4MBUA

Crystal structure of n-acetyltransferase from staphylococcus aureus mu50
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
165
structure length
165
Chain Sequence
SNAMIRCAKKEDLNAILAIYNDAIINTTAVYTYKPQTIDERIAWFETKQRNHEPIFVFEENGSVLGFATFGSFRPWPAYQYTIEHSIYVDASARGKGIASQLLQRLIVEAKAKGYRTLVAGIDASNEASIKLHQKFNFKHAGTLTNVGYKFDYWLDLAFYELDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Similar to N-acetyltransferase
publication title Structural characterization of a Gcn5-related N-acetyltransferase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
total genus 48
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mbuA00
4B5PA 3R9EA 3FIXA 2JDCA 3BJ7A 4KOUA 3S6FA 4B5PB 2FL4A 4B5OA 2FIAA 1RXTA 1P4NA 4H6ZA 2G0BA 1I12A 2JEVA 4X5KA 4MHDA 5E96A 5F46A 4JXRA 1Q2CA 2Z11A 3K9UA 3KKWA 2B3UA 3D2PA 5IV0A 2CNMA 1I21A 4NF1A 2B4DA 4KOYA 2JLMA 5DWMA 2K5TA 3GKRA 1QSOA 1WK4A 1KZFA 5EC4A 1V0CA 4FD4A 4JXQA 3P2HA 2FCKA 2ZW4A 1BO4A 3BLNA 4FD5A 3EO4A 1WWZA 2J8MA 4HNWB 4L8AA 3JVNA 3FBUA 2C27A 1Q2DA 3W6SA 2Z10A 2G3TA 1QSNA 3QAHA 4Y49B 2PSWA 2J8RA 4CAVA 1KUXA 3DDDA 4E0AA 1IB1E 4F0YA 3CXSA 3R96A 2VZZA 4AVCA 4I49A 1YK3A 3TOBA 2PRBA 5JPHA 2WPWA 2FSRA 1YR0A 4PK2A 2OZUA 1XIXA 4M85A 4H89A 2OZHA 4IF5A 4MY0A 4IUSA 2Q04A 3S6GA 4AG9A 2Q4YA 2JDDA 4Y49C 4KORA 1FY7A 4QBJA 4KZTA 4OADA 2ZW6A 3VWEA 3GY9A 1IYKA 3IWGA 1S7FA 4E2AA 1SQHA 3UY5A 3D3SA 4QC6A 4XNHB 1R57A 1M1DA 3TO6A 2D4PA 1M44A 4KOTA 4KVXA 2HUZA 4RS2A 3FYNA 2HQYA 4UWIA 4AVBA 5F49A 3RYOA 2A4NA 2P6FA 4XPDC 4MJ8A 3N7ZA 1S5KA 4PK3A 4AG7A 2ZW5A 3SXOA 3S6HA 3H4QA 2QMLA 4ONUA 1M4DA 2FE7A 3D8PA 5HH1A 3VWDA 4JWPA 4XNHC 4LUAA 2Y0MA 2HV2A 3I3GA 1B6BA 1NMTA 3EXNA 1XMTA 1TIQA 5EBVA 1VHSA 1KUYA 3EFAA 2ZW7A 1S7KA 2BEIA 3ZZIA 5F48A 2ATRA 2OH1A 2OB0A 5F47A 3FRMA 2Q0YA 2B4DB 5IX3A 3PP9A 3TTHA 3PZJA 2PR8A 1QSRA 2P6EA 3BJ8A 4ZBGA 3FNCA 1Z9UA 5I0CA 5J8FA 3R9GA 4YFJA 5J8CA 1MK4A 1M4IA 2Q7BA 1PU9A 2AJ6A 3D2MA 4HNYB 1MJAA 3PGPA 1YLEA 4KLWA 1RO5A 2VQYA 4F6AA 3QB8A 4KUBA 5H84A 2FS5A 4LX9A 2REFA 3G3SA 5CNPA 3V8IA 3C26A 3ZJ0A 4KOWA 1MJBA 4KVME 1NSLA 1Z4EA 3W91A 4CAXA 3IGRA 4II9A 1Z4RA 2WPXA 4NSQA 1S60A 1CM0A 3TCVA 2OZGA 2D4OA 3OWCA 2B3VA 1NE9A 3R1KA 4CRZB 1PUAA 4CAWA 1N71A 1L0CA 3B8GA 4QUSA 4FD6A 2ZXVA 4CRYB 2CY2A 5JQ4A 3TOAA 4BMHA 3I9SA 3TO7A 4YRHA 1S7NA 4UA3A 3TO9A 2I79A 3DR8A 2X7BA 1QSMA 4U9ZA 2REEA 1Y7RA 4DNCA 4R3KA 4HKFA 2VXKA 4PV6A 2F5IA 2PDOA 5KTCA 4PSXA 2GANA 1QSTA 3R9FA 4U5YA 3P2FA 4KOXA 5GCNA 4NEXA 1P0HA 2G3AA 2R7HA 3DNSA 2R8VA 5C82A 1LRZA 3CXQA 2PR1A 3CXPA 4UBRA 2FIWA 4H6UA 3E0KA 4CS0B 1M4GA 3TFYA 2B4BA 5DWNA 4XPKA 4QB9A 2P6GA 4EVYA 2AE6A 2GE3A 4OLLA 3EC4A 1GHEA 1U6MA 2RC4A 1OZPA 4KVOE 2R98A 4KLVA 3NE7A 3G8WA 4R87A 3TT2A 1UFHA 1IICA 3T9YA 1I1DA 1Q2YA 2B5GA 4PSWA 5HMNA 3F0AA 4MBUA 2BL1A 2KCWA 2B5GB 2PC1A 2R1IA 1Y9WA 1IIDA 4R3LA 2IL4A 1J4JA 4M3SA 2CNSA 1YGHA 4AB7A 2VZYA 3GYAA 1YVKA 2J8NA 2CNTA 4JJXA 4L89A 2EVNA 2Q44A 3EY5A 2BUEA 4GS4A 4UWJA 2VBQA 4JD6A 2Z0ZA 3T90A 2Q4VA 1S7LA 2BSWA 1YREA 5IB0A 3FXTA 1S3ZA 4NCZA 2ARHA 3MGDA 1ON0A 5FVJA 2P0WA 3WR7A 4YGOA 3DSBA 2EUIA 4NXYA 2H5MA 3LD2A 5ISVA 4AVAA 3TE4A 2VEZA 1KUVA 3LODA 2DXQA 2O28A 1BOBA 2I00A 2ZPAA 4XPDB 1XEBA 3F8KA 1K4JA 1IYLA 3S6KA 4KOVA 3DR6A 4FD7A 4MI4A 4E8OA 4OAEA 3W6XA 1XF8A 4KOSA 3JUWA 4R9MA 2B58A 4KUAA 2VI7A 1MJ9A 4JLYA 2GIVA 5KTDA 4K30A 5H86A 4RI1A 2FXFA 1YVOA 3F5BA 4ORFA 5KTAA 4U9YA 4R57A 2NMTA 2PQ8A 3FB3A 1Y9KA 2OU2A 2QECA 4J3GA 4HNXB 2QIRA 1CJWA 2FT0A 3R95A 4XPLA 1XE4A 3SXNA 5C88A 1YX0A 1B87A 4MY3A 1VKCA 3SHPA 4QVTA
chains in the Genus database with same CATH superfamily
4B5PA 3R9EA 3FIXA 2JDCA 3BJ7A 4MFJA 2AFMA 4MFQA 3DGVA 4KOUA 3S6FA 4B5PB 2FL4A 4HPSA 2AFXA 2CTBA 2FIAA 3B35A 3LMSA 1RXTA 1XBUA 4ONWA 4B5OA 1IOFA 1P4NA 4H6ZA 2DPTA 2G0BA 2ZEGA 1I12A 2JEVA 8CPAA 3B3VA 4X5KA 4MHDA 3A9LA 2EK9A 2PJ8A 3D7FA 5E96A 5F46A 4JXRA 3TC8A 2ZEHA 1Q2CA 2Z11A 3K9UA 3KKWA 4UEFA 2B3UA 1AMPA 3D2PA 5IV0A 1Y0YA 3PB7X 4EWTA 1XMBA 2CNMA 1ZLHA 1I21A 1YMEA 4NF1A 2B4DA 4KOYA 1ZLIA 1JQGA 2JLMA 4GXHA 5CPAA 4ZYQA 5DWMA 3SJXA 3QNVA 5HVFA 2K5TA 3CPXA 1GYTA 3GKRA 4CYPA 1Z8TA 1QSOA 1WK4A 3H5ZA 4P4IA 1KZFA 2OOTA 5EC4A 1V0CA 3KASA 4FD4A 4NGPA 4JXQA 3P2HA 2FCKA 2ZW4A 1BO4A 1CP7A 3B7IA 4UEEA 3BLNA 5G22A 4FD5A 5K8PA 1XFOA 3D4UA 3EO4A 1WWZA 1Y0RA 4OKOA 2J8MA 2PJBA 2ZELA 4HNWB 4L8AA 3JVNA 4OC1A 3WT4A 4A37A 3FBUA 5HVGA 1LANA 2C27A 1Q2DA 2PJAA 3W6SA 2Z10A 2CTCA 4MCPA 2G3TA 2PVVA 3KHXA 1QSNA 3IU1A 4KSAA 4OMEA 3KI9A 4B13A 4CAEA 3QAHA 1LOKA 4Y49B 3S9MA 2PSWA 3IC1A 5I4MA 1KWMA 4P4FA 4TNUA 2J8RA 4CAVA 2RFHA 1KUXA 2YNDA 3DDDA 4KS9A 4YWYA 1IB1E 4E0AA 5JM6A 4NGMA 1ELLP 4F0YA 3CXSA 3R96A 4UIBA 1CP6A 2VZZA 5LYDA 3K9TA 4AVCA 2JBKA 4I49A 1AUGA 3SJGA 1YK3A 1Z2LA 2PRBA 2ZEEA 3TOBA 5JPHA 2RB7A 4M6GA 2WPWA 1CX8A 1R3NA 2FSRA 1YR0A 4PK2A 1LCPA 1DE4C 1XIXA 2OZUA 4M85A 4MHNA 4H89A 2OZHA 3VH9A 4IF5A 2C6GA 2ANPA 2DPSA 4IUSA 4MY0A 2Q04A 4PPZA 5A27A 3S6GA 4AG9A 4NJQA 1IY7A 3NA6A 2Q4YA 2JDDA 5AG7A 3CPAA 1TKFA 4EMEA 3TX8A 4Y49C 3L2NA 4KORA 3NH8A 1FY7A 1IGBA 3D7DA 4P6YA 4QBJA 4KZTA 2ABZA 4B14A 4OADA 3S9LA 2J9AA 2PJ7A 2ZW6A 1VIXA 2PJCA 3VWEA 3GY9A 1TKJA 1IYKA 3H8GA 3IWGA 4OC5A 1S7FA 2V8HA 4E2AA 1SQHA 3UY5A 3WC5A 1ZG7A 5G21A 2AFZA 3D3SA 4QC6A 4XNHB 1R57A 4NJRA 1M1DA 4JZ0A 3TO6A 4PXBA 2D4PA 1M44A 4K3NA 4X3RA 4KOTA 2GFQA 4C7HA 1IOIA 4KVXA 4A31A 2HUZA 3PFOA 4R8FA 4RS2A 2PJ0A 3BHXA 1TF9A 3FYNA 2HQYA 1X12A 4UWIA 4A33A 4AVBA 5F49A 2YNCA 2EK8A 4LQ6A 1Y7EA 3RYOA 5ELYA 3D67A 3PBEA 2AFSA 2A4NA 1YW4A 2VL1A 3D7GA 2P6FA 1Z5RA 4XPDC 4MJ8A 4P4DA 5AG5A 2FVGA 3N7ZA 3RAMA 1S5KA 4ZX8A 4PK3A 1ZG9A 2ZW5A 3SXOA 4AG7A 2XEGA 3S6HA 3FJUA 5IB9A 3PEIA 4UEZA 2BCOA 2Z3LA 3H4QA 4FWUA 2QMLA 3D7HA 4ONUA 4R7MA 4PXCA 3RZAA 1M4DA 2FE7A 2GREA 3D8PA 5HH1A 3VWDA 4UFVA 4JWPA 4M6HA 1VHOA 3PB6X 3PFEA 4MCSA 4XNHC 4LUAA 2F7VA 4NGRA 2Y0MA 3B3WA 2HV2A 4PXEA 5A28A 2Q43A 1B6BA 3I3GA 3PB4X 1NMTA 2AFUA 3EXNA 4ZY1A 4OC3A 3CT9A 4B10A 1XMTA 4A95A 3B3CA 1TIQA 5EBVA 1ZG8A 1VHSA 4ZY2A 3ISXA 5THWA 2IQ6A 2YNCC 1KUYA 3EFAA 1HDQA 2PIZA 2ZW7A 3IFEA 5HXDA 1S7KA 4MFZA 2BEIA 1QMUA 2PJ6A 3ZZIA 4DUKA 5F48A 5LYLA 2ATRA 5JH9A 2OH1A 2OB0A 5F47A 4TWEA 3FRMA 3KGQA 2EBJA 2Q0YA 2B4DB 5IX3A 1LAPA 3PBBA 3GUXA 1F57A 5K8NA 3PP9A 2IJZA 3TTHA 3PZJA 3N5FA 2V77A 4C2XA 1YSJA 2JEWA 2G9DA 5AGEA 4P4EA 2PR8A 2DF5A 4OC4A 1QSRA 2QVPA 3FEDA 2P6EA 5G20A 1X10A 2EO8A 3BJ8A 3FNCA 4ZBGA 1AYEA 3V7ZA 1Z9UA 2Q7SA 4PXDA 5D8NA 4CAFA 4NGTA 3WC7A 3FX6A 3R9GA 4YFJA 5I0CA 1NSAA 3CDXA 5J8FA 5J8CA 1LAMA 1MK4A 2V8GA 1M4IA 2Q7BA 1PU9A 2AJ6A 2WUUA 3IJ3A 3SJEA 4X2TA 1RTQA 5D29A 1BAVA 3D2MA 4HNYB 1ARLA 3RNZA 2PJ9A 3GLJA 1MJAA 3PGPA 2Z3PA 1YLEA 2NSMA 2WYRA 1ELMP 4KLWA 1RO5A 2VQYA 2QJ8A 1Z8LA 2GU2A 2ODFA 3QB8A 4KUBA 3FEEA 5H84A 4C2ZA 4F6AA 2FS5A 4LX9A 2REFA 1CPXA 1M4LA 3G3SA 4X8IA 3KR4A 5CNPA 3LWUA 4MMOA 3V8IA 3C26A 3KL9A 5LYFA 3ZJ0A 3WABA 2ZOFA 4KOWA 2PIYA 2ZEOA 4C68A 1MJBA 3IWWA 3LACA 3IEHA 5LYIA 4KVME 2O4HA 4A39A 1NSLA 1FT7A 1Z4EA 1OBRA 2PJ1A 3W91A 4CAXA 3IGRA 3PB9X 4II9A 1Z4RA 2WPXA 4UFXA 1YLOA 1BPMA 3D68A 4NSQA 1S60A 4MHYA 2PCUA 1CM0A 4UF4A 4Q38A 3TCVA 2OZGA 1Z8XA 4FBEA 2D4OA 1CG2A 3I1UA 3H8EA 3BI0A 3OWCA 4IK2A 2B3VA 1NE9A 3K2KA 3FVLA 1H8LA 3R1KA 4CRZB 1PUAA 4W9YA 2YNEA 4CAWA 3B3SA 1L0CA 1N71A 3B8GA 4QUSA 2Q51A 4PQAA 4FD6A 3RO0A 2ZXVA 5LRGA 4EFDA 4UCMA 4OIDA 4CRYB 2HC9A 1PCAA 3RBUA 2CY2A 4ZI6A 3D66A 5JQ4A 3TOAA 3MN8A 4BMHA 4G1PA 3I9SA 3TO7A 4Q36A 4YRHA 1XRYA 4BD9A 1S7NA 4UA3A 3TO9A 4CGOA 2Z3OA 3PB8X 2I79A 4A38A 4IHMA 1XOVA 3DR8A 2X7BA 1QSMA 4KSIA 4U9ZA 2REEA 1F2OA 1Y7RA 2Q4ZA 4DNCA 4MRIA 1VHEA 4B12A 2Z3KA 4R3KA 4HKFA 3ISZA 2IMOA 2VXKA 4CGLA 4PV6A 4C2YA 4B6ZA 2GLJA 2F5IA 2PDOA 5KTCA 2OR4A 3CZXA 4PSXA 2GANA 1QSTA 3S9NA 3R9FA 2AFWA 4U5YA 3P2FA 3GB0A 1CBXA 4KOXA 4R76A 5GCNA 4NEXA 3GIUA 1P0HA 1Q7LA 2BO9A 2G3AA 4MCRA 4A94A 4OC2A 2R7HA 3DNSA 3KHZA 4MXUA 4UCPA 3VATA 3VARA 4P44A 2R8VA 4P4JA 6CPAA 5JGFA 4GM5A 5C82A 1LRZA 3CXQA 2PR1A 3FH4A 4A2ZA 3CXPA 4UBRA 2FIWA 3T8WA 4H6UA 3E0KA 4H2KA 4CS0B 1M4GA 2XEFA 4R6TA 5LRKA 2V8DA 4LQGA 3TFYA 5EMIA 2B4BA 1ZO0A 4WJBA 2ZEFA 5DWNA 4F0XA 2C6PA 4XPKA 5AG6A 2Z3MA 4QB9A 3JRUA 4BBHA 2P6GA 4EVYA 2GLFA 3IU2A 4BINA 2AE6A 2GE3A 4OLLA 4M6IA 3EC4A 4P10A 2O53A 2XEIA 4F9VA 2CIJA 3SI0A 1GHEA 1U6MA 7CPAA 2RC4A 1OZPA 4KVOE 2R98A 3HLPA 4KLVA 3NE7A 3G8WA 2AFOA 2POKA 4MFPA 4R87A 4MHPA 2WZNA 3IO1A 3PRTA 4MCQA 3TT2A 4A32A 1UFHA 1IICA 3T9YA 4A30A 3IWEA 3V38A 4CYNA 4DJLA 1I1DA 5K8OA 1Q2YA 2B5GA 4PSWA 5HMNA 3F0AA 4MBUA 1HDUA 2BL1A 3KQZA 4MHZA 2KCWA 2B5GB 2PC1A 1TXRA 1Y9WA 2BOAA 2R1IA 4FUUA 4IAVA 5K8MA 2Z3NA 3QAYA 1IIDA 1BPNA 4R3LA 3KR5A 2IL4A 1J4JA 4M3SA 2CNSA 4Z65A 1YGHA 4AB7A 2ZEMA 4CPAA 1FNOA 2VZYA 3MRUA 5AG4A 1YQEA 5CBMA 1F2PA 3GYAA 4Q7AA 1YVKA 2CF4A 2J8NA 4NFRA 4ZY0A 1VGYA 4RN7A 2CNTA 4JJXA 2F8HA 4L89A 2EVNA 4OC0A 2Q44A 3EY5A 4ZGYB 2BUEA 4GS4A 1DTDA 1TKHA 2EWBA 1JWQA 2DEAA 2VBQA 2YGWA 3BXMA 4JD6A 4UWJA 3B2YA 2Z0ZA 3BI1A 4O23A 3FF3A 3T90A 1EE3P 3KQXA 2Q4VA 1S7LA 2BSWA 3DLJA 1YREA 5IB0A 4UIAA 4CGMA 2ZEPA 3FXTA 1S3ZA 1LFWA 1YW6A 4NCZA 2HB6A 2ARHA 4UCNA 4CYQA 4RUHA 1UWYA 3MGDA 1ON0A 4YU9A 2NYQA 5J1QA 4C7IA 5FVJA 2P0WA 5DS0A 3WR7A 4YGOA 1XJOA 4OP4A 4DYOA 3DSBA 1A2ZA 4P45A 4ZX9A 2EUIA 1ARMA 5BWAB 4NXYA 2PE3A 1CPSA 1PYTB 2H5MA 3LD2A 2PJ2A 2XEJA 5ISVA 4AVAA 4NGSA 3TE4A 5G1ZA 2VEZA 2QYVA 4CGNA 4B11A 1KUVA 3LODA 4OIWA 1R43A 2DXQA 4MFLA 3KZWA 3FECA 2O28A 1BOBA 2ZEDA 4CGPA 1Z8WA 4WWVA 1TF8A 2I00A 2ZPAA 4XPDB 1XEBA 4JYWA 3F8KA 1K4JA 1IYLA 3S6KA 3H8FA 4KOVA 3DR6A 4FD7A 4MI4A 4UFWA 4OAEA 3W6XA 4CYOA 1XF8A 4E8OA 3SI2A 4KOSA 3JUWA 3NH5A 4R9MA 2C1CA 2B58A 2ZOGA 4KUAA 2VI7A 4F9UA 1MJ9A 3NFZA 4KSFA 4P4BA 4AXVA 3HUVA 4JLYA 3NH4A 3WC6A 5F09A 2GIVA 1QQ9A 5KTDA 4NGNA 3FMCA 4K30A 2JBJA 1IU8A 5H86A 4RI1A 4NGQA 4MFKA 3SI1A 2I3CA 2FXFA 2C6CA 3B3TA 1YVOA 1BLLE 3F5BA 1HEEA 4ORFA 3JTKA 4U9YA 5KTAA 2PJ5A 4R57A 2ZENA 2V8VA 2CXAA 2NMTA 2PQ8A 3FB3A 1Y9KA 2OU2A 2QECA 4J3GA 3SJFA 4HNXB 2PJ4A 2QIRA 1CJWA 5HVHA 2FT0A 3R95A 4XPLA 1XE4A 2PRQA 2WSAA 3SXNA 3NE8A 5C88A 1YX0A 1B87A 3IIBA 5LRJA 4MY3A 1VKCA 2PJ3A 4FAIA 2PVWA 3SHPA 4F8ZA 4QVTA
chains in the Genus database with same CATH topology
4B5PA 3R9EA 3FIXA 2JDCA 3BJ7A 4MFJA 4MFQA 4KOUA 3S6FA 4B5PB 2FL4A 4CGMA 4B5OA 2FIAA 1RXTA 1P4NA 4H6ZA 2DPTA 2G0BA 1I12A 2JEVA 4X5KA 4MHDA 3A9LA 5E96A 5F46A 4JXRA 1Q2CA 2Z11A 3K9UA 3KKWA 2B3UA 3D2PA 5IV0A 2CNMA 1I21A 4NF1A 2B4DA 4KOYA 2JLMA 5DWMA 2K5TA 3GKRA 4CYPA 1QSOA 1WK4A 3H5ZA 1KZFA 5EC4A 1V0CA 4FD4A 4JXQA 3P2HA 2FCKA 2ZW4A 1BO4A 3BLNA 5G22A 4FD5A 3EO4A 1WWZA 2J8MA 4HNWB 4L8AA 3JVNA 3FBUA 2C27A 1Q2DA 3W6SA 2Z10A 2G3TA 4KSAA 1QSNA 3IU1A 4B13A 4CAEA 3QAHA 4Y49B 2PSWA 2J8RA 4CAVA 1KUXA 2YNDA 3DDDA 4KS9A 4E0AA 1IB1E 4F0YA 3CXSA 3R96A 2VZZA 4AVCA 4I49A 1YK3A 3TOBA 2PRBA 5JPHA 2WPWA 2FSRA 1YR0A 4PK2A 2OZUA 1XIXA 4M85A 4H89A 2OZHA 4IF5A 2DPSA 4MY0A 4IUSA 5A27A 2Q04A 3S6GA 4AG9A 2Q4YA 2JDDA 5AG7A 4Y49C 4KORA 1FY7A 4QBJA 4KZTA 4B14A 4OADA 2ZW6A 3VWEA 3GY9A 1IYKA 3IWGA 1S7FA 4E2AA 1SQHA 3UY5A 5G21A 3D3SA 4QC6A 4XNHB 1R57A 1M1DA 3TO6A 2D4PA 1M44A 4KOTA 4C7HA 4KVXA 4A31A 2HUZA 4RS2A 3FYNA 2HQYA 4UWIA 4A33A 4AVBA 5F49A 2YNCA 3RYOA 2A4NA 2P6FA 4XPDC 4MJ8A 5AG5A 3N7ZA 1S5KA 4PK3A 4AG7A 2ZW5A 3SXOA 3S6HA 2Z3LA 3H4QA 2QMLA 4ONUA 1M4DA 2FE7A 3D8PA 5HH1A 3VWDA 4UFVA 4JWPA 4XNHC 4LUAA 2Y0MA 2HV2A 5A28A 3I3GA 1B6BA 1NMTA 3EXNA 4B10A 1XMTA 4A95A 1TIQA 5EBVA 1VHSA 2YNCC 1KUYA 3EFAA 2ZW7A 1S7KA 4MFZA 2BEIA 3ZZIA 5F48A 2ATRA 2OH1A 2OB0A 5F47A 3FRMA 2Q0YA 2B4DB 5IX3A 3PP9A 3TTHA 3PZJA 4C2XA 5AGEA 2PR8A 1QSRA 2P6EA 5G20A 3BJ8A 4ZBGA 3FNCA 1Z9UA 4CAFA 5I0CA 5J8FA 3R9GA 4YFJA 5J8CA 1MK4A 1M4IA 2Q7BA 1PU9A 2AJ6A 2WUUA 3D2MA 4HNYB 1MJAA 3PGPA 2Z3PA 1YLEA 4KLWA 1RO5A 2VQYA 4F6AA 3QB8A 4KUBA 5H84A 4C2ZA 2FS5A 4LX9A 2REFA 3G3SA 5CNPA 3V8IA 3C26A 3ZJ0A 4KOWA 4C68A 1MJBA 4KVME 1NSLA 1Z4EA 3W91A 4CAXA 3IGRA 4II9A 1Z4RA 2WPXA 4UFXA 4NSQA 1S60A 1CM0A 4Q38A 3TCVA 2OZGA 2D4OA 3OWCA 2B3VA 1NE9A 3R1KA 4CRZB 1PUAA 2YNEA 4CAWA 1N71A 1L0CA 3B8GA 4QUSA 4FD6A 2ZXVA 4UCMA 4CRYB 2CY2A 5JQ4A 3TOAA 4BMHA 3I9SA 3TO7A 4Q36A 4YRHA 1S7NA 4UA3A 3TO9A 4CGOA 2Z3OA 2I79A 3DR8A 2X7BA 1QSMA 4U9ZA 2REEA 1Y7RA 4DNCA 4B12A 2Z3KA 4R3KA 4HKFA 4CGLA 2VXKA 4PV6A 4C2YA 2F5IA 2PDOA 5KTCA 4PSXA 2GANA 1QSTA 3R9FA 4U5YA 3P2FA 4KOXA 5GCNA 4NEXA 1P0HA 2G3AA 2R7HA 3DNSA 4UCPA 2R8VA 5C82A 1LRZA 3CXQA 2PR1A 4A2ZA 3CXPA 4UBRA 2FIWA 4H6UA 3E0KA 4CS0B 1M4GA 3TFYA 2B4BA 1ZO0A 5DWNA 4F0XA 4XPKA 5AG6A 2Z3MA 4QB9A 4BBHA 2P6GA 4EVYA 3IU2A 2AE6A 2GE3A 4OLLA 3EC4A 1GHEA 1U6MA 2RC4A 1OZPA 4KVOE 2R98A 4KLVA 3NE7A 3G8WA 4MFPA 4R87A 4A32A 3TT2A 1UFHA 1IICA 3T9YA 4A30A 3IWEA 4CYNA 1I1DA 1Q2YA 2B5GA 4PSWA 5HMNA 3F0AA 4MBUA 2BL1A 2KCWA 2B5GB 2PC1A 2R1IA 1Y9WA 2Z3NA 1IIDA 4R3LA 2IL4A 1J4JA 4M3SA 2CNSA 1YGHA 4AB7A 2VZYA 5AG4A 3GYAA 1YVKA 2J8NA 2CNTA 4JJXA 4L89A 2EVNA 2Q44A 3EY5A 4ZGYB 2BUEA 4GS4A 2YGWA 4UWJA 2VBQA 4JD6A 2Z0ZA 3T90A 2Q4VA 1S7LA 2BSWA 1YREA 5IB0A 3FXTA 1S3ZA 4NCZA 2ARHA 4UCNA 4CYQA 3MGDA 1ON0A 4C7IA 5FVJA 2P0WA 3WR7A 4YGOA 3DSBA 2EUIA 5BWAB 4NXYA 2H5MA 3LD2A 5ISVA 4AVAA 3TE4A 5G1ZA 2VEZA 4CGNA 4B11A 1KUVA 3LODA 2DXQA 4MFLA 2O28A 1BOBA 4CGPA 2I00A 2ZPAA 4XPDB 1XEBA 3F8KA 1K4JA 1IYLA 3S6KA 4KOVA 3DR6A 4FD7A 4MI4A 4UFWA 4OAEA 3W6XA 4CYOA 1XF8A 4E8OA 4KOSA 3JUWA 4R9MA 2B58A 4KUAA 2VI7A 1MJ9A 4KSFA 4JLYA 2GIVA 5KTDA 4K30A 5H86A 4RI1A 4MFKA 2FXFA 1YVOA 3F5BA 4ORFA 5KTAA 3JTKA 4U9YA 4R57A 2CXAA 2NMTA 2PQ8A 3FB3A 1Y9KA 2OU2A 2QECA 4J3GA 4HNXB 2QIRA 1CJWA 2FT0A 3R95A 4XPLA 1XE4A 2WSAA 3SXNA 5C88A 1YX0A 1B87A 4MY3A 1VKCA 3SHPA 4QVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B5P A;  3R9E A;  3FIX A;  2JDC A;  3BJ7 A;  4KOU A;  3S6F A;  4B5P B;  2FL4 A;  4B5O A;  2FIA A;  1RXT A;  1P4N A;  4H6Z A;  2G0B A;  1I12 A;  2JEV A;  4X5K A;  4MHD A;  5E96 A;  5F46 A;  4JXR A;  1Q2C A;  2Z11 A;  3K9U A;  3KKW A;  2B3U A;  3D2P A;  5IV0 A;  2CNM A;  1I21 A;  4NF1 A;  2B4D A;  4KOY A;  2JLM A;  5DWM A;  2K5T A;  3GKR A;  1QSO A;  1WK4 A;  1KZF A;  5EC4 A;  1V0C A;  4FD4 A;  4JXQ A;  3P2H A;  2FCK A;  2ZW4 A;  1BO4 A;  3BLN A;  4FD5 A;  3EO4 A;  1WWZ A;  2J8M A;  4HNW B;  4L8A A;  3JVN A;  3FBU A;  2C27 A;  1Q2D A;  3W6S A;  2Z10 A;  2G3T A;  1QSN A;  3QAH A;  4Y49 B;  2PSW A;  2J8R A;  4CAV A;  1KUX A;  3DDD A;  4E0A A;  1IB1 E;  4F0Y A;  3CXS A;  3R96 A;  2VZZ A;  4AVC A;  4I49 A;  1YK3 A;  3TOB A;  2PRB A;  5JPH A;  2WPW A;  2FSR A;  1YR0 A;  4PK2 A;  2OZU A;  1XIX A;  4M85 A;  4H89 A;  2OZH A;  4IF5 A;  4MY0 A;  4IUS A;  2Q04 A;  3S6G A;  4AG9 A;  2Q4Y A;  2JDD A;  4Y49 C;  4KOR A;  1FY7 A;  4QBJ A;  4KZT A;  4OAD A;  2ZW6 A;  3VWE A;  3GY9 A;  1IYK A;  3IWG A;  1S7F A;  4E2A A;  1SQH A;  3UY5 A;  3D3S A;  4QC6 A;  4XNH B;  1R57 A;  1M1D A;  3TO6 A;  2D4P A;  1M44 A;  4KOT A;  4KVX A;  2HUZ A;  4RS2 A;  3FYN A;  2HQY A;  4UWI A;  4AVB A;  5F49 A;  3RYO A;  2A4N A;  2P6F A;  4XPD C;  4MJ8 A;  3N7Z A;  1S5K A;  4PK3 A;  4AG7 A;  2ZW5 A;  3SXO A;  3S6H A;  3H4Q A;  2QML A;  4ONU A;  1M4D A;  2FE7 A;  3D8P A;  5HH1 A;  3VWD A;  4JWP A;  4XNH C;  4LUA A;  2Y0M A;  2HV2 A;  3I3G A;  1B6B A;  1NMT A;  3EXN A;  1XMT A;  1TIQ A;  5EBV A;  1VHS A;  1KUY A;  3EFA A;  2ZW7 A;  1S7K A;  2BEI A;  3ZZI A;  5F48 A;  2ATR A;  2OH1 A;  2OB0 A;  5F47 A;  3FRM A;  2Q0Y A;  2B4D B;  5IX3 A;  3PP9 A;  3TTH A;  3PZJ A;  2PR8 A;  1QSR A;  2P6E A;  3BJ8 A;  4ZBG A;  3FNC A;  1Z9U A;  5I0C A;  5J8F A;  3R9G A;  4YFJ A;  5J8C A;  1MK4 A;  1M4I A;  2Q7B A;  1PU9 A;  2AJ6 A;  3D2M A;  4HNY B;  1MJA A;  3PGP A;  1YLE A;  4KLW A;  1RO5 A;  2VQY A;  4F6A A;  3QB8 A;  4KUB A;  5H84 A;  2FS5 A;  4LX9 A;  2REF A;  3G3S A;  5CNP A;  3V8I A;  3C26 A;  3ZJ0 A;  4KOW A;  1MJB A;  4KVM E;  1NSL A;  1Z4E A;  3W91 A;  4CAX A;  3IGR A;  4II9 A;  1Z4R A;  2WPX A;  4NSQ A;  1S60 A;  1CM0 A;  3TCV A;  2OZG A;  2D4O A;  3OWC A;  2B3V A;  1NE9 A;  3R1K A;  4CRZ B;  1PUA A;  4CAW A;  1N71 A;  1L0C A;  3B8G A;  4QUS A;  4FD6 A;  2ZXV A;  4CRY B;  2CY2 A;  5JQ4 A;  3TOA A;  4BMH A;  3I9S A;  3TO7 A;  4YRH A;  1S7N A;  4UA3 A;  3TO9 A;  2I79 A;  3DR8 A;  2X7B A;  1QSM A;  4U9Z A;  2REE A;  1Y7R A;  4DNC A;  4R3K A;  4HKF A;  2VXK A;  4PV6 A;  2F5I A;  2PDO A;  5KTC A;  4PSX A;  2GAN A;  1QST A;  3R9F A;  4U5Y A;  3P2F A;  4KOX A;  5GCN A;  4NEX A;  1P0H A;  2G3A A;  2R7H A;  3DNS A;  2R8V A;  5C82 A;  1LRZ A;  3CXQ A;  2PR1 A;  3CXP A;  4UBR A;  2FIW A;  4H6U A;  3E0K A;  4CS0 B;  1M4G A;  3TFY A;  2B4B A;  5DWN A;  4XPK A;  4QB9 A;  2P6G A;  4EVY A;  2AE6 A;  2GE3 A;  4OLL A;  3EC4 A;  1GHE A;  1U6M A;  2RC4 A;  1OZP A;  4KVO E;  2R98 A;  4KLV A;  3NE7 A;  3G8W A;  4R87 A;  3TT2 A;  1UFH A;  1IIC A;  3T9Y A;  1I1D A;  1Q2Y A;  2B5G A;  4PSW A;  5HMN A;  3F0A A;  4MBU A;  2BL1 A;  2KCW A;  2B5G B;  2PC1 A;  2R1I A;  1Y9W A;  1IID A;  4R3L A;  2IL4 A;  1J4J A;  4M3S A;  2CNS A;  1YGH A;  4AB7 A;  2VZY A;  3GYA A;  1YVK A;  2J8N A;  2CNT A;  4JJX A;  4L89 A;  2EVN A;  2Q44 A;  3EY5 A;  2BUE A;  4GS4 A;  4UWJ A;  2VBQ A;  4JD6 A;  2Z0Z A;  3T90 A;  2Q4V A;  1S7L A;  2BSW A;  1YRE A;  5IB0 A;  3FXT A;  1S3Z A;  4NCZ A;  2ARH A;  3MGD A;  1ON0 A;  5FVJ A;  2P0W A;  3WR7 A;  4YGO A;  3DSB A;  2EUI A;  4NXY A;  2H5M A;  3LD2 A;  5ISV A;  4AVA A;  3TE4 A;  2VEZ A;  1KUV A;  3LOD A;  2DXQ A;  2O28 A;  1BOB A;  2I00 A;  2ZPA A;  4XPD B;  1XEB A;  3F8K A;  1K4J A;  1IYL A;  3S6K A;  4KOV A;  3DR6 A;  4FD7 A;  4MI4 A;  4E8O A;  4OAE A;  3W6X A;  1XF8 A;  4KOS A;  3JUW A;  4R9M A;  2B58 A;  4KUA A;  2VI7 A;  1MJ9 A;  4JLY A;  2GIV A;  5KTD A;  4K30 A;  5H86 A;  4RI1 A;  2FXF A;  1YVO A;  3F5B A;  4ORF A;  5KTA A;  4U9Y A;  4R57 A;  2NMT A;  2PQ8 A;  3FB3 A;  1Y9K A;  2OU2 A;  2QEC A;  4J3G A;  4HNX B;  2QIR A;  1CJW A;  2FT0 A;  3R95 A;  4XPL A;  1XE4 A;  3SXN A;  5C88 A;  1YX0 A;  1B87 A;  4MY3 A;  1VKC A;  3SHP A;  4QVT A; 
#chains in the Genus database with same CATH topology
 4B5P A;  3R9E A;  3FIX A;  2JDC A;  3BJ7 A;  4MFJ A;  2AFM A;  4MFQ A;  3DGV A;  4KOU A;  3S6F A;  4B5P B;  2FL4 A;  4HPS A;  2AFX A;  2CTB A;  2FIA A;  3B35 A;  3LMS A;  1RXT A;  1XBU A;  4ONW A;  4B5O A;  1IOF A;  1P4N A;  4H6Z A;  2DPT A;  2G0B A;  2ZEG A;  1I12 A;  2JEV A;  8CPA A;  3B3V A;  4X5K A;  4MHD A;  3A9L A;  2EK9 A;  2PJ8 A;  3D7F A;  5E96 A;  5F46 A;  4JXR A;  3TC8 A;  2ZEH A;  1Q2C A;  2Z11 A;  3K9U A;  3KKW A;  4UEF A;  2B3U A;  1AMP A;  3D2P A;  5IV0 A;  1Y0Y A;  3PB7 X;  4EWT A;  1XMB A;  2CNM A;  1ZLH A;  1I21 A;  1YME A;  4NF1 A;  2B4D A;  4KOY A;  1ZLI A;  1JQG A;  2JLM A;  4GXH A;  5CPA A;  4ZYQ A;  5DWM A;  3SJX A;  3QNV A;  5HVF A;  2K5T A;  3CPX A;  1GYT A;  3GKR A;  4CYP A;  1Z8T A;  1QSO A;  1WK4 A;  3H5Z A;  4P4I A;  1KZF A;  2OOT A;  5EC4 A;  1V0C A;  3KAS A;  4FD4 A;  4NGP A;  4JXQ A;  3P2H A;  2FCK A;  2ZW4 A;  1BO4 A;  1CP7 A;  3B7I A;  4UEE A;  3BLN A;  5G22 A;  4FD5 A;  5K8P A;  1XFO A;  3D4U A;  3EO4 A;  1WWZ A;  1Y0R A;  4OKO A;  2J8M A;  2PJB A;  2ZEL A;  4HNW B;  4L8A A;  3JVN A;  4OC1 A;  3WT4 A;  4A37 A;  3FBU A;  5HVG A;  1LAN A;  2C27 A;  1Q2D A;  2PJA A;  3W6S A;  2Z10 A;  2CTC A;  4MCP A;  2G3T A;  2PVV A;  3KHX A;  1QSN A;  3IU1 A;  4KSA A;  4OME A;  3KI9 A;  4B13 A;  4CAE A;  3QAH A;  1LOK A;  4Y49 B;  3S9M A;  2PSW A;  3IC1 A;  5I4M A;  1KWM A;  4P4F A;  4TNU A;  2J8R A;  4CAV A;  2RFH A;  1KUX A;  2YND A;  3DDD A;  4KS9 A;  4YWY A;  1IB1 E;  4E0A A;  5JM6 A;  4NGM A;  1ELL P;  4F0Y A;  3CXS A;  3R96 A;  4UIB A;  1CP6 A;  2VZZ A;  5LYD A;  3K9T A;  4AVC A;  2JBK A;  4I49 A;  1AUG A;  3SJG A;  1YK3 A;  1Z2L A;  2PRB A;  2ZEE A;  3TOB A;  5JPH A;  2RB7 A;  4M6G A;  2WPW A;  1CX8 A;  1R3N A;  2FSR A;  1YR0 A;  4PK2 A;  1LCP A;  1DE4 C;  1XIX A;  2OZU A;  4M85 A;  4MHN A;  4H89 A;  2OZH A;  3VH9 A;  4IF5 A;  2C6G A;  2ANP A;  2DPS A;  4IUS A;  4MY0 A;  2Q04 A;  4PPZ A;  5A27 A;  3S6G A;  4AG9 A;  4NJQ A;  1IY7 A;  3NA6 A;  2Q4Y A;  2JDD A;  5AG7 A;  3CPA A;  1TKF A;  4EME A;  3TX8 A;  4Y49 C;  3L2N A;  4KOR A;  3NH8 A;  1FY7 A;  1IGB A;  3D7D A;  4P6Y A;  4QBJ A;  4KZT A;  2ABZ A;  4B14 A;  4OAD A;  3S9L A;  2J9A A;  2PJ7 A;  2ZW6 A;  1VIX A;  2PJC A;  3VWE A;  3GY9 A;  1TKJ A;  1IYK A;  3H8G A;  3IWG A;  4OC5 A;  1S7F A;  2V8H A;  4E2A A;  1SQH A;  3UY5 A;  3WC5 A;  1ZG7 A;  5G21 A;  2AFZ A;  3D3S A;  4QC6 A;  4XNH B;  1R57 A;  4NJR A;  1M1D A;  4JZ0 A;  3TO6 A;  4PXB A;  2D4P A;  1M44 A;  4K3N A;  4X3R A;  4KOT A;  2GFQ A;  4C7H A;  1IOI A;  4KVX A;  4A31 A;  2HUZ A;  3PFO A;  4R8F A;  4RS2 A;  2PJ0 A;  3BHX A;  1TF9 A;  3FYN A;  2HQY A;  1X12 A;  4UWI A;  4A33 A;  4AVB A;  5F49 A;  2YNC A;  2EK8 A;  4LQ6 A;  1Y7E A;  3RYO A;  5ELY A;  3D67 A;  3PBE A;  2AFS A;  2A4N A;  1YW4 A;  2VL1 A;  3D7G A;  2P6F A;  1Z5R A;  4XPD C;  4MJ8 A;  4P4D A;  5AG5 A;  2FVG A;  3N7Z A;  3RAM A;  1S5K A;  4ZX8 A;  4PK3 A;  1ZG9 A;  2ZW5 A;  3SXO A;  4AG7 A;  2XEG A;  3S6H A;  3FJU A;  5IB9 A;  3PEI A;  4UEZ A;  2BCO A;  2Z3L A;  3H4Q A;  4FWU A;  2QML A;  3D7H A;  4ONU A;  4R7M A;  4PXC A;  3RZA A;  1M4D A;  2FE7 A;  2GRE A;  3D8P A;  5HH1 A;  3VWD A;  4UFV A;  4JWP A;  4M6H A;  1VHO A;  3PB6 X;  3PFE A;  4MCS A;  4XNH C;  4LUA A;  2F7V A;  4NGR A;  2Y0M A;  3B3W A;  2HV2 A;  4PXE A;  5A28 A;  2Q43 A;  1B6B A;  3I3G A;  3PB4 X;  1NMT A;  2AFU A;  3EXN A;  4ZY1 A;  4OC3 A;  3CT9 A;  4B10 A;  1XMT A;  4A95 A;  3B3C A;  1TIQ A;  5EBV A;  1ZG8 A;  1VHS A;  4ZY2 A;  3ISX A;  5THW A;  2IQ6 A;  2YNC C;  1KUY A;  3EFA A;  1HDQ A;  2PIZ A;  2ZW7 A;  3IFE A;  5HXD A;  1S7K A;  4MFZ A;  2BEI A;  1QMU A;  2PJ6 A;  3ZZI A;  4DUK A;  5F48 A;  5LYL A;  2ATR A;  5JH9 A;  2OH1 A;  2OB0 A;  5F47 A;  4TWE A;  3FRM A;  3KGQ A;  2EBJ A;  2Q0Y A;  2B4D B;  5IX3 A;  1LAP A;  3PBB A;  3GUX A;  1F57 A;  5K8N A;  3PP9 A;  2IJZ A;  3TTH A;  3PZJ A;  3N5F A;  2V77 A;  4C2X A;  1YSJ A;  2JEW A;  2G9D A;  5AGE A;  4P4E A;  2PR8 A;  2DF5 A;  4OC4 A;  1QSR A;  2QVP A;  3FED A;  2P6E A;  5G20 A;  1X10 A;  2EO8 A;  3BJ8 A;  3FNC A;  4ZBG A;  1AYE A;  3V7Z A;  1Z9U A;  2Q7S A;  4PXD A;  5D8N A;  4CAF A;  4NGT A;  3WC7 A;  3FX6 A;  3R9G A;  4YFJ A;  5I0C A;  1NSA A;  3CDX A;  5J8F A;  5J8C A;  1LAM A;  1MK4 A;  2V8G A;  1M4I A;  2Q7B A;  1PU9 A;  2AJ6 A;  2WUU A;  3IJ3 A;  3SJE A;  4X2T A;  1RTQ A;  5D29 A;  1BAV A;  3D2M A;  4HNY B;  1ARL A;  3RNZ A;  2PJ9 A;  3GLJ A;  1MJA A;  3PGP A;  2Z3P A;  1YLE A;  2NSM A;  2WYR A;  1ELM P;  4KLW A;  1RO5 A;  2VQY A;  2QJ8 A;  1Z8L A;  2GU2 A;  2ODF A;  3QB8 A;  4KUB A;  3FEE A;  5H84 A;  4C2Z A;  4F6A A;  2FS5 A;  4LX9 A;  2REF A;  1CPX A;  1M4L A;  3G3S A;  4X8I A;  3KR4 A;  5CNP A;  3LWU A;  4MMO A;  3V8I A;  3C26 A;  3KL9 A;  5LYF A;  3ZJ0 A;  3WAB A;  2ZOF A;  4KOW A;  2PIY A;  2ZEO A;  4C68 A;  1MJB A;  3IWW A;  3LAC A;  3IEH A;  5LYI A;  4KVM E;  2O4H A;  4A39 A;  1NSL A;  1FT7 A;  1Z4E A;  1OBR A;  2PJ1 A;  3W91 A;  4CAX A;  3IGR A;  3PB9 X;  4II9 A;  1Z4R A;  2WPX A;  4UFX A;  1YLO A;  1BPM A;  3D68 A;  4NSQ A;  1S60 A;  4MHY A;  2PCU A;  1CM0 A;  4UF4 A;  4Q38 A;  3TCV A;  2OZG A;  1Z8X A;  4FBE A;  2D4O A;  1CG2 A;  3I1U A;  3H8E A;  3BI0 A;  3OWC A;  4IK2 A;  2B3V A;  1NE9 A;  3K2K A;  3FVL A;  1H8L A;  3R1K A;  4CRZ B;  1PUA A;  4W9Y A;  2YNE A;  4CAW A;  3B3S A;  1L0C A;  1N71 A;  3B8G A;  4QUS A;  2Q51 A;  4PQA A;  4FD6 A;  3RO0 A;  2ZXV A;  5LRG A;  4EFD A;  4UCM A;  4OID A;  4CRY B;  2HC9 A;  1PCA A;  3RBU A;  2CY2 A;  4ZI6 A;  3D66 A;  5JQ4 A;  3TOA A;  3MN8 A;  4BMH A;  4G1P A;  3I9S A;  3TO7 A;  4Q36 A;  4YRH A;  1XRY A;  4BD9 A;  1S7N A;  4UA3 A;  3TO9 A;  4CGO A;  2Z3O A;  3PB8 X;  2I79 A;  4A38 A;  4IHM A;  1XOV A;  3DR8 A;  2X7B A;  1QSM A;  4KSI A;  4U9Z A;  2REE A;  1F2O A;  1Y7R A;  2Q4Z A;  4DNC A;  4MRI A;  1VHE A;  4B12 A;  2Z3K A;  4R3K A;  4HKF A;  3ISZ A;  2IMO A;  2VXK A;  4CGL A;  4PV6 A;  4C2Y A;  4B6Z A;  2GLJ A;  2F5I A;  2PDO A;  5KTC A;  2OR4 A;  3CZX A;  4PSX A;  2GAN A;  1QST A;  3S9N A;  3R9F A;  2AFW A;  4U5Y A;  3P2F A;  3GB0 A;  1CBX A;  4KOX A;  4R76 A;  5GCN A;  4NEX A;  3GIU A;  1P0H A;  1Q7L A;  2BO9 A;  2G3A A;  4MCR A;  4A94 A;  4OC2 A;  2R7H A;  3DNS A;  3KHZ A;  4MXU A;  4UCP A;  3VAT A;  3VAR A;  4P44 A;  2R8V A;  4P4J A;  6CPA A;  5JGF A;  4GM5 A;  5C82 A;  1LRZ A;  3CXQ A;  2PR1 A;  3FH4 A;  4A2Z A;  3CXP A;  4UBR A;  2FIW A;  3T8W A;  4H6U A;  3E0K A;  4H2K A;  4CS0 B;  1M4G A;  2XEF A;  4R6T A;  5LRK A;  2V8D A;  4LQG A;  3TFY A;  5EMI A;  2B4B A;  1ZO0 A;  4WJB A;  2ZEF A;  5DWN A;  4F0X A;  2C6P A;  4XPK A;  5AG6 A;  2Z3M A;  4QB9 A;  3JRU A;  4BBH A;  2P6G A;  4EVY A;  2GLF A;  3IU2 A;  4BIN A;  2AE6 A;  2GE3 A;  4OLL A;  4M6I A;  3EC4 A;  4P10 A;  2O53 A;  2XEI A;  4F9V A;  2CIJ A;  3SI0 A;  1GHE A;  1U6M A;  7CPA A;  2RC4 A;  1OZP A;  4KVO E;  2R98 A;  3HLP A;  4KLV A;  3NE7 A;  3G8W A;  2AFO A;  2POK A;  4MFP A;  4R87 A;  4MHP A;  2WZN A;  3IO1 A;  3PRT A;  4MCQ A;  3TT2 A;  4A32 A;  1UFH A;  1IIC A;  3T9Y A;  4A30 A;  3IWE A;  3V38 A;  4CYN A;  4DJL A;  1I1D A;  5K8O A;  1Q2Y A;  2B5G A;  4PSW A;  5HMN A;  3F0A A;  4MBU A;  1HDU A;  2BL1 A;  3KQZ A;  4MHZ A;  2KCW A;  2B5G B;  2PC1 A;  1TXR A;  1Y9W A;  2BOA A;  2R1I A;  4FUU A;  4IAV A;  5K8M A;  2Z3N A;  3QAY A;  1IID A;  1BPN A;  4R3L A;  3KR5 A;  2IL4 A;  1J4J A;  4M3S A;  2CNS A;  4Z65 A;  1YGH A;  4AB7 A;  2ZEM A;  4CPA A;  1FNO A;  2VZY A;  3MRU A;  5AG4 A;  1YQE A;  5CBM A;  1F2P A;  3GYA A;  4Q7A A;  1YVK A;  2CF4 A;  2J8N A;  4NFR A;  4ZY0 A;  1VGY A;  4RN7 A;  2CNT A;  4JJX A;  2F8H A;  4L89 A;  2EVN A;  4OC0 A;  2Q44 A;  3EY5 A;  4ZGY B;  2BUE A;  4GS4 A;  1DTD A;  1TKH A;  2EWB A;  1JWQ A;  2DEA A;  2VBQ A;  2YGW A;  3BXM A;  4JD6 A;  4UWJ A;  3B2Y A;  2Z0Z A;  3BI1 A;  4O23 A;  3FF3 A;  3T90 A;  1EE3 P;  3KQX A;  2Q4V A;  1S7L A;  2BSW A;  3DLJ A;  1YRE A;  5IB0 A;  4UIA A;  4CGM A;  2ZEP A;  3FXT A;  1S3Z A;  1LFW A;  1YW6 A;  4NCZ A;  2HB6 A;  2ARH A;  4UCN A;  4CYQ A;  4RUH A;  1UWY A;  3MGD A;  1ON0 A;  4YU9 A;  2NYQ A;  5J1Q A;  4C7I A;  5FVJ A;  2P0W A;  5DS0 A;  3WR7 A;  4YGO A;  1XJO A;  4OP4 A;  4DYO A;  3DSB A;  1A2Z A;  4P45 A;  4ZX9 A;  2EUI A;  1ARM A;  5BWA B;  4NXY A;  2PE3 A;  1CPS A;  1PYT B;  2H5M A;  3LD2 A;  2PJ2 A;  2XEJ A;  5ISV A;  4AVA A;  4NGS A;  3TE4 A;  5G1Z A;  2VEZ A;  2QYV A;  4CGN A;  4B11 A;  1KUV A;  3LOD A;  4OIW A;  1R43 A;  2DXQ A;  4MFL A;  3KZW A;  3FEC A;  2O28 A;  1BOB A;  2ZED A;  4CGP A;  1Z8W A;  4WWV A;  1TF8 A;  2I00 A;  2ZPA A;  4XPD B;  1XEB A;  4JYW A;  3F8K A;  1K4J A;  1IYL A;  3S6K A;  3H8F A;  4KOV A;  3DR6 A;  4FD7 A;  4MI4 A;  4UFW A;  4OAE A;  3W6X A;  4CYO A;  1XF8 A;  4E8O A;  3SI2 A;  4KOS A;  3JUW A;  3NH5 A;  4R9M A;  2C1C A;  2B58 A;  2ZOG A;  4KUA A;  2VI7 A;  4F9U A;  1MJ9 A;  3NFZ A;  4KSF A;  4P4B A;  4AXV A;  3HUV A;  4JLY A;  3NH4 A;  3WC6 A;  5F09 A;  2GIV A;  1QQ9 A;  5KTD A;  4NGN A;  3FMC A;  4K30 A;  2JBJ A;  1IU8 A;  5H86 A;  4RI1 A;  4NGQ A;  4MFK A;  3SI1 A;  2I3C A;  2FXF A;  2C6C A;  3B3T A;  1YVO A;  1BLL E;  3F5B A;  1HEE A;  4ORF A;  3JTK A;  4U9Y A;  5KTA A;  2PJ5 A;  4R57 A;  2ZEN A;  2V8V A;  2CXA A;  2NMT A;  2PQ8 A;  3FB3 A;  1Y9K A;  2OU2 A;  2QEC A;  4J3G A;  3SJF A;  4HNX B;  2PJ4 A;  2QIR A;  1CJW A;  5HVH A;  2FT0 A;  3R95 A;  4XPL A;  1XE4 A;  2PRQ A;  2WSA A;  3SXN A;  3NE8 A;  5C88 A;  1YX0 A;  1B87 A;  3IIB A;  5LRJ A;  4MY3 A;  1VKC A;  2PJ3 A;  4FAI A;  2PVW A;  3SHP A;  4F8Z A;  4QVT A; 
#chains in the Genus database with same CATH homology
 4B5P A;  3R9E A;  3FIX A;  2JDC A;  3BJ7 A;  4MFJ A;  4MFQ A;  4KOU A;  3S6F A;  4B5P B;  2FL4 A;  4CGM A;  4B5O A;  2FIA A;  1RXT A;  1P4N A;  4H6Z A;  2DPT A;  2G0B A;  1I12 A;  2JEV A;  4X5K A;  4MHD A;  3A9L A;  5E96 A;  5F46 A;  4JXR A;  1Q2C A;  2Z11 A;  3K9U A;  3KKW A;  2B3U A;  3D2P A;  5IV0 A;  2CNM A;  1I21 A;  4NF1 A;  2B4D A;  4KOY A;  2JLM A;  5DWM A;  2K5T A;  3GKR A;  4CYP A;  1QSO A;  1WK4 A;  3H5Z A;  1KZF A;  5EC4 A;  1V0C A;  4FD4 A;  4JXQ A;  3P2H A;  2FCK A;  2ZW4 A;  1BO4 A;  3BLN A;  5G22 A;  4FD5 A;  3EO4 A;  1WWZ A;  2J8M A;  4HNW B;  4L8A A;  3JVN A;  3FBU A;  2C27 A;  1Q2D A;  3W6S A;  2Z10 A;  2G3T A;  4KSA A;  1QSN A;  3IU1 A;  4B13 A;  4CAE A;  3QAH A;  4Y49 B;  2PSW A;  2J8R A;  4CAV A;  1KUX A;  2YND A;  3DDD A;  4KS9 A;  4E0A A;  1IB1 E;  4F0Y A;  3CXS A;  3R96 A;  2VZZ A;  4AVC A;  4I49 A;  1YK3 A;  3TOB A;  2PRB A;  5JPH A;  2WPW A;  2FSR A;  1YR0 A;  4PK2 A;  2OZU A;  1XIX A;  4M85 A;  4H89 A;  2OZH A;  4IF5 A;  2DPS A;  4MY0 A;  4IUS A;  5A27 A;  2Q04 A;  3S6G A;  4AG9 A;  2Q4Y A;  2JDD A;  5AG7 A;  4Y49 C;  4KOR A;  1FY7 A;  4QBJ A;  4KZT A;  4B14 A;  4OAD A;  2ZW6 A;  3VWE A;  3GY9 A;  1IYK A;  3IWG A;  1S7F A;  4E2A A;  1SQH A;  3UY5 A;  5G21 A;  3D3S A;  4QC6 A;  4XNH B;  1R57 A;  1M1D A;  3TO6 A;  2D4P A;  1M44 A;  4KOT A;  4C7H A;  4KVX A;  4A31 A;  2HUZ A;  4RS2 A;  3FYN A;  2HQY A;  4UWI A;  4A33 A;  4AVB A;  5F49 A;  2YNC A;  3RYO A;  2A4N A;  2P6F A;  4XPD C;  4MJ8 A;  5AG5 A;  3N7Z A;  1S5K A;  4PK3 A;  4AG7 A;  2ZW5 A;  3SXO A;  3S6H A;  2Z3L A;  3H4Q A;  2QML A;  4ONU A;  1M4D A;  2FE7 A;  3D8P A;  5HH1 A;  3VWD A;  4UFV A;  4JWP A;  4XNH C;  4LUA A;  2Y0M A;  2HV2 A;  5A28 A;  3I3G A;  1B6B A;  1NMT A;  3EXN A;  4B10 A;  1XMT A;  4A95 A;  1TIQ A;  5EBV A;  1VHS A;  2YNC C;  1KUY A;  3EFA A;  2ZW7 A;  1S7K A;  4MFZ A;  2BEI A;  3ZZI A;  5F48 A;  2ATR A;  2OH1 A;  2OB0 A;  5F47 A;  3FRM A;  2Q0Y A;  2B4D B;  5IX3 A;  3PP9 A;  3TTH A;  3PZJ A;  4C2X A;  5AGE A;  2PR8 A;  1QSR A;  2P6E A;  5G20 A;  3BJ8 A;  4ZBG A;  3FNC A;  1Z9U A;  4CAF A;  5I0C A;  5J8F A;  3R9G A;  4YFJ A;  5J8C A;  1MK4 A;  1M4I A;  2Q7B A;  1PU9 A;  2AJ6 A;  2WUU A;  3D2M A;  4HNY B;  1MJA A;  3PGP A;  2Z3P A;  1YLE A;  4KLW A;  1RO5 A;  2VQY A;  4F6A A;  3QB8 A;  4KUB A;  5H84 A;  4C2Z A;  2FS5 A;  4LX9 A;  2REF A;  3G3S A;  5CNP A;  3V8I A;  3C26 A;  3ZJ0 A;  4KOW A;  4C68 A;  1MJB A;  4KVM E;  1NSL A;  1Z4E A;  3W91 A;  4CAX A;  3IGR A;  4II9 A;  1Z4R A;  2WPX A;  4UFX A;  4NSQ A;  1S60 A;  1CM0 A;  4Q38 A;  3TCV A;  2OZG A;  2D4O A;  3OWC A;  2B3V A;  1NE9 A;  3R1K A;  4CRZ B;  1PUA A;  2YNE A;  4CAW A;  1N71 A;  1L0C A;  3B8G A;  4QUS A;  4FD6 A;  2ZXV A;  4UCM A;  4CRY B;  2CY2 A;  5JQ4 A;  3TOA A;  4BMH A;  3I9S A;  3TO7 A;  4Q36 A;  4YRH A;  1S7N A;  4UA3 A;  3TO9 A;  4CGO A;  2Z3O A;  2I79 A;  3DR8 A;  2X7B A;  1QSM A;  4U9Z A;  2REE A;  1Y7R A;  4DNC A;  4B12 A;  2Z3K A;  4R3K A;  4HKF A;  4CGL A;  2VXK A;  4PV6 A;  4C2Y A;  2F5I A;  2PDO A;  5KTC A;  4PSX A;  2GAN A;  1QST A;  3R9F A;  4U5Y A;  3P2F A;  4KOX A;  5GCN A;  4NEX A;  1P0H A;  2G3A A;  2R7H A;  3DNS A;  4UCP A;  2R8V A;  5C82 A;  1LRZ A;  3CXQ A;  2PR1 A;  4A2Z A;  3CXP A;  4UBR A;  2FIW A;  4H6U A;  3E0K A;  4CS0 B;  1M4G A;  3TFY A;  2B4B A;  1ZO0 A;  5DWN A;  4F0X A;  4XPK A;  5AG6 A;  2Z3M A;  4QB9 A;  4BBH A;  2P6G A;  4EVY A;  3IU2 A;  2AE6 A;  2GE3 A;  4OLL A;  3EC4 A;  1GHE A;  1U6M A;  2RC4 A;  1OZP A;  4KVO E;  2R98 A;  4KLV A;  3NE7 A;  3G8W A;  4MFP A;  4R87 A;  4A32 A;  3TT2 A;  1UFH A;  1IIC A;  3T9Y A;  4A30 A;  3IWE A;  4CYN A;  1I1D A;  1Q2Y A;  2B5G A;  4PSW A;  5HMN A;  3F0A A;  4MBU A;  2BL1 A;  2KCW A;  2B5G B;  2PC1 A;  2R1I A;  1Y9W A;  2Z3N A;  1IID A;  4R3L A;  2IL4 A;  1J4J A;  4M3S A;  2CNS A;  1YGH A;  4AB7 A;  2VZY A;  5AG4 A;  3GYA A;  1YVK A;  2J8N A;  2CNT A;  4JJX A;  4L89 A;  2EVN A;  2Q44 A;  3EY5 A;  4ZGY B;  2BUE A;  4GS4 A;  2YGW A;  4UWJ A;  2VBQ A;  4JD6 A;  2Z0Z A;  3T90 A;  2Q4V A;  1S7L A;  2BSW A;  1YRE A;  5IB0 A;  3FXT A;  1S3Z A;  4NCZ A;  2ARH A;  4UCN A;  4CYQ A;  3MGD A;  1ON0 A;  4C7I A;  5FVJ A;  2P0W A;  3WR7 A;  4YGO A;  3DSB A;  2EUI A;  5BWA B;  4NXY A;  2H5M A;  3LD2 A;  5ISV A;  4AVA A;  3TE4 A;  5G1Z A;  2VEZ A;  4CGN A;  4B11 A;  1KUV A;  3LOD A;  2DXQ A;  4MFL A;  2O28 A;  1BOB A;  4CGP A;  2I00 A;  2ZPA A;  4XPD B;  1XEB A;  3F8K A;  1K4J A;  1IYL A;  3S6K A;  4KOV A;  3DR6 A;  4FD7 A;  4MI4 A;  4UFW A;  4OAE A;  3W6X A;  4CYO A;  1XF8 A;  4E8O A;  4KOS A;  3JUW A;  4R9M A;  2B58 A;  4KUA A;  2VI7 A;  1MJ9 A;  4KSF A;  4JLY A;  2GIV A;  5KTD A;  4K30 A;  5H86 A;  4RI1 A;  4MFK A;  2FXF A;  1YVO A;  3F5B A;  4ORF A;  5KTA A;  3JTK A;  4U9Y A;  4R57 A;  2CXA A;  2NMT A;  2PQ8 A;  3FB3 A;  1Y9K A;  2OU2 A;  2QEC A;  4J3G A;  4HNX B;  2QIR A;  1CJW A;  2FT0 A;  3R95 A;  4XPL A;  1XE4 A;  2WSA A;  3SXN A;  5C88 A;  1YX0 A;  1B87 A;  4MY3 A;  1VKC A;  3SHP A;  4QVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...