1M1DA

Tetrahymena gcn5 with bound bisubstrate analog inhibitor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
163
structure length
163
Chain Sequence
LLDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords TGCN5 HISTONE ACETYL TRANSFERASE
publication title Structure of the GCN5 histone acetyltransferase bound to a bisubstrate inhibitor.
pubmed doi rcsb
source organism Tetrahymena thermophila
total genus 47
structure length 163
sequence length 163
chains with identical sequence C
ec nomenclature ec 2.3.1.-:
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1m1dA00
1XIXA 3T90A 1XEBA 2P6GA 4ORFA 4JXQA 2B58A 3ZZIA 1V0CA 4FD4A 1MK4A 1UFHA 3ZJ0A 2WPXA 1YVKA 2Z0ZA 1ON0A 2Q4VA 1GHEA 3FBUA 4H6UA 4MHDA 4NEXA 5FVJA 2REFA 1BO4A 1NE9A 4B5OA 5F47A 2REEA 1Z9UA 3BJ8A 4JXRA 3FIXA 3VWEA 2X7BA 4B5PB 2R8VA 1PU9A 3MGDA 5HMNA 3TTHA 2P6FA 1XF8A 3LD2A 1MJBA 3OWCA 2HUZA 3CXQA 1N71A 4BMHA 2VZZA 3DR8A 4FD7A 3E0KA 3FXTA 4MJ8A 5I0CA 3TO7A 2Z11A 4RS2A 3TFYA 3PZJA 3D2MA 4KOSA 3QB8A 3CXPA 4UBRA 4UWJA 3TOAA 3T9YA 2WPWA 1QSOA 2DXQA 1S7LA 4PV6A 1B6BA 4KLWA 2Y0MA 4OLLA 4QVTA 2B4DA 3G3SA 1IICA 3R96A 2D4OA 4CAVA 3S6GA 1I21A 3R1KA 4I49A 2HV2A 3W6SA 4II9A 3W6XA 1Y9WA 4NSQA 4KUAA 4PSXA 2QIRA 5H86A 4KOYA 2OZHA 4AG7A 3EO4A 1KZFA 5CNPA 2D4PA 1IYLA 3W91A 4KORA 2CY2A 2B4DB 2Q0YA 3EY5A 2AJ6A 4R87A 3WR7A 3R95A 2PC1A 2JEVA 1Q2YA 3JUWA 5IX3A 4H89A 4KOVA 4R57A 1L0CA 2IL4A 2FCKA 3EC4A 4F6AA 1P0HA 3UY5A 4OAEA 1NSLA 1FY7A 2J8NA 1M44A 4U9YA 3TO6A 4K30A 2Q7BA 5F46A 4NF1A 1I12A 2O28A 1I1DA 3K9UA 3S6KA 2FXFA 4QUSA 3GKRA 4XPLA 4CAWA 2NMTA 1R57A 4AB7A 2PDOA 2ARHA 3GY9A 4KOTA 4E0AA 2QECA 2B3VA 1IIDA 3I3GA 4L89A 2K5TA 3TO9A 1QSMA 2GIVA 4E2AA 1S60A 5ISVA 5IV0A 4LUAA 1RXTA 3N7ZA 2PQ8A 2I00A 1Y7RA 2BSWA 1OZPA 4RI1A 4FD5A 3GYAA 3D2PA 4YGOA 4Y49C 2CNMA 3QAHA 2VXKA 3PGPA 4CRZB 4L8AA 2FT0A 3S6HA 4QBJA 2HQYA 4KVXA 5EBVA 5J8CA 1QSNA 2VBQA 3H4QA 3SXNA 1TIQA 3BJ7A 2C27A 4R3KA 2ZXVA 2PR1A 4HKFA 1XMTA 1VKCA 3TCVA 2BUEA 3SXOA 3V8IA 4UA3A 2OZUA 4YRHA 1S5KA 5HH1A 2B4BA 1NMTA 1VHSA 3VWDA 1QSRA 1RO5A 5EC4A 1S3ZA 4JD6A 1K4JA 4KVOE 1MJ9A 5KTDA 4PK3A 4ONUA 1LRZA 4MY3A 2I79A 2Q4YA 5E96A 4HNXB 2PSWA 2R7HA 4KOUA 1M4DA 4AVAA 3S6FA 4U9ZA 1YGHA 1KUXA 4U5YA 4XPDB 3IGRA 4MBUA 4OADA 2PRBA 3EFAA 3DNSA 2GANA 2ZPAA 5J8FA 4M85A 2OU2A 2FIAA 4QB9A 3P2FA 4YFJA 2P0WA 5F48A 2VZYA 4LX9A 1S7NA 3F8KA 2AE6A 4PSWA 3C26A 2JDDA 3D8PA 5C88A 1WK4A 4XPDC 1YK3A 3TOBA 2ZW4A 2FIWA 1U6MA 2J8RA 3R9GA 2ATRA 4FD6A 3SHPA 3FYNA 4XPKA 4UWIA 4CS0B 4KOWA 2VQYA 2FS5A 1WWZA 1YREA 2R1IA 1CM0A 1Q2DA 1YLEA 4KUBA 4MY0A 1Q2CA 4Y49B 2G0BA 4NXYA 4KOXA 4J3GA 3RYOA 3D3SA 4XNHB 4JLYA 2JDCA 3DSBA 5H84A 4JJXA 3R9EA 3FNCA 1PUAA 3IWGA 2F5IA 1M1DA 3R9FA 1S7KA 2G3TA 3NE7A 2CNTA 2VI7A 2EVNA 1IYKA 2OH1A 1YVOA 2PR8A 4PK2A 2Z10A 1YR0A 4XNHC 3I9SA 3JVNA 4IUSA 4F0YA 4M3SA 1M4GA 1KUYA 2Q04A 1Z4EA 2G3AA 4HNYB 5KTCA 2OZGA 5IB0A 3P2HA 4ZBGA 5KTAA 4KLVA 4HNWB 4R3LA 3FRMA 5DWNA 3F0AA 1Y9KA 4MI4A 4H6ZA 4EVYA 3DDDA 3TT2A 4IF5A 1SQHA 2J8MA 4CRYB 3KKWA 5DWMA 2KCWA 1CJWA 3BLNA 2Q44A 5GCNA 4R9MA 4E8OA 2CNSA 2ZW5A 2FE7A 1P4NA 3DR6A 2VEZA 2JLMA 2B5GA 1BOBA 4AVCA 1YX0A 1MJAA 1S7FA 2BL1A 5JPHA 1KUVA 3TE4A 2A4NA 3EXNA 4KZTA 1J4JA 1Z4RA 3CXSA 2FSRA 5C82A 5F49A 4X5KA 5JQ4A 1IB1E 4GS4A 4AG9A 3FB3A 2QMLA 2R98A 2OB0A 4JWPA 2GE3A 1M4IA 2ZW7A 4CAXA 2FL4A 3LODA 4QC6A 3PP9A 2B5GB 4AVBA 1XE4A 4NCZA 1QSTA 2P6EA 4DNCA 2H5MA 2B3UA 3B8GA 2ZW6A 4B5PA 2EUIA 1B87A 2BEIA 3G8WA 2RC4A 3F5BA 4KVME
chains in the Genus database with same CATH superfamily
2PJ7A 1XIXA 3T90A 3FEDA 3FECA 4BD9A 4IAVA 5K8OA 2QJ8A 3GUXA 1XEBA 2P6GA 3KHXA 3QNVA 1QQ9A 2Z3PA 4ORFA 4UEZA 4JXQA 3B7IA 2B58A 1YW4A 2PJ4A 4CGMA 3ZZIA 1V0CA 1AMPA 2CXAA 3ISXA 4UCNA 3D4UA 4FD4A 1MK4A 1UFHA 2EK8A 3IWWA 2ZEMA 4KSIA 3ZJ0A 2BCOA 2WPXA 1YVKA 4UEFA 4LQ6A 5LRKA 3PB9X 2Z0ZA 2PCUA 4P4DA 2DEAA 3PFEA 1ON0A 2OR4A 4JZ0A 3GIUA 2Q4VA 3IJ3A 1GHEA 3B3TA 1CG2A 3FBUA 2Q4ZA 4H6UA 4MHDA 3WC7A 2AFOA 3PRTA 3RO0A 4NEXA 5FVJA 2REFA 1NSAA 1BO4A 1NE9A 3K2KA 5F47A 4B5OA 2REEA 1Z9UA 4MFLA 3BJ8A 4JXRA 4OKOA 4PXBA 1BLLE 3FIXA 5AG5A 4C2XA 3VWEA 7CPAA 2O53A 2X7BA 4B5PB 2R8VA 5HXDA 4MFPA 1PU9A 3MGDA 2AFUA 3FMCA 3NH8A 1ARMA 5HMNA 3H5ZA 3TTHA 2P6FA 1XF8A 1IU8A 2Z3NA 3D67A 3KQZA 1MJBA 1FT7A 2HUZA 3LD2A 3OWCA 1IOIA 4RUHA 4OIDA 5JGFA 4UCPA 1Y0YA 3CXQA 1N71A 3WABA 4BMHA 2VZZA 4P4FA 2AFSA 3DR8A 4FD7A 3E0KA 3FXTA 4MJ8A 5I0CA 3TO7A 2Z11A 4RS2A 6CPAA 2QYVA 4B12A 8CPAA 5LRJA 3TFYA 4CGOA 1Y0RA 3PZJA 4UIAA 3D2MA 4KOSA 1F57A 3QB8A 1XBUA 3CXPA 4UBRA 4UWJA 1BPMA 3TOAA 2PJ8A 3KGQA 2EBJA 3SI2A 3T9YA 1TKFA 2WPWA 5JM6A 2WYRA 3FX6A 2CTCA 1QSOA 4F0XA 3PFOA 2DXQA 1ZG9A 3FH4A 2V8HA 2ZEPA 2DPSA 1S7LA 4PV6A 1B6BA 4KLWA 2Y0MA 1LFWA 4OLLA 4QVTA 2B4DA 2V8DA 4ZY1A 4C2ZA 3G3SA 1IICA 1AYEA 4C7HA 4NGPA 3R96A 4CGPA 1VHOA 1XJOA 2D4OA 1TF9A 4CAVA 1VGYA 3S6GA 1YLOA 2EO8A 1I21A 3R1KA 2F7VA 4I49A 4GXHA 1HDUA 4F8ZA 2HV2A 3W6SA 1TKHA 3TX8A 4A2ZA 4II9A 2PJ9A 3N5FA 4PXEA 4ZX9A 3BHXA 1Y9WA 1BPNA 3W6XA 5F09A 2GU2A 4KUAA 4NSQA 4PSXA 2QIRA 4OC1A 1XOVA 1LAPA 1IOFA 2ZEEA 5H86A 4KOYA 4MHNA 2OZHA 1LANA 4AG7A 1Z8WA 3EO4A 5G21A 1XFOA 1KZFA 2BO9A 3PB8X 1HEEA 5CNPA 2D4PA 1IYLA 3W91A 3FJUA 1TF8A 4KORA 2CY2A 2B4DB 2GREA 2Q0YA 5G22A 3EY5A 2AJ6A 2I3CA 4OMEA 5AG6A 4R87A 3WR7A 3IWEA 3R95A 4Q36A 2YNEA 3TC8A 4CYQA 4DJLA 2PC1A 2JEVA 3D7GA 1Q2YA 3JUWA 4KS9A 5THWA 4CYPA 4H89A 3LACA 4DYOA 4KOVA 5IX3A 4R57A 4MFKA 2PJ5A 2DPTA 1L0CA 4X2TA 4YWYA 2PJCA 4R76A 1LOKA 2IL4A 2ZEOA 2FCKA 4RN7A 3EC4A 5CBMA 5JH9A 2ZEFA 4F6AA 5AG4A 1P0HA 5IB9A 3BI1A 4OAEA 1NSLA 3LMSA 3UY5A 1FY7A 2J8NA 1M44A 4U9YA 3TO6A 4K30A 2Z3MA 5J1QA 2G9DA 2Q7BA 5A28A 5F46A 3IU1A 4NF1A 1I12A 4IHMA 2O28A 1I1DA 1ZLHA 3BXMA 3K9UA 3S6KA 2FXFA 4QUSA 3GKRA 1H8LA 4H2KA 4XPLA 4CAWA 1ZLIA 4MCPA 2ZEGA 2NMTA 1R57A 4ZY0A 4AB7A 4CAEA 2PDOA 2ARHA 3GY9A 4KOTA 4E0AA 3MN8A 4ZI6A 2QECA 3KHZA 4NGRA 2B3VA 4UFXA 1IIDA 3I3GA 4B13A 4L89A 5LYFA 2K5TA 3PBBA 1QSMA 5D8NA 3TO9A 2GIVA 4M6HA 4E2AA 1YMEA 1S60A 5ISVA 3H8EA 5IV0A 3KQXA 1Z8LA 4LUAA 1RXTA 2PVVA 3N7ZA 2PQ8A 2V8GA 2I00A 1Y7RA 3K9TA 2BSWA 1OZPA 2RB7A 4RI1A 2ODFA 4FD5A 4ZYQA 1Z8TA 4M6IA 2PE3A 3GYAA 3D2PA 3MRUA 1M4LA 2C1CA 4Y49C 4YGOA 1CPSA 2CNMA 2CIJA 2Z3OA 3QAHA 2Q7SA 2VXKA 4P44A 3PGPA 4CRZB 4L8AA 4FBEA 4ZY2A 2FT0A 4P4JA 4UEEA 3S6HA 3PB7X 5CPAA 4NJRA 4QBJA 2HQYA 2JBKA 2NYQA 4KVXA 2J9AA 5EBVA 1YW6A 1QSNA 4CPAA 2VBQA 5J8CA 1AUGA 5HVGA 3H4QA 1Z5RA 3SXNA 1TIQA 1HDQA 2C27A 2PJBA 3BJ7A 2ZXVA 4HPSA 4MHYA 4P4EA 4R3KA 2PR1A 4HKFA 5DS0A 3V7ZA 1XMTA 4MMOA 5LRGA 1VKCA 3HLPA 3TCVA 1X12A 2BUEA 3SXOA 3V8IA 4K3NA 2XEFA 4CAFA 4UA3A 1PCAA 3RAMA 3PB6X 1ELMP 3KASA 2OZUA 4OC4A 1S5KA 4YRHA 5HH1A 2B4BA 4Z65A 3WT4A 1NMTA 4B11A 1VHSA 3VWDA 1QSRA 1RO5A 2AFWA 4GM5A 1OBRA 2XEGA 2DF5A 1S3ZA 2Z3KA 5EC4A 2PRQA 3CZXA 4TWEA 4JD6A 1K4JA 4KVOE 1MJ9A 5AGEA 4F9UA 4PK3A 5KTDA 4ONUA 1LRZA 3KI9A 2I79A 2QVPA 4MY3A 3SI0A 3SI1A 4R6TA 1JWQA 2Q4YA 5E96A 4HNXB 1ZO0A 2PSWA 2R7HA 3CT9A 2PIYA 4KOUA 1UWYA 4P4BA 1M4DA 4AVAA 4C68A 3S6FA 2PJAA 2POKA 3JTKA 4NGQA 4U9ZA 4G1PA 4IK2A 1CP7A 3NH4A 4MFJA 1YGHA 2HC9A 5EMIA 2YNDA 3KZWA 4A30A 4A32A 1KUXA 4U5YA 4XPDB 1CX8A 3IGRA 4OC2A 3V38A 4MBUA 4OADA 2PRBA 3B3VA 3CPXA 3EFAA 3NH5A 3QAYA 2JEWA 3I1UA 3GB0A 4KSFA 4FAIA 3DNSA 2GANA 4PXCA 2ZPAA 5J8FA 4M85A 4MCQA 2OU2A 2FIAA 2GLJA 3P2FA 4QB9A 2ABZA 4WJBA 4YFJA 2P0WA 4B14A 5F48A 2AFMA 2VZYA 3BI0A 4LX9A 3D68A 4OC0A 1S7NA 2YNCC 3F8KA 5ELYA 2AE6A 1CP6A 1IGBA 4PSWA 3VH9A 4PQAA 3PBEA 3KR4A 2CTBA 3C26A 1EE3P 2JDDA 2OOTA 3D8PA 3IU2A 5C88A 1WK4A 4XPDC 2IQ6A 1YK3A 1RTQA 2ZW4A 2FIWA 3RBUA 3TOBA 1U6MA 2J8RA 1ELLP 4NJQA 2C6CA 3R9GA 4EWTA 2ATRA 4FD6A 3IC1A 4ONWA 4R8FA 4UFWA 3SJGA 4PPZA 5K8MA 3RNZA 1LCPA 4W9YA 3SHPA 3L2NA 4BINA 5LYIA 1VIXA 3FYNA 4A37A 2CF4A 4JYWA 2ZOGA 3CPAA 2PJ1A 2Q43A 2ZOFA 4XPKA 4UWIA 4CS0B 4KOWA 4X3RA 4CGLA 5K8NA 2VQYA 3H8FA 2FS5A 1WWZA 1YREA 2R1IA 1ZG7A 2ANPA 1CM0A 1Q2DA 1YLEA 4KUBA 4R7MA 3JRUA 4MY0A 1Q2CA 4Y49B 4MFQA 2G0BA 1ARLA 4NXYA 2EWBA 4KOXA 1DTDA 4F9VA 4FUUA 4J3GA 5HVFA 3RYOA 3D3SA 4Q38A 4MCSA 4A31A 3B35A 4XNHB 4A95A 1PYTB 1A2ZA 3B2YA 4JLYA 4PXDA 2JDCA 2NSMA 3DSBA 4OC5A 5H84A 4JJXA 3R9EA 3FNCA 1PUAA 2V77A 2AFXA 3IWGA 4P4IA 2PVWA 2F5IA 3SJEA 1M1DA 3R9FA 3FF3A 3SJXA 3NA6A 1S7KA 1YQEA 3D66A 2G3TA 2ZEHA 3NE7A 4CGNA 3D7DA 4FWUA 2PJ3A 2CNTA 3H8GA 2VI7A 2EVNA 1IYKA 4B6ZA 4CYNA 2OH1A 1YVOA 5HVHA 2PR8A 4PK2A 2Z10A 4EFDA 1YR0A 2ZENA 4XNHC 3I9SA 3IFEA 1TKJA 2PJ2A 4ZX8A 4NGTA 4TNUA 3JVNA 4IUSA 4A94A 4F0YA 1TXRA 1M4GA 4M3SA 3NFZA 4UFVA 4OIWA 1XRYA 4YU9A 4B10A 2YNCA 3B3WA 2C6PA 1KUYA 4MXUA 4NGSA 1X10A 4UIBA 1FNOA 4A33A 2Q04A 1Z4EA 2G3AA 2ZEDA 4HNYB 2YGWA 5KTCA 4P6YA 1Y7EA 1F2OA 1F2PA 2C6GA 2OZGA 5IB0A 1Z2LA 3P2HA 4ZBGA 4BBHA 4WWVA 4KLVA 3WC5A 4UCMA 5BWAB 5KTAA 3FVLA 2BOAA 2WZNA 1XMBA 4HNWB 3GLJA 4MFZA 4OP4A 3IO1A 4R3LA 4C2YA 2RFHA 3KL9A 2XEIA 2GFQA 3FRMA 5DWNA 3F0AA 1Y9KA 2XEJA 1R43A 4H6ZA 1KWMA 4MI4A 1BAVA 3DDDA 3TT2A 4EVYA 4IF5A 4M6GA 1SQHA 4MCRA 1Z8XA 2ZELA 2J8MA 4CRYB 4ZGYB 3KKWA 4A38A 4AXVA 3S9LA 2Z3LA 5DWMA 3S9MA 5G20A 2KCWA 1R3NA 1CJWA 4Q7AA 3D7HA 3BLNA 3ISZA 3PEIA 3RZAA 3KR5A 2Q44A 3FEEA 5GCNA 4R9MA 2IJZA 2CNSA 4E8OA 2WSAA 1VHEA 3IEHA 4MHPA 4EMEA 5I4MA 2WUUA 2ZW5A 2FE7A 1P4NA 3DR6A 2VEZA 2FVGA 2O4HA 1CBXA 2B5GA 2JLMA 4KSAA 4P10A 3DGVA 1BOBA 4AVCA 1YX0A 1GYTA 3B3SA 1MJAA 1S7FA 1DE4C 1LAMA 2BL1A 4OC3A 5JPHA 5G1ZA 1CPXA 1KUVA 5LYLA 3S9NA 3TE4A 2A4NA 3PB4X 4NGMA 3DLJA 3EXNA 2PIZA 4KZTA 1J4JA 1Z4RA 3CXSA 2FSRA 1ZG8A 2EK9A 4X8IA 5C82A 2HB6A 2PJ0A 1JQGA 3SJFA 3IIBA 5F49A 2JBJA 4DUKA 4X5KA 4UF4A 1YSJA 5JQ4A 2Q51A 2V8VA 1IB1E 2PJ6A 3D7FA 5AG7A 2IMOA 3NE8A 5K8PA 4GS4A 2AFZA 4MHZA 4AG9A 4A39A 3FB3A 3VARA 2QMLA 2R98A 2OB0A 4O23A 4CYOA 4JWPA 2GE3A 1M4IA 2ZW7A 3CDXA 2FL4A 4CAXA 2VL1A 4C7IA 3LODA 4QC6A 2F8HA 3PP9A 3HUVA 4P45A 3LWUA 2B5GB 4AVBA 5D29A 3T8WA 1XE4A 4NFRA 4LQGA 4NCZA 1QSTA 2P6EA 3A9LA 3VATA 4DNCA 1IY7A 5A27A 2H5MA 2B3UA 3B8GA 2ZW6A 3B3CA 2GLFA 1Q7LA 4B5PA 2EUIA 1B87A 3WC6A 5LYDA 1QMUA 2BEIA 3G8WA 2RC4A 4MRIA 4NGNA 3F5BA 4KVME
chains in the Genus database with same CATH topology
1XIXA 3T90A 1XEBA 2P6GA 4ORFA 2Z3PA 4JXQA 2B58A 4CGMA 3ZZIA 1V0CA 2CXAA 4UCNA 4FD4A 1MK4A 1UFHA 3ZJ0A 2WPXA 1YVKA 2Z0ZA 1ON0A 2Q4VA 1GHEA 3FBUA 4H6UA 4MHDA 4NEXA 5FVJA 2REFA 1BO4A 1NE9A 4B5OA 5F47A 2REEA 1Z9UA 4MFLA 3BJ8A 4JXRA 5AG5A 4C2XA 3FIXA 3VWEA 2X7BA 4B5PB 2R8VA 4MFPA 1PU9A 3MGDA 5HMNA 3H5ZA 3TTHA 2P6FA 1XF8A 2Z3NA 3LD2A 1MJBA 3OWCA 2HUZA 4UCPA 3CXQA 1N71A 4BMHA 2VZZA 3DR8A 4FD7A 3E0KA 3FXTA 4MJ8A 5I0CA 3TO7A 2Z11A 4RS2A 4B12A 3TFYA 4CGOA 3PZJA 3D2MA 4KOSA 3QB8A 3CXPA 4UBRA 4UWJA 3TOAA 3T9YA 2WPWA 1QSOA 2DXQA 2DPSA 1S7LA 4PV6A 1B6BA 4KLWA 2Y0MA 4OLLA 4QVTA 2B4DA 4C2ZA 3G3SA 1IICA 4C7HA 3R96A 4CGPA 2D4OA 4CAVA 3S6GA 1I21A 3R1KA 4I49A 2HV2A 3W6SA 4A2ZA 4II9A 3W6XA 1Y9WA 4NSQA 4KUAA 4PSXA 2QIRA 5H86A 4KOYA 2OZHA 4AG7A 3EO4A 5G21A 1KZFA 5CNPA 2D4PA 1IYLA 3W91A 4KORA 2CY2A 2B4DB 2Q0YA 5G22A 3EY5A 2AJ6A 5AG6A 4R87A 3WR7A 3IWEA 3R95A 4Q36A 2YNEA 4CYQA 2PC1A 2JEVA 4KS9A 1Q2YA 3JUWA 4CYPA 4F0XA 5IX3A 4H89A 4KOVA 4R57A 4MFKA 2DPTA 1L0CA 2IL4A 2FCKA 3EC4A 4F6AA 5AG4A 1P0HA 3UY5A 4OAEA 1NSLA 1FY7A 2J8NA 1M44A 4U9YA 3TO6A 4K30A 2Z3MA 2Q7BA 5A28A 5F46A 3IU1A 4NF1A 1I12A 2O28A 1I1DA 3K9UA 3S6KA 2FXFA 4QUSA 3GKRA 4XPLA 4CAWA 2NMTA 1R57A 4AB7A 4CAEA 2PDOA 2ARHA 3GY9A 4KOTA 4E0AA 2QECA 2B3VA 4UFXA 1IIDA 3I3GA 4B13A 4L89A 2K5TA 3TO9A 1QSMA 2GIVA 4E2AA 1S60A 5ISVA 5IV0A 4LUAA 1RXTA 3N7ZA 2PQ8A 2I00A 1Y7RA 2BSWA 1OZPA 4RI1A 4FD5A 3GYAA 3D2PA 4YGOA 4Y49C 2CNMA 2Z3OA 3QAHA 2VXKA 3PGPA 4CRZB 4L8AA 2FT0A 3S6HA 4QBJA 2HQYA 4KVXA 5EBVA 5J8CA 1QSNA 2VBQA 3H4QA 3SXNA 1TIQA 3BJ7A 2C27A 4R3KA 2ZXVA 2PR1A 4HKFA 1XMTA 1VKCA 3TCVA 2BUEA 3SXOA 3V8IA 4CAFA 4UA3A 2OZUA 4YRHA 1S5KA 5HH1A 2B4BA 1NMTA 4B11A 1VHSA 3VWDA 1QSRA 1RO5A 5EC4A 1S3ZA 2Z3KA 4JD6A 1K4JA 4KVOE 1MJ9A 5AGEA 5KTDA 4PK3A 4ONUA 1LRZA 4MY3A 2I79A 2Q4YA 5E96A 4HNXB 1ZO0A 2PSWA 2R7HA 4KOUA 4C68A 1M4DA 4AVAA 3S6FA 3JTKA 4U9ZA 4MFJA 1YGHA 2YNDA 4A30A 4A32A 1KUXA 4U5YA 4XPDB 3IGRA 4MBUA 4OADA 2PRBA 3EFAA 4KSFA 3DNSA 2GANA 2ZPAA 5J8FA 4M85A 2OU2A 2FIAA 4QB9A 3P2FA 4YFJA 2P0WA 4B14A 5F48A 2VZYA 4LX9A 1S7NA 2YNCC 3F8KA 2AE6A 4PSWA 3C26A 2JDDA 3D8PA 3IU2A 5C88A 1WK4A 4XPDC 1YK3A 3TOBA 2ZW4A 2FIWA 1U6MA 2J8RA 3R9GA 2ATRA 4FD6A 4UFWA 3SHPA 3FYNA 4XPKA 4UWIA 4CS0B 4KOWA 4CGLA 2VQYA 2FS5A 1WWZA 1YREA 2R1IA 1CM0A 1Q2DA 1YLEA 4KUBA 4MY0A 1Q2CA 4Y49B 4MFQA 2G0BA 4NXYA 4KOXA 4J3GA 3RYOA 3D3SA 4Q38A 4A31A 4XNHB 4A95A 4JLYA 2JDCA 3DSBA 5H84A 4JJXA 3R9EA 3FNCA 1PUAA 3IWGA 2F5IA 1M1DA 3R9FA 1S7KA 2G3TA 3NE7A 4CGNA 2CNTA 2VI7A 2EVNA 1IYKA 4CYNA 2OH1A 1YVOA 2PR8A 4PK2A 2Z10A 1YR0A 4XNHC 3I9SA 3JVNA 4IUSA 4F0YA 4M3SA 1M4GA 4UFVA 4B10A 2YNCA 1KUYA 4A33A 2Q04A 1Z4EA 2G3AA 4HNYB 2YGWA 5KTCA 2OZGA 5IB0A 3P2HA 4ZBGA 4BBHA 5KTAA 4KLVA 5BWAB 4UCMA 4HNWB 4MFZA 4R3LA 4C2YA 3FRMA 5DWNA 3F0AA 1Y9KA 4MI4A 4H6ZA 4EVYA 3DDDA 3TT2A 4IF5A 1SQHA 2J8MA 4CRYB 4ZGYB 3KKWA 2Z3LA 5DWMA 5G20A 2KCWA 1CJWA 3BLNA 2Q44A 5GCNA 4R9MA 4E8OA 2CNSA 2WSAA 2WUUA 2ZW5A 2FE7A 1P4NA 3DR6A 2VEZA 2JLMA 2B5GA 4KSAA 1BOBA 4AVCA 1YX0A 1MJAA 1S7FA 2BL1A 5JPHA 5G1ZA 1KUVA 3TE4A 2A4NA 3EXNA 4KZTA 1J4JA 1Z4RA 3CXSA 2FSRA 5C82A 5F49A 4X5KA 5JQ4A 1IB1E 5AG7A 4GS4A 4AG9A 3FB3A 2QMLA 2R98A 2OB0A 4CYOA 4JWPA 2GE3A 1M4IA 2ZW7A 4CAXA 2FL4A 4C7IA 3LODA 4QC6A 3PP9A 2B5GB 4AVBA 1XE4A 4NCZA 1QSTA 2P6EA 3A9LA 4DNCA 5A27A 2H5MA 2B3UA 3B8GA 2ZW6A 4B5PA 2EUIA 1B87A 2BEIA 3G8WA 2RC4A 3F5BA 4KVME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XIX A;  3T90 A;  1XEB A;  2P6G A;  4ORF A;  4JXQ A;  2B58 A;  3ZZI A;  1V0C A;  4FD4 A;  1MK4 A;  1UFH A;  3ZJ0 A;  2WPX A;  1YVK A;  2Z0Z A;  1ON0 A;  2Q4V A;  1GHE A;  3FBU A;  4H6U A;  4MHD A;  4NEX A;  5FVJ A;  2REF A;  1BO4 A;  1NE9 A;  4B5O A;  5F47 A;  2REE A;  1Z9U A;  3BJ8 A;  4JXR A;  3FIX A;  3VWE A;  2X7B A;  4B5P B;  2R8V A;  1PU9 A;  3MGD A;  5HMN A;  3TTH A;  2P6F A;  1XF8 A;  3LD2 A;  1MJB A;  3OWC A;  2HUZ A;  3CXQ A;  1N71 A;  4BMH A;  2VZZ A;  3DR8 A;  4FD7 A;  3E0K A;  3FXT A;  4MJ8 A;  5I0C A;  3TO7 A;  2Z11 A;  4RS2 A;  3TFY A;  3PZJ A;  3D2M A;  4KOS A;  3QB8 A;  3CXP A;  4UBR A;  4UWJ A;  3TOA A;  3T9Y A;  2WPW A;  1QSO A;  2DXQ A;  1S7L A;  4PV6 A;  1B6B A;  4KLW A;  2Y0M A;  4OLL A;  4QVT A;  2B4D A;  3G3S A;  1IIC A;  3R96 A;  2D4O A;  4CAV A;  3S6G A;  1I21 A;  3R1K A;  4I49 A;  2HV2 A;  3W6S A;  4II9 A;  3W6X A;  1Y9W A;  4NSQ A;  4KUA A;  4PSX A;  2QIR A;  5H86 A;  4KOY A;  2OZH A;  4AG7 A;  3EO4 A;  1KZF A;  5CNP A;  2D4P A;  1IYL A;  3W91 A;  4KOR A;  2CY2 A;  2B4D B;  2Q0Y A;  3EY5 A;  2AJ6 A;  4R87 A;  3WR7 A;  3R95 A;  2PC1 A;  2JEV A;  1Q2Y A;  3JUW A;  5IX3 A;  4H89 A;  4KOV A;  4R57 A;  1L0C A;  2IL4 A;  2FCK A;  3EC4 A;  4F6A A;  1P0H A;  3UY5 A;  4OAE A;  1NSL A;  1FY7 A;  2J8N A;  1M44 A;  4U9Y A;  3TO6 A;  4K30 A;  2Q7B A;  5F46 A;  4NF1 A;  1I12 A;  2O28 A;  1I1D A;  3K9U A;  3S6K A;  2FXF A;  4QUS A;  3GKR A;  4XPL A;  4CAW A;  2NMT A;  1R57 A;  4AB7 A;  2PDO A;  2ARH A;  3GY9 A;  4KOT A;  4E0A A;  2QEC A;  2B3V A;  1IID A;  3I3G A;  4L89 A;  2K5T A;  3TO9 A;  1QSM A;  2GIV A;  4E2A A;  1S60 A;  5ISV A;  5IV0 A;  4LUA A;  1RXT A;  3N7Z A;  2PQ8 A;  2I00 A;  1Y7R A;  2BSW A;  1OZP A;  4RI1 A;  4FD5 A;  3GYA A;  3D2P A;  4YGO A;  4Y49 C;  2CNM A;  3QAH A;  2VXK A;  3PGP A;  4CRZ B;  4L8A A;  2FT0 A;  3S6H A;  4QBJ A;  2HQY A;  4KVX A;  5EBV A;  5J8C A;  1QSN A;  2VBQ A;  3H4Q A;  3SXN A;  1TIQ A;  3BJ7 A;  2C27 A;  4R3K A;  2ZXV A;  2PR1 A;  4HKF A;  1XMT A;  1VKC A;  3TCV A;  2BUE A;  3SXO A;  3V8I A;  4UA3 A;  2OZU A;  4YRH A;  1S5K A;  5HH1 A;  2B4B A;  1NMT A;  1VHS A;  3VWD A;  1QSR A;  1RO5 A;  5EC4 A;  1S3Z A;  4JD6 A;  1K4J A;  4KVO E;  1MJ9 A;  5KTD A;  4PK3 A;  4ONU A;  1LRZ A;  4MY3 A;  2I79 A;  2Q4Y A;  5E96 A;  4HNX B;  2PSW A;  2R7H A;  4KOU A;  1M4D A;  4AVA A;  3S6F A;  4U9Z A;  1YGH A;  1KUX A;  4U5Y A;  4XPD B;  3IGR A;  4MBU A;  4OAD A;  2PRB A;  3EFA A;  3DNS A;  2GAN A;  2ZPA A;  5J8F A;  4M85 A;  2OU2 A;  2FIA A;  4QB9 A;  3P2F A;  4YFJ A;  2P0W A;  5F48 A;  2VZY A;  4LX9 A;  1S7N A;  3F8K A;  2AE6 A;  4PSW A;  3C26 A;  2JDD A;  3D8P A;  5C88 A;  1WK4 A;  4XPD C;  1YK3 A;  3TOB A;  2ZW4 A;  2FIW A;  1U6M A;  2J8R A;  3R9G A;  2ATR A;  4FD6 A;  3SHP A;  3FYN A;  4XPK A;  4UWI A;  4CS0 B;  4KOW A;  2VQY A;  2FS5 A;  1WWZ A;  1YRE A;  2R1I A;  1CM0 A;  1Q2D A;  1YLE A;  4KUB A;  4MY0 A;  1Q2C A;  4Y49 B;  2G0B A;  4NXY A;  4KOX A;  4J3G A;  3RYO A;  3D3S A;  4XNH B;  4JLY A;  2JDC A;  3DSB A;  5H84 A;  4JJX A;  3R9E A;  3FNC A;  1PUA A;  3IWG A;  2F5I A;  1M1D A;  3R9F A;  1S7K A;  2G3T A;  3NE7 A;  2CNT A;  2VI7 A;  2EVN A;  1IYK A;  2OH1 A;  1YVO A;  2PR8 A;  4PK2 A;  2Z10 A;  1YR0 A;  4XNH C;  3I9S A;  3JVN A;  4IUS A;  4F0Y A;  4M3S A;  1M4G A;  1KUY A;  2Q04 A;  1Z4E A;  2G3A A;  4HNY B;  5KTC A;  2OZG A;  5IB0 A;  3P2H A;  4ZBG A;  5KTA A;  4KLV A;  4HNW B;  4R3L A;  3FRM A;  5DWN A;  3F0A A;  1Y9K A;  4MI4 A;  4H6Z A;  4EVY A;  3DDD A;  3TT2 A;  4IF5 A;  1SQH A;  2J8M A;  4CRY B;  3KKW A;  5DWM A;  2KCW A;  1CJW A;  3BLN A;  2Q44 A;  5GCN A;  4R9M A;  4E8O A;  2CNS A;  2ZW5 A;  2FE7 A;  1P4N A;  3DR6 A;  2VEZ A;  2JLM A;  2B5G A;  1BOB A;  4AVC A;  1YX0 A;  1MJA A;  1S7F A;  2BL1 A;  5JPH A;  1KUV A;  3TE4 A;  2A4N A;  3EXN A;  4KZT A;  1J4J A;  1Z4R A;  3CXS A;  2FSR A;  5C82 A;  5F49 A;  4X5K A;  5JQ4 A;  1IB1 E;  4GS4 A;  4AG9 A;  3FB3 A;  2QML A;  2R98 A;  2OB0 A;  4JWP A;  2GE3 A;  1M4I A;  2ZW7 A;  4CAX A;  2FL4 A;  3LOD A;  4QC6 A;  3PP9 A;  2B5G B;  4AVB A;  1XE4 A;  4NCZ A;  1QST A;  2P6E A;  4DNC A;  2H5M A;  2B3U A;  3B8G A;  2ZW6 A;  4B5P A;  2EUI A;  1B87 A;  2BEI A;  3G8W A;  2RC4 A;  3F5B A;  4KVM E; 
#chains in the Genus database with same CATH topology
 2PJ7 A;  1XIX A;  3T90 A;  3FED A;  3FEC A;  4BD9 A;  4IAV A;  5K8O A;  2QJ8 A;  3GUX A;  1XEB A;  2P6G A;  3KHX A;  3QNV A;  1QQ9 A;  2Z3P A;  4ORF A;  4UEZ A;  4JXQ A;  3B7I A;  2B58 A;  1YW4 A;  2PJ4 A;  4CGM A;  3ZZI A;  1V0C A;  1AMP A;  2CXA A;  3ISX A;  4UCN A;  3D4U A;  4FD4 A;  1MK4 A;  1UFH A;  2EK8 A;  3IWW A;  2ZEM A;  4KSI A;  3ZJ0 A;  2BCO A;  2WPX A;  1YVK A;  4UEF A;  4LQ6 A;  5LRK A;  3PB9 X;  2Z0Z A;  2PCU A;  4P4D A;  2DEA A;  3PFE A;  1ON0 A;  2OR4 A;  4JZ0 A;  3GIU A;  2Q4V A;  3IJ3 A;  1GHE A;  3B3T A;  1CG2 A;  3FBU A;  2Q4Z A;  4H6U A;  4MHD A;  3WC7 A;  2AFO A;  3PRT A;  3RO0 A;  4NEX A;  5FVJ A;  2REF A;  1NSA A;  1BO4 A;  1NE9 A;  3K2K A;  5F47 A;  4B5O A;  2REE A;  1Z9U A;  4MFL A;  3BJ8 A;  4JXR A;  4OKO A;  4PXB A;  1BLL E;  3FIX A;  5AG5 A;  4C2X A;  3VWE A;  7CPA A;  2O53 A;  2X7B A;  4B5P B;  2R8V A;  5HXD A;  4MFP A;  1PU9 A;  3MGD A;  2AFU A;  3FMC A;  3NH8 A;  1ARM A;  5HMN A;  3H5Z A;  3TTH A;  2P6F A;  1XF8 A;  1IU8 A;  2Z3N A;  3D67 A;  3KQZ A;  1MJB A;  1FT7 A;  2HUZ A;  3LD2 A;  3OWC A;  1IOI A;  4RUH A;  4OID A;  5JGF A;  4UCP A;  1Y0Y A;  3CXQ A;  1N71 A;  3WAB A;  4BMH A;  2VZZ A;  4P4F A;  2AFS A;  3DR8 A;  4FD7 A;  3E0K A;  3FXT A;  4MJ8 A;  5I0C A;  3TO7 A;  2Z11 A;  4RS2 A;  6CPA A;  2QYV A;  4B12 A;  8CPA A;  5LRJ A;  3TFY A;  4CGO A;  1Y0R A;  3PZJ A;  4UIA A;  3D2M A;  4KOS A;  1F57 A;  3QB8 A;  1XBU A;  3CXP A;  4UBR A;  4UWJ A;  1BPM A;  3TOA A;  2PJ8 A;  3KGQ A;  2EBJ A;  3SI2 A;  3T9Y A;  1TKF A;  2WPW A;  5JM6 A;  2WYR A;  3FX6 A;  2CTC A;  1QSO A;  4F0X A;  3PFO A;  2DXQ A;  1ZG9 A;  3FH4 A;  2V8H A;  2ZEP A;  2DPS A;  1S7L A;  4PV6 A;  1B6B A;  4KLW A;  2Y0M A;  1LFW A;  4OLL A;  4QVT A;  2B4D A;  2V8D A;  4ZY1 A;  4C2Z A;  3G3S A;  1IIC A;  1AYE A;  4C7H A;  4NGP A;  3R96 A;  4CGP A;  1VHO A;  1XJO A;  2D4O A;  1TF9 A;  4CAV A;  1VGY A;  3S6G A;  1YLO A;  2EO8 A;  1I21 A;  3R1K A;  2F7V A;  4I49 A;  4GXH A;  1HDU A;  4F8Z A;  2HV2 A;  3W6S A;  1TKH A;  3TX8 A;  4A2Z A;  4II9 A;  2PJ9 A;  3N5F A;  4PXE A;  4ZX9 A;  3BHX A;  1Y9W A;  1BPN A;  3W6X A;  5F09 A;  2GU2 A;  4KUA A;  4NSQ A;  4PSX A;  2QIR A;  4OC1 A;  1XOV A;  1LAP A;  1IOF A;  2ZEE A;  5H86 A;  4KOY A;  4MHN A;  2OZH A;  1LAN A;  4AG7 A;  1Z8W A;  3EO4 A;  5G21 A;  1XFO A;  1KZF A;  2BO9 A;  3PB8 X;  1HEE A;  5CNP A;  2D4P A;  1IYL A;  3W91 A;  3FJU A;  1TF8 A;  4KOR A;  2CY2 A;  2B4D B;  2GRE A;  2Q0Y A;  5G22 A;  3EY5 A;  2AJ6 A;  2I3C A;  4OME A;  5AG6 A;  4R87 A;  3WR7 A;  3IWE A;  3R95 A;  4Q36 A;  2YNE A;  3TC8 A;  4CYQ A;  4DJL A;  2PC1 A;  2JEV A;  3D7G A;  1Q2Y A;  3JUW A;  4KS9 A;  5THW A;  4CYP A;  4H89 A;  3LAC A;  4DYO A;  4KOV A;  5IX3 A;  4R57 A;  4MFK A;  2PJ5 A;  2DPT A;  1L0C A;  4X2T A;  4YWY A;  2PJC A;  4R76 A;  1LOK A;  2IL4 A;  2ZEO A;  2FCK A;  4RN7 A;  3EC4 A;  5CBM A;  5JH9 A;  2ZEF A;  4F6A A;  5AG4 A;  1P0H A;  5IB9 A;  3BI1 A;  4OAE A;  1NSL A;  3LMS A;  3UY5 A;  1FY7 A;  2J8N A;  1M44 A;  4U9Y A;  3TO6 A;  4K30 A;  2Z3M A;  5J1Q A;  2G9D A;  2Q7B A;  5A28 A;  5F46 A;  3IU1 A;  4NF1 A;  1I12 A;  4IHM A;  2O28 A;  1I1D A;  1ZLH A;  3BXM A;  3K9U A;  3S6K A;  2FXF A;  4QUS A;  3GKR A;  1H8L A;  4H2K A;  4XPL A;  4CAW A;  1ZLI A;  4MCP A;  2ZEG A;  2NMT A;  1R57 A;  4ZY0 A;  4AB7 A;  4CAE A;  2PDO A;  2ARH A;  3GY9 A;  4KOT A;  4E0A A;  3MN8 A;  4ZI6 A;  2QEC A;  3KHZ A;  4NGR A;  2B3V A;  4UFX A;  1IID A;  3I3G A;  4B13 A;  4L89 A;  5LYF A;  2K5T A;  3PBB A;  1QSM A;  5D8N A;  3TO9 A;  2GIV A;  4M6H A;  4E2A A;  1YME A;  1S60 A;  5ISV A;  3H8E A;  5IV0 A;  3KQX A;  1Z8L A;  4LUA A;  1RXT A;  2PVV A;  3N7Z A;  2PQ8 A;  2V8G A;  2I00 A;  1Y7R A;  3K9T A;  2BSW A;  1OZP A;  2RB7 A;  4RI1 A;  2ODF A;  4FD5 A;  4ZYQ A;  1Z8T A;  4M6I A;  2PE3 A;  3GYA A;  3D2P A;  3MRU A;  1M4L A;  2C1C A;  4Y49 C;  4YGO A;  1CPS A;  2CNM A;  2CIJ A;  2Z3O A;  3QAH A;  2Q7S A;  2VXK A;  4P44 A;  3PGP A;  4CRZ B;  4L8A A;  4FBE A;  4ZY2 A;  2FT0 A;  4P4J A;  4UEE A;  3S6H A;  3PB7 X;  5CPA A;  4NJR A;  4QBJ A;  2HQY A;  2JBK A;  2NYQ A;  4KVX A;  2J9A A;  5EBV A;  1YW6 A;  1QSN A;  4CPA A;  2VBQ A;  5J8C A;  1AUG A;  5HVG A;  3H4Q A;  1Z5R A;  3SXN A;  1TIQ A;  1HDQ A;  2C27 A;  2PJB A;  3BJ7 A;  2ZXV A;  4HPS A;  4MHY A;  4P4E A;  4R3K A;  2PR1 A;  4HKF A;  5DS0 A;  3V7Z A;  1XMT A;  4MMO A;  5LRG A;  1VKC A;  3HLP A;  3TCV A;  1X12 A;  2BUE A;  3SXO A;  3V8I A;  4K3N A;  2XEF A;  4CAF A;  4UA3 A;  1PCA A;  3RAM A;  3PB6 X;  1ELM P;  3KAS A;  2OZU A;  4OC4 A;  1S5K A;  4YRH A;  5HH1 A;  2B4B A;  4Z65 A;  3WT4 A;  1NMT A;  4B11 A;  1VHS A;  3VWD A;  1QSR A;  1RO5 A;  2AFW A;  4GM5 A;  1OBR A;  2XEG A;  2DF5 A;  1S3Z A;  2Z3K A;  5EC4 A;  2PRQ A;  3CZX A;  4TWE A;  4JD6 A;  1K4J A;  4KVO E;  1MJ9 A;  5AGE A;  4F9U A;  4PK3 A;  5KTD A;  4ONU A;  1LRZ A;  3KI9 A;  2I79 A;  2QVP A;  4MY3 A;  3SI0 A;  3SI1 A;  4R6T A;  1JWQ A;  2Q4Y A;  5E96 A;  4HNX B;  1ZO0 A;  2PSW A;  2R7H A;  3CT9 A;  2PIY A;  4KOU A;  1UWY A;  4P4B A;  1M4D A;  4AVA A;  4C68 A;  3S6F A;  2PJA A;  2POK A;  3JTK A;  4NGQ A;  4U9Z A;  4G1P A;  4IK2 A;  1CP7 A;  3NH4 A;  4MFJ A;  1YGH A;  2HC9 A;  5EMI A;  2YND A;  3KZW A;  4A30 A;  4A32 A;  1KUX A;  4U5Y A;  4XPD B;  1CX8 A;  3IGR A;  4OC2 A;  3V38 A;  4MBU A;  4OAD A;  2PRB A;  3B3V A;  3CPX A;  3EFA A;  3NH5 A;  3QAY A;  2JEW A;  3I1U A;  3GB0 A;  4KSF A;  4FAI A;  3DNS A;  2GAN A;  4PXC A;  2ZPA A;  5J8F A;  4M85 A;  4MCQ A;  2OU2 A;  2FIA A;  2GLJ A;  3P2F A;  4QB9 A;  2ABZ A;  4WJB A;  4YFJ A;  2P0W A;  4B14 A;  5F48 A;  2AFM A;  2VZY A;  3BI0 A;  4LX9 A;  3D68 A;  4OC0 A;  1S7N A;  2YNC C;  3F8K A;  5ELY A;  2AE6 A;  1CP6 A;  1IGB A;  4PSW A;  3VH9 A;  4PQA A;  3PBE A;  3KR4 A;  2CTB A;  3C26 A;  1EE3 P;  2JDD A;  2OOT A;  3D8P A;  3IU2 A;  5C88 A;  1WK4 A;  4XPD C;  2IQ6 A;  1YK3 A;  1RTQ A;  2ZW4 A;  2FIW A;  3RBU A;  3TOB A;  1U6M A;  2J8R A;  1ELL P;  4NJQ A;  2C6C A;  3R9G A;  4EWT A;  2ATR A;  4FD6 A;  3IC1 A;  4ONW A;  4R8F A;  4UFW A;  3SJG A;  4PPZ A;  5K8M A;  3RNZ A;  1LCP A;  4W9Y A;  3SHP A;  3L2N A;  4BIN A;  5LYI A;  1VIX A;  3FYN A;  4A37 A;  2CF4 A;  4JYW A;  2ZOG A;  3CPA A;  2PJ1 A;  2Q43 A;  2ZOF A;  4XPK A;  4UWI A;  4CS0 B;  4KOW A;  4X3R A;  4CGL A;  5K8N A;  2VQY A;  3H8F A;  2FS5 A;  1WWZ A;  1YRE A;  2R1I A;  1ZG7 A;  2ANP A;  1CM0 A;  1Q2D A;  1YLE A;  4KUB A;  4R7M A;  3JRU A;  4MY0 A;  1Q2C A;  4Y49 B;  4MFQ A;  2G0B A;  1ARL A;  4NXY A;  2EWB A;  4KOX A;  1DTD A;  4F9V A;  4FUU A;  4J3G A;  5HVF A;  3RYO A;  3D3S A;  4Q38 A;  4MCS A;  4A31 A;  3B35 A;  4XNH B;  4A95 A;  1PYT B;  1A2Z A;  3B2Y A;  4JLY A;  4PXD A;  2JDC A;  2NSM A;  3DSB A;  4OC5 A;  5H84 A;  4JJX A;  3R9E A;  3FNC A;  1PUA A;  2V77 A;  2AFX A;  3IWG A;  4P4I A;  2PVW A;  2F5I A;  3SJE A;  1M1D A;  3R9F A;  3FF3 A;  3SJX A;  3NA6 A;  1S7K A;  1YQE A;  3D66 A;  2G3T A;  2ZEH A;  3NE7 A;  4CGN A;  3D7D A;  4FWU A;  2PJ3 A;  2CNT A;  3H8G A;  2VI7 A;  2EVN A;  1IYK A;  4B6Z A;  4CYN A;  2OH1 A;  1YVO A;  5HVH A;  2PR8 A;  4PK2 A;  2Z10 A;  4EFD A;  1YR0 A;  2ZEN A;  4XNH C;  3I9S A;  3IFE A;  1TKJ A;  2PJ2 A;  4ZX8 A;  4NGT A;  4TNU A;  3JVN A;  4IUS A;  4A94 A;  4F0Y A;  1TXR A;  1M4G A;  4M3S A;  3NFZ A;  4UFV A;  4OIW A;  1XRY A;  4YU9 A;  4B10 A;  2YNC A;  3B3W A;  2C6P A;  1KUY A;  4MXU A;  4NGS A;  1X10 A;  4UIB A;  1FNO A;  4A33 A;  2Q04 A;  1Z4E A;  2G3A A;  2ZED A;  4HNY B;  2YGW A;  5KTC A;  4P6Y A;  1Y7E A;  1F2O A;  1F2P A;  2C6G A;  2OZG A;  5IB0 A;  1Z2L A;  3P2H A;  4ZBG A;  4BBH A;  4WWV A;  4KLV A;  3WC5 A;  4UCM A;  5BWA B;  5KTA A;  3FVL A;  2BOA A;  2WZN A;  1XMB A;  4HNW B;  3GLJ A;  4MFZ A;  4OP4 A;  3IO1 A;  4R3L A;  4C2Y A;  2RFH A;  3KL9 A;  2XEI A;  2GFQ A;  3FRM A;  5DWN A;  3F0A A;  1Y9K A;  2XEJ A;  1R43 A;  4H6Z A;  1KWM A;  4MI4 A;  1BAV A;  3DDD A;  3TT2 A;  4EVY A;  4IF5 A;  4M6G A;  1SQH A;  4MCR A;  1Z8X A;  2ZEL A;  2J8M A;  4CRY B;  4ZGY B;  3KKW A;  4A38 A;  4AXV A;  3S9L A;  2Z3L A;  5DWM A;  3S9M A;  5G20 A;  2KCW A;  1R3N A;  1CJW A;  4Q7A A;  3D7H A;  3BLN A;  3ISZ A;  3PEI A;  3RZA A;  3KR5 A;  2Q44 A;  3FEE A;  5GCN A;  4R9M A;  2IJZ A;  2CNS A;  4E8O A;  2WSA A;  1VHE A;  3IEH A;  4MHP A;  4EME A;  5I4M A;  2WUU A;  2ZW5 A;  2FE7 A;  1P4N A;  3DR6 A;  2VEZ A;  2FVG A;  2O4H A;  1CBX A;  2B5G A;  2JLM A;  4KSA A;  4P10 A;  3DGV A;  1BOB A;  4AVC A;  1YX0 A;  1GYT A;  3B3S A;  1MJA A;  1S7F A;  1DE4 C;  1LAM A;  2BL1 A;  4OC3 A;  5JPH A;  5G1Z A;  1CPX A;  1KUV A;  5LYL A;  3S9N A;  3TE4 A;  2A4N A;  3PB4 X;  4NGM A;  3DLJ A;  3EXN A;  2PIZ A;  4KZT A;  1J4J A;  1Z4R A;  3CXS A;  2FSR A;  1ZG8 A;  2EK9 A;  4X8I A;  5C82 A;  2HB6 A;  2PJ0 A;  1JQG A;  3SJF A;  3IIB A;  5F49 A;  2JBJ A;  4DUK A;  4X5K A;  4UF4 A;  1YSJ A;  5JQ4 A;  2Q51 A;  2V8V A;  1IB1 E;  2PJ6 A;  3D7F A;  5AG7 A;  2IMO A;  3NE8 A;  5K8P A;  4GS4 A;  2AFZ A;  4MHZ A;  4AG9 A;  4A39 A;  3FB3 A;  3VAR A;  2QML A;  2R98 A;  2OB0 A;  4O23 A;  4CYO A;  4JWP A;  2GE3 A;  1M4I A;  2ZW7 A;  3CDX A;  2FL4 A;  4CAX A;  2VL1 A;  4C7I A;  3LOD A;  4QC6 A;  2F8H A;  3PP9 A;  3HUV A;  4P45 A;  3LWU A;  2B5G B;  4AVB A;  5D29 A;  3T8W A;  1XE4 A;  4NFR A;  4LQG A;  4NCZ A;  1QST A;  2P6E A;  3A9L A;  3VAT A;  4DNC A;  1IY7 A;  5A27 A;  2H5M A;  2B3U A;  3B8G A;  2ZW6 A;  3B3C A;  2GLF A;  1Q7L A;  4B5P A;  2EUI A;  1B87 A;  3WC6 A;  5LYD A;  1QMU A;  2BEI A;  3G8W A;  2RC4 A;  4MRI A;  4NGN A;  3F5B A;  4KVM E; 
#chains in the Genus database with same CATH homology
 1XIX A;  3T90 A;  1XEB A;  2P6G A;  4ORF A;  2Z3P A;  4JXQ A;  2B58 A;  4CGM A;  3ZZI A;  1V0C A;  2CXA A;  4UCN A;  4FD4 A;  1MK4 A;  1UFH A;  3ZJ0 A;  2WPX A;  1YVK A;  2Z0Z A;  1ON0 A;  2Q4V A;  1GHE A;  3FBU A;  4H6U A;  4MHD A;  4NEX A;  5FVJ A;  2REF A;  1BO4 A;  1NE9 A;  4B5O A;  5F47 A;  2REE A;  1Z9U A;  4MFL A;  3BJ8 A;  4JXR A;  5AG5 A;  4C2X A;  3FIX A;  3VWE A;  2X7B A;  4B5P B;  2R8V A;  4MFP A;  1PU9 A;  3MGD A;  5HMN A;  3H5Z A;  3TTH A;  2P6F A;  1XF8 A;  2Z3N A;  3LD2 A;  1MJB A;  3OWC A;  2HUZ A;  4UCP A;  3CXQ A;  1N71 A;  4BMH A;  2VZZ A;  3DR8 A;  4FD7 A;  3E0K A;  3FXT A;  4MJ8 A;  5I0C A;  3TO7 A;  2Z11 A;  4RS2 A;  4B12 A;  3TFY A;  4CGO A;  3PZJ A;  3D2M A;  4KOS A;  3QB8 A;  3CXP A;  4UBR A;  4UWJ A;  3TOA A;  3T9Y A;  2WPW A;  1QSO A;  2DXQ A;  2DPS A;  1S7L A;  4PV6 A;  1B6B A;  4KLW A;  2Y0M A;  4OLL A;  4QVT A;  2B4D A;  4C2Z A;  3G3S A;  1IIC A;  4C7H A;  3R96 A;  4CGP A;  2D4O A;  4CAV A;  3S6G A;  1I21 A;  3R1K A;  4I49 A;  2HV2 A;  3W6S A;  4A2Z A;  4II9 A;  3W6X A;  1Y9W A;  4NSQ A;  4KUA A;  4PSX A;  2QIR A;  5H86 A;  4KOY A;  2OZH A;  4AG7 A;  3EO4 A;  5G21 A;  1KZF A;  5CNP A;  2D4P A;  1IYL A;  3W91 A;  4KOR A;  2CY2 A;  2B4D B;  2Q0Y A;  5G22 A;  3EY5 A;  2AJ6 A;  5AG6 A;  4R87 A;  3WR7 A;  3IWE A;  3R95 A;  4Q36 A;  2YNE A;  4CYQ A;  2PC1 A;  2JEV A;  4KS9 A;  1Q2Y A;  3JUW A;  4CYP A;  4F0X A;  5IX3 A;  4H89 A;  4KOV A;  4R57 A;  4MFK A;  2DPT A;  1L0C A;  2IL4 A;  2FCK A;  3EC4 A;  4F6A A;  5AG4 A;  1P0H A;  3UY5 A;  4OAE A;  1NSL A;  1FY7 A;  2J8N A;  1M44 A;  4U9Y A;  3TO6 A;  4K30 A;  2Z3M A;  2Q7B A;  5A28 A;  5F46 A;  3IU1 A;  4NF1 A;  1I12 A;  2O28 A;  1I1D A;  3K9U A;  3S6K A;  2FXF A;  4QUS A;  3GKR A;  4XPL A;  4CAW A;  2NMT A;  1R57 A;  4AB7 A;  4CAE A;  2PDO A;  2ARH A;  3GY9 A;  4KOT A;  4E0A A;  2QEC A;  2B3V A;  4UFX A;  1IID A;  3I3G A;  4B13 A;  4L89 A;  2K5T A;  3TO9 A;  1QSM A;  2GIV A;  4E2A A;  1S60 A;  5ISV A;  5IV0 A;  4LUA A;  1RXT A;  3N7Z A;  2PQ8 A;  2I00 A;  1Y7R A;  2BSW A;  1OZP A;  4RI1 A;  4FD5 A;  3GYA A;  3D2P A;  4YGO A;  4Y49 C;  2CNM A;  2Z3O A;  3QAH A;  2VXK A;  3PGP A;  4CRZ B;  4L8A A;  2FT0 A;  3S6H A;  4QBJ A;  2HQY A;  4KVX A;  5EBV A;  5J8C A;  1QSN A;  2VBQ A;  3H4Q A;  3SXN A;  1TIQ A;  3BJ7 A;  2C27 A;  4R3K A;  2ZXV A;  2PR1 A;  4HKF A;  1XMT A;  1VKC A;  3TCV A;  2BUE A;  3SXO A;  3V8I A;  4CAF A;  4UA3 A;  2OZU A;  4YRH A;  1S5K A;  5HH1 A;  2B4B A;  1NMT A;  4B11 A;  1VHS A;  3VWD A;  1QSR A;  1RO5 A;  5EC4 A;  1S3Z A;  2Z3K A;  4JD6 A;  1K4J A;  4KVO E;  1MJ9 A;  5AGE A;  5KTD A;  4PK3 A;  4ONU A;  1LRZ A;  4MY3 A;  2I79 A;  2Q4Y A;  5E96 A;  4HNX B;  1ZO0 A;  2PSW A;  2R7H A;  4KOU A;  4C68 A;  1M4D A;  4AVA A;  3S6F A;  3JTK A;  4U9Z A;  4MFJ A;  1YGH A;  2YND A;  4A30 A;  4A32 A;  1KUX A;  4U5Y A;  4XPD B;  3IGR A;  4MBU A;  4OAD A;  2PRB A;  3EFA A;  4KSF A;  3DNS A;  2GAN A;  2ZPA A;  5J8F A;  4M85 A;  2OU2 A;  2FIA A;  4QB9 A;  3P2F A;  4YFJ A;  2P0W A;  4B14 A;  5F48 A;  2VZY A;  4LX9 A;  1S7N A;  2YNC C;  3F8K A;  2AE6 A;  4PSW A;  3C26 A;  2JDD A;  3D8P A;  3IU2 A;  5C88 A;  1WK4 A;  4XPD C;  1YK3 A;  3TOB A;  2ZW4 A;  2FIW A;  1U6M A;  2J8R A;  3R9G A;  2ATR A;  4FD6 A;  4UFW A;  3SHP A;  3FYN A;  4XPK A;  4UWI A;  4CS0 B;  4KOW A;  4CGL A;  2VQY A;  2FS5 A;  1WWZ A;  1YRE A;  2R1I A;  1CM0 A;  1Q2D A;  1YLE A;  4KUB A;  4MY0 A;  1Q2C A;  4Y49 B;  4MFQ A;  2G0B A;  4NXY A;  4KOX A;  4J3G A;  3RYO A;  3D3S A;  4Q38 A;  4A31 A;  4XNH B;  4A95 A;  4JLY A;  2JDC A;  3DSB A;  5H84 A;  4JJX A;  3R9E A;  3FNC A;  1PUA A;  3IWG A;  2F5I A;  1M1D A;  3R9F A;  1S7K A;  2G3T A;  3NE7 A;  4CGN A;  2CNT A;  2VI7 A;  2EVN A;  1IYK A;  4CYN A;  2OH1 A;  1YVO A;  2PR8 A;  4PK2 A;  2Z10 A;  1YR0 A;  4XNH C;  3I9S A;  3JVN A;  4IUS A;  4F0Y A;  4M3S A;  1M4G A;  4UFV A;  4B10 A;  2YNC A;  1KUY A;  4A33 A;  2Q04 A;  1Z4E A;  2G3A A;  4HNY B;  2YGW A;  5KTC A;  2OZG A;  5IB0 A;  3P2H A;  4ZBG A;  4BBH A;  5KTA A;  4KLV A;  5BWA B;  4UCM A;  4HNW B;  4MFZ A;  4R3L A;  4C2Y A;  3FRM A;  5DWN A;  3F0A A;  1Y9K A;  4MI4 A;  4H6Z A;  4EVY A;  3DDD A;  3TT2 A;  4IF5 A;  1SQH A;  2J8M A;  4CRY B;  4ZGY B;  3KKW A;  2Z3L A;  5DWM A;  5G20 A;  2KCW A;  1CJW A;  3BLN A;  2Q44 A;  5GCN A;  4R9M A;  4E8O A;  2CNS A;  2WSA A;  2WUU A;  2ZW5 A;  2FE7 A;  1P4N A;  3DR6 A;  2VEZ A;  2JLM A;  2B5G A;  4KSA A;  1BOB A;  4AVC A;  1YX0 A;  1MJA A;  1S7F A;  2BL1 A;  5JPH A;  5G1Z A;  1KUV A;  3TE4 A;  2A4N A;  3EXN A;  4KZT A;  1J4J A;  1Z4R A;  3CXS A;  2FSR A;  5C82 A;  5F49 A;  4X5K A;  5JQ4 A;  1IB1 E;  5AG7 A;  4GS4 A;  4AG9 A;  3FB3 A;  2QML A;  2R98 A;  2OB0 A;  4CYO A;  4JWP A;  2GE3 A;  1M4I A;  2ZW7 A;  4CAX A;  2FL4 A;  4C7I A;  3LOD A;  4QC6 A;  3PP9 A;  2B5G B;  4AVB A;  1XE4 A;  4NCZ A;  1QST A;  2P6E A;  3A9L A;  4DNC A;  5A27 A;  2H5M A;  2B3U A;  3B8G A;  2ZW6 A;  4B5P A;  2EUI A;  1B87 A;  2BEI A;  3G8W A;  2RC4 A;  3F5B A;  4KVM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...