4KORA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with 7-aminocephalosporanic acid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
159
structure length
159
Chain Sequence
b'MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
molecule tags Transferase
source organism Pseudomonas aeruginosa
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
total genus 45
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4korA00
2PDOA 1I1DA 1XF8A 3B8GA 1S7KA 2B4DB 4OLLA 4E8OA 3P2FA 3BJ8A 2FIAA 3CXSA 4KOUA 4J3GA 2ATRA 4R3LA 1WWZA 4AG9A 4UWJA 2VZZA 1XEBA 3EC4A 4LX9A 4RI1A 5E96A 2CY2A 4QUSA 3EY5A 4B5PA 3UY5A 1KUXA 4F6AA 4MHDA 2BEIA 1IYLA 4ONUA 4K30A 1MJBA 2Y0MA 2EVNA 2C27A 2ARHA 2Z0ZA 3D8PA 4M85A 2Z11A 3FNCA 4JWPA 4MBUA 1S5KA 5JQ4A 1MJAA 1B87A 1RO5A 3V8IA 2D4OA 1M4DA 5KTAA 3LODA 1PU9A 1QSMA 1GHEA 2B3UA 3BJ7A 2ZW5A 5H86A 3R95A 2B3VA 1QSOA 1V0CA 2X7BA 1XMTA 3FXTA 5HH1A 1IB1E 4QVTA 2FXFA 3IGRA 3JVNA 4AVBA 3W91A 1Y9KA 4UBRA 4R3KA 2CNSA 4AB7A 2R7HA 4XPDB 5IX3A 2Q4VA 1YGHA 4QBJA 3E0KA 1RXTA 2Q4YA 4HKFA 4X5KA 2GANA 1S60A 4MI4A 4E0AA 1N71A 2ZW6A 4AVAA 3SHPA 1YR0A 5F47A 1Q2CA 2B4DA 2A4NA 1Z4RA 3TFYA 4YRHA 1MJ9A 2B5GA 4H89A 2VXKA 1KUYA 1I12A 3PP9A 2WPWA 2OZGA 3SXOA 4KOTA 4CS0B 4Y49C 2JEVA 2I00A 1KZFA 2I79A 3JUWA 3TOBA 2NMTA 4HNWB 4AVCA 5F49A 3ZJ0A 3EO4A 1M4GA 1S7NA 3IWGA 2REEA 3OWCA 4CAWA 3W6XA 3WR7A 2HQYA 5GCNA 2FCKA 4YGOA 5DWNA 3DR6A 3TO9A 4JXQA 4FD5A 4U9ZA 4OADA 3LD2A 3S6FA 2J8NA 3D2PA 4BMHA 3GY9A 1S7LA 4EVYA 1SQHA 4U5YA 2Q44A 2BSWA 3F8KA 1NMTA 2QMLA 3I9SA 4JLYA 4II9A 1P0HA 4UA3A 1CM0A 2BUEA 1MK4A 2Q7BA 3T9YA 3I3GA 3QAHA 2BL1A 5DWMA 1ON0A 5EC4A 2B5GB 2VEZA 2H5MA 4NF1A 4CAXA 2CNTA 4FD4A 1VKCA 4U9YA 4NCZA 4R9MA 4KOVA 4QC6A 3EXNA 3TCVA 1P4NA 4KOXA 2PR8A 1PUAA 4HNYB 4CAVA 1UFHA 3DDDA 4AG7A 1YK3A 2J8RA 1Y7RA 1R57A 4UWIA 3QB8A 1LRZA 1CJWA 2DXQA 3VWDA 2R98A 4DNCA 4KOWA 2KCWA 4PV6A 2P6FA 3FB3A 4HNXB 5I0CA 3TE4A 2P6EA 1U6MA 2JLMA 3DR8A 2O28A 3G3SA 4M3SA 2PR1A 5J8FA 1Q2YA 2WPXA 4E2AA 4ORFA 4KVOE 2ZXVA 2JDCA 2PSWA 2QIRA 5J8CA 4B5PB 3FYNA 2HUZA 3N7ZA 1NSLA 4Y49B 3R9FA 5C82A 4I49A 1Z4EA 4H6UA 5KTCA 2OH1A 4XPKA 3DSBA 2FIWA 2G0BA 4NXYA 2VI7A 1YVOA 4PK2A 3SXNA 2OB0A 1M4IA 4MJ8A 2Z10A 1BO4A 3R9EA 4GS4A 1YVKA 3TO6A 5KTDA 4OAEA 4FD6A 2Q04A 3D3SA 4KVME 3S6HA 1VHSA 3KKWA 3P2HA 5IV0A 3PGPA 4PSWA 4H6ZA 5C88A 2PQ8A 2AJ6A 4MY3A 3TO7A 4KOSA 1YX0A 3S6GA 3F5BA 3R96A 1S3ZA 4QB9A 2R1IA 5FVJA 5EBVA 2K5TA 2B4BA 2ZW4A 2OZHA 3W6SA 2OU2A 1Q2DA 4KLWA 4KZTA 4KLVA 4KUAA 1QSRA 1BOBA 3GYAA 2PC1A 4L89A 2JDDA 3GKRA 1NE9A 1WK4A 2AE6A 3ZZIA 2VZYA 3R1KA 1QSTA 3PZJA 2QECA 5F46A 3T90A 3NE7A 1M1DA 4PSXA 3VWEA 4L8AA 1M44A 2FE7A 1TIQA 3TOAA 3F0AA 3EFAA 4XNHC 2OZUA 1FY7A 1OZPA 4KORA 3CXQA 3TT2A 4F0YA 2R8VA 2FL4A 1YLEA 2PRBA 2J8MA 3K9UA 5ISVA 1S7FA 1IICA 3G8WA 4PK3A 4CRYB 3D2MA 1Y9WA 4KOYA 1IYKA 5HMNA 1K4JA 4NSQA 2D4PA 1QSNA 2HV2A 4B5OA 4NEXA 4IUSA 4KUBA 2RC4A 3DNSA 2G3TA 1IIDA 1J4JA 1L0CA 2FS5A 2G3AA 5IB0A 4XPDC 1Z9UA 1KUVA 4LUAA 4R57A 2FSRA 3C26A 2GE3A 3CXPA 1I21A 2P6GA 4KVXA 2VQYA 2ZW7A 5F48A 2P0WA 4XNHB 1XIXA 4ZBGA 2GIVA 4MY0A 3FBUA 4R87A 2Q0YA 4RS2A 2ZPAA 4JJXA 1YREA 3R9GA 3FIXA 4CRZB 4IF5A 3FRMA 5CNPA 3S6KA 4FD7A 2FT0A 1XE4A 3MGDA 2EUIA 4YFJA 5JPHA 3BLNA 4JXRA 2VBQA 2B58A 3TTHA 5H84A 2F5IA 3RYOA 2REFA 2CNMA 1B6BA 4JD6A 4XPLA 3H4QA 2IL4A
chains in the Genus database with same CATH superfamily
1ARMA 2GU2A 4NJQA 2PDOA 4OC3A 1I1DA 3KR5A 1XF8A 3B8GA 4RUHA 1S7KA 2B4DB 4OLLA 4E8OA 3P2FA 2PIZA 3D7GA 3BJ8A 4KSIA 2FIAA 3CXSA 5BWAB 4KOUA 1ZG8A 6CPAA 4J3GA 2ATRA 4Q38A 1YQEA 4M6GA 4R3LA 1WWZA 4AG9A 4CYNA 4UWJA 5DS0A 4ZI6A 2VZZA 4UEFA 1XEBA 4Q36A 1RTQA 3B3SA 3FVLA 3EC4A 2EK8A 2DEAA 3NH8A 4LX9A 4RI1A 3SI1A 4ZYQA 5E96A 4GM5A 2CY2A 4QUSA 3EY5A 4H2KA 4B5PA 3UY5A 2PVVA 4YU9A 3TX8A 1KUXA 2RFHA 3B3CA 3L2NA 4F6AA 4MHDA 2BEIA 1IYLA 2POKA 2AFWA 3IO1A 4A31A 4ONUA 4K30A 2ZEEA 4PQAA 1MJBA 2V8VA 2Y0MA 4OC0A 1ZLHA 4P4JA 1XFOA 4MCSA 2EVNA 2C27A 2AFZA 2ARHA 2Z0ZA 3D8PA 3B3WA 2ZOFA 1XOVA 4M85A 4A30A 3S9NA 2NSMA 2Z11A 3FNCA 2AFSA 2YNDA 4JWPA 4MBUA 1S5KA 1EE3P 4P10A 5JQ4A 1MJAA 4X8IA 1B87A 1RO5A 5D29A 3WC7A 4YWYA 5ELYA 1F2OA 4NGMA 1HEEA 3V8IA 2D4OA 2PIYA 1M4DA 2CTCA 2ZENA 5KTAA 2BCOA 3LODA 5LRGA 1PU9A 1QSMA 4MXUA 2WUUA 4B11A 5HXDA 5AG7A 4A39A 1GYTA 1GHEA 2B3UA 4MFPA 3BJ7A 5JM6A 2PJ5A 2ZW5A 4UEZA 5LYLA 3NFZA 4F0XA 5EMIA 5H86A 3PFOA 3R95A 4NGSA 2B3VA 1QSOA 1V0CA 2X7BA 3NA6A 3KZWA 1XMTA 3FXTA 5HH1A 2XEJA 4X3RA 1IB1E 4QVTA 2FXFA 3IGRA 3JVNA 3KQXA 1CPSA 1OBRA 3PFEA 3W91A 4AVBA 2HC9A 1XBUA 1Y9KA 3HLPA 4MMOA 5K8PA 3ISZA 3KQZA 4UBRA 4R3KA 2CNSA 1AUGA 3HUVA 4AB7A 2R7HA 2CTBA 4XPDB 5IX3A 2Q4VA 1CPXA 1YGHA 4Z65A 4UCPA 2Q4ZA 4QBJA 3NH4A 1AMPA 3E0KA 5K8OA 1RXTA 2Q4YA 4HKFA 4X5KA 2GANA 3GB0A 1S60A 4MI4A 1Q7LA 2V8HA 1N71A 2ZW6A 4E0AA 4AVAA 3SHPA 3VARA 4R7MA 4CGLA 3GIUA 2ANPA 4MCPA 1YR0A 4UIBA 1IOIA 4PXEA 1F2PA 4PXCA 4MHZA 2DPTA 4IHMA 4MHYA 4P4EA 5F47A 4PXDA 3NE8A 3MRUA 2PCUA 5J1QA 3KHXA 5THWA 1VGYA 1Q2CA 2PJ6A 2B4DA 2A4NA 2YNEA 3GUXA 4P4FA 1LCPA 1Z4RA 1LFWA 3TFYA 3BI0A 4MFKA 4YRHA 2BOAA 1MJ9A 3D4UA 2B5GA 3D66A 4H89A 2VXKA 1KUYA 5LRKA 1I12A 3B7IA 3PP9A 3JRUA 4R8FA 2WPWA 4NGTA 2OZGA 3SXOA 4KOTA 2CXAA 4P45A 4CS0B 4Y49C 2JEVA 3BI1A 2I00A 1KZFA 2I79A 3JUWA 3RAMA 3TOBA 4NGQA 4A33A 2NMTA 2QJ8A 4HNWB 4AVCA 5F49A 3T8WA 2FVGA 2PJ8A 3ZJ0A 3PB9X 3B35A 3EO4A 4OP4A 1M4GA 1S7NA 3IWGA 2REEA 5D8NA 3OWCA 2PJBA 3QNVA 4CAWA 3W6XA 1YLOA 4R76A 3WR7A 4BD9A 2HQYA 5GCNA 2FCKA 4UIAA 4YGOA 3DR6A 5DWNA 4OC1A 3SI2A 3TO9A 3WC5A 4JXQA 5I4MA 3FEEA 3K9TA 4FD5A 4U9ZA 1M4LA 4OADA 3IIBA 3LD2A 2I3CA 3S6FA 3NH5A 4OC4A 2J8NA 3D2PA 4BMHA 3GY9A 1S7LA 4EVYA 1TKFA 1CG2A 1SQHA 1TF9A 3DGVA 4LQ6A 4U5YA 3SJXA 2Q44A 3VATA 2BSWA 3F8KA 3CDXA 1Z8LA 3PB6X 1NMTA 4B10A 2QMLA 3I9SA 4A37A 3IU2A 4JLYA 4II9A 1P0HA 4UA3A 3JTKA 1CM0A 4UCMA 2BUEA 1MK4A 2Q7BA 1F57A 3T9YA 3I3GA 4CGOA 1ZG7A 3KR4A 3QAHA 2BL1A 5DWMA 1ON0A 5EC4A 1VIXA 3FMCA 4CGMA 2B5GB 2VEZA 2H5MA 4BBHA 4NF1A 4CAXA 2CNTA 3SJEA 7CPAA 4FD4A 4MRIA 1VKCA 4U9YA 2CIJA 4NCZA 2C1CA 4R9MA 4KOVA 1VHEA 4QC6A 3EXNA 3TCVA 1P4NA 1ELLP 2Z3MA 4KOXA 4PXBA 5G1ZA 4F9UA 4K3NA 2PR8A 1PUAA 2WZNA 4HNYB 4NFRA 4CAVA 3IC1A 1UFHA 4A94A 3DDDA 4FWUA 4AG7A 4P4BA 1YK3A 2J8RA 3PB8X 2PJ3A 4MFQA 3SJFA 3A9LA 5HVHA 1Y7RA 8CPAA 1R57A 3S9MA 2AFMA 2PJ7A 4UWIA 3QB8A 3WABA 2ZEMA 1LRZA 2PJ4A 1CJWA 2Z3PA 3IWEA 2DXQA 4OC2A 4Q7AA 3VWDA 4CPAA 4CGNA 2R98A 5G21A 2C6GA 4DNCA 4KOWA 2KCWA 4UFXA 3S9LA 4PV6A 2P6FA 3FB3A 1X10A 4UFWA 1KWMA 5CPAA 1PYTB 1Z8WA 4HNXB 5I0CA 4IK2A 5K8NA 4F9VA 3TE4A 2P6EA 1U6MA 2JLMA 3DR8A 2O28A 1IY7A 3G3SA 4M3SA 3B3VA 2PR1A 1TF8A 5J8FA 1Q2YA 2WPXA 4E2AA 4W9YA 1XRYA 3PBBA 4ORFA 4KVOE 3PRTA 2ZXVA 2JDCA 2PSWA 2YNCC 1VHOA 2QIRA 1BPMA 3H5ZA 4B5PB 4CAFA 5J8CA 3FYNA 3IU1A 1IGBA 2HUZA 4OMEA 5AGEA 3I1UA 2PJ9A 1BLLE 3N7ZA 4B12A 2XEIA 2ZEHA 3N5FA 4ZY2A 1JWQA 1NSLA 2OOTA 4C68A 4Y49B 4C7HA 3R9FA 3V7ZA 5CBMA 1LANA 1IOFA 1ZG9A 4I49A 1Z4EA 4H6UA 5C82A 2OH1A 3KGQA 4XPKA 5KTCA 5A27A 3DSBA 2Q43A 2FIWA 2G0BA 4NXYA 4NGRA 2VI7A 1YVOA 2HB6A 2WSAA 2Z3OA 4PK2A 2ZEOA 2ZEGA 3SXNA 2OB0A 1M4IA 4MJ8A 2Z10A 2Z3KA 5AG5A 1BO4A 3D7DA 3R9EA 1FNOA 4O23A 3BXMA 4ZY1A 4GS4A 1YVKA 3TO6A 5KTDA 4OAEA 4FD6A 2Q04A 4MHNA 4UF4A 3B3TA 1LOKA 3D3SA 4KVME 1TKJA 4MFLA 4BINA 5AG4A 3S6HA 2PJ2A 4KSFA 1VHSA 4OC5A 2C6CA 3KKWA 3P2HA 5IV0A 3PGPA 4PSWA 3D7HA 4WWVA 4H6ZA 5C88A 1CP7A 2PQ8A 1R3NA 5G22A 1JQGA 2ABZA 2AJ6A 1H8LA 4MY3A 3TO7A 5JGFA 4P4DA 4NGPA 4RN7A 4CYOA 1IU8A 5A28A 2VL1A 4NGNA 4UEEA 4KOSA 1YX0A 1Z5RA 5LYDA 3S6GA 3IWWA 4LQGA 2ODFA 3F5BA 4MHPA 3R96A 1S3ZA 4QB9A 2R1IA 5FVJA 2ZEDA 3IJ3A 5AG6A 5EBVA 4B6ZA 2XEFA 2K5TA 2B4BA 3WT4A 2ZW4A 3SJGA 2OZHA 2PJAA 3W6SA 2OU2A 4X2TA 4M6HA 1Q2DA 4KLWA 4KZTA 2G9DA 4TNUA 4KLVA 4P6YA 4KUAA 4UFVA 1QSRA 1Y0RA 2ZELA 4UCNA 4WJBA 1ARLA 3WC6A 1XMBA 1BOBA 1YW6A 1ZO0A 1CBXA 3GYAA 4M6IA 2PC1A 2GREA 4AXVA 1CX8A 1DTDA 4OIDA 3RZAA 3PB4X 4L89A 1Z8TA 2JDDA 3GKRA 4P4IA 2YGWA 1NE9A 2V8GA 1WK4A 2AE6A 2ZOGA 2O53A 4EMEA 2PJCA 3IEHA 2PJ1A 2ZEPA 2QYVA 4DUKA 1CP6A 2CF4A 3H8GA 3PEIA 5HVFA 4ONWA 3CPXA 3DLJA 3ZZIA 2WYRA 2VZYA 4P44A 1A2ZA 3CT9A 3MN8A 3R1KA 4TWEA 2IQ6A 1QSTA 4CYPA 2PRQA 1NSAA 3PZJA 2QECA 4DJLA 5JH9A 5F46A 4JYWA 3H8FA 3T90A 3IFEA 2AFOA 4ZX8A 3NE7A 1M1DA 4PSXA 3VWEA 4EWTA 4L8AA 1M44A 3KI9A 4HPSA 2FE7A 1TIQA 3TOAA 3F0AA 4ZGYB 1UWYA 3EFAA 2PE3A 3FX6A 2GLJA 4OKOA 4XNHC 2PVWA 2OZUA 1FY7A 1OZPA 4C2YA 4KORA 3CXQA 1PCAA 3TT2A 4B14A 4CGPA 4F0YA 3PBEA 2JBJA 2R8VA 3FJUA 2FL4A 1BPNA 1YLEA 4G1PA 1Z2LA 3KASA 3RNZA 2DPSA 2PRBA 2J8MA 3D68A 3K9UA 5ISVA 1FT7A 4DYOA 2NYQA 2Z3LA 5G20A 1S7FA 1IICA 3G8WA 3H8EA 4PK3A 4CRYB 3D2MA 4A2ZA 1YW4A 1HDUA 3QAYA 5HVGA 1Y9WA 4MCQA 3D67A 1Z8XA 4KOYA 1IYKA 2QVPA 5HMNA 1K4JA 4NSQA 2D4PA 1QSNA 2HV2A 4B5OA 4KSAA 4NEXA 3CPAA 4IUSA 4KUBA 2AFUA 5F09A 2IJZA 2RC4A 3DNSA 2G3TA 1IIDA 3VH9A 1J4JA 1L0CA 2FS5A 3RBUA 3D7FA 4MFZA 2G3AA 2ZEFA 1ZLIA 5IB0A 4XPDC 1Z9UA 1KUVA 4LUAA 1Y7EA 5LRJA 4R57A 1LAPA 2F7VA 3ISXA 2FSRA 3C26A 2GE3A 3LACA 3CXPA 4GXHA 1R43A 2JEWA 1I21A 3TC8A 4JZ0A 4KS9A 2V77A 4A95A 2P6GA 4KVXA 2AFXA 2VQYA 2ZW7A 4CAEA 5F48A 4C2XA 2RB7A 4ZX9A 2EK9A 2P0WA 4C2ZA 3FH4A 2DF5A 3KL9A 4XNHB 2GLFA 4OIWA 5LYFA 1XIXA 4A32A 2V8DA 3FEDA 2OR4A 4ZBGA 2Z3NA 2F8HA 2GIVA 4MY0A 3FBUA 2EBJA 1XJOA 4MFJA 1YMEA 2BO9A 3SI0A 4R87A 1YSJA 3LWUA 3FECA 2Q0YA 3K2KA 1DE4C 4RS2A 2ZPAA 4JJXA 4FUUA 4C7IA 4ZY0A 1YREA 3R9GA 3FIXA 1QQ9A 4F8ZA 1LAMA 4MCRA 4CRZB 4IF5A 2IMOA 3FRMA 5CNPA 3FF3A 3LMSA 2PJ0A 4PPZA 4FD7A 2FT0A 3S6KA 4FBEA 2Q7SA 1XE4A 4CYQA 1TXRA 3MGDA 2EUIA 3V38A 1AYEA 2XEGA 4YFJA 3KHZA 1HDQA 5JPHA 3BLNA 2EWBA 4JXRA 3PB7X 5K8MA 3CZXA 3GLJA 1Y0YA 3B2YA 2VBQA 1X12A 2YNCA 2B58A 3TTHA 4R6TA 1BAVA 5H84A 2F5IA 3RYOA 4B13A 2GFQA 2REFA 3BHXA 2CNMA 4IAVA 1QMUA 2EO8A 1ELMP 5LYIA 1B6BA 4A38A 4FAIA 3RO0A 4EFDA 5IB9A 2C6PA 4JD6A 2JBKA 1TKHA 4NJRA 2J9AA 2Q51A 2O4HA 4XPLA 3H4QA 2IL4A
chains in the Genus database with same CATH topology
2PDOA 1I1DA 1XF8A 3B8GA 1S7KA 2B4DB 4OLLA 4E8OA 3P2FA 3BJ8A 2FIAA 3CXSA 5BWAB 4KOUA 4J3GA 2ATRA 4Q38A 4R3LA 1WWZA 4AG9A 4CYNA 4UWJA 2VZZA 1XEBA 4Q36A 3EC4A 4LX9A 4RI1A 5E96A 2CY2A 4QUSA 3EY5A 4B5PA 3UY5A 1KUXA 4F6AA 4MHDA 2BEIA 1IYLA 4A31A 4ONUA 4K30A 1MJBA 2Y0MA 2EVNA 2C27A 2ARHA 2Z0ZA 3D8PA 4M85A 4A30A 2Z11A 3FNCA 2YNDA 4JWPA 4MBUA 1S5KA 5JQ4A 1MJAA 1B87A 1RO5A 3V8IA 2D4OA 1M4DA 5KTAA 3LODA 1PU9A 1QSMA 4B11A 2WUUA 5AG7A 1GHEA 2B3UA 4MFPA 3BJ7A 2ZW5A 4F0XA 5H86A 3R95A 2B3VA 1QSOA 1V0CA 2X7BA 1XMTA 3FXTA 5HH1A 1IB1E 4QVTA 2FXFA 3IGRA 3JVNA 4AVBA 3W91A 1Y9KA 4UBRA 4R3KA 2CNSA 4AB7A 2R7HA 4XPDB 5IX3A 2Q4VA 1YGHA 4UCPA 4QBJA 3E0KA 1RXTA 2Q4YA 4HKFA 4X5KA 2GANA 1S60A 4MI4A 4E0AA 1N71A 2ZW6A 4AVAA 3SHPA 4CGLA 1YR0A 2DPTA 5F47A 1Q2CA 2B4DA 2A4NA 2YNEA 1Z4RA 3TFYA 4MFKA 4YRHA 1MJ9A 2B5GA 4H89A 2VXKA 1KUYA 1I12A 3PP9A 2WPWA 2OZGA 3SXOA 4KOTA 2CXAA 4CS0B 4Y49C 2JEVA 4A33A 2I00A 1KZFA 2I79A 3JUWA 3TOBA 2NMTA 4HNWB 4AVCA 5F49A 3ZJ0A 3EO4A 1M4GA 1S7NA 3IWGA 2REEA 3OWCA 4CAWA 3W6XA 3WR7A 2HQYA 5GCNA 2FCKA 4YGOA 5DWNA 3DR6A 3TO9A 4JXQA 4FD5A 4U9ZA 4OADA 3LD2A 3S6FA 2J8NA 3D2PA 4BMHA 3GY9A 1S7LA 4EVYA 1SQHA 4U5YA 2Q44A 2BSWA 3F8KA 1NMTA 4B10A 2QMLA 3I9SA 3IU2A 4JLYA 4II9A 1P0HA 4UA3A 3JTKA 1CM0A 4UCMA 2BUEA 1MK4A 2Q7BA 3T9YA 3I3GA 4CGOA 3QAHA 2BL1A 5DWMA 1ON0A 5EC4A 4CGMA 2B5GB 2VEZA 2H5MA 4BBHA 4NF1A 4CAXA 2CNTA 4FD4A 1VKCA 4U9YA 4NCZA 4R9MA 4KOVA 4QC6A 3EXNA 3TCVA 1P4NA 2Z3MA 4KOXA 5G1ZA 2PR8A 1PUAA 4HNYB 4CAVA 1UFHA 3DDDA 4AG7A 1YK3A 2J8RA 4MFQA 3A9LA 1Y7RA 1R57A 4UWIA 3QB8A 3IWEA 1LRZA 2Z3PA 1CJWA 2DXQA 3VWDA 4CGNA 2R98A 5G21A 4DNCA 4KOWA 2KCWA 4UFXA 4PV6A 2P6FA 3FB3A 4UFWA 4HNXB 5I0CA 3TE4A 2P6EA 1U6MA 2JLMA 3DR8A 2O28A 3G3SA 4M3SA 2PR1A 5J8FA 1Q2YA 2WPXA 4E2AA 4ORFA 4KVOE 2ZXVA 2JDCA 2PSWA 2YNCC 2QIRA 3H5ZA 5J8CA 4B5PB 4CAFA 3FYNA 3IU1A 2HUZA 5AGEA 3N7ZA 4B12A 1NSLA 4C68A 4Y49B 4C7HA 3R9FA 5C82A 4I49A 1Z4EA 4H6UA 5KTCA 2OH1A 4XPKA 5A27A 3DSBA 2FIWA 2G0BA 4NXYA 2VI7A 1YVOA 2Z3OA 2WSAA 4PK2A 3SXNA 2OB0A 1M4IA 4MJ8A 2Z10A 2Z3KA 5AG5A 1BO4A 3R9EA 4GS4A 1YVKA 3TO6A 5KTDA 4OAEA 4FD6A 2Q04A 3D3SA 4KVME 4MFLA 5AG4A 3S6HA 4KSFA 1VHSA 3KKWA 3P2HA 5IV0A 3PGPA 4PSWA 4H6ZA 5C88A 2PQ8A 5G22A 2AJ6A 4MY3A 3TO7A 4CYOA 5A28A 4KOSA 1YX0A 3S6GA 3F5BA 3R96A 1S3ZA 4QB9A 2R1IA 5FVJA 5AG6A 5EBVA 2K5TA 2B4BA 2ZW4A 2OZHA 3W6SA 2OU2A 1Q2DA 4KLWA 4KZTA 4KLVA 4KUAA 4UFVA 1QSRA 4UCNA 1BOBA 1ZO0A 3GYAA 2PC1A 4L89A 2JDDA 3GKRA 2YGWA 1NE9A 1WK4A 2AE6A 3ZZIA 2VZYA 3R1KA 1QSTA 4CYPA 3PZJA 2QECA 5F46A 3T90A 3NE7A 1M1DA 4PSXA 3VWEA 4L8AA 1M44A 2FE7A 1TIQA 3TOAA 3F0AA 4ZGYB 3EFAA 4XNHC 2OZUA 1FY7A 1OZPA 4C2YA 4KORA 3CXQA 3TT2A 4CGPA 4B14A 4F0YA 2R8VA 2FL4A 1YLEA 2DPSA 2PRBA 2J8MA 3K9UA 5ISVA 5G20A 2Z3LA 1S7FA 1IICA 3G8WA 4PK3A 4CRYB 3D2MA 4A2ZA 1Y9WA 4KOYA 1IYKA 5HMNA 1K4JA 4NSQA 2D4PA 1QSNA 2HV2A 4B5OA 4KSAA 4NEXA 4IUSA 4KUBA 2RC4A 3DNSA 2G3TA 1IIDA 1J4JA 1L0CA 2FS5A 4MFZA 2G3AA 5IB0A 4XPDC 1Z9UA 1KUVA 4LUAA 4R57A 2FSRA 3C26A 2GE3A 3CXPA 1I21A 4KS9A 4A95A 2P6GA 4KVXA 2VQYA 2ZW7A 4CAEA 5F48A 4C2XA 2P0WA 4C2ZA 4XNHB 1XIXA 4A32A 4ZBGA 2Z3NA 2GIVA 4MY0A 3FBUA 4MFJA 4R87A 2Q0YA 4RS2A 4C7IA 2ZPAA 4JJXA 1YREA 3R9GA 3FIXA 4CRZB 4IF5A 3FRMA 5CNPA 3S6KA 4FD7A 2FT0A 1XE4A 4CYQA 3MGDA 2EUIA 4YFJA 5JPHA 3BLNA 4JXRA 2VBQA 2YNCA 2B58A 3TTHA 5H84A 2F5IA 3RYOA 4B13A 2REFA 2CNMA 1B6BA 4JD6A 4XPLA 3H4QA 2IL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PDO A;  1I1D A;  1XF8 A;  3B8G A;  1S7K A;  2B4D B;  4OLL A;  4E8O A;  3P2F A;  3BJ8 A;  2FIA A;  3CXS A;  4KOU A;  4J3G A;  2ATR A;  4R3L A;  1WWZ A;  4AG9 A;  4UWJ A;  2VZZ A;  1XEB A;  3EC4 A;  4LX9 A;  4RI1 A;  5E96 A;  2CY2 A;  4QUS A;  3EY5 A;  4B5P A;  3UY5 A;  1KUX A;  4F6A A;  4MHD A;  2BEI A;  1IYL A;  4ONU A;  4K30 A;  1MJB A;  2Y0M A;  2EVN A;  2C27 A;  2ARH A;  2Z0Z A;  3D8P A;  4M85 A;  2Z11 A;  3FNC A;  4JWP A;  4MBU A;  1S5K A;  5JQ4 A;  1MJA A;  1B87 A;  1RO5 A;  3V8I A;  2D4O A;  1M4D A;  5KTA A;  3LOD A;  1PU9 A;  1QSM A;  1GHE A;  2B3U A;  3BJ7 A;  2ZW5 A;  5H86 A;  3R95 A;  2B3V A;  1QSO A;  1V0C A;  2X7B A;  1XMT A;  3FXT A;  5HH1 A;  1IB1 E;  4QVT A;  2FXF A;  3IGR A;  3JVN A;  4AVB A;  3W91 A;  1Y9K A;  4UBR A;  4R3K A;  2CNS A;  4AB7 A;  2R7H A;  4XPD B;  5IX3 A;  2Q4V A;  1YGH A;  4QBJ A;  3E0K A;  1RXT A;  2Q4Y A;  4HKF A;  4X5K A;  2GAN A;  1S60 A;  4MI4 A;  4E0A A;  1N71 A;  2ZW6 A;  4AVA A;  3SHP A;  1YR0 A;  5F47 A;  1Q2C A;  2B4D A;  2A4N A;  1Z4R A;  3TFY A;  4YRH A;  1MJ9 A;  2B5G A;  4H89 A;  2VXK A;  1KUY A;  1I12 A;  3PP9 A;  2WPW A;  2OZG A;  3SXO A;  4KOT A;  4CS0 B;  4Y49 C;  2JEV A;  2I00 A;  1KZF A;  2I79 A;  3JUW A;  3TOB A;  2NMT A;  4HNW B;  4AVC A;  5F49 A;  3ZJ0 A;  3EO4 A;  1M4G A;  1S7N A;  3IWG A;  2REE A;  3OWC A;  4CAW A;  3W6X A;  3WR7 A;  2HQY A;  5GCN A;  2FCK A;  4YGO A;  5DWN A;  3DR6 A;  3TO9 A;  4JXQ A;  4FD5 A;  4U9Z A;  4OAD A;  3LD2 A;  3S6F A;  2J8N A;  3D2P A;  4BMH A;  3GY9 A;  1S7L A;  4EVY A;  1SQH A;  4U5Y A;  2Q44 A;  2BSW A;  3F8K A;  1NMT A;  2QML A;  3I9S A;  4JLY A;  4II9 A;  1P0H A;  4UA3 A;  1CM0 A;  2BUE A;  1MK4 A;  2Q7B A;  3T9Y A;  3I3G A;  3QAH A;  2BL1 A;  5DWM A;  1ON0 A;  5EC4 A;  2B5G B;  2VEZ A;  2H5M A;  4NF1 A;  4CAX A;  2CNT A;  4FD4 A;  1VKC A;  4U9Y A;  4NCZ A;  4R9M A;  4KOV A;  4QC6 A;  3EXN A;  3TCV A;  1P4N A;  4KOX A;  2PR8 A;  1PUA A;  4HNY B;  4CAV A;  1UFH A;  3DDD A;  4AG7 A;  1YK3 A;  2J8R A;  1Y7R A;  1R57 A;  4UWI A;  3QB8 A;  1LRZ A;  1CJW A;  2DXQ A;  3VWD A;  2R98 A;  4DNC A;  4KOW A;  2KCW A;  4PV6 A;  2P6F A;  3FB3 A;  4HNX B;  5I0C A;  3TE4 A;  2P6E A;  1U6M A;  2JLM A;  3DR8 A;  2O28 A;  3G3S A;  4M3S A;  2PR1 A;  5J8F A;  1Q2Y A;  2WPX A;  4E2A A;  4ORF A;  4KVO E;  2ZXV A;  2JDC A;  2PSW A;  2QIR A;  5J8C A;  4B5P B;  3FYN A;  2HUZ A;  3N7Z A;  1NSL A;  4Y49 B;  3R9F A;  5C82 A;  4I49 A;  1Z4E A;  4H6U A;  5KTC A;  2OH1 A;  4XPK A;  3DSB A;  2FIW A;  2G0B A;  4NXY A;  2VI7 A;  1YVO A;  4PK2 A;  3SXN A;  2OB0 A;  1M4I A;  4MJ8 A;  2Z10 A;  1BO4 A;  3R9E A;  4GS4 A;  1YVK A;  3TO6 A;  5KTD A;  4OAE A;  4FD6 A;  2Q04 A;  3D3S A;  4KVM E;  3S6H A;  1VHS A;  3KKW A;  3P2H A;  5IV0 A;  3PGP A;  4PSW A;  4H6Z A;  5C88 A;  2PQ8 A;  2AJ6 A;  4MY3 A;  3TO7 A;  4KOS A;  1YX0 A;  3S6G A;  3F5B A;  3R96 A;  1S3Z A;  4QB9 A;  2R1I A;  5FVJ A;  5EBV A;  2K5T A;  2B4B A;  2ZW4 A;  2OZH A;  3W6S A;  2OU2 A;  1Q2D A;  4KLW A;  4KZT A;  4KLV A;  4KUA A;  1QSR A;  1BOB A;  3GYA A;  2PC1 A;  4L89 A;  2JDD A;  3GKR A;  1NE9 A;  1WK4 A;  2AE6 A;  3ZZI A;  2VZY A;  3R1K A;  1QST A;  3PZJ A;  2QEC A;  5F46 A;  3T90 A;  3NE7 A;  1M1D A;  4PSX A;  3VWE A;  4L8A A;  1M44 A;  2FE7 A;  1TIQ A;  3TOA A;  3F0A A;  3EFA A;  4XNH C;  2OZU A;  1FY7 A;  1OZP A;  4KOR A;  3CXQ A;  3TT2 A;  4F0Y A;  2R8V A;  2FL4 A;  1YLE A;  2PRB A;  2J8M A;  3K9U A;  5ISV A;  1S7F A;  1IIC A;  3G8W A;  4PK3 A;  4CRY B;  3D2M A;  1Y9W A;  4KOY A;  1IYK A;  5HMN A;  1K4J A;  4NSQ A;  2D4P A;  1QSN A;  2HV2 A;  4B5O A;  4NEX A;  4IUS A;  4KUB A;  2RC4 A;  3DNS A;  2G3T A;  1IID A;  1J4J A;  1L0C A;  2FS5 A;  2G3A A;  5IB0 A;  4XPD C;  1Z9U A;  1KUV A;  4LUA A;  4R57 A;  2FSR A;  3C26 A;  2GE3 A;  3CXP A;  1I21 A;  2P6G A;  4KVX A;  2VQY A;  2ZW7 A;  5F48 A;  2P0W A;  4XNH B;  1XIX A;  4ZBG A;  2GIV A;  4MY0 A;  3FBU A;  4R87 A;  2Q0Y A;  4RS2 A;  2ZPA A;  4JJX A;  1YRE A;  3R9G A;  3FIX A;  4CRZ B;  4IF5 A;  3FRM A;  5CNP A;  3S6K A;  4FD7 A;  2FT0 A;  1XE4 A;  3MGD A;  2EUI A;  4YFJ A;  5JPH A;  3BLN A;  4JXR A;  2VBQ A;  2B58 A;  3TTH A;  5H84 A;  2F5I A;  3RYO A;  2REF A;  2CNM A;  1B6B A;  4JD6 A;  4XPL A;  3H4Q A;  2IL4 A; 
#chains in the Genus database with same CATH topology
 1ARM A;  2GU2 A;  4NJQ A;  2PDO A;  4OC3 A;  1I1D A;  3KR5 A;  1XF8 A;  3B8G A;  4RUH A;  1S7K A;  2B4D B;  4OLL A;  4E8O A;  3P2F A;  2PIZ A;  3D7G A;  3BJ8 A;  4KSI A;  2FIA A;  3CXS A;  5BWA B;  4KOU A;  1ZG8 A;  6CPA A;  4J3G A;  2ATR A;  4Q38 A;  1YQE A;  4M6G A;  4R3L A;  1WWZ A;  4AG9 A;  4CYN A;  4UWJ A;  5DS0 A;  4ZI6 A;  2VZZ A;  4UEF A;  1XEB A;  4Q36 A;  1RTQ A;  3B3S A;  3FVL A;  3EC4 A;  2EK8 A;  2DEA A;  3NH8 A;  4LX9 A;  4RI1 A;  3SI1 A;  4ZYQ A;  5E96 A;  4GM5 A;  2CY2 A;  4QUS A;  3EY5 A;  4H2K A;  4B5P A;  3UY5 A;  2PVV A;  4YU9 A;  3TX8 A;  1KUX A;  2RFH A;  3B3C A;  3L2N A;  4F6A A;  4MHD A;  2BEI A;  1IYL A;  2POK A;  2AFW A;  3IO1 A;  4A31 A;  4ONU A;  4K30 A;  2ZEE A;  4PQA A;  1MJB A;  2V8V A;  2Y0M A;  4OC0 A;  1ZLH A;  4P4J A;  1XFO A;  4MCS A;  2EVN A;  2C27 A;  2AFZ A;  2ARH A;  2Z0Z A;  3D8P A;  3B3W A;  2ZOF A;  1XOV A;  4M85 A;  4A30 A;  3S9N A;  2NSM A;  2Z11 A;  3FNC A;  2AFS A;  2YND A;  4JWP A;  4MBU A;  1S5K A;  1EE3 P;  4P10 A;  5JQ4 A;  1MJA A;  4X8I A;  1B87 A;  1RO5 A;  5D29 A;  3WC7 A;  4YWY A;  5ELY A;  1F2O A;  4NGM A;  1HEE A;  3V8I A;  2D4O A;  2PIY A;  1M4D A;  2CTC A;  2ZEN A;  5KTA A;  2BCO A;  3LOD A;  5LRG A;  1PU9 A;  1QSM A;  4MXU A;  2WUU A;  4B11 A;  5HXD A;  5AG7 A;  4A39 A;  1GYT A;  1GHE A;  2B3U A;  4MFP A;  3BJ7 A;  5JM6 A;  2PJ5 A;  2ZW5 A;  4UEZ A;  5LYL A;  3NFZ A;  4F0X A;  5EMI A;  5H86 A;  3PFO A;  3R95 A;  4NGS A;  2B3V A;  1QSO A;  1V0C A;  2X7B A;  3NA6 A;  3KZW A;  1XMT A;  3FXT A;  5HH1 A;  2XEJ A;  4X3R A;  1IB1 E;  4QVT A;  2FXF A;  3IGR A;  3JVN A;  3KQX A;  1CPS A;  1OBR A;  3PFE A;  3W91 A;  4AVB A;  2HC9 A;  1XBU A;  1Y9K A;  3HLP A;  4MMO A;  5K8P A;  3ISZ A;  3KQZ A;  4UBR A;  4R3K A;  2CNS A;  1AUG A;  3HUV A;  4AB7 A;  2R7H A;  2CTB A;  4XPD B;  5IX3 A;  2Q4V A;  1CPX A;  1YGH A;  4Z65 A;  4UCP A;  2Q4Z A;  4QBJ A;  3NH4 A;  1AMP A;  3E0K A;  5K8O A;  1RXT A;  2Q4Y A;  4HKF A;  4X5K A;  2GAN A;  3GB0 A;  1S60 A;  4MI4 A;  1Q7L A;  2V8H A;  1N71 A;  2ZW6 A;  4E0A A;  4AVA A;  3SHP A;  3VAR A;  4R7M A;  4CGL A;  3GIU A;  2ANP A;  4MCP A;  1YR0 A;  4UIB A;  1IOI A;  4PXE A;  1F2P A;  4PXC A;  4MHZ A;  2DPT A;  4IHM A;  4MHY A;  4P4E A;  5F47 A;  4PXD A;  3NE8 A;  3MRU A;  2PCU A;  5J1Q A;  3KHX A;  5THW A;  1VGY A;  1Q2C A;  2PJ6 A;  2B4D A;  2A4N A;  2YNE A;  3GUX A;  4P4F A;  1LCP A;  1Z4R A;  1LFW A;  3TFY A;  3BI0 A;  4MFK A;  4YRH A;  2BOA A;  1MJ9 A;  3D4U A;  2B5G A;  3D66 A;  4H89 A;  2VXK A;  1KUY A;  5LRK A;  1I12 A;  3B7I A;  3PP9 A;  3JRU A;  4R8F A;  2WPW A;  4NGT A;  2OZG A;  3SXO A;  4KOT A;  2CXA A;  4P45 A;  4CS0 B;  4Y49 C;  2JEV A;  3BI1 A;  2I00 A;  1KZF A;  2I79 A;  3JUW A;  3RAM A;  3TOB A;  4NGQ A;  4A33 A;  2NMT A;  2QJ8 A;  4HNW B;  4AVC A;  5F49 A;  3T8W A;  2FVG A;  2PJ8 A;  3ZJ0 A;  3PB9 X;  3B35 A;  3EO4 A;  4OP4 A;  1M4G A;  1S7N A;  3IWG A;  2REE A;  5D8N A;  3OWC A;  2PJB A;  3QNV A;  4CAW A;  3W6X A;  1YLO A;  4R76 A;  3WR7 A;  4BD9 A;  2HQY A;  5GCN A;  2FCK A;  4UIA A;  4YGO A;  3DR6 A;  5DWN A;  4OC1 A;  3SI2 A;  3TO9 A;  3WC5 A;  4JXQ A;  5I4M A;  3FEE A;  3K9T A;  4FD5 A;  4U9Z A;  1M4L A;  4OAD A;  3IIB A;  3LD2 A;  2I3C A;  3S6F A;  3NH5 A;  4OC4 A;  2J8N A;  3D2P A;  4BMH A;  3GY9 A;  1S7L A;  4EVY A;  1TKF A;  1CG2 A;  1SQH A;  1TF9 A;  3DGV A;  4LQ6 A;  4U5Y A;  3SJX A;  2Q44 A;  3VAT A;  2BSW A;  3F8K A;  3CDX A;  1Z8L A;  3PB6 X;  1NMT A;  4B10 A;  2QML A;  3I9S A;  4A37 A;  3IU2 A;  4JLY A;  4II9 A;  1P0H A;  4UA3 A;  3JTK A;  1CM0 A;  4UCM A;  2BUE A;  1MK4 A;  2Q7B A;  1F57 A;  3T9Y A;  3I3G A;  4CGO A;  1ZG7 A;  3KR4 A;  3QAH A;  2BL1 A;  5DWM A;  1ON0 A;  5EC4 A;  1VIX A;  3FMC A;  4CGM A;  2B5G B;  2VEZ A;  2H5M A;  4BBH A;  4NF1 A;  4CAX A;  2CNT A;  3SJE A;  7CPA A;  4FD4 A;  4MRI A;  1VKC A;  4U9Y A;  2CIJ A;  4NCZ A;  2C1C A;  4R9M A;  4KOV A;  1VHE A;  4QC6 A;  3EXN A;  3TCV A;  1P4N A;  1ELL P;  2Z3M A;  4KOX A;  4PXB A;  5G1Z A;  4F9U A;  4K3N A;  2PR8 A;  1PUA A;  2WZN A;  4HNY B;  4NFR A;  4CAV A;  3IC1 A;  1UFH A;  4A94 A;  3DDD A;  4FWU A;  4AG7 A;  4P4B A;  1YK3 A;  2J8R A;  3PB8 X;  2PJ3 A;  4MFQ A;  3SJF A;  3A9L A;  5HVH A;  1Y7R A;  8CPA A;  1R57 A;  3S9M A;  2AFM A;  2PJ7 A;  4UWI A;  3QB8 A;  3WAB A;  2ZEM A;  1LRZ A;  2PJ4 A;  1CJW A;  2Z3P A;  3IWE A;  2DXQ A;  4OC2 A;  4Q7A A;  3VWD A;  4CPA A;  4CGN A;  2R98 A;  5G21 A;  2C6G A;  4DNC A;  4KOW A;  2KCW A;  4UFX A;  3S9L A;  4PV6 A;  2P6F A;  3FB3 A;  1X10 A;  4UFW A;  1KWM A;  5CPA A;  1PYT B;  1Z8W A;  4HNX B;  5I0C A;  4IK2 A;  5K8N A;  4F9V A;  3TE4 A;  2P6E A;  1U6M A;  2JLM A;  3DR8 A;  2O28 A;  1IY7 A;  3G3S A;  4M3S A;  3B3V A;  2PR1 A;  1TF8 A;  5J8F A;  1Q2Y A;  2WPX A;  4E2A A;  4W9Y A;  1XRY A;  3PBB A;  4ORF A;  4KVO E;  3PRT A;  2ZXV A;  2JDC A;  2PSW A;  2YNC C;  1VHO A;  2QIR A;  1BPM A;  3H5Z A;  4B5P B;  4CAF A;  5J8C A;  3FYN A;  3IU1 A;  1IGB A;  2HUZ A;  4OME A;  5AGE A;  3I1U A;  2PJ9 A;  1BLL E;  3N7Z A;  4B12 A;  2XEI A;  2ZEH A;  3N5F A;  4ZY2 A;  1JWQ A;  1NSL A;  2OOT A;  4C68 A;  4Y49 B;  4C7H A;  3R9F A;  3V7Z A;  5CBM A;  1LAN A;  1IOF A;  1ZG9 A;  4I49 A;  1Z4E A;  4H6U A;  5C82 A;  2OH1 A;  3KGQ A;  4XPK A;  5KTC A;  5A27 A;  3DSB A;  2Q43 A;  2FIW A;  2G0B A;  4NXY A;  4NGR A;  2VI7 A;  1YVO A;  2HB6 A;  2WSA A;  2Z3O A;  4PK2 A;  2ZEO A;  2ZEG A;  3SXN A;  2OB0 A;  1M4I A;  4MJ8 A;  2Z10 A;  2Z3K A;  5AG5 A;  1BO4 A;  3D7D A;  3R9E A;  1FNO A;  4O23 A;  3BXM A;  4ZY1 A;  4GS4 A;  1YVK A;  3TO6 A;  5KTD A;  4OAE A;  4FD6 A;  2Q04 A;  4MHN A;  4UF4 A;  3B3T A;  1LOK A;  3D3S A;  4KVM E;  1TKJ A;  4MFL A;  4BIN A;  5AG4 A;  3S6H A;  2PJ2 A;  4KSF A;  1VHS A;  4OC5 A;  2C6C A;  3KKW A;  3P2H A;  5IV0 A;  3PGP A;  4PSW A;  3D7H A;  4WWV A;  4H6Z A;  5C88 A;  1CP7 A;  2PQ8 A;  1R3N A;  5G22 A;  1JQG A;  2ABZ A;  2AJ6 A;  1H8L A;  4MY3 A;  3TO7 A;  5JGF A;  4P4D A;  4NGP A;  4RN7 A;  4CYO A;  1IU8 A;  5A28 A;  2VL1 A;  4NGN A;  4UEE A;  4KOS A;  1YX0 A;  1Z5R A;  5LYD A;  3S6G A;  3IWW A;  4LQG A;  2ODF A;  3F5B A;  4MHP A;  3R96 A;  1S3Z A;  4QB9 A;  2R1I A;  5FVJ A;  2ZED A;  3IJ3 A;  5AG6 A;  5EBV A;  4B6Z A;  2XEF A;  2K5T A;  2B4B A;  3WT4 A;  2ZW4 A;  3SJG A;  2OZH A;  2PJA A;  3W6S A;  2OU2 A;  4X2T A;  4M6H A;  1Q2D A;  4KLW A;  4KZT A;  2G9D A;  4TNU A;  4KLV A;  4P6Y A;  4KUA A;  4UFV A;  1QSR A;  1Y0R A;  2ZEL A;  4UCN A;  4WJB A;  1ARL A;  3WC6 A;  1XMB A;  1BOB A;  1YW6 A;  1ZO0 A;  1CBX A;  3GYA A;  4M6I A;  2PC1 A;  2GRE A;  4AXV A;  1CX8 A;  1DTD A;  4OID A;  3RZA A;  3PB4 X;  4L89 A;  1Z8T A;  2JDD A;  3GKR A;  4P4I A;  2YGW A;  1NE9 A;  2V8G A;  1WK4 A;  2AE6 A;  2ZOG A;  2O53 A;  4EME A;  2PJC A;  3IEH A;  2PJ1 A;  2ZEP A;  2QYV A;  4DUK A;  1CP6 A;  2CF4 A;  3H8G A;  3PEI A;  5HVF A;  4ONW A;  3CPX A;  3DLJ A;  3ZZI A;  2WYR A;  2VZY A;  4P44 A;  1A2Z A;  3CT9 A;  3MN8 A;  3R1K A;  4TWE A;  2IQ6 A;  1QST A;  4CYP A;  2PRQ A;  1NSA A;  3PZJ A;  2QEC A;  4DJL A;  5JH9 A;  5F46 A;  4JYW A;  3H8F A;  3T90 A;  3IFE A;  2AFO A;  4ZX8 A;  3NE7 A;  1M1D A;  4PSX A;  3VWE A;  4EWT A;  4L8A A;  1M44 A;  3KI9 A;  4HPS A;  2FE7 A;  1TIQ A;  3TOA A;  3F0A A;  4ZGY B;  1UWY A;  3EFA A;  2PE3 A;  3FX6 A;  2GLJ A;  4OKO A;  4XNH C;  2PVW A;  2OZU A;  1FY7 A;  1OZP A;  4C2Y A;  4KOR A;  3CXQ A;  1PCA A;  3TT2 A;  4B14 A;  4CGP A;  4F0Y A;  3PBE A;  2JBJ A;  2R8V A;  3FJU A;  2FL4 A;  1BPN A;  1YLE A;  4G1P A;  1Z2L A;  3KAS A;  3RNZ A;  2DPS A;  2PRB A;  2J8M A;  3D68 A;  3K9U A;  5ISV A;  1FT7 A;  4DYO A;  2NYQ A;  2Z3L A;  5G20 A;  1S7F A;  1IIC A;  3G8W A;  3H8E A;  4PK3 A;  4CRY B;  3D2M A;  4A2Z A;  1YW4 A;  1HDU A;  3QAY A;  5HVG A;  1Y9W A;  4MCQ A;  3D67 A;  1Z8X A;  4KOY A;  1IYK A;  2QVP A;  5HMN A;  1K4J A;  4NSQ A;  2D4P A;  1QSN A;  2HV2 A;  4B5O A;  4KSA A;  4NEX A;  3CPA A;  4IUS A;  4KUB A;  2AFU A;  5F09 A;  2IJZ A;  2RC4 A;  3DNS A;  2G3T A;  1IID A;  3VH9 A;  1J4J A;  1L0C A;  2FS5 A;  3RBU A;  3D7F A;  4MFZ A;  2G3A A;  2ZEF A;  1ZLI A;  5IB0 A;  4XPD C;  1Z9U A;  1KUV A;  4LUA A;  1Y7E A;  5LRJ A;  4R57 A;  1LAP A;  2F7V A;  3ISX A;  2FSR A;  3C26 A;  2GE3 A;  3LAC A;  3CXP A;  4GXH A;  1R43 A;  2JEW A;  1I21 A;  3TC8 A;  4JZ0 A;  4KS9 A;  2V77 A;  4A95 A;  2P6G A;  4KVX A;  2AFX A;  2VQY A;  2ZW7 A;  4CAE A;  5F48 A;  4C2X A;  2RB7 A;  4ZX9 A;  2EK9 A;  2P0W A;  4C2Z A;  3FH4 A;  2DF5 A;  3KL9 A;  4XNH B;  2GLF A;  4OIW A;  5LYF A;  1XIX A;  4A32 A;  2V8D A;  3FED A;  2OR4 A;  4ZBG A;  2Z3N A;  2F8H A;  2GIV A;  4MY0 A;  3FBU A;  2EBJ A;  1XJO A;  4MFJ A;  1YME A;  2BO9 A;  3SI0 A;  4R87 A;  1YSJ A;  3LWU A;  3FEC A;  2Q0Y A;  3K2K A;  1DE4 C;  4RS2 A;  2ZPA A;  4JJX A;  4FUU A;  4C7I A;  4ZY0 A;  1YRE A;  3R9G A;  3FIX A;  1QQ9 A;  4F8Z A;  1LAM A;  4MCR A;  4CRZ B;  4IF5 A;  2IMO A;  3FRM A;  5CNP A;  3FF3 A;  3LMS A;  2PJ0 A;  4PPZ A;  4FD7 A;  2FT0 A;  3S6K A;  4FBE A;  2Q7S A;  1XE4 A;  4CYQ A;  1TXR A;  3MGD A;  2EUI A;  3V38 A;  1AYE A;  2XEG A;  4YFJ A;  3KHZ A;  1HDQ A;  5JPH A;  3BLN A;  2EWB A;  4JXR A;  3PB7 X;  5K8M A;  3CZX A;  3GLJ A;  1Y0Y A;  3B2Y A;  2VBQ A;  1X12 A;  2YNC A;  2B58 A;  3TTH A;  4R6T A;  1BAV A;  5H84 A;  2F5I A;  3RYO A;  4B13 A;  2GFQ A;  2REF A;  3BHX A;  2CNM A;  4IAV A;  1QMU A;  2EO8 A;  1ELM P;  5LYI A;  1B6B A;  4A38 A;  4FAI A;  3RO0 A;  4EFD A;  5IB9 A;  2C6P A;  4JD6 A;  2JBK A;  1TKH A;  4NJR A;  2J9A A;  2Q51 A;  2O4H A;  4XPL A;  3H4Q A;  2IL4 A; 
#chains in the Genus database with same CATH homology
 2PDO A;  1I1D A;  1XF8 A;  3B8G A;  1S7K A;  2B4D B;  4OLL A;  4E8O A;  3P2F A;  3BJ8 A;  2FIA A;  3CXS A;  5BWA B;  4KOU A;  4J3G A;  2ATR A;  4Q38 A;  4R3L A;  1WWZ A;  4AG9 A;  4CYN A;  4UWJ A;  2VZZ A;  1XEB A;  4Q36 A;  3EC4 A;  4LX9 A;  4RI1 A;  5E96 A;  2CY2 A;  4QUS A;  3EY5 A;  4B5P A;  3UY5 A;  1KUX A;  4F6A A;  4MHD A;  2BEI A;  1IYL A;  4A31 A;  4ONU A;  4K30 A;  1MJB A;  2Y0M A;  2EVN A;  2C27 A;  2ARH A;  2Z0Z A;  3D8P A;  4M85 A;  4A30 A;  2Z11 A;  3FNC A;  2YND A;  4JWP A;  4MBU A;  1S5K A;  5JQ4 A;  1MJA A;  1B87 A;  1RO5 A;  3V8I A;  2D4O A;  1M4D A;  5KTA A;  3LOD A;  1PU9 A;  1QSM A;  4B11 A;  2WUU A;  5AG7 A;  1GHE A;  2B3U A;  4MFP A;  3BJ7 A;  2ZW5 A;  4F0X A;  5H86 A;  3R95 A;  2B3V A;  1QSO A;  1V0C A;  2X7B A;  1XMT A;  3FXT A;  5HH1 A;  1IB1 E;  4QVT A;  2FXF A;  3IGR A;  3JVN A;  4AVB A;  3W91 A;  1Y9K A;  4UBR A;  4R3K A;  2CNS A;  4AB7 A;  2R7H A;  4XPD B;  5IX3 A;  2Q4V A;  1YGH A;  4UCP A;  4QBJ A;  3E0K A;  1RXT A;  2Q4Y A;  4HKF A;  4X5K A;  2GAN A;  1S60 A;  4MI4 A;  4E0A A;  1N71 A;  2ZW6 A;  4AVA A;  3SHP A;  4CGL A;  1YR0 A;  2DPT A;  5F47 A;  1Q2C A;  2B4D A;  2A4N A;  2YNE A;  1Z4R A;  3TFY A;  4MFK A;  4YRH A;  1MJ9 A;  2B5G A;  4H89 A;  2VXK A;  1KUY A;  1I12 A;  3PP9 A;  2WPW A;  2OZG A;  3SXO A;  4KOT A;  2CXA A;  4CS0 B;  4Y49 C;  2JEV A;  4A33 A;  2I00 A;  1KZF A;  2I79 A;  3JUW A;  3TOB A;  2NMT A;  4HNW B;  4AVC A;  5F49 A;  3ZJ0 A;  3EO4 A;  1M4G A;  1S7N A;  3IWG A;  2REE A;  3OWC A;  4CAW A;  3W6X A;  3WR7 A;  2HQY A;  5GCN A;  2FCK A;  4YGO A;  5DWN A;  3DR6 A;  3TO9 A;  4JXQ A;  4FD5 A;  4U9Z A;  4OAD A;  3LD2 A;  3S6F A;  2J8N A;  3D2P A;  4BMH A;  3GY9 A;  1S7L A;  4EVY A;  1SQH A;  4U5Y A;  2Q44 A;  2BSW A;  3F8K A;  1NMT A;  4B10 A;  2QML A;  3I9S A;  3IU2 A;  4JLY A;  4II9 A;  1P0H A;  4UA3 A;  3JTK A;  1CM0 A;  4UCM A;  2BUE A;  1MK4 A;  2Q7B A;  3T9Y A;  3I3G A;  4CGO A;  3QAH A;  2BL1 A;  5DWM A;  1ON0 A;  5EC4 A;  4CGM A;  2B5G B;  2VEZ A;  2H5M A;  4BBH A;  4NF1 A;  4CAX A;  2CNT A;  4FD4 A;  1VKC A;  4U9Y A;  4NCZ A;  4R9M A;  4KOV A;  4QC6 A;  3EXN A;  3TCV A;  1P4N A;  2Z3M A;  4KOX A;  5G1Z A;  2PR8 A;  1PUA A;  4HNY B;  4CAV A;  1UFH A;  3DDD A;  4AG7 A;  1YK3 A;  2J8R A;  4MFQ A;  3A9L A;  1Y7R A;  1R57 A;  4UWI A;  3QB8 A;  3IWE A;  1LRZ A;  2Z3P A;  1CJW A;  2DXQ A;  3VWD A;  4CGN A;  2R98 A;  5G21 A;  4DNC A;  4KOW A;  2KCW A;  4UFX A;  4PV6 A;  2P6F A;  3FB3 A;  4UFW A;  4HNX B;  5I0C A;  3TE4 A;  2P6E A;  1U6M A;  2JLM A;  3DR8 A;  2O28 A;  3G3S A;  4M3S A;  2PR1 A;  5J8F A;  1Q2Y A;  2WPX A;  4E2A A;  4ORF A;  4KVO E;  2ZXV A;  2JDC A;  2PSW A;  2YNC C;  2QIR A;  3H5Z A;  5J8C A;  4B5P B;  4CAF A;  3FYN A;  3IU1 A;  2HUZ A;  5AGE A;  3N7Z A;  4B12 A;  1NSL A;  4C68 A;  4Y49 B;  4C7H A;  3R9F A;  5C82 A;  4I49 A;  1Z4E A;  4H6U A;  5KTC A;  2OH1 A;  4XPK A;  5A27 A;  3DSB A;  2FIW A;  2G0B A;  4NXY A;  2VI7 A;  1YVO A;  2Z3O A;  2WSA A;  4PK2 A;  3SXN A;  2OB0 A;  1M4I A;  4MJ8 A;  2Z10 A;  2Z3K A;  5AG5 A;  1BO4 A;  3R9E A;  4GS4 A;  1YVK A;  3TO6 A;  5KTD A;  4OAE A;  4FD6 A;  2Q04 A;  3D3S A;  4KVM E;  4MFL A;  5AG4 A;  3S6H A;  4KSF A;  1VHS A;  3KKW A;  3P2H A;  5IV0 A;  3PGP A;  4PSW A;  4H6Z A;  5C88 A;  2PQ8 A;  5G22 A;  2AJ6 A;  4MY3 A;  3TO7 A;  4CYO A;  5A28 A;  4KOS A;  1YX0 A;  3S6G A;  3F5B A;  3R96 A;  1S3Z A;  4QB9 A;  2R1I A;  5FVJ A;  5AG6 A;  5EBV A;  2K5T A;  2B4B A;  2ZW4 A;  2OZH A;  3W6S A;  2OU2 A;  1Q2D A;  4KLW A;  4KZT A;  4KLV A;  4KUA A;  4UFV A;  1QSR A;  4UCN A;  1BOB A;  1ZO0 A;  3GYA A;  2PC1 A;  4L89 A;  2JDD A;  3GKR A;  2YGW A;  1NE9 A;  1WK4 A;  2AE6 A;  3ZZI A;  2VZY A;  3R1K A;  1QST A;  4CYP A;  3PZJ A;  2QEC A;  5F46 A;  3T90 A;  3NE7 A;  1M1D A;  4PSX A;  3VWE A;  4L8A A;  1M44 A;  2FE7 A;  1TIQ A;  3TOA A;  3F0A A;  4ZGY B;  3EFA A;  4XNH C;  2OZU A;  1FY7 A;  1OZP A;  4C2Y A;  4KOR A;  3CXQ A;  3TT2 A;  4CGP A;  4B14 A;  4F0Y A;  2R8V A;  2FL4 A;  1YLE A;  2DPS A;  2PRB A;  2J8M A;  3K9U A;  5ISV A;  5G20 A;  2Z3L A;  1S7F A;  1IIC A;  3G8W A;  4PK3 A;  4CRY B;  3D2M A;  4A2Z A;  1Y9W A;  4KOY A;  1IYK A;  5HMN A;  1K4J A;  4NSQ A;  2D4P A;  1QSN A;  2HV2 A;  4B5O A;  4KSA A;  4NEX A;  4IUS A;  4KUB A;  2RC4 A;  3DNS A;  2G3T A;  1IID A;  1J4J A;  1L0C A;  2FS5 A;  4MFZ A;  2G3A A;  5IB0 A;  4XPD C;  1Z9U A;  1KUV A;  4LUA A;  4R57 A;  2FSR A;  3C26 A;  2GE3 A;  3CXP A;  1I21 A;  4KS9 A;  4A95 A;  2P6G A;  4KVX A;  2VQY A;  2ZW7 A;  4CAE A;  5F48 A;  4C2X A;  2P0W A;  4C2Z A;  4XNH B;  1XIX A;  4A32 A;  4ZBG A;  2Z3N A;  2GIV A;  4MY0 A;  3FBU A;  4MFJ A;  4R87 A;  2Q0Y A;  4RS2 A;  4C7I A;  2ZPA A;  4JJX A;  1YRE A;  3R9G A;  3FIX A;  4CRZ B;  4IF5 A;  3FRM A;  5CNP A;  3S6K A;  4FD7 A;  2FT0 A;  1XE4 A;  4CYQ A;  3MGD A;  2EUI A;  4YFJ A;  5JPH A;  3BLN A;  4JXR A;  2VBQ A;  2YNC A;  2B58 A;  3TTH A;  5H84 A;  2F5I A;  3RYO A;  4B13 A;  2REF A;  2CNM A;  1B6B A;  4JD6 A;  4XPL A;  3H4Q A;  2IL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...