3D8PA

Crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
160
structure length
158
Chain Sequence
AINIIEYNRSYKEELIEFILSIQKNEFNIKIDRDDQPDLENIEHNYLNSGGQFWLAINNHQNIVGTIGLIRLDNNMSALKKMFVDKGYRNLKIGKKLLDKVIMTCKEQNIDGIYLGTIDKFISAQYFYSNNGFREIKRGDLPSSFPKLDNRFYYRNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acetyltransferase of GNAT family
publication title Crystal structure of acetyltransferase of GNAT family (NP_373092.1) from STAPHYLOCOCCUS AUREUS MU50 at 2.20 A resolution
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Transferase
total genus 49
structure length 158
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3d8pA00
5KTAA 3FBUA 3TOAA 2J8MA 2HUZA 1FY7A 3LODA 4QC6A 4KUBA 3JUWA 1B6BA 1S7KA 4E2AA 5IX3A 4KOXA 2JDDA 4J3GA 4JJXA 2K5TA 1XE4A 1YR0A 1XIXA 4AVCA 1J4JA 5DWNA 3ZZIA 2IL4A 3I3GA 1IYLA 4KOSA 2REEA 2R1IA 4YGOA 3TO6A 3V8IA 1N71A 2ZW5A 1MJAA 4U9YA 4KZTA 2QECA 2CNSA 1S7LA 5EBVA 1NMTA 5CNPA 2HV2A 4NF1A 4YFJA 4U5YA 1I12A 1BOBA 3EO4A 4IF5A 2FS5A 1KZFA 2FSRA 2P6EA 4R87A 1S7FA 5J8FA 3FXTA 2FT0A 4CRZB 2P6GA 3FIXA 4XPDC 5I0CA 4XPKA 3KKWA 2F5IA 1PUAA 1XF8A 4KOYA 4AB7A 3GYAA 3IWGA 4OAEA 2ZXVA 2FIAA 3DR8A 2OB0A 4HNYB 3DNSA 3PP9A 1L0CA 4FD5A 2B4BA 1Z9UA 2Q0YA 2ZW4A 1ON0A 4H6ZA 3D3SA 4JWPA 4I49A 5EC4A 5KTDA 1IYKA 2Q04A 4X5KA 5C82A 3C26A 1I21A 4KVOE 4KVXA 1B87A 2Q44A 4H89A 4IUSA 2Z11A 4NEXA 1Y9WA 2FIWA 4KOWA 1MJ9A 4UWIA 5HH1A 1P4NA 2D4PA 4R3LA 2G0BA 4KOVA 4MBUA 4OLLA 2QMLA 4QUSA 4CAWA 1YGHA 2FE7A 3TO9A 1SQHA 1S60A 1MK4A 1S5KA 3OWCA 3DR6A 1WWZA 2VXKA 2PQ8A 3DSBA 2FXFA 1PU9A 1YK3A 1Z4RA 1QSNA 5ISVA 3RYOA 2GIVA 3VWDA 2EUIA 1YREA 3EXNA 4JLYA 2CNTA 4JXRA 4M3SA 2GANA 4XPLA 3S6GA 2R7HA 2Q4YA 2G3AA 2VBQA 4FD6A 4KLVA 4BMHA 2ZW6A 5HMNA 1Y9KA 3TO7A 3UY5A 3CXQA 2CY2A 1P0HA 4XNHC 5GCNA 4MY3A 3DDDA 3TE4A 1UFHA 1Q2YA 2Y0MA 4PK3A 2B5GA 1IICA 2AJ6A 4B5PA 1YX0A 2VZZA 4NCZA 4JD6A 2WPXA 3WR7A 2GE3A 3F0AA 4ZBGA 4OADA 2J8RA 3SHPA 5JPHA 2P0WA 4FD7A 3P2FA 2Z10A 4II9A 4E8OA 3D8PA 3GKRA 5F47A 5FVJA 3R1KA 3P2HA 1M4GA 4U9ZA 2BEIA 5C88A 2REFA 3JVNA 4CAVA 3BJ8A 2QIRA 4QB9A 2ARHA 1NE9A 3TCVA 4F0YA 2ZPAA 1U6MA 3EFAA 4E0AA 2PC1A 2B4DB 4CAXA 3IGRA 1IB1E 2B3UA 1QSOA 3F8KA 2OH1A 4PV6A 3CXSA 2KCWA 3PZJA 3D2MA 1Y7RA 3W6XA 4KUAA 3VWEA 4K30A 4XPDB 2NMTA 5E96A 1Q2CA 4MHDA 4B5OA 2D4OA 2FL4A 3R96A 3R9EA 3S6KA 2OZHA 2BL1A 1M44A 2ATRA 2CNMA 2OZGA 5J8CA 3R9GA 2H5MA 1V0CA 3TT2A 1NSLA 1CJWA 3MGDA 3H4QA 3T9YA 1VHSA 3B8GA 1KUYA 1QSMA 4UA3A 3S6HA 3FRMA 3PGPA 2FCKA 2VI7A 4YRHA 4QVTA 2RC4A 3I9SA 1IIDA 4Y49B 1KUXA 1YLEA 1Q2DA 4HKFA 5IB0A 3EC4A 1I1DA 2JDCA 3R95A 4AG7A 1WK4A 3EY5A 5H86A 4R57A 4AVBA 4CS0B 4KLWA 3QAHA 3TOBA 4QBJA 1CM0A 2AE6A 1TIQA 5DWMA 2JLMA 3FNCA 1RXTA 1LRZA 2BSWA 4PK2A 4NSQA 1K4JA 1GHEA 4PSXA 1XMTA 2Q4VA 3BJ7A 3G8WA 5IV0A 3S6FA 4L89A 1QSRA 4Y49C 3TFYA 4UWJA 4KOTA 2VEZA 3W6SA 3TTHA 1YVOA 2P6FA 2C27A 2JEVA 4H6UA 2PRBA 4KVME 3K9UA 2PR1A 4RI1A 1KUVA 1XEBA 2VQYA 3CXPA 4RS2A 2BUEA 4F6AA 2PSWA 3N7ZA 2I79A 2J8NA 2R98A 4MY0A 5JQ4A 4EVYA 2PDOA 2ZW7A 1QSTA 3BLNA 5F46A 2WPWA 1M4IA 4HNXB 2Z0ZA 2OZUA 4DNCA 5H84A 1YVKA 2HQYA 4ORFA 4LX9A 2OU2A 1M1DA 4MI4A 3R9FA 2O28A 4KOUA 4AVAA 3D2PA 1R57A 1S3ZA 4L8AA 4PSWA 2R8VA 3FYNA 1S7NA 2B3VA 3GY9A 2B5GB 4ONUA 4B5PB 4LUAA 3T90A 1M4DA 1MJBA 4AG9A 2B58A 3F5BA 1VKCA 5KTCA 2I00A 3FB3A 1RO5A 3LD2A 5F49A 4MJ8A 1BO4A 4KORA 2A4NA 4XNHB 1OZPA 2Q7BA 4M85A 3ZJ0A 2B4DA 2G3TA 4CRYB 2PR8A 4R3KA 2VZYA 3SXNA 2EVNA 1Z4EA 3NE7A 2DXQA 4R9MA 4JXQA 3G3SA 4HNWB 3W91A 4UBRA 5F48A 3SXOA 3QB8A 2X7BA 4FD4A 3E0KA 4NXYA 4GS4A
chains in the Genus database with same CATH superfamily
4FAIA 3FEDA 5KTAA 3FBUA 2PVVA 3K9TA 4P4FA 1F57A 3TOAA 1Z8XA 2J8MA 2HUZA 1FY7A 1ZLHA 3KQZA 3LODA 4KUBA 4QC6A 3JUWA 4RUHA 1B6BA 2XEFA 2ANPA 2ZEPA 2GFQA 1S7KA 3WC5A 4E2AA 2PJAA 2ABZA 4ZX9A 1F2OA 4OIWA 2NYQA 3RZAA 5IX3A 4KOXA 4Q7AA 7CPAA 2JDDA 2ZEMA 4J3GA 4JJXA 2K5TA 3B3WA 3LMSA 1XE4A 1YR0A 1XIXA 4AVCA 2ZEGA 1J4JA 3NFZA 5DWNA 3CZXA 4YU9A 2Z3PA 2IL4A 3ZZIA 2WYRA 4EWTA 4ZY1A 1XJOA 4F0XA 3I3GA 1IYLA 4KOSA 3IEHA 4UEZA 2REEA 2AFZA 3H5ZA 1Y7EA 2R1IA 2WZNA 4YGOA 2POKA 3TO6A 3V8IA 3QAYA 1N71A 2EWBA 3JTKA 5LRGA 4M6HA 2ZW5A 1TF9A 1MJAA 4U9YA 1ZG7A 2QECA 4KZTA 2CNSA 1S7LA 3ISZA 2RB7A 5EBVA 2PJ1A 1NMTA 5CNPA 3SI1A 2HV2A 4NF1A 1R3NA 4YFJA 4CYQA 4U5YA 1I12A 2IQ6A 1BOBA 4UFVA 3EO4A 3RO0A 4MHPA 5K8PA 4IF5A 3CPXA 2FS5A 1JWQA 1KZFA 2FSRA 2P6EA 2XEIA 2C1CA 4R87A 5F09A 1S7FA 5J8FA 3FXTA 2FT0A 1Q7LA 2P6GA 3FIXA 4XPDC 4CRZB 5I0CA 4XPKA 4TNUA 3KKWA 4UFWA 2AFMA 2F5IA 3NH8A 1PUAA 1XF8A 2F7VA 4KOYA 3GYAA 4MXUA 4AB7A 1F2PA 2Q51A 2PJ5A 1YQEA 2QVPA 2Z3MA 1TKFA 3FH4A 1Z8WA 5AG4A 3CPAA 3IWGA 4OAEA 4PXCA 3IWWA 2ZXVA 4NJRA 3KZWA 2CTCA 4BBHA 2FIAA 3DR8A 2OB0A 5HVFA 4HNYB 4F8ZA 3DNSA 3PP9A 1L0CA 2OR4A 4MFZA 4FD5A 2PJ4A 2B4BA 1Z9UA 4F9UA 4PXBA 2Q0YA 2AFWA 4CAEA 3S9LA 2ZW4A 3D7DA 1ON0A 3GB0A 4H6ZA 1VIXA 4NJQA 4CGMA 2AFSA 3D3SA 4JWPA 1YLOA 1PCAA 2Q4ZA 4I49A 4ZGYB 5EC4A 5KTDA 1IYKA 1CBXA 2Q04A 4X5KA 5C82A 3C26A 3RNZA 1CPSA 1I21A 4KVOE 4KVXA 4MHYA 4UCNA 1B87A 1KWMA 3CDXA 4ZY2A 4A39A 2Q44A 2WUUA 4H89A 4CYNA 2RFHA 4IUSA 4FBEA 1IU8A 2Z11A 1IOIA 4NEXA 1LFWA 1Y9WA 2FIWA 2HC9A 4KOWA 3A9LA 1UWYA 4GXHA 1MJ9A 4UWIA 4HPSA 5HH1A 3JRUA 4Q36A 2AFXA 1JQGA 4MHNA 1P4NA 2D4PA 3BHXA 2ZENA 4R3LA 2G0BA 2ZEDA 4KOVA 4MBUA 4OLLA 3GUXA 4OC5A 2QMLA 4QUSA 4CAWA 1YGHA 3IJ3A 2FE7A 3TO9A 4MRIA 3QNVA 3V38A 3VH9A 1S60A 1SQHA 1MK4A 3PBEA 5HVGA 3DGVA 2PRQA 3B35A 3RBUA 1S5KA 6CPAA 3OWCA 3DR6A 1WWZA 2VXKA 2PQ8A 3DSBA 2HB6A 1ZG8A 2FXFA 4C2ZA 5JH9A 3PRTA 1XBUA 1PU9A 1YK3A 2IJZA 3LWUA 1Z4RA 1QSNA 4MFJA 5ISVA 2CF4A 2NSMA 3RYOA 1BAVA 2JBKA 2GIVA 4UCMA 3VWDA 5G22A 1EE3P 2BOAA 1ZLIA 2EUIA 1YREA 3FJUA 3TX8A 4A95A 5AG6A 3EXNA 2F8HA 4JLYA 2CNTA 4JXRA 4M3SA 3KASA 2EBJA 2GANA 4UEFA 4XPLA 3S6GA 3KR4A 2XEJA 2R7HA 2Q4YA 2G3AA 2VBQA 4GM5A 4FD6A 2J9AA 4KLVA 4BMHA 2ZELA 4A32A 2PJ6A 2ZW6A 5HMNA 1Y9KA 4CGLA 3TO7A 3PFEA 3UY5A 2YNDA 3CXQA 1Z2LA 2BO9A 2CY2A 4CAFA 1P0HA 4MFKA 3CT9A 2QJ8A 4XNHC 4MY3A 1GYTA 3DDDA 5GCNA 3WC7A 3TE4A 2PJCA 3PB8X 1UFHA 1Q2YA 4F9VA 4TWEA 2Y0MA 4NGPA 4ZI6A 5IB9A 1AUGA 1HDQA 2PJ7A 2AFOA 2PCUA 2B5GA 1IICA 4P10A 4PK3A 2AJ6A 4FWUA 4B5PA 1YX0A 2VZZA 3IO1A 4NCZA 4JD6A 2WPXA 2ZEHA 3WR7A 2GE3A 3F0AA 3HUVA 4MCQA 4X3RA 4ZBGA 4A31A 4OADA 2J8RA 3SHPA 5JPHA 2P0WA 3KHZA 4FD7A 1H8LA 3P2FA 5HVHA 4IK2A 2Z10A 4II9A 4JYWA 4B13A 4E8OA 1LOKA 3D8PA 3GKRA 5F47A 4MCRA 4Q38A 5FVJA 5D8NA 2PJ2A 3R1KA 1TXRA 4H2KA 2DEAA 3P2HA 1M4GA 3B2YA 2BEIA 4U9ZA 2REFA 3JVNA 4CAVA 3BJ8A 5LYDA 5C88A 2QIRA 1FT7A 5D29A 4QB9A 3K2KA 2ARHA 3PB9X 4R76A 1NE9A 3TCVA 4F0YA 2ZPAA 1U6MA 4OC4A 3EFAA 4A37A 3TC8A 4E0AA 2PC1A 8CPAA 2B4DB 5CPAA 2V77A 4CAXA 3IGRA 1IB1E 3IWEA 4R6TA 2B3UA 1CP7A 4ZX8A 1QSOA 1TKJA 1X10A 3F8KA 2OOTA 3SJFA 2OH1A 1YSJA 2PJ0A 4PV6A 1BPNA 3CXSA 4JZ0A 2KCWA 3PB6X 5K8OA 3PZJA 3D2MA 1Y7RA 4NGNA 3W6XA 5THWA 4KUAA 3VWEA 3IU1A 3MN8A 4K30A 4NGQA 4KSIA 4NGMA 4PXDA 2NMTA 4XPDB 1Q2CA 2DPSA 5E96A 2Z3OA 3HLPA 3N5FA 3VATA 1XFOA 4C7IA 3IIBA 3D68A 4MHDA 2DPTA 4B5OA 2D4OA 5J1QA 1YW4A 2YNEA 1X12A 2FL4A 3R96A 4UIBA 1IOFA 3R9EA 2ZEOA 3IU2A 3S6KA 5DS0A 2Q43A 2OZHA 3H8EA 2BL1A 4PXEA 3NA6A 4LQGA 1M44A 2PIYA 4P45A 5LRKA 4OC1A 2ATRA 2CNMA 2OZGA 3T8WA 2DF5A 5J8CA 4R7MA 3R9GA 2H5MA 4CPAA 1V0CA 3TT2A 1XRYA 1NSLA 1CJWA 3MGDA 1AMPA 1ZG9A 4IHMA 4NFRA 2IMOA 3H4QA 3PFOA 5AGEA 4A2ZA 5LYFA 3FX6A 3T9YA 4NXYA 1VHSA 1VGYA 1CPXA 3B8GA 1KUYA 1QSMA 4B14A 4P4BA 4MCSA 5LYIA 2V8HA 1Y0RA 4UA3A 3S6HA 3FRMA 5G21A 3PGPA 1YMEA 2FCKA 3SJGA 3KHXA 3SI0A 3SI2A 3H8FA 2VI7A 4YRHA 1TF8A 4QVTA 3B7IA 1IY7A 1IGBA 5A27A 2RC4A 3B3TA 1IIDA 3I9SA 4X2TA 4Y49B 4C2YA 4P6YA 2PJ9A 4OC2A 4RN7A 1KUXA 5JM6A 1ELLP 4NGSA 2EK8A 1YLEA 4MHZA 1CX8A 1Q2DA 4HKFA 5IB0A 5K8MA 3EC4A 5CBMA 3S9NA 1I1DA 2JDCA 4M6IA 3R95A 1WK4A 3EY5A 5H86A 4AG7A 2Z3NA 4R57A 3WABA 4MCPA 2AFUA 4AVBA 4MFPA 3KQXA 3IFEA 4CS0B 1RTQA 4ONWA 3WC6A 4KLWA 4DJLA 4EFDA 2I3CA 3QAHA 3H8GA 4CGOA 3TOBA 4BINA 4QBJA 5AG7A 2ZEEA 1ARMA 1CM0A 2AE6A 1TIQA 2CXAA 5DWMA 2JLMA 5ELYA 2YGWA 3FNCA 2PIZA 1RXTA 4R8FA 1LRZA 2PVWA 3I1UA 2BSWA 2BCOA 1BPMA 4OKOA 4PK2A 2QYVA 3LACA 4NSQA 1K4JA 4OC0A 2CTBA 1GHEA 5JGFA 1ARLA 2FVGA 4PSXA 3NE8A 3IC1A 1XMTA 4OP4A 3KL9A 2GLJA 5AG5A 3SJEA 2Q4VA 3BJ7A 3G8WA 5IV0A 4MFQA 3ISXA 3RAMA 3NH4A 2GLFA 3V7ZA 4NGTA 1YW6A 4UIAA 1LAMA 3S6FA 4IAVA 3WT4A 4KSFA 2ZEFA 3FECA 4L89A 4MFLA 1QSRA 3S9MA 3GLJA 4Y49C 3DLJA 3TFYA 4UWJA 5EMIA 4KOTA 2VEZA 3GIUA 5LRJA 3KR5A 4UFXA 3W6SA 4KS9A 2Z3LA 2ZOGA 3L2NA 3PBBA 3TTHA 1YVOA 2P6FA 1NSAA 2C27A 1R43A 1CP6A 4OC3A 2JEVA 2PJ8A 4H6UA 2PRBA 4KVME 1AYEA 1BLLE 4WWVA 4OIDA 1XOVA 3K9UA 1CG2A 4UEEA 2PR1A 4B12A 4P4JA 4RI1A 1KUVA 4CGPA 4DUKA 1XEBA 3PB7X 2V8VA 2VQYA 4PPZA 1XMBA 3CXPA 4RS2A 3KGQA 2BUEA 3FVLA 4F6AA 4UF4A 5G1ZA 4P4IA 1PYTB 1TKHA 2PSWA 4OMEA 3SJXA 3N7ZA 2I79A 2J8NA 2R98A 1Z8LA 4NGRA 1DE4C 3FMCA 4K3NA 4P4EA 4ZY0A 4MY0A 4PQAA 4UCPA 5JQ4A 5A28A 4CGNA 2PDOA 4EVYA 2ZW7A 3PEIA 4A94A 4B10A 4BD9A 4P4DA 1QSTA 1QQ9A 3BLNA 2ZOFA 2XEGA 2O4HA 5F46A 1HEEA 2WPWA 1M4IA 1VHEA 4HNXB 2Z0ZA 4C7HA 2OZUA 3B3SA 4DNCA 2O53A 3BI1A 2ODFA 5H84A 1YVKA 2HQYA 4ORFA 5K8NA 4LX9A 4B6ZA 4C2XA 2OU2A 2PE3A 3D7HA 5G20A 1M1DA 4B11A 4MI4A 2V8DA 3B3VA 3R9FA 2Q7SA 4X8IA 2O28A 3NH5A 4KOUA 4AVAA 5LYLA 3D2PA 4A38A 1R57A 5BWAB 1S3ZA 2G9DA 3BXMA 4L8AA 4PSWA 2R8VA 3FYNA 2C6PA 1S7NA 4CYPA 4Z65A 2B3VA 2GREA 3D67A 4MMOA 1Z5RA 3GY9A 5HXDA 2B5GB 4ONUA 1ZO0A 2C6CA 3FF3A 4M6GA 4AXVA 4LUAA 3T90A 4B5PB 1M4DA 1MJBA 1M4LA 4AG9A 2B58A 3F5BA 1VKCA 3D7FA 5KTCA 2I00A 3FB3A 1RO5A 3LD2A 5F49A 2V8GA 4MJ8A 4EMEA 1BO4A 4KORA 1FNOA 2A4NA 4KSAA 2C6GA 4XNHB 1OZPA 3FEEA 2JEWA 1HDUA 2YNCC 2Q7BA 2JBJA 3KI9A 4M85A 3ZJ0A 3PB4X 2B4DA 2G3TA 2WSAA 2GU2A 5I4MA 4CRYB 1A2ZA 4FUUA 2CIJA 2PR8A 4R3KA 1LAPA 1QMUA 2VZYA 1Z8TA 4O23A 2PJ3A 2EK9A 2EVNA 1Z4EA 3SXNA 1Y0YA 3NE7A 1LCPA 2DXQA 3BI0A 2VL1A 1VHOA 4R9MA 4JXQA 4ZYQA 4WJBA 3B3CA 4DYOA 2EO8A 1DTDA 3D7GA 4G1PA 3G3SA 4HNWB 1LANA 3W91A 4UBRA 4YWYA 3D4UA 2YNCA 3VARA 4CYOA 5F48A 1ELMP 3SXOA 4P44A 4A30A 2Z3KA 3QB8A 2X7BA 3MRUA 4A33A 4FD4A 1OBRA 2PJBA 4C68A 3E0KA 3D66A 4LQ6A 4W9YA 4GS4A
chains in the Genus database with same CATH topology
5KTAA 3FBUA 3TOAA 2J8MA 2HUZA 1FY7A 3LODA 4QC6A 4KUBA 3JUWA 1B6BA 1S7KA 4E2AA 5IX3A 4KOXA 2JDDA 4J3GA 4JJXA 2K5TA 1XE4A 1YR0A 1XIXA 4AVCA 1J4JA 5DWNA 3ZZIA 2Z3PA 2IL4A 4F0XA 3I3GA 1IYLA 4KOSA 2REEA 3H5ZA 2R1IA 4YGOA 3TO6A 3V8IA 1N71A 3JTKA 2ZW5A 1MJAA 4U9YA 4KZTA 2QECA 2CNSA 1S7LA 5EBVA 1NMTA 5CNPA 2HV2A 4NF1A 4YFJA 4CYQA 4U5YA 1I12A 4UFVA 1BOBA 3EO4A 4IF5A 2FS5A 1KZFA 2FSRA 2P6EA 4R87A 1S7FA 5J8FA 3FXTA 2FT0A 4CRZB 2P6GA 3FIXA 4XPDC 5I0CA 4XPKA 3KKWA 4UFWA 2F5IA 1PUAA 1XF8A 4KOYA 4AB7A 3GYAA 2Z3MA 5AG4A 3IWGA 4OAEA 2ZXVA 4BBHA 2FIAA 3DR8A 2OB0A 4HNYB 3DNSA 3PP9A 1L0CA 4MFZA 4FD5A 2B4BA 1Z9UA 2Q0YA 4CAEA 2ZW4A 1ON0A 4H6ZA 4CGMA 3D3SA 4JWPA 4I49A 4ZGYB 5EC4A 5KTDA 1IYKA 2Q04A 4X5KA 5C82A 3C26A 1I21A 4KVOE 4KVXA 4UCNA 1B87A 2Q44A 2WUUA 4H89A 4CYNA 4IUSA 2Z11A 4NEXA 1Y9WA 2FIWA 4KOWA 3A9LA 1MJ9A 4UWIA 5HH1A 4Q36A 1P4NA 2D4PA 4R3LA 2G0BA 4KOVA 4MBUA 4OLLA 2QMLA 4QUSA 4CAWA 1YGHA 2FE7A 3TO9A 1SQHA 1S60A 1MK4A 1S5KA 3OWCA 3DR6A 1WWZA 2VXKA 2PQ8A 3DSBA 2FXFA 4C2ZA 1PU9A 1YK3A 1Z4RA 1QSNA 4MFJA 5ISVA 3RYOA 2GIVA 4UCMA 3VWDA 5G22A 2EUIA 4A95A 1YREA 5AG6A 3EXNA 4JLYA 2CNTA 4JXRA 4M3SA 2GANA 4XPLA 3S6GA 2R7HA 2Q4YA 2G3AA 2VBQA 4FD6A 4KLVA 4BMHA 4A32A 2ZW6A 5HMNA 1Y9KA 4CGLA 3TO7A 3UY5A 2YNDA 3CXQA 4CAFA 2CY2A 1P0HA 4MFKA 4XNHC 5GCNA 4MY3A 3DDDA 3TE4A 1UFHA 1Q2YA 2Y0MA 4PK3A 2B5GA 1IICA 2AJ6A 4B5PA 1YX0A 2VZZA 4NCZA 4JD6A 2WPXA 3WR7A 2GE3A 3F0AA 4ZBGA 4A31A 4OADA 2J8RA 3SHPA 5JPHA 2P0WA 4FD7A 3P2FA 2Z10A 4II9A 4B13A 4E8OA 3D8PA 3GKRA 5F47A 4Q38A 5FVJA 3R1KA 3P2HA 1M4GA 4U9ZA 2BEIA 5C88A 2REFA 3JVNA 4CAVA 3BJ8A 2QIRA 4QB9A 2ARHA 1NE9A 3TCVA 4F0YA 2ZPAA 1U6MA 3EFAA 4E0AA 2PC1A 2B4DB 4CAXA 3IGRA 1IB1E 3IWEA 2B3UA 1QSOA 3F8KA 2OH1A 4PV6A 3CXSA 2KCWA 3PZJA 3D2MA 1Y7RA 3W6XA 4KUAA 3VWEA 3IU1A 4K30A 4XPDB 2NMTA 5E96A 1Q2CA 2DPSA 2Z3OA 4C7IA 4MHDA 2DPTA 4B5OA 2D4OA 2YNEA 2FL4A 3R96A 3R9EA 3IU2A 3S6KA 2OZHA 2BL1A 1M44A 2ATRA 2CNMA 2OZGA 5J8CA 3R9GA 2H5MA 1V0CA 3TT2A 1NSLA 1CJWA 3MGDA 3H4QA 5AGEA 4A2ZA 3T9YA 1VHSA 3B8GA 1KUYA 1QSMA 4B14A 4UA3A 3S6HA 3FRMA 5G21A 3PGPA 2FCKA 2VI7A 4YRHA 4QVTA 5A27A 2RC4A 3I9SA 1IIDA 4Y49B 4C2YA 1KUXA 1YLEA 1Q2DA 4HKFA 5IB0A 3EC4A 1I1DA 2JDCA 3R95A 4AG7A 1WK4A 3EY5A 5H86A 2Z3NA 4R57A 4AVBA 4MFPA 4CS0B 4KLWA 3QAHA 4CGOA 3TOBA 4QBJA 5AG7A 1CM0A 2AE6A 1TIQA 2CXAA 5DWMA 2JLMA 2YGWA 3FNCA 1RXTA 1LRZA 2BSWA 4PK2A 4NSQA 1K4JA 1GHEA 4PSXA 1XMTA 5AG5A 2Q4VA 3BJ7A 3G8WA 5IV0A 4MFQA 3S6FA 4KSFA 4L89A 4MFLA 1QSRA 4Y49C 3TFYA 4UWJA 4KOTA 2VEZA 4UFXA 3W6SA 4KS9A 2Z3LA 3TTHA 1YVOA 2P6FA 2C27A 2JEVA 4H6UA 2PRBA 4KVME 3K9UA 2PR1A 4B12A 4RI1A 1KUVA 4CGPA 1XEBA 2VQYA 3CXPA 4RS2A 2BUEA 4F6AA 5G1ZA 2PSWA 3N7ZA 2I79A 2J8NA 2R98A 4MY0A 4UCPA 5JQ4A 5A28A 4CGNA 2PDOA 4EVYA 2ZW7A 4B10A 1QSTA 3BLNA 5F46A 2WPWA 1M4IA 4HNXB 2Z0ZA 4C7HA 2OZUA 4DNCA 5H84A 1YVKA 2HQYA 4ORFA 4LX9A 4C2XA 2OU2A 5G20A 1M1DA 4B11A 4MI4A 3R9FA 2O28A 4KOUA 4AVAA 3D2PA 1R57A 5BWAB 1S3ZA 4L8AA 4PSWA 4CYPA 2R8VA 3FYNA 1S7NA 2B3VA 3GY9A 2B5GB 4ONUA 1ZO0A 4B5PB 4LUAA 3T90A 1M4DA 1MJBA 4AG9A 2B58A 3F5BA 1VKCA 5KTCA 2I00A 3FB3A 1RO5A 3LD2A 5F49A 4MJ8A 1BO4A 4KORA 2A4NA 4KSAA 4XNHB 1OZPA 2YNCC 2Q7BA 4M85A 3ZJ0A 2B4DA 2G3TA 2WSAA 4CRYB 2PR8A 4R3KA 2VZYA 3SXNA 2EVNA 1Z4EA 3NE7A 2DXQA 4R9MA 4JXQA 3G3SA 4HNWB 3W91A 4UBRA 4CYOA 2YNCA 5F48A 3SXOA 4A30A 2Z3KA 3QB8A 2X7BA 4A33A 4FD4A 4C68A 3E0KA 4NXYA 4GS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KTA A;  3FBU A;  3TOA A;  2J8M A;  2HUZ A;  1FY7 A;  3LOD A;  4QC6 A;  4KUB A;  3JUW A;  1B6B A;  1S7K A;  4E2A A;  5IX3 A;  4KOX A;  2JDD A;  4J3G A;  4JJX A;  2K5T A;  1XE4 A;  1YR0 A;  1XIX A;  4AVC A;  1J4J A;  5DWN A;  3ZZI A;  2IL4 A;  3I3G A;  1IYL A;  4KOS A;  2REE A;  2R1I A;  4YGO A;  3TO6 A;  3V8I A;  1N71 A;  2ZW5 A;  1MJA A;  4U9Y A;  4KZT A;  2QEC A;  2CNS A;  1S7L A;  5EBV A;  1NMT A;  5CNP A;  2HV2 A;  4NF1 A;  4YFJ A;  4U5Y A;  1I12 A;  1BOB A;  3EO4 A;  4IF5 A;  2FS5 A;  1KZF A;  2FSR A;  2P6E A;  4R87 A;  1S7F A;  5J8F A;  3FXT A;  2FT0 A;  4CRZ B;  2P6G A;  3FIX A;  4XPD C;  5I0C A;  4XPK A;  3KKW A;  2F5I A;  1PUA A;  1XF8 A;  4KOY A;  4AB7 A;  3GYA A;  3IWG A;  4OAE A;  2ZXV A;  2FIA A;  3DR8 A;  2OB0 A;  4HNY B;  3DNS A;  3PP9 A;  1L0C A;  4FD5 A;  2B4B A;  1Z9U A;  2Q0Y A;  2ZW4 A;  1ON0 A;  4H6Z A;  3D3S A;  4JWP A;  4I49 A;  5EC4 A;  5KTD A;  1IYK A;  2Q04 A;  4X5K A;  5C82 A;  3C26 A;  1I21 A;  4KVO E;  4KVX A;  1B87 A;  2Q44 A;  4H89 A;  4IUS A;  2Z11 A;  4NEX A;  1Y9W A;  2FIW A;  4KOW A;  1MJ9 A;  4UWI A;  5HH1 A;  1P4N A;  2D4P A;  4R3L A;  2G0B A;  4KOV A;  4MBU A;  4OLL A;  2QML A;  4QUS A;  4CAW A;  1YGH A;  2FE7 A;  3TO9 A;  1SQH A;  1S60 A;  1MK4 A;  1S5K A;  3OWC A;  3DR6 A;  1WWZ A;  2VXK A;  2PQ8 A;  3DSB A;  2FXF A;  1PU9 A;  1YK3 A;  1Z4R A;  1QSN A;  5ISV A;  3RYO A;  2GIV A;  3VWD A;  2EUI A;  1YRE A;  3EXN A;  4JLY A;  2CNT A;  4JXR A;  4M3S A;  2GAN A;  4XPL A;  3S6G A;  2R7H A;  2Q4Y A;  2G3A A;  2VBQ A;  4FD6 A;  4KLV A;  4BMH A;  2ZW6 A;  5HMN A;  1Y9K A;  3TO7 A;  3UY5 A;  3CXQ A;  2CY2 A;  1P0H A;  4XNH C;  5GCN A;  4MY3 A;  3DDD A;  3TE4 A;  1UFH A;  1Q2Y A;  2Y0M A;  4PK3 A;  2B5G A;  1IIC A;  2AJ6 A;  4B5P A;  1YX0 A;  2VZZ A;  4NCZ A;  4JD6 A;  2WPX A;  3WR7 A;  2GE3 A;  3F0A A;  4ZBG A;  4OAD A;  2J8R A;  3SHP A;  5JPH A;  2P0W A;  4FD7 A;  3P2F A;  2Z10 A;  4II9 A;  4E8O A;  3D8P A;  3GKR A;  5F47 A;  5FVJ A;  3R1K A;  3P2H A;  1M4G A;  4U9Z A;  2BEI A;  5C88 A;  2REF A;  3JVN A;  4CAV A;  3BJ8 A;  2QIR A;  4QB9 A;  2ARH A;  1NE9 A;  3TCV A;  4F0Y A;  2ZPA A;  1U6M A;  3EFA A;  4E0A A;  2PC1 A;  2B4D B;  4CAX A;  3IGR A;  1IB1 E;  2B3U A;  1QSO A;  3F8K A;  2OH1 A;  4PV6 A;  3CXS A;  2KCW A;  3PZJ A;  3D2M A;  1Y7R A;  3W6X A;  4KUA A;  3VWE A;  4K30 A;  4XPD B;  2NMT A;  5E96 A;  1Q2C A;  4MHD A;  4B5O A;  2D4O A;  2FL4 A;  3R96 A;  3R9E A;  3S6K A;  2OZH A;  2BL1 A;  1M44 A;  2ATR A;  2CNM A;  2OZG A;  5J8C A;  3R9G A;  2H5M A;  1V0C A;  3TT2 A;  1NSL A;  1CJW A;  3MGD A;  3H4Q A;  3T9Y A;  1VHS A;  3B8G A;  1KUY A;  1QSM A;  4UA3 A;  3S6H A;  3FRM A;  3PGP A;  2FCK A;  2VI7 A;  4YRH A;  4QVT A;  2RC4 A;  3I9S A;  1IID A;  4Y49 B;  1KUX A;  1YLE A;  1Q2D A;  4HKF A;  5IB0 A;  3EC4 A;  1I1D A;  2JDC A;  3R95 A;  4AG7 A;  1WK4 A;  3EY5 A;  5H86 A;  4R57 A;  4AVB A;  4CS0 B;  4KLW A;  3QAH A;  3TOB A;  4QBJ A;  1CM0 A;  2AE6 A;  1TIQ A;  5DWM A;  2JLM A;  3FNC A;  1RXT A;  1LRZ A;  2BSW A;  4PK2 A;  4NSQ A;  1K4J A;  1GHE A;  4PSX A;  1XMT A;  2Q4V A;  3BJ7 A;  3G8W A;  5IV0 A;  3S6F A;  4L89 A;  1QSR A;  4Y49 C;  3TFY A;  4UWJ A;  4KOT A;  2VEZ A;  3W6S A;  3TTH A;  1YVO A;  2P6F A;  2C27 A;  2JEV A;  4H6U A;  2PRB A;  4KVM E;  3K9U A;  2PR1 A;  4RI1 A;  1KUV A;  1XEB A;  2VQY A;  3CXP A;  4RS2 A;  2BUE A;  4F6A A;  2PSW A;  3N7Z A;  2I79 A;  2J8N A;  2R98 A;  4MY0 A;  5JQ4 A;  4EVY A;  2PDO A;  2ZW7 A;  1QST A;  3BLN A;  5F46 A;  2WPW A;  1M4I A;  4HNX B;  2Z0Z A;  2OZU A;  4DNC A;  5H84 A;  1YVK A;  2HQY A;  4ORF A;  4LX9 A;  2OU2 A;  1M1D A;  4MI4 A;  3R9F A;  2O28 A;  4KOU A;  4AVA A;  3D2P A;  1R57 A;  1S3Z A;  4L8A A;  4PSW A;  2R8V A;  3FYN A;  1S7N A;  2B3V A;  3GY9 A;  2B5G B;  4ONU A;  4B5P B;  4LUA A;  3T90 A;  1M4D A;  1MJB A;  4AG9 A;  2B58 A;  3F5B A;  1VKC A;  5KTC A;  2I00 A;  3FB3 A;  1RO5 A;  3LD2 A;  5F49 A;  4MJ8 A;  1BO4 A;  4KOR A;  2A4N A;  4XNH B;  1OZP A;  2Q7B A;  4M85 A;  3ZJ0 A;  2B4D A;  2G3T A;  4CRY B;  2PR8 A;  4R3K A;  2VZY A;  3SXN A;  2EVN A;  1Z4E A;  3NE7 A;  2DXQ A;  4R9M A;  4JXQ A;  3G3S A;  4HNW B;  3W91 A;  4UBR A;  5F48 A;  3SXO A;  3QB8 A;  2X7B A;  4FD4 A;  3E0K A;  4NXY A;  4GS4 A; 
#chains in the Genus database with same CATH topology
 4FAI A;  3FED A;  5KTA A;  3FBU A;  2PVV A;  3K9T A;  4P4F A;  1F57 A;  3TOA A;  1Z8X A;  2J8M A;  2HUZ A;  1FY7 A;  1ZLH A;  3KQZ A;  3LOD A;  4KUB A;  4QC6 A;  3JUW A;  4RUH A;  1B6B A;  2XEF A;  2ANP A;  2ZEP A;  2GFQ A;  1S7K A;  3WC5 A;  4E2A A;  2PJA A;  2ABZ A;  4ZX9 A;  1F2O A;  4OIW A;  2NYQ A;  3RZA A;  5IX3 A;  4KOX A;  4Q7A A;  7CPA A;  2JDD A;  2ZEM A;  4J3G A;  4JJX A;  2K5T A;  3B3W A;  3LMS A;  1XE4 A;  1YR0 A;  1XIX A;  4AVC A;  2ZEG A;  1J4J A;  3NFZ A;  5DWN A;  3CZX A;  4YU9 A;  2Z3P A;  2IL4 A;  3ZZI A;  2WYR A;  4EWT A;  4ZY1 A;  1XJO A;  4F0X A;  3I3G A;  1IYL A;  4KOS A;  3IEH A;  4UEZ A;  2REE A;  2AFZ A;  3H5Z A;  1Y7E A;  2R1I A;  2WZN A;  4YGO A;  2POK A;  3TO6 A;  3V8I A;  3QAY A;  1N71 A;  2EWB A;  3JTK A;  5LRG A;  4M6H A;  2ZW5 A;  1TF9 A;  1MJA A;  4U9Y A;  1ZG7 A;  2QEC A;  4KZT A;  2CNS A;  1S7L A;  3ISZ A;  2RB7 A;  5EBV A;  2PJ1 A;  1NMT A;  5CNP A;  3SI1 A;  2HV2 A;  4NF1 A;  1R3N A;  4YFJ A;  4CYQ A;  4U5Y A;  1I12 A;  2IQ6 A;  1BOB A;  4UFV A;  3EO4 A;  3RO0 A;  4MHP A;  5K8P A;  4IF5 A;  3CPX A;  2FS5 A;  1JWQ A;  1KZF A;  2FSR A;  2P6E A;  2XEI A;  2C1C A;  4R87 A;  5F09 A;  1S7F A;  5J8F A;  3FXT A;  2FT0 A;  1Q7L A;  2P6G A;  3FIX A;  4XPD C;  4CRZ B;  5I0C A;  4XPK A;  4TNU A;  3KKW A;  4UFW A;  2AFM A;  2F5I A;  3NH8 A;  1PUA A;  1XF8 A;  2F7V A;  4KOY A;  3GYA A;  4MXU A;  4AB7 A;  1F2P A;  2Q51 A;  2PJ5 A;  1YQE A;  2QVP A;  2Z3M A;  1TKF A;  3FH4 A;  1Z8W A;  5AG4 A;  3CPA A;  3IWG A;  4OAE A;  4PXC A;  3IWW A;  2ZXV A;  4NJR A;  3KZW A;  2CTC A;  4BBH A;  2FIA A;  3DR8 A;  2OB0 A;  5HVF A;  4HNY B;  4F8Z A;  3DNS A;  3PP9 A;  1L0C A;  2OR4 A;  4MFZ A;  4FD5 A;  2PJ4 A;  2B4B A;  1Z9U A;  4F9U A;  4PXB A;  2Q0Y A;  2AFW A;  4CAE A;  3S9L A;  2ZW4 A;  3D7D A;  1ON0 A;  3GB0 A;  4H6Z A;  1VIX A;  4NJQ A;  4CGM A;  2AFS A;  3D3S A;  4JWP A;  1YLO A;  1PCA A;  2Q4Z A;  4I49 A;  4ZGY B;  5EC4 A;  5KTD A;  1IYK A;  1CBX A;  2Q04 A;  4X5K A;  5C82 A;  3C26 A;  3RNZ A;  1CPS A;  1I21 A;  4KVO E;  4KVX A;  4MHY A;  4UCN A;  1B87 A;  1KWM A;  3CDX A;  4ZY2 A;  4A39 A;  2Q44 A;  2WUU A;  4H89 A;  4CYN A;  2RFH A;  4IUS A;  4FBE A;  1IU8 A;  2Z11 A;  1IOI A;  4NEX A;  1LFW A;  1Y9W A;  2FIW A;  2HC9 A;  4KOW A;  3A9L A;  1UWY A;  4GXH A;  1MJ9 A;  4UWI A;  4HPS A;  5HH1 A;  3JRU A;  4Q36 A;  2AFX A;  1JQG A;  4MHN A;  1P4N A;  2D4P A;  3BHX A;  2ZEN A;  4R3L A;  2G0B A;  2ZED A;  4KOV A;  4MBU A;  4OLL A;  3GUX A;  4OC5 A;  2QML A;  4QUS A;  4CAW A;  1YGH A;  3IJ3 A;  2FE7 A;  3TO9 A;  4MRI A;  3QNV A;  3V38 A;  3VH9 A;  1S60 A;  1SQH A;  1MK4 A;  3PBE A;  5HVG A;  3DGV A;  2PRQ A;  3B35 A;  3RBU A;  1S5K A;  6CPA A;  3OWC A;  3DR6 A;  1WWZ A;  2VXK A;  2PQ8 A;  3DSB A;  2HB6 A;  1ZG8 A;  2FXF A;  4C2Z A;  5JH9 A;  3PRT A;  1XBU A;  1PU9 A;  1YK3 A;  2IJZ A;  3LWU A;  1Z4R A;  1QSN A;  4MFJ A;  5ISV A;  2CF4 A;  2NSM A;  3RYO A;  1BAV A;  2JBK A;  2GIV A;  4UCM A;  3VWD A;  5G22 A;  1EE3 P;  2BOA A;  1ZLI A;  2EUI A;  1YRE A;  3FJU A;  3TX8 A;  4A95 A;  5AG6 A;  3EXN A;  2F8H A;  4JLY A;  2CNT A;  4JXR A;  4M3S A;  3KAS A;  2EBJ A;  2GAN A;  4UEF A;  4XPL A;  3S6G A;  3KR4 A;  2XEJ A;  2R7H A;  2Q4Y A;  2G3A A;  2VBQ A;  4GM5 A;  4FD6 A;  2J9A A;  4KLV A;  4BMH A;  2ZEL A;  4A32 A;  2PJ6 A;  2ZW6 A;  5HMN A;  1Y9K A;  4CGL A;  3TO7 A;  3PFE A;  3UY5 A;  2YND A;  3CXQ A;  1Z2L A;  2BO9 A;  2CY2 A;  4CAF A;  1P0H A;  4MFK A;  3CT9 A;  2QJ8 A;  4XNH C;  4MY3 A;  1GYT A;  3DDD A;  5GCN A;  3WC7 A;  3TE4 A;  2PJC A;  3PB8 X;  1UFH A;  1Q2Y A;  4F9V A;  4TWE A;  2Y0M A;  4NGP A;  4ZI6 A;  5IB9 A;  1AUG A;  1HDQ A;  2PJ7 A;  2AFO A;  2PCU A;  2B5G A;  1IIC A;  4P10 A;  4PK3 A;  2AJ6 A;  4FWU A;  4B5P A;  1YX0 A;  2VZZ A;  3IO1 A;  4NCZ A;  4JD6 A;  2WPX A;  2ZEH A;  3WR7 A;  2GE3 A;  3F0A A;  3HUV A;  4MCQ A;  4X3R A;  4ZBG A;  4A31 A;  4OAD A;  2J8R A;  3SHP A;  5JPH A;  2P0W A;  3KHZ A;  4FD7 A;  1H8L A;  3P2F A;  5HVH A;  4IK2 A;  2Z10 A;  4II9 A;  4JYW A;  4B13 A;  4E8O A;  1LOK A;  3D8P A;  3GKR A;  5F47 A;  4MCR A;  4Q38 A;  5FVJ A;  5D8N A;  2PJ2 A;  3R1K A;  1TXR A;  4H2K A;  2DEA A;  3P2H A;  1M4G A;  3B2Y A;  2BEI A;  4U9Z A;  2REF A;  3JVN A;  4CAV A;  3BJ8 A;  5LYD A;  5C88 A;  2QIR A;  1FT7 A;  5D29 A;  4QB9 A;  3K2K A;  2ARH A;  3PB9 X;  4R76 A;  1NE9 A;  3TCV A;  4F0Y A;  2ZPA A;  1U6M A;  4OC4 A;  3EFA A;  4A37 A;  3TC8 A;  4E0A A;  2PC1 A;  8CPA A;  2B4D B;  5CPA A;  2V77 A;  4CAX A;  3IGR A;  1IB1 E;  3IWE A;  4R6T A;  2B3U A;  1CP7 A;  4ZX8 A;  1QSO A;  1TKJ A;  1X10 A;  3F8K A;  2OOT A;  3SJF A;  2OH1 A;  1YSJ A;  2PJ0 A;  4PV6 A;  1BPN A;  3CXS A;  4JZ0 A;  2KCW A;  3PB6 X;  5K8O A;  3PZJ A;  3D2M A;  1Y7R A;  4NGN A;  3W6X A;  5THW A;  4KUA A;  3VWE A;  3IU1 A;  3MN8 A;  4K30 A;  4NGQ A;  4KSI A;  4NGM A;  4PXD A;  2NMT A;  4XPD B;  1Q2C A;  2DPS A;  5E96 A;  2Z3O A;  3HLP A;  3N5F A;  3VAT A;  1XFO A;  4C7I A;  3IIB A;  3D68 A;  4MHD A;  2DPT A;  4B5O A;  2D4O A;  5J1Q A;  1YW4 A;  2YNE A;  1X12 A;  2FL4 A;  3R96 A;  4UIB A;  1IOF A;  3R9E A;  2ZEO A;  3IU2 A;  3S6K A;  5DS0 A;  2Q43 A;  2OZH A;  3H8E A;  2BL1 A;  4PXE A;  3NA6 A;  4LQG A;  1M44 A;  2PIY A;  4P45 A;  5LRK A;  4OC1 A;  2ATR A;  2CNM A;  2OZG A;  3T8W A;  2DF5 A;  5J8C A;  4R7M A;  3R9G A;  2H5M A;  4CPA A;  1V0C A;  3TT2 A;  1XRY A;  1NSL A;  1CJW A;  3MGD A;  1AMP A;  1ZG9 A;  4IHM A;  4NFR A;  2IMO A;  3H4Q A;  3PFO A;  5AGE A;  4A2Z A;  5LYF A;  3FX6 A;  3T9Y A;  4NXY A;  1VHS A;  1VGY A;  1CPX A;  3B8G A;  1KUY A;  1QSM A;  4B14 A;  4P4B A;  4MCS A;  5LYI A;  2V8H A;  1Y0R A;  4UA3 A;  3S6H A;  3FRM A;  5G21 A;  3PGP A;  1YME A;  2FCK A;  3SJG A;  3KHX A;  3SI0 A;  3SI2 A;  3H8F A;  2VI7 A;  4YRH A;  1TF8 A;  4QVT A;  3B7I A;  1IY7 A;  1IGB A;  5A27 A;  2RC4 A;  3B3T A;  1IID A;  3I9S A;  4X2T A;  4Y49 B;  4C2Y A;  4P6Y A;  2PJ9 A;  4OC2 A;  4RN7 A;  1KUX A;  5JM6 A;  1ELL P;  4NGS A;  2EK8 A;  1YLE A;  4MHZ A;  1CX8 A;  1Q2D A;  4HKF A;  5IB0 A;  5K8M A;  3EC4 A;  5CBM A;  3S9N A;  1I1D A;  2JDC A;  4M6I A;  3R95 A;  1WK4 A;  3EY5 A;  5H86 A;  4AG7 A;  2Z3N A;  4R57 A;  3WAB A;  4MCP A;  2AFU A;  4AVB A;  4MFP A;  3KQX A;  3IFE A;  4CS0 B;  1RTQ A;  4ONW A;  3WC6 A;  4KLW A;  4DJL A;  4EFD A;  2I3C A;  3QAH A;  3H8G A;  4CGO A;  3TOB A;  4BIN A;  4QBJ A;  5AG7 A;  2ZEE A;  1ARM A;  1CM0 A;  2AE6 A;  1TIQ A;  2CXA A;  5DWM A;  2JLM A;  5ELY A;  2YGW A;  3FNC A;  2PIZ A;  1RXT A;  4R8F A;  1LRZ A;  2PVW A;  3I1U A;  2BSW A;  2BCO A;  1BPM A;  4OKO A;  4PK2 A;  2QYV A;  3LAC A;  4NSQ A;  1K4J A;  4OC0 A;  2CTB A;  1GHE A;  5JGF A;  1ARL A;  2FVG A;  4PSX A;  3NE8 A;  3IC1 A;  1XMT A;  4OP4 A;  3KL9 A;  2GLJ A;  5AG5 A;  3SJE A;  2Q4V A;  3BJ7 A;  3G8W A;  5IV0 A;  4MFQ A;  3ISX A;  3RAM A;  3NH4 A;  2GLF A;  3V7Z A;  4NGT A;  1YW6 A;  4UIA A;  1LAM A;  3S6F A;  4IAV A;  3WT4 A;  4KSF A;  2ZEF A;  3FEC A;  4L89 A;  4MFL A;  1QSR A;  3S9M A;  3GLJ A;  4Y49 C;  3DLJ A;  3TFY A;  4UWJ A;  5EMI A;  4KOT A;  2VEZ A;  3GIU A;  5LRJ A;  3KR5 A;  4UFX A;  3W6S A;  4KS9 A;  2Z3L A;  2ZOG A;  3L2N A;  3PBB A;  3TTH A;  1YVO A;  2P6F A;  1NSA A;  2C27 A;  1R43 A;  1CP6 A;  4OC3 A;  2JEV A;  2PJ8 A;  4H6U A;  2PRB A;  4KVM E;  1AYE A;  1BLL E;  4WWV A;  4OID A;  1XOV A;  3K9U A;  1CG2 A;  4UEE A;  2PR1 A;  4B12 A;  4P4J A;  4RI1 A;  1KUV A;  4CGP A;  4DUK A;  1XEB A;  3PB7 X;  2V8V A;  2VQY A;  4PPZ A;  1XMB A;  3CXP A;  4RS2 A;  3KGQ A;  2BUE A;  3FVL A;  4F6A A;  4UF4 A;  5G1Z A;  4P4I A;  1PYT B;  1TKH A;  2PSW A;  4OME A;  3SJX A;  3N7Z A;  2I79 A;  2J8N A;  2R98 A;  1Z8L A;  4NGR A;  1DE4 C;  3FMC A;  4K3N A;  4P4E A;  4ZY0 A;  4MY0 A;  4PQA A;  4UCP A;  5JQ4 A;  5A28 A;  4CGN A;  2PDO A;  4EVY A;  2ZW7 A;  3PEI A;  4A94 A;  4B10 A;  4BD9 A;  4P4D A;  1QST A;  1QQ9 A;  3BLN A;  2ZOF A;  2XEG A;  2O4H A;  5F46 A;  1HEE A;  2WPW A;  1M4I A;  1VHE A;  4HNX B;  2Z0Z A;  4C7H A;  2OZU A;  3B3S A;  4DNC A;  2O53 A;  3BI1 A;  2ODF A;  5H84 A;  1YVK A;  2HQY A;  4ORF A;  5K8N A;  4LX9 A;  4B6Z A;  4C2X A;  2OU2 A;  2PE3 A;  3D7H A;  5G20 A;  1M1D A;  4B11 A;  4MI4 A;  2V8D A;  3B3V A;  3R9F A;  2Q7S A;  4X8I A;  2O28 A;  3NH5 A;  4KOU A;  4AVA A;  5LYL A;  3D2P A;  4A38 A;  1R57 A;  5BWA B;  1S3Z A;  2G9D A;  3BXM A;  4L8A A;  4PSW A;  2R8V A;  3FYN A;  2C6P A;  1S7N A;  4CYP A;  4Z65 A;  2B3V A;  2GRE A;  3D67 A;  4MMO A;  1Z5R A;  3GY9 A;  5HXD A;  2B5G B;  4ONU A;  1ZO0 A;  2C6C A;  3FF3 A;  4M6G A;  4AXV A;  4LUA A;  3T90 A;  4B5P B;  1M4D A;  1MJB A;  1M4L A;  4AG9 A;  2B58 A;  3F5B A;  1VKC A;  3D7F A;  5KTC A;  2I00 A;  3FB3 A;  1RO5 A;  3LD2 A;  5F49 A;  2V8G A;  4MJ8 A;  4EME A;  1BO4 A;  4KOR A;  1FNO A;  2A4N A;  4KSA A;  2C6G A;  4XNH B;  1OZP A;  3FEE A;  2JEW A;  1HDU A;  2YNC C;  2Q7B A;  2JBJ A;  3KI9 A;  4M85 A;  3ZJ0 A;  3PB4 X;  2B4D A;  2G3T A;  2WSA A;  2GU2 A;  5I4M A;  4CRY B;  1A2Z A;  4FUU A;  2CIJ A;  2PR8 A;  4R3K A;  1LAP A;  1QMU A;  2VZY A;  1Z8T A;  4O23 A;  2PJ3 A;  2EK9 A;  2EVN A;  1Z4E A;  3SXN A;  1Y0Y A;  3NE7 A;  1LCP A;  2DXQ A;  3BI0 A;  2VL1 A;  1VHO A;  4R9M A;  4JXQ A;  4ZYQ A;  4WJB A;  3B3C A;  4DYO A;  2EO8 A;  1DTD A;  3D7G A;  4G1P A;  3G3S A;  4HNW B;  1LAN A;  3W91 A;  4UBR A;  4YWY A;  3D4U A;  2YNC A;  3VAR A;  4CYO A;  5F48 A;  1ELM P;  3SXO A;  4P44 A;  4A30 A;  2Z3K A;  3QB8 A;  2X7B A;  3MRU A;  4A33 A;  4FD4 A;  1OBR A;  2PJB A;  4C68 A;  3E0K A;  3D66 A;  4LQ6 A;  4W9Y A;  4GS4 A; 
#chains in the Genus database with same CATH homology
 5KTA A;  3FBU A;  3TOA A;  2J8M A;  2HUZ A;  1FY7 A;  3LOD A;  4QC6 A;  4KUB A;  3JUW A;  1B6B A;  1S7K A;  4E2A A;  5IX3 A;  4KOX A;  2JDD A;  4J3G A;  4JJX A;  2K5T A;  1XE4 A;  1YR0 A;  1XIX A;  4AVC A;  1J4J A;  5DWN A;  3ZZI A;  2Z3P A;  2IL4 A;  4F0X A;  3I3G A;  1IYL A;  4KOS A;  2REE A;  3H5Z A;  2R1I A;  4YGO A;  3TO6 A;  3V8I A;  1N71 A;  3JTK A;  2ZW5 A;  1MJA A;  4U9Y A;  4KZT A;  2QEC A;  2CNS A;  1S7L A;  5EBV A;  1NMT A;  5CNP A;  2HV2 A;  4NF1 A;  4YFJ A;  4CYQ A;  4U5Y A;  1I12 A;  4UFV A;  1BOB A;  3EO4 A;  4IF5 A;  2FS5 A;  1KZF A;  2FSR A;  2P6E A;  4R87 A;  1S7F A;  5J8F A;  3FXT A;  2FT0 A;  4CRZ B;  2P6G A;  3FIX A;  4XPD C;  5I0C A;  4XPK A;  3KKW A;  4UFW A;  2F5I A;  1PUA A;  1XF8 A;  4KOY A;  4AB7 A;  3GYA A;  2Z3M A;  5AG4 A;  3IWG A;  4OAE A;  2ZXV A;  4BBH A;  2FIA A;  3DR8 A;  2OB0 A;  4HNY B;  3DNS A;  3PP9 A;  1L0C A;  4MFZ A;  4FD5 A;  2B4B A;  1Z9U A;  2Q0Y A;  4CAE A;  2ZW4 A;  1ON0 A;  4H6Z A;  4CGM A;  3D3S A;  4JWP A;  4I49 A;  4ZGY B;  5EC4 A;  5KTD A;  1IYK A;  2Q04 A;  4X5K A;  5C82 A;  3C26 A;  1I21 A;  4KVO E;  4KVX A;  4UCN A;  1B87 A;  2Q44 A;  2WUU A;  4H89 A;  4CYN A;  4IUS A;  2Z11 A;  4NEX A;  1Y9W A;  2FIW A;  4KOW A;  3A9L A;  1MJ9 A;  4UWI A;  5HH1 A;  4Q36 A;  1P4N A;  2D4P A;  4R3L A;  2G0B A;  4KOV A;  4MBU A;  4OLL A;  2QML A;  4QUS A;  4CAW A;  1YGH A;  2FE7 A;  3TO9 A;  1SQH A;  1S60 A;  1MK4 A;  1S5K A;  3OWC A;  3DR6 A;  1WWZ A;  2VXK A;  2PQ8 A;  3DSB A;  2FXF A;  4C2Z A;  1PU9 A;  1YK3 A;  1Z4R A;  1QSN A;  4MFJ A;  5ISV A;  3RYO A;  2GIV A;  4UCM A;  3VWD A;  5G22 A;  2EUI A;  4A95 A;  1YRE A;  5AG6 A;  3EXN A;  4JLY A;  2CNT A;  4JXR A;  4M3S A;  2GAN A;  4XPL A;  3S6G A;  2R7H A;  2Q4Y A;  2G3A A;  2VBQ A;  4FD6 A;  4KLV A;  4BMH A;  4A32 A;  2ZW6 A;  5HMN A;  1Y9K A;  4CGL A;  3TO7 A;  3UY5 A;  2YND A;  3CXQ A;  4CAF A;  2CY2 A;  1P0H A;  4MFK A;  4XNH C;  5GCN A;  4MY3 A;  3DDD A;  3TE4 A;  1UFH A;  1Q2Y A;  2Y0M A;  4PK3 A;  2B5G A;  1IIC A;  2AJ6 A;  4B5P A;  1YX0 A;  2VZZ A;  4NCZ A;  4JD6 A;  2WPX A;  3WR7 A;  2GE3 A;  3F0A A;  4ZBG A;  4A31 A;  4OAD A;  2J8R A;  3SHP A;  5JPH A;  2P0W A;  4FD7 A;  3P2F A;  2Z10 A;  4II9 A;  4B13 A;  4E8O A;  3D8P A;  3GKR A;  5F47 A;  4Q38 A;  5FVJ A;  3R1K A;  3P2H A;  1M4G A;  4U9Z A;  2BEI A;  5C88 A;  2REF A;  3JVN A;  4CAV A;  3BJ8 A;  2QIR A;  4QB9 A;  2ARH A;  1NE9 A;  3TCV A;  4F0Y A;  2ZPA A;  1U6M A;  3EFA A;  4E0A A;  2PC1 A;  2B4D B;  4CAX A;  3IGR A;  1IB1 E;  3IWE A;  2B3U A;  1QSO A;  3F8K A;  2OH1 A;  4PV6 A;  3CXS A;  2KCW A;  3PZJ A;  3D2M A;  1Y7R A;  3W6X A;  4KUA A;  3VWE A;  3IU1 A;  4K30 A;  4XPD B;  2NMT A;  5E96 A;  1Q2C A;  2DPS A;  2Z3O A;  4C7I A;  4MHD A;  2DPT A;  4B5O A;  2D4O A;  2YNE A;  2FL4 A;  3R96 A;  3R9E A;  3IU2 A;  3S6K A;  2OZH A;  2BL1 A;  1M44 A;  2ATR A;  2CNM A;  2OZG A;  5J8C A;  3R9G A;  2H5M A;  1V0C A;  3TT2 A;  1NSL A;  1CJW A;  3MGD A;  3H4Q A;  5AGE A;  4A2Z A;  3T9Y A;  1VHS A;  3B8G A;  1KUY A;  1QSM A;  4B14 A;  4UA3 A;  3S6H A;  3FRM A;  5G21 A;  3PGP A;  2FCK A;  2VI7 A;  4YRH A;  4QVT A;  5A27 A;  2RC4 A;  3I9S A;  1IID A;  4Y49 B;  4C2Y A;  1KUX A;  1YLE A;  1Q2D A;  4HKF A;  5IB0 A;  3EC4 A;  1I1D A;  2JDC A;  3R95 A;  4AG7 A;  1WK4 A;  3EY5 A;  5H86 A;  2Z3N A;  4R57 A;  4AVB A;  4MFP A;  4CS0 B;  4KLW A;  3QAH A;  4CGO A;  3TOB A;  4QBJ A;  5AG7 A;  1CM0 A;  2AE6 A;  1TIQ A;  2CXA A;  5DWM A;  2JLM A;  2YGW A;  3FNC A;  1RXT A;  1LRZ A;  2BSW A;  4PK2 A;  4NSQ A;  1K4J A;  1GHE A;  4PSX A;  1XMT A;  5AG5 A;  2Q4V A;  3BJ7 A;  3G8W A;  5IV0 A;  4MFQ A;  3S6F A;  4KSF A;  4L89 A;  4MFL A;  1QSR A;  4Y49 C;  3TFY A;  4UWJ A;  4KOT A;  2VEZ A;  4UFX A;  3W6S A;  4KS9 A;  2Z3L A;  3TTH A;  1YVO A;  2P6F A;  2C27 A;  2JEV A;  4H6U A;  2PRB A;  4KVM E;  3K9U A;  2PR1 A;  4B12 A;  4RI1 A;  1KUV A;  4CGP A;  1XEB A;  2VQY A;  3CXP A;  4RS2 A;  2BUE A;  4F6A A;  5G1Z A;  2PSW A;  3N7Z A;  2I79 A;  2J8N A;  2R98 A;  4MY0 A;  4UCP A;  5JQ4 A;  5A28 A;  4CGN A;  2PDO A;  4EVY A;  2ZW7 A;  4B10 A;  1QST A;  3BLN A;  5F46 A;  2WPW A;  1M4I A;  4HNX B;  2Z0Z A;  4C7H A;  2OZU A;  4DNC A;  5H84 A;  1YVK A;  2HQY A;  4ORF A;  4LX9 A;  4C2X A;  2OU2 A;  5G20 A;  1M1D A;  4B11 A;  4MI4 A;  3R9F A;  2O28 A;  4KOU A;  4AVA A;  3D2P A;  1R57 A;  5BWA B;  1S3Z A;  4L8A A;  4PSW A;  4CYP A;  2R8V A;  3FYN A;  1S7N A;  2B3V A;  3GY9 A;  2B5G B;  4ONU A;  1ZO0 A;  4B5P B;  4LUA A;  3T90 A;  1M4D A;  1MJB A;  4AG9 A;  2B58 A;  3F5B A;  1VKC A;  5KTC A;  2I00 A;  3FB3 A;  1RO5 A;  3LD2 A;  5F49 A;  4MJ8 A;  1BO4 A;  4KOR A;  2A4N A;  4KSA A;  4XNH B;  1OZP A;  2YNC C;  2Q7B A;  4M85 A;  3ZJ0 A;  2B4D A;  2G3T A;  2WSA A;  4CRY B;  2PR8 A;  4R3K A;  2VZY A;  3SXN A;  2EVN A;  1Z4E A;  3NE7 A;  2DXQ A;  4R9M A;  4JXQ A;  3G3S A;  4HNW B;  3W91 A;  4UBR A;  4CYO A;  2YNC A;  5F48 A;  3SXO A;  4A30 A;  2Z3K A;  3QB8 A;  2X7B A;  4A33 A;  4FD4 A;  4C68 A;  3E0K A;  4NXY A;  4GS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...