4KORA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with 7-aminocephalosporanic acid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 45
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4korA00
3CXPA 4UBRA 5F49A 4ORFA 2K5TA 2NMTA 1M1DA 1OZPA 4UA3A 4XPDB 1WWZA 3MGDA 1NMTA 4HNYB 2ZW7A 3T9YA 3C26A 4QB9A 4MHDA 4MY3A 3D8PA 4FD4A 4MBUA 3T90A 1I21A 1KZFA 3PGPA 2Z11A 2D4PA 4XNHC 2R98A 2OZGA 3FNCA 1XIXA 2Q44A 4E8OA 2FCKA 4OLLA 4XPLA 4II9A 2Q7BA 3G8WA 1PU9A 1S7KA 2Q4VA 4M85A 2QIRA 4XPDC 2I00A 2FS5A 1QSOA 3D3SA 3LODA 4B5PA 2VZYA 5IX3A 2P6EA 4EVYA 1Y7RA 2PQ8A 2G0BA 2JLMA 5H84A 1J4JA 4BMHA 3VWEA 1KUYA 2RC4A 2I79A 4E0AA 1B87A 3R96A 4R9MA 4CRYB 1YR0A 3LD2A 5C88A 2OU2A 1Q2DA 2FL4A 2VI7A 4JXQA 4KOXA 2EVNA 1Z9UA 3QB8A 1Q2YA 2J8NA 2B4DA 3R95A 4PK2A 2Z0ZA 3TFYA 2B3VA 1MJBA 3TOAA 4PV6A 1K4JA 5JPHA 2J8RA 5H86A 1LRZA 1XEBA 4KOVA 1BO4A 3H4QA 2WPXA 1IYLA 2REEA 2HQYA 2ZPAA 4R57A 1IIDA 3BJ7A 3DNSA 5E96A 3SXOA 3S6KA 4KUAA 4U9YA 2B5GA 2PSWA 4GS4A 2ATRA 2JDDA 4KOTA 3DSBA 4MI4A 3TO9A 4MY0A 1Y9KA 1QSRA 1KUXA 4JD6A 4E2AA 2FIWA 1IYKA 3FB3A 4AG7A 4CAXA 4QBJA 3CXQA 4JXRA 4PK3A 2FIAA 2FSRA 2G3AA 3W91A 3FRMA 4KOYA 3GY9A 2PR1A 3R9FA 3S6HA 1S7NA 2J8MA 4IF5A 3ZJ0A 2P6FA 4NSQA 4FD7A 4R3LA 2Y0MA 2ZW6A 1P0HA 4AVBA 4HKFA 1S3ZA 1RXTA 1M44A 5CNPA 1L0CA 3W6XA 4FD6A 4Y49B 4KZTA 4B5PB 2FXFA 5C82A 4CS0B 4KLVA 2CNMA 3PZJA 1Y9WA 1XE4A 2OB0A 5F48A 2H5MA 1M4IA 3TTHA 3JUWA 1QSTA 2PC1A 3P2FA 1VKCA 2PR8A 4YGOA 5HH1A 3EO4A 5JQ4A 5DWMA 1S7FA 2KCWA 3SXNA 2O28A 3FIXA 4H6UA 2PRBA 1CM0A 2B4DB 5I0CA 3D2PA 5IV0A 2Q04A 5EBVA 1N71A 1YVKA 4AG9A 1NSLA 1B6BA 4R3KA 2AJ6A 4Y49C 4QC6A 4I49A 3ZZIA 2CY2A 1MK4A 4NF1A 4KOUA 2PDOA 4OAEA 5KTDA 3F5BA 3EFAA 4JLYA 4F0YA 3BLNA 4K30A 3TO6A 2OH1A 4PSXA 3DR8A 1IICA 3RYOA 2BL1A 4NCZA 5J8CA 5KTAA 3VWDA 3D2MA 2QMLA 4IUSA 4RI1A 4FD5A 1YK3A 2BUEA 3IGRA 3GKRA 4KUBA 5KTCA 4LX9A 3G3SA 4JJXA 4KVOE 2B5GB 3EXNA 1IB1E 2DXQA 3W6SA 5FVJA 4RS2A 4OADA 4B5OA 3OWCA 1I1DA 1P4NA 2QECA 4NXYA 1UFHA 1QSNA 1SQHA 4U5YA 4KVXA 4YFJA 3E0KA 4LUAA 2GIVA 1V0CA 3QAHA 4QUSA 2VBQA 2BSWA 4J3GA 1Z4RA 4UWIA 1MJ9A 4CAWA 3I9SA 2CNSA 4L89A 4YRHA 2Z10A 1FY7A 1KUVA 2VZZA 1ON0A 2AE6A 1RO5A 2R1IA 2JEVA 3GYAA 4M3SA 5DWNA 4NEXA 1M4DA 2HV2A 3S6FA 1S60A 3TE4A 2OZHA 4U9ZA 3F0AA 4KOSA 3B8GA 3R9EA 1TIQA 2EUIA 2P0WA 1WK4A 1YVOA 3TT2A 4F6AA 4R87A 4HNWB 1PUAA 3F8KA 1NE9A 1S7LA 2ZW5A 1S5KA 2R7HA 2ZW4A 2CNTA 1YLEA 2P6GA 1Z4EA 3DR6A 2GANA 3K9UA 2VXKA 3SHPA 2B4BA 4L8AA 5HMNA 1CJWA 1QSMA 3TOBA 4ZBGA 4CAVA 4CRZB 4KLWA 3I3GA 4H89A 4AB7A 2A4NA 3P2HA 2R8VA 4KORA 1U6MA 2D4OA 3TO7A 4DNCA 2IL4A 5J8FA 3FBUA 2HUZA 4MJ8A 3EY5A 3V8IA 1I12A 1XMTA 2BEIA 2FE7A 2FT0A 3IWGA 2GE3A 4XPKA 1YREA 1XF8A 1MJAA 2OZUA 2B3UA 3R9GA 3NE7A 4KVME 3EC4A 3WR7A 3N7ZA 3KKWA 2VQYA 2Q4YA 3BJ8A 4KOWA 1YX0A 4UWJA 3UY5A 2C27A 4AVAA 2VEZA 2ARHA 3S6GA 1GHEA 3CXSA 4JWPA 3PP9A 5F46A 5GCNA 2X7BA 5ISVA 2WPWA 4H6ZA 3FYNA 1R57A 1YGHA 2JDCA 2ZXVA 2G3TA 3DDDA 1Q2CA 5F47A 5IB0A 3TCVA 1VHSA 3FXTA 1BOBA 2F5IA 4XNHB 3JVNA 2Q0YA 4X5KA 4AVCA 2REFA 3R1KA 2B58A 4PSWA 4HNXB 4ONUA 4QVTA 1M4GA 5EC4A
chains in the Genus database with same CATH superfamily
3GIUA 4ZY0A 2JBJA 4MMOA 5JM6A 3IIBA 3CXPA 4UBRA 3K2KA 4H2KA 5F49A 4ORFA 2GFQA 2K5TA 1M1DA 1OZPA 2NMTA 4P45A 5CPAA 4UA3A 4XPDB 1WWZA 3MGDA 4B13A 2BO9A 1NMTA 4HNYB 1Y0RA 4P4EA 2ZW7A 2AFXA 3T9YA 3C26A 4QB9A 4CGOA 4MHDA 3SI1A 4MY3A 2F8HA 4YU9A 4C7HA 1YQEA 2Z3MA 3NH4A 4C2YA 3I1UA 3PB8X 3D8PA 5BWAB 4FD4A 3WC7A 4MBUA 3T90A 4C2XA 3IEHA 2IJZA 5K8PA 3QNVA 1I21A 1KZFA 2FVGA 1XFOA 1CP7A 4NGTA 4BBHA 4CPAA 4OIDA 3PGPA 1TKFA 2Z11A 1TF8A 2D4PA 2ZOGA 3IJ3A 2V8DA 4XNHC 2R98A 2OZGA 5F09A 2ODFA 4P4BA 3VARA 3FNCA 1XIXA 2HC9A 2Q44A 4E8OA 1F57A 3D67A 4P4JA 2WYRA 3SJGA 2FCKA 4OLLA 4XPLA 1PCAA 4II9A 1KWMA 4B6ZA 2VL1A 4ZY1A 2AFSA 2JBKA 2Q7BA 2ZOFA 3G8WA 3SJXA 7CPAA 1PU9A 5HVFA 1S7KA 4MFLA 3L2NA 4R76A 4UIBA 4CGLA 4EFDA 2Q4VA 2EBJA 2PRQA 4P6YA 4M85A 4UIAA 2QIRA 1Z8TA 3FX6A 4XPDC 4X3RA 5LYFA 4M6IA 3WT4A 4UEZA 4A37A 3JRUA 4PXEA 2I00A 2FS5A 1VIXA 4G1PA 4Q7AA 4PQAA 1QSOA 3D3SA 3LODA 4B5PA 3A9LA 5HVHA 2VZYA 3IU2A 5IX3A 2P6EA 3B3TA 4UFXA 3TC8A 3JTKA 4EVYA 1Y7RA 2CTBA 1XRYA 2PQ8A 2G0BA 4OP4A 1AMPA 2JLMA 2BOAA 5H84A 1J4JA 3HLPA 1JQGA 4MHPA 4NJQA 4BMHA 3VWEA 1KUYA 2RC4A 1IGBA 1R3NA 2I79A 4E0AA 2C6GA 5LRKA 1B87A 3R96A 4A94A 4BINA 4R9MA 4CRYB 1YR0A 3IWEA 3T8WA 3LD2A 1YLOA 5C88A 2OU2A 1CBXA 2Z3LA 4LQ6A 4PXCA 4ZY2A 1Q2DA 2FL4A 2VI7A 2Z3NA 4JXQA 3D7FA 4KOXA 2EVNA 1Z9UA 3QB8A 5G20A 4EMEA 4NGPA 2GREA 5AGEA 1Q2YA 3CPAA 2PJ2A 2QYVA 5A27A 5JGFA 2J8NA 2B4DA 3FMCA 1CPSA 3R95A 5THWA 2XEGA 4PK2A 2EWBA 2Z0ZA 3TFYA 2PJ7A 2YGWA 2PJ9A 2B3VA 1MJBA 3TOAA 4PV6A 2I3CA 3S9NA 3RBUA 1ZLHA 1XOVA 1Y0YA 4ZYQA 4OC5A 3H8FA 4F8ZA 2WUUA 1K4JA 4WJBA 5JPHA 5G21A 2CTCA 2J8RA 5H86A 3HUVA 1HDUA 1OBRA 4UF4A 1LRZA 1PYTB 1XEBA 4KOVA 3H5ZA 2V8VA 2ZEDA 1TKHA 1BO4A 3TX8A 3H4QA 2WPXA 3GLJA 1ZLIA 4A2ZA 1NSAA 2Q43A 2YNCC 5AG6A 3BHXA 2ANPA 1IYLA 3D68A 4Z65A 2REEA 3B35A 2PJ3A 3NH8A 4ZX8A 2HQYA 2ZPAA 3PFOA 4R57A 3GB0A 1IIDA 2O4HA 3BJ7A 3DNSA 5E96A 2CF4A 4B11A 4MFJA 3SXOA 3B3CA 4UEEA 2GLJA 1LANA 3QAYA 3S6KA 3LWUA 2CXAA 4KUAA 3PRTA 4F0YA 4U9YA 2B5GA 3PB6X 2PSWA 3FJUA 3KHZA 3NFZA 4GS4A 5AG4A 1Q7LA 2ATRA 2JDDA 4KOTA 1ZG9A 3DSBA 4MI4A 1IY7A 4AXVA 3IFEA 3TO9A 1Z2LA 3D7GA 3FF3A 1Y9KA 4MY0A 1ELLP 4NGNA 4P4DA 3RO0A 1QSRA 2DPTA 1KUXA 4GXHA 4JD6A 4E2AA 2FIWA 4MFPA 2OOTA 1CX8A 3H8EA 1IYKA 3FB3A 4MHYA 4RN7A 3V38A 1BPNA 3K9TA 4OIWA 4AG7A 4CAXA 4K3NA 1UWYA 4QBJA 1FT7A 3CXQA 4OC1A 2PVWA 5DS0A 4JZ0A 4JXRA 4R7MA 4P4IA 4PK3A 4NFRA 2FIAA 2FSRA 2PJ5A 2G3AA 2Q4ZA 4MXUA 4UCNA 4LQGA 4FUUA 1ARMA 4CAEA 3W91A 3FRMA 4KOYA 4BD9A 4OKOA 4EWTA 3S9LA 1HEEA 2IMOA 3GY9A 4R8FA 4KSAA 2PJ1A 4UCMA 2PR1A 1BAVA 3R9FA 1S7NA 2J8MA 4IF5A 3S6HA 3ZJ0A 2RFHA 1BLLE 2P6FA 3CDXA 4MRIA 2PIYA 2ZEFA 4NSQA 2PJ6A 1DE4C 4FD7A 4RUHA 4R3LA 2NYQA 2Y0MA 2ZW6A 1P0HA 2PJ0A 3LACA 4AVBA 4HKFA 1S3ZA 5JH9A 1RXTA 3H8GA 1M44A 4JYWA 5CNPA 1L0CA 3RZAA 4NGQA 3W6XA 4FD6A 4Y49B 4KZTA 4B5PB 3FEDA 2J9AA 2FXFA 5G1ZA 5C82A 4CS0B 4KLVA 2CNMA 3D7HA 3KASA 2Z3KA 3PZJA 1Y9WA 3D7DA 1XE4A 4MCPA 2AFWA 2EK9A 2OB0A 5F48A 2HB6A 4MHZA 2H5MA 2RB7A 4A39A 2NSMA 1M4IA 3TTHA 5ELYA 1VGYA 3JUWA 2V77A 1QSTA 2PC1A 3P2FA 1VKCA 2PR8A 1R43A 4YGOA 4B12A 4DUKA 2POKA 2GLFA 5HH1A 2ZEPA 3EO4A 2AFUA 1AYEA 4A30A 5JQ4A 2C1CA 2C6CA 1FNOA 1TF9A 5DWMA 1S7FA 2KCWA 3FVLA 2O28A 3FIXA 3SXNA 4H6UA 2OR4A 5HXDA 2PRBA 1CM0A 2B4DB 4OC3A 5I0CA 3D2PA 4Q36A 2Q04A 5EBVA 5IV0A 5K8OA 1N71A 1YVKA 4AG9A 4F9VA 4P4FA 3KR4A 1NSLA 2AFOA 1B6BA 4R3KA 2AJ6A 4Y49C 4QC6A 4FAIA 3KHXA 4I49A 3ZZIA 4A38A 5LYDA 3SJEA 2CY2A 1MK4A 4NF1A 1IOFA 4B14A 4KOUA 4O23A 2PDOA 4OAEA 5KTDA 2F7VA 3F5BA 4P44A 1TKJA 3V7ZA 3PB9X 2G9DA 3EFAA 3ISXA 4JLYA 1A2ZA 2ZEEA 1LOKA 3BLNA 4K30A 4WWVA 3TO6A 3WC6A 2OH1A 4PSXA 3DR8A 1IICA 3RYOA 2BL1A 4CAFA 3NE8A 4NCZA 4NGMA 2CIJA 5LRJA 2XEIA 1ZG8A 5J8CA 2V8HA 4X2TA 5KTAA 5CBMA 3RNZA 3VWDA 3D2MA 2QMLA 4DYOA 2JEWA 3WABA 4P10A 1GYTA 3D66A 1Z8XA 4F0XA 1XMBA 2Z3PA 4IUSA 4RI1A 1ZG7A 3PBBA 4FD5A 4DJLA 4MCRA 5J1QA 1YK3A 1LAMA 2BUEA 3GKRA 3IGRA 4KUBA 5KTCA 3S9MA 4LX9A 4UCPA 2YNEA 4NGRA 3G3SA 1VHEA 4JJXA 4KVOE 2B5GB 2O53A 3EXNA 1IB1E 2DXQA 2BCOA 1H8LA 3W6SA 1ARLA 1AUGA 5AG7A 5FVJA 4YWYA 4RS2A 2PJ4A 3IU1A 4Q38A 4W9YA 4C7IA 3SJFA 3MRUA 4OADA 4TNUA 4B5OA 3GUXA 3FH4A 3OWCA 3PFEA 1I1DA 1P4NA 5EMIA 2QECA 4NXYA 5LRGA 1X10A 1ZO0A 2DEAA 3PEIA 1UFHA 1QSNA 1SQHA 2PJAA 1QMUA 4M6HA 4KVXA 4U5YA 4C68A 8CPAA 4UFWA 4YFJA 2XEJA 4A32A 3E0KA 3PBEA 4LUAA 2GIVA 2Z3OA 1V0CA 3QAHA 4UEFA 4QUSA 1YSJA 2BSWA 2VBQA 1BPMA 4C2ZA 1Z8WA 4J3GA 4IHMA 1Z4RA 3KL9A 1ELMP 3D4UA 4UWIA 1HDQA 1MJ9A 4CAWA 3I9SA 2CNSA 2EK8A 4L89A 2PJ8A 4YRHA 4F9UA 2Z10A 5HVGA 1FY7A 1X12A 1M4LA 5IB9A 2Q51A 1KUVA 4A33A 2AFMA 2VZZA 4ZI6A 1ON0A 2PIZA 3FECA 1CPXA 2AE6A 3LMSA 4UFVA 1YW6A 3PB4X 1XJOA 1RO5A 2PE3A 3N5FA 2R1IA 2JEVA 3GYAA 3KGQA 4M3SA 4M6GA 4X8IA 5LYLA 5DWNA 3IO1A 1M4DA 3ISZA 2HV2A 2Q7SA 1EE3P 4NEXA 4NJRA 3S6FA 4A95A 1S60A 3TE4A 2OZHA 3MN8A 4HPSA 4R6TA 4CYNA 4U9ZA 2WZNA 3F0AA 4KOSA 3B8GA 3BXMA 2EO8A 3R9EA 1TIQA 2EUIA 3B7IA 2P0WA 3NA6A 1WK4A 1YVOA 4PXDA 3TT2A 3CT9A 4F6AA 4GM5A 4HNWB 4OC2A 4R87A 1PUAA 3F8KA 1NE9A 1S7LA 2ZW5A 3VATA 1S5KA 2R7HA 1IOIA 2ZW4A 5A28A 3SI2A 2CNTA 2DF5A 1YLEA 3KQXA 2P6GA 1Z4EA 3DR6A 2GANA 3K9UA 2VXKA 1Y7EA 3SHPA 2ZEMA 2B4BA 4L8AA 5HMNA 4MCQA 3SI0A 3B2YA 4OMEA 5D8NA 1RTQA 1CJWA 3RAMA 2GU2A 1QSMA 4PXBA 3TOBA 1QQ9A 4CYQA 4ZBGA 4MFZA 3PB7X 3FEEA 4CAVA 4CRZB 4KLWA 3I3GA 4CYOA 4H89A 2ZELA 3IC1A 4TWEA 4AB7A 1LAPA 2PCUA 4IK2A 2A4NA 2ZENA 5I4MA 2V8GA 3P2HA 2R8VA 4KORA 1U6MA 2D4OA 2PJCA 3BI0A 3TO7A 3KR5A 4MHNA 4OC4A 2IL4A 3VH9A 4DNCA 1F2OA 1TXRA 4CGPA 4FBEA 4ZGYB 3B3WA 4KS9A 5J8FA 3KI9A 3FBUA 2HUZA 4MJ8A 1CP6A 4KSIA 4FWUA 3EY5A 1IU8A 3B3SA 3V8IA 1Z8LA 1I12A 4PPZA 2ZEOA 3BI1A 3KZWA 1XMTA 2BEIA 2ZEHA 3KQZA 2FE7A 2FT0A 3B3VA 3IWGA 2ABZA 2GE3A 5LYIA 2C6PA 2YNCA 4XPKA 1YREA 2AFZA 1XBUA 1MJAA 1XF8A 2OZUA 1DTDA 2PVVA 2B3UA 3DGVA 1JWQA 3R9GA 3NE7A 4KVME 4OC0A 3EC4A 3WR7A 5K8MA 3N7ZA 5D29A 3WC5A 2QJ8A 3KKWA 2VQYA 2Q4YA 4MFQA 2YNDA 4A31A 3BJ8A 4KOWA 1YX0A 4UWJA 3UY5A 2C27A 2WSAA 4AVAA 4CYPA 2IQ6A 2VEZA 2ARHA 2PJBA 3IWWA 3S6GA 5G22A 1GHEA 3CXSA 4CGMA 4JWPA 3PP9A 5F46A 5GCNA 2X7BA 1YW4A 5ISVA 4ZX9A 2WPWA 6CPAA 1VHOA 4H6ZA 4CGNA 3FYNA 1R57A 1YGHA 1Z5RA 1F2PA 2QVPA 2JDCA 4NGSA 2ZXVA 2G3TA 4IAVA 4MCSA 3DDDA 1Q2CA 5F47A 5IB0A 1YMEA 4B10A 3TCVA 1VHSA 3FXTA 1BOBA 1LCPA 5AG5A 1CG2A 2F5IA 4XNHB 4ONWA 4KSFA 2XEFA 1LFWA 2Q0YA 3CZXA 3JVNA 5K8NA 3DLJA 2ZEGA 4MFKA 4X5KA 2REFA 4AVCA 3R1KA 2DPSA 2B58A 3NH5A 4PSWA 4HNXB 4ONUA 4QVTA 1M4GA 3CPXA 5EC4A
chains in the Genus database with same CATH topology
3CXPA 4UBRA 5F49A 4ORFA 2K5TA 2NMTA 1M1DA 1OZPA 4UA3A 4XPDB 1WWZA 3MGDA 4B13A 1NMTA 4HNYB 2ZW7A 3T9YA 4CGOA 3C26A 4QB9A 4MHDA 4MY3A 4C7HA 2Z3MA 4C2YA 3D8PA 5BWAB 4FD4A 4C2XA 4MBUA 3T90A 1I21A 1KZFA 4BBHA 3PGPA 2Z11A 2D4PA 4XNHC 2R98A 2OZGA 3FNCA 1XIXA 2Q44A 4E8OA 2FCKA 4OLLA 4XPLA 4II9A 2Q7BA 3G8WA 1PU9A 1S7KA 4MFLA 4CGLA 2Q4VA 4M85A 2QIRA 4XPDC 2I00A 2FS5A 1QSOA 3D3SA 3LODA 4B5PA 3A9LA 2VZYA 3IU2A 5IX3A 2P6EA 4UFXA 3JTKA 4EVYA 1Y7RA 2PQ8A 2G0BA 2JLMA 5H84A 1J4JA 4BMHA 3VWEA 1KUYA 2RC4A 2I79A 4E0AA 1B87A 3R96A 4R9MA 4CRYB 1YR0A 3IWEA 3LD2A 5C88A 2OU2A 2Z3LA 1Q2DA 2FL4A 2VI7A 2Z3NA 4JXQA 4KOXA 2EVNA 1Z9UA 3QB8A 5G20A 5AGEA 1Q2YA 5A27A 2J8NA 2B4DA 3R95A 4PK2A 2Z0ZA 3TFYA 2YGWA 2B3VA 1MJBA 3TOAA 4PV6A 2WUUA 1K4JA 5JPHA 5G21A 2J8RA 5H86A 1LRZA 1XEBA 4KOVA 3H5ZA 1BO4A 3H4QA 2WPXA 4A2ZA 2YNCC 5AG6A 1IYLA 2REEA 2HQYA 2ZPAA 4R57A 1IIDA 3BJ7A 3DNSA 5E96A 4B11A 4MFJA 3SXOA 3S6KA 2CXAA 4KUAA 4U9YA 2B5GA 2PSWA 4GS4A 5AG4A 2ATRA 2JDDA 4KOTA 3DSBA 4MI4A 3TO9A 4MY0A 1Y9KA 1QSRA 2DPTA 1KUXA 4JD6A 4E2AA 2FIWA 4MFPA 1IYKA 3FB3A 4AG7A 4CAXA 4QBJA 3CXQA 4JXRA 4PK3A 2FIAA 2FSRA 2G3AA 4UCNA 4CAEA 3W91A 3FRMA 4KOYA 3GY9A 4KSAA 4UCMA 2PR1A 3R9FA 3S6HA 1S7NA 2J8MA 4IF5A 3ZJ0A 2P6FA 4NSQA 4FD7A 4R3LA 2Y0MA 2ZW6A 1P0HA 4AVBA 4HKFA 1S3ZA 1RXTA 1M44A 5CNPA 1L0CA 3W6XA 4FD6A 4Y49B 4KZTA 4B5PB 2FXFA 5G1ZA 5C82A 4CS0B 4KLVA 2CNMA 2Z3KA 3PZJA 1Y9WA 1XE4A 2OB0A 5F48A 2H5MA 1M4IA 3TTHA 3JUWA 1QSTA 2PC1A 3P2FA 1VKCA 2PR8A 4YGOA 4B12A 5HH1A 3EO4A 4A30A 5JQ4A 5DWMA 1S7FA 2KCWA 3SXNA 2O28A 3FIXA 4H6UA 2PRBA 1CM0A 2B4DB 5I0CA 3D2PA 4Q36A 2Q04A 5EBVA 5IV0A 1N71A 1YVKA 4AG9A 1NSLA 1B6BA 4R3KA 2AJ6A 4Y49C 4QC6A 4I49A 3ZZIA 2CY2A 1MK4A 4NF1A 4B14A 4KOUA 2PDOA 4OAEA 5KTDA 3F5BA 3EFAA 4JLYA 4F0YA 3BLNA 4K30A 3TO6A 2OH1A 4PSXA 3DR8A 1IICA 3RYOA 2BL1A 4CAFA 4NCZA 5J8CA 5KTAA 3VWDA 3D2MA 2QMLA 4F0XA 2Z3PA 4IUSA 4RI1A 4FD5A 1YK3A 2BUEA 3IGRA 3GKRA 4KUBA 5KTCA 4LX9A 4UCPA 2YNEA 3G3SA 4JJXA 4KVOE 2B5GB 3EXNA 1IB1E 2DXQA 3W6SA 5AG7A 5FVJA 4RS2A 3IU1A 4Q38A 4C7IA 4OADA 4B5OA 3OWCA 1I1DA 1P4NA 2QECA 4NXYA 1ZO0A 1UFHA 1QSNA 1SQHA 4U5YA 4C68A 4KVXA 4UFWA 4YFJA 4A32A 3E0KA 4LUAA 2GIVA 2Z3OA 1V0CA 3QAHA 4QUSA 2VBQA 2BSWA 4C2ZA 4J3GA 1Z4RA 4UWIA 1MJ9A 4CAWA 3I9SA 2CNSA 4L89A 4YRHA 2Z10A 1FY7A 4A33A 1KUVA 2VZZA 1ON0A 2AE6A 4UFVA 1RO5A 2R1IA 2JEVA 3GYAA 4M3SA 5DWNA 4NEXA 1M4DA 2HV2A 3S6FA 4A95A 1S60A 3TE4A 2OZHA 4CYNA 4U9ZA 3F0AA 4KOSA 3B8GA 3R9EA 1TIQA 2EUIA 2P0WA 1WK4A 1YVOA 3TT2A 4F6AA 4R87A 4HNWB 1PUAA 3F8KA 1NE9A 1S7LA 2ZW5A 1S5KA 2R7HA 2ZW4A 5A28A 2CNTA 4MFZA 1YLEA 2P6GA 1Z4EA 3DR6A 2GANA 3K9UA 2VXKA 3SHPA 2B4BA 4L8AA 5HMNA 1CJWA 1QSMA 3TOBA 4CYQA 4ZBGA 4CAVA 4CRZB 4KLWA 3I3GA 4CYOA 4H89A 4AB7A 2A4NA 3P2HA 2R8VA 4KORA 1U6MA 2D4OA 3TO7A 4DNCA 2IL4A 4CGPA 5J8FA 4ZGYB 4KS9A 3FBUA 2HUZA 4MJ8A 3EY5A 3V8IA 1I12A 1XMTA 2BEIA 2FE7A 2FT0A 3IWGA 2GE3A 2YNCA 4XPKA 1YREA 1XF8A 1MJAA 2OZUA 2B3UA 3R9GA 3NE7A 4KVME 3EC4A 3WR7A 3N7ZA 3KKWA 2VQYA 2Q4YA 4MFQA 2YNDA 4A31A 3BJ8A 4KOWA 1YX0A 4UWJA 3UY5A 2C27A 2WSAA 4AVAA 4CYPA 2VEZA 2ARHA 3S6GA 5G22A 1GHEA 3CXSA 4CGMA 4JWPA 3PP9A 5F46A 5GCNA 2X7BA 5ISVA 2WPWA 4H6ZA 4CGNA 3FYNA 1R57A 1YGHA 2JDCA 2ZXVA 2G3TA 3DDDA 1Q2CA 5F47A 5IB0A 4B10A 3TCVA 1VHSA 3FXTA 1BOBA 5AG5A 2F5IA 4XNHB 4KSFA 3JVNA 2Q0YA 4MFKA 4X5KA 4AVCA 2REFA 3R1KA 2DPSA 2B58A 4PSWA 4HNXB 4ONUA 4QVTA 1M4GA 5EC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXP A;  4UBR A;  5F49 A;  4ORF A;  2K5T A;  2NMT A;  1M1D A;  1OZP A;  4UA3 A;  4XPD B;  1WWZ A;  3MGD A;  1NMT A;  4HNY B;  2ZW7 A;  3T9Y A;  3C26 A;  4QB9 A;  4MHD A;  4MY3 A;  3D8P A;  4FD4 A;  4MBU A;  3T90 A;  1I21 A;  1KZF A;  3PGP A;  2Z11 A;  2D4P A;  4XNH C;  2R98 A;  2OZG A;  3FNC A;  1XIX A;  2Q44 A;  4E8O A;  2FCK A;  4OLL A;  4XPL A;  4II9 A;  2Q7B A;  3G8W A;  1PU9 A;  1S7K A;  2Q4V A;  4M85 A;  2QIR A;  4XPD C;  2I00 A;  2FS5 A;  1QSO A;  3D3S A;  3LOD A;  4B5P A;  2VZY A;  5IX3 A;  2P6E A;  4EVY A;  1Y7R A;  2PQ8 A;  2G0B A;  2JLM A;  5H84 A;  1J4J A;  4BMH A;  3VWE A;  1KUY A;  2RC4 A;  2I79 A;  4E0A A;  1B87 A;  3R96 A;  4R9M A;  4CRY B;  1YR0 A;  3LD2 A;  5C88 A;  2OU2 A;  1Q2D A;  2FL4 A;  2VI7 A;  4JXQ A;  4KOX A;  2EVN A;  1Z9U A;  3QB8 A;  1Q2Y A;  2J8N A;  2B4D A;  3R95 A;  4PK2 A;  2Z0Z A;  3TFY A;  2B3V A;  1MJB A;  3TOA A;  4PV6 A;  1K4J A;  5JPH A;  2J8R A;  5H86 A;  1LRZ A;  1XEB A;  4KOV A;  1BO4 A;  3H4Q A;  2WPX A;  1IYL A;  2REE A;  2HQY A;  2ZPA A;  4R57 A;  1IID A;  3BJ7 A;  3DNS A;  5E96 A;  3SXO A;  3S6K A;  4KUA A;  4U9Y A;  2B5G A;  2PSW A;  4GS4 A;  2ATR A;  2JDD A;  4KOT A;  3DSB A;  4MI4 A;  3TO9 A;  4MY0 A;  1Y9K A;  1QSR A;  1KUX A;  4JD6 A;  4E2A A;  2FIW A;  1IYK A;  3FB3 A;  4AG7 A;  4CAX A;  4QBJ A;  3CXQ A;  4JXR A;  4PK3 A;  2FIA A;  2FSR A;  2G3A A;  3W91 A;  3FRM A;  4KOY A;  3GY9 A;  2PR1 A;  3R9F A;  3S6H A;  1S7N A;  2J8M A;  4IF5 A;  3ZJ0 A;  2P6F A;  4NSQ A;  4FD7 A;  4R3L A;  2Y0M A;  2ZW6 A;  1P0H A;  4AVB A;  4HKF A;  1S3Z A;  1RXT A;  1M44 A;  5CNP A;  1L0C A;  3W6X A;  4FD6 A;  4Y49 B;  4KZT A;  4B5P B;  2FXF A;  5C82 A;  4CS0 B;  4KLV A;  2CNM A;  3PZJ A;  1Y9W A;  1XE4 A;  2OB0 A;  5F48 A;  2H5M A;  1M4I A;  3TTH A;  3JUW A;  1QST A;  2PC1 A;  3P2F A;  1VKC A;  2PR8 A;  4YGO A;  5HH1 A;  3EO4 A;  5JQ4 A;  5DWM A;  1S7F A;  2KCW A;  3SXN A;  2O28 A;  3FIX A;  4H6U A;  2PRB A;  1CM0 A;  2B4D B;  5I0C A;  3D2P A;  5IV0 A;  2Q04 A;  5EBV A;  1N71 A;  1YVK A;  4AG9 A;  1NSL A;  1B6B A;  4R3K A;  2AJ6 A;  4Y49 C;  4QC6 A;  4I49 A;  3ZZI A;  2CY2 A;  1MK4 A;  4NF1 A;  4KOU A;  2PDO A;  4OAE A;  5KTD A;  3F5B A;  3EFA A;  4JLY A;  4F0Y A;  3BLN A;  4K30 A;  3TO6 A;  2OH1 A;  4PSX A;  3DR8 A;  1IIC A;  3RYO A;  2BL1 A;  4NCZ A;  5J8C A;  5KTA A;  3VWD A;  3D2M A;  2QML A;  4IUS A;  4RI1 A;  4FD5 A;  1YK3 A;  2BUE A;  3IGR A;  3GKR A;  4KUB A;  5KTC A;  4LX9 A;  3G3S A;  4JJX A;  4KVO E;  2B5G B;  3EXN A;  1IB1 E;  2DXQ A;  3W6S A;  5FVJ A;  4RS2 A;  4OAD A;  4B5O A;  3OWC A;  1I1D A;  1P4N A;  2QEC A;  4NXY A;  1UFH A;  1QSN A;  1SQH A;  4U5Y A;  4KVX A;  4YFJ A;  3E0K A;  4LUA A;  2GIV A;  1V0C A;  3QAH A;  4QUS A;  2VBQ A;  2BSW A;  4J3G A;  1Z4R A;  4UWI A;  1MJ9 A;  4CAW A;  3I9S A;  2CNS A;  4L89 A;  4YRH A;  2Z10 A;  1FY7 A;  1KUV A;  2VZZ A;  1ON0 A;  2AE6 A;  1RO5 A;  2R1I A;  2JEV A;  3GYA A;  4M3S A;  5DWN A;  4NEX A;  1M4D A;  2HV2 A;  3S6F A;  1S60 A;  3TE4 A;  2OZH A;  4U9Z A;  3F0A A;  4KOS A;  3B8G A;  3R9E A;  1TIQ A;  2EUI A;  2P0W A;  1WK4 A;  1YVO A;  3TT2 A;  4F6A A;  4R87 A;  4HNW B;  1PUA A;  3F8K A;  1NE9 A;  1S7L A;  2ZW5 A;  1S5K A;  2R7H A;  2ZW4 A;  2CNT A;  1YLE A;  2P6G A;  1Z4E A;  3DR6 A;  2GAN A;  3K9U A;  2VXK A;  3SHP A;  2B4B A;  4L8A A;  5HMN A;  1CJW A;  1QSM A;  3TOB A;  4ZBG A;  4CAV A;  4CRZ B;  4KLW A;  3I3G A;  4H89 A;  4AB7 A;  2A4N A;  3P2H A;  2R8V A;  4KOR A;  1U6M A;  2D4O A;  3TO7 A;  4DNC A;  2IL4 A;  5J8F A;  3FBU A;  2HUZ A;  4MJ8 A;  3EY5 A;  3V8I A;  1I12 A;  1XMT A;  2BEI A;  2FE7 A;  2FT0 A;  3IWG A;  2GE3 A;  4XPK A;  1YRE A;  1XF8 A;  1MJA A;  2OZU A;  2B3U A;  3R9G A;  3NE7 A;  4KVM E;  3EC4 A;  3WR7 A;  3N7Z A;  3KKW A;  2VQY A;  2Q4Y A;  3BJ8 A;  4KOW A;  1YX0 A;  4UWJ A;  3UY5 A;  2C27 A;  4AVA A;  2VEZ A;  2ARH A;  3S6G A;  1GHE A;  3CXS A;  4JWP A;  3PP9 A;  5F46 A;  5GCN A;  2X7B A;  5ISV A;  2WPW A;  4H6Z A;  3FYN A;  1R57 A;  1YGH A;  2JDC A;  2ZXV A;  2G3T A;  3DDD A;  1Q2C A;  5F47 A;  5IB0 A;  3TCV A;  1VHS A;  3FXT A;  1BOB A;  2F5I A;  4XNH B;  3JVN A;  2Q0Y A;  4X5K A;  4AVC A;  2REF A;  3R1K A;  2B58 A;  4PSW A;  4HNX B;  4ONU A;  4QVT A;  1M4G A;  5EC4 A; 
#chains in the Genus database with same CATH topology
 3GIU A;  4ZY0 A;  2JBJ A;  4MMO A;  5JM6 A;  3IIB A;  3CXP A;  4UBR A;  3K2K A;  4H2K A;  5F49 A;  4ORF A;  2GFQ A;  2K5T A;  1M1D A;  1OZP A;  2NMT A;  4P45 A;  5CPA A;  4UA3 A;  4XPD B;  1WWZ A;  3MGD A;  4B13 A;  2BO9 A;  1NMT A;  4HNY B;  1Y0R A;  4P4E A;  2ZW7 A;  2AFX A;  3T9Y A;  3C26 A;  4QB9 A;  4CGO A;  4MHD A;  3SI1 A;  4MY3 A;  2F8H A;  4YU9 A;  4C7H A;  1YQE A;  2Z3M A;  3NH4 A;  4C2Y A;  3I1U A;  3PB8 X;  3D8P A;  5BWA B;  4FD4 A;  3WC7 A;  4MBU A;  3T90 A;  4C2X A;  3IEH A;  2IJZ A;  5K8P A;  3QNV A;  1I21 A;  1KZF A;  2FVG A;  1XFO A;  1CP7 A;  4NGT A;  4BBH A;  4CPA A;  4OID A;  3PGP A;  1TKF A;  2Z11 A;  1TF8 A;  2D4P A;  2ZOG A;  3IJ3 A;  2V8D A;  4XNH C;  2R98 A;  2OZG A;  5F09 A;  2ODF A;  4P4B A;  3VAR A;  3FNC A;  1XIX A;  2HC9 A;  2Q44 A;  4E8O A;  1F57 A;  3D67 A;  4P4J A;  2WYR A;  3SJG A;  2FCK A;  4OLL A;  4XPL A;  1PCA A;  4II9 A;  1KWM A;  4B6Z A;  2VL1 A;  4ZY1 A;  2AFS A;  2JBK A;  2Q7B A;  2ZOF A;  3G8W A;  3SJX A;  7CPA A;  1PU9 A;  5HVF A;  1S7K A;  4MFL A;  3L2N A;  4R76 A;  4UIB A;  4CGL A;  4EFD A;  2Q4V A;  2EBJ A;  2PRQ A;  4P6Y A;  4M85 A;  4UIA A;  2QIR A;  1Z8T A;  3FX6 A;  4XPD C;  4X3R A;  5LYF A;  4M6I A;  3WT4 A;  4UEZ A;  4A37 A;  3JRU A;  4PXE A;  2I00 A;  2FS5 A;  1VIX A;  4G1P A;  4Q7A A;  4PQA A;  1QSO A;  3D3S A;  3LOD A;  4B5P A;  3A9L A;  5HVH A;  2VZY A;  3IU2 A;  5IX3 A;  2P6E A;  3B3T A;  4UFX A;  3TC8 A;  3JTK A;  4EVY A;  1Y7R A;  2CTB A;  1XRY A;  2PQ8 A;  2G0B A;  4OP4 A;  1AMP A;  2JLM A;  2BOA A;  5H84 A;  1J4J A;  3HLP A;  1JQG A;  4MHP A;  4NJQ A;  4BMH A;  3VWE A;  1KUY A;  2RC4 A;  1IGB A;  1R3N A;  2I79 A;  4E0A A;  2C6G A;  5LRK A;  1B87 A;  3R96 A;  4A94 A;  4BIN A;  4R9M A;  4CRY B;  1YR0 A;  3IWE A;  3T8W A;  3LD2 A;  1YLO A;  5C88 A;  2OU2 A;  1CBX A;  2Z3L A;  4LQ6 A;  4PXC A;  4ZY2 A;  1Q2D A;  2FL4 A;  2VI7 A;  2Z3N A;  4JXQ A;  3D7F A;  4KOX A;  2EVN A;  1Z9U A;  3QB8 A;  5G20 A;  4EME A;  4NGP A;  2GRE A;  5AGE A;  1Q2Y A;  3CPA A;  2PJ2 A;  2QYV A;  5A27 A;  5JGF A;  2J8N A;  2B4D A;  3FMC A;  1CPS A;  3R95 A;  5THW A;  2XEG A;  4PK2 A;  2EWB A;  2Z0Z A;  3TFY A;  2PJ7 A;  2YGW A;  2PJ9 A;  2B3V A;  1MJB A;  3TOA A;  4PV6 A;  2I3C A;  3S9N A;  3RBU A;  1ZLH A;  1XOV A;  1Y0Y A;  4ZYQ A;  4OC5 A;  3H8F A;  4F8Z A;  2WUU A;  1K4J A;  4WJB A;  5JPH A;  5G21 A;  2CTC A;  2J8R A;  5H86 A;  3HUV A;  1HDU A;  1OBR A;  4UF4 A;  1LRZ A;  1PYT B;  1XEB A;  4KOV A;  3H5Z A;  2V8V A;  2ZED A;  1TKH A;  1BO4 A;  3TX8 A;  3H4Q A;  2WPX A;  3GLJ A;  1ZLI A;  4A2Z A;  1NSA A;  2Q43 A;  2YNC C;  5AG6 A;  3BHX A;  2ANP A;  1IYL A;  3D68 A;  4Z65 A;  2REE A;  3B35 A;  2PJ3 A;  3NH8 A;  4ZX8 A;  2HQY A;  2ZPA A;  3PFO A;  4R57 A;  3GB0 A;  1IID A;  2O4H A;  3BJ7 A;  3DNS A;  5E96 A;  2CF4 A;  4B11 A;  4MFJ A;  3SXO A;  3B3C A;  4UEE A;  2GLJ A;  1LAN A;  3QAY A;  3S6K A;  3LWU A;  2CXA A;  4KUA A;  3PRT A;  4F0Y A;  4U9Y A;  2B5G A;  3PB6 X;  2PSW A;  3FJU A;  3KHZ A;  3NFZ A;  4GS4 A;  5AG4 A;  1Q7L A;  2ATR A;  2JDD A;  4KOT A;  1ZG9 A;  3DSB A;  4MI4 A;  1IY7 A;  4AXV A;  3IFE A;  3TO9 A;  1Z2L A;  3D7G A;  3FF3 A;  1Y9K A;  4MY0 A;  1ELL P;  4NGN A;  4P4D A;  3RO0 A;  1QSR A;  2DPT A;  1KUX A;  4GXH A;  4JD6 A;  4E2A A;  2FIW A;  4MFP A;  2OOT A;  1CX8 A;  3H8E A;  1IYK A;  3FB3 A;  4MHY A;  4RN7 A;  3V38 A;  1BPN A;  3K9T A;  4OIW A;  4AG7 A;  4CAX A;  4K3N A;  1UWY A;  4QBJ A;  1FT7 A;  3CXQ A;  4OC1 A;  2PVW A;  5DS0 A;  4JZ0 A;  4JXR A;  4R7M A;  4P4I A;  4PK3 A;  4NFR A;  2FIA A;  2FSR A;  2PJ5 A;  2G3A A;  2Q4Z A;  4MXU A;  4UCN A;  4LQG A;  4FUU A;  1ARM A;  4CAE A;  3W91 A;  3FRM A;  4KOY A;  4BD9 A;  4OKO A;  4EWT A;  3S9L A;  1HEE A;  2IMO A;  3GY9 A;  4R8F A;  4KSA A;  2PJ1 A;  4UCM A;  2PR1 A;  1BAV A;  3R9F A;  1S7N A;  2J8M A;  4IF5 A;  3S6H A;  3ZJ0 A;  2RFH A;  1BLL E;  2P6F A;  3CDX A;  4MRI A;  2PIY A;  2ZEF A;  4NSQ A;  2PJ6 A;  1DE4 C;  4FD7 A;  4RUH A;  4R3L A;  2NYQ A;  2Y0M A;  2ZW6 A;  1P0H A;  2PJ0 A;  3LAC A;  4AVB A;  4HKF A;  1S3Z A;  5JH9 A;  1RXT A;  3H8G A;  1M44 A;  4JYW A;  5CNP A;  1L0C A;  3RZA A;  4NGQ A;  3W6X A;  4FD6 A;  4Y49 B;  4KZT A;  4B5P B;  3FED A;  2J9A A;  2FXF A;  5G1Z A;  5C82 A;  4CS0 B;  4KLV A;  2CNM A;  3D7H A;  3KAS A;  2Z3K A;  3PZJ A;  1Y9W A;  3D7D A;  1XE4 A;  4MCP A;  2AFW A;  2EK9 A;  2OB0 A;  5F48 A;  2HB6 A;  4MHZ A;  2H5M A;  2RB7 A;  4A39 A;  2NSM A;  1M4I A;  3TTH A;  5ELY A;  1VGY A;  3JUW A;  2V77 A;  1QST A;  2PC1 A;  3P2F A;  1VKC A;  2PR8 A;  1R43 A;  4YGO A;  4B12 A;  4DUK A;  2POK A;  2GLF A;  5HH1 A;  2ZEP A;  3EO4 A;  2AFU A;  1AYE A;  4A30 A;  5JQ4 A;  2C1C A;  2C6C A;  1FNO A;  1TF9 A;  5DWM A;  1S7F A;  2KCW A;  3FVL A;  2O28 A;  3FIX A;  3SXN A;  4H6U A;  2OR4 A;  5HXD A;  2PRB A;  1CM0 A;  2B4D B;  4OC3 A;  5I0C A;  3D2P A;  4Q36 A;  2Q04 A;  5EBV A;  5IV0 A;  5K8O A;  1N71 A;  1YVK A;  4AG9 A;  4F9V A;  4P4F A;  3KR4 A;  1NSL A;  2AFO A;  1B6B A;  4R3K A;  2AJ6 A;  4Y49 C;  4QC6 A;  4FAI A;  3KHX A;  4I49 A;  3ZZI A;  4A38 A;  5LYD A;  3SJE A;  2CY2 A;  1MK4 A;  4NF1 A;  1IOF A;  4B14 A;  4KOU A;  4O23 A;  2PDO A;  4OAE A;  5KTD A;  2F7V A;  3F5B A;  4P44 A;  1TKJ A;  3V7Z A;  3PB9 X;  2G9D A;  3EFA A;  3ISX A;  4JLY A;  1A2Z A;  2ZEE A;  1LOK A;  3BLN A;  4K30 A;  4WWV A;  3TO6 A;  3WC6 A;  2OH1 A;  4PSX A;  3DR8 A;  1IIC A;  3RYO A;  2BL1 A;  4CAF A;  3NE8 A;  4NCZ A;  4NGM A;  2CIJ A;  5LRJ A;  2XEI A;  1ZG8 A;  5J8C A;  2V8H A;  4X2T A;  5KTA A;  5CBM A;  3RNZ A;  3VWD A;  3D2M A;  2QML A;  4DYO A;  2JEW A;  3WAB A;  4P10 A;  1GYT A;  3D66 A;  1Z8X A;  4F0X A;  1XMB A;  2Z3P A;  4IUS A;  4RI1 A;  1ZG7 A;  3PBB A;  4FD5 A;  4DJL A;  4MCR A;  5J1Q A;  1YK3 A;  1LAM A;  2BUE A;  3GKR A;  3IGR A;  4KUB A;  5KTC A;  3S9M A;  4LX9 A;  4UCP A;  2YNE A;  4NGR A;  3G3S A;  1VHE A;  4JJX A;  4KVO E;  2B5G B;  2O53 A;  3EXN A;  1IB1 E;  2DXQ A;  2BCO A;  1H8L A;  3W6S A;  1ARL A;  1AUG A;  5AG7 A;  5FVJ A;  4YWY A;  4RS2 A;  2PJ4 A;  3IU1 A;  4Q38 A;  4W9Y A;  4C7I A;  3SJF A;  3MRU A;  4OAD A;  4TNU A;  4B5O A;  3GUX A;  3FH4 A;  3OWC A;  3PFE A;  1I1D A;  1P4N A;  5EMI A;  2QEC A;  4NXY A;  5LRG A;  1X10 A;  1ZO0 A;  2DEA A;  3PEI A;  1UFH A;  1QSN A;  1SQH A;  2PJA A;  1QMU A;  4M6H A;  4KVX A;  4U5Y A;  4C68 A;  8CPA A;  4UFW A;  4YFJ A;  2XEJ A;  4A32 A;  3E0K A;  3PBE A;  4LUA A;  2GIV A;  2Z3O A;  1V0C A;  3QAH A;  4UEF A;  4QUS A;  1YSJ A;  2BSW A;  2VBQ A;  1BPM A;  4C2Z A;  1Z8W A;  4J3G A;  4IHM A;  1Z4R A;  3KL9 A;  1ELM P;  3D4U A;  4UWI A;  1HDQ A;  1MJ9 A;  4CAW A;  3I9S A;  2CNS A;  2EK8 A;  4L89 A;  2PJ8 A;  4YRH A;  4F9U A;  2Z10 A;  5HVG A;  1FY7 A;  1X12 A;  1M4L A;  5IB9 A;  2Q51 A;  1KUV A;  4A33 A;  2AFM A;  2VZZ A;  4ZI6 A;  1ON0 A;  2PIZ A;  3FEC A;  1CPX A;  2AE6 A;  3LMS A;  4UFV A;  1YW6 A;  3PB4 X;  1XJO A;  1RO5 A;  2PE3 A;  3N5F A;  2R1I A;  2JEV A;  3GYA A;  3KGQ A;  4M3S A;  4M6G A;  4X8I A;  5LYL A;  5DWN A;  3IO1 A;  1M4D A;  3ISZ A;  2HV2 A;  2Q7S A;  1EE3 P;  4NEX A;  4NJR A;  3S6F A;  4A95 A;  1S60 A;  3TE4 A;  2OZH A;  3MN8 A;  4HPS A;  4R6T A;  4CYN A;  4U9Z A;  2WZN A;  3F0A A;  4KOS A;  3B8G A;  3BXM A;  2EO8 A;  3R9E A;  1TIQ A;  2EUI A;  3B7I A;  2P0W A;  3NA6 A;  1WK4 A;  1YVO A;  4PXD A;  3TT2 A;  3CT9 A;  4F6A A;  4GM5 A;  4HNW B;  4OC2 A;  4R87 A;  1PUA A;  3F8K A;  1NE9 A;  1S7L A;  2ZW5 A;  3VAT A;  1S5K A;  2R7H A;  1IOI A;  2ZW4 A;  5A28 A;  3SI2 A;  2CNT A;  2DF5 A;  1YLE A;  3KQX A;  2P6G A;  1Z4E A;  3DR6 A;  2GAN A;  3K9U A;  2VXK A;  1Y7E A;  3SHP A;  2ZEM A;  2B4B A;  4L8A A;  5HMN A;  4MCQ A;  3SI0 A;  3B2Y A;  4OME A;  5D8N A;  1RTQ A;  1CJW A;  3RAM A;  2GU2 A;  1QSM A;  4PXB A;  3TOB A;  1QQ9 A;  4CYQ A;  4ZBG A;  4MFZ A;  3PB7 X;  3FEE A;  4CAV A;  4CRZ B;  4KLW A;  3I3G A;  4CYO A;  4H89 A;  2ZEL A;  3IC1 A;  4TWE A;  4AB7 A;  1LAP A;  2PCU A;  4IK2 A;  2A4N A;  2ZEN A;  5I4M A;  2V8G A;  3P2H A;  2R8V A;  4KOR A;  1U6M A;  2D4O A;  2PJC A;  3BI0 A;  3TO7 A;  3KR5 A;  4MHN A;  4OC4 A;  2IL4 A;  3VH9 A;  4DNC A;  1F2O A;  1TXR A;  4CGP A;  4FBE A;  4ZGY B;  3B3W A;  4KS9 A;  5J8F A;  3KI9 A;  3FBU A;  2HUZ A;  4MJ8 A;  1CP6 A;  4KSI A;  4FWU A;  3EY5 A;  1IU8 A;  3B3S A;  3V8I A;  1Z8L A;  1I12 A;  4PPZ A;  2ZEO A;  3BI1 A;  3KZW A;  1XMT A;  2BEI A;  2ZEH A;  3KQZ A;  2FE7 A;  2FT0 A;  3B3V A;  3IWG A;  2ABZ A;  2GE3 A;  5LYI A;  2C6P A;  2YNC A;  4XPK A;  1YRE A;  2AFZ A;  1XBU A;  1MJA A;  1XF8 A;  2OZU A;  1DTD A;  2PVV A;  2B3U A;  3DGV A;  1JWQ A;  3R9G A;  3NE7 A;  4KVM E;  4OC0 A;  3EC4 A;  3WR7 A;  5K8M A;  3N7Z A;  5D29 A;  3WC5 A;  2QJ8 A;  3KKW A;  2VQY A;  2Q4Y A;  4MFQ A;  2YND A;  4A31 A;  3BJ8 A;  4KOW A;  1YX0 A;  4UWJ A;  3UY5 A;  2C27 A;  2WSA A;  4AVA A;  4CYP A;  2IQ6 A;  2VEZ A;  2ARH A;  2PJB A;  3IWW A;  3S6G A;  5G22 A;  1GHE A;  3CXS A;  4CGM A;  4JWP A;  3PP9 A;  5F46 A;  5GCN A;  2X7B A;  1YW4 A;  5ISV A;  4ZX9 A;  2WPW A;  6CPA A;  1VHO A;  4H6Z A;  4CGN A;  3FYN A;  1R57 A;  1YGH A;  1Z5R A;  1F2P A;  2QVP A;  2JDC A;  4NGS A;  2ZXV A;  2G3T A;  4IAV A;  4MCS A;  3DDD A;  1Q2C A;  5F47 A;  5IB0 A;  1YME A;  4B10 A;  3TCV A;  1VHS A;  3FXT A;  1BOB A;  1LCP A;  5AG5 A;  1CG2 A;  2F5I A;  4XNH B;  4ONW A;  4KSF A;  2XEF A;  1LFW A;  2Q0Y A;  3CZX A;  3JVN A;  5K8N A;  3DLJ A;  2ZEG A;  4MFK A;  4X5K A;  2REF A;  4AVC A;  3R1K A;  2DPS A;  2B58 A;  3NH5 A;  4PSW A;  4HNX B;  4ONU A;  4QVT A;  1M4G A;  3CPX A;  5EC4 A; 
#chains in the Genus database with same CATH homology
 3CXP A;  4UBR A;  5F49 A;  4ORF A;  2K5T A;  2NMT A;  1M1D A;  1OZP A;  4UA3 A;  4XPD B;  1WWZ A;  3MGD A;  4B13 A;  1NMT A;  4HNY B;  2ZW7 A;  3T9Y A;  4CGO A;  3C26 A;  4QB9 A;  4MHD A;  4MY3 A;  4C7H A;  2Z3M A;  4C2Y A;  3D8P A;  5BWA B;  4FD4 A;  4C2X A;  4MBU A;  3T90 A;  1I21 A;  1KZF A;  4BBH A;  3PGP A;  2Z11 A;  2D4P A;  4XNH C;  2R98 A;  2OZG A;  3FNC A;  1XIX A;  2Q44 A;  4E8O A;  2FCK A;  4OLL A;  4XPL A;  4II9 A;  2Q7B A;  3G8W A;  1PU9 A;  1S7K A;  4MFL A;  4CGL A;  2Q4V A;  4M85 A;  2QIR A;  4XPD C;  2I00 A;  2FS5 A;  1QSO A;  3D3S A;  3LOD A;  4B5P A;  3A9L A;  2VZY A;  3IU2 A;  5IX3 A;  2P6E A;  4UFX A;  3JTK A;  4EVY A;  1Y7R A;  2PQ8 A;  2G0B A;  2JLM A;  5H84 A;  1J4J A;  4BMH A;  3VWE A;  1KUY A;  2RC4 A;  2I79 A;  4E0A A;  1B87 A;  3R96 A;  4R9M A;  4CRY B;  1YR0 A;  3IWE A;  3LD2 A;  5C88 A;  2OU2 A;  2Z3L A;  1Q2D A;  2FL4 A;  2VI7 A;  2Z3N A;  4JXQ A;  4KOX A;  2EVN A;  1Z9U A;  3QB8 A;  5G20 A;  5AGE A;  1Q2Y A;  5A27 A;  2J8N A;  2B4D A;  3R95 A;  4PK2 A;  2Z0Z A;  3TFY A;  2YGW A;  2B3V A;  1MJB A;  3TOA A;  4PV6 A;  2WUU A;  1K4J A;  5JPH A;  5G21 A;  2J8R A;  5H86 A;  1LRZ A;  1XEB A;  4KOV A;  3H5Z A;  1BO4 A;  3H4Q A;  2WPX A;  4A2Z A;  2YNC C;  5AG6 A;  1IYL A;  2REE A;  2HQY A;  2ZPA A;  4R57 A;  1IID A;  3BJ7 A;  3DNS A;  5E96 A;  4B11 A;  4MFJ A;  3SXO A;  3S6K A;  2CXA A;  4KUA A;  4U9Y A;  2B5G A;  2PSW A;  4GS4 A;  5AG4 A;  2ATR A;  2JDD A;  4KOT A;  3DSB A;  4MI4 A;  3TO9 A;  4MY0 A;  1Y9K A;  1QSR A;  2DPT A;  1KUX A;  4JD6 A;  4E2A A;  2FIW A;  4MFP A;  1IYK A;  3FB3 A;  4AG7 A;  4CAX A;  4QBJ A;  3CXQ A;  4JXR A;  4PK3 A;  2FIA A;  2FSR A;  2G3A A;  4UCN A;  4CAE A;  3W91 A;  3FRM A;  4KOY A;  3GY9 A;  4KSA A;  4UCM A;  2PR1 A;  3R9F A;  3S6H A;  1S7N A;  2J8M A;  4IF5 A;  3ZJ0 A;  2P6F A;  4NSQ A;  4FD7 A;  4R3L A;  2Y0M A;  2ZW6 A;  1P0H A;  4AVB A;  4HKF A;  1S3Z A;  1RXT A;  1M44 A;  5CNP A;  1L0C A;  3W6X A;  4FD6 A;  4Y49 B;  4KZT A;  4B5P B;  2FXF A;  5G1Z A;  5C82 A;  4CS0 B;  4KLV A;  2CNM A;  2Z3K A;  3PZJ A;  1Y9W A;  1XE4 A;  2OB0 A;  5F48 A;  2H5M A;  1M4I A;  3TTH A;  3JUW A;  1QST A;  2PC1 A;  3P2F A;  1VKC A;  2PR8 A;  4YGO A;  4B12 A;  5HH1 A;  3EO4 A;  4A30 A;  5JQ4 A;  5DWM A;  1S7F A;  2KCW A;  3SXN A;  2O28 A;  3FIX A;  4H6U A;  2PRB A;  1CM0 A;  2B4D B;  5I0C A;  3D2P A;  4Q36 A;  2Q04 A;  5EBV A;  5IV0 A;  1N71 A;  1YVK A;  4AG9 A;  1NSL A;  1B6B A;  4R3K A;  2AJ6 A;  4Y49 C;  4QC6 A;  4I49 A;  3ZZI A;  2CY2 A;  1MK4 A;  4NF1 A;  4B14 A;  4KOU A;  2PDO A;  4OAE A;  5KTD A;  3F5B A;  3EFA A;  4JLY A;  4F0Y A;  3BLN A;  4K30 A;  3TO6 A;  2OH1 A;  4PSX A;  3DR8 A;  1IIC A;  3RYO A;  2BL1 A;  4CAF A;  4NCZ A;  5J8C A;  5KTA A;  3VWD A;  3D2M A;  2QML A;  4F0X A;  2Z3P A;  4IUS A;  4RI1 A;  4FD5 A;  1YK3 A;  2BUE A;  3IGR A;  3GKR A;  4KUB A;  5KTC A;  4LX9 A;  4UCP A;  2YNE A;  3G3S A;  4JJX A;  4KVO E;  2B5G B;  3EXN A;  1IB1 E;  2DXQ A;  3W6S A;  5AG7 A;  5FVJ A;  4RS2 A;  3IU1 A;  4Q38 A;  4C7I A;  4OAD A;  4B5O A;  3OWC A;  1I1D A;  1P4N A;  2QEC A;  4NXY A;  1ZO0 A;  1UFH A;  1QSN A;  1SQH A;  4U5Y A;  4C68 A;  4KVX A;  4UFW A;  4YFJ A;  4A32 A;  3E0K A;  4LUA A;  2GIV A;  2Z3O A;  1V0C A;  3QAH A;  4QUS A;  2VBQ A;  2BSW A;  4C2Z A;  4J3G A;  1Z4R A;  4UWI A;  1MJ9 A;  4CAW A;  3I9S A;  2CNS A;  4L89 A;  4YRH A;  2Z10 A;  1FY7 A;  4A33 A;  1KUV A;  2VZZ A;  1ON0 A;  2AE6 A;  4UFV A;  1RO5 A;  2R1I A;  2JEV A;  3GYA A;  4M3S A;  5DWN A;  4NEX A;  1M4D A;  2HV2 A;  3S6F A;  4A95 A;  1S60 A;  3TE4 A;  2OZH A;  4CYN A;  4U9Z A;  3F0A A;  4KOS A;  3B8G A;  3R9E A;  1TIQ A;  2EUI A;  2P0W A;  1WK4 A;  1YVO A;  3TT2 A;  4F6A A;  4R87 A;  4HNW B;  1PUA A;  3F8K A;  1NE9 A;  1S7L A;  2ZW5 A;  1S5K A;  2R7H A;  2ZW4 A;  5A28 A;  2CNT A;  4MFZ A;  1YLE A;  2P6G A;  1Z4E A;  3DR6 A;  2GAN A;  3K9U A;  2VXK A;  3SHP A;  2B4B A;  4L8A A;  5HMN A;  1CJW A;  1QSM A;  3TOB A;  4CYQ A;  4ZBG A;  4CAV A;  4CRZ B;  4KLW A;  3I3G A;  4CYO A;  4H89 A;  4AB7 A;  2A4N A;  3P2H A;  2R8V A;  4KOR A;  1U6M A;  2D4O A;  3TO7 A;  4DNC A;  2IL4 A;  4CGP A;  5J8F A;  4ZGY B;  4KS9 A;  3FBU A;  2HUZ A;  4MJ8 A;  3EY5 A;  3V8I A;  1I12 A;  1XMT A;  2BEI A;  2FE7 A;  2FT0 A;  3IWG A;  2GE3 A;  2YNC A;  4XPK A;  1YRE A;  1XF8 A;  1MJA A;  2OZU A;  2B3U A;  3R9G A;  3NE7 A;  4KVM E;  3EC4 A;  3WR7 A;  3N7Z A;  3KKW A;  2VQY A;  2Q4Y A;  4MFQ A;  2YND A;  4A31 A;  3BJ8 A;  4KOW A;  1YX0 A;  4UWJ A;  3UY5 A;  2C27 A;  2WSA A;  4AVA A;  4CYP A;  2VEZ A;  2ARH A;  3S6G A;  5G22 A;  1GHE A;  3CXS A;  4CGM A;  4JWP A;  3PP9 A;  5F46 A;  5GCN A;  2X7B A;  5ISV A;  2WPW A;  4H6Z A;  4CGN A;  3FYN A;  1R57 A;  1YGH A;  2JDC A;  2ZXV A;  2G3T A;  3DDD A;  1Q2C A;  5F47 A;  5IB0 A;  4B10 A;  3TCV A;  1VHS A;  3FXT A;  1BOB A;  5AG5 A;  2F5I A;  4XNH B;  4KSF A;  3JVN A;  2Q0Y A;  4MFK A;  4X5K A;  4AVC A;  2REF A;  3R1K A;  2DPS A;  2B58 A;  4PSW A;  4HNX B;  4ONU A;  4QVT A;  1M4G A;  5EC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...