4MBUA

Crystal structure of n-acetyltransferase from staphylococcus aureus mu50
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
165
structure length
165
Chain Sequence
SNAMIRCAKKEDLNAILAIYNDAIINTTAVYTYKPQTIDERIAWFETKQRNHEPIFVFEENGSVLGFATFGSFRPWPAYQYTIEHSIYVDASARGKGIASQLLQRLIVEAKAKGYRTLVAGIDASNEASIKLHQKFNFKHAGTLTNVGYKFDYWLDLAFYELDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of a Gcn5-related N-acetyltransferase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
molecule keywords Similar to N-acetyltransferase
total genus 48
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mbuA00
4R9MA 4PSWA 1I12A 1MJ9A 3EO4A 4IF5A 2B4DA 3EFAA 4UA3A 4B5OA 4DNCA 2WPXA 1S7FA 4NF1A 2QMLA 5KTDA 4E8OA 1B87A 2B5GA 4JWPA 3TO9A 1K4JA 4I49A 1IIDA 4X5KA 3H4QA 4KORA 5J8FA 1WK4A 5EBVA 2O28A 2HV2A 4CAVA 4QUSA 1M1DA 3DR6A 4AG7A 3FXTA 3LD2A 5HMNA 4J3GA 3FBUA 2REFA 4R3KA 4CAWA 4L89A 4HKFA 3S6KA 3VWEA 1NMTA 4ONUA 3RYOA 4H6ZA 2JDDA 2B4DB 2AJ6A 1VKCA 4KUBA 4UWJA 2FXFA 5EC4A 4YGOA 2Z0ZA 2R1IA 3EY5A 5JPHA 1YK3A 1YR0A 2VXKA 4QC6A 4F0YA 5C82A 3TO6A 4PV6A 1QSRA 1MJAA 4XPLA 3IWGA 1S7LA 3GKRA 2J8NA 1KUVA 1I1DA 2FE7A 5E96A 1MJBA 4F6AA 3GYAA 1LRZA 3E0KA 5F47A 2EUIA 3TE4A 1RXTA 5DWNA 1P4NA 2JLMA 3DNSA 1Z9UA 4NCZA 3JVNA 1NSLA 2R7HA 1Q2YA 5F48A 4PK3A 2EVNA 5KTAA 2AE6A 1M4DA 3TCVA 4L8AA 4KUAA 3TTHA 2FS5A 2VEZA 1PU9A 4NSQA 1GHEA 4OADA 4XPDB 3CXPA 1FY7A 2PDOA 5CNPA 3D3SA 2H5MA 3R1KA 5JQ4A 4EVYA 2OZGA 4CRZB 4AG9A 2Q0YA 4YRHA 4B5PB 2ZW7A 1VHSA 4JXRA 2Q7BA 2PR8A 2OB0A 1YREA 4R87A 3JUWA 3TT2A 2CY2A 2CNMA 4II9A 2JDCA 2DXQA 4NEXA 1QSTA 2FL4A 3R95A 1XMTA 2PSWA 3G8WA 2ARHA 5IV0A 3BLNA 1M44A 3V8IA 1M4IA 2I00A 4QVTA 3N7ZA 3K9UA 1S7KA 3G3SA 4HNWB 3SHPA 3ZZIA 1R57A 2R98A 5IX3A 1BO4A 4H89A 1I21A 2A4NA 3B8GA 1Y9WA 2FT0A 1IB1E 4HNYB 2B3VA 1QSOA 2FSRA 4LX9A 4XNHB 5ISVA 5HH1A 3TOBA 3WR7A 1PUAA 1Q2CA 4KOYA 3NE7A 2Z11A 2OH1A 1CJWA 2QECA 1Q2DA 3I9SA 4IUSA 2WPWA 3P2HA 3SXNA 1QSMA 3LODA 1N71A 2IL4A 3BJ7A 3UY5A 4K30A 1QSNA 4NXYA 1XE4A 4Y49C 1XF8A 3KKWA 1J4JA 2R8VA 2PQ8A 4CRYB 3C26A 4XPDC 2JEVA 4M85A 4U5YA 3FYNA 2J8MA 2D4OA 5F46A 3F8KA 1Y7RA 2ZW6A 2PR1A 4KLWA 3W6XA 5I0CA 1MK4A 2VBQA 4RS2A 2KCWA 3R9EA 1S3ZA 2Z10A 1Z4RA 4FD4A 3FRMA 1IICA 4GS4A 3W91A 4KLVA 3D8PA 4AVCA 4ZBGA 2ZW4A 1Y9KA 2I79A 5IB0A 2P6GA 4KVME 1S7NA 4QB9A 4KVXA 4AVAA 3P2FA 1OZPA 2REEA 1YVKA 2Q04A 2RC4A 3GY9A 2C27A 4FD5A 4E0AA 1KUXA 3FNCA 4MY3A 3OWCA 3PP9A 5F49A 1ON0A 4KOXA 5H86A 4JJXA 4KOWA 2K5TA 3F5BA 4M3SA 2G3TA 2OU2A 2VZZA 4OAEA 4MY0A 3FIXA 4QBJA 4R57A 4PK2A 3PGPA 1TIQA 3T90A 3DDDA 4E2AA 2ZW5A 3VWDA 3CXSA 1YLEA 5KTCA 1KUYA 1U6MA 4XPKA 2OZUA 1S5KA 4KOVA 2P0WA 4UBRA 4FD6A 4OLLA 4PSXA 1WWZA 3EC4A 2B3UA 1YGHA 4FD7A 2Y0MA 4BMHA 2GE3A 4U9YA 3IGRA 5C88A 1Z4EA 3R96A 2VQYA 4AB7A 2FIWA 2FIAA 3S6GA 4MHDA 1IYKA 2ZPAA 1V0CA 4UWIA 4RI1A 3QAHA 4YFJA 5DWMA 2G0BA 2HQYA 1XIXA 2PRBA 3D2MA 2CNTA 3R9GA 5FVJA 1CM0A 4CAXA 3R9FA 3EXNA 4U9ZA 4H6UA 2GANA 4R3LA 3DSBA 4KVOE 2P6FA 4KZTA 1XEBA 2NMTA 4KOTA 2Q4VA 3ZJ0A 1SQHA 2PC1A 3F0AA 2VI7A 2BL1A 2ZXVA 3FB3A 2CNSA 4XNHC 2FCKA 2X7BA 1M4GA 4KOSA 5J8CA 2GIVA 3D2PA 4LUAA 3BJ8A 3TO7A 2F5IA 2J8RA 3S6FA 1S60A 2BUEA 3TOAA 4JXQA 3CXQA 1YX0A 3TFYA 3S6HA 1L0CA 3QB8A 4KOUA 3PZJA 4MJ8A 1P0HA 2Q44A 3T9YA 4MI4A 2BEIA 2BSWA 2D4PA 5H84A 2P6EA 4MBUA 2QIRA 2G3AA 2ATRA 2B5GB 4ORFA 1KZFA 5GCNA 1BOBA 2Q4YA 3SXOA 1NE9A 4JD6A 2VZYA 3MGDA 1YVOA 1RO5A 4CS0B 4Y49B 1IYLA 2HUZA 2OZHA 3I3GA 4B5PA 4JLYA 4HNXB 1UFHA 2B4BA 2B58A 3DR8A 3W6SA 1B6BA 4AVBA
chains in the Genus database with same CATH superfamily
4UIAA 4R9MA 4PSWA 2POKA 1I12A 1MJ9A 1TKHA 1VHEA 1BAVA 3EO4A 3NH5A 2B4DA 3EFAA 4IF5A 3IWEA 4UA3A 4B5OA 4EWTA 4Z65A 4DNCA 2PVWA 2WPXA 5CPAA 3MN8A 1IGBA 1Y0YA 4K3NA 3JTKA 1S7FA 3BHXA 4NGNA 2IMOA 4NF1A 2QMLA 5KTDA 2Z3PA 4E8OA 4CYNA 1B87A 2B5GA 3NFZA 4JWPA 2HC9A 3TO9A 4PPZA 1K4JA 3HUVA 4MHYA 4I49A 2ODFA 4ONWA 1IIDA 4X5KA 2ZEDA 1AMPA 2NYQA 3H4QA 4MHZA 4KORA 5J8FA 1WK4A 3D7GA 5EBVA 2O28A 2HV2A 3IO1A 3KHXA 4QUSA 1M1DA 3DR6A 3PB8X 4RN7A 3FXTA 3B3SA 1FT7A 3K9TA 3LD2A 5EMIA 4AG7A 2ZEFA 4DYOA 2JBJA 3GIUA 3IC1A 1CPXA 2PJ5A 1XBUA 3FECA 4J3GA 4KSAA 3FBUA 4PXEA 2REFA 5D29A 4R3KA 8CPAA 4CAWA 1XMBA 4L89A 1BPMA 5I4MA 4FAIA 5HMNA 1IOFA 4HKFA 3S6KA 3VWEA 2XEIA 4MXUA 1NMTA 2FVGA 4ONUA 3RYOA 2ABZA 4MHPA 4H6ZA 2JDDA 2B4DB 3PB4X 2AJ6A 2V8HA 1YQEA 1CX8A 1VKCA 3PEIA 4KUBA 2I3CA 1X12A 4UWJA 4B6ZA 4NGMA 5AG6A 2FXFA 5EC4A 4MCSA 4YGOA 2Z0ZA 2CF4A 2R1IA 3EY5A 4NGQA 5JPHA 1YK3A 1YR0A 4UIBA 2EBJA 2VXKA 4QC6A 2GLFA 4F0YA 5JH9A 5C82A 3TO6A 3I1UA 4PV6A 3MRUA 1QSRA 3B3VA 4F9VA 2AFSA 1MJAA 2EK9A 4MFZA 4XPLA 4UCMA 2OR4A 5LRJA 3IWGA 1S7LA 2BCOA 3FH4A 3GKRA 4PXCA 2Z3OA 2J8NA 1VIXA 1KUVA 2YNCC 4H2KA 3LWUA 1I1DA 2FE7A 4OC1A 5A28A 4X8IA 1CG2A 5E96A 1MJBA 3KL9A 4F6AA 3GYAA 4ZY0A 5HVHA 2PJ9A 1LRZA 4CGOA 3E0KA 4MRIA 3WT4A 4CGLA 5F47A 4BD9A 2V77A 2EUIA 4CGNA 5AG4A 3TE4A 4P4BA 3SJFA 4PXBA 2C6GA 3BXMA 1XRYA 4NJRA 1RTQA 3DLJA 1RXTA 3KR5A 5D8NA 5DWNA 4A30A 4TWEA 1P4NA 4C2XA 2YGWA 3DGVA 2V8GA 2JLMA 4ZX9A 3GUXA 2AFWA 3DNSA 4P45A 1Z9UA 3NH4A 4NCZA 3JVNA 1GYTA 2Q51A 1HDUA 1TF8A 1NSLA 2R7HA 1Q2YA 3A9LA 5F48A 4PK3A 2EVNA 4A37A 5KTAA 1ARLA 1NSAA 2AE6A 3LACA 1TKFA 4R6TA 4WJBA 1M4DA 3TCVA 4L8AA 2NSMA 3RNZA 4KUAA 3K2KA 3S9LA 2XEFA 3WC7A 3TTHA 2PJ3A 2FS5A 4FWUA 4CAVA 4MCQA 2VEZA 2Z3NA 5JGFA 4O23A 3PBBA 1PU9A 3WC5A 4UCPA 4GM5A 4NSQA 1GHEA 4OADA 4CGMA 4XPDB 2DEAA 3B7IA 4MMOA 1ARMA 4MHNA 4CYPA 1YMEA 2DPTA 2F7VA 2ZENA 1ELMP 3CXPA 3IWWA 4WWVA 1OBRA 4B14A 1FY7A 2PDOA 4GXHA 2PJBA 5CNPA 3GB0A 2JEWA 2XEGA 2V8DA 2PVVA 3D3SA 4W9YA 2H5MA 3R1KA 5JQ4A 2Z3MA 3PB9X 4EVYA 2OZGA 3KASA 4OMEA 4CRZB 1F57A 5ELYA 4AG9A 1IU8A 2Q0YA 4YRHA 3V38A 2ZW7A 4B5PB 5HVGA 5G20A 1ZO0A 1VHSA 6CPAA 1QMUA 2WYRA 5DS0A 4UCNA 2CTCA 4CAFA 4IHMA 4JXRA 1R43A 2PR8A 2Q7BA 5LYLA 4OC0A 2OB0A 1YREA 3KR4A 3NH8A 4R87A 2Z3KA 3JUWA 4M6IA 3TT2A 2CY2A 2CNMA 4II9A 3H8EA 2JDCA 2DXQA 1BPNA 4NEXA 3BI1A 1QSTA 3H5ZA 2FL4A 4P4FA 3R95A 1XMTA 2PSWA 2RFHA 2ARHA 3G8WA 3IU1A 3BLNA 4X2TA 5IV0A 4CPAA 4C2YA 2PJ1A 1M44A 2QJ8A 3V8IA 4Q36A 1M4IA 3QNVA 3V7ZA 2I00A 4QVTA 4MFPA 2VL1A 1YSJA 2IJZA 3N7ZA 3K9UA 1S7KA 3G3SA 4HNWB 3RAMA 5LYDA 3SHPA 3ZZIA 1CP6A 1F2PA 4JYWA 4OC4A 1R57A 2PIYA 5G1ZA 2R98A 4M6GA 1Z8LA 5IX3A 1BO4A 3FF3A 4H89A 1I21A 2PJCA 2A4NA 3B8GA 1Y9WA 2FT0A 1IB1E 3KZWA 4HNYB 2B3VA 4A31A 1TKJA 3FX6A 3FEEA 1Q7LA 1Z8XA 4UEEA 2C6CA 4MCPA 1QSOA 2FSRA 4LX9A 4XNHB 5ISVA 5HH1A 3TOBA 3S9NA 1HDQA 3WR7A 1LAPA 1PUAA 1ZG8A 1JQGA 3D7HA 4BBHA 3GLJA 5LRKA 1Q2CA 1A2ZA 2DF5A 3TX8A 3S9MA 4KOYA 3WABA 3NA6A 3NE7A 2WUUA 4DUKA 2Z11A 2OH1A 1CJWA 2QECA 1Q2DA 3D7FA 3I9SA 4IUSA 1JWQA 2ZELA 2WPWA 1AUGA 3P2HA 1VGYA 2GREA 3SXNA 1QSMA 1FNOA 2HB6A 3FJUA 3LODA 1N71A 2IL4A 3CPAA 3BJ7A 4P4JA 3UY5A 2ZOGA 4K30A 4LQ6A 5AG7A 4P44A 1QSNA 2O4HA 3D7DA 4OC3A 4F0XA 4NXYA 1XE4A 4Y49C 1XF8A 3KKWA 4R76A 2WZNA 1DE4C 1J4JA 4ZYQA 4B11A 2PJ7A 3PFEA 2R8VA 1ZG9A 2ZEHA 2PQ8A 5AG5A 2PE3A 3C26A 4CRYB 1HEEA 4OKOA 4XPDC 2JEVA 4ZGYB 3D68A 4YU9A 4M85A 4U5YA 3PFOA 3FYNA 4IK2A 2J8MA 2D4OA 4B13A 4F8ZA 4KS9A 5F46A 2ZEMA 3F8KA 3VATA 1Y7RA 2ZW6A 2PR1A 4FUUA 4KLWA 4NFRA 2F8HA 4Q7AA 4C7IA 2EK8A 3W6XA 5I0CA 3H8GA 1KWMA 2AFXA 1MK4A 1PCAA 4OP4A 2VBQA 2YNEA 4RS2A 4ZY2A 1XFOA 2KCWA 5G22A 3R9EA 1S3ZA 2Z10A 1Z4RA 1XJOA 3FRMA 1ELLP 3HLPA 4FD4A 2Q43A 1IICA 4GS4A 4KSFA 3W91A 3NE8A 4KLVA 1Y0RA 5CBMA 3FVLA 3D8PA 4AVCA 3VH9A 4ZBGA 5J1QA 4OC2A 2ZW4A 2Q7SA 1UWYA 1Y9KA 1YW6A 1AYEA 1Z2LA 2I79A 5IB0A 2C1CA 2OOTA 2AFOA 5JM6A 5K8NA 3N5FA 1TXRA 2PCUA 2P6GA 4KVME 1S7NA 4QB9A 4KSIA 4KVXA 4AVAA 3P2FA 2IQ6A 1OZPA 2REEA 1YVKA 3KQXA 4NGSA 1Y7EA 2Q04A 4ZY1A 2PJ4A 3RO0A 2RC4A 2CTBA 5LRGA 3GY9A 3KHZA 2C27A 4UFWA 3PBEA 3CDXA 1TF9A 1KUXA 4FD5A 4E0AA 5HVFA 2DPSA 3FNCA 3RZAA 3CZXA 3CPXA 3KGQA 4CGPA 3B35A 4MY3A 3OWCA 3PP9A 5F49A 5HXDA 1ON0A 2YNCA 2CXAA 1YLOA 4CYOA 5K8OA 4A39A 4KOXA 4P4IA 4B12A 4MFQA 4OIDA 4NJQA 5H86A 4JJXA 4KOWA 2K5TA 3F5BA 4M3SA 2CIJA 2G3TA 2QVPA 3SI1A 2OU2A 4MCRA 1LFWA 2VZZA 1ZLHA 4PXDA 3ISZA 1IY7A 1EE3P 4OAEA 3B2YA 2PIZA 2WSAA 3ISXA 4MY0A 3FIXA 4QBJA 4R57A 5IB9A 4LQGA 5LYFA 4CYQA 4PK2A 3PGPA 1TIQA 2ZEGA 3T90A 3DDDA 5AGEA 4E2AA 2ZW5A 4NGRA 3VWDA 3CXSA 1YLEA 5KTCA 5G21A 7CPAA 1KUYA 4B10A 1U6MA 3QAYA 4XPKA 3SI0A 2OZUA 1S5KA 4P4EA 1CP7A 4P6YA 4AXVA 4KOVA 2P0WA 4DJLA 1IOIA 2Q4ZA 4UBRA 2V8VA 4FD6A 1ZLIA 4NGTA 4OLLA 4PSXA 1WWZA 3TC8A 2QYVA 4UFXA 2Z3LA 5A27A 3EC4A 2B3UA 1YGHA 4P10A 4FD7A 1BLLE 4A94A 2Y0MA 4BMHA 2GE3A 4U9YA 3IGRA 2AFUA 2C6PA 4NGPA 4OC5A 3VARA 4RUHA 5C88A 1Z4EA 1LCPA 3R96A 2VQYA 1Z5RA 4AB7A 3IIBA 4PQAA 1ZG7A 2FIWA 2GFQA 2FIAA 3S6GA 4A32A 3B3WA 3D66A 1CBXA 1QQ9A 4C68A 4MHDA 1IYKA 2ZPAA 1V0CA 4UWIA 4RI1A 2XEJA 2PRQA 4IAVA 1LAMA 3QAHA 4UFVA 4JZ0A 4FBEA 4YFJA 5DWMA 5F09A 2G0BA 4MFLA 1Z8TA 2J9AA 5K8PA 2HQYA 4A2ZA 1XIXA 2PRBA 3D2MA 2CNTA 4HPSA 3R9GA 1LOKA 5FVJA 2YNDA 1CM0A 4CAXA 2O53A 2ZEPA 2ANPA 3BI0A 1PYTB 3R9FA 3EXNA 3FEDA 5THWA 2PJ6A 1Z8WA 4U9ZA 4H6UA 3D67A 2EWBA 2GANA 3IJ3A 4UEFA 2EO8A 3T8WA 4R3LA 3FMCA 3DSBA 4KVOE 2P6FA 4KZTA 1XEBA 2NMTA 2GU2A 4KOTA 3H8FA 4R7MA 2Q4VA 1CPSA 3ZJ0A 1SQHA 1YW4A 2PC1A 3SJEA 3F0AA 2VI7A 4Q38A 1H8LA 4ZX8A 2BL1A 3SI2A 2ZXVA 2PJ8A 2CNSA 3FB3A 3L2NA 4EFDA 3D4UA 4XNHC 3B3CA 2FCKA 3WC6A 4A38A 2X7BA 1M4GA 3PRTA 4KOSA 1XOVA 5J8CA 2GIVA 3D2PA 4M6HA 2G9DA 4LUAA 4BINA 3BJ8A 3TO7A 4F9UA 2F5IA 2J8RA 3S6FA 1S60A 2BUEA 3TOAA 2ZEOA 3KQZA 4R8FA 4C2ZA 4JXQA 2BOAA 3CXQA 4MFJA 1DTDA 1YX0A 3TFYA 3S6HA 1L0CA 2PJAA 2ZEEA 3JRUA 3QB8A 4KOUA 3PZJA 2BO9A 4MJ8A 1M4LA 1F2OA 2AFMA 2PJ0A 1P0HA 2Q44A 3T9YA 3IFEA 4MI4A 3SJGA 3B3TA 1X10A 4OIWA 5LYIA 2BEIA 2ZOFA 2BSWA 3SJXA 1LANA 1VHOA 2AFZA 2D4PA 3IEHA 4X3RA 2P6EA 5H84A 4MBUA 2QIRA 2G3AA 2ATRA 3KI9A 4EMEA 4ZI6A 2B5GB 5BWAB 4ORFA 1KZFA 4P4DA 5GCNA 4CAEA 3RBUA 4C7HA 2JBKA 4YWYA 3IU2A 1BOBA 2Q4YA 4G1PA 3SXOA 4A33A 1NE9A 4JD6A 4UEZA 2VZYA 3MGDA 1YVOA 3PB7X 4TNUA 3LMSA 2RB7A 1RO5A 4CS0B 4Y49B 4A95A 1IYLA 1R3NA 4UF4A 2HUZA 2GLJA 4MFKA 3CT9A 5K8MA 2OZHA 3I3GA 4B5PA 4JLYA 4HNXB 1UFHA 2B4BA 2B58A 3DR8A 3W6SA 2PJ2A 1B6BA 3PB6X 4AVBA
chains in the Genus database with same CATH topology
4R9MA 4PSWA 1I12A 1MJ9A 3EO4A 4IF5A 2B4DA 3EFAA 4UA3A 3IWEA 4B5OA 4DNCA 2WPXA 3JTKA 1S7FA 4NF1A 2QMLA 5KTDA 2Z3PA 4E8OA 4CYNA 1B87A 2B5GA 4JWPA 3TO9A 1K4JA 4I49A 1IIDA 4X5KA 3H4QA 4KORA 5J8FA 1WK4A 5EBVA 2O28A 2HV2A 4CAVA 4QUSA 1M1DA 3DR6A 4AG7A 3FXTA 3LD2A 5HMNA 4KSAA 4J3GA 3FBUA 2REFA 4R3KA 4CAWA 4L89A 4HKFA 3S6KA 3VWEA 1NMTA 4ONUA 3RYOA 4H6ZA 2JDDA 2B4DB 2AJ6A 1VKCA 4KUBA 4UWJA 5AG6A 2FXFA 5EC4A 4YGOA 2Z0ZA 2R1IA 3EY5A 5JPHA 1YK3A 1YR0A 2VXKA 4QC6A 4F0YA 5C82A 3TO6A 4PV6A 1QSRA 1MJAA 4MFZA 4XPLA 4UCMA 3IWGA 1S7LA 3GKRA 2Z3OA 2J8NA 2YNCC 1KUVA 1I1DA 2FE7A 5A28A 5E96A 1MJBA 4F6AA 3GYAA 1LRZA 4CGOA 3E0KA 4CGLA 5F47A 2EUIA 4CGNA 5AG4A 3TE4A 1RXTA 5DWNA 4A30A 1P4NA 4C2XA 2YGWA 2JLMA 3DNSA 1Z9UA 4NCZA 3JVNA 1NSLA 2R7HA 1Q2YA 3A9LA 5F48A 4PK3A 2EVNA 5KTAA 2AE6A 1M4DA 3TCVA 4L8AA 4KUAA 3TTHA 2FS5A 2VEZA 2Z3NA 1PU9A 4UCPA 4NSQA 1GHEA 4OADA 4CGMA 4XPDB 4CYPA 2DPTA 3CXPA 4B14A 1FY7A 2PDOA 5CNPA 3D3SA 2H5MA 3R1KA 5JQ4A 2Z3MA 4EVYA 2OZGA 4CRZB 4AG9A 2Q0YA 4YRHA 4B5PB 2ZW7A 5G20A 1ZO0A 1VHSA 4UCNA 4CAFA 4JXRA 2Q7BA 2PR8A 2OB0A 1YREA 4R87A 2Z3KA 3JUWA 3TT2A 2CY2A 2CNMA 4II9A 2JDCA 2DXQA 4NEXA 1QSTA 3H5ZA 2FL4A 3R95A 1XMTA 2PSWA 3G8WA 2ARHA 3IU1A 5IV0A 3BLNA 4C2YA 1M44A 3V8IA 4Q36A 1M4IA 2I00A 4QVTA 4MFPA 3N7ZA 3K9UA 1S7KA 3G3SA 4HNWB 3SHPA 3ZZIA 1R57A 5G1ZA 2R98A 5IX3A 1BO4A 4H89A 1I21A 2A4NA 3B8GA 1Y9WA 2FT0A 1IB1E 4HNYB 2B3VA 4A31A 1QSOA 2FSRA 4LX9A 4XNHB 5ISVA 5HH1A 3TOBA 3WR7A 1PUAA 4BBHA 1Q2CA 4KOYA 3NE7A 2WUUA 2Z11A 2OH1A 1CJWA 2QECA 1Q2DA 3I9SA 4IUSA 2WPWA 3P2HA 3SXNA 1QSMA 3LODA 1N71A 2IL4A 3BJ7A 3UY5A 4K30A 5AG7A 1QSNA 4F0XA 4NXYA 1XE4A 4Y49C 1XF8A 3KKWA 1J4JA 4B11A 2R8VA 2PQ8A 5AG5A 4CRYB 3C26A 4XPDC 2JEVA 4ZGYB 4M85A 4U5YA 3FYNA 2J8MA 2D4OA 4KS9A 5F46A 3F8KA 1Y7RA 2ZW6A 2PR1A 4KLWA 4C7IA 3W6XA 5I0CA 1MK4A 2VBQA 2YNEA 4RS2A 2KCWA 5G22A 3R9EA 1S3ZA 2Z10A 1Z4RA 4FD4A 3FRMA 4B13A 4KSFA 1IICA 4GS4A 3W91A 4KLVA 3D8PA 4AVCA 4ZBGA 2ZW4A 1Y9KA 2I79A 5IB0A 2P6GA 4KVME 1S7NA 4QB9A 4KVXA 4AVAA 3P2FA 1OZPA 2REEA 1YVKA 2Q04A 2RC4A 3GY9A 2C27A 4UFWA 4FD5A 4E0AA 1KUXA 2DPSA 3FNCA 4CGPA 4MY3A 3OWCA 3PP9A 5F49A 1ON0A 2YNCA 2CXAA 4CYOA 4KOXA 4B12A 4MFQA 5H86A 4JJXA 4KOWA 2K5TA 3F5BA 4M3SA 2G3TA 2OU2A 2VZZA 4OAEA 2WSAA 4MY0A 3FIXA 4QBJA 4R57A 4CYQA 4PK2A 3PGPA 1TIQA 3T90A 3DDDA 5AGEA 4E2AA 2ZW5A 3VWDA 3CXSA 1YLEA 5KTCA 5G21A 1KUYA 4B10A 1U6MA 4XPKA 2OZUA 1S5KA 4KOVA 2P0WA 4UBRA 4FD6A 4OLLA 4PSXA 1WWZA 4UFXA 2Z3LA 5A27A 3EC4A 2B3UA 1YGHA 4FD7A 2Y0MA 4BMHA 2GE3A 4U9YA 3IGRA 5C88A 1Z4EA 3R96A 2VQYA 4AB7A 2FIWA 2FIAA 3S6GA 4A32A 4C68A 4MHDA 1IYKA 2ZPAA 1V0CA 4UWIA 4RI1A 4UFVA 3QAHA 4YFJA 5DWMA 2G0BA 4MFLA 2HQYA 4A2ZA 1XIXA 2PRBA 3D2MA 2CNTA 3R9GA 5FVJA 2YNDA 1CM0A 4CAXA 3R9FA 3EXNA 4U9ZA 4H6UA 2GANA 4R3LA 3DSBA 4KVOE 2P6FA 4KZTA 1XEBA 2NMTA 4KOTA 2Q4VA 3ZJ0A 1SQHA 2PC1A 3F0AA 2VI7A 4Q38A 2BL1A 2ZXVA 3FB3A 2CNSA 4XNHC 2FCKA 2X7BA 1M4GA 4KOSA 5J8CA 2GIVA 3D2PA 4LUAA 3BJ8A 3TO7A 2F5IA 2J8RA 3S6FA 1S60A 2BUEA 3TOAA 4C2ZA 4JXQA 3CXQA 4MFJA 1YX0A 3TFYA 3S6HA 1L0CA 3QB8A 4KOUA 3PZJA 4MJ8A 1P0HA 2Q44A 3T9YA 4MI4A 2BEIA 2BSWA 2D4PA 5H84A 2P6EA 4MBUA 2QIRA 2G3AA 2ATRA 5BWAB 2B5GB 4ORFA 1KZFA 4CAEA 5GCNA 4C7HA 3IU2A 1BOBA 2Q4YA 3SXOA 4A33A 1NE9A 4JD6A 2VZYA 3MGDA 1YVOA 1RO5A 4CS0B 4Y49B 4A95A 1IYLA 2HUZA 4MFKA 2OZHA 3I3GA 4B5PA 4JLYA 4HNXB 1UFHA 2B4BA 2B58A 3DR8A 3W6SA 1B6BA 4AVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R9M A;  4PSW A;  1I12 A;  1MJ9 A;  3EO4 A;  4IF5 A;  2B4D A;  3EFA A;  4UA3 A;  4B5O A;  4DNC A;  2WPX A;  1S7F A;  4NF1 A;  2QML A;  5KTD A;  4E8O A;  1B87 A;  2B5G A;  4JWP A;  3TO9 A;  1K4J A;  4I49 A;  1IID A;  4X5K A;  3H4Q A;  4KOR A;  5J8F A;  1WK4 A;  5EBV A;  2O28 A;  2HV2 A;  4CAV A;  4QUS A;  1M1D A;  3DR6 A;  4AG7 A;  3FXT A;  3LD2 A;  5HMN A;  4J3G A;  3FBU A;  2REF A;  4R3K A;  4CAW A;  4L89 A;  4HKF A;  3S6K A;  3VWE A;  1NMT A;  4ONU A;  3RYO A;  4H6Z A;  2JDD A;  2B4D B;  2AJ6 A;  1VKC A;  4KUB A;  4UWJ A;  2FXF A;  5EC4 A;  4YGO A;  2Z0Z A;  2R1I A;  3EY5 A;  5JPH A;  1YK3 A;  1YR0 A;  2VXK A;  4QC6 A;  4F0Y A;  5C82 A;  3TO6 A;  4PV6 A;  1QSR A;  1MJA A;  4XPL A;  3IWG A;  1S7L A;  3GKR A;  2J8N A;  1KUV A;  1I1D A;  2FE7 A;  5E96 A;  1MJB A;  4F6A A;  3GYA A;  1LRZ A;  3E0K A;  5F47 A;  2EUI A;  3TE4 A;  1RXT A;  5DWN A;  1P4N A;  2JLM A;  3DNS A;  1Z9U A;  4NCZ A;  3JVN A;  1NSL A;  2R7H A;  1Q2Y A;  5F48 A;  4PK3 A;  2EVN A;  5KTA A;  2AE6 A;  1M4D A;  3TCV A;  4L8A A;  4KUA A;  3TTH A;  2FS5 A;  2VEZ A;  1PU9 A;  4NSQ A;  1GHE A;  4OAD A;  4XPD B;  3CXP A;  1FY7 A;  2PDO A;  5CNP A;  3D3S A;  2H5M A;  3R1K A;  5JQ4 A;  4EVY A;  2OZG A;  4CRZ B;  4AG9 A;  2Q0Y A;  4YRH A;  4B5P B;  2ZW7 A;  1VHS A;  4JXR A;  2Q7B A;  2PR8 A;  2OB0 A;  1YRE A;  4R87 A;  3JUW A;  3TT2 A;  2CY2 A;  2CNM A;  4II9 A;  2JDC A;  2DXQ A;  4NEX A;  1QST A;  2FL4 A;  3R95 A;  1XMT A;  2PSW A;  3G8W A;  2ARH A;  5IV0 A;  3BLN A;  1M44 A;  3V8I A;  1M4I A;  2I00 A;  4QVT A;  3N7Z A;  3K9U A;  1S7K A;  3G3S A;  4HNW B;  3SHP A;  3ZZI A;  1R57 A;  2R98 A;  5IX3 A;  1BO4 A;  4H89 A;  1I21 A;  2A4N A;  3B8G A;  1Y9W A;  2FT0 A;  1IB1 E;  4HNY B;  2B3V A;  1QSO A;  2FSR A;  4LX9 A;  4XNH B;  5ISV A;  5HH1 A;  3TOB A;  3WR7 A;  1PUA A;  1Q2C A;  4KOY A;  3NE7 A;  2Z11 A;  2OH1 A;  1CJW A;  2QEC A;  1Q2D A;  3I9S A;  4IUS A;  2WPW A;  3P2H A;  3SXN A;  1QSM A;  3LOD A;  1N71 A;  2IL4 A;  3BJ7 A;  3UY5 A;  4K30 A;  1QSN A;  4NXY A;  1XE4 A;  4Y49 C;  1XF8 A;  3KKW A;  1J4J A;  2R8V A;  2PQ8 A;  4CRY B;  3C26 A;  4XPD C;  2JEV A;  4M85 A;  4U5Y A;  3FYN A;  2J8M A;  2D4O A;  5F46 A;  3F8K A;  1Y7R A;  2ZW6 A;  2PR1 A;  4KLW A;  3W6X A;  5I0C A;  1MK4 A;  2VBQ A;  4RS2 A;  2KCW A;  3R9E A;  1S3Z A;  2Z10 A;  1Z4R A;  4FD4 A;  3FRM A;  1IIC A;  4GS4 A;  3W91 A;  4KLV A;  3D8P A;  4AVC A;  4ZBG A;  2ZW4 A;  1Y9K A;  2I79 A;  5IB0 A;  2P6G A;  4KVM E;  1S7N A;  4QB9 A;  4KVX A;  4AVA A;  3P2F A;  1OZP A;  2REE A;  1YVK A;  2Q04 A;  2RC4 A;  3GY9 A;  2C27 A;  4FD5 A;  4E0A A;  1KUX A;  3FNC A;  4MY3 A;  3OWC A;  3PP9 A;  5F49 A;  1ON0 A;  4KOX A;  5H86 A;  4JJX A;  4KOW A;  2K5T A;  3F5B A;  4M3S A;  2G3T A;  2OU2 A;  2VZZ A;  4OAE A;  4MY0 A;  3FIX A;  4QBJ A;  4R57 A;  4PK2 A;  3PGP A;  1TIQ A;  3T90 A;  3DDD A;  4E2A A;  2ZW5 A;  3VWD A;  3CXS A;  1YLE A;  5KTC A;  1KUY A;  1U6M A;  4XPK A;  2OZU A;  1S5K A;  4KOV A;  2P0W A;  4UBR A;  4FD6 A;  4OLL A;  4PSX A;  1WWZ A;  3EC4 A;  2B3U A;  1YGH A;  4FD7 A;  2Y0M A;  4BMH A;  2GE3 A;  4U9Y A;  3IGR A;  5C88 A;  1Z4E A;  3R96 A;  2VQY A;  4AB7 A;  2FIW A;  2FIA A;  3S6G A;  4MHD A;  1IYK A;  2ZPA A;  1V0C A;  4UWI A;  4RI1 A;  3QAH A;  4YFJ A;  5DWM A;  2G0B A;  2HQY A;  1XIX A;  2PRB A;  3D2M A;  2CNT A;  3R9G A;  5FVJ A;  1CM0 A;  4CAX A;  3R9F A;  3EXN A;  4U9Z A;  4H6U A;  2GAN A;  4R3L A;  3DSB A;  4KVO E;  2P6F A;  4KZT A;  1XEB A;  2NMT A;  4KOT A;  2Q4V A;  3ZJ0 A;  1SQH A;  2PC1 A;  3F0A A;  2VI7 A;  2BL1 A;  2ZXV A;  3FB3 A;  2CNS A;  4XNH C;  2FCK A;  2X7B A;  1M4G A;  4KOS A;  5J8C A;  2GIV A;  3D2P A;  4LUA A;  3BJ8 A;  3TO7 A;  2F5I A;  2J8R A;  3S6F A;  1S60 A;  2BUE A;  3TOA A;  4JXQ A;  3CXQ A;  1YX0 A;  3TFY A;  3S6H A;  1L0C A;  3QB8 A;  4KOU A;  3PZJ A;  4MJ8 A;  1P0H A;  2Q44 A;  3T9Y A;  4MI4 A;  2BEI A;  2BSW A;  2D4P A;  5H84 A;  2P6E A;  4MBU A;  2QIR A;  2G3A A;  2ATR A;  2B5G B;  4ORF A;  1KZF A;  5GCN A;  1BOB A;  2Q4Y A;  3SXO A;  1NE9 A;  4JD6 A;  2VZY A;  3MGD A;  1YVO A;  1RO5 A;  4CS0 B;  4Y49 B;  1IYL A;  2HUZ A;  2OZH A;  3I3G A;  4B5P A;  4JLY A;  4HNX B;  1UFH A;  2B4B A;  2B58 A;  3DR8 A;  3W6S A;  1B6B A;  4AVB A; 
#chains in the Genus database with same CATH topology
 4UIA A;  4R9M A;  4PSW A;  2POK A;  1I12 A;  1MJ9 A;  1TKH A;  1VHE A;  1BAV A;  3EO4 A;  3NH5 A;  2B4D A;  3EFA A;  4IF5 A;  3IWE A;  4UA3 A;  4B5O A;  4EWT A;  4Z65 A;  4DNC A;  2PVW A;  2WPX A;  5CPA A;  3MN8 A;  1IGB A;  1Y0Y A;  4K3N A;  3JTK A;  1S7F A;  3BHX A;  4NGN A;  2IMO A;  4NF1 A;  2QML A;  5KTD A;  2Z3P A;  4E8O A;  4CYN A;  1B87 A;  2B5G A;  3NFZ A;  4JWP A;  2HC9 A;  3TO9 A;  4PPZ A;  1K4J A;  3HUV A;  4MHY A;  4I49 A;  2ODF A;  4ONW A;  1IID A;  4X5K A;  2ZED A;  1AMP A;  2NYQ A;  3H4Q A;  4MHZ A;  4KOR A;  5J8F A;  1WK4 A;  3D7G A;  5EBV A;  2O28 A;  2HV2 A;  3IO1 A;  3KHX A;  4QUS A;  1M1D A;  3DR6 A;  3PB8 X;  4RN7 A;  3FXT A;  3B3S A;  1FT7 A;  3K9T A;  3LD2 A;  5EMI A;  4AG7 A;  2ZEF A;  4DYO A;  2JBJ A;  3GIU A;  3IC1 A;  1CPX A;  2PJ5 A;  1XBU A;  3FEC A;  4J3G A;  4KSA A;  3FBU A;  4PXE A;  2REF A;  5D29 A;  4R3K A;  8CPA A;  4CAW A;  1XMB A;  4L89 A;  1BPM A;  5I4M A;  4FAI A;  5HMN A;  1IOF A;  4HKF A;  3S6K A;  3VWE A;  2XEI A;  4MXU A;  1NMT A;  2FVG A;  4ONU A;  3RYO A;  2ABZ A;  4MHP A;  4H6Z A;  2JDD A;  2B4D B;  3PB4 X;  2AJ6 A;  2V8H A;  1YQE A;  1CX8 A;  1VKC A;  3PEI A;  4KUB A;  2I3C A;  1X12 A;  4UWJ A;  4B6Z A;  4NGM A;  5AG6 A;  2FXF A;  5EC4 A;  4MCS A;  4YGO A;  2Z0Z A;  2CF4 A;  2R1I A;  3EY5 A;  4NGQ A;  5JPH A;  1YK3 A;  1YR0 A;  4UIB A;  2EBJ A;  2VXK A;  4QC6 A;  2GLF A;  4F0Y A;  5JH9 A;  5C82 A;  3TO6 A;  3I1U A;  4PV6 A;  3MRU A;  1QSR A;  3B3V A;  4F9V A;  2AFS A;  1MJA A;  2EK9 A;  4MFZ A;  4XPL A;  4UCM A;  2OR4 A;  5LRJ A;  3IWG A;  1S7L A;  2BCO A;  3FH4 A;  3GKR A;  4PXC A;  2Z3O A;  2J8N A;  1VIX A;  1KUV A;  2YNC C;  4H2K A;  3LWU A;  1I1D A;  2FE7 A;  4OC1 A;  5A28 A;  4X8I A;  1CG2 A;  5E96 A;  1MJB A;  3KL9 A;  4F6A A;  3GYA A;  4ZY0 A;  5HVH A;  2PJ9 A;  1LRZ A;  4CGO A;  3E0K A;  4MRI A;  3WT4 A;  4CGL A;  5F47 A;  4BD9 A;  2V77 A;  2EUI A;  4CGN A;  5AG4 A;  3TE4 A;  4P4B A;  3SJF A;  4PXB A;  2C6G A;  3BXM A;  1XRY A;  4NJR A;  1RTQ A;  3DLJ A;  1RXT A;  3KR5 A;  5D8N A;  5DWN A;  4A30 A;  4TWE A;  1P4N A;  4C2X A;  2YGW A;  3DGV A;  2V8G A;  2JLM A;  4ZX9 A;  3GUX A;  2AFW A;  3DNS A;  4P45 A;  1Z9U A;  3NH4 A;  4NCZ A;  3JVN A;  1GYT A;  2Q51 A;  1HDU A;  1TF8 A;  1NSL A;  2R7H A;  1Q2Y A;  3A9L A;  5F48 A;  4PK3 A;  2EVN A;  4A37 A;  5KTA A;  1ARL A;  1NSA A;  2AE6 A;  3LAC A;  1TKF A;  4R6T A;  4WJB A;  1M4D A;  3TCV A;  4L8A A;  2NSM A;  3RNZ A;  4KUA A;  3K2K A;  3S9L A;  2XEF A;  3WC7 A;  3TTH A;  2PJ3 A;  2FS5 A;  4FWU A;  4CAV A;  4MCQ A;  2VEZ A;  2Z3N A;  5JGF A;  4O23 A;  3PBB A;  1PU9 A;  3WC5 A;  4UCP A;  4GM5 A;  4NSQ A;  1GHE A;  4OAD A;  4CGM A;  4XPD B;  2DEA A;  3B7I A;  4MMO A;  1ARM A;  4MHN A;  4CYP A;  1YME A;  2DPT A;  2F7V A;  2ZEN A;  1ELM P;  3CXP A;  3IWW A;  4WWV A;  1OBR A;  4B14 A;  1FY7 A;  2PDO A;  4GXH A;  2PJB A;  5CNP A;  3GB0 A;  2JEW A;  2XEG A;  2V8D A;  2PVV A;  3D3S A;  4W9Y A;  2H5M A;  3R1K A;  5JQ4 A;  2Z3M A;  3PB9 X;  4EVY A;  2OZG A;  3KAS A;  4OME A;  4CRZ B;  1F57 A;  5ELY A;  4AG9 A;  1IU8 A;  2Q0Y A;  4YRH A;  3V38 A;  2ZW7 A;  4B5P B;  5HVG A;  5G20 A;  1ZO0 A;  1VHS A;  6CPA A;  1QMU A;  2WYR A;  5DS0 A;  4UCN A;  2CTC A;  4CAF A;  4IHM A;  4JXR A;  1R43 A;  2PR8 A;  2Q7B A;  5LYL A;  4OC0 A;  2OB0 A;  1YRE A;  3KR4 A;  3NH8 A;  4R87 A;  2Z3K A;  3JUW A;  4M6I A;  3TT2 A;  2CY2 A;  2CNM A;  4II9 A;  3H8E A;  2JDC A;  2DXQ A;  1BPN A;  4NEX A;  3BI1 A;  1QST A;  3H5Z A;  2FL4 A;  4P4F A;  3R95 A;  1XMT A;  2PSW A;  2RFH A;  2ARH A;  3G8W A;  3IU1 A;  3BLN A;  4X2T A;  5IV0 A;  4CPA A;  4C2Y A;  2PJ1 A;  1M44 A;  2QJ8 A;  3V8I A;  4Q36 A;  1M4I A;  3QNV A;  3V7Z A;  2I00 A;  4QVT A;  4MFP A;  2VL1 A;  1YSJ A;  2IJZ A;  3N7Z A;  3K9U A;  1S7K A;  3G3S A;  4HNW B;  3RAM A;  5LYD A;  3SHP A;  3ZZI A;  1CP6 A;  1F2P A;  4JYW A;  4OC4 A;  1R57 A;  2PIY A;  5G1Z A;  2R98 A;  4M6G A;  1Z8L A;  5IX3 A;  1BO4 A;  3FF3 A;  4H89 A;  1I21 A;  2PJC A;  2A4N A;  3B8G A;  1Y9W A;  2FT0 A;  1IB1 E;  3KZW A;  4HNY B;  2B3V A;  4A31 A;  1TKJ A;  3FX6 A;  3FEE A;  1Q7L A;  1Z8X A;  4UEE A;  2C6C A;  4MCP A;  1QSO A;  2FSR A;  4LX9 A;  4XNH B;  5ISV A;  5HH1 A;  3TOB A;  3S9N A;  1HDQ A;  3WR7 A;  1LAP A;  1PUA A;  1ZG8 A;  1JQG A;  3D7H A;  4BBH A;  3GLJ A;  5LRK A;  1Q2C A;  1A2Z A;  2DF5 A;  3TX8 A;  3S9M A;  4KOY A;  3WAB A;  3NA6 A;  3NE7 A;  2WUU A;  4DUK A;  2Z11 A;  2OH1 A;  1CJW A;  2QEC A;  1Q2D A;  3D7F A;  3I9S A;  4IUS A;  1JWQ A;  2ZEL A;  2WPW A;  1AUG A;  3P2H A;  1VGY A;  2GRE A;  3SXN A;  1QSM A;  1FNO A;  2HB6 A;  3FJU A;  3LOD A;  1N71 A;  2IL4 A;  3CPA A;  3BJ7 A;  4P4J A;  3UY5 A;  2ZOG A;  4K30 A;  4LQ6 A;  5AG7 A;  4P44 A;  1QSN A;  2O4H A;  3D7D A;  4OC3 A;  4F0X A;  4NXY A;  1XE4 A;  4Y49 C;  1XF8 A;  3KKW A;  4R76 A;  2WZN A;  1DE4 C;  1J4J A;  4ZYQ A;  4B11 A;  2PJ7 A;  3PFE A;  2R8V A;  1ZG9 A;  2ZEH A;  2PQ8 A;  5AG5 A;  2PE3 A;  3C26 A;  4CRY B;  1HEE A;  4OKO A;  4XPD C;  2JEV A;  4ZGY B;  3D68 A;  4YU9 A;  4M85 A;  4U5Y A;  3PFO A;  3FYN A;  4IK2 A;  2J8M A;  2D4O A;  4B13 A;  4F8Z A;  4KS9 A;  5F46 A;  2ZEM A;  3F8K A;  3VAT A;  1Y7R A;  2ZW6 A;  2PR1 A;  4FUU A;  4KLW A;  4NFR A;  2F8H A;  4Q7A A;  4C7I A;  2EK8 A;  3W6X A;  5I0C A;  3H8G A;  1KWM A;  2AFX A;  1MK4 A;  1PCA A;  4OP4 A;  2VBQ A;  2YNE A;  4RS2 A;  4ZY2 A;  1XFO A;  2KCW A;  5G22 A;  3R9E A;  1S3Z A;  2Z10 A;  1Z4R A;  1XJO A;  3FRM A;  1ELL P;  3HLP A;  4FD4 A;  2Q43 A;  1IIC A;  4GS4 A;  4KSF A;  3W91 A;  3NE8 A;  4KLV A;  1Y0R A;  5CBM A;  3FVL A;  3D8P A;  4AVC A;  3VH9 A;  4ZBG A;  5J1Q A;  4OC2 A;  2ZW4 A;  2Q7S A;  1UWY A;  1Y9K A;  1YW6 A;  1AYE A;  1Z2L A;  2I79 A;  5IB0 A;  2C1C A;  2OOT A;  2AFO A;  5JM6 A;  5K8N A;  3N5F A;  1TXR A;  2PCU A;  2P6G A;  4KVM E;  1S7N A;  4QB9 A;  4KSI A;  4KVX A;  4AVA A;  3P2F A;  2IQ6 A;  1OZP A;  2REE A;  1YVK A;  3KQX A;  4NGS A;  1Y7E A;  2Q04 A;  4ZY1 A;  2PJ4 A;  3RO0 A;  2RC4 A;  2CTB A;  5LRG A;  3GY9 A;  3KHZ A;  2C27 A;  4UFW A;  3PBE A;  3CDX A;  1TF9 A;  1KUX A;  4FD5 A;  4E0A A;  5HVF A;  2DPS A;  3FNC A;  3RZA A;  3CZX A;  3CPX A;  3KGQ A;  4CGP A;  3B35 A;  4MY3 A;  3OWC A;  3PP9 A;  5F49 A;  5HXD A;  1ON0 A;  2YNC A;  2CXA A;  1YLO A;  4CYO A;  5K8O A;  4A39 A;  4KOX A;  4P4I A;  4B12 A;  4MFQ A;  4OID A;  4NJQ A;  5H86 A;  4JJX A;  4KOW A;  2K5T A;  3F5B A;  4M3S A;  2CIJ A;  2G3T A;  2QVP A;  3SI1 A;  2OU2 A;  4MCR A;  1LFW A;  2VZZ A;  1ZLH A;  4PXD A;  3ISZ A;  1IY7 A;  1EE3 P;  4OAE A;  3B2Y A;  2PIZ A;  2WSA A;  3ISX A;  4MY0 A;  3FIX A;  4QBJ A;  4R57 A;  5IB9 A;  4LQG A;  5LYF A;  4CYQ A;  4PK2 A;  3PGP A;  1TIQ A;  2ZEG A;  3T90 A;  3DDD A;  5AGE A;  4E2A A;  2ZW5 A;  4NGR A;  3VWD A;  3CXS A;  1YLE A;  5KTC A;  5G21 A;  7CPA A;  1KUY A;  4B10 A;  1U6M A;  3QAY A;  4XPK A;  3SI0 A;  2OZU A;  1S5K A;  4P4E A;  1CP7 A;  4P6Y A;  4AXV A;  4KOV A;  2P0W A;  4DJL A;  1IOI A;  2Q4Z A;  4UBR A;  2V8V A;  4FD6 A;  1ZLI A;  4NGT A;  4OLL A;  4PSX A;  1WWZ A;  3TC8 A;  2QYV A;  4UFX A;  2Z3L A;  5A27 A;  3EC4 A;  2B3U A;  1YGH A;  4P10 A;  4FD7 A;  1BLL E;  4A94 A;  2Y0M A;  4BMH A;  2GE3 A;  4U9Y A;  3IGR A;  2AFU A;  2C6P A;  4NGP A;  4OC5 A;  3VAR A;  4RUH A;  5C88 A;  1Z4E A;  1LCP A;  3R96 A;  2VQY A;  1Z5R A;  4AB7 A;  3IIB A;  4PQA A;  1ZG7 A;  2FIW A;  2GFQ A;  2FIA A;  3S6G A;  4A32 A;  3B3W A;  3D66 A;  1CBX A;  1QQ9 A;  4C68 A;  4MHD A;  1IYK A;  2ZPA A;  1V0C A;  4UWI A;  4RI1 A;  2XEJ A;  2PRQ A;  4IAV A;  1LAM A;  3QAH A;  4UFV A;  4JZ0 A;  4FBE A;  4YFJ A;  5DWM A;  5F09 A;  2G0B A;  4MFL A;  1Z8T A;  2J9A A;  5K8P A;  2HQY A;  4A2Z A;  1XIX A;  2PRB A;  3D2M A;  2CNT A;  4HPS A;  3R9G A;  1LOK A;  5FVJ A;  2YND A;  1CM0 A;  4CAX A;  2O53 A;  2ZEP A;  2ANP A;  3BI0 A;  1PYT B;  3R9F A;  3EXN A;  3FED A;  5THW A;  2PJ6 A;  1Z8W A;  4U9Z A;  4H6U A;  3D67 A;  2EWB A;  2GAN A;  3IJ3 A;  4UEF A;  2EO8 A;  3T8W A;  4R3L A;  3FMC A;  3DSB A;  4KVO E;  2P6F A;  4KZT A;  1XEB A;  2NMT A;  2GU2 A;  4KOT A;  3H8F A;  4R7M A;  2Q4V A;  1CPS A;  3ZJ0 A;  1SQH A;  1YW4 A;  2PC1 A;  3SJE A;  3F0A A;  2VI7 A;  4Q38 A;  1H8L A;  4ZX8 A;  2BL1 A;  3SI2 A;  2ZXV A;  2PJ8 A;  2CNS A;  3FB3 A;  3L2N A;  4EFD A;  3D4U A;  4XNH C;  3B3C A;  2FCK A;  3WC6 A;  4A38 A;  2X7B A;  1M4G A;  3PRT A;  4KOS A;  1XOV A;  5J8C A;  2GIV A;  3D2P A;  4M6H A;  2G9D A;  4LUA A;  4BIN A;  3BJ8 A;  3TO7 A;  4F9U A;  2F5I A;  2J8R A;  3S6F A;  1S60 A;  2BUE A;  3TOA A;  2ZEO A;  3KQZ A;  4R8F A;  4C2Z A;  4JXQ A;  2BOA A;  3CXQ A;  4MFJ A;  1DTD A;  1YX0 A;  3TFY A;  3S6H A;  1L0C A;  2PJA A;  2ZEE A;  3JRU A;  3QB8 A;  4KOU A;  3PZJ A;  2BO9 A;  4MJ8 A;  1M4L A;  1F2O A;  2AFM A;  2PJ0 A;  1P0H A;  2Q44 A;  3T9Y A;  3IFE A;  4MI4 A;  3SJG A;  3B3T A;  1X10 A;  4OIW A;  5LYI A;  2BEI A;  2ZOF A;  2BSW A;  3SJX A;  1LAN A;  1VHO A;  2AFZ A;  2D4P A;  3IEH A;  4X3R A;  2P6E A;  5H84 A;  4MBU A;  2QIR A;  2G3A A;  2ATR A;  3KI9 A;  4EME A;  4ZI6 A;  2B5G B;  5BWA B;  4ORF A;  1KZF A;  4P4D A;  5GCN A;  4CAE A;  3RBU A;  4C7H A;  2JBK A;  4YWY A;  3IU2 A;  1BOB A;  2Q4Y A;  4G1P A;  3SXO A;  4A33 A;  1NE9 A;  4JD6 A;  4UEZ A;  2VZY A;  3MGD A;  1YVO A;  3PB7 X;  4TNU A;  3LMS A;  2RB7 A;  1RO5 A;  4CS0 B;  4Y49 B;  4A95 A;  1IYL A;  1R3N A;  4UF4 A;  2HUZ A;  2GLJ A;  4MFK A;  3CT9 A;  5K8M A;  2OZH A;  3I3G A;  4B5P A;  4JLY A;  4HNX B;  1UFH A;  2B4B A;  2B58 A;  3DR8 A;  3W6S A;  2PJ2 A;  1B6B A;  3PB6 X;  4AVB A; 
#chains in the Genus database with same CATH homology
 4R9M A;  4PSW A;  1I12 A;  1MJ9 A;  3EO4 A;  4IF5 A;  2B4D A;  3EFA A;  4UA3 A;  3IWE A;  4B5O A;  4DNC A;  2WPX A;  3JTK A;  1S7F A;  4NF1 A;  2QML A;  5KTD A;  2Z3P A;  4E8O A;  4CYN A;  1B87 A;  2B5G A;  4JWP A;  3TO9 A;  1K4J A;  4I49 A;  1IID A;  4X5K A;  3H4Q A;  4KOR A;  5J8F A;  1WK4 A;  5EBV A;  2O28 A;  2HV2 A;  4CAV A;  4QUS A;  1M1D A;  3DR6 A;  4AG7 A;  3FXT A;  3LD2 A;  5HMN A;  4KSA A;  4J3G A;  3FBU A;  2REF A;  4R3K A;  4CAW A;  4L89 A;  4HKF A;  3S6K A;  3VWE A;  1NMT A;  4ONU A;  3RYO A;  4H6Z A;  2JDD A;  2B4D B;  2AJ6 A;  1VKC A;  4KUB A;  4UWJ A;  5AG6 A;  2FXF A;  5EC4 A;  4YGO A;  2Z0Z A;  2R1I A;  3EY5 A;  5JPH A;  1YK3 A;  1YR0 A;  2VXK A;  4QC6 A;  4F0Y A;  5C82 A;  3TO6 A;  4PV6 A;  1QSR A;  1MJA A;  4MFZ A;  4XPL A;  4UCM A;  3IWG A;  1S7L A;  3GKR A;  2Z3O A;  2J8N A;  2YNC C;  1KUV A;  1I1D A;  2FE7 A;  5A28 A;  5E96 A;  1MJB A;  4F6A A;  3GYA A;  1LRZ A;  4CGO A;  3E0K A;  4CGL A;  5F47 A;  2EUI A;  4CGN A;  5AG4 A;  3TE4 A;  1RXT A;  5DWN A;  4A30 A;  1P4N A;  4C2X A;  2YGW A;  2JLM A;  3DNS A;  1Z9U A;  4NCZ A;  3JVN A;  1NSL A;  2R7H A;  1Q2Y A;  3A9L A;  5F48 A;  4PK3 A;  2EVN A;  5KTA A;  2AE6 A;  1M4D A;  3TCV A;  4L8A A;  4KUA A;  3TTH A;  2FS5 A;  2VEZ A;  2Z3N A;  1PU9 A;  4UCP A;  4NSQ A;  1GHE A;  4OAD A;  4CGM A;  4XPD B;  4CYP A;  2DPT A;  3CXP A;  4B14 A;  1FY7 A;  2PDO A;  5CNP A;  3D3S A;  2H5M A;  3R1K A;  5JQ4 A;  2Z3M A;  4EVY A;  2OZG A;  4CRZ B;  4AG9 A;  2Q0Y A;  4YRH A;  4B5P B;  2ZW7 A;  5G20 A;  1ZO0 A;  1VHS A;  4UCN A;  4CAF A;  4JXR A;  2Q7B A;  2PR8 A;  2OB0 A;  1YRE A;  4R87 A;  2Z3K A;  3JUW A;  3TT2 A;  2CY2 A;  2CNM A;  4II9 A;  2JDC A;  2DXQ A;  4NEX A;  1QST A;  3H5Z A;  2FL4 A;  3R95 A;  1XMT A;  2PSW A;  3G8W A;  2ARH A;  3IU1 A;  5IV0 A;  3BLN A;  4C2Y A;  1M44 A;  3V8I A;  4Q36 A;  1M4I A;  2I00 A;  4QVT A;  4MFP A;  3N7Z A;  3K9U A;  1S7K A;  3G3S A;  4HNW B;  3SHP A;  3ZZI A;  1R57 A;  5G1Z A;  2R98 A;  5IX3 A;  1BO4 A;  4H89 A;  1I21 A;  2A4N A;  3B8G A;  1Y9W A;  2FT0 A;  1IB1 E;  4HNY B;  2B3V A;  4A31 A;  1QSO A;  2FSR A;  4LX9 A;  4XNH B;  5ISV A;  5HH1 A;  3TOB A;  3WR7 A;  1PUA A;  4BBH A;  1Q2C A;  4KOY A;  3NE7 A;  2WUU A;  2Z11 A;  2OH1 A;  1CJW A;  2QEC A;  1Q2D A;  3I9S A;  4IUS A;  2WPW A;  3P2H A;  3SXN A;  1QSM A;  3LOD A;  1N71 A;  2IL4 A;  3BJ7 A;  3UY5 A;  4K30 A;  5AG7 A;  1QSN A;  4F0X A;  4NXY A;  1XE4 A;  4Y49 C;  1XF8 A;  3KKW A;  1J4J A;  4B11 A;  2R8V A;  2PQ8 A;  5AG5 A;  4CRY B;  3C26 A;  4XPD C;  2JEV A;  4ZGY B;  4M85 A;  4U5Y A;  3FYN A;  2J8M A;  2D4O A;  4KS9 A;  5F46 A;  3F8K A;  1Y7R A;  2ZW6 A;  2PR1 A;  4KLW A;  4C7I A;  3W6X A;  5I0C A;  1MK4 A;  2VBQ A;  2YNE A;  4RS2 A;  2KCW A;  5G22 A;  3R9E A;  1S3Z A;  2Z10 A;  1Z4R A;  4FD4 A;  3FRM A;  4B13 A;  4KSF A;  1IIC A;  4GS4 A;  3W91 A;  4KLV A;  3D8P A;  4AVC A;  4ZBG A;  2ZW4 A;  1Y9K A;  2I79 A;  5IB0 A;  2P6G A;  4KVM E;  1S7N A;  4QB9 A;  4KVX A;  4AVA A;  3P2F A;  1OZP A;  2REE A;  1YVK A;  2Q04 A;  2RC4 A;  3GY9 A;  2C27 A;  4UFW A;  4FD5 A;  4E0A A;  1KUX A;  2DPS A;  3FNC A;  4CGP A;  4MY3 A;  3OWC A;  3PP9 A;  5F49 A;  1ON0 A;  2YNC A;  2CXA A;  4CYO A;  4KOX A;  4B12 A;  4MFQ A;  5H86 A;  4JJX A;  4KOW A;  2K5T A;  3F5B A;  4M3S A;  2G3T A;  2OU2 A;  2VZZ A;  4OAE A;  2WSA A;  4MY0 A;  3FIX A;  4QBJ A;  4R57 A;  4CYQ A;  4PK2 A;  3PGP A;  1TIQ A;  3T90 A;  3DDD A;  5AGE A;  4E2A A;  2ZW5 A;  3VWD A;  3CXS A;  1YLE A;  5KTC A;  5G21 A;  1KUY A;  4B10 A;  1U6M A;  4XPK A;  2OZU A;  1S5K A;  4KOV A;  2P0W A;  4UBR A;  4FD6 A;  4OLL A;  4PSX A;  1WWZ A;  4UFX A;  2Z3L A;  5A27 A;  3EC4 A;  2B3U A;  1YGH A;  4FD7 A;  2Y0M A;  4BMH A;  2GE3 A;  4U9Y A;  3IGR A;  5C88 A;  1Z4E A;  3R96 A;  2VQY A;  4AB7 A;  2FIW A;  2FIA A;  3S6G A;  4A32 A;  4C68 A;  4MHD A;  1IYK A;  2ZPA A;  1V0C A;  4UWI A;  4RI1 A;  4UFV A;  3QAH A;  4YFJ A;  5DWM A;  2G0B A;  4MFL A;  2HQY A;  4A2Z A;  1XIX A;  2PRB A;  3D2M A;  2CNT A;  3R9G A;  5FVJ A;  2YND A;  1CM0 A;  4CAX A;  3R9F A;  3EXN A;  4U9Z A;  4H6U A;  2GAN A;  4R3L A;  3DSB A;  4KVO E;  2P6F A;  4KZT A;  1XEB A;  2NMT A;  4KOT A;  2Q4V A;  3ZJ0 A;  1SQH A;  2PC1 A;  3F0A A;  2VI7 A;  4Q38 A;  2BL1 A;  2ZXV A;  3FB3 A;  2CNS A;  4XNH C;  2FCK A;  2X7B A;  1M4G A;  4KOS A;  5J8C A;  2GIV A;  3D2P A;  4LUA A;  3BJ8 A;  3TO7 A;  2F5I A;  2J8R A;  3S6F A;  1S60 A;  2BUE A;  3TOA A;  4C2Z A;  4JXQ A;  3CXQ A;  4MFJ A;  1YX0 A;  3TFY A;  3S6H A;  1L0C A;  3QB8 A;  4KOU A;  3PZJ A;  4MJ8 A;  1P0H A;  2Q44 A;  3T9Y A;  4MI4 A;  2BEI A;  2BSW A;  2D4P A;  5H84 A;  2P6E A;  4MBU A;  2QIR A;  2G3A A;  2ATR A;  5BWA B;  2B5G B;  4ORF A;  1KZF A;  4CAE A;  5GCN A;  4C7H A;  3IU2 A;  1BOB A;  2Q4Y A;  3SXO A;  4A33 A;  1NE9 A;  4JD6 A;  2VZY A;  3MGD A;  1YVO A;  1RO5 A;  4CS0 B;  4Y49 B;  4A95 A;  1IYL A;  2HUZ A;  4MFK A;  2OZH A;  3I3G A;  4B5P A;  4JLY A;  4HNX B;  1UFH A;  2B4B A;  2B58 A;  3DR8 A;  3W6S A;  1B6B A;  4AVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...