4MBUA

Crystal structure of n-acetyltransferase from staphylococcus aureus mu50
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
165
structure length
165
Chain Sequence
SNAMIRCAKKEDLNAILAIYNDAIINTTAVYTYKPQTIDERIAWFETKQRNHEPIFVFEENGSVLGFATFGSFRPWPAYQYTIEHSIYVDASARGKGIASQLLQRLIVEAKAKGYRTLVAGIDASNEASIKLHQKFNFKHAGTLTNVGYKFDYWLDLAFYELDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Similar to N-acetyltransferase
publication title Structural characterization of a Gcn5-related N-acetyltransferase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
total genus 48
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mbuA00
2ZPAA 5GCNA 3CXSA 2OH1A 1Z4EA 4NF1A 4R9MA 2VZZA 2C27A 1RO5A 3D8PA 4IF5A 3CXQA 2WPWA 2G0BA 4MBUA 1OZPA 1RXTA 3BJ7A 1Z9UA 3TO7A 1M4IA 5HMNA 2OB0A 4H6ZA 1Z4RA 2BSWA 4OADA 1R57A 3F5BA 2I79A 1QSNA 5JQ4A 4UBRA 3GYAA 2P6EA 3PP9A 2J8RA 4H6UA 1IYLA 1P4NA 2P0WA 2J8NA 2GE3A 1S7KA 2FE7A 4QBJA 3TOAA 4CAVA 4JD6A 1M44A 4JWPA 4HNWB 2B4BA 3FXTA 1NMTA 2R98A 1N71A 2EVNA 3D2MA 4HNYB 2B4DB 1PUAA 2AE6A 3IGRA 4LX9A 2B5GB 4F6AA 4AVCA 1Q2CA 2REEA 1XEBA 5F48A 3MGDA 1ON0A 2JDCA 5FVJA 1GHEA 4AG7A 5H84A 3BJ8A 4KOVA 4MHDA 3ZZIA 1M1DA 3K9UA 5C88A 3UY5A 1CJWA 2FIWA 4QC6A 2F5IA 2ZW7A 2PR8A 1PU9A 5E96A 2J8MA 2CNMA 4KVME 3EFAA 4II9A 2B58A 3TFYA 3H4QA 4R87A 1YR0A 4PK2A 1I21A 5KTDA 1VHSA 4KLWA 2PR1A 5I0CA 4KUAA 3E0KA 3FIXA 4YRHA 4U5YA 1IYKA 2OZHA 5J8CA 2HUZA 4DNCA 2ZXVA 2RC4A 3S6GA 2Y0MA 2VQYA 3CXPA 5KTAA 3JUWA 1QSOA 4R3LA 1MJ9A 2B3UA 3EC4A 1S5KA 5J8FA 1SQHA 4Y49B 2R1IA 2B3VA 1U6MA 1J4JA 2P6FA 2O28A 4NSQA 3DSBA 3T9YA 1YVOA 4QVTA 2BL1A 2PSWA 3T90A 3SXOA 3S6FA 3BLNA 4YFJA 3TO6A 4BMHA 4PK3A 1YLEA 3TE4A 2NMTA 1NSLA 1I1DA 2VEZA 3PGPA 4R3KA 4XPDB 3TCVA 3B8GA 3TO9A 2Q44A 4E8OA 2Z11A 1XMTA 2FCKA 2Z10A 3TT2A 2I00A 1XE4A 5EBVA 3R9GA 4KZTA 1LRZA 4XPKA 2VI7A 2BUEA 4XNHB 4KVXA 1QSRA 4AVAA 4K30A 2PQ8A 2DXQA 3W91A 1S3ZA 4MY0A 2Q4YA 4RS2A 1FY7A 3WR7A 1VKCA 4E0AA 4QUSA 3DDDA 2R8VA 4HKFA 2ARHA 1Y9KA 4F0YA 2EUIA 2JLMA 4FD4A 4U9YA 5EC4A 3OWCA 1TIQA 4B5PB 1P0HA 3S6HA 2FS5A 1V0CA 2BEIA 5DWNA 2IL4A 4UWIA 4U9ZA 2GANA 2K5TA 4FD6A 1BO4A 1YGHA 4RI1A 5ISVA 3TOBA 3SXNA 1KUXA 3EO4A 3R1KA 4ORFA 2CNTA 4KOYA 3QB8A 3VWDA 4M85A 1I12A 4H89A 3RYOA 5HH1A 3DR8A 2CY2A 3D3SA 2FL4A 3P2HA 5F49A 4E2AA 4AVBA 1XIXA 4KOXA 3N7ZA 3G8WA 1MJBA 2Q0YA 3TTHA 2FSRA 4MY3A 4X5KA 2Q4VA 3EXNA 2AJ6A 4JXQA 4PSXA 4Y49C 2Q04A 4ZBGA 1Y7RA 1KUYA 3R96A 4NXYA 3SHPA 4CS0B 1S7FA 5DWMA 4AB7A 1KUVA 1Q2DA 3FB3A 2B4DA 2WPXA 2QMLA 2HV2A 2JDDA 1YK3A 2B5GA 4L89A 1CM0A 3G3SA 2OZUA 2OU2A 3FNCA 3W6SA 2QIRA 4KOTA 3C26A 4J3GA 4CAXA 1BOBA 1MK4A 4CRYB 3GY9A 2REFA 4XPDC 5IV0A 3VWEA 1M4GA 3R9FA 3F0AA 3QAHA 4PSWA 3GKRA 4GS4A 1K4JA 1M4DA 5CNPA 2PRBA 4JXRA 3ZJ0A 4XNHC 5JPHA 4KORA 2GIVA 2JEVA 3DR6A 3LODA 1S7LA 1YVKA 2D4OA 4KOUA 3V8IA 2FT0A 5F46A 3S6KA 4HNXB 1YX0A 5F47A 2ZW6A 3DNSA 1Q2YA 3PZJA 3FBUA 3P2FA 2ZW5A 3KKWA 5C82A 2X7BA 4LUAA 2G3AA 4M3SA 1Y9WA 2H5MA 4PV6A 4ONUA 1YREA 1IICA 4FD7A 3I9SA 3IWGA 3LD2A 4OLLA 1UFHA 4R57A 2P6GA 4KUBA 2FXFA 4NCZA 4KOWA 2A4NA 3I3GA 3EY5A 1IIDA 3FRMA 2CNSA 2Z0ZA 1QSTA 1IB1E 4UWJA 2FIAA 4JLYA 1WWZA 1QSMA 3D2PA 4MJ8A 3F8KA 4KOSA 2R7HA 4KVOE 2G3TA 2VBQA 1B6BA 4XPLA 2HQYA 4JJXA 5IB0A 4CAWA 1WK4A 4NEXA 2ZW4A 5IX3A 2VZYA 4L8AA 1MJAA 2D4PA 1NE9A 2QECA 1XF8A 2PDOA 1B87A 2ATRA 2OZGA 4CRZB 2PC1A 2Q7BA 4QB9A 1L0CA 4UA3A 3R9EA 3R95A 5KTCA 2VXKA 4EVYA 1S7NA 1S60A 4MI4A 4IUSA 4OAEA 1KZFA 5H86A 4B5OA 4FD5A 3JVNA 4YGOA 3W6XA 3NE7A 4I49A 4B5PA 4KLVA 4AG9A 2KCWA 3FYNA
chains in the Genus database with same CATH superfamily
2ZPAA 5GCNA 3CXSA 2OH1A 1Z4EA 3FEEA 2I3CA 4NF1A 4R9MA 2VZZA 5A28A 2C27A 1ZG8A 1RO5A 2POKA 2PJ8A 3D8PA 4IF5A 4R6TA 3H8EA 4Q36A 1ELMP 3CXQA 2WPWA 2ZEPA 2DPSA 3KI9A 4NGQA 4BD9A 3RZAA 3VARA 2DPTA 2G0BA 1Z8TA 4H2KA 4MBUA 5CPAA 1TF8A 5AG7A 5EMIA 1OZPA 4ZX9A 1Y7EA 4OP4A 1RXTA 3BJ7A 4CAEA 2ZEHA 4MFPA 4NGSA 1Z9UA 4P4EA 3TO7A 1M4IA 4A30A 2OB0A 5HMNA 3PB7X 1Z4RA 2BSWA 4H6ZA 4OADA 1R57A 3F5BA 1LANA 2I79A 1QSNA 4UFWA 5JQ4A 5G20A 2ZELA 3S9NA 4UBRA 1BPNA 5D8NA 3GYAA 2DF5A 3PB4X 2P6EA 3IWWA 3PP9A 2J8RA 3S9MA 1Z8LA 4H6UA 4MFKA 5LYDA 4CGMA 2DEAA 1IYLA 3S9LA 1P4NA 2P0WA 3SI2A 2ZEFA 4UEEA 1YQEA 2AFZA 2J8NA 2GE3A 1S7KA 2FE7A 4QBJA 2XEJA 1LAPA 3TOAA 5CBMA 1CP6A 3BHXA 4CAVA 2PE3A 4JD6A 4P6YA 4P44A 4MCSA 1M44A 2PJ7A 4JWPA 4HNWB 4A38A 3TC8A 2B4BA 3FXTA 1NMTA 2AFWA 1N71A 2EVNA 2HC9A 2PJ9A 2R98A 3D2MA 4HNYB 2B4DB 3FMCA 1Y0YA 1PUAA 4KSIA 4UCMA 2AE6A 3D4UA 5BWAB 3IGRA 4LX9A 2B5GB 3IIBA 4AVCA 4F6AA 3NH4A 1Q2CA 2GFQA 4M6IA 3CPXA 1QMUA 4MHYA 4UIAA 1UWYA 1JQGA 2REEA 3K9TA 1XEBA 5F48A 4MFQA 2ZEEA 1ARMA 3IWEA 3MGDA 4M6HA 5K8PA 4PXEA 2Q4ZA 1ON0A 2JDCA 5FVJA 1GHEA 4AG7A 4MFLA 4C2ZA 1CBXA 5H84A 3LACA 2ZEMA 3BJ8A 3FH4A 2PCUA 4GM5A 4KOVA 4MHDA 2NYQA 3ZZIA 4A31A 5LRJA 1M1DA 3SJXA 2XEIA 3K9UA 4NFRA 5C88A 3UY5A 2PJ5A 1ARLA 1CJWA 1LOKA 2FIWA 4QC6A 4RN7A 3WC7A 4ZI6A 2PJ2A 3KL9A 2F5IA 4NGNA 5AG4A 2ZW7A 4O23A 2PR8A 1PU9A 1TKHA 3V38A 5E96A 3IC1A 1CPSA 1HEEA 4NGMA 2PRQA 4ONWA 4FWUA 3WC5A 2J8MA 2CNMA 4KVME 1IY7A 4MHPA 3MN8A 3EFAA 4NJRA 2PJ1A 4II9A 2B58A 4Q7AA 2PJ4A 2BO9A 3TFYA 4OKOA 4MHNA 3H4QA 4R87A 3PFEA 3H5ZA 1F2PA 5G21A 1YR0A 4ZX8A 4PK2A 4CGLA 2CTCA 1I21A 3FECA 5KTDA 1VHSA 4KLWA 4OIWA 4G1PA 4Z65A 4P45A 2PR1A 3HLPA 5F09A 1LFWA 2PJ6A 5I0CA 2PVWA 3ISXA 3D68A 4NGPA 1IU8A 4B6ZA 3B3SA 4KUAA 4WWVA 4C68A 5K8MA 3E0KA 3FIXA 1YW4A 4YRHA 4F0XA 4U5YA 5HXDA 1IYKA 1PYTB 2Z3PA 2OZHA 2BCOA 1EE3P 5J8CA 2HUZA 5ELYA 3CT9A 2QJ8A 2CTBA 4UFXA 2Q43A 4YU9A 2ZXVA 2Q7SA 2RC4A 3S6GA 4DNCA 2Y0MA 2VQYA 2HB6A 4OC0A 3T8WA 3CXPA 4P4DA 5KTAA 3JUWA 1QSOA 4R3LA 2PJCA 2AFUA 1CX8A 1MJ9A 3IU2A 3MRUA 5AG6A 3L2NA 1CG2A 4ZGYB 2B3UA 2J9AA 3EC4A 1S5KA 5J8FA 5LYIA 2CF4A 1SQHA 1YW6A 4Y49B 2PVVA 2R1IA 4UCNA 2B3VA 1U6MA 2CXAA 2WZNA 2JBKA 3BI1A 1J4JA 5I4MA 2P6FA 4CGPA 4CYNA 2BOAA 1XOVA 2O28A 4NSQA 3DSBA 4OMEA 3T9YA 3NFZA 1Q7LA 5G1ZA 3H8GA 4P4IA 1FT7A 1YVOA 4QVTA 4MHZA 2BL1A 2PSWA 3T90A 3SXOA 3S6FA 1LCPA 3PFOA 3BLNA 5AG5A 4YFJA 3TO6A 4BMHA 4P4FA 4PK3A 5LRKA 1YLEA 4CYQA 3TE4A 1IOIA 2NMTA 1NSLA 1I1DA 2VEZA 3PGPA 4R3KA 4XPDB 3TCVA 4CGNA 1ZLIA 4CGOA 3SJFA 4C2XA 5JGFA 2VL1A 3B8GA 4OIDA 2YNCC 3TO9A 2F8HA 5G22A 2Q44A 4E8OA 4NJQA 2Z11A 3PB9X 1XMTA 2FCKA 4IK2A 1XFOA 2Z10A 3TT2A 2I00A 3KHZA 1XE4A 2ZEDA 4JZ0A 4NGTA 2OR4A 5EBVA 3KR4A 3R9GA 3DLJA 4KZTA 1LRZA 4XPKA 2VI7A 2BUEA 4XNHB 1TKJA 4KVXA 1QSRA 5D29A 2OOTA 4MRIA 2EBJA 5AGEA 3B2YA 4AVAA 4K30A 2PQ8A 2DXQA 2XEFA 4OC4A 2QVPA 3BXMA 1S3ZA 3W91A 4A32A 4C7HA 4MY0A 3IO1A 2FVGA 3K2KA 2Q4YA 3PEIA 4RS2A 1FY7A 3WR7A 5A27A 1VKCA 4E0AA 3IEHA 2V77A 2V8DA 4LQGA 4QUSA 1GYTA 3SI0A 3DDDA 1ZLHA 4UIBA 2R8VA 4HKFA 2ARHA 1Y9KA 3FF3A 2EUIA 4F0YA 2JLMA 4FD4A 3NE8A 4M6GA 4U9YA 3OWCA 1TIQA 1Z5RA 5EC4A 3SI1A 4B5PB 2AFOA 1P0HA 3S6HA 2FS5A 1V0CA 1F57A 2BEIA 2IQ6A 2Z3LA 3LMSA 5DS0A 4F8ZA 5K8OA 5DWNA 2IL4A 4UWIA 4U9ZA 2EWBA 2GANA 2YNEA 4WJBA 3GIUA 2K5TA 4FD6A 2Q51A 4CYPA 4BINA 5JH9A 4C7IA 1BO4A 3IU1A 4P10A 1ZG9A 1YGHA 1DTDA 3JRUA 2AFXA 4RI1A 4A37A 3RNZA 5ISVA 3TOBA 4IHMA 2Z3NA 2V8GA 3SXNA 1KUXA 4Q38A 3EO4A 4MFJA 2YNDA 3R1KA 4ORFA 2CNTA 3FJUA 4KOYA 2RB7A 3QB8A 3VWDA 1AUGA 3RBUA 4MCPA 2Z3MA 2G9DA 4UCPA 2IMOA 1CP7A 3GB0A 4M85A 4EWTA 1I12A 4H89A 3RYOA 5HH1A 3DR8A 4B11A 2CY2A 3D3SA 1X12A 2XEGA 3PBEA 2FL4A 3P2HA 5F49A 1Y0RA 4E2AA 2C6GA 4P4BA 4AVBA 2O53A 2V8VA 1XIXA 4KOXA 1A2ZA 1NSAA 3N7ZA 3G8WA 1MJBA 2ZOFA 2ODFA 3LWUA 2Q0YA 4CAFA 1BAVA 1AMPA 3SJGA 3TTHA 2FSRA 4A33A 3B3VA 4MY3A 4X5KA 3BI0A 4R8FA 4F9VA 1CPXA 2AFMA 2Q4VA 3EXNA 3PBBA 2AJ6A 2EK8A 3TX8A 4JXQA 4FUUA 4PSXA 4Y49C 2Q04A 1OBRA 1Y7RA 1KUYA 3CPAA 4TNUA 1HDUA 4ZBGA 3R96A 3PB6X 4NXYA 3RAMA 3SHPA 3QNVA 4CS0B 1S7FA 3NH8A 3D7FA 5DWMA 4AB7A 1KUVA 1Q2DA 3FB3A 3WABA 2JEWA 3KGQA 2B4DA 2WPXA 2QMLA 3D7DA 2YNCA 2HV2A 3B3TA 3B7IA 2JDDA 1YK3A 2B5GA 3FX6A 4L89A 1KWMA 1CM0A 3SJEA 2AFSA 2ABZA 2OZUA 3G3SA 2OU2A 4MFZA 4ZY0A 3FEDA 2GREA 2ZENA 1ZO0A 2EO8A 3FNCA 4UFVA 4EFDA 3W6SA 1VHEA 2QIRA 4R7MA 1BLLE 2WSAA 4KOTA 4OC5A 3C26A 3KZWA 3RO0A 1RTQA 1TXRA 1IOFA 4J3GA 4CAXA 3N5FA 1BOBA 1MK4A 4CRYB 3GLJA 3GY9A 2REFA 3B3WA 4PXCA 4XPDC 3KQXA 4MCRA 5IV0A 4IAVA 3WT4A 3VWEA 1VHOA 1M4GA 3R9FA 2PJ3A 3F0AA 3QAHA 4PSWA 3GKRA 3IJ3A 4GS4A 4ZY1A 1K4JA 1M4DA 4B14A 5CNPA 2PRBA 4JXRA 4K3NA 3ZJ0A 4XNHC 3I1UA 2PJAA 1Z8WA 5JPHA 4KORA 2GIVA 2JEVA 5HVHA 3DR6A 3LODA 4RUHA 4B13A 1S7LA 4FBEA 4OC1A 1YVKA 2CIJA 3NH5A 1XBUA 1XMBA 2D4OA 3GUXA 4KOUA 3V8IA 2FT0A 4W9YA 4C2YA 4OC3A 2Z3OA 3S6KA 4HNXB 5F46A 1YX0A 5F47A 1Z8XA 2ZW6A 1AYEA 4AXVA 4B10A 3DNSA 2Z3KA 4DUKA 1Q2YA 1M4LA 3D7HA 3PZJA 1YMEA 3FBUA 3P2FA 1TF9A 3B35A 3NA6A 4F9UA 2ZW5A 3A9LA 3KKWA 4KSFA 4OC2A 2X7BA 4LUAA 5C82A 2G3AA 4M3SA 1Y9WA 1YSJA 2H5MA 4PV6A 4ONUA 4LQ6A 1YREA 1IICA 1JWQA 4FD7A 3I9SA 1DE4C 1H8LA 3IWGA 3LD2A 2YGWA 4OLLA 4R76A 3D66A 1UFHA 1IGBA 1F2OA 4P4JA 2EK9A 3KHXA 4R57A 2NSMA 2P6GA 4PXDA 4KUBA 3H8FA 3D67A 2WUUA 5K8NA 2FXFA 2PIZA 3QAYA 4NGRA 5HVFA 4NCZA 4FAIA 2C6CA 4KOWA 1ZG7A 2A4NA 2PIYA 3I3GA 4A95A 3EY5A 1XRYA 2RFHA 3D7GA 4BBHA 1IIDA 2C1CA 2CNSA 2Z0ZA 3FRMA 1YLOA 2F7VA 4PXBA 8CPAA 1QSTA 1IB1E 4UWJA 2FIAA 3V7ZA 2IJZA 2JBJA 2QYVA 4JLYA 1WWZA 3PB8X 4X3RA 3KR5A 1VIXA 5LYFA 1QSMA 3KQZA 3D2PA 1BPMA 4MJ8A 3FVLA 3F8KA 4KOSA 1R3NA 4X2TA 2PJ0A 2R7HA 4KVOE 4A39A 2G3TA 3CDXA 3DGVA 4KS9A 2VBQA 1B6BA 7CPAA 4CYOA 4A2ZA 4KSAA 5HVGA 2GU2A 1LAMA 4XPLA 2ANPA 5LRGA 2HQYA 3PRTA 4JJXA 5IB0A 4CAWA 1WK4A 4NEXA 4DJLA 1HDQA 2PJBA 1FNOA 2ZW4A 2V8HA 5IX3A 2GLFA 2ZOGA 1XJOA 6CPAA 1PCAA 2VZYA 4L8AA 1TKFA 5LYLA 1MJAA 2D4PA 1NE9A 2QECA 4TWEA 1ELLP 4X8IA 1XF8A 2PDOA 1B87A 3CZXA 2ATRA 3VATA 4ZYQA 2C6PA 5IB9A 2WYRA 2ZEGA 3WC6A 2OZGA 4UEFA 4CRZB 4MMOA 4MXUA 1X10A 2GLJA 2PC1A 4EMEA 2Q7BA 4QB9A 4UEZA 1L0CA 4UA3A 3R9EA 4HPSA 3R95A 3KASA 4GXHA 5KTCA 4PQAA 3VH9A 2VXKA 2O4HA 4EVYA 1S7NA 1S60A 4MI4A 4UF4A 1QQ9A 4ZY2A 4B12A 2ZEOA 4IUSA 5J1QA 4YWYA 4OAEA 1KZFA 5H86A 4B5OA 4FD5A 5JM6A 3JVNA 4CPAA 4DYOA 1VGYA 4YGOA 5THWA 3HUVA 3NE7A 3B3CA 4I49A 3W6XA 3IFEA 4A94A 4PPZA 4B5PA 3ISZA 4KLVA 4JYWA 4AG9A 1Z2LA 2KCWA 4MCQA 3FYNA 3JTKA 1R43A
chains in the Genus database with same CATH topology
2ZPAA 5GCNA 3CXSA 2OH1A 1Z4EA 4NF1A 5A28A 4R9MA 2VZZA 2C27A 1RO5A 3D8PA 4IF5A 4Q36A 3CXQA 2WPWA 2DPSA 2DPTA 2G0BA 4MBUA 5AG7A 1OZPA 1RXTA 3BJ7A 4CAEA 4MFPA 1Z9UA 3TO7A 1M4IA 4A30A 2OB0A 5HMNA 4H6ZA 1Z4RA 2BSWA 4OADA 1R57A 3F5BA 2I79A 1QSNA 4UFWA 5JQ4A 5G20A 4UBRA 3GYAA 2P6EA 3PP9A 2J8RA 4H6UA 4MFKA 4CGMA 1IYLA 1P4NA 2P0WA 2J8NA 2GE3A 1S7KA 2FE7A 4QBJA 3TOAA 4CAVA 4JD6A 1M44A 4JWPA 4HNWB 2B4BA 3FXTA 1NMTA 2R98A 1N71A 2EVNA 3D2MA 4HNYB 2B4DB 1PUAA 4UCMA 2AE6A 5BWAB 3IGRA 4LX9A 2B5GB 4F6AA 4AVCA 1Q2CA 2REEA 1XEBA 5F48A 4MFQA 3IWEA 3MGDA 1ON0A 2JDCA 5FVJA 1GHEA 4AG7A 4MFLA 4C2ZA 5H84A 3BJ8A 4KOVA 4MHDA 3ZZIA 4A31A 1M1DA 3K9UA 5C88A 3UY5A 1CJWA 2FIWA 4QC6A 2F5IA 5AG4A 2ZW7A 2PR8A 1PU9A 5E96A 2J8MA 2CNMA 4KVME 3EFAA 4II9A 2B58A 3TFYA 3H4QA 4R87A 3H5ZA 5G21A 1YR0A 4CGLA 4PK2A 1I21A 5KTDA 1VHSA 4KLWA 2PR1A 5I0CA 4KUAA 4C68A 3E0KA 3FIXA 4YRHA 4F0XA 4U5YA 1IYKA 2Z3PA 2OZHA 5J8CA 2HUZA 4UFXA 4DNCA 2ZXVA 2RC4A 3S6GA 2Y0MA 2VQYA 3CXPA 5KTAA 3JUWA 1QSOA 4R3LA 1MJ9A 3IU2A 5AG6A 4ZGYB 2B3UA 3EC4A 1S5KA 5J8FA 1SQHA 4Y49B 2R1IA 4UCNA 2B3VA 1U6MA 2CXAA 1J4JA 2P6FA 4CGPA 4CYNA 2O28A 4NSQA 3DSBA 3T9YA 5G1ZA 1YVOA 4QVTA 2BL1A 2PSWA 3T90A 3SXOA 3S6FA 3BLNA 5AG5A 4YFJA 3TO6A 4BMHA 4PK3A 1YLEA 4CYQA 3TE4A 2NMTA 1NSLA 1I1DA 2VEZA 3PGPA 4R3KA 4XPDB 3TCVA 4CGNA 4CGOA 4C2XA 3B8GA 2YNCC 3TO9A 5G22A 2Q44A 4E8OA 2Z11A 1XMTA 2FCKA 2Z10A 3TT2A 2I00A 1XE4A 5EBVA 3R9GA 4KZTA 1LRZA 4XPKA 2VI7A 2BUEA 4XNHB 4KVXA 1QSRA 5AGEA 4AVAA 4K30A 2PQ8A 2DXQA 3W91A 4C7HA 1S3ZA 4A32A 4MY0A 2Q4YA 4RS2A 1FY7A 3WR7A 5A27A 1VKCA 4E0AA 4QUSA 3DDDA 2R8VA 4HKFA 2ARHA 1Y9KA 4F0YA 2EUIA 2JLMA 4FD4A 4U9YA 5EC4A 3OWCA 1TIQA 4B5PB 1P0HA 3S6HA 2FS5A 1V0CA 2BEIA 2Z3LA 5DWNA 2IL4A 4UWIA 4U9ZA 2GANA 2YNEA 2K5TA 4FD6A 4CYPA 4C7IA 1BO4A 3IU1A 1YGHA 4RI1A 5ISVA 3TOBA 2Z3NA 3SXNA 1KUXA 4Q38A 3EO4A 4MFJA 2YNDA 3R1KA 4ORFA 2CNTA 4KOYA 3QB8A 3VWDA 2Z3MA 4UCPA 4M85A 1I12A 4H89A 3RYOA 5HH1A 3DR8A 4B11A 2CY2A 3D3SA 2FL4A 3P2HA 5F49A 4E2AA 4AVBA 1XIXA 4KOXA 3N7ZA 3G8WA 1MJBA 2Q0YA 4CAFA 3TTHA 2FSRA 4A33A 4MY3A 4X5KA 2Q4VA 3EXNA 2AJ6A 4JXQA 4PSXA 4Y49C 2Q04A 4ZBGA 1Y7RA 1KUYA 3R96A 4NXYA 3SHPA 4CS0B 1S7FA 5DWMA 4AB7A 1KUVA 1Q2DA 3FB3A 2B4DA 2WPXA 2QMLA 2YNCA 2HV2A 2JDDA 1YK3A 2B5GA 4L89A 1CM0A 3G3SA 4MFZA 2OZUA 2OU2A 1ZO0A 3FNCA 4UFVA 3W6SA 2QIRA 2WSAA 4KOTA 3C26A 4J3GA 4CAXA 1BOBA 1MK4A 4CRYB 3GY9A 2REFA 4XPDC 5IV0A 3VWEA 1M4GA 3R9FA 3F0AA 3QAHA 4PSWA 3GKRA 4GS4A 1K4JA 1M4DA 4B14A 5CNPA 2PRBA 4JXRA 3ZJ0A 4XNHC 5JPHA 4KORA 2GIVA 2JEVA 3DR6A 3LODA 4B13A 1S7LA 1YVKA 2D4OA 4KOUA 3V8IA 2FT0A 4C2YA 5F46A 2Z3OA 3S6KA 4HNXB 1YX0A 5F47A 2ZW6A 4B10A 3DNSA 2Z3KA 1Q2YA 3PZJA 3FBUA 3P2FA 2ZW5A 3A9LA 3KKWA 4KSFA 5C82A 2X7BA 4LUAA 2G3AA 4M3SA 1Y9WA 2H5MA 4PV6A 4ONUA 1YREA 1IICA 4FD7A 3I9SA 3IWGA 3LD2A 2YGWA 4OLLA 1UFHA 4R57A 2P6GA 4KUBA 2WUUA 2FXFA 4NCZA 4KOWA 2A4NA 3I3GA 4A95A 4BBHA 3EY5A 1IIDA 3FRMA 2CNSA 2Z0ZA 1QSTA 1IB1E 4UWJA 2FIAA 4JLYA 1WWZA 1QSMA 3D2PA 4MJ8A 3F8KA 4KOSA 2R7HA 4KVOE 2G3TA 4KS9A 2VBQA 1B6BA 4CYOA 4A2ZA 4KSAA 4XPLA 2HQYA 4JJXA 5IB0A 4CAWA 1WK4A 4NEXA 2ZW4A 5IX3A 2VZYA 4L8AA 1MJAA 2D4PA 1NE9A 2QECA 1XF8A 2PDOA 1B87A 2ATRA 2OZGA 4CRZB 2PC1A 2Q7BA 4QB9A 1L0CA 4UA3A 3R9EA 3R95A 5KTCA 2VXKA 4EVYA 1S7NA 1S60A 4MI4A 4B12A 4IUSA 4OAEA 1KZFA 5H86A 4B5OA 4FD5A 3JVNA 4YGOA 3W6XA 3NE7A 4I49A 4B5PA 4KLVA 4AG9A 2KCWA 3FYNA 3JTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPA A;  5GCN A;  3CXS A;  2OH1 A;  1Z4E A;  4NF1 A;  4R9M A;  2VZZ A;  2C27 A;  1RO5 A;  3D8P A;  4IF5 A;  3CXQ A;  2WPW A;  2G0B A;  4MBU A;  1OZP A;  1RXT A;  3BJ7 A;  1Z9U A;  3TO7 A;  1M4I A;  5HMN A;  2OB0 A;  4H6Z A;  1Z4R A;  2BSW A;  4OAD A;  1R57 A;  3F5B A;  2I79 A;  1QSN A;  5JQ4 A;  4UBR A;  3GYA A;  2P6E A;  3PP9 A;  2J8R A;  4H6U A;  1IYL A;  1P4N A;  2P0W A;  2J8N A;  2GE3 A;  1S7K A;  2FE7 A;  4QBJ A;  3TOA A;  4CAV A;  4JD6 A;  1M44 A;  4JWP A;  4HNW B;  2B4B A;  3FXT A;  1NMT A;  2R98 A;  1N71 A;  2EVN A;  3D2M A;  4HNY B;  2B4D B;  1PUA A;  2AE6 A;  3IGR A;  4LX9 A;  2B5G B;  4F6A A;  4AVC A;  1Q2C A;  2REE A;  1XEB A;  5F48 A;  3MGD A;  1ON0 A;  2JDC A;  5FVJ A;  1GHE A;  4AG7 A;  5H84 A;  3BJ8 A;  4KOV A;  4MHD A;  3ZZI A;  1M1D A;  3K9U A;  5C88 A;  3UY5 A;  1CJW A;  2FIW A;  4QC6 A;  2F5I A;  2ZW7 A;  2PR8 A;  1PU9 A;  5E96 A;  2J8M A;  2CNM A;  4KVM E;  3EFA A;  4II9 A;  2B58 A;  3TFY A;  3H4Q A;  4R87 A;  1YR0 A;  4PK2 A;  1I21 A;  5KTD A;  1VHS A;  4KLW A;  2PR1 A;  5I0C A;  4KUA A;  3E0K A;  3FIX A;  4YRH A;  4U5Y A;  1IYK A;  2OZH A;  5J8C A;  2HUZ A;  4DNC A;  2ZXV A;  2RC4 A;  3S6G A;  2Y0M A;  2VQY A;  3CXP A;  5KTA A;  3JUW A;  1QSO A;  4R3L A;  1MJ9 A;  2B3U A;  3EC4 A;  1S5K A;  5J8F A;  1SQH A;  4Y49 B;  2R1I A;  2B3V A;  1U6M A;  1J4J A;  2P6F A;  2O28 A;  4NSQ A;  3DSB A;  3T9Y A;  1YVO A;  4QVT A;  2BL1 A;  2PSW A;  3T90 A;  3SXO A;  3S6F A;  3BLN A;  4YFJ A;  3TO6 A;  4BMH A;  4PK3 A;  1YLE A;  3TE4 A;  2NMT A;  1NSL A;  1I1D A;  2VEZ A;  3PGP A;  4R3K A;  4XPD B;  3TCV A;  3B8G A;  3TO9 A;  2Q44 A;  4E8O A;  2Z11 A;  1XMT A;  2FCK A;  2Z10 A;  3TT2 A;  2I00 A;  1XE4 A;  5EBV A;  3R9G A;  4KZT A;  1LRZ A;  4XPK A;  2VI7 A;  2BUE A;  4XNH B;  4KVX A;  1QSR A;  4AVA A;  4K30 A;  2PQ8 A;  2DXQ A;  3W91 A;  1S3Z A;  4MY0 A;  2Q4Y A;  4RS2 A;  1FY7 A;  3WR7 A;  1VKC A;  4E0A A;  4QUS A;  3DDD A;  2R8V A;  4HKF A;  2ARH A;  1Y9K A;  4F0Y A;  2EUI A;  2JLM A;  4FD4 A;  4U9Y A;  5EC4 A;  3OWC A;  1TIQ A;  4B5P B;  1P0H A;  3S6H A;  2FS5 A;  1V0C A;  2BEI A;  5DWN A;  2IL4 A;  4UWI A;  4U9Z A;  2GAN A;  2K5T A;  4FD6 A;  1BO4 A;  1YGH A;  4RI1 A;  5ISV A;  3TOB A;  3SXN A;  1KUX A;  3EO4 A;  3R1K A;  4ORF A;  2CNT A;  4KOY A;  3QB8 A;  3VWD A;  4M85 A;  1I12 A;  4H89 A;  3RYO A;  5HH1 A;  3DR8 A;  2CY2 A;  3D3S A;  2FL4 A;  3P2H A;  5F49 A;  4E2A A;  4AVB A;  1XIX A;  4KOX A;  3N7Z A;  3G8W A;  1MJB A;  2Q0Y A;  3TTH A;  2FSR A;  4MY3 A;  4X5K A;  2Q4V A;  3EXN A;  2AJ6 A;  4JXQ A;  4PSX A;  4Y49 C;  2Q04 A;  4ZBG A;  1Y7R A;  1KUY A;  3R96 A;  4NXY A;  3SHP A;  4CS0 B;  1S7F A;  5DWM A;  4AB7 A;  1KUV A;  1Q2D A;  3FB3 A;  2B4D A;  2WPX A;  2QML A;  2HV2 A;  2JDD A;  1YK3 A;  2B5G A;  4L89 A;  1CM0 A;  3G3S A;  2OZU A;  2OU2 A;  3FNC A;  3W6S A;  2QIR A;  4KOT A;  3C26 A;  4J3G A;  4CAX A;  1BOB A;  1MK4 A;  4CRY B;  3GY9 A;  2REF A;  4XPD C;  5IV0 A;  3VWE A;  1M4G A;  3R9F A;  3F0A A;  3QAH A;  4PSW A;  3GKR A;  4GS4 A;  1K4J A;  1M4D A;  5CNP A;  2PRB A;  4JXR A;  3ZJ0 A;  4XNH C;  5JPH A;  4KOR A;  2GIV A;  2JEV A;  3DR6 A;  3LOD A;  1S7L A;  1YVK A;  2D4O A;  4KOU A;  3V8I A;  2FT0 A;  5F46 A;  3S6K A;  4HNX B;  1YX0 A;  5F47 A;  2ZW6 A;  3DNS A;  1Q2Y A;  3PZJ A;  3FBU A;  3P2F A;  2ZW5 A;  3KKW A;  5C82 A;  2X7B A;  4LUA A;  2G3A A;  4M3S A;  1Y9W A;  2H5M A;  4PV6 A;  4ONU A;  1YRE A;  1IIC A;  4FD7 A;  3I9S A;  3IWG A;  3LD2 A;  4OLL A;  1UFH A;  4R57 A;  2P6G A;  4KUB A;  2FXF A;  4NCZ A;  4KOW A;  2A4N A;  3I3G A;  3EY5 A;  1IID A;  3FRM A;  2CNS A;  2Z0Z A;  1QST A;  1IB1 E;  4UWJ A;  2FIA A;  4JLY A;  1WWZ A;  1QSM A;  3D2P A;  4MJ8 A;  3F8K A;  4KOS A;  2R7H A;  4KVO E;  2G3T A;  2VBQ A;  1B6B A;  4XPL A;  2HQY A;  4JJX A;  5IB0 A;  4CAW A;  1WK4 A;  4NEX A;  2ZW4 A;  5IX3 A;  2VZY A;  4L8A A;  1MJA A;  2D4P A;  1NE9 A;  2QEC A;  1XF8 A;  2PDO A;  1B87 A;  2ATR A;  2OZG A;  4CRZ B;  2PC1 A;  2Q7B A;  4QB9 A;  1L0C A;  4UA3 A;  3R9E A;  3R95 A;  5KTC A;  2VXK A;  4EVY A;  1S7N A;  1S60 A;  4MI4 A;  4IUS A;  4OAE A;  1KZF A;  5H86 A;  4B5O A;  4FD5 A;  3JVN A;  4YGO A;  3W6X A;  3NE7 A;  4I49 A;  4B5P A;  4KLV A;  4AG9 A;  2KCW A;  3FYN A; 
#chains in the Genus database with same CATH topology
 2ZPA A;  5GCN A;  3CXS A;  2OH1 A;  1Z4E A;  3FEE A;  2I3C A;  4NF1 A;  4R9M A;  2VZZ A;  5A28 A;  2C27 A;  1ZG8 A;  1RO5 A;  2POK A;  2PJ8 A;  3D8P A;  4IF5 A;  4R6T A;  3H8E A;  4Q36 A;  1ELM P;  3CXQ A;  2WPW A;  2ZEP A;  2DPS A;  3KI9 A;  4NGQ A;  4BD9 A;  3RZA A;  3VAR A;  2DPT A;  2G0B A;  1Z8T A;  4H2K A;  4MBU A;  5CPA A;  1TF8 A;  5AG7 A;  5EMI A;  1OZP A;  4ZX9 A;  1Y7E A;  4OP4 A;  1RXT A;  3BJ7 A;  4CAE A;  2ZEH A;  4MFP A;  4NGS A;  1Z9U A;  4P4E A;  3TO7 A;  1M4I A;  4A30 A;  2OB0 A;  5HMN A;  3PB7 X;  1Z4R A;  2BSW A;  4H6Z A;  4OAD A;  1R57 A;  3F5B A;  1LAN A;  2I79 A;  1QSN A;  4UFW A;  5JQ4 A;  5G20 A;  2ZEL A;  3S9N A;  4UBR A;  1BPN A;  5D8N A;  3GYA A;  2DF5 A;  3PB4 X;  2P6E A;  3IWW A;  3PP9 A;  2J8R A;  3S9M A;  1Z8L A;  4H6U A;  4MFK A;  5LYD A;  4CGM A;  2DEA A;  1IYL A;  3S9L A;  1P4N A;  2P0W A;  3SI2 A;  2ZEF A;  4UEE A;  1YQE A;  2AFZ A;  2J8N A;  2GE3 A;  1S7K A;  2FE7 A;  4QBJ A;  2XEJ A;  1LAP A;  3TOA A;  5CBM A;  1CP6 A;  3BHX A;  4CAV A;  2PE3 A;  4JD6 A;  4P6Y A;  4P44 A;  4MCS A;  1M44 A;  2PJ7 A;  4JWP A;  4HNW B;  4A38 A;  3TC8 A;  2B4B A;  3FXT A;  1NMT A;  2AFW A;  1N71 A;  2EVN A;  2HC9 A;  2PJ9 A;  2R98 A;  3D2M A;  4HNY B;  2B4D B;  3FMC A;  1Y0Y A;  1PUA A;  4KSI A;  4UCM A;  2AE6 A;  3D4U A;  5BWA B;  3IGR A;  4LX9 A;  2B5G B;  3IIB A;  4AVC A;  4F6A A;  3NH4 A;  1Q2C A;  2GFQ A;  4M6I A;  3CPX A;  1QMU A;  4MHY A;  4UIA A;  1UWY A;  1JQG A;  2REE A;  3K9T A;  1XEB A;  5F48 A;  4MFQ A;  2ZEE A;  1ARM A;  3IWE A;  3MGD A;  4M6H A;  5K8P A;  4PXE A;  2Q4Z A;  1ON0 A;  2JDC A;  5FVJ A;  1GHE A;  4AG7 A;  4MFL A;  4C2Z A;  1CBX A;  5H84 A;  3LAC A;  2ZEM A;  3BJ8 A;  3FH4 A;  2PCU A;  4GM5 A;  4KOV A;  4MHD A;  2NYQ A;  3ZZI A;  4A31 A;  5LRJ A;  1M1D A;  3SJX A;  2XEI A;  3K9U A;  4NFR A;  5C88 A;  3UY5 A;  2PJ5 A;  1ARL A;  1CJW A;  1LOK A;  2FIW A;  4QC6 A;  4RN7 A;  3WC7 A;  4ZI6 A;  2PJ2 A;  3KL9 A;  2F5I A;  4NGN A;  5AG4 A;  2ZW7 A;  4O23 A;  2PR8 A;  1PU9 A;  1TKH A;  3V38 A;  5E96 A;  3IC1 A;  1CPS A;  1HEE A;  4NGM A;  2PRQ A;  4ONW A;  4FWU A;  3WC5 A;  2J8M A;  2CNM A;  4KVM E;  1IY7 A;  4MHP A;  3MN8 A;  3EFA A;  4NJR A;  2PJ1 A;  4II9 A;  2B58 A;  4Q7A A;  2PJ4 A;  2BO9 A;  3TFY A;  4OKO A;  4MHN A;  3H4Q A;  4R87 A;  3PFE A;  3H5Z A;  1F2P A;  5G21 A;  1YR0 A;  4ZX8 A;  4PK2 A;  4CGL A;  2CTC A;  1I21 A;  3FEC A;  5KTD A;  1VHS A;  4KLW A;  4OIW A;  4G1P A;  4Z65 A;  4P45 A;  2PR1 A;  3HLP A;  5F09 A;  1LFW A;  2PJ6 A;  5I0C A;  2PVW A;  3ISX A;  3D68 A;  4NGP A;  1IU8 A;  4B6Z A;  3B3S A;  4KUA A;  4WWV A;  4C68 A;  5K8M A;  3E0K A;  3FIX A;  1YW4 A;  4YRH A;  4F0X A;  4U5Y A;  5HXD A;  1IYK A;  1PYT B;  2Z3P A;  2OZH A;  2BCO A;  1EE3 P;  5J8C A;  2HUZ A;  5ELY A;  3CT9 A;  2QJ8 A;  2CTB A;  4UFX A;  2Q43 A;  4YU9 A;  2ZXV A;  2Q7S A;  2RC4 A;  3S6G A;  4DNC A;  2Y0M A;  2VQY A;  2HB6 A;  4OC0 A;  3T8W A;  3CXP A;  4P4D A;  5KTA A;  3JUW A;  1QSO A;  4R3L A;  2PJC A;  2AFU A;  1CX8 A;  1MJ9 A;  3IU2 A;  3MRU A;  5AG6 A;  3L2N A;  1CG2 A;  4ZGY B;  2B3U A;  2J9A A;  3EC4 A;  1S5K A;  5J8F A;  5LYI A;  2CF4 A;  1SQH A;  1YW6 A;  4Y49 B;  2PVV A;  2R1I A;  4UCN A;  2B3V A;  1U6M A;  2CXA A;  2WZN A;  2JBK A;  3BI1 A;  1J4J A;  5I4M A;  2P6F A;  4CGP A;  4CYN A;  2BOA A;  1XOV A;  2O28 A;  4NSQ A;  3DSB A;  4OME A;  3T9Y A;  3NFZ A;  1Q7L A;  5G1Z A;  3H8G A;  4P4I A;  1FT7 A;  1YVO A;  4QVT A;  4MHZ A;  2BL1 A;  2PSW A;  3T90 A;  3SXO A;  3S6F A;  1LCP A;  3PFO A;  3BLN A;  5AG5 A;  4YFJ A;  3TO6 A;  4BMH A;  4P4F A;  4PK3 A;  5LRK A;  1YLE A;  4CYQ A;  3TE4 A;  1IOI A;  2NMT A;  1NSL A;  1I1D A;  2VEZ A;  3PGP A;  4R3K A;  4XPD B;  3TCV A;  4CGN A;  1ZLI A;  4CGO A;  3SJF A;  4C2X A;  5JGF A;  2VL1 A;  3B8G A;  4OID A;  2YNC C;  3TO9 A;  2F8H A;  5G22 A;  2Q44 A;  4E8O A;  4NJQ A;  2Z11 A;  3PB9 X;  1XMT A;  2FCK A;  4IK2 A;  1XFO A;  2Z10 A;  3TT2 A;  2I00 A;  3KHZ A;  1XE4 A;  2ZED A;  4JZ0 A;  4NGT A;  2OR4 A;  5EBV A;  3KR4 A;  3R9G A;  3DLJ A;  4KZT A;  1LRZ A;  4XPK A;  2VI7 A;  2BUE A;  4XNH B;  1TKJ A;  4KVX A;  1QSR A;  5D29 A;  2OOT A;  4MRI A;  2EBJ A;  5AGE A;  3B2Y A;  4AVA A;  4K30 A;  2PQ8 A;  2DXQ A;  2XEF A;  4OC4 A;  2QVP A;  3BXM A;  1S3Z A;  3W91 A;  4A32 A;  4C7H A;  4MY0 A;  3IO1 A;  2FVG A;  3K2K A;  2Q4Y A;  3PEI A;  4RS2 A;  1FY7 A;  3WR7 A;  5A27 A;  1VKC A;  4E0A A;  3IEH A;  2V77 A;  2V8D A;  4LQG A;  4QUS A;  1GYT A;  3SI0 A;  3DDD A;  1ZLH A;  4UIB A;  2R8V A;  4HKF A;  2ARH A;  1Y9K A;  3FF3 A;  2EUI A;  4F0Y A;  2JLM A;  4FD4 A;  3NE8 A;  4M6G A;  4U9Y A;  3OWC A;  1TIQ A;  1Z5R A;  5EC4 A;  3SI1 A;  4B5P B;  2AFO A;  1P0H A;  3S6H A;  2FS5 A;  1V0C A;  1F57 A;  2BEI A;  2IQ6 A;  2Z3L A;  3LMS A;  5DS0 A;  4F8Z A;  5K8O A;  5DWN A;  2IL4 A;  4UWI A;  4U9Z A;  2EWB A;  2GAN A;  2YNE A;  4WJB A;  3GIU A;  2K5T A;  4FD6 A;  2Q51 A;  4CYP A;  4BIN A;  5JH9 A;  4C7I A;  1BO4 A;  3IU1 A;  4P10 A;  1ZG9 A;  1YGH A;  1DTD A;  3JRU A;  2AFX A;  4RI1 A;  4A37 A;  3RNZ A;  5ISV A;  3TOB A;  4IHM A;  2Z3N A;  2V8G A;  3SXN A;  1KUX A;  4Q38 A;  3EO4 A;  4MFJ A;  2YND A;  3R1K A;  4ORF A;  2CNT A;  3FJU A;  4KOY A;  2RB7 A;  3QB8 A;  3VWD A;  1AUG A;  3RBU A;  4MCP A;  2Z3M A;  2G9D A;  4UCP A;  2IMO A;  1CP7 A;  3GB0 A;  4M85 A;  4EWT A;  1I12 A;  4H89 A;  3RYO A;  5HH1 A;  3DR8 A;  4B11 A;  2CY2 A;  3D3S A;  1X12 A;  2XEG A;  3PBE A;  2FL4 A;  3P2H A;  5F49 A;  1Y0R A;  4E2A A;  2C6G A;  4P4B A;  4AVB A;  2O53 A;  2V8V A;  1XIX A;  4KOX A;  1A2Z A;  1NSA A;  3N7Z A;  3G8W A;  1MJB A;  2ZOF A;  2ODF A;  3LWU A;  2Q0Y A;  4CAF A;  1BAV A;  1AMP A;  3SJG A;  3TTH A;  2FSR A;  4A33 A;  3B3V A;  4MY3 A;  4X5K A;  3BI0 A;  4R8F A;  4F9V A;  1CPX A;  2AFM A;  2Q4V A;  3EXN A;  3PBB A;  2AJ6 A;  2EK8 A;  3TX8 A;  4JXQ A;  4FUU A;  4PSX A;  4Y49 C;  2Q04 A;  1OBR A;  1Y7R A;  1KUY A;  3CPA A;  4TNU A;  1HDU A;  4ZBG A;  3R96 A;  3PB6 X;  4NXY A;  3RAM A;  3SHP A;  3QNV A;  4CS0 B;  1S7F A;  3NH8 A;  3D7F A;  5DWM A;  4AB7 A;  1KUV A;  1Q2D A;  3FB3 A;  3WAB A;  2JEW A;  3KGQ A;  2B4D A;  2WPX A;  2QML A;  3D7D A;  2YNC A;  2HV2 A;  3B3T A;  3B7I A;  2JDD A;  1YK3 A;  2B5G A;  3FX6 A;  4L89 A;  1KWM A;  1CM0 A;  3SJE A;  2AFS A;  2ABZ A;  2OZU A;  3G3S A;  2OU2 A;  4MFZ A;  4ZY0 A;  3FED A;  2GRE A;  2ZEN A;  1ZO0 A;  2EO8 A;  3FNC A;  4UFV A;  4EFD A;  3W6S A;  1VHE A;  2QIR A;  4R7M A;  1BLL E;  2WSA A;  4KOT A;  4OC5 A;  3C26 A;  3KZW A;  3RO0 A;  1RTQ A;  1TXR A;  1IOF A;  4J3G A;  4CAX A;  3N5F A;  1BOB A;  1MK4 A;  4CRY B;  3GLJ A;  3GY9 A;  2REF A;  3B3W A;  4PXC A;  4XPD C;  3KQX A;  4MCR A;  5IV0 A;  4IAV A;  3WT4 A;  3VWE A;  1VHO A;  1M4G A;  3R9F A;  2PJ3 A;  3F0A A;  3QAH A;  4PSW A;  3GKR A;  3IJ3 A;  4GS4 A;  4ZY1 A;  1K4J A;  1M4D A;  4B14 A;  5CNP A;  2PRB A;  4JXR A;  4K3N A;  3ZJ0 A;  4XNH C;  3I1U A;  2PJA A;  1Z8W A;  5JPH A;  4KOR A;  2GIV A;  2JEV A;  5HVH A;  3DR6 A;  3LOD A;  4RUH A;  4B13 A;  1S7L A;  4FBE A;  4OC1 A;  1YVK A;  2CIJ A;  3NH5 A;  1XBU A;  1XMB A;  2D4O A;  3GUX A;  4KOU A;  3V8I A;  2FT0 A;  4W9Y A;  4C2Y A;  4OC3 A;  2Z3O A;  3S6K A;  4HNX B;  5F46 A;  1YX0 A;  5F47 A;  1Z8X A;  2ZW6 A;  1AYE A;  4AXV A;  4B10 A;  3DNS A;  2Z3K A;  4DUK A;  1Q2Y A;  1M4L A;  3D7H A;  3PZJ A;  1YME A;  3FBU A;  3P2F A;  1TF9 A;  3B35 A;  3NA6 A;  4F9U A;  2ZW5 A;  3A9L A;  3KKW A;  4KSF A;  4OC2 A;  2X7B A;  4LUA A;  5C82 A;  2G3A A;  4M3S A;  1Y9W A;  1YSJ A;  2H5M A;  4PV6 A;  4ONU A;  4LQ6 A;  1YRE A;  1IIC A;  1JWQ A;  4FD7 A;  3I9S A;  1DE4 C;  1H8L A;  3IWG A;  3LD2 A;  2YGW A;  4OLL A;  4R76 A;  3D66 A;  1UFH A;  1IGB A;  1F2O A;  4P4J A;  2EK9 A;  3KHX A;  4R57 A;  2NSM A;  2P6G A;  4PXD A;  4KUB A;  3H8F A;  3D67 A;  2WUU A;  5K8N A;  2FXF A;  2PIZ A;  3QAY A;  4NGR A;  5HVF A;  4NCZ A;  4FAI A;  2C6C A;  4KOW A;  1ZG7 A;  2A4N A;  2PIY A;  3I3G A;  4A95 A;  3EY5 A;  1XRY A;  2RFH A;  3D7G A;  4BBH A;  1IID A;  2C1C A;  2CNS A;  2Z0Z A;  3FRM A;  1YLO A;  2F7V A;  4PXB A;  8CPA A;  1QST A;  1IB1 E;  4UWJ A;  2FIA A;  3V7Z A;  2IJZ A;  2JBJ A;  2QYV A;  4JLY A;  1WWZ A;  3PB8 X;  4X3R A;  3KR5 A;  1VIX A;  5LYF A;  1QSM A;  3KQZ A;  3D2P A;  1BPM A;  4MJ8 A;  3FVL A;  3F8K A;  4KOS A;  1R3N A;  4X2T A;  2PJ0 A;  2R7H A;  4KVO E;  4A39 A;  2G3T A;  3CDX A;  3DGV A;  4KS9 A;  2VBQ A;  1B6B A;  7CPA A;  4CYO A;  4A2Z A;  4KSA A;  5HVG A;  2GU2 A;  1LAM A;  4XPL A;  2ANP A;  5LRG A;  2HQY A;  3PRT A;  4JJX A;  5IB0 A;  4CAW A;  1WK4 A;  4NEX A;  4DJL A;  1HDQ A;  2PJB A;  1FNO A;  2ZW4 A;  2V8H A;  5IX3 A;  2GLF A;  2ZOG A;  1XJO A;  6CPA A;  1PCA A;  2VZY A;  4L8A A;  1TKF A;  5LYL A;  1MJA A;  2D4P A;  1NE9 A;  2QEC A;  4TWE A;  1ELL P;  4X8I A;  1XF8 A;  2PDO A;  1B87 A;  3CZX A;  2ATR A;  3VAT A;  4ZYQ A;  2C6P A;  5IB9 A;  2WYR A;  2ZEG A;  3WC6 A;  2OZG A;  4UEF A;  4CRZ B;  4MMO A;  4MXU A;  1X10 A;  2GLJ A;  2PC1 A;  4EME A;  2Q7B A;  4QB9 A;  4UEZ A;  1L0C A;  4UA3 A;  3R9E A;  4HPS A;  3R95 A;  3KAS A;  4GXH A;  5KTC A;  4PQA A;  3VH9 A;  2VXK A;  2O4H A;  4EVY A;  1S7N A;  1S60 A;  4MI4 A;  4UF4 A;  1QQ9 A;  4ZY2 A;  4B12 A;  2ZEO A;  4IUS A;  5J1Q A;  4YWY A;  4OAE A;  1KZF A;  5H86 A;  4B5O A;  4FD5 A;  5JM6 A;  3JVN A;  4CPA A;  4DYO A;  1VGY A;  4YGO A;  5THW A;  3HUV A;  3NE7 A;  3B3C A;  4I49 A;  3W6X A;  3IFE A;  4A94 A;  4PPZ A;  4B5P A;  3ISZ A;  4KLV A;  4JYW A;  4AG9 A;  1Z2L A;  2KCW A;  4MCQ A;  3FYN A;  3JTK A;  1R43 A; 
#chains in the Genus database with same CATH homology
 2ZPA A;  5GCN A;  3CXS A;  2OH1 A;  1Z4E A;  4NF1 A;  5A28 A;  4R9M A;  2VZZ A;  2C27 A;  1RO5 A;  3D8P A;  4IF5 A;  4Q36 A;  3CXQ A;  2WPW A;  2DPS A;  2DPT A;  2G0B A;  4MBU A;  5AG7 A;  1OZP A;  1RXT A;  3BJ7 A;  4CAE A;  4MFP A;  1Z9U A;  3TO7 A;  1M4I A;  4A30 A;  2OB0 A;  5HMN A;  4H6Z A;  1Z4R A;  2BSW A;  4OAD A;  1R57 A;  3F5B A;  2I79 A;  1QSN A;  4UFW A;  5JQ4 A;  5G20 A;  4UBR A;  3GYA A;  2P6E A;  3PP9 A;  2J8R A;  4H6U A;  4MFK A;  4CGM A;  1IYL A;  1P4N A;  2P0W A;  2J8N A;  2GE3 A;  1S7K A;  2FE7 A;  4QBJ A;  3TOA A;  4CAV A;  4JD6 A;  1M44 A;  4JWP A;  4HNW B;  2B4B A;  3FXT A;  1NMT A;  2R98 A;  1N71 A;  2EVN A;  3D2M A;  4HNY B;  2B4D B;  1PUA A;  4UCM A;  2AE6 A;  5BWA B;  3IGR A;  4LX9 A;  2B5G B;  4F6A A;  4AVC A;  1Q2C A;  2REE A;  1XEB A;  5F48 A;  4MFQ A;  3IWE A;  3MGD A;  1ON0 A;  2JDC A;  5FVJ A;  1GHE A;  4AG7 A;  4MFL A;  4C2Z A;  5H84 A;  3BJ8 A;  4KOV A;  4MHD A;  3ZZI A;  4A31 A;  1M1D A;  3K9U A;  5C88 A;  3UY5 A;  1CJW A;  2FIW A;  4QC6 A;  2F5I A;  5AG4 A;  2ZW7 A;  2PR8 A;  1PU9 A;  5E96 A;  2J8M A;  2CNM A;  4KVM E;  3EFA A;  4II9 A;  2B58 A;  3TFY A;  3H4Q A;  4R87 A;  3H5Z A;  5G21 A;  1YR0 A;  4CGL A;  4PK2 A;  1I21 A;  5KTD A;  1VHS A;  4KLW A;  2PR1 A;  5I0C A;  4KUA A;  4C68 A;  3E0K A;  3FIX A;  4YRH A;  4F0X A;  4U5Y A;  1IYK A;  2Z3P A;  2OZH A;  5J8C A;  2HUZ A;  4UFX A;  4DNC A;  2ZXV A;  2RC4 A;  3S6G A;  2Y0M A;  2VQY A;  3CXP A;  5KTA A;  3JUW A;  1QSO A;  4R3L A;  1MJ9 A;  3IU2 A;  5AG6 A;  4ZGY B;  2B3U A;  3EC4 A;  1S5K A;  5J8F A;  1SQH A;  4Y49 B;  2R1I A;  4UCN A;  2B3V A;  1U6M A;  2CXA A;  1J4J A;  2P6F A;  4CGP A;  4CYN A;  2O28 A;  4NSQ A;  3DSB A;  3T9Y A;  5G1Z A;  1YVO A;  4QVT A;  2BL1 A;  2PSW A;  3T90 A;  3SXO A;  3S6F A;  3BLN A;  5AG5 A;  4YFJ A;  3TO6 A;  4BMH A;  4PK3 A;  1YLE A;  4CYQ A;  3TE4 A;  2NMT A;  1NSL A;  1I1D A;  2VEZ A;  3PGP A;  4R3K A;  4XPD B;  3TCV A;  4CGN A;  4CGO A;  4C2X A;  3B8G A;  2YNC C;  3TO9 A;  5G22 A;  2Q44 A;  4E8O A;  2Z11 A;  1XMT A;  2FCK A;  2Z10 A;  3TT2 A;  2I00 A;  1XE4 A;  5EBV A;  3R9G A;  4KZT A;  1LRZ A;  4XPK A;  2VI7 A;  2BUE A;  4XNH B;  4KVX A;  1QSR A;  5AGE A;  4AVA A;  4K30 A;  2PQ8 A;  2DXQ A;  3W91 A;  4C7H A;  1S3Z A;  4A32 A;  4MY0 A;  2Q4Y A;  4RS2 A;  1FY7 A;  3WR7 A;  5A27 A;  1VKC A;  4E0A A;  4QUS A;  3DDD A;  2R8V A;  4HKF A;  2ARH A;  1Y9K A;  4F0Y A;  2EUI A;  2JLM A;  4FD4 A;  4U9Y A;  5EC4 A;  3OWC A;  1TIQ A;  4B5P B;  1P0H A;  3S6H A;  2FS5 A;  1V0C A;  2BEI A;  2Z3L A;  5DWN A;  2IL4 A;  4UWI A;  4U9Z A;  2GAN A;  2YNE A;  2K5T A;  4FD6 A;  4CYP A;  4C7I A;  1BO4 A;  3IU1 A;  1YGH A;  4RI1 A;  5ISV A;  3TOB A;  2Z3N A;  3SXN A;  1KUX A;  4Q38 A;  3EO4 A;  4MFJ A;  2YND A;  3R1K A;  4ORF A;  2CNT A;  4KOY A;  3QB8 A;  3VWD A;  2Z3M A;  4UCP A;  4M85 A;  1I12 A;  4H89 A;  3RYO A;  5HH1 A;  3DR8 A;  4B11 A;  2CY2 A;  3D3S A;  2FL4 A;  3P2H A;  5F49 A;  4E2A A;  4AVB A;  1XIX A;  4KOX A;  3N7Z A;  3G8W A;  1MJB A;  2Q0Y A;  4CAF A;  3TTH A;  2FSR A;  4A33 A;  4MY3 A;  4X5K A;  2Q4V A;  3EXN A;  2AJ6 A;  4JXQ A;  4PSX A;  4Y49 C;  2Q04 A;  4ZBG A;  1Y7R A;  1KUY A;  3R96 A;  4NXY A;  3SHP A;  4CS0 B;  1S7F A;  5DWM A;  4AB7 A;  1KUV A;  1Q2D A;  3FB3 A;  2B4D A;  2WPX A;  2QML A;  2YNC A;  2HV2 A;  2JDD A;  1YK3 A;  2B5G A;  4L89 A;  1CM0 A;  3G3S A;  4MFZ A;  2OZU A;  2OU2 A;  1ZO0 A;  3FNC A;  4UFV A;  3W6S A;  2QIR A;  2WSA A;  4KOT A;  3C26 A;  4J3G A;  4CAX A;  1BOB A;  1MK4 A;  4CRY B;  3GY9 A;  2REF A;  4XPD C;  5IV0 A;  3VWE A;  1M4G A;  3R9F A;  3F0A A;  3QAH A;  4PSW A;  3GKR A;  4GS4 A;  1K4J A;  1M4D A;  4B14 A;  5CNP A;  2PRB A;  4JXR A;  3ZJ0 A;  4XNH C;  5JPH A;  4KOR A;  2GIV A;  2JEV A;  3DR6 A;  3LOD A;  4B13 A;  1S7L A;  1YVK A;  2D4O A;  4KOU A;  3V8I A;  2FT0 A;  4C2Y A;  5F46 A;  2Z3O A;  3S6K A;  4HNX B;  1YX0 A;  5F47 A;  2ZW6 A;  4B10 A;  3DNS A;  2Z3K A;  1Q2Y A;  3PZJ A;  3FBU A;  3P2F A;  2ZW5 A;  3A9L A;  3KKW A;  4KSF A;  5C82 A;  2X7B A;  4LUA A;  2G3A A;  4M3S A;  1Y9W A;  2H5M A;  4PV6 A;  4ONU A;  1YRE A;  1IIC A;  4FD7 A;  3I9S A;  3IWG A;  3LD2 A;  2YGW A;  4OLL A;  1UFH A;  4R57 A;  2P6G A;  4KUB A;  2WUU A;  2FXF A;  4NCZ A;  4KOW A;  2A4N A;  3I3G A;  4A95 A;  4BBH A;  3EY5 A;  1IID A;  3FRM A;  2CNS A;  2Z0Z A;  1QST A;  1IB1 E;  4UWJ A;  2FIA A;  4JLY A;  1WWZ A;  1QSM A;  3D2P A;  4MJ8 A;  3F8K A;  4KOS A;  2R7H A;  4KVO E;  2G3T A;  4KS9 A;  2VBQ A;  1B6B A;  4CYO A;  4A2Z A;  4KSA A;  4XPL A;  2HQY A;  4JJX A;  5IB0 A;  4CAW A;  1WK4 A;  4NEX A;  2ZW4 A;  5IX3 A;  2VZY A;  4L8A A;  1MJA A;  2D4P A;  1NE9 A;  2QEC A;  1XF8 A;  2PDO A;  1B87 A;  2ATR A;  2OZG A;  4CRZ B;  2PC1 A;  2Q7B A;  4QB9 A;  1L0C A;  4UA3 A;  3R9E A;  3R95 A;  5KTC A;  2VXK A;  4EVY A;  1S7N A;  1S60 A;  4MI4 A;  4B12 A;  4IUS A;  4OAE A;  1KZF A;  5H86 A;  4B5O A;  4FD5 A;  3JVN A;  4YGO A;  3W6X A;  3NE7 A;  4I49 A;  4B5P A;  4KLV A;  4AG9 A;  2KCW A;  3FYN A;  3JTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...