4MBUA

Crystal structure of n-acetyltransferase from staphylococcus aureus mu50
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
165
structure length
165
Chain Sequence
SNAMIRCAKKEDLNAILAIYNDAIINTTAVYTYKPQTIDERIAWFETKQRNHEPIFVFEENGSVLGFATFGSFRPWPAYQYTIEHSIYVDASARGKGIASQLLQRLIVEAKAKGYRTLVAGIDASNEASIKLHQKFNFKHAGTLTNVGYKFDYWLDLAFYELDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Similar to N-acetyltransferase
publication title Structural characterization of a Gcn5-related N-acetyltransferase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 48
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mbuA00
4R57A 3GYAA 1XIXA 1QSRA 3EFAA 4QC6A 2HQYA 2FSRA 3D8PA 2VZZA 2AJ6A 2FT0A 1BO4A 3SXNA 4F6AA 4CS0B 1QSNA 3W91A 4IUSA 1NMTA 2P0WA 4EVYA 1RO5A 1IYLA 1KUYA 4MI4A 2ZPAA 1M1DA 2J8MA 4CAXA 1WWZA 3DDDA 3T9YA 1SQHA 2FIAA 3TCVA 2R1IA 4UWIA 1N71A 2FIWA 1XMTA 4J3GA 3I9SA 4ONUA 4Y49B 1MJAA 1RXTA 1QSOA 4UWJA 1Y9WA 1YVOA 4E2AA 3DR6A 4FD4A 2J8NA 2H5MA 3S6HA 4BMHA 3FRMA 4U9YA 3EO4A 4XPDB 4KUAA 3FNCA 4AVBA 3IGRA 1YR0A 4HNWB 5KTAA 3T90A 4R3KA 3R9FA 2I00A 3W6SA 1IICA 2EUIA 2QECA 4OLLA 1XEBA 4MHDA 1R57A 3FBUA 2WPXA 3S6GA 4L8AA 4KUBA 3SHPA 1LRZA 5DWMA 5F47A 4NCZA 4MBUA 5C88A 1ON0A 1U6MA 3H4QA 4L89A 1YGHA 5F46A 4ORFA 2R7HA 2AE6A 1K4JA 3D2PA 2VEZA 3R96A 3TTHA 2Q7BA 4NEXA 2EVNA 2Z10A 4QBJA 3NE7A 2JLMA 3TO6A 2B4BA 2HV2A 2Y0MA 4GS4A 2ZW4A 4R9MA 2P6GA 4KOVA 1Z4EA 3F8KA 2R98A 4Y49C 3FXTA 2B3UA 4B5PB 1CM0A 1M4IA 2VZYA 2PC1A 4AVAA 4MY0A 3G3SA 5EBVA 3BJ8A 5IX3A 2ZW6A 2OZGA 4XPDC 4H6ZA 5F49A 1S60A 4E8OA 2BUEA 3CXPA 5JQ4A 4KLVA 3F5BA 2CNSA 4QVTA 4B5PA 3P2FA 1B6BA 3G8WA 4YRHA 4CAWA 4RI1A 5J8CA 3E0KA 3W6XA 2K5TA 2QIRA 2Q44A 4YGOA 1S5KA 4XNHB 4JLYA 3TO9A 5KTCA 2B3VA 2Q4VA 2IL4A 1I1DA 2X7BA 2REFA 1J4JA 5HMNA 4UA3A 4JXRA 2Q04A 5C82A 3S6KA 3VWEA 1YVKA 1UFHA 4KOYA 2WPWA 2CNMA 1KZFA 2BSWA 2VXKA 3PGPA 2I79A 2REEA 1P0HA 2ARHA 4JD6A 4OAEA 4PSXA 2OZUA 4RS2A 4NSQA 1XF8A 4KVME 4X5KA 3B8GA 1I12A 3R95A 3V8IA 2B4DB 2D4OA 4KVOE 1VKCA 4B5OA 4U5YA 2B5GB 1QSMA 2ZXVA 2A4NA 4PSWA 4AB7A 1M4GA 4PK3A 1Z9UA 2Z11A 3I3GA 4KOWA 1S7KA 2B4DA 3S6FA 2KCWA 3BJ7A 4I49A 1WK4A 2FCKA 5I0CA 2B5GA 3TOAA 1PUAA 1CJWA 4AG9A 2Q4YA 4HNXB 4FD6A 1S7LA 2OU2A 2RC4A 3WR7A 4AG7A 4K30A 2HUZA 3GY9A 1YK3A 5E96A 4U9ZA 1YLEA 4KOTA 5DWNA 3PP9A 3EXNA 2VI7A 1QSTA 3R9GA 4NXYA 2FXFA 2JEVA 1YX0A 3ZZIA 4M3SA 3QAHA 2GIVA 4ZBGA 4YFJA 4PV6A 2OH1A 4E0AA 4AVCA 1FY7A 4LUAA 5HH1A 3LD2A 1BOBA 4M85A 1IYKA 2JDCA 4MY3A 1L0CA 3CXQA 3MGDA 2ZW5A 2FE7A 3FYNA 2O28A 3C26A 5EC4A 2J8RA 3UY5A 4KOSA 5JPHA 3LODA 3TFYA 4HNYB 2CY2A 2PSWA 1P4NA 2FL4A 2PDOA 4JWPA 2PQ8A 1Y7RA 3VWDA 3D3SA 4DNCA 1KUXA 3FIXA 4II9A 4NF1A 3RYOA 3TT2A 2DXQA 1S7FA 2VQYA 3IWGA 4CAVA 1MJ9A 4H89A 3DNSA 4PK2A 2FS5A 4H6UA 1YREA 4FD5A 3TO7A 3JUWA 3N7ZA 1Q2DA 3OWCA 4KORA 5CNPA 2JDDA 1S7NA 5FVJA 4XPKA 2P6FA 1KUVA 4LX9A 1Q2CA 4XPLA 2P6EA 4QB9A 4JXQA 2GANA 1GHEA 2B58A 1IIDA 1PU9A 4FD7A 2Z0ZA 3CXSA 1MJBA 4UBRA 2Q0YA 3KKWA 4CRZB 1Z4RA 2GE3A 4KOXA 2R8VA 2PR8A 3DR8A 4OADA 2ATRA 4KLWA 5IV0A 5KTDA 4XNHC 4HKFA 2BL1A 4IF5A 5IB0A 2ZW7A 2G3AA 3R1KA 4F0YA 1TIQA 4MJ8A 3D2MA 1M4DA 2C27A 5GCNA 2CNTA 3PZJA 1V0CA 3JVNA 4R87A 2OB0A 2QMLA 1NE9A 4CRYB 2OZHA 3P2HA 1OZPA 3EY5A 4KVXA 4QUSA 3R9EA 3F0AA 2F5IA 2G3TA 2VBQA 1VHSA 3TE4A 2G0BA 3ZJ0A 1MK4A 4KZTA 2BEIA 5ISVA 3QB8A 4JJXA 3K9UA 1NSLA 3SXOA 4R3LA 1Y9KA 4KOUA 3EC4A 5H86A 5F48A 1S3ZA 1Q2YA 5H84A 2PRBA 1XE4A 1I21A 3FB3A 2PR1A 3GKRA 2NMTA 5J8FA 3TOBA 1M44A 3BLNA 2D4PA 1B87A 1IB1E 3DSBA
chains in the Genus database with same CATH superfamily
4CGNA 4KSIA 3CPXA 4OC5A 4A95A 3B3VA 4R57A 2Z3MA 2Z3LA 3GYAA 1XIXA 4MFQA 2V8VA 4CYQA 1QSRA 1VHOA 1BAVA 3GLJA 3EFAA 4QC6A 2HQYA 2FSRA 1OBRA 3D8PA 2QVPA 2VZZA 2AJ6A 2FT0A 1BO4A 4P4BA 3SXNA 4F6AA 4P10A 4WJBA 4CS0B 1QSNA 3W91A 4IUSA 1NMTA 4A33A 1TKHA 2P0WA 4MFZA 1XMBA 2POKA 4WWVA 1RO5A 4EVYA 1IYLA 1ELLP 1KUYA 3GUXA 4AXVA 4H2KA 3B2YA 4MI4A 3FECA 4A39A 2ZPAA 1M1DA 2J8MA 2YNDA 4F8ZA 4CAXA 1WWZA 4C7HA 3B7IA 3DDDA 2ZEPA 2EK9A 3T9YA 1SQHA 2FIAA 1HDUA 2R1IA 4KS9A 4NGQA 4P4FA 3D67A 4UWIA 1N71A 3TCVA 3WC5A 2PIZA 2JEWA 2FIWA 1XMTA 1CX8A 4J3GA 2HC9A 3I9SA 2XEJA 4ONUA 3BHXA 4Q38A 4Y49B 5G22A 3WABA 1MJAA 2IMOA 1Z8XA 2EO8A 1RXTA 1QSOA 3CZXA 3CT9A 4UWJA 4F9VA 1Y9WA 2WSAA 1YVOA 3D4UA 4E2AA 3DR6A 4FD4A 2J8NA 1LCPA 2PJ5A 4UEZA 2H5MA 3HUVA 3S6HA 4BMHA 3FRMA 4U9YA 4RUHA 3PB4X 2ZOFA 3EO4A 4JYWA 4XPDB 3B3TA 3FNCA 4KUAA 4AVBA 1VGYA 1YSJA 2J9AA 3H5ZA 1QQ9A 2ZENA 3IGRA 4FUUA 5D8NA 1YR0A 4HNWB 5KTAA 2WZNA 4KSAA 3T90A 4R3KA 5CPAA 3R9FA 4ZY1A 2I00A 3W6SA 1IICA 2EUIA 3LWUA 4EFDA 2QECA 3D68A 4TWEA 4B11A 2Q43A 2BCOA 4OLLA 5AG4A 1XEBA 4R8FA 4MHDA 2PJ0A 2C6CA 1R57A 3FBUA 1ARLA 2WPXA 5LYFA 3S6GA 3NFZA 4L8AA 1ARMA 4PXBA 4IK2A 4KUBA 3SHPA 1LRZA 5DWMA 5F47A 4NCZA 4MBUA 5C88A 1XFOA 1Z2LA 3WC6A 1F2OA 2Q4ZA 1ON0A 1U6MA 4ONWA 3H4QA 5HVGA 4L89A 1YGHA 5F46A 4MHNA 5AG6A 4ORFA 2R7HA 4ZGYB 2AE6A 1K4JA 3D2PA 2VEZA 2ZEMA 1TKFA 3R96A 3TTHA 1LANA 2EWBA 3RZAA 3FVLA 2Q7BA 4NEXA 4K3NA 3VATA 2EVNA 2Z10A 6CPAA 4QBJA 3NE7A 4A30A 3NH5A 2JLMA 3T8WA 4YU9A 4NGNA 3TO6A 2B4BA 1Z8WA 2HV2A 2Y0MA 4IAVA 4C68A 4GS4A 2CF4A 2IQ6A 2PJ1A 2ZW4A 4R9MA 4CGOA 2P6GA 3NA6A 1CBXA 4KOVA 1Z4EA 4NGSA 3F8KA 1Y7EA 4EWTA 2R98A 2Z3NA 3JTKA 4PXEA 2WYRA 4Y49C 1GYTA 5HVFA 3IFEA 2Q51A 3FXTA 4ZI6A 2B3UA 2G9DA 1ZG8A 4B5PB 5K8NA 1CM0A 2PJ7A 1X10A 1M4IA 2VZYA 2EBJA 2PC1A 4AVAA 4MY0A 3GIUA 3G3SA 2C1CA 2ZEHA 5EBVA 4UIAA 2C6PA 3BJ8A 4CGMA 5IX3A 1F2PA 2ZW6A 3D7HA 2OZGA 1PYTB 4DUKA 3DSBA 4XPDC 3SI0A 4H6ZA 5F49A 1AUGA 1S60A 4E8OA 2BUEA 3CXPA 1CP7A 4MFPA 4FAIA 5JQ4A 2JBJA 3IWWA 1DE4C 4CAFA 4DJLA 5G21A 1R3NA 2PJ8A 4KLVA 3F5BA 2CNSA 4QVTA 3CDXA 1RTQA 5ELYA 5HVHA 4B5PA 1LOKA 3FF3A 3P2FA 1B6BA 4LQ6A 4MMOA 3FH4A 3G8WA 4YRHA 4DYOA 1XJOA 4CAWA 4RI1A 4NJRA 4Z65A 5J8CA 3E0KA 1YQEA 3QNVA 3DGVA 3W6XA 1JWQA 2PJCA 4NFRA 4P6YA 4R6TA 2K5TA 2QIRA 2Q44A 4YGOA 1S5KA 4UIBA 4XNHB 2C6GA 4C2XA 5K8MA 3PEIA 2QJ8A 4JLYA 3TO9A 5LRGA 3D7FA 3ISZA 3IC1A 5CBMA 5KTCA 2B3VA 2F8HA 2Q4VA 3PBEA 4BBHA 2CTBA 4ZX8A 2AFMA 2IL4A 1BLLE 1I1DA 2X7BA 1DTDA 2REFA 1J4JA 4UFVA 5DS0A 3SI1A 5HMNA 4UA3A 4JXRA 1IU8A 2Q04A 5JH9A 4PPZA 3FEEA 5C82A 1H8LA 3S6KA 3ISXA 1AYEA 5K8PA 5A27A 3VWEA 1JQGA 1YVKA 4M6GA 1HEEA 1UFHA 4KOYA 2DF5A 3JRUA 4OC3A 2WPWA 1AMPA 1ZG9A 2CNMA 2PJ6A 4IHMA 1KZFA 3FMCA 2BSWA 2YNEA 2VXKA 2PCUA 3LMSA 1CPSA 3PGPA 2I79A 2REEA 1P0HA 2ARHA 2FVGA 2PVVA 4JD6A 4OAEA 4X3RA 4CPAA 4PSXA 5JM6A 3IJ3A 2OZUA 4P45A 2PIYA 4NSQA 4RS2A 1NSAA 1XF8A 4KVME 5BWAB 4GXHA 4X5KA 3B8GA 1I12A 4BD9A 3R95A 3V8IA 2B4DB 2D4OA 3PB8X 2ZEFA 3RNZA 4KVOE 1VKCA 4BINA 1LAMA 5AG7A 4B5OA 1XOVA 4M6HA 4U5YA 2B5GB 3FX6A 1QSMA 2A4NA 2AFSA 3D66A 4OP4A 5AG5A 4MRIA 2Z3KA 1R43A 4PSWA 4AB7A 2PRQA 1M4GA 4PK3A 1Z8TA 3RO0A 1Z9UA 4NJQA 2Z11A 5LYLA 3IEHA 2ZEGA 3I3GA 1A2ZA 4KOWA 1S7KA 2B4DA 4B10A 2GFQA 2RB7A 3S6FA 4C2YA 2KCWA 3BJ7A 4ZY2A 4I49A 3TC8A 1KWMA 1WK4A 2PJAA 2FCKA 5I0CA 2B5GA 3TOAA 4F0XA 1F57A 3DLJA 1LFWA 1PUAA 2GU2A 2XEGA 5THWA 1CJWA 4Q36A 4AG9A 3D7GA 2Q4YA 2ABZA 4HNXB 2RFHA 3PB9X 3BXMA 4P4JA 2I3CA 1S7LA 4FD6A 1CPXA 4MCRA 4F9UA 2GLJA 4HPSA 3PFOA 3S9LA 3CPAA 3IU2A 2OU2A 1ZLIA 2RC4A 4YWYA 3WR7A 4AG7A 4K30A 1BPNA 3IU1A 4UCNA 8CPAA 2O4HA 3KI9A 2HUZA 3GY9A 1YK3A 4P4IA 5J1QA 1CG2A 3KR4A 1FNOA 3I1UA 4U9ZA 5E96A 1YLEA 4KOTA 3IO1A 4OMEA 3H8FA 5DWNA 4ZY0A 4A38A 3PP9A 1VIXA 4R7MA 5LYIA 3WT4A 3EXNA 2VI7A 1QSTA 3R9GA 3B35A 3L2NA 1X12A 4NXYA 2FXFA 2JEVA 1YX0A 4A32A 3ZZIA 4M3SA 3QAHA 2GIVA 4ZBGA 4YFJA 3KQXA 2OH1A 1ELMP 3MRUA 4PV6A 1Z8LA 4AVCA 1Y0YA 1FY7A 2QYVA 4X8IA 4E0AA 5F09A 1VHEA 2PJ3A 4UF4A 4C7IA 4LUAA 5HH1A 3LD2A 3GB0A 1BOBA 4M85A 1IYKA 2PJ2A 2JDCA 4UFWA 5LRJA 2IJZA 2YGWA 4MY3A 4MCPA 1L0CA 3CXQA 3FJUA 4MHZA 3B3WA 2WUUA 2AFUA 3MGDA 2ZW5A 5LYDA 4MCSA 1LAPA 2BO9A 2BOAA 4M6IA 1ZG7A 3RBUA 2FE7A 3FYNA 4OC2A 4MFKA 2O28A 4MXUA 5HXDA 3C26A 2ANPA 4A94A 2PJBA 3H8GA 4GM5A 4Q7AA 5EC4A 2J8RA 2NYQA 3UY5A 3K9TA 4KOSA 4ZYQA 5JPHA 3LODA 3TFYA 3QAYA 4HNYB 2CY2A 2PSWA 4UEFA 4MFLA 1P4NA 2FL4A 2PDOA 4JWPA 4CGLA 2PQ8A 2CTCA 1Y7RA 2AFXA 1TF8A 5IB9A 4UCPA 2YNCA 3VWDA 3FEDA 1IGBA 1YW4A 3D3SA 4OC4A 2PVWA 4UFXA 4DNCA 1KUXA 4JZ0A 3FIXA 4II9A 4NF1A 3S9NA 3RYOA 1FT7A 2DXQA 3K2KA 1S7FA 3TT2A 4B6ZA 2VQYA 3IWGA 4CAVA 2ZEEA 1MJ9A 3SI2A 1TF9A 4H89A 3DNSA 3SJGA 4CAEA 7CPAA 4PK2A 3B3CA 2OR4A 1YW6A 2FS5A 2ZEDA 3IIBA 4H6UA 1YREA 4FD5A 2PE3A 4NGMA 3TO7A 2CXAA 2ZOGA 3BI0A 3JUWA 3S9MA 5A28A 4W9YA 1Q7LA 3N7ZA 1Q2DA 3OWCA 2PJ9A 4KORA 4PXCA 5CNPA 3VH9A 2JDDA 5K8OA 4NGTA 1S7NA 5FVJA 2V77A 4UEEA 3PBBA 4XPKA 2P6FA 1IOIA 1KUVA 2AFOA 3KGQA 1Q2CA 4LX9A 4UCMA 4LQGA 4P4EA 4XPLA 2P6EA 1QMUA 4QB9A 4JXQA 2GANA 3B3SA 1GHEA 2JBKA 2B58A 1IIDA 2Z3OA 1PU9A 4FD7A 3N5FA 3SJXA 2Z0ZA 2NSMA 4PQAA 3CXSA 1MJBA 4UBRA 2Z3PA 2Q0YA 2AFZA 3KKWA 5I4MA 3NH8A 3KASA 4CRZB 4CYNA 2ZELA 5EMIA 4B12A 2AFWA 2YNCC 1ZLHA 4MHYA 1Z4RA 2GREA 3KHZA 3PFEA 2GE3A 4KOXA 2R8VA 1IOFA 2PR8A 3DR8A 3V38A 1XBUA 1XRYA 4OADA 3MN8A 3NE8A 2ATRA 5G1ZA 3NH4A 4KLWA 4OC0A 1YMEA 3WC7A 5IV0A 5KTDA 1Z5RA 4XNHC 2V8HA 4HKFA 3KR5A 1EE3P 2GLFA 4OC1A 2BL1A 4IF5A 3H8EA 4PXDA 5IB0A 2ZW7A 4MFJA 4FBEA 4O23A 1PCAA 2G3AA 3R1KA 4F0YA 1TIQA 3VARA 2EK8A 4MJ8A 3D2MA 5LRKA 1M4DA 2C27A 5GCNA 3TX8A 2CNTA 2XEIA 3HLPA 4FWUA 1HDQA 3PZJA 4R76A 4RN7A 1V0CA 3JVNA 3KQZA 3SJFA 4R87A 2OB0A 1UWYA 3PB7X 2OOTA 3SJEA 3LACA 1CP6A 2QMLA 2Q7SA 4KSFA 5G20A 1NE9A 4G1PA 4CRYB 4P44A 2OZHA 3P2HA 3KZWA 1YLOA 2PJ4A 4C2ZA 1M4LA 4B14A 1OZPA 3EY5A 4KVXA 4QUSA 2DPTA 3F0AA 3R9EA 2CIJA 2F5IA 2G3TA 2VBQA 3V7ZA 1VHSA 3TE4A 2G0BA 3ZJ0A 2ZEOA 1MK4A 4ZX9A 3D7DA 4KZTA 4MCQA 2BEIA 4OKOA 3QB8A 2HB6A 4EMEA 5ISVA 4JJXA 3IWEA 1TKJA 4OIDA 3K9UA 4X2TA 1NSLA 1BPMA 2V8DA 3SXOA 2DPSA 1ZO0A 5JGFA 4R3LA 1Y9KA 4KOUA 4NGPA 4TNUA 3EC4A 3PB6X 4B13A 5D29A 5H86A 4A37A 2O53A 5F48A 1S3ZA 4P4DA 1Q2YA 5H84A 2PRBA 4CYOA 2XEFA 3KL9A 4OIWA 4A2ZA 1XE4A 1Y0RA 2V8GA 2VL1A 4NGRA 1I21A 2ODFA 3FB3A 2PR1A 5AGEA 4A31A 3KHXA 3GKRA 1TXRA 2NMTA 5J8FA 4CGPA 1IY7A 3A9LA 2DEAA 2F7VA 3PRTA 3RAMA 3TOBA 4CYPA 3BI1A 1M44A 4MHPA 3BLNA 2D4PA 1B87A 1IB1E 2ZXVA
chains in the Genus database with same CATH topology
4CGNA 4A95A 4R57A 2Z3MA 2Z3LA 3GYAA 1XIXA 4MFQA 4CYQA 1QSRA 3EFAA 4QC6A 2HQYA 2FSRA 3D8PA 2VZZA 2AJ6A 2FT0A 1BO4A 3SXNA 4F6AA 4CS0B 1QSNA 3W91A 4IUSA 1NMTA 4A33A 2P0WA 4MFZA 4EVYA 1RO5A 1IYLA 1KUYA 4MI4A 2ZPAA 1M1DA 2J8MA 2YNDA 4CAXA 1WWZA 4C7HA 3DDDA 3T9YA 1SQHA 2FIAA 3TCVA 2R1IA 4KS9A 4UWIA 1N71A 2FIWA 1XMTA 4J3GA 3I9SA 4ONUA 4Y49B 4Q38A 5G22A 1MJAA 1RXTA 1QSOA 4UWJA 1Y9WA 2WSAA 1YVOA 4E2AA 3DR6A 4FD4A 2J8NA 2H5MA 3S6HA 4BMHA 3FRMA 4U9YA 3EO4A 4XPDB 4KUAA 3FNCA 4AVBA 3IGRA 3H5ZA 1YR0A 4HNWB 5KTAA 4KSAA 3T90A 4R3KA 3R9FA 2I00A 3W6SA 1IICA 2EUIA 2QECA 4B11A 4OLLA 5AG4A 1XEBA 4MHDA 1R57A 3FBUA 2WPXA 3S6GA 4L8AA 4KUBA 3SHPA 1LRZA 5DWMA 5F47A 4NCZA 4MBUA 5C88A 1ON0A 1U6MA 3H4QA 4L89A 1YGHA 5F46A 5AG6A 4ORFA 2R7HA 4ZGYB 2AE6A 1K4JA 3D2PA 2VEZA 3R96A 3TTHA 2Q7BA 4NEXA 2EVNA 2Z10A 4QBJA 3NE7A 4A30A 2JLMA 3TO6A 2B4BA 2HV2A 2Y0MA 4C68A 4GS4A 2ZW4A 4R9MA 4CGOA 2P6GA 4KOVA 1Z4EA 3F8KA 2R98A 2Z3NA 3JTKA 4Y49C 3FXTA 2B3UA 4B5PB 1CM0A 1M4IA 2VZYA 2PC1A 4AVAA 4MY0A 3G3SA 5EBVA 3BJ8A 4CGMA 5IX3A 2ZW6A 2OZGA 4XPDC 4H6ZA 5F49A 1S60A 4E8OA 2BUEA 3CXPA 4MFPA 5JQ4A 4CAFA 5G21A 4KLVA 3F5BA 2CNSA 4QVTA 4B5PA 3P2FA 1B6BA 3G8WA 4YRHA 4CAWA 4RI1A 5J8CA 3E0KA 3W6XA 2K5TA 2QIRA 2Q44A 4YGOA 1S5KA 4XNHB 4C2XA 4JLYA 3TO9A 5KTCA 2B3VA 2Q4VA 4BBHA 2IL4A 4UFVA 1I1DA 2X7BA 2REFA 1J4JA 5HMNA 4UA3A 4JXRA 2Q04A 5C82A 3S6KA 5A27A 3VWEA 1YVKA 1UFHA 4KOYA 2WPWA 2CNMA 1KZFA 2BSWA 2YNEA 2VXKA 3PGPA 2I79A 2REEA 1P0HA 2ARHA 4JD6A 4OAEA 4PSXA 2OZUA 4RS2A 4NSQA 1XF8A 4KVME 5BWAB 4X5KA 3B8GA 1I12A 3R95A 3V8IA 2B4DB 2D4OA 4KVOE 1VKCA 5AG7A 4B5OA 4U5YA 2B5GB 1QSMA 2ZXVA 2A4NA 5AG5A 2Z3KA 4PSWA 4AB7A 1M4GA 4PK3A 1Z9UA 2Z11A 3I3GA 4KOWA 1S7KA 2B4DA 4B10A 3S6FA 4C2YA 2KCWA 3BJ7A 4I49A 1WK4A 2FCKA 5I0CA 2B5GA 3TOAA 4F0XA 1PUAA 1CJWA 4Q36A 4AG9A 2Q4YA 4HNXB 4FD6A 1S7LA 3IU2A 2OU2A 2RC4A 3WR7A 4AG7A 4K30A 3IU1A 4UCNA 2HUZA 3GY9A 1YK3A 5E96A 4U9ZA 1YLEA 4KOTA 5DWNA 3PP9A 3EXNA 2VI7A 1QSTA 3R9GA 4NXYA 2FXFA 2JEVA 1YX0A 4A32A 3ZZIA 4M3SA 3QAHA 2GIVA 4ZBGA 4YFJA 4PV6A 2OH1A 4E0AA 4AVCA 1FY7A 4C7IA 4LUAA 5HH1A 3LD2A 1BOBA 4M85A 1IYKA 2JDCA 4UFWA 2YGWA 4MY3A 1L0CA 3CXQA 2WUUA 3MGDA 2ZW5A 2FE7A 3FYNA 4MFKA 2O28A 3C26A 5EC4A 2J8RA 3UY5A 4KOSA 5JPHA 3LODA 3TFYA 4HNYB 2CY2A 2PSWA 4MFLA 1P4NA 2FL4A 2PDOA 4JWPA 4CGLA 2PQ8A 1Y7RA 4UCPA 2YNCA 3VWDA 3D3SA 4UFXA 4DNCA 1KUXA 3FIXA 4II9A 4NF1A 3RYOA 3TT2A 2DXQA 1S7FA 2VQYA 3IWGA 4CAVA 1MJ9A 4H89A 3DNSA 4CAEA 4PK2A 2FS5A 4H6UA 1YREA 4FD5A 3TO7A 2CXAA 3JUWA 3N7ZA 1Q2DA 3OWCA 4KORA 5CNPA 2JDDA 1S7NA 5FVJA 4XPKA 2P6FA 5A28A 1KUVA 4LX9A 1Q2CA 4UCMA 4XPLA 2P6EA 4QB9A 4JXQA 2GANA 1GHEA 2B58A 1IIDA 2Z3OA 1PU9A 4FD7A 2Z0ZA 3CXSA 1MJBA 4UBRA 2Z3PA 2Q0YA 3KKWA 4CRZB 4CYNA 4B12A 2YNCC 1Z4RA 2GE3A 4KOXA 2R8VA 2PR8A 3DR8A 4OADA 2ATRA 5G1ZA 4KLWA 5IV0A 5KTDA 4XNHC 4HKFA 2BL1A 4IF5A 5IB0A 2ZW7A 4MFJA 2G3AA 3R1KA 4F0YA 1TIQA 4MJ8A 3D2MA 1M4DA 2C27A 5GCNA 2CNTA 3PZJA 1V0CA 3JVNA 4R87A 2OB0A 2QMLA 4KSFA 5G20A 1NE9A 4CRYB 2OZHA 3P2HA 4C2ZA 4B14A 1OZPA 3EY5A 4KVXA 4QUSA 2DPTA 3F0AA 3R9EA 2F5IA 2G3TA 2VBQA 1VHSA 3TE4A 2G0BA 3ZJ0A 1MK4A 4KZTA 2BEIA 5ISVA 3QB8A 4JJXA 3IWEA 3K9UA 1NSLA 3SXOA 2DPSA 1ZO0A 4R3LA 1Y9KA 4KOUA 3EC4A 4B13A 5H86A 5F48A 1S3ZA 1Q2YA 5H84A 2PRBA 4CYOA 4A2ZA 1XE4A 4A31A 1I21A 3FB3A 5AGEA 2PR1A 3GKRA 2NMTA 5J8FA 4CGPA 3A9LA 3TOBA 4CYPA 1M44A 3BLNA 2D4PA 1B87A 1IB1E 3DSBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R57 A;  3GYA A;  1XIX A;  1QSR A;  3EFA A;  4QC6 A;  2HQY A;  2FSR A;  3D8P A;  2VZZ A;  2AJ6 A;  2FT0 A;  1BO4 A;  3SXN A;  4F6A A;  4CS0 B;  1QSN A;  3W91 A;  4IUS A;  1NMT A;  2P0W A;  4EVY A;  1RO5 A;  1IYL A;  1KUY A;  4MI4 A;  2ZPA A;  1M1D A;  2J8M A;  4CAX A;  1WWZ A;  3DDD A;  3T9Y A;  1SQH A;  2FIA A;  3TCV A;  2R1I A;  4UWI A;  1N71 A;  2FIW A;  1XMT A;  4J3G A;  3I9S A;  4ONU A;  4Y49 B;  1MJA A;  1RXT A;  1QSO A;  4UWJ A;  1Y9W A;  1YVO A;  4E2A A;  3DR6 A;  4FD4 A;  2J8N A;  2H5M A;  3S6H A;  4BMH A;  3FRM A;  4U9Y A;  3EO4 A;  4XPD B;  4KUA A;  3FNC A;  4AVB A;  3IGR A;  1YR0 A;  4HNW B;  5KTA A;  3T90 A;  4R3K A;  3R9F A;  2I00 A;  3W6S A;  1IIC A;  2EUI A;  2QEC A;  4OLL A;  1XEB A;  4MHD A;  1R57 A;  3FBU A;  2WPX A;  3S6G A;  4L8A A;  4KUB A;  3SHP A;  1LRZ A;  5DWM A;  5F47 A;  4NCZ A;  4MBU A;  5C88 A;  1ON0 A;  1U6M A;  3H4Q A;  4L89 A;  1YGH A;  5F46 A;  4ORF A;  2R7H A;  2AE6 A;  1K4J A;  3D2P A;  2VEZ A;  3R96 A;  3TTH A;  2Q7B A;  4NEX A;  2EVN A;  2Z10 A;  4QBJ A;  3NE7 A;  2JLM A;  3TO6 A;  2B4B A;  2HV2 A;  2Y0M A;  4GS4 A;  2ZW4 A;  4R9M A;  2P6G A;  4KOV A;  1Z4E A;  3F8K A;  2R98 A;  4Y49 C;  3FXT A;  2B3U A;  4B5P B;  1CM0 A;  1M4I A;  2VZY A;  2PC1 A;  4AVA A;  4MY0 A;  3G3S A;  5EBV A;  3BJ8 A;  5IX3 A;  2ZW6 A;  2OZG A;  4XPD C;  4H6Z A;  5F49 A;  1S60 A;  4E8O A;  2BUE A;  3CXP A;  5JQ4 A;  4KLV A;  3F5B A;  2CNS A;  4QVT A;  4B5P A;  3P2F A;  1B6B A;  3G8W A;  4YRH A;  4CAW A;  4RI1 A;  5J8C A;  3E0K A;  3W6X A;  2K5T A;  2QIR A;  2Q44 A;  4YGO A;  1S5K A;  4XNH B;  4JLY A;  3TO9 A;  5KTC A;  2B3V A;  2Q4V A;  2IL4 A;  1I1D A;  2X7B A;  2REF A;  1J4J A;  5HMN A;  4UA3 A;  4JXR A;  2Q04 A;  5C82 A;  3S6K A;  3VWE A;  1YVK A;  1UFH A;  4KOY A;  2WPW A;  2CNM A;  1KZF A;  2BSW A;  2VXK A;  3PGP A;  2I79 A;  2REE A;  1P0H A;  2ARH A;  4JD6 A;  4OAE A;  4PSX A;  2OZU A;  4RS2 A;  4NSQ A;  1XF8 A;  4KVM E;  4X5K A;  3B8G A;  1I12 A;  3R95 A;  3V8I A;  2B4D B;  2D4O A;  4KVO E;  1VKC A;  4B5O A;  4U5Y A;  2B5G B;  1QSM A;  2ZXV A;  2A4N A;  4PSW A;  4AB7 A;  1M4G A;  4PK3 A;  1Z9U A;  2Z11 A;  3I3G A;  4KOW A;  1S7K A;  2B4D A;  3S6F A;  2KCW A;  3BJ7 A;  4I49 A;  1WK4 A;  2FCK A;  5I0C A;  2B5G A;  3TOA A;  1PUA A;  1CJW A;  4AG9 A;  2Q4Y A;  4HNX B;  4FD6 A;  1S7L A;  2OU2 A;  2RC4 A;  3WR7 A;  4AG7 A;  4K30 A;  2HUZ A;  3GY9 A;  1YK3 A;  5E96 A;  4U9Z A;  1YLE A;  4KOT A;  5DWN A;  3PP9 A;  3EXN A;  2VI7 A;  1QST A;  3R9G A;  4NXY A;  2FXF A;  2JEV A;  1YX0 A;  3ZZI A;  4M3S A;  3QAH A;  2GIV A;  4ZBG A;  4YFJ A;  4PV6 A;  2OH1 A;  4E0A A;  4AVC A;  1FY7 A;  4LUA A;  5HH1 A;  3LD2 A;  1BOB A;  4M85 A;  1IYK A;  2JDC A;  4MY3 A;  1L0C A;  3CXQ A;  3MGD A;  2ZW5 A;  2FE7 A;  3FYN A;  2O28 A;  3C26 A;  5EC4 A;  2J8R A;  3UY5 A;  4KOS A;  5JPH A;  3LOD A;  3TFY A;  4HNY B;  2CY2 A;  2PSW A;  1P4N A;  2FL4 A;  2PDO A;  4JWP A;  2PQ8 A;  1Y7R A;  3VWD A;  3D3S A;  4DNC A;  1KUX A;  3FIX A;  4II9 A;  4NF1 A;  3RYO A;  3TT2 A;  2DXQ A;  1S7F A;  2VQY A;  3IWG A;  4CAV A;  1MJ9 A;  4H89 A;  3DNS A;  4PK2 A;  2FS5 A;  4H6U A;  1YRE A;  4FD5 A;  3TO7 A;  3JUW A;  3N7Z A;  1Q2D A;  3OWC A;  4KOR A;  5CNP A;  2JDD A;  1S7N A;  5FVJ A;  4XPK A;  2P6F A;  1KUV A;  4LX9 A;  1Q2C A;  4XPL A;  2P6E A;  4QB9 A;  4JXQ A;  2GAN A;  1GHE A;  2B58 A;  1IID A;  1PU9 A;  4FD7 A;  2Z0Z A;  3CXS A;  1MJB A;  4UBR A;  2Q0Y A;  3KKW A;  4CRZ B;  1Z4R A;  2GE3 A;  4KOX A;  2R8V A;  2PR8 A;  3DR8 A;  4OAD A;  2ATR A;  4KLW A;  5IV0 A;  5KTD A;  4XNH C;  4HKF A;  2BL1 A;  4IF5 A;  5IB0 A;  2ZW7 A;  2G3A A;  3R1K A;  4F0Y A;  1TIQ A;  4MJ8 A;  3D2M A;  1M4D A;  2C27 A;  5GCN A;  2CNT A;  3PZJ A;  1V0C A;  3JVN A;  4R87 A;  2OB0 A;  2QML A;  1NE9 A;  4CRY B;  2OZH A;  3P2H A;  1OZP A;  3EY5 A;  4KVX A;  4QUS A;  3R9E A;  3F0A A;  2F5I A;  2G3T A;  2VBQ A;  1VHS A;  3TE4 A;  2G0B A;  3ZJ0 A;  1MK4 A;  4KZT A;  2BEI A;  5ISV A;  3QB8 A;  4JJX A;  3K9U A;  1NSL A;  3SXO A;  4R3L A;  1Y9K A;  4KOU A;  3EC4 A;  5H86 A;  5F48 A;  1S3Z A;  1Q2Y A;  5H84 A;  2PRB A;  1XE4 A;  1I21 A;  3FB3 A;  2PR1 A;  3GKR A;  2NMT A;  5J8F A;  3TOB A;  1M44 A;  3BLN A;  2D4P A;  1B87 A;  1IB1 E;  3DSB A; 
#chains in the Genus database with same CATH topology
 4CGN A;  4KSI A;  3CPX A;  4OC5 A;  4A95 A;  3B3V A;  4R57 A;  2Z3M A;  2Z3L A;  3GYA A;  1XIX A;  4MFQ A;  2V8V A;  4CYQ A;  1QSR A;  1VHO A;  1BAV A;  3GLJ A;  3EFA A;  4QC6 A;  2HQY A;  2FSR A;  1OBR A;  3D8P A;  2QVP A;  2VZZ A;  2AJ6 A;  2FT0 A;  1BO4 A;  4P4B A;  3SXN A;  4F6A A;  4P10 A;  4WJB A;  4CS0 B;  1QSN A;  3W91 A;  4IUS A;  1NMT A;  4A33 A;  1TKH A;  2P0W A;  4MFZ A;  1XMB A;  2POK A;  4WWV A;  1RO5 A;  4EVY A;  1IYL A;  1ELL P;  1KUY A;  3GUX A;  4AXV A;  4H2K A;  3B2Y A;  4MI4 A;  3FEC A;  4A39 A;  2ZPA A;  1M1D A;  2J8M A;  2YND A;  4F8Z A;  4CAX A;  1WWZ A;  4C7H A;  3B7I A;  3DDD A;  2ZEP A;  2EK9 A;  3T9Y A;  1SQH A;  2FIA A;  1HDU A;  2R1I A;  4KS9 A;  4NGQ A;  4P4F A;  3D67 A;  4UWI A;  1N71 A;  3TCV A;  3WC5 A;  2PIZ A;  2JEW A;  2FIW A;  1XMT A;  1CX8 A;  4J3G A;  2HC9 A;  3I9S A;  2XEJ A;  4ONU A;  3BHX A;  4Q38 A;  4Y49 B;  5G22 A;  3WAB A;  1MJA A;  2IMO A;  1Z8X A;  2EO8 A;  1RXT A;  1QSO A;  3CZX A;  3CT9 A;  4UWJ A;  4F9V A;  1Y9W A;  2WSA A;  1YVO A;  3D4U A;  4E2A A;  3DR6 A;  4FD4 A;  2J8N A;  1LCP A;  2PJ5 A;  4UEZ A;  2H5M A;  3HUV A;  3S6H A;  4BMH A;  3FRM A;  4U9Y A;  4RUH A;  3PB4 X;  2ZOF A;  3EO4 A;  4JYW A;  4XPD B;  3B3T A;  3FNC A;  4KUA A;  4AVB A;  1VGY A;  1YSJ A;  2J9A A;  3H5Z A;  1QQ9 A;  2ZEN A;  3IGR A;  4FUU A;  5D8N A;  1YR0 A;  4HNW B;  5KTA A;  2WZN A;  4KSA A;  3T90 A;  4R3K A;  5CPA A;  3R9F A;  4ZY1 A;  2I00 A;  3W6S A;  1IIC A;  2EUI A;  3LWU A;  4EFD A;  2QEC A;  3D68 A;  4TWE A;  4B11 A;  2Q43 A;  2BCO A;  4OLL A;  5AG4 A;  1XEB A;  4R8F A;  4MHD A;  2PJ0 A;  2C6C A;  1R57 A;  3FBU A;  1ARL A;  2WPX A;  5LYF A;  3S6G A;  3NFZ A;  4L8A A;  1ARM A;  4PXB A;  4IK2 A;  4KUB A;  3SHP A;  1LRZ A;  5DWM A;  5F47 A;  4NCZ A;  4MBU A;  5C88 A;  1XFO A;  1Z2L A;  3WC6 A;  1F2O A;  2Q4Z A;  1ON0 A;  1U6M A;  4ONW A;  3H4Q A;  5HVG A;  4L89 A;  1YGH A;  5F46 A;  4MHN A;  5AG6 A;  4ORF A;  2R7H A;  4ZGY B;  2AE6 A;  1K4J A;  3D2P A;  2VEZ A;  2ZEM A;  1TKF A;  3R96 A;  3TTH A;  1LAN A;  2EWB A;  3RZA A;  3FVL A;  2Q7B A;  4NEX A;  4K3N A;  3VAT A;  2EVN A;  2Z10 A;  6CPA A;  4QBJ A;  3NE7 A;  4A30 A;  3NH5 A;  2JLM A;  3T8W A;  4YU9 A;  4NGN A;  3TO6 A;  2B4B A;  1Z8W A;  2HV2 A;  2Y0M A;  4IAV A;  4C68 A;  4GS4 A;  2CF4 A;  2IQ6 A;  2PJ1 A;  2ZW4 A;  4R9M A;  4CGO A;  2P6G A;  3NA6 A;  1CBX A;  4KOV A;  1Z4E A;  4NGS A;  3F8K A;  1Y7E A;  4EWT A;  2R98 A;  2Z3N A;  3JTK A;  4PXE A;  2WYR A;  4Y49 C;  1GYT A;  5HVF A;  3IFE A;  2Q51 A;  3FXT A;  4ZI6 A;  2B3U A;  2G9D A;  1ZG8 A;  4B5P B;  5K8N A;  1CM0 A;  2PJ7 A;  1X10 A;  1M4I A;  2VZY A;  2EBJ A;  2PC1 A;  4AVA A;  4MY0 A;  3GIU A;  3G3S A;  2C1C A;  2ZEH A;  5EBV A;  4UIA A;  2C6P A;  3BJ8 A;  4CGM A;  5IX3 A;  1F2P A;  2ZW6 A;  3D7H A;  2OZG A;  1PYT B;  4DUK A;  3DSB A;  4XPD C;  3SI0 A;  4H6Z A;  5F49 A;  1AUG A;  1S60 A;  4E8O A;  2BUE A;  3CXP A;  1CP7 A;  4MFP A;  4FAI A;  5JQ4 A;  2JBJ A;  3IWW A;  1DE4 C;  4CAF A;  4DJL A;  5G21 A;  1R3N A;  2PJ8 A;  4KLV A;  3F5B A;  2CNS A;  4QVT A;  3CDX A;  1RTQ A;  5ELY A;  5HVH A;  4B5P A;  1LOK A;  3FF3 A;  3P2F A;  1B6B A;  4LQ6 A;  4MMO A;  3FH4 A;  3G8W A;  4YRH A;  4DYO A;  1XJO A;  4CAW A;  4RI1 A;  4NJR A;  4Z65 A;  5J8C A;  3E0K A;  1YQE A;  3QNV A;  3DGV A;  3W6X A;  1JWQ A;  2PJC A;  4NFR A;  4P6Y A;  4R6T A;  2K5T A;  2QIR A;  2Q44 A;  4YGO A;  1S5K A;  4UIB A;  4XNH B;  2C6G A;  4C2X A;  5K8M A;  3PEI A;  2QJ8 A;  4JLY A;  3TO9 A;  5LRG A;  3D7F A;  3ISZ A;  3IC1 A;  5CBM A;  5KTC A;  2B3V A;  2F8H A;  2Q4V A;  3PBE A;  4BBH A;  2CTB A;  4ZX8 A;  2AFM A;  2IL4 A;  1BLL E;  1I1D A;  2X7B A;  1DTD A;  2REF A;  1J4J A;  4UFV A;  5DS0 A;  3SI1 A;  5HMN A;  4UA3 A;  4JXR A;  1IU8 A;  2Q04 A;  5JH9 A;  4PPZ A;  3FEE A;  5C82 A;  1H8L A;  3S6K A;  3ISX A;  1AYE A;  5K8P A;  5A27 A;  3VWE A;  1JQG A;  1YVK A;  4M6G A;  1HEE A;  1UFH A;  4KOY A;  2DF5 A;  3JRU A;  4OC3 A;  2WPW A;  1AMP A;  1ZG9 A;  2CNM A;  2PJ6 A;  4IHM A;  1KZF A;  3FMC A;  2BSW A;  2YNE A;  2VXK A;  2PCU A;  3LMS A;  1CPS A;  3PGP A;  2I79 A;  2REE A;  1P0H A;  2ARH A;  2FVG A;  2PVV A;  4JD6 A;  4OAE A;  4X3R A;  4CPA A;  4PSX A;  5JM6 A;  3IJ3 A;  2OZU A;  4P45 A;  2PIY A;  4NSQ A;  4RS2 A;  1NSA A;  1XF8 A;  4KVM E;  5BWA B;  4GXH A;  4X5K A;  3B8G A;  1I12 A;  4BD9 A;  3R95 A;  3V8I A;  2B4D B;  2D4O A;  3PB8 X;  2ZEF A;  3RNZ A;  4KVO E;  1VKC A;  4BIN A;  1LAM A;  5AG7 A;  4B5O A;  1XOV A;  4M6H A;  4U5Y A;  2B5G B;  3FX6 A;  1QSM A;  2A4N A;  2AFS A;  3D66 A;  4OP4 A;  5AG5 A;  4MRI A;  2Z3K A;  1R43 A;  4PSW A;  4AB7 A;  2PRQ A;  1M4G A;  4PK3 A;  1Z8T A;  3RO0 A;  1Z9U A;  4NJQ A;  2Z11 A;  5LYL A;  3IEH A;  2ZEG A;  3I3G A;  1A2Z A;  4KOW A;  1S7K A;  2B4D A;  4B10 A;  2GFQ A;  2RB7 A;  3S6F A;  4C2Y A;  2KCW A;  3BJ7 A;  4ZY2 A;  4I49 A;  3TC8 A;  1KWM A;  1WK4 A;  2PJA A;  2FCK A;  5I0C A;  2B5G A;  3TOA A;  4F0X A;  1F57 A;  3DLJ A;  1LFW A;  1PUA A;  2GU2 A;  2XEG A;  5THW A;  1CJW A;  4Q36 A;  4AG9 A;  3D7G A;  2Q4Y A;  2ABZ A;  4HNX B;  2RFH A;  3PB9 X;  3BXM A;  4P4J A;  2I3C A;  1S7L A;  4FD6 A;  1CPX A;  4MCR A;  4F9U A;  2GLJ A;  4HPS A;  3PFO A;  3S9L A;  3CPA A;  3IU2 A;  2OU2 A;  1ZLI A;  2RC4 A;  4YWY A;  3WR7 A;  4AG7 A;  4K30 A;  1BPN A;  3IU1 A;  4UCN A;  8CPA A;  2O4H A;  3KI9 A;  2HUZ A;  3GY9 A;  1YK3 A;  4P4I A;  5J1Q A;  1CG2 A;  3KR4 A;  1FNO A;  3I1U A;  4U9Z A;  5E96 A;  1YLE A;  4KOT A;  3IO1 A;  4OME A;  3H8F A;  5DWN A;  4ZY0 A;  4A38 A;  3PP9 A;  1VIX A;  4R7M A;  5LYI A;  3WT4 A;  3EXN A;  2VI7 A;  1QST A;  3R9G A;  3B35 A;  3L2N A;  1X12 A;  4NXY A;  2FXF A;  2JEV A;  1YX0 A;  4A32 A;  3ZZI A;  4M3S A;  3QAH A;  2GIV A;  4ZBG A;  4YFJ A;  3KQX A;  2OH1 A;  1ELM P;  3MRU A;  4PV6 A;  1Z8L A;  4AVC A;  1Y0Y A;  1FY7 A;  2QYV A;  4X8I A;  4E0A A;  5F09 A;  1VHE A;  2PJ3 A;  4UF4 A;  4C7I A;  4LUA A;  5HH1 A;  3LD2 A;  3GB0 A;  1BOB A;  4M85 A;  1IYK A;  2PJ2 A;  2JDC A;  4UFW A;  5LRJ A;  2IJZ A;  2YGW A;  4MY3 A;  4MCP A;  1L0C A;  3CXQ A;  3FJU A;  4MHZ A;  3B3W A;  2WUU A;  2AFU A;  3MGD A;  2ZW5 A;  5LYD A;  4MCS A;  1LAP A;  2BO9 A;  2BOA A;  4M6I A;  1ZG7 A;  3RBU A;  2FE7 A;  3FYN A;  4OC2 A;  4MFK A;  2O28 A;  4MXU A;  5HXD A;  3C26 A;  2ANP A;  4A94 A;  2PJB A;  3H8G A;  4GM5 A;  4Q7A A;  5EC4 A;  2J8R A;  2NYQ A;  3UY5 A;  3K9T A;  4KOS A;  4ZYQ A;  5JPH A;  3LOD A;  3TFY A;  3QAY A;  4HNY B;  2CY2 A;  2PSW A;  4UEF A;  4MFL A;  1P4N A;  2FL4 A;  2PDO A;  4JWP A;  4CGL A;  2PQ8 A;  2CTC A;  1Y7R A;  2AFX A;  1TF8 A;  5IB9 A;  4UCP A;  2YNC A;  3VWD A;  3FED A;  1IGB A;  1YW4 A;  3D3S A;  4OC4 A;  2PVW A;  4UFX A;  4DNC A;  1KUX A;  4JZ0 A;  3FIX A;  4II9 A;  4NF1 A;  3S9N A;  3RYO A;  1FT7 A;  2DXQ A;  3K2K A;  1S7F A;  3TT2 A;  4B6Z A;  2VQY A;  3IWG A;  4CAV A;  2ZEE A;  1MJ9 A;  3SI2 A;  1TF9 A;  4H89 A;  3DNS A;  3SJG A;  4CAE A;  7CPA A;  4PK2 A;  3B3C A;  2OR4 A;  1YW6 A;  2FS5 A;  2ZED A;  3IIB A;  4H6U A;  1YRE A;  4FD5 A;  2PE3 A;  4NGM A;  3TO7 A;  2CXA A;  2ZOG A;  3BI0 A;  3JUW A;  3S9M A;  5A28 A;  4W9Y A;  1Q7L A;  3N7Z A;  1Q2D A;  3OWC A;  2PJ9 A;  4KOR A;  4PXC A;  5CNP A;  3VH9 A;  2JDD A;  5K8O A;  4NGT A;  1S7N A;  5FVJ A;  2V77 A;  4UEE A;  3PBB A;  4XPK A;  2P6F A;  1IOI A;  1KUV A;  2AFO A;  3KGQ A;  1Q2C A;  4LX9 A;  4UCM A;  4LQG A;  4P4E A;  4XPL A;  2P6E A;  1QMU A;  4QB9 A;  4JXQ A;  2GAN A;  3B3S A;  1GHE A;  2JBK A;  2B58 A;  1IID A;  2Z3O A;  1PU9 A;  4FD7 A;  3N5F A;  3SJX A;  2Z0Z A;  2NSM A;  4PQA A;  3CXS A;  1MJB A;  4UBR A;  2Z3P A;  2Q0Y A;  2AFZ A;  3KKW A;  5I4M A;  3NH8 A;  3KAS A;  4CRZ B;  4CYN A;  2ZEL A;  5EMI A;  4B12 A;  2AFW A;  2YNC C;  1ZLH A;  4MHY A;  1Z4R A;  2GRE A;  3KHZ A;  3PFE A;  2GE3 A;  4KOX A;  2R8V A;  1IOF A;  2PR8 A;  3DR8 A;  3V38 A;  1XBU A;  1XRY A;  4OAD A;  3MN8 A;  3NE8 A;  2ATR A;  5G1Z A;  3NH4 A;  4KLW A;  4OC0 A;  1YME A;  3WC7 A;  5IV0 A;  5KTD A;  1Z5R A;  4XNH C;  2V8H A;  4HKF A;  3KR5 A;  1EE3 P;  2GLF A;  4OC1 A;  2BL1 A;  4IF5 A;  3H8E A;  4PXD A;  5IB0 A;  2ZW7 A;  4MFJ A;  4FBE A;  4O23 A;  1PCA A;  2G3A A;  3R1K A;  4F0Y A;  1TIQ A;  3VAR A;  2EK8 A;  4MJ8 A;  3D2M A;  5LRK A;  1M4D A;  2C27 A;  5GCN A;  3TX8 A;  2CNT A;  2XEI A;  3HLP A;  4FWU A;  1HDQ A;  3PZJ A;  4R76 A;  4RN7 A;  1V0C A;  3JVN A;  3KQZ A;  3SJF A;  4R87 A;  2OB0 A;  1UWY A;  3PB7 X;  2OOT A;  3SJE A;  3LAC A;  1CP6 A;  2QML A;  2Q7S A;  4KSF A;  5G20 A;  1NE9 A;  4G1P A;  4CRY B;  4P44 A;  2OZH A;  3P2H A;  3KZW A;  1YLO A;  2PJ4 A;  4C2Z A;  1M4L A;  4B14 A;  1OZP A;  3EY5 A;  4KVX A;  4QUS A;  2DPT A;  3F0A A;  3R9E A;  2CIJ A;  2F5I A;  2G3T A;  2VBQ A;  3V7Z A;  1VHS A;  3TE4 A;  2G0B A;  3ZJ0 A;  2ZEO A;  1MK4 A;  4ZX9 A;  3D7D A;  4KZT A;  4MCQ A;  2BEI A;  4OKO A;  3QB8 A;  2HB6 A;  4EME A;  5ISV A;  4JJX A;  3IWE A;  1TKJ A;  4OID A;  3K9U A;  4X2T A;  1NSL A;  1BPM A;  2V8D A;  3SXO A;  2DPS A;  1ZO0 A;  5JGF A;  4R3L A;  1Y9K A;  4KOU A;  4NGP A;  4TNU A;  3EC4 A;  3PB6 X;  4B13 A;  5D29 A;  5H86 A;  4A37 A;  2O53 A;  5F48 A;  1S3Z A;  4P4D A;  1Q2Y A;  5H84 A;  2PRB A;  4CYO A;  2XEF A;  3KL9 A;  4OIW A;  4A2Z A;  1XE4 A;  1Y0R A;  2V8G A;  2VL1 A;  4NGR A;  1I21 A;  2ODF A;  3FB3 A;  2PR1 A;  5AGE A;  4A31 A;  3KHX A;  3GKR A;  1TXR A;  2NMT A;  5J8F A;  4CGP A;  1IY7 A;  3A9L A;  2DEA A;  2F7V A;  3PRT A;  3RAM A;  3TOB A;  4CYP A;  3BI1 A;  1M44 A;  4MHP A;  3BLN A;  2D4P A;  1B87 A;  1IB1 E;  2ZXV A; 
#chains in the Genus database with same CATH homology
 4CGN A;  4A95 A;  4R57 A;  2Z3M A;  2Z3L A;  3GYA A;  1XIX A;  4MFQ A;  4CYQ A;  1QSR A;  3EFA A;  4QC6 A;  2HQY A;  2FSR A;  3D8P A;  2VZZ A;  2AJ6 A;  2FT0 A;  1BO4 A;  3SXN A;  4F6A A;  4CS0 B;  1QSN A;  3W91 A;  4IUS A;  1NMT A;  4A33 A;  2P0W A;  4MFZ A;  4EVY A;  1RO5 A;  1IYL A;  1KUY A;  4MI4 A;  2ZPA A;  1M1D A;  2J8M A;  2YND A;  4CAX A;  1WWZ A;  4C7H A;  3DDD A;  3T9Y A;  1SQH A;  2FIA A;  3TCV A;  2R1I A;  4KS9 A;  4UWI A;  1N71 A;  2FIW A;  1XMT A;  4J3G A;  3I9S A;  4ONU A;  4Y49 B;  4Q38 A;  5G22 A;  1MJA A;  1RXT A;  1QSO A;  4UWJ A;  1Y9W A;  2WSA A;  1YVO A;  4E2A A;  3DR6 A;  4FD4 A;  2J8N A;  2H5M A;  3S6H A;  4BMH A;  3FRM A;  4U9Y A;  3EO4 A;  4XPD B;  4KUA A;  3FNC A;  4AVB A;  3IGR A;  3H5Z A;  1YR0 A;  4HNW B;  5KTA A;  4KSA A;  3T90 A;  4R3K A;  3R9F A;  2I00 A;  3W6S A;  1IIC A;  2EUI A;  2QEC A;  4B11 A;  4OLL A;  5AG4 A;  1XEB A;  4MHD A;  1R57 A;  3FBU A;  2WPX A;  3S6G A;  4L8A A;  4KUB A;  3SHP A;  1LRZ A;  5DWM A;  5F47 A;  4NCZ A;  4MBU A;  5C88 A;  1ON0 A;  1U6M A;  3H4Q A;  4L89 A;  1YGH A;  5F46 A;  5AG6 A;  4ORF A;  2R7H A;  4ZGY B;  2AE6 A;  1K4J A;  3D2P A;  2VEZ A;  3R96 A;  3TTH A;  2Q7B A;  4NEX A;  2EVN A;  2Z10 A;  4QBJ A;  3NE7 A;  4A30 A;  2JLM A;  3TO6 A;  2B4B A;  2HV2 A;  2Y0M A;  4C68 A;  4GS4 A;  2ZW4 A;  4R9M A;  4CGO A;  2P6G A;  4KOV A;  1Z4E A;  3F8K A;  2R98 A;  2Z3N A;  3JTK A;  4Y49 C;  3FXT A;  2B3U A;  4B5P B;  1CM0 A;  1M4I A;  2VZY A;  2PC1 A;  4AVA A;  4MY0 A;  3G3S A;  5EBV A;  3BJ8 A;  4CGM A;  5IX3 A;  2ZW6 A;  2OZG A;  4XPD C;  4H6Z A;  5F49 A;  1S60 A;  4E8O A;  2BUE A;  3CXP A;  4MFP A;  5JQ4 A;  4CAF A;  5G21 A;  4KLV A;  3F5B A;  2CNS A;  4QVT A;  4B5P A;  3P2F A;  1B6B A;  3G8W A;  4YRH A;  4CAW A;  4RI1 A;  5J8C A;  3E0K A;  3W6X A;  2K5T A;  2QIR A;  2Q44 A;  4YGO A;  1S5K A;  4XNH B;  4C2X A;  4JLY A;  3TO9 A;  5KTC A;  2B3V A;  2Q4V A;  4BBH A;  2IL4 A;  4UFV A;  1I1D A;  2X7B A;  2REF A;  1J4J A;  5HMN A;  4UA3 A;  4JXR A;  2Q04 A;  5C82 A;  3S6K A;  5A27 A;  3VWE A;  1YVK A;  1UFH A;  4KOY A;  2WPW A;  2CNM A;  1KZF A;  2BSW A;  2YNE A;  2VXK A;  3PGP A;  2I79 A;  2REE A;  1P0H A;  2ARH A;  4JD6 A;  4OAE A;  4PSX A;  2OZU A;  4RS2 A;  4NSQ A;  1XF8 A;  4KVM E;  5BWA B;  4X5K A;  3B8G A;  1I12 A;  3R95 A;  3V8I A;  2B4D B;  2D4O A;  4KVO E;  1VKC A;  5AG7 A;  4B5O A;  4U5Y A;  2B5G B;  1QSM A;  2ZXV A;  2A4N A;  5AG5 A;  2Z3K A;  4PSW A;  4AB7 A;  1M4G A;  4PK3 A;  1Z9U A;  2Z11 A;  3I3G A;  4KOW A;  1S7K A;  2B4D A;  4B10 A;  3S6F A;  4C2Y A;  2KCW A;  3BJ7 A;  4I49 A;  1WK4 A;  2FCK A;  5I0C A;  2B5G A;  3TOA A;  4F0X A;  1PUA A;  1CJW A;  4Q36 A;  4AG9 A;  2Q4Y A;  4HNX B;  4FD6 A;  1S7L A;  3IU2 A;  2OU2 A;  2RC4 A;  3WR7 A;  4AG7 A;  4K30 A;  3IU1 A;  4UCN A;  2HUZ A;  3GY9 A;  1YK3 A;  5E96 A;  4U9Z A;  1YLE A;  4KOT A;  5DWN A;  3PP9 A;  3EXN A;  2VI7 A;  1QST A;  3R9G A;  4NXY A;  2FXF A;  2JEV A;  1YX0 A;  4A32 A;  3ZZI A;  4M3S A;  3QAH A;  2GIV A;  4ZBG A;  4YFJ A;  4PV6 A;  2OH1 A;  4E0A A;  4AVC A;  1FY7 A;  4C7I A;  4LUA A;  5HH1 A;  3LD2 A;  1BOB A;  4M85 A;  1IYK A;  2JDC A;  4UFW A;  2YGW A;  4MY3 A;  1L0C A;  3CXQ A;  2WUU A;  3MGD A;  2ZW5 A;  2FE7 A;  3FYN A;  4MFK A;  2O28 A;  3C26 A;  5EC4 A;  2J8R A;  3UY5 A;  4KOS A;  5JPH A;  3LOD A;  3TFY A;  4HNY B;  2CY2 A;  2PSW A;  4MFL A;  1P4N A;  2FL4 A;  2PDO A;  4JWP A;  4CGL A;  2PQ8 A;  1Y7R A;  4UCP A;  2YNC A;  3VWD A;  3D3S A;  4UFX A;  4DNC A;  1KUX A;  3FIX A;  4II9 A;  4NF1 A;  3RYO A;  3TT2 A;  2DXQ A;  1S7F A;  2VQY A;  3IWG A;  4CAV A;  1MJ9 A;  4H89 A;  3DNS A;  4CAE A;  4PK2 A;  2FS5 A;  4H6U A;  1YRE A;  4FD5 A;  3TO7 A;  2CXA A;  3JUW A;  3N7Z A;  1Q2D A;  3OWC A;  4KOR A;  5CNP A;  2JDD A;  1S7N A;  5FVJ A;  4XPK A;  2P6F A;  5A28 A;  1KUV A;  4LX9 A;  1Q2C A;  4UCM A;  4XPL A;  2P6E A;  4QB9 A;  4JXQ A;  2GAN A;  1GHE A;  2B58 A;  1IID A;  2Z3O A;  1PU9 A;  4FD7 A;  2Z0Z A;  3CXS A;  1MJB A;  4UBR A;  2Z3P A;  2Q0Y A;  3KKW A;  4CRZ B;  4CYN A;  4B12 A;  2YNC C;  1Z4R A;  2GE3 A;  4KOX A;  2R8V A;  2PR8 A;  3DR8 A;  4OAD A;  2ATR A;  5G1Z A;  4KLW A;  5IV0 A;  5KTD A;  4XNH C;  4HKF A;  2BL1 A;  4IF5 A;  5IB0 A;  2ZW7 A;  4MFJ A;  2G3A A;  3R1K A;  4F0Y A;  1TIQ A;  4MJ8 A;  3D2M A;  1M4D A;  2C27 A;  5GCN A;  2CNT A;  3PZJ A;  1V0C A;  3JVN A;  4R87 A;  2OB0 A;  2QML A;  4KSF A;  5G20 A;  1NE9 A;  4CRY B;  2OZH A;  3P2H A;  4C2Z A;  4B14 A;  1OZP A;  3EY5 A;  4KVX A;  4QUS A;  2DPT A;  3F0A A;  3R9E A;  2F5I A;  2G3T A;  2VBQ A;  1VHS A;  3TE4 A;  2G0B A;  3ZJ0 A;  1MK4 A;  4KZT A;  2BEI A;  5ISV A;  3QB8 A;  4JJX A;  3IWE A;  3K9U A;  1NSL A;  3SXO A;  2DPS A;  1ZO0 A;  4R3L A;  1Y9K A;  4KOU A;  3EC4 A;  4B13 A;  5H86 A;  5F48 A;  1S3Z A;  1Q2Y A;  5H84 A;  2PRB A;  4CYO A;  4A2Z A;  1XE4 A;  4A31 A;  1I21 A;  3FB3 A;  5AGE A;  2PR1 A;  3GKR A;  2NMT A;  5J8F A;  4CGP A;  3A9L A;  3TOB A;  4CYP A;  1M44 A;  3BLN A;  2D4P A;  1B87 A;  1IB1 E;  3DSB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...