHS A;  1Q2C A;  3I3G A;  3QAH A;  4U9Z A;  4JD6 A;  4X5K A;  5IB0 A;  4ZBG A;  4E2A A;  4MFQ A;  3JTK A;  4MBU A;  3SHP A;  4A95 A;  2QEC A;  3FB3 A;  4KOR A;  1TIQ A;  5A28 A;  3JUW A;  3B8G A;  1IB1 E;  4L89 A;  2OZH A;  1M4D A;  4PSX A;  2HUZ A;  4B5O A;  2J8N A;  4QVT A;  5EC4 A;  4C2Y A;  1XF8 A;  4EVY A;  4AVA A;  4PV6 A;  2AE6 A;  4UFW A;  1Q2Y A;  3S6H A;  2ZXV A;  4M3S A;  4MFL A;  3VWE A;  1Z9U A;  4MFZ A;  4FD4 A;  2ATR A;  5ISV A;  5F49 A;  3S6K A;  3TOB A;  4II9 A;  2P0W A;  5GCN A;  2G3T A;  2D4P A;  1BO4 A;  4R3K A;  4ORF A;  4B11 A;  4XNH B;  4PSW A;  3IU1 A;  1V0C A;  4B13 A;  5IX3 A;  2Z3N A;  4UCN A;  1S5K A;  1L0C A;  1Y9K A;  3OWC A;  1KUV A;  1WK4 A;  3BJ7 A;  3H4Q A;  1FY7 A;  3ZZI A;  2OH1 A;  4H6U A;  2Q44 A;  2VXK A;  4JWP A;  4DNC A;  2PRB A;  2QML A;  3GKR A;  3DNS A;  5I0C A;  2HV2 A;  1MJB A;  1U6M A;  4UA3 A;  3CXP A;  3F0A A;  4A2Z A;  3R9G A;  2B3U A;  1YVO A;  4CGN A;  3NE7 A;  1KZF A;  3KKW A;  1S7N A;  4KOU A;  3P2F A;  4U5Y A;  2GE3 A;  3IGR A;  4JXR A;  2I00 A;  5A27 A;  4CYN A;  5BWA B;  2I79 A;  4ONU A;  3QB8 A;  4HKF A;  1ZO0 A;  4XPK A;  2OB0 A;  4CGM A;  3TCV A;  1SQH A;  5KTD A;  2PSW A;  3DR8 A;  1ON0 A;  4CRY B;  2ZW5 A;  4A33 A;  5IV0 A;  3EXN A;  3D3S A;  2ZW4 A;  2OU2 A;  3V8I A;  5DWN A;  2VI7 A;  4UFV A;  5E96 A;  1MJA A;  1P0H A;  3PGP A;  4AVB A;  5J8F A;  5JPH A;  3DSB A;  1YK3 A;  4C68 A;  1QSO A;  3EY5 A;  2VZZ A;  3W6X A;  1KUY A;  2BUE A;  1S7L A;  2G3A A;  3EC4 A;  4I49 A;  2PR8 A;  4XPD B;  4C7H A;  3LD2 A;  3S6G A;  1NE9 A;  2RC4 A;  4CGP A;  2ZW6 A;  2A4N A;  4Q38 A;  4IF5 A;  2AJ6 A;  2NMT A;  2VZY A;  1S3Z A;  2QIR A;  2PDO A;  2H5M A;  1XMT A;  2Q4Y A;  4CAE A;  3SXN A;  1Q2D A;  4KVO E;  4MHD A;  2CNS A;  3P2H A;  4UCM A;  4R87 A;  2C27 A;  1QSM A;  2OZU A;  2WUU A;  4XPL A;  2CNT A;  3TT2 A;  4HNW B;  1YR0 A;  2B3V A;  4FD5 A;  5DWM A;  2DXQ A;  3R96 A;  2FIW A;  4KVX A;  2J8M A;  4YRH A;  2BL1 A;  2X7B A;  3T90 A;  1K4J A;  5EBV A;  5F46 A;  2F5I A;  2Z3O A;  5C88 A;  4B5P B;  3F5B A;  5AG5 A;  4JXQ A;  3TOA A;  3R1K A;  1IIC A;  4FD7 A;  4C7I A;  4KLW A;  4NF1 A;  1S7K A;  4NCZ A;  4U9Y A;  3UY5 A;  3H5Z A;  1RO5 A;  1YGH A;  4A31 A;  1NMT A;  2B5G B;  1LRZ A;  3IU2 A;  5HH1 A;  4L8A A;  4XPD C;  1YLE A;  3TO9 A;  4MFK A;  3BLN A;  4CAF A;  2CY2 A;  2WPX A;  2YND A;  3FNC A;  3DDD A;  4CGO A;  3C26 A;  1YX0 A;  4B14 A;  3ZJ0 A;  4NEX A;  2JDD A;  2Q4V A;  5AG4 A;  2FT0 A;  2Z3L A;  4MFJ A;  4E8O A;  5HMN A;  3PP9 A;  3A9L A;  4GS4 A;  3TTH A;  3I9S A;  4UWJ A;  4CRZ B;  4R3L A;  4UFX A;  4MJ8 A;  2VEZ A;  4AB7 A;  4Q36 A;  2R98 A;  4F6A A;  2ZW7 A;  2P6G A;  4NXY A;  2R8V A;  5CNP A;  3TO6 A;  1YVK A;  1M4I A;  2B4B A;  4A32 A;  5AGE A;  2D4O A;  3G8W A;  2Q7B A;  3R9F A;  4M85 A;  4KSF A;  4B12 A;  3SXO A;  4JJX A;  3T9Y A;  4CYQ A;  4OAD A;  2B4D B;  2YGW A;  4AVC A;  3FYN A;  1GHE A;  1NSL A;  3FBU A;  2IL4 A;  4AG7 A;  3D8P A;  1CJW A;  2FE7 A;  3K9U A;  2CXA A;  4LX9 A;  4KOT A;  4B5P A;  1Y9W A;  1MJ9 A;  3GYA A;  4K30 A;  3IWG A;  3BJ8 A;  2FCK A;  1S7F A;  1CM0 A;  4UBR A;  2ZPA A;  4KUA A;  3F8K A;  5AG7 A;  1QSN A;  2B5G A;  2Y0M A;  5G20 A;  4KS9 A;  1M1D A;  4A30 A;  2GIV A;  4PK3 A;  2WPW A;  1P4N A;  1Z4E A;  4OLL A;  4Y49 C;  4KOY A;  4KZT A;  2JDC A;  4IUS A;  4JLY A;  2BEI A;  3WR7 A;  1QST A;  4CAX A;  2VQY A;  2HQY A;  2Z0Z A;  1VKC A;  4RS2 A;  2REF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...