3D8PA

Crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
160
structure length
158
Chain Sequence
AINIIEYNRSYKEELIEFILSIQKNEFNIKIDRDDQPDLENIEHNYLNSGGQFWLAINNHQNIVGTIGLIRLDNNMSALKKMFVDKGYRNLKIGKKLLDKVIMTCKEQNIDGIYLGTIDKFISAQYFYSNNGFREIKRGDLPSSFPKLDNRFYYRNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords acetyltransferase of GNAT family
publication title Crystal structure of acetyltransferase of GNAT family (NP_373092.1) from STAPHYLOCOCCUS AUREUS MU50 at 2.20 A resolution
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
total genus 49
structure length 158
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3d8pA00
5C82A 4HNYB 3PZJA 2BL1A 2P6EA 1OZPA 3IGRA 2HQYA 4I49A 4MY0A 4CS0B 4CAVA 1KUVA 1TIQA 2ZW7A 1KUXA 3R95A 4H6ZA 3I3GA 1Q2DA 5HH1A 3R1KA 5HMNA 2ZW6A 1I12A 1P4NA 1IB1E 4YRHA 3EY5A 4MY3A 2A4NA 5JPHA 3B8GA 4ONUA 4BMHA 1J4JA 1Y7RA 2ZPAA 2JDDA 3P2HA 1S5KA 1QSRA 2EUIA 4QC6A 4KUBA 3OWCA 4PSXA 2P6FA 2CNTA 1XE4A 4EVYA 3FXTA 4L89A 1PU9A 2VXKA 3IWGA 4OAEA 1MK4A 3KKWA 1M4DA 4NSQA 1UFHA 5F46A 4H6UA 1P0HA 3EC4A 3SHPA 2VI7A 4JJXA 3W6XA 2Y0MA 3DSBA 2BEIA 3D2PA 2ATRA 4K30A 4KZTA 2RC4A 4XNHC 1S7FA 2HUZA 1BOBA 2VQYA 5F48A 2X7BA 2R98A 1B87A 1NMTA 2FXFA 3W6SA 1Z9UA 4KOYA 2P6GA 2G3AA 3FIXA 4RS2A 3TO9A 1Z4RA 2G0BA 4KOTA 2G3TA 1YVKA 4B5PB 1B6BA 4KVXA 4CAWA 4ORFA 3G3SA 3D2MA 3D8PA 2P0WA 4AVAA 3CXPA 1XEBA 4FD5A 3S6FA 3G8WA 3TOBA 4XPLA 4PV6A 2OZHA 2OB0A 3R9FA 2Z10A 4CAXA 2PRBA 4KLVA 4XNHB 5C88A 1I21A 4KOXA 5DWNA 4E0AA 3T90A 2F5IA 5EC4A 5IV0A 2FS5A 2FT0A 2FIAA 1Y9WA 3LODA 4KOWA 5IX3A 2DXQA 4JXQA 1SQHA 1V0CA 1KZFA 2FSRA 4FD6A 1LRZA 3D3SA 1M1DA 4MJ8A 3FRMA 1MJBA 5DWMA 2PR8A 2VZZA 4JWPA 2WPWA 1IYLA 2Z0ZA 2R1IA 4UWJA 5J8FA 4XPDC 4NEXA 5KTAA 4MBUA 4KORA 2Q44A 2PDOA 4KVOE 3TO6A 5IB0A 1YGHA 3I9SA 3TT2A 1BO4A 4UWIA 4OADA 4U9YA 4PSWA 4CRZB 4DNCA 3GKRA 4UA3A 1CM0A 2J8MA 1Y9KA 1IICA 4QVTA 2QIRA 1S60A 3S6GA 4F0YA 4AG7A 2B4DA 4JD6A 3LD2A 5F47A 2IL4A 4YFJA 2BUEA 3TOAA 2O28A 1WWZA 1XF8A 4NXYA 2JLMA 4XPDB 3TTHA 1Z4EA 2CNSA 2D4OA 2ZW4A 4KOUA 5FVJA 3S6HA 2QMLA 2Q4YA 2Z11A 4MHDA 4ZBGA 1RO5A 1IIDA 3FYNA 4HKFA 2B58A 5F49A 4AVCA 2OZGA 4HNXB 2PR1A 1YREA 4E2AA 4NF1A 3ZZIA 3CXSA 2R7HA 2REEA 4LUAA 2ARHA 1R57A 4U9ZA 3QAHA 3VWEA 3RYOA 1NE9A 2C27A 3T9YA 4R3LA 1QSNA 3F8KA 4Y49C 2D4PA 1S7NA 4KVME 3V8IA 4KUAA 4B5PA 4LX9A 5JQ4A 2H5MA 5I0CA 3F0AA 3S6KA 1MJAA 3EXNA 3TE4A 4M3SA 4U5YA 1M4IA 4QB9A 1M44A 1YX0A 3WR7A 4R3KA 5CNPA 3NE7A 4R57A 2B5GB 1ON0A 5J8CA 4F6AA 1YVOA 3TO7A 4MI4A 4HNWB 1XIXA 2GIVA 2Q04A 4NCZA 3R9EA 2BSWA 4II9A 3EFAA 4GS4A 3DDDA 3N7ZA 3R9GA 2FE7A 3K9UA 1U6MA 4RI1A 1XMTA 2QECA 4R87A 5KTCA 2B4BA 3BJ8A 4XPKA 2VEZA 1QSMA 1QSOA 4QBJA 3MGDA 1I1DA 3BJ7A 1YK3A 3E0KA 4CRYB 2CNMA 1Q2CA 2PSWA 4KOVA 1QSTA 4UBRA 3JUWA 2HV2A 4OLLA 4AVBA 2ZXVA 3R96A 1FY7A 1S7LA 2VZYA 1PUAA 5H84A 2R8VA 3F5BA 1VHSA 2B3UA 4H89A 3PGPA 5KTDA 3PP9A 3EO4A 1WK4A 2J8NA 2VBQA 2Q0YA 2NMTA 3P2FA 2AE6A 2REFA 1IYKA 2B4DB 3SXNA 3DNSA 2OH1A 3GYAA 4R9MA 2KCWA 2PC1A 4L8AA 1RXTA 2I00A 2AJ6A 4B5OA 2PQ8A 4KLWA 3QB8A 1VKCA 1NSLA 3SXOA 2GE3A 2OZUA 1L0CA 2I79A 3CXQA 4IF5A 2Q4VA 3GY9A 1YLEA 3DR6A 5ISVA 1KUYA 4M85A 4E8OA 1M4GA 4FD7A 2FIWA 5E96A 3UY5A 3H4QA 2Q7BA 2B3VA 2FCKA 5EBVA 1MJ9A 4FD4A 4QUSA 4AG9A 3JVNA 1N71A 1CJWA 3TFYA 4JXRA 4PK2A 5H86A 1S3ZA 3DR8A 2J8RA 3VWDA 4X5KA 4YGOA 4AB7A 2GANA 4J3GA 3W91A 2FL4A 2B5GA 2OU2A 2WPXA 3FBUA 2JEVA 5GCNA 3ZJ0A 1Q2YA 3C26A 2K5TA 4KOSA 3FB3A 1GHEA 4Y49B 1S7KA 2CY2A 4IUSA 2JDCA 1YR0A 3BLNA 4PK3A 2EVNA 3FNCA 3TCVA 2ZW5A 4JLYA 1K4JA
chains in the Genus database with same CATH superfamily
4MCPA 5C82A 4HNYB 2ANPA 2PJCA 5JGFA 3PZJA 3PBBA 1GYTA 2BL1A 4X8IA 2P6EA 1CPXA 1BPNA 1OZPA 3IGRA 3ISXA 3D4UA 1F57A 4O23A 4B6ZA 2HQYA 4I49A 4MY0A 4CS0B 3QAYA 5G22A 1KUVA 4CAVA 2Q4ZA 1TIQA 2ZW7A 1KUXA 2WZNA 3CPXA 4M6HA 3R95A 4H6ZA 3KR5A 3TX8A 1BPMA 3I3GA 1Q2DA 5HH1A 3SI0A 1Z5RA 3R1KA 5HMNA 1Z2LA 2ZW6A 1I12A 1P4NA 1IB1E 4YRHA 2V8GA 4A39A 3EY5A 4MY3A 2A4NA 5JPHA 5CPAA 3B8GA 2Q7SA 4ONUA 4BMHA 4B10A 1J4JA 4JZ0A 1Y7RA 2ZPAA 1XJOA 2JDDA 4WJBA 4BINA 3PB7X 5IB9A 5JM6A 3LWUA 3FF3A 3JRUA 3P2HA 3NA6A 3PRTA 4PQAA 4UEZA 1S5KA 1QSRA 2EUIA 1ZG8A 2C1CA 4QC6A 4KUBA 4A2ZA 3OWCA 4OIWA 1ZO0A 2DPSA 5AG5A 1BAVA 3NE8A 4PSXA 2HB6A 4GXHA 2P6FA 1TF8A 2C6PA 1IOIA 1VGYA 2CNTA 3BI0A 5HXDA 4NFRA 5D8NA 3CPAA 5G1ZA 1XE4A 4EVYA 4OP4A 2BO9A 3FXTA 4L89A 3FX6A 1PU9A 2Q43A 4ZX8A 2VXKA 2WUUA 3IWGA 4OAEA 4PPZA 1ARMA 1MK4A 1PYTB 2QJ8A 3KKWA 1Y7EA 3RNZA 1M4DA 6CPAA 4ZGYB 4NSQA 3SJXA 3K2KA 4MHPA 1UFHA 5F46A 4MFPA 1AMPA 1KWMA 3HUVA 1P0HA 4H6UA 1LFWA 4W9YA 3EC4A 4ZX9A 3SHPA 4MHNA 2VI7A 3LMSA 4JJXA 2Y0MA 3W6XA 3DSBA 4A94A 4NGSA 2BEIA 1OBRA 4MHZA 3S9MA 3D2PA 1XRYA 2ATRA 4K30A 1CP7A 2RC4A 4KZTA 2ABZA 5J8FA 4XNHC 1S7FA 2HUZA 1BLLE 1BOBA 2VQYA 4G1PA 4GM5A 1ZLIA 4MRIA 1R43A 5F48A 2X7BA 2R98A 5CBMA 2PJ8A 1B87A 1NMTA 1QQ9A 2FXFA 2YNCC 2Z3OA 1YQEA 3B35A 1Z9UA 3W6SA 4A31A 5A28A 5LRKA 4KOYA 2P6GA 2G3AA 2AFMA 1IU8A 3FIXA 1YW4A 4RS2A 2QVPA 3TO9A 1Z4RA 4ZY2A 4DJLA 4RUHA 3D7GA 2XEJA 2G0BA 5LYDA 4KOTA 2G3TA 2PJ2A 1YVKA 4B5PB 3A9LA 3FJUA 3B7IA 5G20A 4DYOA 1B6BA 2AFZA 4DUKA 4KVXA 4MHYA 3PFOA 2GLJA 4UCNA 4CAWA 3S9NA 5AGEA 2OR4A 4MFJA 4A37A 4ORFA 4B14A 1ARLA 2POKA 4ONWA 3G3SA 3D2MA 4UCPA 3SJFA 3D8PA 2P0WA 4AVAA 4F8ZA 2ZEFA 1XEBA 3CXPA 4FBEA 4FD5A 3S6FA 3G8WA 4R6TA 3TOBA 4XPLA 4PV6A 1NSAA 1HEEA 4P44A 2OZHA 2OB0A 3R9FA 2RB7A 4UCMA 2Z10A 4CYOA 2AFOA 4CAXA 2PRBA 1HDUA 4KLVA 4XNHB 3SI1A 5C88A 1I21A 5JH9A 4OC0A 2PVWA 3PEIA 2ZEPA 4KOXA 5DWNA 4E0AA 3T90A 3VH9A 2F5IA 5AG6A 5EC4A 3FH4A 5IV0A 2FS5A 2FT0A 5HVGA 4CGOA 2FIAA 4P6YA 1Y9WA 3LODA 4KOWA 4UFVA 2OOTA 4P4DA 1LOKA 5IX3A 4H2KA 4Q38A 1FT7A 1YSJA 4IK2A 4NGPA 1ZLHA 2DXQA 4JXQA 1SQHA 5K8MA 3CDXA 1Y0YA 2VL1A 1V0CA 4CPAA 1KZFA 2FSRA 2PCUA 3B3WA 4FD6A 1LRZA 1X12A 2C6GA 2PJ4A 3D3SA 1EE3P 1VHEA 1AUGA 1M1DA 4MJ8A 3FRMA 3H8EA 4CGNA 1MJBA 5DWMA 4MCSA 2PR8A 2VZZA 4JWPA 3KQZA 2WPWA 1IYLA 2IJZA 2Z0ZA 4YU9A 2DPTA 2R1IA 4UWJA 5F09A 3IO1A 4XPDC 4A95A 4AXVA 4NEXA 2O4HA 4MBUA 5KTAA 4KORA 2Q44A 2PDOA 4KVOE 2AFWA 4CYPA 4NGTA 3TO6A 4FAIA 3KI9A 5IB0A 2DEAA 1YGHA 4ZY1A 4B13A 3I9SA 3TT2A 1CBXA 5G21A 5BWAB 1BO4A 5AG7A 2YNEA 3BHXA 3SJEA 4A33A 4UWIA 4OADA 4U9YA 3B2YA 4PSWA 3KHXA 4CRZB 4DNCA 3GKRA 4UA3A 1CM0A 2J8MA 1Y9KA 4P4FA 4C68A 1IICA 1HDQA 4LQGA 4P45A 4C2ZA 5AG4A 4QVTA 2QIRA 1S60A 4BBHA 2AFSA 3S6GA 4F0YA 2YNDA 4CGMA 4AG7A 2B4DA 4JD6A 2GFQA 3LD2A 2C6CA 5F47A 4F9VA 4F9UA 2NYQA 2IL4A 3RO0A 3T8WA 4MFZA 4YFJA 2BUEA 3IFEA 4IAVA 2ZELA 4CGPA 3TOAA 5DS0A 3IU2A 4ZYQA 2O28A 1WWZA 1XF8A 1CG2A 5K8PA 4KSIA 2JLMA 4NXYA 4XPDB 3TTHA 1Z4EA 2CNSA 2D4OA 3GIUA 4FWUA 2ZW4A 4KOUA 5FVJA 3S6HA 2CXAA 2QMLA 2Q51A 2Q4YA 1CPSA 2Z11A 5THWA 2NSMA 1YLOA 4UIAA 4MHDA 4ZBGA 4CAEA 1RO5A 1LANA 2ZEGA 3IIBA 2ZEHA 4PXCA 3DLJA 1IIDA 3N5FA 3FYNA 4R8FA 3IWEA 2EK8A 1TKFA 2FVGA 2Z3PA 4HKFA 4OMEA 2B58A 5F49A 4AVCA 4OC2A 2PJAA 1LAPA 2OZGA 4HNXB 1IGBA 2PR1A 1YREA 4P4BA 2PJ0A 2V8DA 4PXEA 4E2AA 1ZG7A 3RZAA 2Z3NA 3D67A 1VHOA 4NF1A 3ZZIA 2PJ7A 3CXSA 2R7HA 2REEA 4LUAA 1Z8WA 2ARHA 1R57A 2ZEDA 3RAMA 4ZI6A 4U9ZA 3WC6A 3QAHA 3VWEA 3RYOA 2WSAA 2ZOFA 1NE9A 4UFWA 2C27A 4C7HA 3T9YA 4R3LA 4F0XA 1QSNA 3F8KA 4Y49C 1Y0RA 1S7NA 2D4PA 4KVME 1TKJA 3V8IA 4KUAA 4B5PA 2CF4A 4LX9A 3BXMA 2PJ5A 1Z8XA 2H5MA 5JQ4A 1XBUA 5I0CA 1ELLP 2XEGA 3RBUA 3PB4X 2HC9A 3F0AA 4MXUA 3S6KA 4NGNA 1UWYA 1PCAA 1MJAA 2CTBA 3EXNA 1M4LA 3D7DA 2V8HA 3TE4A 2YGWA 4M3SA 3SI2A 3GB0A 1IY7A 4U5YA 1M4IA 2ZEEA 3I1UA 4QB9A 1M44A 3IEHA 4M6GA 2JBKA 1YX0A 5LRGA 4A30A 1ZG9A 4Q36A 1Z8TA 2PJ3A 1A2ZA 4CYNA 3WR7A 2ZOGA 2EBJA 4R3KA 5CNPA 3NE7A 1XMBA 4R57A 3KHZA 3WT4A 2F7VA 4P4EA 2B5GB 1ON0A 5J8CA 2AFUA 1YVOA 2PIYA 3TO7A 4F6AA 4PXBA 3IWWA 2YNCA 4NGMA 4MI4A 4ZY0A 2EWBA 4C2YA 4HNWB 3VATA 1DTDA 2V77A 4MFKA 1XIXA 4TWEA 2GIVA 2EK9A 1X10A 2Q04A 4OIDA 4NCZA 3R9EA 1FNOA 2BSWA 2ZW5A 3IU1A 3EFAA 4II9A 2BOAA 1LCPA 4GS4A 2PE3A 1TF9A 3DDDA 1F2OA 3N7ZA 4PXDA 8CPAA 3R9GA 2FE7A 3K9UA 2WYRA 1U6MA 4A38A 3GUXA 4RI1A 1XMTA 5HVHA 2JBJA 2ODFA 3PB9X 4UEFA 1XFOA 2QECA 4HPSA 4R87A 2PJBA 5J1QA 4EWTA 3FEDA 3H8FA 3H5ZA 5KTCA 2B4BA 1XOVA 3BJ8A 3B3TA 4XPKA 4MMOA 5LYIA 2GU2A 4MFQA 2VEZA 1QSMA 4OC4A 1QSOA 2DF5A 4CGLA 4QBJA 1Z8LA 4K3NA 2G9DA 4R7MA 3MGDA 1I1DA 4Z65A 3BJ7A 1YK3A 3V7ZA 3E0KA 4NGRA 4CRYB 2CNMA 1Q2CA 2PSWA 3ISZA 4KOVA 4TNUA 1QSTA 4UBRA 2JEWA 3JUWA 2HV2A 2EO8A 3IJ3A 4OLLA 4AVBA 2ZXVA 3R96A 1FY7A 1S7LA 4KSFA 3KASA 1QMUA 2VZYA 1PUAA 2F8HA 2PJ9A 3QNVA 1YW6A 2BCOA 2QYVA 5H84A 2Z3LA 2IMOA 4X3RA 5K8OA 2R8VA 2ZENA 3F5BA 1VHSA 4OC1A 4A32A 4MCQA 2B3UA 5K8NA 4H89A 3PGPA 2CTCA 3KQXA 4KSAA 3B3CA 5KTDA 3PP9A 3EO4A 1VIXA 2AFXA 2I3CA 2PJ6A 4CAFA 3WABA 5HVFA 3PB6X 1WK4A 3SJGA 2V8VA 2J8NA 2J9AA 4MCRA 5EMIA 1AYEA 2VBQA 3D68A 2Q0YA 1TXRA 2NMTA 3P2FA 2AE6A 2O53A 1R3NA 2REFA 3NH4A 1IYKA 2B4DB 3SXNA 1LAMA 3DNSA 4P4JA 2PIZA 2OH1A 3GYAA 4R9MA 1JQGA 2KCWA 2PC1A 4NJQA 3FVLA 4OKOA 3B3VA 4L8AA 1RXTA 3V38A 2XEFA 3D7HA 2I00A 4EFDA 2AJ6A 4B5OA 2PQ8A 3KR4A 3B3SA 3QB8A 1VKCA 4KLWA 4P4IA 3NH8A 1NSLA 3SXOA 2GE3A 2OZUA 1L0CA 2I79A 3CXQA 4MFLA 3MRUA 4FUUA 4IF5A 2ZEMA 2Q4VA 3IC1A 3GY9A 1YLEA 3DR6A 3L2NA 5ELYA 5ISVA 1KUYA 4M85A 3HLPA 4E8OA 4IHMA 1M4GA 4JYWA 4FD7A 1F2PA 2FIWA 4P10A 1CX8A 5E96A 3FECA 3H4QA 2ZEOA 3BI1A 4OC3A 3UY5A 3WC5A 2Q7BA 2B3VA 2PVVA 2FCKA 3VARA 3H8GA 4RN7A 5EBVA 1IOFA 1MJ9A 3D7FA 4FD4A 4QUSA 4AG9A 5LYFA 2XEIA 3JVNA 3WC7A 1N71A 3PB8X 3FEEA 4EMEA 4NJRA 1CJWA 4KS9A 4C2XA 1DE4C 3TFYA 4JXRA 4PK2A 5LRJA 2Z3KA 4BD9A 4B11A 1TKHA 5H86A 1S3ZA 3DR8A 2J8RA 2GLFA 3VWDA 4X5KA 4YGOA 4UF4A 4AB7A 4OC5A 2IQ6A 3GLJA 3K9TA 4UFXA 2GANA 4J3GA 3W91A 2CIJA 2FL4A 3KZWA 3CT9A 5D29A 2B5GA 2OU2A 3D66A 2WPXA 1Q7LA 3FBUA 7CPAA 4LQ6A 3PBEA 2JEVA 5GCNA 3FMCA 1Q2YA 3C26A 4WWVA 3ZJ0A 5LYLA 2K5TA 3DGVA 4KOSA 1CP6A 2RFHA 4NGQA 3FB3A 1GHEA 1H8LA 4Q7AA 4Y49B 4B12A 1S7KA 2CY2A 4UIBA 3JTKA 3KGQA 4IUSA 2JDCA 4R76A 4C7IA 2Z3MA 3TC8A 3PFEA 1YR0A 3BLNA 2GREA 2PRQA 2PJ1A 5A27A 4UEEA 3LACA 4M6IA 3CZXA 3MN8A 4PK3A 3KL9A 4YWYA 1RTQA 3NFZA 2EVNA 1ELMP 3NH5A 3FNCA 3TCVA 3S9LA 4X2TA 1JWQA 4CYQA 1YMEA 5I4MA 4JLYA 1K4JA
chains in the Genus database with same CATH topology
5C82A 4HNYB 3PZJA 2BL1A 2P6EA 1OZPA 3IGRA 2HQYA 4I49A 4MY0A 4CS0B 5G22A 1KUVA 4CAVA 1TIQA 2ZW7A 1KUXA 3R95A 4H6ZA 3I3GA 1Q2DA 5HH1A 3R1KA 5HMNA 2ZW6A 1I12A 1P4NA 1IB1E 4YRHA 3EY5A 4MY3A 2A4NA 5JPHA 3B8GA 4ONUA 4BMHA 4B10A 1J4JA 1Y7RA 2ZPAA 2JDDA 3P2HA 1S5KA 1QSRA 2EUIA 4QC6A 4KUBA 4A2ZA 3OWCA 1ZO0A 2DPSA 5AG5A 4PSXA 2P6FA 2CNTA 5G1ZA 1XE4A 4EVYA 3FXTA 4L89A 1PU9A 2VXKA 2WUUA 3IWGA 4OAEA 1MK4A 3KKWA 1M4DA 4ZGYB 4NSQA 1UFHA 5F46A 4MFPA 4H6UA 1P0HA 3EC4A 3SHPA 2VI7A 4JJXA 3W6XA 2Y0MA 3DSBA 2BEIA 3D2PA 2ATRA 4K30A 4KZTA 2RC4A 4XNHC 1S7FA 2HUZA 1BOBA 2VQYA 5F48A 2X7BA 2R98A 2Z3OA 1B87A 1NMTA 2FXFA 2YNCC 4A31A 3W6SA 1Z9UA 5A28A 4KOYA 2P6GA 2G3AA 3FIXA 4RS2A 3TO9A 1Z4RA 2G0BA 4KOTA 2G3TA 1YVKA 4B5PB 3A9LA 5G20A 1B6BA 4KVXA 4UCNA 4CAWA 5AGEA 4MFJA 4ORFA 4B14A 4UCPA 3G3SA 3D2MA 3D8PA 2P0WA 4AVAA 3CXPA 1XEBA 4FD5A 3S6FA 3G8WA 3TOBA 4XPLA 4PV6A 2OZHA 2OB0A 3R9FA 4UCMA 2Z10A 4CYOA 4CAXA 2PRBA 4KLVA 4XNHB 5C88A 1I21A 4KOXA 5DWNA 4E0AA 3T90A 2F5IA 5AG6A 5EC4A 5IV0A 2FS5A 2FT0A 4CGOA 2FIAA 1Y9WA 3LODA 4KOWA 4UFVA 5IX3A 4Q38A 2DXQA 4JXQA 1SQHA 1V0CA 1KZFA 2FSRA 4FD6A 1LRZA 3D3SA 1M1DA 4MJ8A 3FRMA 4CGNA 1MJBA 5DWMA 2PR8A 2VZZA 4JWPA 2WPWA 1IYLA 2Z0ZA 2DPTA 2R1IA 4UWJA 5J8FA 4XPDC 4A95A 4NEXA 5KTAA 4MBUA 4KORA 2Q44A 2PDOA 4KVOE 4CYPA 3TO6A 5IB0A 1YGHA 4B13A 3I9SA 3TT2A 5G21A 5BWAB 1BO4A 5AG7A 2YNEA 4A33A 4UWIA 4OADA 4U9YA 4PSWA 4CRZB 4DNCA 3GKRA 4UA3A 1CM0A 2J8MA 1Y9KA 4C68A 1IICA 4C2ZA 5AG4A 4QVTA 2QIRA 1S60A 4BBHA 3S6GA 4F0YA 2YNDA 4CGMA 4AG7A 2B4DA 4JD6A 3LD2A 5F47A 2IL4A 4MFZA 4YFJA 2BUEA 4CGPA 3TOAA 3IU2A 2O28A 1WWZA 1XF8A 4NXYA 2JLMA 4XPDB 3TTHA 1Z4EA 2CNSA 2D4OA 2ZW4A 4KOUA 5FVJA 3S6HA 2CXAA 2QMLA 2Q4YA 2Z11A 4CAEA 4MHDA 4ZBGA 1RO5A 1IIDA 3FYNA 3IWEA 4HKFA 2Z3PA 2B58A 5F49A 4AVCA 2OZGA 4HNXB 2PR1A 1YREA 4E2AA 2Z3NA 4NF1A 3ZZIA 3CXSA 2R7HA 2REEA 4LUAA 2ARHA 1R57A 4U9ZA 3QAHA 3VWEA 3RYOA 2WSAA 1NE9A 4UFWA 2C27A 4C7HA 3T9YA 4R3LA 4F0XA 1QSNA 3F8KA 4Y49C 2D4PA 1S7NA 4KVME 3V8IA 4KUAA 4B5PA 4LX9A 5JQ4A 2H5MA 5I0CA 3F0AA 3S6KA 1MJAA 3EXNA 3TE4A 2YGWA 4M3SA 4U5YA 1M4IA 4QB9A 1M44A 1YX0A 4A30A 4Q36A 4CYNA 3WR7A 4R3KA 5CNPA 3NE7A 4R57A 2B5GB 1ON0A 5J8CA 4F6AA 1YVOA 3TO7A 2YNCA 4MI4A 4C2YA 4HNWB 4MFKA 1XIXA 2GIVA 2Q04A 4NCZA 3R9EA 2BSWA 3IU1A 4II9A 3EFAA 4GS4A 3DDDA 3N7ZA 3R9GA 2FE7A 3K9UA 1U6MA 4RI1A 1XMTA 2QECA 4R87A 3H5ZA 5KTCA 2B4BA 3BJ8A 4XPKA 4MFQA 2VEZA 1QSMA 1QSOA 4CGLA 4QBJA 3MGDA 1I1DA 3BJ7A 1YK3A 3E0KA 4CRYB 2CNMA 1Q2CA 2PSWA 4KOVA 1QSTA 4UBRA 3JUWA 2HV2A 4OLLA 4AVBA 2ZXVA 3R96A 1FY7A 1S7LA 4KSFA 2VZYA 1PUAA 5H84A 2Z3LA 2R8VA 3F5BA 1VHSA 4A32A 2B3UA 4H89A 3PGPA 4KSAA 5KTDA 3PP9A 3EO4A 4CAFA 1WK4A 2J8NA 2VBQA 2Q0YA 2NMTA 3P2FA 2AE6A 2REFA 1IYKA 2B4DB 3SXNA 3DNSA 2OH1A 3GYAA 4R9MA 2KCWA 2PC1A 4L8AA 1RXTA 2I00A 2AJ6A 4B5OA 2PQ8A 4KLWA 3QB8A 1VKCA 1NSLA 3SXOA 2GE3A 2OZUA 1L0CA 2I79A 3CXQA 4MFLA 4IF5A 2Q4VA 3GY9A 1YLEA 3DR6A 5ISVA 1KUYA 4M85A 4E8OA 1M4GA 4FD7A 2FIWA 5E96A 3UY5A 3H4QA 2Q7BA 2B3VA 2FCKA 5EBVA 1MJ9A 4FD4A 4QUSA 4AG9A 3JVNA 1N71A 1CJWA 4KS9A 4C2XA 3TFYA 4JXRA 4PK2A 2Z3KA 4B11A 5H86A 1S3ZA 3DR8A 2J8RA 3VWDA 4X5KA 4YGOA 4AB7A 4UFXA 2GANA 4J3GA 3W91A 2FL4A 2B5GA 2OU2A 2WPXA 3FBUA 2JEVA 5GCNA 3ZJ0A 1Q2YA 3C26A 2K5TA 4KOSA 3FB3A 1GHEA 4Y49B 4B12A 1S7KA 2CY2A 3JTKA 4IUSA 2JDCA 4C7IA 2Z3MA 1YR0A 3BLNA 5A27A 4PK3A 2EVNA 3FNCA 3TCVA 4CYQA 2ZW5A 4JLYA 1K4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C82 A;  4HNY B;  3PZJ A;  2BL1 A;  2P6E A;  1OZP A;  3IGR A;  2HQY A;  4I49 A;  4MY0 A;  4CS0 B;  4CAV A;  1KUV A;  1TIQ A;  2ZW7 A;  1KUX A;  3R95 A;  4H6Z A;  3I3G A;  1Q2D A;  5HH1 A;  3R1K A;  5HMN A;  2ZW6 A;  1I12 A;  1P4N A;  1IB1 E;  4YRH A;  3EY5 A;  4MY3 A;  2A4N A;  5JPH A;  3B8G A;  4ONU A;  4BMH A;  1J4J A;  1Y7R A;  2ZPA A;  2JDD A;  3P2H A;  1S5K A;  1QSR A;  2EUI A;  4QC6 A;  4KUB A;  3OWC A;  4PSX A;  2P6F A;  2CNT A;  1XE4 A;  4EVY A;  3FXT A;  4L89 A;  1PU9 A;  2VXK A;  3IWG A;  4OAE A;  1MK4 A;  3KKW A;  1M4D A;  4NSQ A;  1UFH A;  5F46 A;  4H6U A;  1P0H A;  3EC4 A;  3SHP A;  2VI7 A;  4JJX A;  3W6X A;  2Y0M A;  3DSB A;  2BEI A;  3D2P A;  2ATR A;  4K30 A;  4KZT A;  2RC4 A;  4XNH C;  1S7F A;  2HUZ A;  1BOB A;  2VQY A;  5F48 A;  2X7B A;  2R98 A;  1B87 A;  1NMT A;  2FXF A;  3W6S A;  1Z9U A;  4KOY A;  2P6G A;  2G3A A;  3FIX A;  4RS2 A;  3TO9 A;  1Z4R A;  2G0B A;  4KOT A;  2G3T A;  1YVK A;  4B5P B;  1B6B A;  4KVX A;  4CAW A;  4ORF A;  3G3S A;  3D2M A;  3D8P A;  2P0W A;  4AVA A;  3CXP A;  1XEB A;  4FD5 A;  3S6F A;  3G8W A;  3TOB A;  4XPL A;  4PV6 A;  2OZH A;  2OB0 A;  3R9F A;  2Z10 A;  4CAX A;  2PRB A;  4KLV A;  4XNH B;  5C88 A;  1I21 A;  4KOX A;  5DWN A;  4E0A A;  3T90 A;  2F5I A;  5EC4 A;  5IV0 A;  2FS5 A;  2FT0 A;  2FIA A;  1Y9W A;  3LOD A;  4KOW A;  5IX3 A;  2DXQ A;  4JXQ A;  1SQH A;  1V0C A;  1KZF A;  2FSR A;  4FD6 A;  1LRZ A;  3D3S A;  1M1D A;  4MJ8 A;  3FRM A;  1MJB A;  5DWM A;  2PR8 A;  2VZZ A;  4JWP A;  2WPW A;  1IYL A;  2Z0Z A;  2R1I A;  4UWJ A;  5J8F A;  4XPD C;  4NEX A;  5KTA A;  4MBU A;  4KOR A;  2Q44 A;  2PDO A;  4KVO E;  3TO6 A;  5IB0 A;  1YGH A;  3I9S A;  3TT2 A;  1BO4 A;  4UWI A;  4OAD A;  4U9Y A;  4PSW A;  4CRZ B;  4DNC A;  3GKR A;  4UA3 A;  1CM0 A;  2J8M A;  1Y9K A;  1IIC A;  4QVT A;  2QIR A;  1S60 A;  3S6G A;  4F0Y A;  4AG7 A;  2B4D A;  4JD6 A;  3LD2 A;  5F47 A;  2IL4 A;  4YFJ A;  2BUE A;  3TOA A;  2O28 A;  1WWZ A;  1XF8 A;  4NXY A;  2JLM A;  4XPD B;  3TTH A;  1Z4E A;  2CNS A;  2D4O A;  2ZW4 A;  4KOU A;  5FVJ A;  3S6H A;  2QML A;  2Q4Y A;  2Z11 A;  4MHD A;  4ZBG A;  1RO5 A;  1IID A;  3FYN A;  4HKF A;  2B58 A;  5F49 A;  4AVC A;  2OZG A;  4HNX B;  2PR1 A;  1YRE A;  4E2A A;  4NF1 A;  3ZZI A;  3CXS A;  2R7H A;  2REE A;  4LUA A;  2ARH A;  1R57 A;  4U9Z A;  3QAH A;  3VWE A;  3RYO A;  1NE9 A;  2C27 A;  3T9Y A;  4R3L A;  1QSN A;  3F8K A;  4Y49 C;  2D4P A;  1S7N A;  4KVM E;  3V8I A;  4KUA A;  4B5P A;  4LX9 A;  5JQ4 A;  2H5M A;  5I0C A;  3F0A A;  3S6K A;  1MJA A;  3EXN A;  3TE4 A;  4M3S A;  4U5Y A;  1M4I A;  4QB9 A;  1M44 A;  1YX0 A;  3WR7 A;  4R3K A;  5CNP A;  3NE7 A;  4R57 A;  2B5G B;  1ON0 A;  5J8C A;  4F6A A;  1YVO A;  3TO7 A;  4MI4 A;  4HNW B;  1XIX A;  2GIV A;  2Q04 A;  4NCZ A;  3R9E A;  2BSW A;  4II9 A;  3EFA A;  4GS4 A;  3DDD A;  3N7Z A;  3R9G A;  2FE7 A;  3K9U A;  1U6M A;  4RI1 A;  1XMT A;  2QEC A;  4R87 A;  5KTC A;  2B4B A;  3BJ8 A;  4XPK A;  2VEZ A;  1QSM A;  1QSO A;  4QBJ A;  3MGD A;  1I1D A;  3BJ7 A;  1YK3 A;  3E0K A;  4CRY B;  2CNM A;  1Q2C A;  2PSW A;  4KOV A;  1QST A;  4UBR A;  3JUW A;  2HV2 A;  4OLL A;  4AVB A;  2ZXV A;  3R96 A;  1FY7 A;  1S7L A;  2VZY A;  1PUA A;  5H84 A;  2R8V A;  3F5B A;  1VHS A;  2B3U A;  4H89 A;  3PGP A;  5KTD A;  3PP9 A;  3EO4 A;  1WK4 A;  2J8N A;  2VBQ A;  2Q0Y A;  2NMT A;  3P2F A;  2AE6 A;  2REF A;  1IYK A;  2B4D B;  3SXN A;  3DNS A;  2OH1 A;  3GYA A;  4R9M A;  2KCW A;  2PC1 A;  4L8A A;  1RXT A;  2I00 A;  2AJ6 A;  4B5O A;  2PQ8 A;  4KLW A;  3QB8 A;  1VKC A;  1NSL A;  3SXO A;  2GE3 A;  2OZU A;  1L0C A;  2I79 A;  3CXQ A;  4IF5 A;  2Q4V A;  3GY9 A;  1YLE A;  3DR6 A;  5ISV A;  1KUY A;  4M85 A;  4E8O A;  1M4G A;  4FD7 A;  2FIW A;  5E96 A;  3UY5 A;  3H4Q A;  2Q7B A;  2B3V A;  2FCK A;  5EBV A;  1MJ9 A;  4FD4 A;  4QUS A;  4AG9 A;  3JVN A;  1N71 A;  1CJW A;  3TFY A;  4JXR A;  4PK2 A;  5H86 A;  1S3Z A;  3DR8 A;  2J8R A;  3VWD A;  4X5K A;  4YGO A;  4AB7 A;  2GAN A;  4J3G A;  3W91 A;  2FL4 A;  2B5G A;  2OU2 A;  2WPX A;  3FBU A;  2JEV A;  5GCN A;  3ZJ0 A;  1Q2Y A;  3C26 A;  2K5T A;  4KOS A;  3FB3 A;  1GHE A;  4Y49 B;  1S7K A;  2CY2 A;  4IUS A;  2JDC A;  1YR0 A;  3BLN A;  4PK3 A;  2EVN A;  3FNC A;  3TCV A;  2ZW5 A;  4JLY A;  1K4J A; 
#chains in the Genus database with same CATH topology
 4MCP A;  5C82 A;  4HNY B;  2ANP A;  2PJC A;  5JGF A;  3PZJ A;  3PBB A;  1GYT A;  2BL1 A;  4X8I A;  2P6E A;  1CPX A;  1BPN A;  1OZP A;  3IGR A;  3ISX A;  3D4U A;  1F57 A;  4O23 A;  4B6Z A;  2HQY A;  4I49 A;  4MY0 A;  4CS0 B;  3QAY A;  5G22 A;  1KUV A;  4CAV A;  2Q4Z A;  1TIQ A;  2ZW7 A;  1KUX A;  2WZN A;  3CPX A;  4M6H A;  3R95 A;  4H6Z A;  3KR5 A;  3TX8 A;  1BPM A;  3I3G A;  1Q2D A;  5HH1 A;  3SI0 A;  1Z5R A;  3R1K A;  5HMN A;  1Z2L A;  2ZW6 A;  1I12 A;  1P4N A;  1IB1 E;  4YRH A;  2V8G A;  4A39 A;  3EY5 A;  4MY3 A;  2A4N A;  5JPH A;  5CPA A;  3B8G A;  2Q7S A;  4ONU A;  4BMH A;  4B10 A;  1J4J A;  4JZ0 A;  1Y7R A;  2ZPA A;  1XJO A;  2JDD A;  4WJB A;  4BIN A;  3PB7 X;  5IB9 A;  5JM6 A;  3LWU A;  3FF3 A;  3JRU A;  3P2H A;  3NA6 A;  3PRT A;  4PQA A;  4UEZ A;  1S5K A;  1QSR A;  2EUI A;  1ZG8 A;  2C1C A;  4QC6 A;  4KUB A;  4A2Z A;  3OWC A;  4OIW A;  1ZO0 A;  2DPS A;  5AG5 A;  1BAV A;  3NE8 A;  4PSX A;  2HB6 A;  4GXH A;  2P6F A;  1TF8 A;  2C6P A;  1IOI A;  1VGY A;  2CNT A;  3BI0 A;  5HXD A;  4NFR A;  5D8N A;  3CPA A;  5G1Z A;  1XE4 A;  4EVY A;  4OP4 A;  2BO9 A;  3FXT A;  4L89 A;  3FX6 A;  1PU9 A;  2Q43 A;  4ZX8 A;  2VXK A;  2WUU A;  3IWG A;  4OAE A;  4PPZ A;  1ARM A;  1MK4 A;  1PYT B;  2QJ8 A;  3KKW A;  1Y7E A;  3RNZ A;  1M4D A;  6CPA A;  4ZGY B;  4NSQ A;  3SJX A;  3K2K A;  4MHP A;  1UFH A;  5F46 A;  4MFP A;  1AMP A;  1KWM A;  3HUV A;  1P0H A;  4H6U A;  1LFW A;  4W9Y A;  3EC4 A;  4ZX9 A;  3SHP A;  4MHN A;  2VI7 A;  3LMS A;  4JJX A;  2Y0M A;  3W6X A;  3DSB A;  4A94 A;  4NGS A;  2BEI A;  1OBR A;  4MHZ A;  3S9M A;  3D2P A;  1XRY A;  2ATR A;  4K30 A;  1CP7 A;  2RC4 A;  4KZT A;  2ABZ A;  5J8F A;  4XNH C;  1S7F A;  2HUZ A;  1BLL E;  1BOB A;  2VQY A;  4G1P A;  4GM5 A;  1ZLI A;  4MRI A;  1R43 A;  5F48 A;  2X7B A;  2R98 A;  5CBM A;  2PJ8 A;  1B87 A;  1NMT A;  1QQ9 A;  2FXF A;  2YNC C;  2Z3O A;  1YQE A;  3B35 A;  1Z9U A;  3W6S A;  4A31 A;  5A28 A;  5LRK A;  4KOY A;  2P6G A;  2G3A A;  2AFM A;  1IU8 A;  3FIX A;  1YW4 A;  4RS2 A;  2QVP A;  3TO9 A;  1Z4R A;  4ZY2 A;  4DJL A;  4RUH A;  3D7G A;  2XEJ A;  2G0B A;  5LYD A;  4KOT A;  2G3T A;  2PJ2 A;  1YVK A;  4B5P B;  3A9L A;  3FJU A;  3B7I A;  5G20 A;  4DYO A;  1B6B A;  2AFZ A;  4DUK A;  4KVX A;  4MHY A;  3PFO A;  2GLJ A;  4UCN A;  4CAW A;  3S9N A;  5AGE A;  2OR4 A;  4MFJ A;  4A37 A;  4ORF A;  4B14 A;  1ARL A;  2POK A;  4ONW A;  3G3S A;  3D2M A;  4UCP A;  3SJF A;  3D8P A;  2P0W A;  4AVA A;  4F8Z A;  2ZEF A;  1XEB A;  3CXP A;  4FBE A;  4FD5 A;  3S6F A;  3G8W A;  4R6T A;  3TOB A;  4XPL A;  4PV6 A;  1NSA A;  1HEE A;  4P44 A;  2OZH A;  2OB0 A;  3R9F A;  2RB7 A;  4UCM A;  2Z10 A;  4CYO A;  2AFO A;  4CAX A;  2PRB A;  1HDU A;  4KLV A;  4XNH B;  3SI1 A;  5C88 A;  1I21 A;  5JH9 A;  4OC0 A;  2PVW A;  3PEI A;  2ZEP A;  4KOX A;  5DWN A;  4E0A A;  3T90 A;  3VH9 A;  2F5I A;  5AG6 A;  5EC4 A;  3FH4 A;  5IV0 A;  2FS5 A;  2FT0 A;  5HVG A;  4CGO A;  2FIA A;  4P6Y A;  1Y9W A;  3LOD A;  4KOW A;  4UFV A;  2OOT A;  4P4D A;  1LOK A;  5IX3 A;  4H2K A;  4Q38 A;  1FT7 A;  1YSJ A;  4IK2 A;  4NGP A;  1ZLH A;  2DXQ A;  4JXQ A;  1SQH A;  5K8M A;  3CDX A;  1Y0Y A;  2VL1 A;  1V0C A;  4CPA A;  1KZF A;  2FSR A;  2PCU A;  3B3W A;  4FD6 A;  1LRZ A;  1X12 A;  2C6G A;  2PJ4 A;  3D3S A;  1EE3 P;  1VHE A;  1AUG A;  1M1D A;  4MJ8 A;  3FRM A;  3H8E A;  4CGN A;  1MJB A;  5DWM A;  4MCS A;  2PR8 A;  2VZZ A;  4JWP A;  3KQZ A;  2WPW A;  1IYL A;  2IJZ A;  2Z0Z A;  4YU9 A;  2DPT A;  2R1I A;  4UWJ A;  5F09 A;  3IO1 A;  4XPD C;  4A95 A;  4AXV A;  4NEX A;  2O4H A;  4MBU A;  5KTA A;  4KOR A;  2Q44 A;  2PDO A;  4KVO E;  2AFW A;  4CYP A;  4NGT A;  3TO6 A;  4FAI A;  3KI9 A;  5IB0 A;  2DEA A;  1YGH A;  4ZY1 A;  4B13 A;  3I9S A;  3TT2 A;  1CBX A;  5G21 A;  5BWA B;  1BO4 A;  5AG7 A;  2YNE A;  3BHX A;  3SJE A;  4A33 A;  4UWI A;  4OAD A;  4U9Y A;  3B2Y A;  4PSW A;  3KHX A;  4CRZ B;  4DNC A;  3GKR A;  4UA3 A;  1CM0 A;  2J8M A;  1Y9K A;  4P4F A;  4C68 A;  1IIC A;  1HDQ A;  4LQG A;  4P45 A;  4C2Z A;  5AG4 A;  4QVT A;  2QIR A;  1S60 A;  4BBH A;  2AFS A;  3S6G A;  4F0Y A;  2YND A;  4CGM A;  4AG7 A;  2B4D A;  4JD6 A;  2GFQ A;  3LD2 A;  2C6C A;  5F47 A;  4F9V A;  4F9U A;  2NYQ A;  2IL4 A;  3RO0 A;  3T8W A;  4MFZ A;  4YFJ A;  2BUE A;  3IFE A;  4IAV A;  2ZEL A;  4CGP A;  3TOA A;  5DS0 A;  3IU2 A;  4ZYQ A;  2O28 A;  1WWZ A;  1XF8 A;  1CG2 A;  5K8P A;  4KSI A;  2JLM A;  4NXY A;  4XPD B;  3TTH A;  1Z4E A;  2CNS A;  2D4O A;  3GIU A;  4FWU A;  2ZW4 A;  4KOU A;  5FVJ A;  3S6H A;  2CXA A;  2QML A;  2Q51 A;  2Q4Y A;  1CPS A;  2Z11 A;  5THW A;  2NSM A;  1YLO A;  4UIA A;  4MHD A;  4ZBG A;  4CAE A;  1RO5 A;  1LAN A;  2ZEG A;  3IIB A;  2ZEH A;  4PXC A;  3DLJ A;  1IID A;  3N5F A;  3FYN A;  4R8F A;  3IWE A;  2EK8 A;  1TKF A;  2FVG A;  2Z3P A;  4HKF A;  4OME A;  2B58 A;  5F49 A;  4AVC A;  4OC2 A;  2PJA A;  1LAP A;  2OZG A;  4HNX B;  1IGB A;  2PR1 A;  1YRE A;  4P4B A;  2PJ0 A;  2V8D A;  4PXE A;  4E2A A;  1ZG7 A;  3RZA A;  2Z3N A;  3D67 A;  1VHO A;  4NF1 A;  3ZZI A;  2PJ7 A;  3CXS A;  2R7H A;  2REE A;  4LUA A;  1Z8W A;  2ARH A;  1R57 A;  2ZED A;  3RAM A;  4ZI6 A;  4U9Z A;  3WC6 A;  3QAH A;  3VWE A;  3RYO A;  2WSA A;  2ZOF A;  1NE9 A;  4UFW A;  2C27 A;  4C7H A;  3T9Y A;  4R3L A;  4F0X A;  1QSN A;  3F8K A;  4Y49 C;  1Y0R A;  1S7N A;  2D4P A;  4KVM E;  1TKJ A;  3V8I A;  4KUA A;  4B5P A;  2CF4 A;  4LX9 A;  3BXM A;  2PJ5 A;  1Z8X A;  2H5M A;  5JQ4 A;  1XBU A;  5I0C A;  1ELL P;  2XEG A;  3RBU A;  3PB4 X;  2HC9 A;  3F0A A;  4MXU A;  3S6K A;  4NGN A;  1UWY A;  1PCA A;  1MJA A;  2CTB A;  3EXN A;  1M4L A;  3D7D A;  2V8H A;  3TE4 A;  2YGW A;  4M3S A;  3SI2 A;  3GB0 A;  1IY7 A;  4U5Y A;  1M4I A;  2ZEE A;  3I1U A;  4QB9 A;  1M44 A;  3IEH A;  4M6G A;  2JBK A;  1YX0 A;  5LRG A;  4A30 A;  1ZG9 A;  4Q36 A;  1Z8T A;  2PJ3 A;  1A2Z A;  4CYN A;  3WR7 A;  2ZOG A;  2EBJ A;  4R3K A;  5CNP A;  3NE7 A;  1XMB A;  4R57 A;  3KHZ A;  3WT4 A;  2F7V A;  4P4E A;  2B5G B;  1ON0 A;  5J8C A;  2AFU A;  1YVO A;  2PIY A;  3TO7 A;  4F6A A;  4PXB A;  3IWW A;  2YNC A;  4NGM A;  4MI4 A;  4ZY0 A;  2EWB A;  4C2Y A;  4HNW B;  3VAT A;  1DTD A;  2V77 A;  4MFK A;  1XIX A;  4TWE A;  2GIV A;  2EK9 A;  1X10 A;  2Q04 A;  4OID A;  4NCZ A;  3R9E A;  1FNO A;  2BSW A;  2ZW5 A;  3IU1 A;  3EFA A;  4II9 A;  2BOA A;  1LCP A;  4GS4 A;  2PE3 A;  1TF9 A;  3DDD A;  1F2O A;  3N7Z A;  4PXD A;  8CPA A;  3R9G A;  2FE7 A;  3K9U A;  2WYR A;  1U6M A;  4A38 A;  3GUX A;  4RI1 A;  1XMT A;  5HVH A;  2JBJ A;  2ODF A;  3PB9 X;  4UEF A;  1XFO A;  2QEC A;  4HPS A;  4R87 A;  2PJB A;  5J1Q A;  4EWT A;  3FED A;  3H8F A;  3H5Z A;  5KTC A;  2B4B A;  1XOV A;  3BJ8 A;  3B3T A;  4XPK A;  4MMO A;  5LYI A;  2GU2 A;  4MFQ A;  2VEZ A;  1QSM A;  4OC4 A;  1QSO A;  2DF5 A;  4CGL A;  4QBJ A;  1Z8L A;  4K3N A;  2G9D A;  4R7M A;  3MGD A;  1I1D A;  4Z65 A;  3BJ7 A;  1YK3 A;  3V7Z A;  3E0K A;  4NGR A;  4CRY B;  2CNM A;  1Q2C A;  2PSW A;  3ISZ A;  4KOV A;  4TNU A;  1QST A;  4UBR A;  2JEW A;  3JUW A;  2HV2 A;  2EO8 A;  3IJ3 A;  4OLL A;  4AVB A;  2ZXV A;  3R96 A;  1FY7 A;  1S7L A;  4KSF A;  3KAS A;  1QMU A;  2VZY A;  1PUA A;  2F8H A;  2PJ9 A;  3QNV A;  1YW6 A;  2BCO A;  2QYV A;  5H84 A;  2Z3L A;  2IMO A;  4X3R A;  5K8O A;  2R8V A;  2ZEN A;  3F5B A;  1VHS A;  4OC1 A;  4A32 A;  4MCQ A;  2B3U A;  5K8N A;  4H89 A;  3PGP A;  2CTC A;  3KQX A;  4KSA A;  3B3C A;  5KTD A;  3PP9 A;  3EO4 A;  1VIX A;  2AFX A;  2I3C A;  2PJ6 A;  4CAF A;  3WAB A;  5HVF A;  3PB6 X;  1WK4 A;  3SJG A;  2V8V A;  2J8N A;  2J9A A;  4MCR A;  5EMI A;  1AYE A;  2VBQ A;  3D68 A;  2Q0Y A;  1TXR A;  2NMT A;  3P2F A;  2AE6 A;  2O53 A;  1R3N A;  2REF A;  3NH4 A;  1IYK A;  2B4D B;  3SXN A;  1LAM A;  3DNS A;  4P4J A;  2PIZ A;  2OH1 A;  3GYA A;  4R9M A;  1JQG A;  2KCW A;  2PC1 A;  4NJQ A;  3FVL A;  4OKO A;  3B3V A;  4L8A A;  1RXT A;  3V38 A;  2XEF A;  3D7H A;  2I00 A;  4EFD A;  2AJ6 A;  4B5O A;  2PQ8 A;  3KR4 A;  3B3S A;  3QB8 A;  1VKC A;  4KLW A;  4P4I A;  3NH8 A;  1NSL A;  3SXO A;  2GE3 A;  2OZU A;  1L0C A;  2I79 A;  3CXQ A;  4MFL A;  3MRU A;  4FUU A;  4IF5 A;  2ZEM A;  2Q4V A;  3IC1 A;  3GY9 A;  1YLE A;  3DR6 A;  3L2N A;  5ELY A;  5ISV A;  1KUY A;  4M85 A;  3HLP A;  4E8O A;  4IHM A;  1M4G A;  4JYW A;  4FD7 A;  1F2P A;  2FIW A;  4P10 A;  1CX8 A;  5E96 A;  3FEC A;  3H4Q A;  2ZEO A;  3BI1 A;  4OC3 A;  3UY5 A;  3WC5 A;  2Q7B A;  2B3V A;  2PVV A;  2FCK A;  3VAR A;  3H8G A;  4RN7 A;  5EBV A;  1IOF A;  1MJ9 A;  3D7F A;  4FD4 A;  4QUS A;  4AG9 A;  5LYF A;  2XEI A;  3JVN A;  3WC7 A;  1N71 A;  3PB8 X;  3FEE A;  4EME A;  4NJR A;  1CJW A;  4KS9 A;  4C2X A;  1DE4 C;  3TFY A;  4JXR A;  4PK2 A;  5LRJ A;  2Z3K A;  4BD9 A;  4B11 A;  1TKH A;  5H86 A;  1S3Z A;  3DR8 A;  2J8R A;  2GLF A;  3VWD A;  4X5K A;  4YGO A;  4UF4 A;  4AB7 A;  4OC5 A;  2IQ6 A;  3GLJ A;  3K9T A;  4UFX A;  2GAN A;  4J3G A;  3W91 A;  2CIJ A;  2FL4 A;  3KZW A;  3CT9 A;  5D29 A;  2B5G A;  2OU2 A;  3D66 A;  2WPX A;  1Q7L A;  3FBU A;  7CPA A;  4LQ6 A;  3PBE A;  2JEV A;  5GCN A;  3FMC A;  1Q2Y A;  3C26 A;  4WWV A;  3ZJ0 A;  5LYL A;  2K5T A;  3DGV A;  4KOS A;  1CP6 A;  2RFH A;  4NGQ A;  3FB3 A;  1GHE A;  1H8L A;  4Q7A A;  4Y49 B;  4B12 A;  1S7K A;  2CY2 A;  4UIB A;  3JTK A;  3KGQ A;  4IUS A;  2JDC A;  4R76 A;  4C7I A;  2Z3M A;  3TC8 A;  3PFE A;  1YR0 A;  3BLN A;  2GRE A;  2PRQ A;  2PJ1 A;  5A27 A;  4UEE A;  3LAC A;  4M6I A;  3CZX A;  3MN8 A;  4PK3 A;  3KL9 A;  4YWY A;  1RTQ A;  3NFZ A;  2EVN A;  1ELM P;  3NH5 A;  3FNC A;  3TCV A;  3S9L A;  4X2T A;  1JWQ A;  4CYQ A;  1YME A;  5I4M A;  4JLY A;  1K4J A; 
#chains in the Genus database with same CATH homology
 5C82 A;  4HNY B;  3PZJ A;  2BL1 A;  2P6E A;  1OZP A;  3IGR A;  2HQY A;  4I49 A;  4MY0 A;  4CS0 B;  5G22 A;  1KUV A;  4CAV A;  1TIQ A;  2ZW7 A;  1KUX A;  3R95 A;  4H6Z A;  3I3G A;  1Q2D A;  5HH1 A;  3R1K A;  5HMN A;  2ZW6 A;  1I12 A;  1P4N A;  1IB1 E;  4YRH A;  3EY5 A;  4MY3 A;  2A4N A;  5JPH A;  3B8G A;  4ONU A;  4BMH A;  4B10 A;  1J4J A;  1Y7R A;  2ZPA A;  2JDD A;  3P2H A;  1S5K A;  1QSR A;  2EUI A;  4QC6 A;  4KUB A;  4A2Z A;  3OWC A;  1ZO0 A;  2DPS A;  5AG5 A;  4PSX A;  2P6F A;  2CNT A;  5G1Z A;  1XE4 A;  4EVY A;  3FXT A;  4L89 A;  1PU9 A;  2VXK A;  2WUU A;  3IWG A;  4OAE A;  1MK4 A;  3KKW A;  1M4D A;  4ZGY B;  4NSQ A;  1UFH A;  5F46 A;  4MFP A;  4H6U A;  1P0H A;  3EC4 A;  3SHP A;  2VI7 A;  4JJX A;  3W6X A;  2Y0M A;  3DSB A;  2BEI A;  3D2P A;  2ATR A;  4K30 A;  4KZT A;  2RC4 A;  4XNH C;  1S7F A;  2HUZ A;  1BOB A;  2VQY A;  5F48 A;  2X7B A;  2R98 A;  2Z3O A;  1B87 A;  1NMT A;  2FXF A;  2YNC C;  4A31 A;  3W6S A;  1Z9U A;  5A28 A;  4KOY A;  2P6G A;  2G3A A;  3FIX A;  4RS2 A;  3TO9 A;  1Z4R A;  2G0B A;  4KOT A;  2G3T A;  1YVK A;  4B5P B;  3A9L A;  5G20 A;  1B6B A;  4KVX A;  4UCN A;  4CAW A;  5AGE A;  4MFJ A;  4ORF A;  4B14 A;  4UCP A;  3G3S A;  3D2M A;  3D8P A;  2P0W A;  4AVA A;  3CXP A;  1XEB A;  4FD5 A;  3S6F A;  3G8W A;  3TOB A;  4XPL A;  4PV6 A;  2OZH A;  2OB0 A;  3R9F A;  4UCM A;  2Z10 A;  4CYO A;  4CAX A;  2PRB A;  4KLV A;  4XNH B;  5C88 A;  1I21 A;  4KOX A;  5DWN A;  4E0A A;  3T90 A;  2F5I A;  5AG6 A;  5EC4 A;  5IV0 A;  2FS5 A;  2FT0 A;  4CGO A;  2FIA A;  1Y9W A;  3LOD A;  4KOW A;  4UFV A;  5IX3 A;  4Q38 A;  2DXQ A;  4JXQ A;  1SQH A;  1V0C A;  1KZF A;  2FSR A;  4FD6 A;  1LRZ A;  3D3S A;  1M1D A;  4MJ8 A;  3FRM A;  4CGN A;  1MJB A;  5DWM A;  2PR8 A;  2VZZ A;  4JWP A;  2WPW A;  1IYL A;  2Z0Z A;  2DPT A;  2R1I A;  4UWJ A;  5J8F A;  4XPD C;  4A95 A;  4NEX A;  5KTA A;  4MBU A;  4KOR A;  2Q44 A;  2PDO A;  4KVO E;  4CYP A;  3TO6 A;  5IB0 A;  1YGH A;  4B13 A;  3I9S A;  3TT2 A;  5G21 A;  5BWA B;  1BO4 A;  5AG7 A;  2YNE A;  4A33 A;  4UWI A;  4OAD A;  4U9Y A;  4PSW A;  4CRZ B;  4DNC A;  3GKR A;  4UA3 A;  1CM0 A;  2J8M A;  1Y9K A;  4C68 A;  1IIC A;  4C2Z A;  5AG4 A;  4QVT A;  2QIR A;  1S60 A;  4BBH A;  3S6G A;  4F0Y A;  2YND A;  4CGM A;  4AG7 A;  2B4D A;  4JD6 A;  3LD2 A;  5F47 A;  2IL4 A;  4MFZ A;  4YFJ A;  2BUE A;  4CGP A;  3TOA A;  3IU2 A;  2O28 A;  1WWZ A;  1XF8 A;  4NXY A;  2JLM A;  4XPD B;  3TTH A;  1Z4E A;  2CNS A;  2D4O A;  2ZW4 A;  4KOU A;  5FVJ A;  3S6H A;  2CXA A;  2QML A;  2Q4Y A;  2Z11 A;  4CAE A;  4MHD A;  4ZBG A;  1RO5 A;  1IID A;  3FYN A;  3IWE A;  4HKF A;  2Z3P A;  2B58 A;  5F49 A;  4AVC A;  2OZG A;  4HNX B;  2PR1 A;  1YRE A;  4E2A A;  2Z3N A;  4NF1 A;  3ZZI A;  3CXS A;  2R7H A;  2REE A;  4LUA A;  2ARH A;  1R57 A;  4U9Z A;  3QAH A;  3VWE A;  3RYO A;  2WSA A;  1NE9 A;  4UFW A;  2C27 A;  4C7H A;  3T9Y A;  4R3L A;  4F0X A;  1QSN A;  3F8K A;  4Y49 C;  2D4P A;  1S7N A;  4KVM E;  3V8I A;  4KUA A;  4B5P A;  4LX9 A;  5JQ4 A;  2H5M A;  5I0C A;  3F0A A;  3S6K A;  1MJA A;  3EXN A;  3TE4 A;  2YGW A;  4M3S A;  4U5Y A;  1M4I A;  4QB9 A;  1M44 A;  1YX0 A;  4A30 A;  4Q36 A;  4CYN A;  3WR7 A;  4R3K A;  5CNP A;  3NE7 A;  4R57 A;  2B5G B;  1ON0 A;  5J8C A;  4F6A A;  1YVO A;  3TO7 A;  2YNC A;  4MI4 A;  4C2Y A;  4HNW B;  4MFK A;  1XIX A;  2GIV A;  2Q04 A;  4NCZ A;  3R9E A;  2BSW A;  3IU1 A;  4II9 A;  3EFA A;  4GS4 A;  3DDD A;  3N7Z A;  3R9G A;  2FE7 A;  3K9U A;  1U6M A;  4RI1 A;  1XMT A;  2QEC A;  4R87 A;  3H5Z A;  5KTC A;  2B4B A;  3BJ8 A;  4XPK A;  4MFQ A;  2VEZ A;  1QSM A;  1QSO A;  4CGL A;  4QBJ A;  3MGD A;  1I1D A;  3BJ7 A;  1YK3 A;  3E0K A;  4CRY B;  2CNM A;  1Q2C A;  2PSW A;  4KOV A;  1QST A;  4UBR A;  3JUW A;  2HV2 A;  4OLL A;  4AVB A;  2ZXV A;  3R96 A;  1FY7 A;  1S7L A;  4KSF A;  2VZY A;  1PUA A;  5H84 A;  2Z3L A;  2R8V A;  3F5B A;  1VHS A;  4A32 A;  2B3U A;  4H89 A;  3PGP A;  4KSA A;  5KTD A;  3PP9 A;  3EO4 A;  4CAF A;  1WK4 A;  2J8N A;  2VBQ A;  2Q0Y A;  2NMT A;  3P2F A;  2AE6 A;  2REF A;  1IYK A;  2B4D B;  3SXN A;  3DNS A;  2OH1 A;  3GYA A;  4R9M A;  2KCW A;  2PC1 A;  4L8A A;  1RXT A;  2I00 A;  2AJ6 A;  4B5O A;  2PQ8 A;  4KLW A;  3QB8 A;  1VKC A;  1NSL A;  3SXO A;  2GE3 A;  2OZU A;  1L0C A;  2I79 A;  3CXQ A;  4MFL A;  4IF5 A;  2Q4V A;  3GY9 A;  1YLE A;  3DR6 A;  5ISV A;  1KUY A;  4M85 A;  4E8O A;  1M4G A;  4FD7 A;  2FIW A;  5E96 A;  3UY5 A;  3H4Q A;  2Q7B A;  2B3V A;  2FCK A;  5EBV A;  1MJ9 A;  4FD4 A;  4QUS A;  4AG9 A;  3JVN A;  1N71 A;  1CJW A;  4KS9 A;  4C2X A;  3TFY A;  4JXR A;  4PK2 A;  2Z3K A;  4B11 A;  5H86 A;  1S3Z A;  3DR8 A;  2J8R A;  3VWD A;  4X5K A;  4YGO A;  4AB7 A;  4UFX A;  2GAN A;  4J3G A;  3W91 A;  2FL4 A;  2B5G A;  2OU2 A;  2WPX A;  3FBU A;  2JEV A;  5GCN A;  3ZJ0 A;  1Q2Y A;  3C26 A;  2K5T A;  4KOS A;  3FB3 A;  1GHE A;  4Y49 B;  4B12 A;  1S7K A;  2CY2 A;  3JTK A;  4IUS A;  2JDC A;  4C7I A;  2Z3M A;  1YR0 A;  3BLN A;  5A27 A;  4PK3 A;  2EVN A;  3FNC A;  3TCV A;  4CYQ A;  2ZW5 A;  4JLY A;  1K4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...