4MBUA

Crystal structure of n-acetyltransferase from staphylococcus aureus mu50
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
165
structure length
165
Chain Sequence
b'SNAMIRCAKKEDLNAILAIYNDAIINTTAVYTYKPQTIDERIAWFETKQRNHEPIFVFEENGSVLGFATFGSFRPWPAYQYTIEHSIYVDASARGKGIASQLLQRLIVEAKAKGYRTLVAGIDASNEASIKLHQKFNFKHAGTLTNVGYKFDYWLDLAFYELDLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Similar to N-acetyltransferase
publication title Structural characterization of a Gcn5-related N-acetyltransferase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
total genus 48
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mbuA00
3TO6A 2FSRA 2B4DB 2G0BA 1VHSA 3EC4A 4CAXA 1M44A 1MJAA 1U6MA 4GS4A 1S7FA 2IL4A 2HUZA 3CXSA 4MJ8A 5HMNA 2FS5A 3TO9A 1KUVA 5C82A 2C27A 4KUAA 3SXNA 4PSXA 5J8FA 4AVBA 4H89A 4NEXA 2Z11A 4FD7A 2DXQA 3PGPA 3FBUA 2ARHA 1PUAA 4YFJA 5H84A 2PR8A 4ONUA 2FXFA 2CNTA 2EUIA 1BOBA 1SQHA 4Y49C 3FRMA 3S6GA 5IB0A 3E0KA 3I9SA 1MJBA 3K9UA 4E2AA 1XF8A 3DR6A 4YRHA 4MBUA 3S6HA 1XMTA 2VZZA 5CNPA 1YR0A 1NSLA 4CAVA 3TFYA 2G3TA 3T9YA 2JDDA 1TIQA 1YVOA 2PRBA 4XPDC 2PC1A 1Y9WA 1GHEA 2BEIA 4PV6A 2JLMA 4IF5A 1I21A 2VZYA 3DDDA 3B8GA 4CRZB 2B4DA 4KUBA 4R57A 2ZW4A 2Q44A 4CS0B 5F47A 4FD6A 4II9A 4ZBGA 3W6XA 4YGOA 3R96A 1Q2CA 2Z0ZA 4UWIA 2F5IA 4X5KA 5DWMA 2OB0A 2OU2A 4QBJA 4KOYA 4PK3A 2REEA 4AVCA 2AJ6A 5E96A 3DSBA 4B5PB 2X7BA 4JXQA 3TE4A 3G8WA 2QIRA 2B3VA 4KOSA 3F0AA 3DNSA 1S5KA 2P6EA 4FD4A 3S6FA 2Q4YA 1NE9A 4JLYA 4CRYB 3R1KA 4QVTA 4MI4A 1XEBA 5ISVA 5FVJA 1S3ZA 4CAWA 5H86A 3R9FA 2K5TA 3EO4A 4R87A 2QECA 1YLEA 4RS2A 2Q4VA 4R9MA 1N71A 4ORFA 2PDOA 1RXTA 2Q0YA 4KLWA 3LD2A 1QSTA 4KOUA 3BJ8A 4K30A 4U9YA 1L0CA 4U9ZA 1WWZA 5F49A 4I49A 4RI1A 1BO4A 4L89A 1IB1E 5IX3A 1YK3A 2R1IA 3TOAA 2CNMA 2FL4A 4B5OA 1YREA 4F0YA 3FYNA 1XE4A 2BSWA 3G3SA 1ON0A 5GCNA 2O28A 5KTAA 3CXQA 3W91A 3C26A 4QUSA 1S60A 1M4IA 1Y7RA 3QB8A 3V8IA 4B5PA 4NCZA 5IV0A 5DWNA 3FXTA 1VKCA 3WR7A 2Y0MA 3EXNA 2A4NA 3S6KA 3D8PA 2OZGA 2J8NA 2REFA 2R98A 3VWEA 2B58A 4HKFA 2P6FA 2B5GA 3P2FA 2H5MA 1V0CA 4KOTA 4E8OA 4UA3A 1QSOA 2FIWA 3SXOA 1Z9UA 2R8VA 4JWPA 4XNHB 3GY9A 2OZHA 3NE7A 4L8AA 2HV2A 3DR8A 1YVKA 3JVNA 3TOBA 1Y9KA 4XPLA 1K4JA 3R95A 2ZW5A 2NMTA 1QSRA 1UFHA 2GANA 4HNWB 3GYAA 3QAHA 2D4PA 3F8KA 1IYLA 1Z4EA 3EFAA 2Q04A 4KZTA 2D4OA 2RC4A 4KORA 2VI7A 4E0AA 3IWGA 4H6UA 3W6SA 4PSWA 1WK4A 3FIXA 1XIXA 4OADA 2B5GB 4QB9A 1NMTA 2VXKA 3TO7A 5C88A 3D3SA 4MY0A 2QMLA 4JJXA 4NXYA 2OH1A 2ZW7A 2JDCA 2I79A 4KOVA 1QSNA 4UBRA 1RO5A 1FY7A 3TTHA 4KLVA 3F5BA 3CXPA 1S7KA 2J8MA 4IUSA 2EVNA 1PU9A 2P0WA 3PP9A 4M3SA 2GE3A 2BUEA 3LODA 2G3AA 4KVOE 3R9GA 4EVYA 3D2MA 2VEZA 4AG7A 2FIAA 2ZW6A 4U5YA 4M85A 4OLLA 1Q2DA 1YX0A 4FD5A 1I12A 2WPXA 3KKWA 3MGDA 2KCWA 3BJ7A 4Y49B 3N7ZA 2R7HA 1QSMA 4LUAA 2WPWA 2FT0A 3GKRA 4AVAA 2ZXVA 4H6ZA 3H4QA 5KTDA 3FNCA 4HNYB 2FCKA 1P0HA 4DNCA 3BLNA 5KTCA 4JXRA 4KOWA 3PZJA 3VWDA 2PSWA 3RYOA 4XPDB 4PK2A 1YGHA 3TCVA 3TT2A 4KVXA 2I00A 1LRZA 1M1DA 1B87A 1KZFA 2PR1A 1S7NA 1CM0A 3ZZIA 2P6GA 1I1DA 2CNSA 1P4NA 2VQYA 4KOXA 1R57A 5J8CA 3FB3A 4NSQA 3IGRA 3OWCA 4XPKA 5EBVA 1KUYA 4UWJA 4KVME 3JUWA 2Q7BA 5HH1A 1MK4A 1S7LA 5EC4A 3D2PA 4AB7A 3R9EA 4LX9A 1J4JA 2PQ8A 3P2HA 4MHDA 4NF1A 3T90A 2Z10A 2CY2A 3EY5A 4F6AA 4XNHC 1IIDA 1KUXA 4R3LA 2HQYA 1OZPA 2JEVA 2FE7A 1CJWA 2ZPAA 2B3UA 2OZUA 4J3GA 2VBQA 5F46A 2B4BA 1B6BA 5I0CA 1M4GA 2ATRA 1M4DA 4QC6A 1IYKA 1IICA 2AE6A 4JD6A 3UY5A 2J8RA 2BL1A 3SHPA 4AG9A 1Q2YA 3I3GA 4OAEA 1MJ9A 1Z4RA 4HNXB 5F48A 4BMHA 5JPHA 3ZJ0A 4R3KA 2GIVA 4MY3A 5JQ4A
chains in the Genus database with same CATH superfamily
3TO6A 2FSRA 2B4DB 2G0BA 1VHSA 3EC4A 4CAXA 1MJAA 1M44A 3D66A 3FECA 1U6MA 4GS4A 1S7FA 2IL4A 2HUZA 1LAMA 2C6GA 3CXSA 4MJ8A 2NYQA 5HMNA 2WZNA 2FS5A 4YU9A 3TO9A 3WC7A 5EMIA 3LACA 4OC1A 4R8FA 1KUVA 5C82A 2PJ9A 2C27A 4UCMA 2C6CA 2V8VA 3B3TA 4KUAA 3SXNA 4ZYQA 2ZEFA 3PB6X 4K3NA 3T8WA 3WC5A 1VHEA 1ELLP 5G21A 4PSXA 5J8FA 4AVBA 4H89A 4NEXA 3GUXA 2Z11A 4FD7A 4BINA 3L2NA 4P45A 2DXQA 3PGPA 3VARA 3FBUA 2ARHA 1PUAA 2J9AA 5H84A 5LRGA 4YFJA 2PR8A 4ONUA 4PXBA 2FXFA 3VATA 1ARMA 2NSMA 2CNTA 2EUIA 4GXHA 1XMBA 1BOBA 1H8LA 4BBHA 1DE4C 2EO8A 3IWWA 1SQHA 4Y49C 4A38A 3FRMA 4M6GA 2Z3PA 3S6GA 4P4IA 4Q36A 5IB0A 1A2ZA 3E0KA 4UIAA 5BWAB 3I9SA 1MJBA 3K9UA 5I4MA 4NGMA 4YWYA 2F7VA 1XF8A 3DR6A 3KHZA 4RN7A 4E2AA 3DGVA 1VHOA 4YRHA 2V8GA 7CPAA 2PJ0A 4MBUA 4PXCA 2Z3NA 4UFVA 3LMSA 4NGPA 1XMTA 3S6HA 4A2ZA 4UEEA 4ZY0A 2VZZA 5CNPA 1YR0A 1NSLA 4CAVA 3B35A 2YNDA 4MCSA 3TFYA 4P6YA 2G3TA 1YQEA 1Z8LA 4MCRA 3T9YA 2JDDA 1DTDA 1FT7A 1TIQA 1YVOA 2PRBA 1HEEA 1ZG8A 3BHXA 4XPDC 1Z8WA 2PC1A 5AGEA 4LQGA 1Y9WA 1GHEA 2GLJA 5IB9A 1Y0YA 1CPSA 3B7IA 3KQZA 4X2TA 2BEIA 4PV6A 8CPAA 2JLMA 2IQ6A 3K2KA 3I1UA 5A27A 4IF5A 4NFRA 2PCUA 1Y0RA 4OMEA 1I21A 2G9DA 1R3NA 2VZYA 2PIYA 3DDDA 3B8GA 4P4FA 4CRZB 2QVPA 2B4DA 2DF5A 2ZOFA 3V38A 3RZAA 2PJAA 4KUBA 4R57A 4F0XA 3ISZA 2ZW4A 2AFXA 2Q44A 1BLLE 3PBEA 1ZLIA 4CS0B 4Z65A 4OC5A 2PVVA 4A30A 5LYDA 4ZI6A 1FNOA 4MXUA 4P10A 5CPAA 4OC0A 5F47A 4FD6A 4BD9A 2CF4A 4II9A 1AUGA 2Q7SA 5ELYA 3BXMA 2ZEOA 4Q7AA 4B13A 4ZBGA 3W6XA 3GLJA 4YGOA 4UEZA 1Q7LA 2EWBA 5D8NA 3PB7X 3R96A 1Q2CA 4FBEA 2Z0ZA 4UWIA 5CBMA 3KI9A 4ZX9A 4PPZA 3KQXA 2F5IA 2ZEHA 4X5KA 5DWMA 1TF8A 2OB0A 4MCQA 3GB0A 2OU2A 4QBJA 4RUHA 2O4HA 2ZEEA 4ZX8A 2I3CA 4KOYA 4PK3A 2REEA 4Q38A 4AVCA 4B6ZA 2AJ6A 5E96A 3DSBA 4B5PB 1BPMA 4PQAA 2X7BA 3PFOA 4EWTA 4KSAA 4OIDA 3H8EA 1HDUA 4JXQA 3TE4A 4CYNA 3G8WA 1YW4A 2QIRA 4IHMA 3NE8A 2B3VA 2C1CA 4KOSA 3MN8A 2ZEPA 2PJ4A 2RFHA 4CGMA 5G20A 1F2PA 3F0AA 1ZO0A 3DNSA 5IV0A 3B3WA 4A37A 1S5KA 4MMOA 1XRYA 4UF4A 3PBBA 4A95A 2P6EA 4NJRA 4FD4A 2QJ8A 2HC9A 2BOAA 3RNZA 3S6FA 2Q4YA 4DUKA 3B3CA 1JQGA 1NE9A 4JLYA 4CRYB 3R1KA 4QVTA 3S9LA 4UCPA 4MI4A 4C68A 2QYVA 5LYFA 1XEBA 1XFOA 2O53A 5K8MA 5ISVA 2POKA 5FVJA 2CXAA 3VH9A 3KL9A 2AFOA 2GREA 1S3ZA 4CAWA 3A9LA 4O23A 3KR4A 3KZWA 5AG5A 4ZGYB 5H86A 2YNCA 3RAMA 3R9FA 2K5TA 1X12A 3EO4A 1VGYA 3BI0A 4R87A 2QECA 1YLEA 3GIUA 4RS2A 2Q4VA 2PJ8A 2ZELA 4R9MA 2RB7A 1N71A 2JBKA 2PDOA 1RXTA 2Q0YA 3IO1A 4KLWA 2WUUA 3LD2A 4ORFA 1QSTA 4UFWA 4DJLA 4KOUA 3CDXA 3BJ8A 4K30A 4JZ0A 2GU2A 3IJ3A 1F57A 1L0CA 4U9YA 3KGQA 4OC2A 4U9ZA 3RBUA 4CAFA 1WWZA 2ZEMA 2VL1A 4P4JA 4I49A 4RI1A 1BO4A 3CZXA 2Q51A 5DS0A 5F49A 1ZLHA 2PJCA 3D4UA 3D7FA 3FJUA 4L89A 3SJXA 1IB1E 1Z8XA 1YK3A 1TXRA 2YGWA 3IFEA 5IX3A 2R1IA 3TOAA 2CNMA 2FL4A 3RO0A 2ANPA 4B5OA 4NGQA 5A28A 3S9NA 1YREA 2BCOA 4MFZA 4F0YA 3FYNA 4UIBA 1XE4A 2BSWA 3CPAA 3G3SA 1ON0A 5GCNA 1LAPA 2O28A 3PEIA 2WSAA 4TWEA 5D29A 5KTAA 3CXQA 2PJBA 4PXDA 3W91A 1Z2LA 3C26A 1S60A 1M4IA 1Y7RA 3PFEA 3QB8A 4QUSA 4NCZA 2AFWA 3FX6A 3V8IA 4B5PA 5DWNA 4CGOA 2AFMA 3FXTA 1CP7A 3FF3A 1VKCA 3B3VA 2Z3OA 3IWEA 5AG7A 3WR7A 2Y0MA 2PJ5A 3CPXA 3EXNA 2A4NA 2ABZA 3S6KA 4KS9A 3HLPA 1Z8TA 3D8PA 3IU1A 4R7MA 2OZGA 4F8ZA 1CBXA 2J8NA 2REFA 6CPAA 2CIJA 2R98A 4P4DA 3NH4A 2Z3LA 4H2KA 4C2ZA 3VWEA 5HXDA 4CAEA 3NA6A 3KHXA 2B58A 4HKFA 2IMOA 2B5GA 2P6FA 3QAYA 3SJEA 4JYWA 4EFDA 1IOFA 4MFJA 2YNEA 1NSAA 3P2FA 2H5MA 1V0CA 4KOTA 4C2XA 4E8OA 4UA3A 1QSOA 2V8DA 4M6IA 5F09A 2FIWA 3SXOA 1Z9UA 2R8VA 4UCNA 2YNCC 2BO9A 4NGNA 4JWPA 4PXEA 4WJBA 4XNHB 3N5FA 2F8HA 1AMPA 2GLFA 3GY9A 2OZHA 3NE7A 4L8AA 2HV2A 3DR8A 3ISXA 3IU2A 1IOIA 1YVKA 1R43A 3JVNA 4NGTA 1Y9KA 1IU8A 3K9TA 1K4JA 4XPLA 3TOBA 1RTQA 2ZW5A 2NMTA 1QSRA 4OC3A 3R95A 3IC1A 4B11A 1UFHA 2GANA 1IY7A 1CX8A 3GYAA 3QAHA 4HNWB 2PJ3A 4FUUA 5J1QA 1YLOA 4F9VA 1EE3P 3SJGA 2D4PA 4KSFA 3NH8A 4MFPA 5G22A 5G1ZA 2JEWA 2AFUA 3F8KA 1IYLA 1Z4EA 3EFAA 2Q04A 2V77A 4KZTA 4ONWA 1LFWA 1IGBA 2D4OA 2RC4A 3FEEA 4KORA 2VI7A 4E0AA 2ODFA 4MFLA 1AYEA 3IWGA 4H6UA 1BAVA 3W6SA 2XEJA 2V8HA 1F2OA 4PSWA 1WK4A 3FH4A 4NJQA 3NFZA 3IIBA 1PYTB 1TKHA 4CYQA 4FWUA 3WT4A 4KSIA 5HVHA 3FIXA 1XJOA 4UEFA 1XIXA 4OADA 1YSJA 5LRKA 5K8NA 2B5GB 4WWVA 2HB6A 4QB9A 1NMTA 2VXKA 1XOVA 1YW6A 4P4BA 3TO7A 4CPAA 3D3SA 2ZENA 4CGPA 5C88A 4MY0A 3TC8A 2QMLA 4JJXA 3FVLA 4NXYA 1ELMP 2OH1A 2GFQA 2JDCA 2I79A 2ZW7A 1QSNA 4KOVA 4X8IA 4UBRA 3SI2A 4AXVA 1OBRA 1RO5A 1FY7A 3TTHA 1QQ9A 4KLVA 3F5BA 3CXPA 3LWUA 4A39A 4MFQA 3KR5A 1S7KA 2J8MA 2XEIA 4IUSA 2EVNA 3D7DA 1PU9A 2P0WA 3PP9A 4M3SA 5K8OA 4CYPA 2GE3A 3B2YA 2OOTA 1VIXA 2BUEA 2G3AA 3LODA 4KVOE 3R9GA 4EVYA 3D2MA 2VEZA 2DEAA 4AG7A 2FIAA 4B10A 2ZW6A 4R76A 4U5YA 4M85A 5LYIA 5LYLA 2Z3MA 1Q2DA 4OLLA 4CGLA 4MHNA 3PB9X 3H8FA 1YX0A 4FD5A 1I12A 2DPTA 2WPXA 3KKWA 3MGDA 2EK9A 2KCWA 3BJ7A 4C7IA 1TKJA 3PB8X 3QNVA 4G1PA 4MHPA 3HUVA 4Y49B 3N7ZA 2R7HA 1QSMA 4LUAA 2WPWA 2FT0A 3GKRA 5THWA 4AVAA 3H5ZA 2ZXVA 2PIZA 1QMUA 4GM5A 4H6ZA 3H4QA 5KTDA 4X3RA 3FNCA 4HNYB 3WABA 2IJZA 2FCKA 4ZY1A 2PJ2A 4EMEA 1GYTA 1P0HA 2AFZA 2PJ7A 4DNCA 4B14A 4A94A 1KWMA 3BLNA 5KTCA 4M6HA 5LRJA 4DYOA 4JXRA 3D68A 1ARLA 4KOWA 4OP4A 4HPSA 3PZJA 1X10A 4FAIA 3VWDA 2PSWA 1M4LA 3RYOA 3MRUA 4XPDB 4PK2A 3D7GA 1YGHA 3TCVA 3TT2A 4KVXA 2I00A 3JRUA 3PRTA 1LRZA 4IAVA 1BPNA 4UFXA 5JH9A 3SJFA 1YMEA 1PCAA 3H8GA 1M1DA 3CT9A 1B87A 1KZFA 2PR1A 3BI1A 2PRQA 1S7NA 1CM0A 5JM6A 3TX8A 3ZZIA 2JBJA 2P6GA 1I1DA 1LCPA 2CNSA 1P4NA 2VQYA 4KOXA 1R57A 5J8CA 2ZOGA 3FB3A 4NSQA 3IGRA 3OWCA 4XPKA 2FVGA 5EBVA 3SI0A 2AFSA 1KUYA 4UWJA 4KVME 3JUWA 2ZEDA 4R6TA 1TKFA 2Q7BA 2EBJA 2PE3A 1LOKA 1CPXA 1ZG7A 5HH1A 1MK4A 1S7LA 1ZG9A 5EC4A 3D2PA 3FMCA 4AB7A 5JGFA 2Q4ZA 5HVFA 4A33A 3R9EA 4LX9A 2XEGA 1J4JA 2PQ8A 4LQ6A 3P2HA 4MHDA 4NF1A 4TNUA 2PJ1A 2DPSA 3KASA 3T90A 3JTKA 2Z10A 2CY2A 2OR4A 4P44A 3EY5A 4P4EA 3SI1A 4F6AA 5AG6A 4XNHC 3FEDA 3S9MA 4B12A 1Z5RA 1IIDA 1KUXA 4MCPA 4NGRA 4R3LA 2HQYA 2CTCA 4W9YA 1OZPA 2JEVA 4A32A 4OIWA 3IEHA 2FE7A 1CJWA 4IK2A 4CGNA 2ZPAA 2PVWA 4OC4A 2XEFA 2B3UA 4OKOA 1CG2A 2OZUA 4J3GA 2VBQA 2Q43A 4MFKA 1LANA 5F46A 2B4BA 2WYRA 4A31A 4C2YA 4NGSA 3NH5A 1B6BA 5I0CA 1JWQA 2CTBA 1M4GA 1TF9A 2ATRA 4CYOA 1M4DA 3D7HA 1HDQA 4QC6A 2C6PA 1IYKA 1IICA 2AE6A 4MHZA 4F9UA 4JD6A 3UY5A 2J8RA 2BL1A 2PJ6A 3SHPA 4AG9A 3DLJA 4MHYA 3D67A 5K8PA 4ZY2A 1Q2YA 1CP6A 3I3GA 2ZEGA 4OAEA 1MJ9A 1Z4RA 1XBUA 4HNXB 5F48A 1Y7EA 5AG4A 4BMHA 5JPHA 3V7ZA 3ZJ0A 3WC6A 4R3KA 2GIVA 5HVGA 4C7HA 2EK8A 2Z3KA 4MRIA 4MY3A 1UWYA 5JQ4A 3B3SA 3PB4X
chains in the Genus database with same CATH topology
3TO6A 2FSRA 2B4DB 2G0BA 1VHSA 3EC4A 4CAXA 1M44A 1MJAA 1U6MA 4GS4A 1S7FA 2IL4A 2HUZA 3CXSA 4MJ8A 5HMNA 2FS5A 3TO9A 1KUVA 5C82A 2C27A 4UCMA 4KUAA 3SXNA 5G21A 4PSXA 5J8FA 4AVBA 4H89A 4NEXA 2Z11A 4FD7A 2DXQA 3PGPA 3FBUA 2ARHA 1PUAA 4YFJA 5H84A 2PR8A 4ONUA 2FXFA 2CNTA 2EUIA 1BOBA 4BBHA 1SQHA 4Y49C 3FRMA 2Z3PA 3S6GA 4Q36A 5IB0A 3E0KA 5BWAB 3I9SA 1MJBA 3K9UA 4E2AA 1XF8A 3DR6A 4YRHA 4MBUA 3S6HA 4UFVA 2Z3NA 4A2ZA 1XMTA 2VZZA 5CNPA 1YR0A 1NSLA 4CAVA 2YNDA 3TFYA 2G3TA 3T9YA 2JDDA 1TIQA 1YVOA 2PRBA 4XPDC 2PC1A 5AGEA 1Y9WA 1GHEA 2BEIA 4PV6A 2JLMA 5A27A 4IF5A 1I21A 2VZYA 3DDDA 3B8GA 4CRZB 2B4DA 4KUBA 4R57A 4F0XA 2ZW4A 2Q44A 4CS0B 4A30A 5F47A 4FD6A 4II9A 4B13A 4ZBGA 3W6XA 4YGOA 3R96A 1Q2CA 2Z0ZA 4UWIA 2F5IA 4X5KA 5DWMA 2OB0A 2OU2A 4QBJA 4KOYA 4PK3A 2REEA 4Q38A 4AVCA 2AJ6A 5E96A 3DSBA 4B5PB 2X7BA 4KSAA 4JXQA 3TE4A 4CYNA 3G8WA 2QIRA 2B3VA 4KOSA 4CGMA 5G20A 3F0AA 1ZO0A 3DNSA 1S5KA 4A95A 2P6EA 4FD4A 3S6FA 2Q4YA 1NE9A 4JLYA 4CRYB 3R1KA 4QVTA 4UCPA 4MI4A 4C68A 1XEBA 5ISVA 5FVJA 2CXAA 1S3ZA 4CAWA 3A9LA 5AG5A 4ZGYB 5H86A 2YNCA 3R9FA 2K5TA 3EO4A 4R87A 2QECA 1YLEA 4RS2A 2Q4VA 4R9MA 1N71A 4ORFA 2PDOA 1RXTA 2Q0YA 4KLWA 4B12A 2WUUA 3LD2A 4UFWA 1QSTA 4KOUA 3BJ8A 4K30A 4U9YA 1L0CA 4U9ZA 4CAFA 1WWZA 5F49A 4I49A 4RI1A 1BO4A 4L89A 1IB1E 2YGWA 1YK3A 5IX3A 2R1IA 3TOAA 2CNMA 2FL4A 4B5OA 5A28A 1YREA 4MFZA 4F0YA 3FYNA 1XE4A 2BSWA 3G3SA 1ON0A 5GCNA 2O28A 2WSAA 5KTAA 3CXQA 3W91A 3C26A 4QUSA 1S60A 1M4IA 1Y7RA 3QB8A 3V8IA 4B5PA 4NCZA 5IV0A 4CGOA 5DWNA 3FXTA 1VKCA 2Z3OA 3IWEA 5AG7A 3WR7A 2Y0MA 3EXNA 2A4NA 3S6KA 4KS9A 3D8PA 3IU1A 2OZGA 2J8NA 2REFA 2R98A 2Z3LA 4C2ZA 3VWEA 4CAEA 2B58A 4HKFA 2P6FA 2B5GA 4MFJA 2YNEA 3P2FA 2H5MA 1V0CA 4KOTA 4C2XA 4E8OA 4UA3A 1QSOA 2FIWA 3SXOA 1Z9UA 2R8VA 4UCNA 2YNCC 4JWPA 4XNHB 3GY9A 2OZHA 3NE7A 4L8AA 2HV2A 3DR8A 3IU2A 1YVKA 3JVNA 3TOBA 1Y9KA 4XPLA 1K4JA 3R95A 2ZW5A 2NMTA 1QSRA 4B11A 1UFHA 2GANA 4HNWB 3GYAA 3QAHA 2D4PA 4KSFA 4MFPA 5G22A 5G1ZA 3F8KA 1IYLA 1Z4EA 3EFAA 2Q04A 4KZTA 2D4OA 2RC4A 4KORA 2VI7A 4E0AA 4MFLA 3IWGA 4H6UA 3W6SA 4PSWA 1WK4A 4CYQA 3FIXA 1XIXA 4OADA 2B5GB 4QB9A 1NMTA 2VXKA 3TO7A 5C88A 3D3SA 4CGPA 4MY0A 2QMLA 4JJXA 4NXYA 2OH1A 2ZW7A 2JDCA 2I79A 4KOVA 1QSNA 4UBRA 1RO5A 1FY7A 3TTHA 4KLVA 3F5BA 3CXPA 4MFQA 1S7KA 2J8MA 4IUSA 2EVNA 1PU9A 2P0WA 3PP9A 4M3SA 4CYPA 2GE3A 2BUEA 3LODA 2G3AA 4KVOE 3R9GA 4EVYA 3D2MA 2VEZA 4AG7A 2FIAA 4B10A 2ZW6A 4U5YA 4M85A 2Z3MA 1Q2DA 4OLLA 4CGLA 1YX0A 4FD5A 1I12A 2DPTA 2WPXA 3KKWA 3MGDA 2KCWA 3BJ7A 4C7IA 4Y49B 3N7ZA 2R7HA 1QSMA 4LUAA 2WPWA 2FT0A 3GKRA 4AVAA 3H5ZA 2ZXVA 4H6ZA 3H4QA 5KTDA 3FNCA 4HNYB 2FCKA 1P0HA 4DNCA 4B14A 3BLNA 5KTCA 4JXRA 4KOWA 3PZJA 3VWDA 2PSWA 3RYOA 4XPDB 4PK2A 1YGHA 3TCVA 3TT2A 4KVXA 2I00A 1LRZA 4UFXA 1M1DA 1B87A 1KZFA 2PR1A 1S7NA 1CM0A 3ZZIA 2P6GA 1I1DA 2CNSA 1P4NA 2VQYA 4KOXA 1R57A 5J8CA 3FB3A 4NSQA 3IGRA 3OWCA 4XPKA 5EBVA 1KUYA 4UWJA 4KVME 3JUWA 2Q7BA 5HH1A 1MK4A 1S7LA 5EC4A 3D2PA 4AB7A 4A33A 3R9EA 4LX9A 1J4JA 2PQ8A 3P2HA 4MHDA 4NF1A 2DPSA 3T90A 3JTKA 2Z10A 2CY2A 3EY5A 4F6AA 5AG6A 4XNHC 1IIDA 1KUXA 4R3LA 2HQYA 1OZPA 2JEVA 4A32A 2FE7A 1CJWA 4CGNA 2ZPAA 2B3UA 2OZUA 4J3GA 2VBQA 4MFKA 5F46A 2B4BA 4A31A 4C2YA 1B6BA 5I0CA 1M4GA 2ATRA 4CYOA 1M4DA 4QC6A 1IYKA 1IICA 2AE6A 4JD6A 3UY5A 2J8RA 2BL1A 3SHPA 4AG9A 1Q2YA 3I3GA 4OAEA 1MJ9A 1Z4RA 4HNXB 5F48A 5AG4A 4BMHA 5JPHA 3ZJ0A 4R3KA 2GIVA 4C7HA 2Z3KA 4MY3A 5JQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TO6 A;  2FSR A;  2B4D B;  2G0B A;  1VHS A;  3EC4 A;  4CAX A;  1M44 A;  1MJA A;  1U6M A;  4GS4 A;  1S7F A;  2IL4 A;  2HUZ A;  3CXS A;  4MJ8 A;  5HMN A;  2FS5 A;  3TO9 A;  1KUV A;  5C82 A;  2C27 A;  4KUA A;  3SXN A;  4PSX A;  5J8F A;  4AVB A;  4H89 A;  4NEX A;  2Z11 A;  4FD7 A;  2DXQ A;  3PGP A;  3FBU A;  2ARH A;  1PUA A;  4YFJ A;  5H84 A;  2PR8 A;  4ONU A;  2FXF A;  2CNT A;  2EUI A;  1BOB A;  1SQH A;  4Y49 C;  3FRM A;  3S6G A;  5IB0 A;  3E0K A;  3I9S A;  1MJB A;  3K9U A;  4E2A A;  1XF8 A;  3DR6 A;  4YRH A;  4MBU A;  3S6H A;  1XMT A;  2VZZ A;  5CNP A;  1YR0 A;  1NSL A;  4CAV A;  3TFY A;  2G3T A;  3T9Y A;  2JDD A;  1TIQ A;  1YVO A;  2PRB A;  4XPD C;  2PC1 A;  1Y9W A;  1GHE A;  2BEI A;  4PV6 A;  2JLM A;  4IF5 A;  1I21 A;  2VZY A;  3DDD A;  3B8G A;  4CRZ B;  2B4D A;  4KUB A;  4R57 A;  2ZW4 A;  2Q44 A;  4CS0 B;  5F47 A;  4FD6 A;  4II9 A;  4ZBG A;  3W6X A;  4YGO A;  3R96 A;  1Q2C A;  2Z0Z A;  4UWI A;  2F5I A;  4X5K A;  5DWM A;  2OB0 A;  2OU2 A;  4QBJ A;  4KOY A;  4PK3 A;  2REE A;  4AVC A;  2AJ6 A;  5E96 A;  3DSB A;  4B5P B;  2X7B A;  4JXQ A;  3TE4 A;  3G8W A;  2QIR A;  2B3V A;  4KOS A;  3F0A A;  3DNS A;  1S5K A;  2P6E A;  4FD4 A;  3S6F A;  2Q4Y A;  1NE9 A;  4JLY A;  4CRY B;  3R1K A;  4QVT A;  4MI4 A;  1XEB A;  5ISV A;  5FVJ A;  1S3Z A;  4CAW A;  5H86 A;  3R9F A;  2K5T A;  3EO4 A;  4R87 A;  2QEC A;  1YLE A;  4RS2 A;  2Q4V A;  4R9M A;  1N71 A;  4ORF A;  2PDO A;  1RXT A;  2Q0Y A;  4KLW A;  3LD2 A;  1QST A;  4KOU A;  3BJ8 A;  4K30 A;  4U9Y A;  1L0C A;  4U9Z A;  1WWZ A;  5F49 A;  4I49 A;  4RI1 A;  1BO4 A;  4L89 A;  1IB1 E;  5IX3 A;  1YK3 A;  2R1I A;  3TOA A;  2CNM A;  2FL4 A;  4B5O A;  1YRE A;  4F0Y A;  3FYN A;  1XE4 A;  2BSW A;  3G3S A;  1ON0 A;  5GCN A;  2O28 A;  5KTA A;  3CXQ A;  3W91 A;  3C26 A;  4QUS A;  1S60 A;  1M4I A;  1Y7R A;  3QB8 A;  3V8I A;  4B5P A;  4NCZ A;  5IV0 A;  5DWN A;  3FXT A;  1VKC A;  3WR7 A;  2Y0M A;  3EXN A;  2A4N A;  3S6K A;  3D8P A;  2OZG A;  2J8N A;  2REF A;  2R98 A;  3VWE A;  2B58 A;  4HKF A;  2P6F A;  2B5G A;  3P2F A;  2H5M A;  1V0C A;  4KOT A;  4E8O A;  4UA3 A;  1QSO A;  2FIW A;  3SXO A;  1Z9U A;  2R8V A;  4JWP A;  4XNH B;  3GY9 A;  2OZH A;  3NE7 A;  4L8A A;  2HV2 A;  3DR8 A;  1YVK A;  3JVN A;  3TOB A;  1Y9K A;  4XPL A;  1K4J A;  3R95 A;  2ZW5 A;  2NMT A;  1QSR A;  1UFH A;  2GAN A;  4HNW B;  3GYA A;  3QAH A;  2D4P A;  3F8K A;  1IYL A;  1Z4E A;  3EFA A;  2Q04 A;  4KZT A;  2D4O A;  2RC4 A;  4KOR A;  2VI7 A;  4E0A A;  3IWG A;  4H6U A;  3W6S A;  4PSW A;  1WK4 A;  3FIX A;  1XIX A;  4OAD A;  2B5G B;  4QB9 A;  1NMT A;  2VXK A;  3TO7 A;  5C88 A;  3D3S A;  4MY0 A;  2QML A;  4JJX A;  4NXY A;  2OH1 A;  2ZW7 A;  2JDC A;  2I79 A;  4KOV A;  1QSN A;  4UBR A;  1RO5 A;  1FY7 A;  3TTH A;  4KLV A;  3F5B A;  3CXP A;  1S7K A;  2J8M A;  4IUS A;  2EVN A;  1PU9 A;  2P0W A;  3PP9 A;  4M3S A;  2GE3 A;  2BUE A;  3LOD A;  2G3A A;  4KVO E;  3R9G A;  4EVY A;  3D2M A;  2VEZ A;  4AG7 A;  2FIA A;  2ZW6 A;  4U5Y A;  4M85 A;  4OLL A;  1Q2D A;  1YX0 A;  4FD5 A;  1I12 A;  2WPX A;  3KKW A;  3MGD A;  2KCW A;  3BJ7 A;  4Y49 B;  3N7Z A;  2R7H A;  1QSM A;  4LUA A;  2WPW A;  2FT0 A;  3GKR A;  4AVA A;  2ZXV A;  4H6Z A;  3H4Q A;  5KTD A;  3FNC A;  4HNY B;  2FCK A;  1P0H A;  4DNC A;  3BLN A;  5KTC A;  4JXR A;  4KOW A;  3PZJ A;  3VWD A;  2PSW A;  3RYO A;  4XPD B;  4PK2 A;  1YGH A;  3TCV A;  3TT2 A;  4KVX A;  2I00 A;  1LRZ A;  1M1D A;  1B87 A;  1KZF A;  2PR1 A;  1S7N A;  1CM0 A;  3ZZI A;  2P6G A;  1I1D A;  2CNS A;  1P4N A;  2VQY A;  4KOX A;  1R57 A;  5J8C A;  3FB3 A;  4NSQ A;  3IGR A;  3OWC A;  4XPK A;  5EBV A;  1KUY A;  4UWJ A;  4KVM E;  3JUW A;  2Q7B A;  5HH1 A;  1MK4 A;  1S7L A;  5EC4 A;  3D2P A;  4AB7 A;  3R9E A;  4LX9 A;  1J4J A;  2PQ8 A;  3P2H A;  4MHD A;  4NF1 A;  3T90 A;  2Z10 A;  2CY2 A;  3EY5 A;  4F6A A;  4XNH C;  1IID A;  1KUX A;  4R3L A;  2HQY A;  1OZP A;  2JEV A;  2FE7 A;  1CJW A;  2ZPA A;  2B3U A;  2OZU A;  4J3G A;  2VBQ A;  5F46 A;  2B4B A;  1B6B A;  5I0C A;  1M4G A;  2ATR A;  1M4D A;  4QC6 A;  1IYK A;  1IIC A;  2AE6 A;  4JD6 A;  3UY5 A;  2J8R A;  2BL1 A;  3SHP A;  4AG9 A;  1Q2Y A;  3I3G A;  4OAE A;  1MJ9 A;  1Z4R A;  4HNX B;  5F48 A;  4BMH A;  5JPH A;  3ZJ0 A;  4R3K A;  2GIV A;  4MY3 A;  5JQ4 A; 
#chains in the Genus database with same CATH topology
 3TO6 A;  2FSR A;  2B4D B;  2G0B A;  1VHS A;  3EC4 A;  4CAX A;  1MJA A;  1M44 A;  3D66 A;  3FEC A;  1U6M A;  4GS4 A;  1S7F A;  2IL4 A;  2HUZ A;  1LAM A;  2C6G A;  3CXS A;  4MJ8 A;  2NYQ A;  5HMN A;  2WZN A;  2FS5 A;  4YU9 A;  3TO9 A;  3WC7 A;  5EMI A;  3LAC A;  4OC1 A;  4R8F A;  1KUV A;  5C82 A;  2PJ9 A;  2C27 A;  4UCM A;  2C6C A;  2V8V A;  3B3T A;  4KUA A;  3SXN A;  4ZYQ A;  2ZEF A;  3PB6 X;  4K3N A;  3T8W A;  3WC5 A;  1VHE A;  1ELL P;  5G21 A;  4PSX A;  5J8F A;  4AVB A;  4H89 A;  4NEX A;  3GUX A;  2Z11 A;  4FD7 A;  4BIN A;  3L2N A;  4P45 A;  2DXQ A;  3PGP A;  3VAR A;  3FBU A;  2ARH A;  1PUA A;  2J9A A;  5H84 A;  5LRG A;  4YFJ A;  2PR8 A;  4ONU A;  4PXB A;  2FXF A;  3VAT A;  1ARM A;  2NSM A;  2CNT A;  2EUI A;  4GXH A;  1XMB A;  1BOB A;  1H8L A;  4BBH A;  1DE4 C;  2EO8 A;  3IWW A;  1SQH A;  4Y49 C;  4A38 A;  3FRM A;  4M6G A;  2Z3P A;  3S6G A;  4P4I A;  4Q36 A;  5IB0 A;  1A2Z A;  3E0K A;  4UIA A;  5BWA B;  3I9S A;  1MJB A;  3K9U A;  5I4M A;  4NGM A;  4YWY A;  2F7V A;  1XF8 A;  3DR6 A;  3KHZ A;  4RN7 A;  4E2A A;  3DGV A;  1VHO A;  4YRH A;  2V8G A;  7CPA A;  2PJ0 A;  4MBU A;  4PXC A;  2Z3N A;  4UFV A;  3LMS A;  4NGP A;  1XMT A;  3S6H A;  4A2Z A;  4UEE A;  4ZY0 A;  2VZZ A;  5CNP A;  1YR0 A;  1NSL A;  4CAV A;  3B35 A;  2YND A;  4MCS A;  3TFY A;  4P6Y A;  2G3T A;  1YQE A;  1Z8L A;  4MCR A;  3T9Y A;  2JDD A;  1DTD A;  1FT7 A;  1TIQ A;  1YVO A;  2PRB A;  1HEE A;  1ZG8 A;  3BHX A;  4XPD C;  1Z8W A;  2PC1 A;  5AGE A;  4LQG A;  1Y9W A;  1GHE A;  2GLJ A;  5IB9 A;  1Y0Y A;  1CPS A;  3B7I A;  3KQZ A;  4X2T A;  2BEI A;  4PV6 A;  8CPA A;  2JLM A;  2IQ6 A;  3K2K A;  3I1U A;  5A27 A;  4IF5 A;  4NFR A;  2PCU A;  1Y0R A;  4OME A;  1I21 A;  2G9D A;  1R3N A;  2VZY A;  2PIY A;  3DDD A;  3B8G A;  4P4F A;  4CRZ B;  2QVP A;  2B4D A;  2DF5 A;  2ZOF A;  3V38 A;  3RZA A;  2PJA A;  4KUB A;  4R57 A;  4F0X A;  3ISZ A;  2ZW4 A;  2AFX A;  2Q44 A;  1BLL E;  3PBE A;  1ZLI A;  4CS0 B;  4Z65 A;  4OC5 A;  2PVV A;  4A30 A;  5LYD A;  4ZI6 A;  1FNO A;  4MXU A;  4P10 A;  5CPA A;  4OC0 A;  5F47 A;  4FD6 A;  4BD9 A;  2CF4 A;  4II9 A;  1AUG A;  2Q7S A;  5ELY A;  3BXM A;  2ZEO A;  4Q7A A;  4B13 A;  4ZBG A;  3W6X A;  3GLJ A;  4YGO A;  4UEZ A;  1Q7L A;  2EWB A;  5D8N A;  3PB7 X;  3R96 A;  1Q2C A;  4FBE A;  2Z0Z A;  4UWI A;  5CBM A;  3KI9 A;  4ZX9 A;  4PPZ A;  3KQX A;  2F5I A;  2ZEH A;  4X5K A;  5DWM A;  1TF8 A;  2OB0 A;  4MCQ A;  3GB0 A;  2OU2 A;  4QBJ A;  4RUH A;  2O4H A;  2ZEE A;  4ZX8 A;  2I3C A;  4KOY A;  4PK3 A;  2REE A;  4Q38 A;  4AVC A;  4B6Z A;  2AJ6 A;  5E96 A;  3DSB A;  4B5P B;  1BPM A;  4PQA A;  2X7B A;  3PFO A;  4EWT A;  4KSA A;  4OID A;  3H8E A;  1HDU A;  4JXQ A;  3TE4 A;  4CYN A;  3G8W A;  1YW4 A;  2QIR A;  4IHM A;  3NE8 A;  2B3V A;  2C1C A;  4KOS A;  3MN8 A;  2ZEP A;  2PJ4 A;  2RFH A;  4CGM A;  5G20 A;  1F2P A;  3F0A A;  1ZO0 A;  3DNS A;  5IV0 A;  3B3W A;  4A37 A;  1S5K A;  4MMO A;  1XRY A;  4UF4 A;  3PBB A;  4A95 A;  2P6E A;  4NJR A;  4FD4 A;  2QJ8 A;  2HC9 A;  2BOA A;  3RNZ A;  3S6F A;  2Q4Y A;  4DUK A;  3B3C A;  1JQG A;  1NE9 A;  4JLY A;  4CRY B;  3R1K A;  4QVT A;  3S9L A;  4UCP A;  4MI4 A;  4C68 A;  2QYV A;  5LYF A;  1XEB A;  1XFO A;  2O53 A;  5K8M A;  5ISV A;  2POK A;  5FVJ A;  2CXA A;  3VH9 A;  3KL9 A;  2AFO A;  2GRE A;  1S3Z A;  4CAW A;  3A9L A;  4O23 A;  3KR4 A;  3KZW A;  5AG5 A;  4ZGY B;  5H86 A;  2YNC A;  3RAM A;  3R9F A;  2K5T A;  1X12 A;  3EO4 A;  1VGY A;  3BI0 A;  4R87 A;  2QEC A;  1YLE A;  3GIU A;  4RS2 A;  2Q4V A;  2PJ8 A;  2ZEL A;  4R9M A;  2RB7 A;  1N71 A;  2JBK A;  2PDO A;  1RXT A;  2Q0Y A;  3IO1 A;  4KLW A;  2WUU A;  3LD2 A;  4ORF A;  1QST A;  4UFW A;  4DJL A;  4KOU A;  3CDX A;  3BJ8 A;  4K30 A;  4JZ0 A;  2GU2 A;  3IJ3 A;  1F57 A;  1L0C A;  4U9Y A;  3KGQ A;  4OC2 A;  4U9Z A;  3RBU A;  4CAF A;  1WWZ A;  2ZEM A;  2VL1 A;  4P4J A;  4I49 A;  4RI1 A;  1BO4 A;  3CZX A;  2Q51 A;  5DS0 A;  5F49 A;  1ZLH A;  2PJC A;  3D4U A;  3D7F A;  3FJU A;  4L89 A;  3SJX A;  1IB1 E;  1Z8X A;  1YK3 A;  1TXR A;  2YGW A;  3IFE A;  5IX3 A;  2R1I A;  3TOA A;  2CNM A;  2FL4 A;  3RO0 A;  2ANP A;  4B5O A;  4NGQ A;  5A28 A;  3S9N A;  1YRE A;  2BCO A;  4MFZ A;  4F0Y A;  3FYN A;  4UIB A;  1XE4 A;  2BSW A;  3CPA A;  3G3S A;  1ON0 A;  5GCN A;  1LAP A;  2O28 A;  3PEI A;  2WSA A;  4TWE A;  5D29 A;  5KTA A;  3CXQ A;  2PJB A;  4PXD A;  3W91 A;  1Z2L A;  3C26 A;  1S60 A;  1M4I A;  1Y7R A;  3PFE A;  3QB8 A;  4QUS A;  4NCZ A;  2AFW A;  3FX6 A;  3V8I A;  4B5P A;  5DWN A;  4CGO A;  2AFM A;  3FXT A;  1CP7 A;  3FF3 A;  1VKC A;  3B3V A;  2Z3O A;  3IWE A;  5AG7 A;  3WR7 A;  2Y0M A;  2PJ5 A;  3CPX A;  3EXN A;  2A4N A;  2ABZ A;  3S6K A;  4KS9 A;  3HLP A;  1Z8T A;  3D8P A;  3IU1 A;  4R7M A;  2OZG A;  4F8Z A;  1CBX A;  2J8N A;  2REF A;  6CPA A;  2CIJ A;  2R98 A;  4P4D A;  3NH4 A;  2Z3L A;  4H2K A;  4C2Z A;  3VWE A;  5HXD A;  4CAE A;  3NA6 A;  3KHX A;  2B58 A;  4HKF A;  2IMO A;  2B5G A;  2P6F A;  3QAY A;  3SJE A;  4JYW A;  4EFD A;  1IOF A;  4MFJ A;  2YNE A;  1NSA A;  3P2F A;  2H5M A;  1V0C A;  4KOT A;  4C2X A;  4E8O A;  4UA3 A;  1QSO A;  2V8D A;  4M6I A;  5F09 A;  2FIW A;  3SXO A;  1Z9U A;  2R8V A;  4UCN A;  2YNC C;  2BO9 A;  4NGN A;  4JWP A;  4PXE A;  4WJB A;  4XNH B;  3N5F A;  2F8H A;  1AMP A;  2GLF A;  3GY9 A;  2OZH A;  3NE7 A;  4L8A A;  2HV2 A;  3DR8 A;  3ISX A;  3IU2 A;  1IOI A;  1YVK A;  1R43 A;  3JVN A;  4NGT A;  1Y9K A;  1IU8 A;  3K9T A;  1K4J A;  4XPL A;  3TOB A;  1RTQ A;  2ZW5 A;  2NMT A;  1QSR A;  4OC3 A;  3R95 A;  3IC1 A;  4B11 A;  1UFH A;  2GAN A;  1IY7 A;  1CX8 A;  3GYA A;  3QAH A;  4HNW B;  2PJ3 A;  4FUU A;  5J1Q A;  1YLO A;  4F9V A;  1EE3 P;  3SJG A;  2D4P A;  4KSF A;  3NH8 A;  4MFP A;  5G22 A;  5G1Z A;  2JEW A;  2AFU A;  3F8K A;  1IYL A;  1Z4E A;  3EFA A;  2Q04 A;  2V77 A;  4KZT A;  4ONW A;  1LFW A;  1IGB A;  2D4O A;  2RC4 A;  3FEE A;  4KOR A;  2VI7 A;  4E0A A;  2ODF A;  4MFL A;  1AYE A;  3IWG A;  4H6U A;  1BAV A;  3W6S A;  2XEJ A;  2V8H A;  1F2O A;  4PSW A;  1WK4 A;  3FH4 A;  4NJQ A;  3NFZ A;  3IIB A;  1PYT B;  1TKH A;  4CYQ A;  4FWU A;  3WT4 A;  4KSI A;  5HVH A;  3FIX A;  1XJO A;  4UEF A;  1XIX A;  4OAD A;  1YSJ A;  5LRK A;  5K8N A;  2B5G B;  4WWV A;  2HB6 A;  4QB9 A;  1NMT A;  2VXK A;  1XOV A;  1YW6 A;  4P4B A;  3TO7 A;  4CPA A;  3D3S A;  2ZEN A;  4CGP A;  5C88 A;  4MY0 A;  3TC8 A;  2QML A;  4JJX A;  3FVL A;  4NXY A;  1ELM P;  2OH1 A;  2GFQ A;  2JDC A;  2I79 A;  2ZW7 A;  1QSN A;  4KOV A;  4X8I A;  4UBR A;  3SI2 A;  4AXV A;  1OBR A;  1RO5 A;  1FY7 A;  3TTH A;  1QQ9 A;  4KLV A;  3F5B A;  3CXP A;  3LWU A;  4A39 A;  4MFQ A;  3KR5 A;  1S7K A;  2J8M A;  2XEI A;  4IUS A;  2EVN A;  3D7D A;  1PU9 A;  2P0W A;  3PP9 A;  4M3S A;  5K8O A;  4CYP A;  2GE3 A;  3B2Y A;  2OOT A;  1VIX A;  2BUE A;  2G3A A;  3LOD A;  4KVO E;  3R9G A;  4EVY A;  3D2M A;  2VEZ A;  2DEA A;  4AG7 A;  2FIA A;  4B10 A;  2ZW6 A;  4R76 A;  4U5Y A;  4M85 A;  5LYI A;  5LYL A;  2Z3M A;  1Q2D A;  4OLL A;  4CGL A;  4MHN A;  3PB9 X;  3H8F A;  1YX0 A;  4FD5 A;  1I12 A;  2DPT A;  2WPX A;  3KKW A;  3MGD A;  2EK9 A;  2KCW A;  3BJ7 A;  4C7I A;  1TKJ A;  3PB8 X;  3QNV A;  4G1P A;  4MHP A;  3HUV A;  4Y49 B;  3N7Z A;  2R7H A;  1QSM A;  4LUA A;  2WPW A;  2FT0 A;  3GKR A;  5THW A;  4AVA A;  3H5Z A;  2ZXV A;  2PIZ A;  1QMU A;  4GM5 A;  4H6Z A;  3H4Q A;  5KTD A;  4X3R A;  3FNC A;  4HNY B;  3WAB A;  2IJZ A;  2FCK A;  4ZY1 A;  2PJ2 A;  4EME A;  1GYT A;  1P0H A;  2AFZ A;  2PJ7 A;  4DNC A;  4B14 A;  4A94 A;  1KWM A;  3BLN A;  5KTC A;  4M6H A;  5LRJ A;  4DYO A;  4JXR A;  3D68 A;  1ARL A;  4KOW A;  4OP4 A;  4HPS A;  3PZJ A;  1X10 A;  4FAI A;  3VWD A;  2PSW A;  1M4L A;  3RYO A;  3MRU A;  4XPD B;  4PK2 A;  3D7G A;  1YGH A;  3TCV A;  3TT2 A;  4KVX A;  2I00 A;  3JRU A;  3PRT A;  1LRZ A;  4IAV A;  1BPN A;  4UFX A;  5JH9 A;  3SJF A;  1YME A;  1PCA A;  3H8G A;  1M1D A;  3CT9 A;  1B87 A;  1KZF A;  2PR1 A;  3BI1 A;  2PRQ A;  1S7N A;  1CM0 A;  5JM6 A;  3TX8 A;  3ZZI A;  2JBJ A;  2P6G A;  1I1D A;  1LCP A;  2CNS A;  1P4N A;  2VQY A;  4KOX A;  1R57 A;  5J8C A;  2ZOG A;  3FB3 A;  4NSQ A;  3IGR A;  3OWC A;  4XPK A;  2FVG A;  5EBV A;  3SI0 A;  2AFS A;  1KUY A;  4UWJ A;  4KVM E;  3JUW A;  2ZED A;  4R6T A;  1TKF A;  2Q7B A;  2EBJ A;  2PE3 A;  1LOK A;  1CPX A;  1ZG7 A;  5HH1 A;  1MK4 A;  1S7L A;  1ZG9 A;  5EC4 A;  3D2P A;  3FMC A;  4AB7 A;  5JGF A;  2Q4Z A;  5HVF A;  4A33 A;  3R9E A;  4LX9 A;  2XEG A;  1J4J A;  2PQ8 A;  4LQ6 A;  3P2H A;  4MHD A;  4NF1 A;  4TNU A;  2PJ1 A;  2DPS A;  3KAS A;  3T90 A;  3JTK A;  2Z10 A;  2CY2 A;  2OR4 A;  4P44 A;  3EY5 A;  4P4E A;  3SI1 A;  4F6A A;  5AG6 A;  4XNH C;  3FED A;  3S9M A;  4B12 A;  1Z5R A;  1IID A;  1KUX A;  4MCP A;  4NGR A;  4R3L A;  2HQY A;  2CTC A;  4W9Y A;  1OZP A;  2JEV A;  4A32 A;  4OIW A;  3IEH A;  2FE7 A;  1CJW A;  4IK2 A;  4CGN A;  2ZPA A;  2PVW A;  4OC4 A;  2XEF A;  2B3U A;  4OKO A;  1CG2 A;  2OZU A;  4J3G A;  2VBQ A;  2Q43 A;  4MFK A;  1LAN A;  5F46 A;  2B4B A;  2WYR A;  4A31 A;  4C2Y A;  4NGS A;  3NH5 A;  1B6B A;  5I0C A;  1JWQ A;  2CTB A;  1M4G A;  1TF9 A;  2ATR A;  4CYO A;  1M4D A;  3D7H A;  1HDQ A;  4QC6 A;  2C6P A;  1IYK A;  1IIC A;  2AE6 A;  4MHZ A;  4F9U A;  4JD6 A;  3UY5 A;  2J8R A;  2BL1 A;  2PJ6 A;  3SHP A;  4AG9 A;  3DLJ A;  4MHY A;  3D67 A;  5K8P A;  4ZY2 A;  1Q2Y A;  1CP6 A;  3I3G A;  2ZEG A;  4OAE A;  1MJ9 A;  1Z4R A;  1XBU A;  4HNX B;  5F48 A;  1Y7E A;  5AG4 A;  4BMH A;  5JPH A;  3V7Z A;  3ZJ0 A;  3WC6 A;  4R3K A;  2GIV A;  5HVG A;  4C7H A;  2EK8 A;  2Z3K A;  4MRI A;  4MY3 A;  1UWY A;  5JQ4 A;  3B3S A;  3PB4 X; 
#chains in the Genus database with same CATH homology
 3TO6 A;  2FSR A;  2B4D B;  2G0B A;  1VHS A;  3EC4 A;  4CAX A;  1M44 A;  1MJA A;  1U6M A;  4GS4 A;  1S7F A;  2IL4 A;  2HUZ A;  3CXS A;  4MJ8 A;  5HMN A;  2FS5 A;  3TO9 A;  1KUV A;  5C82 A;  2C27 A;  4UCM A;  4KUA A;  3SXN A;  5G21 A;  4PSX A;  5J8F A;  4AVB A;  4H89 A;  4NEX A;  2Z11 A;  4FD7 A;  2DXQ A;  3PGP A;  3FBU A;  2ARH A;  1PUA A;  4YFJ A;  5H84 A;  2PR8 A;  4ONU A;  2FXF A;  2CNT A;  2EUI A;  1BOB A;  4BBH A;  1SQH A;  4Y49 C;  3FRM A;  2Z3P A;  3S6G A;  4Q36 A;  5IB0 A;  3E0K A;  5BWA B;  3I9S A;  1MJB A;  3K9U A;  4E2A A;  1XF8 A;  3DR6 A;  4YRH A;  4MBU A;  3S6H A;  4UFV A;  2Z3N A;  4A2Z A;  1XMT A;  2VZZ A;  5CNP A;  1YR0 A;  1NSL A;  4CAV A;  2YND A;  3TFY A;  2G3T A;  3T9Y A;  2JDD A;  1TIQ A;  1YVO A;  2PRB A;  4XPD C;  2PC1 A;  5AGE A;  1Y9W A;  1GHE A;  2BEI A;  4PV6 A;  2JLM A;  5A27 A;  4IF5 A;  1I21 A;  2VZY A;  3DDD A;  3B8G A;  4CRZ B;  2B4D A;  4KUB A;  4R57 A;  4F0X A;  2ZW4 A;  2Q44 A;  4CS0 B;  4A30 A;  5F47 A;  4FD6 A;  4II9 A;  4B13 A;  4ZBG A;  3W6X A;  4YGO A;  3R96 A;  1Q2C A;  2Z0Z A;  4UWI A;  2F5I A;  4X5K A;  5DWM A;  2OB0 A;  2OU2 A;  4QBJ A;  4KOY A;  4PK3 A;  2REE A;  4Q38 A;  4AVC A;  2AJ6 A;  5E96 A;  3DSB A;  4B5P B;  2X7B A;  4KSA A;  4JXQ A;  3TE4 A;  4CYN A;  3G8W A;  2QIR A;  2B3V A;  4KOS A;  4CGM A;  5G20 A;  3F0A A;  1ZO0 A;  3DNS A;  1S5K A;  4A95 A;  2P6E A;  4FD4 A;  3S6F A;  2Q4Y A;  1NE9 A;  4JLY A;  4CRY B;  3R1K A;  4QVT A;  4UCP A;  4MI4 A;  4C68 A;  1XEB A;  5ISV A;  5FVJ A;  2CXA A;  1S3Z A;  4CAW A;  3A9L A;  5AG5 A;  4ZGY B;  5H86 A;  2YNC A;  3R9F A;  2K5T A;  3EO4 A;  4R87 A;  2QEC A;  1YLE A;  4RS2 A;  2Q4V A;  4R9M A;  1N71 A;  4ORF A;  2PDO A;  1RXT A;  2Q0Y A;  4KLW A;  4B12 A;  2WUU A;  3LD2 A;  4UFW A;  1QST A;  4KOU A;  3BJ8 A;  4K30 A;  4U9Y A;  1L0C A;  4U9Z A;  4CAF A;  1WWZ A;  5F49 A;  4I49 A;  4RI1 A;  1BO4 A;  4L89 A;  1IB1 E;  2YGW A;  1YK3 A;  5IX3 A;  2R1I A;  3TOA A;  2CNM A;  2FL4 A;  4B5O A;  5A28 A;  1YRE A;  4MFZ A;  4F0Y A;  3FYN A;  1XE4 A;  2BSW A;  3G3S A;  1ON0 A;  5GCN A;  2O28 A;  2WSA A;  5KTA A;  3CXQ A;  3W91 A;  3C26 A;  4QUS A;  1S60 A;  1M4I A;  1Y7R A;  3QB8 A;  3V8I A;  4B5P A;  4NCZ A;  5IV0 A;  4CGO A;  5DWN A;  3FXT A;  1VKC A;  2Z3O A;  3IWE A;  5AG7 A;  3WR7 A;  2Y0M A;  3EXN A;  2A4N A;  3S6K A;  4KS9 A;  3D8P A;  3IU1 A;  2OZG A;  2J8N A;  2REF A;  2R98 A;  2Z3L A;  4C2Z A;  3VWE A;  4CAE A;  2B58 A;  4HKF A;  2P6F A;  2B5G A;  4MFJ A;  2YNE A;  3P2F A;  2H5M A;  1V0C A;  4KOT A;  4C2X A;  4E8O A;  4UA3 A;  1QSO A;  2FIW A;  3SXO A;  1Z9U A;  2R8V A;  4UCN A;  2YNC C;  4JWP A;  4XNH B;  3GY9 A;  2OZH A;  3NE7 A;  4L8A A;  2HV2 A;  3DR8 A;  3IU2 A;  1YVK A;  3JVN A;  3TOB A;  1Y9K A;  4XPL A;  1K4J A;  3R95 A;  2ZW5 A;  2NMT A;  1QSR A;  4B11 A;  1UFH A;  2GAN A;  4HNW B;  3GYA A;  3QAH A;  2D4P A;  4KSF A;  4MFP A;  5G22 A;  5G1Z A;  3F8K A;  1IYL A;  1Z4E A;  3EFA A;  2Q04 A;  4KZT A;  2D4O A;  2RC4 A;  4KOR A;  2VI7 A;  4E0A A;  4MFL A;  3IWG A;  4H6U A;  3W6S A;  4PSW A;  1WK4 A;  4CYQ A;  3FIX A;  1XIX A;  4OAD A;  2B5G B;  4QB9 A;  1NMT A;  2VXK A;  3TO7 A;  5C88 A;  3D3S A;  4CGP A;  4MY0 A;  2QML A;  4JJX A;  4NXY A;  2OH1 A;  2ZW7 A;  2JDC A;  2I79 A;  4KOV A;  1QSN A;  4UBR A;  1RO5 A;  1FY7 A;  3TTH A;  4KLV A;  3F5B A;  3CXP A;  4MFQ A;  1S7K A;  2J8M A;  4IUS A;  2EVN A;  1PU9 A;  2P0W A;  3PP9 A;  4M3S A;  4CYP A;  2GE3 A;  2BUE A;  3LOD A;  2G3A A;  4KVO E;  3R9G A;  4EVY A;  3D2M A;  2VEZ A;  4AG7 A;  2FIA A;  4B10 A;  2ZW6 A;  4U5Y A;  4M85 A;  2Z3M A;  1Q2D A;  4OLL A;  4CGL A;  1YX0 A;  4FD5 A;  1I12 A;  2DPT A;  2WPX A;  3KKW A;  3MGD A;  2KCW A;  3BJ7 A;  4C7I A;  4Y49 B;  3N7Z A;  2R7H A;  1QSM A;  4LUA A;  2WPW A;  2FT0 A;  3GKR A;  4AVA A;  3H5Z A;  2ZXV A;  4H6Z A;  3H4Q A;  5KTD A;  3FNC A;  4HNY B;  2FCK A;  1P0H A;  4DNC A;  4B14 A;  3BLN A;  5KTC A;  4JXR A;  4KOW A;  3PZJ A;  3VWD A;  2PSW A;  3RYO A;  4XPD B;  4PK2 A;  1YGH A;  3TCV A;  3TT2 A;  4KVX A;  2I00 A;  1LRZ A;  4UFX A;  1M1D A;  1B87 A;  1KZF A;  2PR1 A;  1S7N A;  1CM0 A;  3ZZI A;  2P6G A;  1I1D A;  2CNS A;  1P4N A;  2VQY A;  4KOX A;  1R57 A;  5J8C A;  3FB3 A;  4NSQ A;  3IGR A;  3OWC A;  4XPK A;  5EBV A;  1KUY A;  4UWJ A;  4KVM E;  3JUW A;  2Q7B A;  5HH1 A;  1MK4 A;  1S7L A;  5EC4 A;  3D2P A;  4AB7 A;  4A33 A;  3R9E A;  4LX9 A;  1J4J A;  2PQ8 A;  3P2H A;  4MHD A;  4NF1 A;  2DPS A;  3T90 A;  3JTK A;  2Z10 A;  2CY2 A;  3EY5 A;  4F6A A;  5AG6 A;  4XNH C;  1IID A;  1KUX A;  4R3L A;  2HQY A;  1OZP A;  2JEV A;  4A32 A;  2FE7 A;  1CJW A;  4CGN A;  2ZPA A;  2B3U A;  2OZU A;  4J3G A;  2VBQ A;  4MFK A;  5F46 A;  2B4B A;  4A31 A;  4C2Y A;  1B6B A;  5I0C A;  1M4G A;  2ATR A;  4CYO A;  1M4D A;  4QC6 A;  1IYK A;  1IIC A;  2AE6 A;  4JD6 A;  3UY5 A;  2J8R A;  2BL1 A;  3SHP A;  4AG9 A;  1Q2Y A;  3I3G A;  4OAE A;  1MJ9 A;  1Z4R A;  4HNX B;  5F48 A;  5AG4 A;  4BMH A;  5JPH A;  3ZJ0 A;  4R3K A;  2GIV A;  4C7H A;  2Z3K A;  4MY3 A;  5JQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...