1PU9A

Crystal structure of tetrahymena gcn5 with bound coenzyme a and a 19-residue histone h3 peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
163
structure length
163
Chain Sequence
LLDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAT A1
publication title Structural basis for histone and phospho-histone binding by the GCN5 histone acetyltransferase
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Transferase/structural protein
total genus 44
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2003-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1pu9A00
3NE7A 3W91A 5HMNA 3JUWA 4M85A 4F6AA 3OWCA 3FXTA 2AJ6A 2JDDA 5F47A 3IGRA 1PUAA 1GHEA 4J3GA 2J8RA 2Z0ZA 2ZW6A 2DXQA 3LODA 2OU2A 2BSWA 2K5TA 3GY9A 5C82A 4R3KA 2VXKA 4XNHB 3ZZIA 2FL4A 4QBJA 4QB9A 1XIXA 4U9ZA 4NEXA 1XEBA 2FIAA 4OLLA 4CAWA 4HKFA 2AE6A 1MJAA 2PSWA 4PSXA 2BEIA 5EC4A 3DR6A 5F48A 4NXYA 4ZBGA 3W6XA 1YGHA 3FYNA 4AVBA 2HV2A 1KUXA 3S6FA 4JWPA 4R9MA 4KVOE 2PQ8A 2ZXVA 4AB7A 5H86A 5E96A 4FD6A 3QB8A 2CY2A 2EVNA 1ON0A 4PV6A 1RXTA 4KVME 4OAEA 3TO7A 1IICA 4B5PB 5IB0A 1P4NA 3P2HA 4MHDA 5I0CA 4PSWA 4ONUA 2ZW4A 2FSRA 2B4BA 4MJ8A 2Q04A 2P6GA 3VWEA 4KORA 4MY0A 2JEVA 4F0YA 3S6HA 2B3UA 4KUAA 4IUSA 4HNYB 1J4JA 4KOVA 4UWJA 3FRMA 4NSQA 1I1DA 2OH1A 2P6FA 3BLNA 4KOTA 1IYKA 4H89A 3TOAA 3K9UA 1OZPA 4AG7A 1I21A 2WPXA 4NF1A 2WPWA 3D3SA 2H5MA 3DR8A 4YFJA 2JLMA 4M3SA 3GYAA 4HNWB 1XE4A 3BJ7A 2Y0MA 2I79A 1MK4A 3QAHA 1FY7A 5H84A 2FT0A 2VI7A 3D8PA 4UWIA 4XNHC 1XMTA 5IX3A 1Z4EA 3PGPA 2OB0A 2B4DB 1YVKA 2EUIA 4XPLA 3R9FA 4DNCA 2OZHA 4GS4A 3B8GA 4Y49B 2VZZA 2J8NA 1S3ZA 4AVAA 3VWDA 1SQHA 4CRYB 1IB1E 2FE7A 5KTDA 3CXQA 4MY3A 4QVTA 4E8OA 3PZJA 1KZFA 3GKRA 4KOXA 1YK3A 4CAXA 1M4DA 2FXFA 1CM0A 2BUEA 4AG9A 2HUZA 3R9EA 3FNCA 4JXRA 3EO4A 3TE4A 1YREA 4LUAA 3G3SA 1M44A 5HH1A 3R95A 1BO4A 4AVCA 1V0CA 1YLEA 3SHPA 2R8VA 3H4QA 4JLYA 3F5BA 4X5KA 2Q7BA 1KUVA 1M4GA 3TTHA 2G3AA 3SXNA 3IWGA 4R57A 5J8FA 1L0CA 1Z4RA 2ZW5A 5EBVA 3LD2A 2X7BA 2B58A 1B87A 4PK3A 3DDDA 5F49A 5GCNA 3TT2A 1YX0A 3EC4A 2NMTA 3DSBA 3EY5A 2P0WA 3D2PA 3KKWA 4OADA 2CNSA 3TFYA 1Y9KA 2OZUA 3EFAA 3S6KA 2O28A 2FIWA 3I9SA 4R3LA 2CNTA 2J8MA 4UBRA 4KVXA 2I00A 3D2MA 4JD6A 2G0BA 1Q2DA 1UFHA 4YGOA 5DWNA 4KUBA 4K30A 3T90A 2D4OA 3W6SA 3UY5A 3F0AA 3JVNA 1QSMA 3PP9A 4IF5A 2GE3A 3T9YA 1WWZA 2F5IA 4YRHA 4KOWA 2VQYA 4Y49C 1M4IA 3FB3A 2ATRA 1Q2CA 2VZYA 3RYOA 1N71A 3MGDA 4LX9A 2HQYA 1Y9WA 4R87A 5C88A 2Q4VA 5ISVA 3TOBA 4PK2A 2ARHA 4ORFA 1S5KA 4FD5A 5J8CA 3F8KA 4KLVA 2Q0YA 1MJ9A 2R1IA 2VBQA 4U9YA 5KTCA 1NE9A 1QSRA 1S7NA 4U5YA 2FS5A 4NCZA 2QMLA 5IV0A 3G8WA 1PU9A 2GIVA 3TO9A 4HNXB 3R96A 5KTAA 4RS2A 4QUSA 1CJWA 2B5GA 1QSTA 3E0KA 2Z11A 3WR7A 2G3TA 2A4NA 1P0HA 1IYLA 1U6MA 3FIXA 4JXQA 1KUYA 2KCWA 1VHSA 4KLWA 3S6GA 2GANA 2PR8A 4L89A 1S7LA 5FVJA 1I12A 1TIQA 2ZPAA 4E2AA 4B5PA 1RO5A 2REFA 2D4PA 4CS0B 2IL4A 2PDOA 4XPDC 1XF8A 2PRBA 3R9GA 3V8IA 4H6UA 4BMHA 5JPHA 1S60A 4KOUA 2ZW7A 2QIRA 2B5GB 3ZJ0A 4KOYA 2VEZA 3R1KA 4MBUA 4XPDB 4EVYA 2PR1A 3FBUA 1NMTA 4B5OA 5CNPA 2CNMA 3I3GA 4I49A 2OZGA 4E0AA 4RI1A 4FD7A 1QSNA 1BOBA 3N7ZA 2JDCA 5F46A 1NSLA 3CXSA 4KZTA 1Z9UA 4II9A 2PC1A 1WK4A 2REEA 5DWMA 1M1DA 2RC4A 2BL1A 3TCVA 4CRZB 1R57A 2FCKA 4XPKA 3TO6A 2C27A 1B6BA 1QSOA 2B4DA 1YVOA 4H6ZA 1LRZA 4KOSA 3P2FA 2B3VA 3DNSA 1Q2YA 4L8AA 2Q44A 3EXNA 1VKCA 4UA3A 4QC6A 1S7KA 4FD4A 2P6EA 3C26A 3CXPA 1Y7RA 4MI4A 1YR0A 3SXOA 2Z10A 1MJBA 2Q4YA 4CAVA 5JQ4A 1S7FA 1K4JA 2R98A 1IIDA 2R7HA 3BJ8A 4JJXA 2QECA
chains in the Genus database with same CATH superfamily
5AG5A 2Z3NA 3ISXA 3NE7A 3W91A 5HMNA 1ELLP 3JUWA 4M85A 4F6AA 3OWCA 4BD9A 2XEFA 3FXTA 2JDDA 5AG7A 5F47A 3SI1A 3IC1A 4Q36A 3IGRA 4RN7A 1PUAA 1F2OA 1HDQA 4CGPA 1GHEA 2JBKA 4J3GA 1BLLE 2PJ1A 3MRUA 5K8PA 3B3CA 2J8RA 3JRUA 2V8GA 2Z0ZA 2ZW6A 3BI1A 3MN8A 1LCPA 4MFPA 3RAMA 2DXQA 3LODA 2OU2A 1YQEA 2BSWA 2K5TA 4NGQA 1Z8LA 4KS9A 3GY9A 5C82A 2CTCA 2BCOA 4NGMA 4MHNA 4R3KA 2QYVA 2VXKA 4XNHB 4YU9A 2FL4A 4MFKA 4MFQA 4MHPA 3ZZIA 4QBJA 4QB9A 4CYOA 1TXRA 1XIXA 4A94A 4U9ZA 3LACA 4NEXA 2G9DA 4PXDA 2GFQA 1XEBA 4MHZA 2FIAA 3IIBA 2HB6A 2RB7A 1Q7LA 2WZNA 4CAFA 2V8DA 4OLLA 4CAWA 4HKFA 2AE6A 1MJAA 1CPXA 2PSWA 4PSXA 1JWQA 2BEIA 5EC4A 3DR6A 5F48A 1ZG8A 4KSFA 4NXYA 4ZBGA 4P10A 5LRGA 1IOFA 3W6XA 4B12A 4OC4A 1YGHA 3L2NA 3D7GA 3FYNA 2AFWA 4AVBA 2HV2A 1TKJA 2GLJA 2PJBA 1KUXA 3S6FA 4JWPA 4FAIA 4R9MA 4KVOE 3VARA 4P6YA 2PQ8A 2ZXVA 3NH4A 4MFZA 2ZENA 4ZY0A 4AB7A 3B35A 2XEIA 2ANPA 3NH8A 5H86A 2XEGA 5E96A 4FD6A 2WYRA 3KI9A 3GIUA 3QB8A 4UF4A 3FECA 4BBHA 2CY2A 2PJ7A 3B7IA 4TWEA 5HVHA 2EVNA 1ON0A 4PV6A 4IAVA 3RNZA 3DGVA 1RXTA 3TC8A 1LOKA 2AFXA 1BPMA 4KVME 1EE3P 1Z8XA 4OAEA 2ZEMA 3TO7A 2Q43A 3B2YA 1IICA 4B5PB 2PJ9A 3BHXA 1P4NA 3GLJA 3P2HA 3PRTA 4M6IA 5IB0A 4MHDA 5I0CA 4PSWA 4ONUA 2ZW4A 2FSRA 3KASA 1A2ZA 2PJ6A 2B4BA 2ZOGA 2OOTA 2PRQA 3FEEA 4MJ8A 4NFRA 4OC2A 3HLPA 2AFUA 1Z5RA 2Q04A 2P6GA 3KQZA 4P45A 2C6PA 3VWEA 4KORA 4MY0A 2HC9A 2JEVA 4F0YA 3S6HA 2YNCA 4UCPA 3SI2A 2Q7SA 2B3UA 3D68A 3NA6A 4KUAA 4IUSA 5IB9A 1QQ9A 1PYTB 1Y0YA 1KWMA 1J4JA 2PIYA 4HNYB 4KOVA 5J1QA 2OR4A 4UWJA 1ZLIA 3FRMA 4NSQA 1I1DA 4B6ZA 4UFVA 1ZG7A 4A37A 4ZI6A 2OH1A 4WJBA 2P6FA 2IJZA 5K8NA 3BLNA 1X10A 2PJCA 4ONWA 4KOTA 8CPAA 1F57A 1IYKA 4H89A 4R7MA 1FT7A 3TOAA 3K9UA 2EK9A 4DJLA 1CG2A 1OZPA 2V77A 3KL9A 4AG7A 1I21A 2WPXA 4NF1A 3PB4X 2WPWA 3D3SA 2H5MA 3DR8A 1Z8TA 4MCRA 1CBXA 2XEJA 4YFJA 2JLMA 4M3SA 3GYAA 4HNWB 1FNOA 3D7FA 1VHOA 4NJRA 4G1PA 1XE4A 3BJ7A 2Y0MA 2I79A 1MK4A 3H8FA 3S9LA 4MFJA 1ARLA 2DEAA 3QAHA 4Q38A 3DLJA 2CXAA 4MXUA 1FY7A 4NGPA 4P4EA 4X2TA 5H84A 2FT0A 2NSMA 2VI7A 3D8PA 4UWIA 4XNHC 3V7ZA 4F9UA 4OC5A 1XMTA 5LYIA 1NSAA 3B3TA 1Z4EA 3KGQA 5IX3A 3PGPA 3NE8A 2QJ8A 2WUUA 3D7DA 2F7VA 2OB0A 3SJGA 1Y7EA 4B13A 2B4DB 2O53A 3PB8X 1YLOA 1YVKA 2EUIA 3PB9X 4XPLA 3R9FA 3VATA 1IU8A 4CYQA 4DNCA 2OZHA 4GS4A 3B8GA 4Y49B 3N5FA 4F8ZA 2VZZA 2J8NA 4M6GA 3PB6X 4KSAA 3WC7A 2IMOA 1S3ZA 3V38A 4AVAA 4CGLA 4EMEA 5G21A 3S9NA 5DS0A 3VH9A 3VWDA 1SQHA 3FF3A 2EO8A 4NGSA 4CRYB 4CYPA 3D4UA 3BXMA 1IB1E 2FE7A 5KTDA 4P44A 2EBJA 3CXQA 3KHXA 5AGEA 4GXHA 4NGNA 4MY3A 3CDXA 4QVTA 4PXCA 4EFDA 4E8OA 3PZJA 2GREA 2NYQA 3D67A 3IU2A 1KZFA 1TF8A 4OIDA 2JEWA 3GKRA 3RO0A 4C2XA 4KOXA 4ZY2A 2ZEDA 1YK3A 2PJAA 1YW6A 4CAXA 2PJ4A 1M4DA 3K9TA 1RTQA 4UIAA 4A39A 2FXFA 5JH9A 1CM0A 2BUEA 2PVVA 4AG9A 2HUZA 5G1ZA 4MCSA 2CF4A 4GM5A 3JTKA 1XFOA 2FVGA 3FNCA 3EO4A 4JXRA 4P4JA 5LRKA 3TE4A 1YREA 4Z65A 4PPZA 4LUAA 3GB0A 4JYWA 3G3SA 4CGNA 4C2YA 5CBMA 1M44A 5HH1A 3R95A 1BO4A 4AVCA 1V0CA 1YLEA 3SHPA 2R8VA 2C6GA 5JM6A 4OIWA 4TNUA 3H4QA 4UIBA 4DUKA 3IWWA 5G22A 4C7HA 1IY7A 4JLYA 3F5BA 4X5KA 2Q7BA 3H8EA 3WABA 1KUVA 1VIXA 1M4GA 3TTHA 2G3AA 3SXNA 7CPAA 3IWGA 2AFSA 3BI0A 2GLFA 3PFOA 5HVFA 5LRJA 4R57A 4UEZA 3B3SA 4ZY1A 2J9AA 5J8FA 1L0CA 1Z4RA 1CP7A 3A9LA 3IFEA 2ZW5A 5EBVA 1LFWA 3LD2A 3TX8A 2X7BA 4A33A 4BINA 2B58A 4OC3A 1B87A 3PBBA 4PK3A 3DDDA 5F49A 5GCNA 3TT2A 1YX0A 2ZEPA 3EC4A 5LYLA 2NMTA 4NGTA 3DSBA 3EY5A 2P0WA 2PVWA 1ZO0A 2YNEA 4EWTA 3D2PA 3CT9A 3H5ZA 4B11A 3KKWA 4OADA 3FH4A 2EWBA 2F8HA 2CNSA 3R9EA 3TFYA 1Y9KA 2OZUA 5CPAA 3EFAA 3S6KA 2JBJA 2O28A 2FIWA 3I9SA 3K2KA 4O23A 4R3LA 2CNTA 2J8MA 1ELMP 1XOVA 4KVXA 4UBRA 4PXBA 3T8WA 1DTDA 2C6CA 2I00A 4LQGA 1VHEA 3D2MA 2PIZA 4JD6A 2Z3LA 4UEFA 2G0BA 3IU1A 1Q2DA 1XRYA 1CX8A 1UFHA 2PE3A 5K8OA 1YW4A 4YGOA 4JJXA 5DWNA 3PB7X 3B3WA 4KUBA 4ZX8A 2ZEGA 3RBUA 3SI0A 4K30A 5EMIA 3T90A 2D4OA 3W6SA 3UY5A 4W9YA 4CGMA 2YNCC 3QNVA 4FUUA 4M6HA 3IO1A 4P4IA 3F0AA 3JVNA 1CPSA 1QSMA 3PEIA 3PP9A 3FJUA 4IF5A 2WSAA 5THWA 2GE3A 3T9YA 1WWZA 4C7IA 2F5IA 4YRHA 4KOWA 4R6TA 4CGOA 2VQYA 1LAPA 2IQ6A 3QAYA 1M4IA 2Q51A 3FB3A 4Y49C 4B10A 2ATRA 1Q2CA 2CIJA 2VZYA 3RYOA 3HUVA 1IOIA 1N71A 3MGDA 4LX9A 2VL1A 2HQYA 1Y9WA 4R87A 5C88A 4OC1A 2Q4VA 1DE4C 2YGWA 4P4BA 4WWVA 5ISVA 3TOBA 4PK2A 2ARHA 4ORFA 4MRIA 4CAEA 3SJFA 1F2PA 1S5KA 3RZAA 4FD5A 5J8CA 3F8KA 4KLVA 2POKA 5LYFA 2Z3OA 2Q0YA 1MJ9A 2R1IA 2VBQA 2ZELA 4U9YA 5KTCA 1NE9A 1QSRA 1S7NA 1ARMA 1YMEA 4U5YA 1JQGA 2FS5A 1HDUA 3SJXA 4NCZA 2QMLA 3D66A 5IV0A 3G8WA 2ODFA 3NH5A 2DF5A 1PU9A 2GIVA 5G20A 3TO9A 3CZXA 5BWAB 4HNXB 3R96A 5KTAA 2GU2A 4IK2A 5ELYA 4RS2A 4QUSA 1CJWA 2B5GA 2DPSA 1QSTA 3E0KA 5K8MA 3PBEA 2Z11A 3WR7A 4MHYA 4HPSA 1BPNA 2G3TA 2A4NA 1P0HA 1IYLA 1U6MA 3FIXA 4FWUA 4JXQA 4ZGYB 4MCPA 1KUYA 3B3VA 2KCWA 1VHSA 4KLWA 3S6GA 2GANA 1X12A 2ABZA 2PR8A 2QVPA 1AMPA 4JZ0A 3IWEA 2ZEOA 2C1CA 5I4MA 1QMUA 2YNDA 2PJ8A 4L89A 4CYNA 1S7LA 5FVJA 4P4DA 2ZEHA 4YWYA 2PJ0A 1I12A 1Y0RA 3IEHA 1TIQA 2BO9A 3NFZA 4ZYQA 2ZPAA 3FX6A 1VGYA 4E2AA 4B5PA 1RO5A 3KR4A 2REFA 1BAVA 2D4PA 3KR5A 3SJEA 3WT4A 2PCUA 2ZOFA 1XMBA 4C2ZA 1R3NA 4CS0B 1CP6A 1GYTA 2I3CA 2IL4A 2ZEFA 5F09A 2Z3KA 4LQ6A 1XBUA 2PDOA 4XPDC 4UCNA 1XF8A 2PRBA 1OBRA 4A38A 2V8HA 3R9GA 3V8IA 4A31A 4UFWA 4H6UA 4B14A 4BMHA 1AYEA 4IHMA 4MFLA 5JPHA 5AG6A 1Z2LA 4A95A 1S60A 2BOAA 4KOUA 2ZW7A 1H8LA 2PJ3A 4PXEA 3CPAA 2QIRA 2B5GB 3ZJ0A 4KOYA 5HXDA 1Z8WA 1AUGA 4H2KA 1PCAA 2VEZA 2RFHA 3IJ3A 3R1KA 4OP4A 4MBUA 4F9VA 1M4LA 4X3RA 2PJ5A 3S9MA 4XPDB 1ZLHA 2PR1A 4ZX9A 4EVYA 3LMSA 5AG4A 3KQXA 4KSIA 5JGFA 3FBUA 3ISZA 1NMTA 4B5OA 4A30A 5CNPA 2CNMA 3FEDA 3I3GA 5LYDA 4I49A 3WC5A 1R43A 2OZGA 4RUHA 4E0AA 4DYOA 4RI1A 4FBEA 2Q4ZA 2AFMA 1QSNA 1BOBA 3N7ZA 1ZG9A 4FD7A 4MCQA 2DPTA 4R76A 1YSJA 2JDCA 1TF9A 5F46A 1NSLA 2Z3PA 4NGRA 3CXSA 4OMEA 4KZTA 1Z9UA 4II9A 2PC1A 1WK4A 3WC6A 1HEEA 3GUXA 5HVGA 4F0XA 2REEA 5DWMA 4OKOA 1M1DA 1TKHA 2RC4A 4A2ZA 4UFXA 6CPAA 2BL1A 3TCVA 4CRZB 2AFZA 1R57A 2EK8A 3FVLA 4C68A 2FCKA 3KZWA 4XPKA 3TO6A 2C27A 5D8NA 1B6BA 1QSOA 2ZEEA 2B4DA 4Q7AA 1YVOA 4AXVA 3PFEA 4H6ZA 1LANA 1LRZA 3LWUA 4KOSA 1UWYA 4UEEA 3P2FA 4CPAA 1XJOA 2B3VA 3DNSA 5A27A 2PJ2A 1Q2YA 4L8AA 2Q44A 3EXNA 1VKCA 3FMCA 4K3NA 4P4FA 4UA3A 4QC6A 2AFOA 1S7KA 5D29A 2Z3MA 4MMOA 3D7HA 4FD4A 2P6EA 3C26A 3CXPA 2V8VA 1Y7RA 2CTBA 4UCMA 1TKFA 1IGBA 4MI4A 3KHZA 2O4HA 4X8IA 1YR0A 4PQAA 3SXOA 2Z10A 3H8GA 4R8FA 1MJBA 2Q4YA 4CAVA 5JQ4A 1S7FA 1K4JA 4OC0A 3I1UA 5A28A 3CPXA 2R98A 1LAMA 4A32A 1IIDA 2R7HA 3BJ8A 2AJ6A 2QECA 4NJQA
chains in the Genus database with same CATH topology
5AG5A 2Z3NA 3NE7A 3W91A 5HMNA 3JUWA 4M85A 4F6AA 3OWCA 3FXTA 2AJ6A 2JDDA 5AG7A 5F47A 4Q36A 3IGRA 1PUAA 4CGPA 1GHEA 4J3GA 2J8RA 2Z0ZA 2ZW6A 4MFPA 2DXQA 3LODA 2OU2A 2BSWA 2K5TA 4KS9A 3GY9A 5C82A 4R3KA 2VXKA 4XNHB 3ZZIA 2FL4A 4MFKA 4MFQA 4QBJA 4QB9A 4CYOA 1XIXA 4U9ZA 4NEXA 1XEBA 2FIAA 4CAFA 4OLLA 4CAWA 4HKFA 2AE6A 1MJAA 2PSWA 4PSXA 2BEIA 5EC4A 3DR6A 5F48A 4NXYA 4KSFA 4ZBGA 3W6XA 4B12A 1YGHA 3FYNA 4AVBA 2HV2A 1KUXA 3S6FA 4JWPA 4R9MA 4KVOE 2PQ8A 2ZXVA 4MFZA 4AB7A 5H86A 5E96A 4FD6A 3QB8A 4BBHA 2CY2A 2EVNA 1ON0A 4PV6A 1RXTA 4KVME 4OAEA 3TO7A 1IICA 4B5PB 5IB0A 1P4NA 3P2HA 4MHDA 5I0CA 4PSWA 4ONUA 2ZW4A 2FSRA 4C2ZA 2B4BA 4MJ8A 2Q04A 2P6GA 3VWEA 4KORA 4MY0A 2JEVA 4F0YA 3S6HA 2YNCA 4UCPA 2B3UA 4KUAA 4IUSA 4HNYB 1J4JA 4KOVA 4UWJA 3FRMA 4NSQA 1I1DA 4UFVA 2OH1A 2P6FA 3BLNA 4KOTA 1IYKA 4H89A 3TOAA 3K9UA 1OZPA 4AG7A 1I21A 2WPXA 4NF1A 2WPWA 3D3SA 2H5MA 3DR8A 4YFJA 2JLMA 4M3SA 3GYAA 4HNWB 1XE4A 3BJ7A 2Y0MA 2I79A 1MK4A 4MFJA 3QAHA 4Q38A 2CXAA 1FY7A 5H84A 2FT0A 2VI7A 3D8PA 4UWIA 4XNHC 1XMTA 5IX3A 1Z4EA 3PGPA 2WUUA 2OB0A 4B13A 2B4DB 1YVKA 2EUIA 4XPLA 3R9FA 4CYQA 4DNCA 2OZHA 4GS4A 3B8GA 4Y49B 2VZZA 2J8NA 4KSAA 4CGLA 1S3ZA 4AVAA 5G21A 3VWDA 1SQHA 4CRYB 4CYPA 1IB1E 2FE7A 5KTDA 3CXQA 5AGEA 4MY3A 4QVTA 4E8OA 3PZJA 3IU2A 1KZFA 3GKRA 4C2XA 4KOXA 1YK3A 4CAXA 1M4DA 2FXFA 1CM0A 2BUEA 4AG9A 2HUZA 5G1ZA 3R9EA 3JTKA 3FNCA 4JXRA 3EO4A 3TE4A 1YREA 4LUAA 3G3SA 4CGNA 4C2YA 1M44A 5HH1A 3R95A 1BO4A 4AVCA 1V0CA 1YLEA 3SHPA 2R8VA 3H4QA 5G22A 4C7HA 4JLYA 3F5BA 4X5KA 2Q7BA 1KUVA 1M4GA 3TTHA 2G3AA 3SXNA 3IWGA 4R57A 5J8FA 1L0CA 3A9LA 1Z4RA 2ZW5A 5EBVA 3LD2A 2X7BA 4A33A 2B58A 1B87A 4PK3A 3DDDA 5F49A 5GCNA 3TT2A 1YX0A 3EC4A 2NMTA 3DSBA 3EY5A 2P0WA 2YNEA 1ZO0A 3D2PA 3H5ZA 4B11A 3KKWA 4OADA 2CNSA 3TFYA 1Y9KA 2OZUA 3EFAA 3S6KA 2O28A 2FIWA 3I9SA 4R3LA 2CNTA 2J8MA 4UBRA 4KVXA 2I00A 3D2MA 4JD6A 2Z3LA 2G0BA 3IU1A 1Q2DA 1UFHA 4YGOA 5DWNA 4KUBA 4K30A 3T90A 4CGMA 2D4OA 3W6SA 3UY5A 2YNCC 3F0AA 3JVNA 1QSMA 3PP9A 4IF5A 2WSAA 2GE3A 3T9YA 1WWZA 4C7IA 2F5IA 4YRHA 4KOWA 4CGOA 2VQYA 4Y49C 1M4IA 3FB3A 4B10A 2ATRA 1Q2CA 2VZYA 3RYOA 1N71A 3MGDA 4LX9A 2HQYA 1Y9WA 4R87A 5C88A 2Q4VA 2YGWA 5ISVA 3TOBA 4PK2A 2ARHA 4ORFA 4CAEA 1S5KA 4FD5A 5J8CA 3F8KA 4KLVA 2Z3OA 2Q0YA 1MJ9A 2R1IA 2VBQA 4U9YA 5KTCA 1NE9A 1QSRA 1S7NA 4U5YA 2FS5A 4NCZA 2QMLA 5IV0A 3G8WA 1PU9A 2GIVA 5G20A 3TO9A 5BWAB 4HNXB 3R96A 5KTAA 4RS2A 4QUSA 1CJWA 2B5GA 2DPSA 1QSTA 3E0KA 2Z11A 3WR7A 2G3TA 2A4NA 1P0HA 1IYLA 1U6MA 3FIXA 4JXQA 4ZGYB 1KUYA 2KCWA 1VHSA 4KLWA 3S6GA 2GANA 2PR8A 3IWEA 2YNDA 4L89A 4CYNA 1S7LA 5FVJA 1I12A 1TIQA 2ZPAA 4E2AA 4B5PA 1RO5A 2REFA 2D4PA 4CS0B 2IL4A 2Z3KA 2PDOA 4XPDC 4UCNA 1XF8A 2PRBA 3R9GA 3V8IA 4A31A 4UFWA 4H6UA 4B14A 4BMHA 5JPHA 4MFLA 5AG6A 4A95A 1S60A 4KOUA 2ZW7A 2QIRA 2B5GB 3ZJ0A 4KOYA 2VEZA 3R1KA 4MBUA 4XPDB 4EVYA 2PR1A 5AG4A 3FBUA 1NMTA 4B5OA 4A30A 5CNPA 2CNMA 3I3GA 4I49A 2OZGA 4E0AA 4RI1A 4FD7A 1QSNA 1BOBA 3N7ZA 2DPTA 2JDCA 5F46A 1NSLA 2Z3PA 3CXSA 4KZTA 1Z9UA 4II9A 2PC1A 1WK4A 4F0XA 2REEA 5DWMA 1M1DA 2RC4A 4A2ZA 4UFXA 2BL1A 3TCVA 4CRZB 1R57A 4C68A 2FCKA 4XPKA 3TO6A 2C27A 1B6BA 1QSOA 2B4DA 1YVOA 4H6ZA 1LRZA 4KOSA 3P2FA 2B3VA 3DNSA 5A27A 1Q2YA 4L8AA 2Q44A 3EXNA 1VKCA 4UA3A 4QC6A 1S7KA 2Z3MA 4FD4A 2P6EA 3C26A 3CXPA 1Y7RA 4UCMA 4MI4A 1YR0A 3SXOA 2Z10A 1MJBA 2Q4YA 4CAVA 5JQ4A 1S7FA 1K4JA 5A28A 2R98A 4A32A 1IIDA 2R7HA 3BJ8A 4JJXA 2QECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NE7 A;  3W91 A;  5HMN A;  3JUW A;  4M85 A;  4F6A A;  3OWC A;  3FXT A;  2AJ6 A;  2JDD A;  5F47 A;  3IGR A;  1PUA A;  1GHE A;  4J3G A;  2J8R A;  2Z0Z A;  2ZW6 A;  2DXQ A;  3LOD A;  2OU2 A;  2BSW A;  2K5T A;  3GY9 A;  5C82 A;  4R3K A;  2VXK A;  4XNH B;  3ZZI A;  2FL4 A;  4QBJ A;  4QB9 A;  1XIX A;  4U9Z A;  4NEX A;  1XEB A;  2FIA A;  4OLL A;  4CAW A;  4HKF A;  2AE6 A;  1MJA A;  2PSW A;  4PSX A;  2BEI A;  5EC4 A;  3DR6 A;  5F48 A;  4NXY A;  4ZBG A;  3W6X A;  1YGH A;  3FYN A;  4AVB A;  2HV2 A;  1KUX A;  3S6F A;  4JWP A;  4R9M A;  4KVO E;  2PQ8 A;  2ZXV A;  4AB7 A;  5H86 A;  5E96 A;  4FD6 A;  3QB8 A;  2CY2 A;  2EVN A;  1ON0 A;  4PV6 A;  1RXT A;  4KVM E;  4OAE A;  3TO7 A;  1IIC A;  4B5P B;  5IB0 A;  1P4N A;  3P2H A;  4MHD A;  5I0C A;  4PSW A;  4ONU A;  2ZW4 A;  2FSR A;  2B4B A;  4MJ8 A;  2Q04 A;  2P6G A;  3VWE A;  4KOR A;  4MY0 A;  2JEV A;  4F0Y A;  3S6H A;  2B3U A;  4KUA A;  4IUS A;  4HNY B;  1J4J A;  4KOV A;  4UWJ A;  3FRM A;  4NSQ A;  1I1D A;  2OH1 A;  2P6F A;  3BLN A;  4KOT A;  1IYK A;  4H89 A;  3TOA A;  3K9U A;  1OZP A;  4AG7 A;  1I21 A;  2WPX A;  4NF1 A;  2WPW A;  3D3S A;  2H5M A;  3DR8 A;  4YFJ A;  2JLM A;  4M3S A;  3GYA A;  4HNW B;  1XE4 A;  3BJ7 A;  2Y0M A;  2I79 A;  1MK4 A;  3QAH A;  1FY7 A;  5H84 A;  2FT0 A;  2VI7 A;  3D8P A;  4UWI A;  4XNH C;  1XMT A;  5IX3 A;  1Z4E A;  3PGP A;  2OB0 A;  2B4D B;  1YVK A;  2EUI A;  4XPL A;  3R9F A;  4DNC A;  2OZH A;  4GS4 A;  3B8G A;  4Y49 B;  2VZZ A;  2J8N A;  1S3Z A;  4AVA A;  3VWD A;  1SQH A;  4CRY B;  1IB1 E;  2FE7 A;  5KTD A;  3CXQ A;  4MY3 A;  4QVT A;  4E8O A;  3PZJ A;  1KZF A;  3GKR A;  4KOX A;  1YK3 A;  4CAX A;  1M4D A;  2FXF A;  1CM0 A;  2BUE A;  4AG9 A;  2HUZ A;  3R9E A;  3FNC A;  4JXR A;  3EO4 A;  3TE4 A;  1YRE A;  4LUA A;  3G3S A;  1M44 A;  5HH1 A;  3R95 A;  1BO4 A;  4AVC A;  1V0C A;  1YLE A;  3SHP A;  2R8V A;  3H4Q A;  4JLY A;  3F5B A;  4X5K A;  2Q7B A;  1KUV A;  1M4G A;  3TTH A;  2G3A A;  3SXN A;  3IWG A;  4R57 A;  5J8F A;  1L0C A;  1Z4R A;  2ZW5 A;  5EBV A;  3LD2 A;  2X7B A;  2B58 A;  1B87 A;  4PK3 A;  3DDD A;  5F49 A;  5GCN A;  3TT2 A;  1YX0 A;  3EC4 A;  2NMT A;  3DSB A;  3EY5 A;  2P0W A;  3D2P A;  3KKW A;  4OAD A;  2CNS A;  3TFY A;  1Y9K A;  2OZU A;  3EFA A;  3S6K A;  2O28 A;  2FIW A;  3I9S A;  4R3L A;  2CNT A;  2J8M A;  4UBR A;  4KVX A;  2I00 A;  3D2M A;  4JD6 A;  2G0B A;  1Q2D A;  1UFH A;  4YGO A;  5DWN A;  4KUB A;  4K30 A;  3T90 A;  2D4O A;  3W6S A;  3UY5 A;  3F0A A;  3JVN A;  1QSM A;  3PP9 A;  4IF5 A;  2GE3 A;  3T9Y A;  1WWZ A;  2F5I A;  4YRH A;  4KOW A;  2VQY A;  4Y49 C;  1M4I A;  3FB3 A;  2ATR A;  1Q2C A;  2VZY A;  3RYO A;  1N71 A;  3MGD A;  4LX9 A;  2HQY A;  1Y9W A;  4R87 A;  5C88 A;  2Q4V A;  5ISV A;  3TOB A;  4PK2 A;  2ARH A;  4ORF A;  1S5K A;  4FD5 A;  5J8C A;  3F8K A;  4KLV A;  2Q0Y A;  1MJ9 A;  2R1I A;  2VBQ A;  4U9Y A;  5KTC A;  1NE9 A;  1QSR A;  1S7N A;  4U5Y A;  2FS5 A;  4NCZ A;  2QML A;  5IV0 A;  3G8W A;  1PU9 A;  2GIV A;  3TO9 A;  4HNX B;  3R96 A;  5KTA A;  4RS2 A;  4QUS A;  1CJW A;  2B5G A;  1QST A;  3E0K A;  2Z11 A;  3WR7 A;  2G3T A;  2A4N A;  1P0H A;  1IYL A;  1U6M A;  3FIX A;  4JXQ A;  1KUY A;  2KCW A;  1VHS A;  4KLW A;  3S6G A;  2GAN A;  2PR8 A;  4L89 A;  1S7L A;  5FVJ A;  1I12 A;  1TIQ A;  2ZPA A;  4E2A A;  4B5P A;  1RO5 A;  2REF A;  2D4P A;  4CS0 B;  2IL4 A;  2PDO A;  4XPD C;  1XF8 A;  2PRB A;  3R9G A;  3V8I A;  4H6U A;  4BMH A;  5JPH A;  1S60 A;  4KOU A;  2ZW7 A;  2QIR A;  2B5G B;  3ZJ0 A;  4KOY A;  2VEZ A;  3R1K A;  4MBU A;  4XPD B;  4EVY A;  2PR1 A;  3FBU A;  1NMT A;  4B5O A;  5CNP A;  2CNM A;  3I3G A;  4I49 A;  2OZG A;  4E0A A;  4RI1 A;  4FD7 A;  1QSN A;  1BOB A;  3N7Z A;  2JDC A;  5F46 A;  1NSL A;  3CXS A;  4KZT A;  1Z9U A;  4II9 A;  2PC1 A;  1WK4 A;  2REE A;  5DWM A;  1M1D A;  2RC4 A;  2BL1 A;  3TCV A;  4CRZ B;  1R57 A;  2FCK A;  4XPK A;  3TO6 A;  2C27 A;  1B6B A;  1QSO A;  2B4D A;  1YVO A;  4H6Z A;  1LRZ A;  4KOS A;  3P2F A;  2B3V A;  3DNS A;  1Q2Y A;  4L8A A;  2Q44 A;  3EXN A;  1VKC A;  4UA3 A;  4QC6 A;  1S7K A;  4FD4 A;  2P6E A;  3C26 A;  3CXP A;  1Y7R A;  4MI4 A;  1YR0 A;  3SXO A;  2Z10 A;  1MJB A;  2Q4Y A;  4CAV A;  5JQ4 A;  1S7F A;  1K4J A;  2R98 A;  1IID A;  2R7H A;  3BJ8 A;  4JJX A;  2QEC A; 
#chains in the Genus database with same CATH topology
 5AG5 A;  2Z3N A;  3ISX A;  3NE7 A;  3W91 A;  5HMN A;  1ELL P;  3JUW A;  4M85 A;  4F6A A;  3OWC A;  4BD9 A;  2XEF A;  3FXT A;  2JDD A;  5AG7 A;  5F47 A;  3SI1 A;  3IC1 A;  4Q36 A;  3IGR A;  4RN7 A;  1PUA A;  1F2O A;  1HDQ A;  4CGP A;  1GHE A;  2JBK A;  4J3G A;  1BLL E;  2PJ1 A;  3MRU A;  5K8P A;  3B3C A;  2J8R A;  3JRU A;  2V8G A;  2Z0Z A;  2ZW6 A;  3BI1 A;  3MN8 A;  1LCP A;  4MFP A;  3RAM A;  2DXQ A;  3LOD A;  2OU2 A;  1YQE A;  2BSW A;  2K5T A;  4NGQ A;  1Z8L A;  4KS9 A;  3GY9 A;  5C82 A;  2CTC A;  2BCO A;  4NGM A;  4MHN A;  4R3K A;  2QYV A;  2VXK A;  4XNH B;  4YU9 A;  2FL4 A;  4MFK A;  4MFQ A;  4MHP A;  3ZZI A;  4QBJ A;  4QB9 A;  4CYO A;  1TXR A;  1XIX A;  4A94 A;  4U9Z A;  3LAC A;  4NEX A;  2G9D A;  4PXD A;  2GFQ A;  1XEB A;  4MHZ A;  2FIA A;  3IIB A;  2HB6 A;  2RB7 A;  1Q7L A;  2WZN A;  4CAF A;  2V8D A;  4OLL A;  4CAW A;  4HKF A;  2AE6 A;  1MJA A;  1CPX A;  2PSW A;  4PSX A;  1JWQ A;  2BEI A;  5EC4 A;  3DR6 A;  5F48 A;  1ZG8 A;  4KSF A;  4NXY A;  4ZBG A;  4P10 A;  5LRG A;  1IOF A;  3W6X A;  4B12 A;  4OC4 A;  1YGH A;  3L2N A;  3D7G A;  3FYN A;  2AFW A;  4AVB A;  2HV2 A;  1TKJ A;  2GLJ A;  2PJB A;  1KUX A;  3S6F A;  4JWP A;  4FAI A;  4R9M A;  4KVO E;  3VAR A;  4P6Y A;  2PQ8 A;  2ZXV A;  3NH4 A;  4MFZ A;  2ZEN A;  4ZY0 A;  4AB7 A;  3B35 A;  2XEI A;  2ANP A;  3NH8 A;  5H86 A;  2XEG A;  5E96 A;  4FD6 A;  2WYR A;  3KI9 A;  3GIU A;  3QB8 A;  4UF4 A;  3FEC A;  4BBH A;  2CY2 A;  2PJ7 A;  3B7I A;  4TWE A;  5HVH A;  2EVN A;  1ON0 A;  4PV6 A;  4IAV A;  3RNZ A;  3DGV A;  1RXT A;  3TC8 A;  1LOK A;  2AFX A;  1BPM A;  4KVM E;  1EE3 P;  1Z8X A;  4OAE A;  2ZEM A;  3TO7 A;  2Q43 A;  3B2Y A;  1IIC A;  4B5P B;  2PJ9 A;  3BHX A;  1P4N A;  3GLJ A;  3P2H A;  3PRT A;  4M6I A;  5IB0 A;  4MHD A;  5I0C A;  4PSW A;  4ONU A;  2ZW4 A;  2FSR A;  3KAS A;  1A2Z A;  2PJ6 A;  2B4B A;  2ZOG A;  2OOT A;  2PRQ A;  3FEE A;  4MJ8 A;  4NFR A;  4OC2 A;  3HLP A;  2AFU A;  1Z5R A;  2Q04 A;  2P6G A;  3KQZ A;  4P45 A;  2C6P A;  3VWE A;  4KOR A;  4MY0 A;  2HC9 A;  2JEV A;  4F0Y A;  3S6H A;  2YNC A;  4UCP A;  3SI2 A;  2Q7S A;  2B3U A;  3D68 A;  3NA6 A;  4KUA A;  4IUS A;  5IB9 A;  1QQ9 A;  1PYT B;  1Y0Y A;  1KWM A;  1J4J A;  2PIY A;  4HNY B;  4KOV A;  5J1Q A;  2OR4 A;  4UWJ A;  1ZLI A;  3FRM A;  4NSQ A;  1I1D A;  4B6Z A;  4UFV A;  1ZG7 A;  4A37 A;  4ZI6 A;  2OH1 A;  4WJB A;  2P6F A;  2IJZ A;  5K8N A;  3BLN A;  1X10 A;  2PJC A;  4ONW A;  4KOT A;  8CPA A;  1F57 A;  1IYK A;  4H89 A;  4R7M A;  1FT7 A;  3TOA A;  3K9U A;  2EK9 A;  4DJL A;  1CG2 A;  1OZP A;  2V77 A;  3KL9 A;  4AG7 A;  1I21 A;  2WPX A;  4NF1 A;  3PB4 X;  2WPW A;  3D3S A;  2H5M A;  3DR8 A;  1Z8T A;  4MCR A;  1CBX A;  2XEJ A;  4YFJ A;  2JLM A;  4M3S A;  3GYA A;  4HNW B;  1FNO A;  3D7F A;  1VHO A;  4NJR A;  4G1P A;  1XE4 A;  3BJ7 A;  2Y0M A;  2I79 A;  1MK4 A;  3H8F A;  3S9L A;  4MFJ A;  1ARL A;  2DEA A;  3QAH A;  4Q38 A;  3DLJ A;  2CXA A;  4MXU A;  1FY7 A;  4NGP A;  4P4E A;  4X2T A;  5H84 A;  2FT0 A;  2NSM A;  2VI7 A;  3D8P A;  4UWI A;  4XNH C;  3V7Z A;  4F9U A;  4OC5 A;  1XMT A;  5LYI A;  1NSA A;  3B3T A;  1Z4E A;  3KGQ A;  5IX3 A;  3PGP A;  3NE8 A;  2QJ8 A;  2WUU A;  3D7D A;  2F7V A;  2OB0 A;  3SJG A;  1Y7E A;  4B13 A;  2B4D B;  2O53 A;  3PB8 X;  1YLO A;  1YVK A;  2EUI A;  3PB9 X;  4XPL A;  3R9F A;  3VAT A;  1IU8 A;  4CYQ A;  4DNC A;  2OZH A;  4GS4 A;  3B8G A;  4Y49 B;  3N5F A;  4F8Z A;  2VZZ A;  2J8N A;  4M6G A;  3PB6 X;  4KSA A;  3WC7 A;  2IMO A;  1S3Z A;  3V38 A;  4AVA A;  4CGL A;  4EME A;  5G21 A;  3S9N A;  5DS0 A;  3VH9 A;  3VWD A;  1SQH A;  3FF3 A;  2EO8 A;  4NGS A;  4CRY B;  4CYP A;  3D4U A;  3BXM A;  1IB1 E;  2FE7 A;  5KTD A;  4P44 A;  2EBJ A;  3CXQ A;  3KHX A;  5AGE A;  4GXH A;  4NGN A;  4MY3 A;  3CDX A;  4QVT A;  4PXC A;  4EFD A;  4E8O A;  3PZJ A;  2GRE A;  2NYQ A;  3D67 A;  3IU2 A;  1KZF A;  1TF8 A;  4OID A;  2JEW A;  3GKR A;  3RO0 A;  4C2X A;  4KOX A;  4ZY2 A;  2ZED A;  1YK3 A;  2PJA A;  1YW6 A;  4CAX A;  2PJ4 A;  1M4D A;  3K9T A;  1RTQ A;  4UIA A;  4A39 A;  2FXF A;  5JH9 A;  1CM0 A;  2BUE A;  2PVV A;  4AG9 A;  2HUZ A;  5G1Z A;  4MCS A;  2CF4 A;  4GM5 A;  3JTK A;  1XFO A;  2FVG A;  3FNC A;  3EO4 A;  4JXR A;  4P4J A;  5LRK A;  3TE4 A;  1YRE A;  4Z65 A;  4PPZ A;  4LUA A;  3GB0 A;  4JYW A;  3G3S A;  4CGN A;  4C2Y A;  5CBM A;  1M44 A;  5HH1 A;  3R95 A;  1BO4 A;  4AVC A;  1V0C A;  1YLE A;  3SHP A;  2R8V A;  2C6G A;  5JM6 A;  4OIW A;  4TNU A;  3H4Q A;  4UIB A;  4DUK A;  3IWW A;  5G22 A;  4C7H A;  1IY7 A;  4JLY A;  3F5B A;  4X5K A;  2Q7B A;  3H8E A;  3WAB A;  1KUV A;  1VIX A;  1M4G A;  3TTH A;  2G3A A;  3SXN A;  7CPA A;  3IWG A;  2AFS A;  3BI0 A;  2GLF A;  3PFO A;  5HVF A;  5LRJ A;  4R57 A;  4UEZ A;  3B3S A;  4ZY1 A;  2J9A A;  5J8F A;  1L0C A;  1Z4R A;  1CP7 A;  3A9L A;  3IFE A;  2ZW5 A;  5EBV A;  1LFW A;  3LD2 A;  3TX8 A;  2X7B A;  4A33 A;  4BIN A;  2B58 A;  4OC3 A;  1B87 A;  3PBB A;  4PK3 A;  3DDD A;  5F49 A;  5GCN A;  3TT2 A;  1YX0 A;  2ZEP A;  3EC4 A;  5LYL A;  2NMT A;  4NGT A;  3DSB A;  3EY5 A;  2P0W A;  2PVW A;  1ZO0 A;  2YNE A;  4EWT A;  3D2P A;  3CT9 A;  3H5Z A;  4B11 A;  3KKW A;  4OAD A;  3FH4 A;  2EWB A;  2F8H A;  2CNS A;  3R9E A;  3TFY A;  1Y9K A;  2OZU A;  5CPA A;  3EFA A;  3S6K A;  2JBJ A;  2O28 A;  2FIW A;  3I9S A;  3K2K A;  4O23 A;  4R3L A;  2CNT A;  2J8M A;  1ELM P;  1XOV A;  4KVX A;  4UBR A;  4PXB A;  3T8W A;  1DTD A;  2C6C A;  2I00 A;  4LQG A;  1VHE A;  3D2M A;  2PIZ A;  4JD6 A;  2Z3L A;  4UEF A;  2G0B A;  3IU1 A;  1Q2D A;  1XRY A;  1CX8 A;  1UFH A;  2PE3 A;  5K8O A;  1YW4 A;  4YGO A;  4JJX A;  5DWN A;  3PB7 X;  3B3W A;  4KUB A;  4ZX8 A;  2ZEG A;  3RBU A;  3SI0 A;  4K30 A;  5EMI A;  3T90 A;  2D4O A;  3W6S A;  3UY5 A;  4W9Y A;  4CGM A;  2YNC C;  3QNV A;  4FUU A;  4M6H A;  3IO1 A;  4P4I A;  3F0A A;  3JVN A;  1CPS A;  1QSM A;  3PEI A;  3PP9 A;  3FJU A;  4IF5 A;  2WSA A;  5THW A;  2GE3 A;  3T9Y A;  1WWZ A;  4C7I A;  2F5I A;  4YRH A;  4KOW A;  4R6T A;  4CGO A;  2VQY A;  1LAP A;  2IQ6 A;  3QAY A;  1M4I A;  2Q51 A;  3FB3 A;  4Y49 C;  4B10 A;  2ATR A;  1Q2C A;  2CIJ A;  2VZY A;  3RYO A;  3HUV A;  1IOI A;  1N71 A;  3MGD A;  4LX9 A;  2VL1 A;  2HQY A;  1Y9W A;  4R87 A;  5C88 A;  4OC1 A;  2Q4V A;  1DE4 C;  2YGW A;  4P4B A;  4WWV A;  5ISV A;  3TOB A;  4PK2 A;  2ARH A;  4ORF A;  4MRI A;  4CAE A;  3SJF A;  1F2P A;  1S5K A;  3RZA A;  4FD5 A;  5J8C A;  3F8K A;  4KLV A;  2POK A;  5LYF A;  2Z3O A;  2Q0Y A;  1MJ9 A;  2R1I A;  2VBQ A;  2ZEL A;  4U9Y A;  5KTC A;  1NE9 A;  1QSR A;  1S7N A;  1ARM A;  1YME A;  4U5Y A;  1JQG A;  2FS5 A;  1HDU A;  3SJX A;  4NCZ A;  2QML A;  3D66 A;  5IV0 A;  3G8W A;  2ODF A;  3NH5 A;  2DF5 A;  1PU9 A;  2GIV A;  5G20 A;  3TO9 A;  3CZX A;  5BWA B;  4HNX B;  3R96 A;  5KTA A;  2GU2 A;  4IK2 A;  5ELY A;  4RS2 A;  4QUS A;  1CJW A;  2B5G A;  2DPS A;  1QST A;  3E0K A;  5K8M A;  3PBE A;  2Z11 A;  3WR7 A;  4MHY A;  4HPS A;  1BPN A;  2G3T A;  2A4N A;  1P0H A;  1IYL A;  1U6M A;  3FIX A;  4FWU A;  4JXQ A;  4ZGY B;  4MCP A;  1KUY A;  3B3V A;  2KCW A;  1VHS A;  4KLW A;  3S6G A;  2GAN A;  1X12 A;  2ABZ A;  2PR8 A;  2QVP A;  1AMP A;  4JZ0 A;  3IWE A;  2ZEO A;  2C1C A;  5I4M A;  1QMU A;  2YND A;  2PJ8 A;  4L89 A;  4CYN A;  1S7L A;  5FVJ A;  4P4D A;  2ZEH A;  4YWY A;  2PJ0 A;  1I12 A;  1Y0R A;  3IEH A;  1TIQ A;  2BO9 A;  3NFZ A;  4ZYQ A;  2ZPA A;  3FX6 A;  1VGY A;  4E2A A;  4B5P A;  1RO5 A;  3KR4 A;  2REF A;  1BAV A;  2D4P A;  3KR5 A;  3SJE A;  3WT4 A;  2PCU A;  2ZOF A;  1XMB A;  4C2Z A;  1R3N A;  4CS0 B;  1CP6 A;  1GYT A;  2I3C A;  2IL4 A;  2ZEF A;  5F09 A;  2Z3K A;  4LQ6 A;  1XBU A;  2PDO A;  4XPD C;  4UCN A;  1XF8 A;  2PRB A;  1OBR A;  4A38 A;  2V8H A;  3R9G A;  3V8I A;  4A31 A;  4UFW A;  4H6U A;  4B14 A;  4BMH A;  1AYE A;  4IHM A;  4MFL A;  5JPH A;  5AG6 A;  1Z2L A;  4A95 A;  1S60 A;  2BOA A;  4KOU A;  2ZW7 A;  1H8L A;  2PJ3 A;  4PXE A;  3CPA A;  2QIR A;  2B5G B;  3ZJ0 A;  4KOY A;  5HXD A;  1Z8W A;  1AUG A;  4H2K A;  1PCA A;  2VEZ A;  2RFH A;  3IJ3 A;  3R1K A;  4OP4 A;  4MBU A;  4F9V A;  1M4L A;  4X3R A;  2PJ5 A;  3S9M A;  4XPD B;  1ZLH A;  2PR1 A;  4ZX9 A;  4EVY A;  3LMS A;  5AG4 A;  3KQX A;  4KSI A;  5JGF A;  3FBU A;  3ISZ A;  1NMT A;  4B5O A;  4A30 A;  5CNP A;  2CNM A;  3FED A;  3I3G A;  5LYD A;  4I49 A;  3WC5 A;  1R43 A;  2OZG A;  4RUH A;  4E0A A;  4DYO A;  4RI1 A;  4FBE A;  2Q4Z A;  2AFM A;  1QSN A;  1BOB A;  3N7Z A;  1ZG9 A;  4FD7 A;  4MCQ A;  2DPT A;  4R76 A;  1YSJ A;  2JDC A;  1TF9 A;  5F46 A;  1NSL A;  2Z3P A;  4NGR A;  3CXS A;  4OME A;  4KZT A;  1Z9U A;  4II9 A;  2PC1 A;  1WK4 A;  3WC6 A;  1HEE A;  3GUX A;  5HVG A;  4F0X A;  2REE A;  5DWM A;  4OKO A;  1M1D A;  1TKH A;  2RC4 A;  4A2Z A;  4UFX A;  6CPA A;  2BL1 A;  3TCV A;  4CRZ B;  2AFZ A;  1R57 A;  2EK8 A;  3FVL A;  4C68 A;  2FCK A;  3KZW A;  4XPK A;  3TO6 A;  2C27 A;  5D8N A;  1B6B A;  1QSO A;  2ZEE A;  2B4D A;  4Q7A A;  1YVO A;  4AXV A;  3PFE A;  4H6Z A;  1LAN A;  1LRZ A;  3LWU A;  4KOS A;  1UWY A;  4UEE A;  3P2F A;  4CPA A;  1XJO A;  2B3V A;  3DNS A;  5A27 A;  2PJ2 A;  1Q2Y A;  4L8A A;  2Q44 A;  3EXN A;  1VKC A;  3FMC A;  4K3N A;  4P4F A;  4UA3 A;  4QC6 A;  2AFO A;  1S7K A;  5D29 A;  2Z3M A;  4MMO A;  3D7H A;  4FD4 A;  2P6E A;  3C26 A;  3CXP A;  2V8V A;  1Y7R A;  2CTB A;  4UCM A;  1TKF A;  1IGB A;  4MI4 A;  3KHZ A;  2O4H A;  4X8I A;  1YR0 A;  4PQA A;  3SXO A;  2Z10 A;  3H8G A;  4R8F A;  1MJB A;  2Q4Y A;  4CAV A;  5JQ4 A;  1S7F A;  1K4J A;  4OC0 A;  3I1U A;  5A28 A;  3CPX A;  2R98 A;  1LAM A;  4A32 A;  1IID A;  2R7H A;  3BJ8 A;  2AJ6 A;  2QEC A;  4NJQ A; 
#chains in the Genus database with same CATH homology
 5AG5 A;  2Z3N A;  3NE7 A;  3W91 A;  5HMN A;  3JUW A;  4M85 A;  4F6A A;  3OWC A;  3FXT A;  2AJ6 A;  2JDD A;  5AG7 A;  5F47 A;  4Q36 A;  3IGR A;  1PUA A;  4CGP A;  1GHE A;  4J3G A;  2J8R A;  2Z0Z A;  2ZW6 A;  4MFP A;  2DXQ A;  3LOD A;  2OU2 A;  2BSW A;  2K5T A;  4KS9 A;  3GY9 A;  5C82 A;  4R3K A;  2VXK A;  4XNH B;  3ZZI A;  2FL4 A;  4MFK A;  4MFQ A;  4QBJ A;  4QB9 A;  4CYO A;  1XIX A;  4U9Z A;  4NEX A;  1XEB A;  2FIA A;  4CAF A;  4OLL A;  4CAW A;  4HKF A;  2AE6 A;  1MJA A;  2PSW A;  4PSX A;  2BEI A;  5EC4 A;  3DR6 A;  5F48 A;  4NXY A;  4KSF A;  4ZBG A;  3W6X A;  4B12 A;  1YGH A;  3FYN A;  4AVB A;  2HV2 A;  1KUX A;  3S6F A;  4JWP A;  4R9M A;  4KVO E;  2PQ8 A;  2ZXV A;  4MFZ A;  4AB7 A;  5H86 A;  5E96 A;  4FD6 A;  3QB8 A;  4BBH A;  2CY2 A;  2EVN A;  1ON0 A;  4PV6 A;  1RXT A;  4KVM E;  4OAE A;  3TO7 A;  1IIC A;  4B5P B;  5IB0 A;  1P4N A;  3P2H A;  4MHD A;  5I0C A;  4PSW A;  4ONU A;  2ZW4 A;  2FSR A;  4C2Z A;  2B4B A;  4MJ8 A;  2Q04 A;  2P6G A;  3VWE A;  4KOR A;  4MY0 A;  2JEV A;  4F0Y A;  3S6H A;  2YNC A;  4UCP A;  2B3U A;  4KUA A;  4IUS A;  4HNY B;  1J4J A;  4KOV A;  4UWJ A;  3FRM A;  4NSQ A;  1I1D A;  4UFV A;  2OH1 A;  2P6F A;  3BLN A;  4KOT A;  1IYK A;  4H89 A;  3TOA A;  3K9U A;  1OZP A;  4AG7 A;  1I21 A;  2WPX A;  4NF1 A;  2WPW A;  3D3S A;  2H5M A;  3DR8 A;  4YFJ A;  2JLM A;  4M3S A;  3GYA A;  4HNW B;  1XE4 A;  3BJ7 A;  2Y0M A;  2I79 A;  1MK4 A;  4MFJ A;  3QAH A;  4Q38 A;  2CXA A;  1FY7 A;  5H84 A;  2FT0 A;  2VI7 A;  3D8P A;  4UWI A;  4XNH C;  1XMT A;  5IX3 A;  1Z4E A;  3PGP A;  2WUU A;  2OB0 A;  4B13 A;  2B4D B;  1YVK A;  2EUI A;  4XPL A;  3R9F A;  4CYQ A;  4DNC A;  2OZH A;  4GS4 A;  3B8G A;  4Y49 B;  2VZZ A;  2J8N A;  4KSA A;  4CGL A;  1S3Z A;  4AVA A;  5G21 A;  3VWD A;  1SQH A;  4CRY B;  4CYP A;  1IB1 E;  2FE7 A;  5KTD A;  3CXQ A;  5AGE A;  4MY3 A;  4QVT A;  4E8O A;  3PZJ A;  3IU2 A;  1KZF A;  3GKR A;  4C2X A;  4KOX A;  1YK3 A;  4CAX A;  1M4D A;  2FXF A;  1CM0 A;  2BUE A;  4AG9 A;  2HUZ A;  5G1Z A;  3R9E A;  3JTK A;  3FNC A;  4JXR A;  3EO4 A;  3TE4 A;  1YRE A;  4LUA A;  3G3S A;  4CGN A;  4C2Y A;  1M44 A;  5HH1 A;  3R95 A;  1BO4 A;  4AVC A;  1V0C A;  1YLE A;  3SHP A;  2R8V A;  3H4Q A;  5G22 A;  4C7H A;  4JLY A;  3F5B A;  4X5K A;  2Q7B A;  1KUV A;  1M4G A;  3TTH A;  2G3A A;  3SXN A;  3IWG A;  4R57 A;  5J8F A;  1L0C A;  3A9L A;  1Z4R A;  2ZW5 A;  5EBV A;  3LD2 A;  2X7B A;  4A33 A;  2B58 A;  1B87 A;  4PK3 A;  3DDD A;  5F49 A;  5GCN A;  3TT2 A;  1YX0 A;  3EC4 A;  2NMT A;  3DSB A;  3EY5 A;  2P0W A;  2YNE A;  1ZO0 A;  3D2P A;  3H5Z A;  4B11 A;  3KKW A;  4OAD A;  2CNS A;  3TFY A;  1Y9K A;  2OZU A;  3EFA A;  3S6K A;  2O28 A;  2FIW A;  3I9S A;  4R3L A;  2CNT A;  2J8M A;  4UBR A;  4KVX A;  2I00 A;  3D2M A;  4JD6 A;  2Z3L A;  2G0B A;  3IU1 A;  1Q2D A;  1UFH A;  4YGO A;  5DWN A;  4KUB A;  4K30 A;  3T90 A;  4CGM A;  2D4O A;  3W6S A;  3UY5 A;  2YNC C;  3F0A A;  3JVN A;  1QSM A;  3PP9 A;  4IF5 A;  2WSA A;  2GE3 A;  3T9Y A;  1WWZ A;  4C7I A;  2F5I A;  4YRH A;  4KOW A;  4CGO A;  2VQY A;  4Y49 C;  1M4I A;  3FB3 A;  4B10 A;  2ATR A;  1Q2C A;  2VZY A;  3RYO A;  1N71 A;  3MGD A;  4LX9 A;  2HQY A;  1Y9W A;  4R87 A;  5C88 A;  2Q4V A;  2YGW A;  5ISV A;  3TOB A;  4PK2 A;  2ARH A;  4ORF A;  4CAE A;  1S5K A;  4FD5 A;  5J8C A;  3F8K A;  4KLV A;  2Z3O A;  2Q0Y A;  1MJ9 A;  2R1I A;  2VBQ A;  4U9Y A;  5KTC A;  1NE9 A;  1QSR A;  1S7N A;  4U5Y A;  2FS5 A;  4NCZ A;  2QML A;  5IV0 A;  3G8W A;  1PU9 A;  2GIV A;  5G20 A;  3TO9 A;  5BWA B;  4HNX B;  3R96 A;  5KTA A;  4RS2 A;  4QUS A;  1CJW A;  2B5G A;  2DPS A;  1QST A;  3E0K A;  2Z11 A;  3WR7 A;  2G3T A;  2A4N A;  1P0H A;  1IYL A;  1U6M A;  3FIX A;  4JXQ A;  4ZGY B;  1KUY A;  2KCW A;  1VHS A;  4KLW A;  3S6G A;  2GAN A;  2PR8 A;  3IWE A;  2YND A;  4L89 A;  4CYN A;  1S7L A;  5FVJ A;  1I12 A;  1TIQ A;  2ZPA A;  4E2A A;  4B5P A;  1RO5 A;  2REF A;  2D4P A;  4CS0 B;  2IL4 A;  2Z3K A;  2PDO A;  4XPD C;  4UCN A;  1XF8 A;  2PRB A;  3R9G A;  3V8I A;  4A31 A;  4UFW A;  4H6U A;  4B14 A;  4BMH A;  5JPH A;  4MFL A;  5AG6 A;  4A95 A;  1S60 A;  4KOU A;  2ZW7 A;  2QIR A;  2B5G B;  3ZJ0 A;  4KOY A;  2VEZ A;  3R1K A;  4MBU A;  4XPD B;  4EVY A;  2PR1 A;  5AG4 A;  3FBU A;  1NMT A;  4B5O A;  4A30 A;  5CNP A;  2CNM A;  3I3G A;  4I49 A;  2OZG A;  4E0A A;  4RI1 A;  4FD7 A;  1QSN A;  1BOB A;  3N7Z A;  2DPT A;  2JDC A;  5F46 A;  1NSL A;  2Z3P A;  3CXS A;  4KZT A;  1Z9U A;  4II9 A;  2PC1 A;  1WK4 A;  4F0X A;  2REE A;  5DWM A;  1M1D A;  2RC4 A;  4A2Z A;  4UFX A;  2BL1 A;  3TCV A;  4CRZ B;  1R57 A;  4C68 A;  2FCK A;  4XPK A;  3TO6 A;  2C27 A;  1B6B A;  1QSO A;  2B4D A;  1YVO A;  4H6Z A;  1LRZ A;  4KOS A;  3P2F A;  2B3V A;  3DNS A;  5A27 A;  1Q2Y A;  4L8A A;  2Q44 A;  3EXN A;  1VKC A;  4UA3 A;  4QC6 A;  1S7K A;  2Z3M A;  4FD4 A;  2P6E A;  3C26 A;  3CXP A;  1Y7R A;  4UCM A;  4MI4 A;  1YR0 A;  3SXO A;  2Z10 A;  1MJB A;  2Q4Y A;  4CAV A;  5JQ4 A;  1S7F A;  1K4J A;  5A28 A;  2R98 A;  4A32 A;  1IID A;  2R7H A;  3BJ8 A;  4JJX A;  2QEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...