4KORA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with 7-aminocephalosporanic acid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uncharacterized protein
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 45
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4korA00
4M3SA 2J8RA 2VXKA 2B3VA 2HUZA 1Z9UA 5IB0A 4JLYA 1M4IA 2PQ8A 4NCZA 4YGOA 2R98A 4JXQA 1FY7A 4X5KA 4MJ8A 3LD2A 1U6MA 1I1DA 4JD6A 1MJAA 2Q4VA 5GCNA 2AE6A 2OU2A 4PK3A 2REFA 4RI1A 3D2PA 1NMTA 1ON0A 4NSQA 4XPKA 1Y9WA 2R1IA 4KOUA 1S7NA 4CAXA 3P2HA 1TIQA 4R3LA 1XEBA 1QSMA 2FXFA 4UWIA 4B5PA 3TFYA 5C82A 3PGPA 3DR8A 3BJ8A 3GYAA 2F5IA 4KOYA 4Y49C 3SXOA 1WK4A 2QECA 2GIVA 2Q04A 3F0AA 4XPDB 5F49A 3IWGA 5E96A 3S6GA 2ARHA 5F48A 3ZJ0A 1S60A 1I12A 3OWCA 3EXNA 1M4DA 1S7LA 1MJ9A 1PUAA 3R1KA 1P4NA 2REEA 3DDDA 1B6BA 3D2MA 2VEZA 5KTAA 1L0CA 3KKWA 4E2AA 2PR8A 2Q7BA 3FNCA 1YREA 1Q2DA 2Z0ZA 5H84A 4QC6A 2FE7A 4KOWA 1GHEA 4U9YA 4AB7A 2X7BA 2KCWA 4F0YA 4FD7A 2GANA 4HKFA 1XE4A 1KUYA 1Q2YA 4KOSA 3G8WA 1Y9KA 3I9SA 5CNPA 4B5OA 1RO5A 5DWNA 1RXTA 1IYKA 1PU9A 1P0HA 2Z11A 3TCVA 4H89A 1CM0A 1VHSA 3E0KA 1NSLA 4Y49B 5KTCA 1YX0A 3FYNA 4MI4A 2QMLA 4F6AA 1YVKA 3G3SA 4I49A 2RC4A 4YFJA 2AJ6A 4R87A 1SQHA 3TO9A 4KOVA 4II9A 1LRZA 2DXQA 4KLVA 4LUAA 2ZW5A 3EC4A 2B5GB 2JDDA 3FIXA 4R57A 1QSNA 2FIWA 4MBUA 4OAEA 2OB0A 4UA3A 4H6UA 3JUWA 2VQYA 4ONUA 1R57A 4DNCA 4J3GA 1M1DA 4NEXA 3EY5A 3W6XA 4H6ZA 2HQYA 3TTHA 2B58A 1YR0A 4CAVA 2PR1A 3F5BA 1S7KA 3JVNA 3H4QA 4CAWA 1J4JA 3R96A 4KVXA 2G3TA 2ATRA 4MY3A 3VWDA 5HMNA 4CS0B 1CJWA 2ZXVA 3T9YA 4KVOE 3FXTA 4FD4A 1BOBA 5C88A 3UY5A 2D4PA 1MJBA 4KORA 3P2FA 2NMTA 5I0CA 2G0BA 4QUSA 1N71A 3FRMA 4QB9A 4PSWA 2FT0A 2CNMA 2ZW6A 2I00A 3K9UA 1IYLA 1XMTA 4AG9A 4NF1A 3T90A 4KUBA 3R9FA 2FS5A 1I21A 2OZGA 2J8MA 2B4BA 4CRZB 4MHDA 2OZHA 1K4JA 3DSBA 3FB3A 3I3GA 5JQ4A 2P6GA 2JLMA 2BEIA 1Z4EA 2OZUA 1MK4A 2JEVA 1KUXA 5EBVA 4KUAA 2GE3A 5HH1A 2ZPAA 4OADA 1IICA 2BSWA 3D3SA 3LODA 3MGDA 4L89A 1V0CA 2Q0YA 2OH1A 4IF5A 3DNSA 3SXNA 2I79A 2VI7A 4E8OA 2FL4A 2J8NA 2B4DB 2ZW7A 4XNHC 4MY0A 4RS2A 3C26A 1IB1E 3D8PA 4ZBGA 5KTDA 4KOTA 2PC1A 1S5KA 1YVOA 3F8KA 3W91A 4CRYB 1BO4A 2FCKA 2B4DA 4YRHA 4IUSA 3WR7A 1Z4RA 2BL1A 1S7FA 3ZZIA 1XF8A 5H86A 1KUVA 5F46A 1YLEA 2BUEA 2CY2A 4HNYB 4L8AA 1B87A 2P6EA 2A4NA 3CXPA 5EC4A 3S6FA 5IX3A 3NE7A 1M44A 2O28A 3DR6A 2VZYA 4R3KA 4U9ZA 3W6SA 2Z10A 3B8GA 4EVYA 1YK3A 2B5GA 2QIRA 4AVAA 4HNXB 4BMHA 1KZFA 1Y7RA 4UWJA 5JPHA 3VWEA 3R9EA 5DWMA 4KOXA 1UFHA 1QSOA 3RYOA 3TO6A 4AVCA 4FD6A 1QSRA 4PK2A 4GS4A 5FVJA 2G3AA 3V8IA 4KVME 4B5PB 2ZW4A 2R8VA 2FIAA 4KLWA 2Y0MA 3TO7A 2VZZA 4JJXA 3PZJA 1OZPA 2D4OA 1YGHA 1IIDA 2HV2A 4XNHB 4FD5A 3IGRA 4K30A 3EO4A 4JWPA 3QB8A 2Q4YA 5IV0A 3N7ZA 2VBQA 4JXRA 2P0WA 4PV6A 2Q44A 2B3UA 3QAHA 4M85A 5J8FA 1NE9A 4XPLA 1S3ZA 3R95A 2R7HA 2PSWA 4LX9A 2EUIA 2PRBA 2P6FA 1VKCA 2EVNA 1Q2CA 4ORFA 4AG7A 4UBRA 3GY9A 1QSTA 4NXYA 2FSRA 3TE4A 3GKRA 2CNTA 3SHPA 4R9MA 2WPWA 5F47A 3FBUA 3TOAA 3BJ7A 2C27A 4QBJA 5ISVA 3S6HA 3BLNA 3TT2A 2IL4A 3R9GA 3CXSA 5J8CA 4AVBA 2CNSA 4E0AA 4PSXA 1XIXA 3TOBA 2JDCA 2PDOA 3PP9A 4QVTA 3S6KA 2WPXA 4XPDC 4KZTA 1WWZA 1M4GA 4U5YA 3EFAA 3CXQA 4HNWB 2K5TA 4OLLA 2H5MA
chains in the Genus database with same CATH superfamily
2CTCA 4JYWA 4M3SA 2J8RA 3IEHA 2DF5A 2VXKA 2B3VA 2I3CA 2HUZA 4AXVA 1Z9UA 5IB0A 3MN8A 4JLYA 1M4IA 2PQ8A 4NCZA 4OC5A 3GLJA 4YGOA 2R98A 2ZEFA 3B3WA 5IX3A 3RBUA 4JXQA 1FY7A 4X5KA 4MJ8A 2GFQA 3CZXA 3LD2A 3KHXA 1U6MA 1ELLP 1I1DA 4B14A 3IC1A 4JD6A 4H2KA 1MJAA 2Q4VA 1VHEA 5GCNA 2AE6A 2OU2A 3CT9A 4PK3A 2Q51A 2REFA 4RI1A 1QQ9A 3D2PA 2Q4ZA 1NMTA 3GIUA 1ON0A 1AMPA 4NSQA 4UCNA 3VH9A 2YNCC 4CYNA 1VIXA 4XPKA 3SJFA 5JM6A 1OBRA 1Y9WA 2R1IA 4KOUA 4RUHA 1S7NA 2ZEDA 3ISZA 4CAXA 4DJLA 3B3CA 4PXDA 2WZNA 5AG6A 1YLOA 5G21A 4F0XA 3IWEA 3P2HA 1TIQA 3D66A 4A30A 3BHXA 1TXRA 4R3LA 3CPXA 4A95A 1XEBA 1QSMA 4BD9A 1XBUA 2FXFA 4UWIA 4EMEA 4B5PA 3TFYA 4ONWA 5C82A 2F7VA 3PGPA 3DR8A 4CYQA 3BJ8A 2V8GA 3B7IA 3GYAA 4B12A 2F5IA 4KOYA 4Y49C 3SXOA 1WK4A 2QECA 3JRUA 2JBJA 2GREA 2GIVA 2POKA 4UEEA 2Q04A 3F0AA 4XPDB 4OMEA 4OC1A 5F49A 1ZG9A 4X3RA 3IWGA 4TNUA 5E96A 4UFXA 2AFSA 3S6GA 2ARHA 5F48A 5LYIA 1FNOA 3NE8A 3PEIA 4MFLA 3IU2A 3ZJ0A 1Z8XA 1S60A 1PCAA 1F2PA 1I12A 3OWCA 4WJBA 3EXNA 4ZY0A 1M4DA 1YQEA 5J1QA 1ZLIA 3BXMA 3IFEA 1XRYA 4KSFA 1BPNA 1S7LA 1MJ9A 1PUAA 3R1KA 2GU2A 2F8HA 4C7HA 5LYDA 1P4NA 2REEA 4BBHA 2IQ6A 2WSAA 3KR4A 1F57A 3DDDA 1B6BA 4CGOA 5AG4A 2IJZA 3D2MA 5A27A 5CPAA 5IB9A 5LRGA 2VEZA 3PRTA 5KTAA 4A39A 1L0CA 1R3NA 2ANPA 3KKWA 4OC0A 4ZX8A 3D7FA 2PR8A 4WWVA 2Q7BA 4E2AA 3FNCA 4M6GA 4B11A 1YREA 4A31A 4NGNA 3KASA 1Q2DA 4MHPA 1AUGA 4ZGYB 2Z0ZA 5H84A 1ELMP 2GLFA 4QC6A 4RN7A 5CBMA 2FE7A 3IJ3A 4KOWA 2ZELA 5DS0A 4FUUA 1GHEA 4U9YA 2PJ0A 4AB7A 1R43A 2X7BA 2KCWA 4F0YA 4FD7A 2GANA 4HKFA 1XE4A 1KUYA 3I1UA 1Q2YA 4IK2A 2EK8A 4KOSA 3G8WA 4CGPA 1Y9KA 3I9SA 5CNPA 3NFZA 4OC4A 4B5OA 1RO5A 2YNCA 5DWNA 2ZENA 4ZY2A 1Z8LA 1RXTA 4UIBA 3K2KA 1IYKA 1PU9A 1P0HA 3WC7A 2PJ5A 2Z11A 3TCVA 1HEEA 2ZEGA 3B2YA 4H89A 1CM0A 4CYPA 4NJQA 1VHSA 4UCMA 1ARMA 2PJ2A 3E0KA 4Y49B 1NSLA 1YX0A 3FYNA 5KTCA 4MI4A 1X10A 4MFPA 2QMLA 1HDUA 3NH5A 4A32A 2QJ8A 4MFZA 2Z3OA 4F6AA 2RFHA 1YVKA 4R6TA 2EO8A 3G3SA 4G1PA 3KGQA 1TF8A 3KI9A 4UF4A 3D7HA 4I49A 2RC4A 4X2TA 4YFJA 2AJ6A 4ZY1A 2PIYA 4R76A 4R87A 2VL1A 4OP4A 2OOTA 1SQHA 1Z8TA 4GM5A 3VATA 4F9UA 4MFQA 3TO9A 1IY7A 4X8IA 4YU9A 1Z8WA 3D7GA 4KOVA 3PFOA 2PJ4A 2ZEHA 4UEZA 3V7ZA 1LRZA 1CX8A 2DXQA 4II9A 2OR4A 4KLVA 4LUAA 5ELYA 4A38A 4M6IA 2ZW5A 1YSJA 3EC4A 4CGLA 1TF9A 2NSMA 3HLPA 1Z5RA 5G1ZA 2B5GB 2JDDA 2PJ1A 3FIXA 4R57A 4A2ZA 2XEIA 4MCQA 3RNZA 1QSNA 2ABZA 2FIWA 4MBUA 2XEFA 4OAEA 3WABA 5LYLA 5LRKA 3MRUA 3NH4A 2OB0A 2PVWA 4MRIA 4UA3A 4UIAA 3BI0A 2PJ7A 4CGNA 3H8FA 4PXCA 2PJ9A 3HUVA 4GXHA 3LACA 4H6UA 5AG7A 4F8ZA 3L2NA 3NA6A 3JUWA 2VQYA 3D68A 1CPXA 4ONUA 1R57A 4NGPA 4DNCA 4J3GA 1M1DA 2Z3PA 4NEXA 3EY5A 3PB8X 4PPZA 3W6XA 4H6ZA 1JWQA 2HQYA 4OC3A 2O4HA 3TTHA 2B58A 1YR0A 2QYVA 4P4BA 3SI0A 4CAVA 2PR1A 3F5BA 1S7KA 2PJAA 3JVNA 4HPSA 4ZI6A 3H4QA 3WT4A 4CAWA 1J4JA 1XMBA 2JBKA 2AFMA 3R96A 3FEEA 4KVXA 2G3TA 2ATRA 4MY3A 2V77A 3VWDA 2AFXA 5HMNA 4CS0B 4MCRA 4B10A 1CJWA 2ZXVA 3T9YA 3PB6X 4UCPA 5THWA 4KVOE 3FXTA 1AYEA 1LOKA 3B35A 4FD4A 1BOBA 2PJ3A 4OKOA 2V8VA 2GLJA 4R7MA 5C88A 1LAPA 2D4PA 3UY5A 2FVGA 1MJBA 4P4FA 3WC6A 2PE3A 4KORA 3SI1A 2HB6A 3H5ZA 2NMTA 3P2FA 4MHNA 3QNVA 2ZEOA 5I0CA 3BI1A 2G0BA 3FVLA 4QUSA 1TKJA 5G20A 1N71A 2RB7A 2CXAA 3FRMA 4QB9A 4PSWA 2FT0A 2CNMA 1CP7A 2YNEA 2ZW6A 4CGMA 4C2ZA 2I00A 3K9UA 1IYLA 2C6GA 1XMTA 4AG9A 1NSAA 1TKFA 3D4UA 4NF1A 1ZG7A 2PJCA 2WUUA 5HVGA 5K8PA 3T90A 4NGTA 1Y7EA 4KUBA 4MFJA 3R9FA 2FS5A 5F09A 1I21A 2OZGA 4YWYA 2AFWA 2J8MA 4P4JA 4NGMA 4CAEA 2B4BA 1Z2LA 4R8FA 2BO9A 4CRZB 1IOFA 4MHDA 4NFRA 2OZHA 1A2ZA 2V8DA 1Y0YA 4P45A 3LMSA 1K4JA 2DEAA 3FJUA 3DSBA 5A28A 3FB3A 2EBJA 2PIZA 3I3GA 5JQ4A 2P6GA 2EK9A 2JLMA 5HVHA 2ZOFA 2XEJA 2BEIA 1ZLHA 4P4DA 1Z4EA 2OZUA 1MK4A 3V38A 4FAIA 2JEVA 1KUXA 4NGSA 1FT7A 4KUAA 5EBVA 1IOIA 2GE3A 5HH1A 4K3NA 1M4LA 2ZPAA 2PJ8A 4P4EA 4OADA 1IICA 2BSWA 3D3SA 3LODA 4C2YA 3MGDA 4L89A 1V0CA 2C6PA 1RTQA 2Q0YA 3PBBA 2ODFA 2OH1A 5K8MA 4IF5A 5AG5A 3DNSA 4Q36A 3SXNA 2I79A 2VI7A 4E8OA 2FL4A 3PFEA 2J8NA 1VGYA 2B4DB 1CG2A 2Z3NA 2ZW7A 4XNHC 4MY0A 4RS2A 3C26A 4KSIA 7CPAA 3H8EA 1IB1E 2V8HA 3D8PA 4ZBGA 5KTDA 4KOTA 2PC1A 4MCSA 1IU8A 1S5KA 4LQGA 2YGWA 1YVOA 2PJBA 3F8KA 3W91A 1BO4A 1BLLE 5HVFA 2CF4A 2FCKA 4CRYB 3CDXA 3FMCA 2PVVA 2CTBA 2B4DA 4YRHA 5BWAB 3PB9X 4IUSA 4MFKA 2ZEEA 3WR7A 4ZYQA 5G22A 4DYOA 1Z4RA 2AFZA 1S7FA 2BL1A 1XF8A 3ZZIA 4C68A 1KWMA 4KS9A 1KUVA 5H86A 5F46A 2XEGA 4MHYA 1YLEA 1YW6A 4UFVA 4ZX9A 2BUEA 1X12A 2CY2A 3RO0A 4HNYB 1UWYA 4L8AA 1B87A 2Z3LA 2P6EA 2A4NA 3CXPA 3ISXA 3KHZA 3QAYA 5EC4A 3DLJA 3NE7A 3S6FA 2WYRA 4Q7AA 5JGFA 3S9LA 3KQXA 3RZAA 1M44A 2O28A 3DR6A 2VZYA 4R3KA 4U9ZA 4A94A 3W6SA 4NJRA 2Z10A 3B8GA 4EVYA 4F9VA 1F2OA 1YK3A 2B5GA 2QIRA 4AVAA 4MCPA 2G9DA 4HNXB 3KL9A 4BMHA 1KZFA 1Y7RA 4UWJA 2PCUA 4C7IA 1Q7LA 3KR5A 4B6ZA 3CPAA 1ZO0A 3VWEA 5JPHA 1DE4C 5EMIA 4JZ0A 1XFOA 3R9EA 4CYOA 4P6YA 1DTDA 5DWMA 4PQAA 4MHZA 1BAVA 4KOXA 4IHMA 1UFHA 1QSOA 2J9AA 4A33A 2BOAA 3NH8A 3RYOA 3WC5A 3TO6A 3B3TA 5LRJA 4AVCA 1LANA 3FX6A 4FD6A 4Z65A 1QSRA 4PK2A 4GS4A 3FF3A 2DPTA 4P44A 5FVJA 2Z3KA 4W9YA 2Z3MA 2G3AA 2HC9A 2C6CA 2AFOA 2ZOGA 2ZEMA 3FECA 4FWUA 4KVME 3GUXA 3V8IA 4B5PB 4DUKA 4BINA 2ZW4A 4OIWA 2R8VA 2FIAA 4KLWA 2Y0MA 2C1CA 4LQ6A 4NGRA 3B3SA 3TO7A 2VZZA 4JJXA 3DGVA 3PZJA 1OZPA 1JQGA 1LAMA 2D4OA 1IGBA 3N5FA 1YGHA 1IIDA 2HV2A 2O53A 2PJ6A 4O23A 5D8NA 4XNHB 4FD5A 4EWTA 2JEWA 3IGRA 4PXBA 3A9LA 1CPSA 8CPAA 1ARLA 3FEDA 4K30A 4M6HA 3T8WA 3EO4A 5HXDA 3IU1A 4JWPA 3PB4X 3SI2A 3GB0A 4CPAA 4TWEA 1LCPA 3IIBA 3QB8A 2Q43A 2Q4YA 5D29A 5IV0A 3IO1A 3VARA 3N7ZA 2VBQA 4JXRA 4MMOA 3FH4A 2P0WA 4KSAA 4OIDA 4PV6A 4EFDA 2Q44A 2B3UA 3QAHA 4M85A 5J8FA 4OC2A 3SJGA 1NE9A 4XPLA 1S3ZA 3R95A 2R7HA 2PSWA 3D67A 4IAVA 4LX9A 5AGEA 4MXUA 2EUIA 2PRBA 3RAMA 2P6FA 1VKCA 2EVNA 1XJOA 1Q2CA 1CBXA 1EE3P 2NYQA 2ZEPA 3D7DA 3H8GA 3B3VA 3S9NA 4ORFA 4AG7A 2IMOA 4UBRA 3PB7X 4PXEA 3GY9A 1QSTA 4NXYA 2FSRA 3TE4A 5I4MA 1VHOA 3GKRA 1TKHA 2CNTA 3SHPA 2CIJA 1HDQA 5JH9A 4C2XA 4R9MA 3IWWA 1LFWA 2WPWA 5F47A 3FBUA 2AFUA 3KZWA 3SJEA 3TOAA 2YNDA 1ZG8A 2C27A 3BJ7A 3S9MA 1BPMA 4QBJA 1PYTB 5ISVA 1XOVA 6CPAA 3S6HA 3BLNA 4A37A 3TT2A 1Y0RA 1YW4A 2IL4A 5K8NA 5LYFA 4P4IA 3R9GA 3CXSA 5J8CA 4AVBA 4FBEA 2Q7SA 2QVPA 4UFWA 2CNSA 3K9TA 4E0AA 3PBEA 4PSXA 1XIXA 3TX8A 5K8OA 4UEFA 3JTKA 3SJXA 2EWBA 3TC8A 2JDCA 3TOBA 3KQZA 2BCOA 2PDOA 1GYTA 3PP9A 1YMEA 4Q38A 2PRQA 4QVTA 4CAFA 3S6KA 1QMUA 2WPXA 4P10A 3LWUA 4KZTA 4XPDC 4B13A 2DPSA 1WWZA 1M4GA 4NGQA 4U5YA 3EFAA 1CP6A 3CXQA 4HNWB 2K5TA 1H8LA 4OLLA 2H5MA
chains in the Genus database with same CATH topology
4M3SA 2J8RA 2VXKA 2B3VA 2HUZA 1Z9UA 5IB0A 4JLYA 1M4IA 2PQ8A 4NCZA 4YGOA 2R98A 4JXQA 1FY7A 4X5KA 4MJ8A 3LD2A 1U6MA 1I1DA 4B14A 4JD6A 1MJAA 2Q4VA 5GCNA 2AE6A 2OU2A 4PK3A 2REFA 4RI1A 3D2PA 1NMTA 1ON0A 4NSQA 4UCNA 2YNCC 4CYNA 4XPKA 1Y9WA 2R1IA 4KOUA 1S7NA 4CAXA 5AG6A 5G21A 4F0XA 3IWEA 3P2HA 1TIQA 4A30A 4A95A 4R3LA 1XEBA 1QSMA 2FXFA 4UWIA 4B5PA 3TFYA 5C82A 3PGPA 4CYQA 3DR8A 3BJ8A 4B12A 3GYAA 2F5IA 4KOYA 4Y49C 3SXOA 1WK4A 2QECA 2GIVA 2Q04A 3F0AA 4XPDB 5F49A 3IWGA 5E96A 4UFXA 3S6GA 2ARHA 5F48A 3ZJ0A 4MFLA 3IU2A 1S60A 1I12A 3OWCA 3EXNA 1M4DA 4KSFA 1S7LA 1MJ9A 1PUAA 3R1KA 4C7HA 1P4NA 2REEA 4BBHA 2WSAA 3DDDA 1B6BA 4CGOA 5AG4A 3D2MA 5A27A 2VEZA 5KTAA 1L0CA 3KKWA 4E2AA 2PR8A 2Q7BA 3FNCA 4B11A 1YREA 4A31A 1Q2DA 4ZGYB 2Z0ZA 5H84A 4QC6A 2FE7A 4KOWA 1GHEA 4U9YA 4AB7A 2X7BA 2KCWA 4F0YA 4FD7A 2GANA 4HKFA 1XE4A 1KUYA 1Q2YA 4KOSA 3G8WA 4CGPA 1Y9KA 3I9SA 5CNPA 4B5OA 1RO5A 2YNCA 5DWNA 1RXTA 1IYKA 1PU9A 1P0HA 2Z11A 3TCVA 4CYPA 4H89A 1CM0A 1VHSA 4UCMA 3E0KA 1NSLA 4Y49B 5KTCA 1YX0A 3FYNA 4MI4A 4MFPA 2QMLA 4A32A 4MFZA 2Z3OA 4F6AA 1YVKA 3G3SA 4I49A 2RC4A 4YFJA 2AJ6A 4R87A 1SQHA 4MFQA 3TO9A 4KOVA 4II9A 1LRZA 2DXQA 4KLVA 4LUAA 2ZW5A 3EC4A 4CGLA 5G1ZA 2B5GB 2JDDA 3FIXA 4R57A 4A2ZA 1QSNA 2FIWA 4MBUA 4OAEA 2OB0A 4UA3A 4CGNA 5AG7A 4H6UA 3JUWA 2VQYA 4ONUA 1R57A 4DNCA 4J3GA 1M1DA 2Z3PA 4NEXA 3EY5A 3W6XA 4H6ZA 2HQYA 3TTHA 2B58A 1YR0A 4CAVA 3F5BA 2PR1A 1S7KA 3JVNA 3H4QA 4CAWA 1J4JA 3R96A 4KVXA 2G3TA 2ATRA 4MY3A 3VWDA 5HMNA 4CS0B 4B10A 1CJWA 2ZXVA 3T9YA 4UCPA 4KVOE 3FXTA 4FD4A 1BOBA 5C88A 3UY5A 2D4PA 1MJBA 4KORA 3H5ZA 3P2FA 2NMTA 5I0CA 2G0BA 4QUSA 5G20A 1N71A 2CXAA 3FRMA 4QB9A 4PSWA 2FT0A 2CNMA 2YNEA 2ZW6A 4CGMA 4C2ZA 2I00A 3K9UA 1IYLA 1XMTA 4AG9A 4NF1A 2WUUA 3T90A 4KUBA 4MFJA 3R9FA 2FS5A 1I21A 2OZGA 2J8MA 4CAEA 2B4BA 4CRZB 4MHDA 2OZHA 1K4JA 3DSBA 5A28A 3FB3A 3I3GA 5JQ4A 2P6GA 2JLMA 2BEIA 1Z4EA 2OZUA 1MK4A 2JEVA 1KUXA 5EBVA 4KUAA 2GE3A 5HH1A 2ZPAA 4OADA 1IICA 2BSWA 3D3SA 3LODA 4C2YA 3MGDA 4L89A 1V0CA 2Q0YA 2OH1A 4IF5A 5AG5A 3DNSA 4Q36A 3SXNA 2I79A 2VI7A 4E8OA 2FL4A 2J8NA 2B4DB 2ZW7A 2Z3NA 4XNHC 4MY0A 4RS2A 3C26A 1IB1E 3D8PA 4ZBGA 5KTDA 4KOTA 2PC1A 1S5KA 2YGWA 1YVOA 3F8KA 3W91A 4CRYB 1BO4A 2FCKA 2B4DA 4YRHA 4IUSA 4MFKA 3WR7A 5G22A 1Z4RA 2BL1A 1S7FA 3ZZIA 1XF8A 4C68A 4KS9A 1KUVA 5H86A 5F46A 1YLEA 4UFVA 2BUEA 2CY2A 4HNYB 4L8AA 1B87A 2Z3LA 2P6EA 2A4NA 3CXPA 5EC4A 3S6FA 5IX3A 3NE7A 1M44A 2O28A 3DR6A 2VZYA 4R3KA 4U9ZA 3W6SA 2Z10A 3B8GA 4EVYA 1YK3A 2B5GA 2QIRA 4AVAA 4HNXB 4BMHA 1KZFA 1Y7RA 4UWJA 4C7IA 5JPHA 1ZO0A 3VWEA 3R9EA 4CYOA 5DWMA 4KOXA 1UFHA 1QSOA 4A33A 3RYOA 3TO6A 4AVCA 4FD6A 1QSRA 4PK2A 4GS4A 2DPTA 5FVJA 2Z3KA 2Z3MA 2G3AA 3V8IA 4KVME 4B5PB 2ZW4A 2R8VA 2FIAA 4KLWA 2Y0MA 3TO7A 2VZZA 4JJXA 3PZJA 1OZPA 2D4OA 1YGHA 1IIDA 2HV2A 4XNHB 4FD5A 3IGRA 3A9LA 4K30A 3EO4A 3IU1A 4JWPA 3QB8A 2Q4YA 5IV0A 3N7ZA 2VBQA 4JXRA 2P0WA 4KSAA 4PV6A 2Q44A 2B3UA 3QAHA 4M85A 5J8FA 1NE9A 4XPLA 1S3ZA 3R95A 2R7HA 2PSWA 4LX9A 5AGEA 2EUIA 2PRBA 2P6FA 1VKCA 2EVNA 1Q2CA 4ORFA 4AG7A 4UBRA 3GY9A 1QSTA 4NXYA 2FSRA 3TE4A 3GKRA 2CNTA 3SHPA 4C2XA 4R9MA 2WPWA 5F47A 3FBUA 3TOAA 2YNDA 3BJ7A 2C27A 4QBJA 5ISVA 3S6HA 3BLNA 3TT2A 2IL4A 3R9GA 3CXSA 5J8CA 4AVBA 4UFWA 2CNSA 4E0AA 4PSXA 1XIXA 3JTKA 3TOBA 2JDCA 2PDOA 3PP9A 4Q38A 4QVTA 4CAFA 5BWAB 3S6KA 2WPXA 4XPDC 4B13A 4KZTA 2DPSA 1WWZA 1M4GA 4U5YA 3EFAA 3CXQA 4HNWB 2K5TA 4OLLA 2H5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3S A;  2J8R A;  2VXK A;  2B3V A;  2HUZ A;  1Z9U A;  5IB0 A;  4JLY A;  1M4I A;  2PQ8 A;  4NCZ A;  4YGO A;  2R98 A;  4JXQ A;  1FY7 A;  4X5K A;  4MJ8 A;  3LD2 A;  1U6M A;  1I1D A;  4JD6 A;  1MJA A;  2Q4V A;  5GCN A;  2AE6 A;  2OU2 A;  4PK3 A;  2REF A;  4RI1 A;  3D2P A;  1NMT A;  1ON0 A;  4NSQ A;  4XPK A;  1Y9W A;  2R1I A;  4KOU A;  1S7N A;  4CAX A;  3P2H A;  1TIQ A;  4R3L A;  1XEB A;  1QSM A;  2FXF A;  4UWI A;  4B5P A;  3TFY A;  5C82 A;  3PGP A;  3DR8 A;  3BJ8 A;  3GYA A;  2F5I A;  4KOY A;  4Y49 C;  3SXO A;  1WK4 A;  2QEC A;  2GIV A;  2Q04 A;  3F0A A;  4XPD B;  5F49 A;  3IWG A;  5E96 A;  3S6G A;  2ARH A;  5F48 A;  3ZJ0 A;  1S60 A;  1I12 A;  3OWC A;  3EXN A;  1M4D A;  1S7L A;  1MJ9 A;  1PUA A;  3R1K A;  1P4N A;  2REE A;  3DDD A;  1B6B A;  3D2M A;  2VEZ A;  5KTA A;  1L0C A;  3KKW A;  4E2A A;  2PR8 A;  2Q7B A;  3FNC A;  1YRE A;  1Q2D A;  2Z0Z A;  5H84 A;  4QC6 A;  2FE7 A;  4KOW A;  1GHE A;  4U9Y A;  4AB7 A;  2X7B A;  2KCW A;  4F0Y A;  4FD7 A;  2GAN A;  4HKF A;  1XE4 A;  1KUY A;  1Q2Y A;  4KOS A;  3G8W A;  1Y9K A;  3I9S A;  5CNP A;  4B5O A;  1RO5 A;  5DWN A;  1RXT A;  1IYK A;  1PU9 A;  1P0H A;  2Z11 A;  3TCV A;  4H89 A;  1CM0 A;  1VHS A;  3E0K A;  1NSL A;  4Y49 B;  5KTC A;  1YX0 A;  3FYN A;  4MI4 A;  2QML A;  4F6A A;  1YVK A;  3G3S A;  4I49 A;  2RC4 A;  4YFJ A;  2AJ6 A;  4R87 A;  1SQH A;  3TO9 A;  4KOV A;  4II9 A;  1LRZ A;  2DXQ A;  4KLV A;  4LUA A;  2ZW5 A;  3EC4 A;  2B5G B;  2JDD A;  3FIX A;  4R57 A;  1QSN A;  2FIW A;  4MBU A;  4OAE A;  2OB0 A;  4UA3 A;  4H6U A;  3JUW A;  2VQY A;  4ONU A;  1R57 A;  4DNC A;  4J3G A;  1M1D A;  4NEX A;  3EY5 A;  3W6X A;  4H6Z A;  2HQY A;  3TTH A;  2B58 A;  1YR0 A;  4CAV A;  2PR1 A;  3F5B A;  1S7K A;  3JVN A;  3H4Q A;  4CAW A;  1J4J A;  3R96 A;  4KVX A;  2G3T A;  2ATR A;  4MY3 A;  3VWD A;  5HMN A;  4CS0 B;  1CJW A;  2ZXV A;  3T9Y A;  4KVO E;  3FXT A;  4FD4 A;  1BOB A;  5C88 A;  3UY5 A;  2D4P A;  1MJB A;  4KOR A;  3P2F A;  2NMT A;  5I0C A;  2G0B A;  4QUS A;  1N71 A;  3FRM A;  4QB9 A;  4PSW A;  2FT0 A;  2CNM A;  2ZW6 A;  2I00 A;  3K9U A;  1IYL A;  1XMT A;  4AG9 A;  4NF1 A;  3T90 A;  4KUB A;  3R9F A;  2FS5 A;  1I21 A;  2OZG A;  2J8M A;  2B4B A;  4CRZ B;  4MHD A;  2OZH A;  1K4J A;  3DSB A;  3FB3 A;  3I3G A;  5JQ4 A;  2P6G A;  2JLM A;  2BEI A;  1Z4E A;  2OZU A;  1MK4 A;  2JEV A;  1KUX A;  5EBV A;  4KUA A;  2GE3 A;  5HH1 A;  2ZPA A;  4OAD A;  1IIC A;  2BSW A;  3D3S A;  3LOD A;  3MGD A;  4L89 A;  1V0C A;  2Q0Y A;  2OH1 A;  4IF5 A;  3DNS A;  3SXN A;  2I79 A;  2VI7 A;  4E8O A;  2FL4 A;  2J8N A;  2B4D B;  2ZW7 A;  4XNH C;  4MY0 A;  4RS2 A;  3C26 A;  1IB1 E;  3D8P A;  4ZBG A;  5KTD A;  4KOT A;  2PC1 A;  1S5K A;  1YVO A;  3F8K A;  3W91 A;  4CRY B;  1BO4 A;  2FCK A;  2B4D A;  4YRH A;  4IUS A;  3WR7 A;  1Z4R A;  2BL1 A;  1S7F A;  3ZZI A;  1XF8 A;  5H86 A;  1KUV A;  5F46 A;  1YLE A;  2BUE A;  2CY2 A;  4HNY B;  4L8A A;  1B87 A;  2P6E A;  2A4N A;  3CXP A;  5EC4 A;  3S6F A;  5IX3 A;  3NE7 A;  1M44 A;  2O28 A;  3DR6 A;  2VZY A;  4R3K A;  4U9Z A;  3W6S A;  2Z10 A;  3B8G A;  4EVY A;  1YK3 A;  2B5G A;  2QIR A;  4AVA A;  4HNX B;  4BMH A;  1KZF A;  1Y7R A;  4UWJ A;  5JPH A;  3VWE A;  3R9E A;  5DWM A;  4KOX A;  1UFH A;  1QSO A;  3RYO A;  3TO6 A;  4AVC A;  4FD6 A;  1QSR A;  4PK2 A;  4GS4 A;  5FVJ A;  2G3A A;  3V8I A;  4KVM E;  4B5P B;  2ZW4 A;  2R8V A;  2FIA A;  4KLW A;  2Y0M A;  3TO7 A;  2VZZ A;  4JJX A;  3PZJ A;  1OZP A;  2D4O A;  1YGH A;  1IID A;  2HV2 A;  4XNH B;  4FD5 A;  3IGR A;  4K30 A;  3EO4 A;  4JWP A;  3QB8 A;  2Q4Y A;  5IV0 A;  3N7Z A;  2VBQ A;  4JXR A;  2P0W A;  4PV6 A;  2Q44 A;  2B3U A;  3QAH A;  4M85 A;  5J8F A;  1NE9 A;  4XPL A;  1S3Z A;  3R95 A;  2R7H A;  2PSW A;  4LX9 A;  2EUI A;  2PRB A;  2P6F A;  1VKC A;  2EVN A;  1Q2C A;  4ORF A;  4AG7 A;  4UBR A;  3GY9 A;  1QST A;  4NXY A;  2FSR A;  3TE4 A;  3GKR A;  2CNT A;  3SHP A;  4R9M A;  2WPW A;  5F47 A;  3FBU A;  3TOA A;  3BJ7 A;  2C27 A;  4QBJ A;  5ISV A;  3S6H A;  3BLN A;  3TT2 A;  2IL4 A;  3R9G A;  3CXS A;  5J8C A;  4AVB A;  2CNS A;  4E0A A;  4PSX A;  1XIX A;  3TOB A;  2JDC A;  2PDO A;  3PP9 A;  4QVT A;  3S6K A;  2WPX A;  4XPD C;  4KZT A;  1WWZ A;  1M4G A;  4U5Y A;  3EFA A;  3CXQ A;  4HNW B;  2K5T A;  4OLL A;  2H5M A; 
#chains in the Genus database with same CATH topology
 2CTC A;  4JYW A;  4M3S A;  2J8R A;  3IEH A;  2DF5 A;  2VXK A;  2B3V A;  2I3C A;  2HUZ A;  4AXV A;  1Z9U A;  5IB0 A;  3MN8 A;  4JLY A;  1M4I A;  2PQ8 A;  4NCZ A;  4OC5 A;  3GLJ A;  4YGO A;  2R98 A;  2ZEF A;  3B3W A;  5IX3 A;  3RBU A;  4JXQ A;  1FY7 A;  4X5K A;  4MJ8 A;  2GFQ A;  3CZX A;  3LD2 A;  3KHX A;  1U6M A;  1ELL P;  1I1D A;  4B14 A;  3IC1 A;  4JD6 A;  4H2K A;  1MJA A;  2Q4V A;  1VHE A;  5GCN A;  2AE6 A;  2OU2 A;  3CT9 A;  4PK3 A;  2Q51 A;  2REF A;  4RI1 A;  1QQ9 A;  3D2P A;  2Q4Z A;  1NMT A;  3GIU A;  1ON0 A;  1AMP A;  4NSQ A;  4UCN A;  3VH9 A;  2YNC C;  4CYN A;  1VIX A;  4XPK A;  3SJF A;  5JM6 A;  1OBR A;  1Y9W A;  2R1I A;  4KOU A;  4RUH A;  1S7N A;  2ZED A;  3ISZ A;  4CAX A;  4DJL A;  3B3C A;  4PXD A;  2WZN A;  5AG6 A;  1YLO A;  5G21 A;  4F0X A;  3IWE A;  3P2H A;  1TIQ A;  3D66 A;  4A30 A;  3BHX A;  1TXR A;  4R3L A;  3CPX A;  4A95 A;  1XEB A;  1QSM A;  4BD9 A;  1XBU A;  2FXF A;  4UWI A;  4EME A;  4B5P A;  3TFY A;  4ONW A;  5C82 A;  2F7V A;  3PGP A;  3DR8 A;  4CYQ A;  3BJ8 A;  2V8G A;  3B7I A;  3GYA A;  4B12 A;  2F5I A;  4KOY A;  4Y49 C;  3SXO A;  1WK4 A;  2QEC A;  3JRU A;  2JBJ A;  2GRE A;  2GIV A;  2POK A;  4UEE A;  2Q04 A;  3F0A A;  4XPD B;  4OME A;  4OC1 A;  5F49 A;  1ZG9 A;  4X3R A;  3IWG A;  4TNU A;  5E96 A;  4UFX A;  2AFS A;  3S6G A;  2ARH A;  5F48 A;  5LYI A;  1FNO A;  3NE8 A;  3PEI A;  4MFL A;  3IU2 A;  3ZJ0 A;  1Z8X A;  1S60 A;  1PCA A;  1F2P A;  1I12 A;  3OWC A;  4WJB A;  3EXN A;  4ZY0 A;  1M4D A;  1YQE A;  5J1Q A;  1ZLI A;  3BXM A;  3IFE A;  1XRY A;  4KSF A;  1BPN A;  1S7L A;  1MJ9 A;  1PUA A;  3R1K A;  2GU2 A;  2F8H A;  4C7H A;  5LYD A;  1P4N A;  2REE A;  4BBH A;  2IQ6 A;  2WSA A;  3KR4 A;  1F57 A;  3DDD A;  1B6B A;  4CGO A;  5AG4 A;  2IJZ A;  3D2M A;  5A27 A;  5CPA A;  5IB9 A;  5LRG A;  2VEZ A;  3PRT A;  5KTA A;  4A39 A;  1L0C A;  1R3N A;  2ANP A;  3KKW A;  4OC0 A;  4ZX8 A;  3D7F A;  2PR8 A;  4WWV A;  2Q7B A;  4E2A A;  3FNC A;  4M6G A;  4B11 A;  1YRE A;  4A31 A;  4NGN A;  3KAS A;  1Q2D A;  4MHP A;  1AUG A;  4ZGY B;  2Z0Z A;  5H84 A;  1ELM P;  2GLF A;  4QC6 A;  4RN7 A;  5CBM A;  2FE7 A;  3IJ3 A;  4KOW A;  2ZEL A;  5DS0 A;  4FUU A;  1GHE A;  4U9Y A;  2PJ0 A;  4AB7 A;  1R43 A;  2X7B A;  2KCW A;  4F0Y A;  4FD7 A;  2GAN A;  4HKF A;  1XE4 A;  1KUY A;  3I1U A;  1Q2Y A;  4IK2 A;  2EK8 A;  4KOS A;  3G8W A;  4CGP A;  1Y9K A;  3I9S A;  5CNP A;  3NFZ A;  4OC4 A;  4B5O A;  1RO5 A;  2YNC A;  5DWN A;  2ZEN A;  4ZY2 A;  1Z8L A;  1RXT A;  4UIB A;  3K2K A;  1IYK A;  1PU9 A;  1P0H A;  3WC7 A;  2PJ5 A;  2Z11 A;  3TCV A;  1HEE A;  2ZEG A;  3B2Y A;  4H89 A;  1CM0 A;  4CYP A;  4NJQ A;  1VHS A;  4UCM A;  1ARM A;  2PJ2 A;  3E0K A;  4Y49 B;  1NSL A;  1YX0 A;  3FYN A;  5KTC A;  4MI4 A;  1X10 A;  4MFP A;  2QML A;  1HDU A;  3NH5 A;  4A32 A;  2QJ8 A;  4MFZ A;  2Z3O A;  4F6A A;  2RFH A;  1YVK A;  4R6T A;  2EO8 A;  3G3S A;  4G1P A;  3KGQ A;  1TF8 A;  3KI9 A;  4UF4 A;  3D7H A;  4I49 A;  2RC4 A;  4X2T A;  4YFJ A;  2AJ6 A;  4ZY1 A;  2PIY A;  4R76 A;  4R87 A;  2VL1 A;  4OP4 A;  2OOT A;  1SQH A;  1Z8T A;  4GM5 A;  3VAT A;  4F9U A;  4MFQ A;  3TO9 A;  1IY7 A;  4X8I A;  4YU9 A;  1Z8W A;  3D7G A;  4KOV A;  3PFO A;  2PJ4 A;  2ZEH A;  4UEZ A;  3V7Z A;  1LRZ A;  1CX8 A;  2DXQ A;  4II9 A;  2OR4 A;  4KLV A;  4LUA A;  5ELY A;  4A38 A;  4M6I A;  2ZW5 A;  1YSJ A;  3EC4 A;  4CGL A;  1TF9 A;  2NSM A;  3HLP A;  1Z5R A;  5G1Z A;  2B5G B;  2JDD A;  2PJ1 A;  3FIX A;  4R57 A;  4A2Z A;  2XEI A;  4MCQ A;  3RNZ A;  1QSN A;  2ABZ A;  2FIW A;  4MBU A;  2XEF A;  4OAE A;  3WAB A;  5LYL A;  5LRK A;  3MRU A;  3NH4 A;  2OB0 A;  2PVW A;  4MRI A;  4UA3 A;  4UIA A;  3BI0 A;  2PJ7 A;  4CGN A;  3H8F A;  4PXC A;  2PJ9 A;  3HUV A;  4GXH A;  3LAC A;  4H6U A;  5AG7 A;  4F8Z A;  3L2N A;  3NA6 A;  3JUW A;  2VQY A;  3D68 A;  1CPX A;  4ONU A;  1R57 A;  4NGP A;  4DNC A;  4J3G A;  1M1D A;  2Z3P A;  4NEX A;  3EY5 A;  3PB8 X;  4PPZ A;  3W6X A;  4H6Z A;  1JWQ A;  2HQY A;  4OC3 A;  2O4H A;  3TTH A;  2B58 A;  1YR0 A;  2QYV A;  4P4B A;  3SI0 A;  4CAV A;  2PR1 A;  3F5B A;  1S7K A;  2PJA A;  3JVN A;  4HPS A;  4ZI6 A;  3H4Q A;  3WT4 A;  4CAW A;  1J4J A;  1XMB A;  2JBK A;  2AFM A;  3R96 A;  3FEE A;  4KVX A;  2G3T A;  2ATR A;  4MY3 A;  2V77 A;  3VWD A;  2AFX A;  5HMN A;  4CS0 B;  4MCR A;  4B10 A;  1CJW A;  2ZXV A;  3T9Y A;  3PB6 X;  4UCP A;  5THW A;  4KVO E;  3FXT A;  1AYE A;  1LOK A;  3B35 A;  4FD4 A;  1BOB A;  2PJ3 A;  4OKO A;  2V8V A;  2GLJ A;  4R7M A;  5C88 A;  1LAP A;  2D4P A;  3UY5 A;  2FVG A;  1MJB A;  4P4F A;  3WC6 A;  2PE3 A;  4KOR A;  3SI1 A;  2HB6 A;  3H5Z A;  2NMT A;  3P2F A;  4MHN A;  3QNV A;  2ZEO A;  5I0C A;  3BI1 A;  2G0B A;  3FVL A;  4QUS A;  1TKJ A;  5G20 A;  1N71 A;  2RB7 A;  2CXA A;  3FRM A;  4QB9 A;  4PSW A;  2FT0 A;  2CNM A;  1CP7 A;  2YNE A;  2ZW6 A;  4CGM A;  4C2Z A;  2I00 A;  3K9U A;  1IYL A;  2C6G A;  1XMT A;  4AG9 A;  1NSA A;  1TKF A;  3D4U A;  4NF1 A;  1ZG7 A;  2PJC A;  2WUU A;  5HVG A;  5K8P A;  3T90 A;  4NGT A;  1Y7E A;  4KUB A;  4MFJ A;  3R9F A;  2FS5 A;  5F09 A;  1I21 A;  2OZG A;  4YWY A;  2AFW A;  2J8M A;  4P4J A;  4NGM A;  4CAE A;  2B4B A;  1Z2L A;  4R8F A;  2BO9 A;  4CRZ B;  1IOF A;  4MHD A;  4NFR A;  2OZH A;  1A2Z A;  2V8D A;  1Y0Y A;  4P45 A;  3LMS A;  1K4J A;  2DEA A;  3FJU A;  3DSB A;  5A28 A;  3FB3 A;  2EBJ A;  2PIZ A;  3I3G A;  5JQ4 A;  2P6G A;  2EK9 A;  2JLM A;  5HVH A;  2ZOF A;  2XEJ A;  2BEI A;  1ZLH A;  4P4D A;  1Z4E A;  2OZU A;  1MK4 A;  3V38 A;  4FAI A;  2JEV A;  1KUX A;  4NGS A;  1FT7 A;  4KUA A;  5EBV A;  1IOI A;  2GE3 A;  5HH1 A;  4K3N A;  1M4L A;  2ZPA A;  2PJ8 A;  4P4E A;  4OAD A;  1IIC A;  2BSW A;  3D3S A;  3LOD A;  4C2Y A;  3MGD A;  4L89 A;  1V0C A;  2C6P A;  1RTQ A;  2Q0Y A;  3PBB A;  2ODF A;  2OH1 A;  5K8M A;  4IF5 A;  5AG5 A;  3DNS A;  4Q36 A;  3SXN A;  2I79 A;  2VI7 A;  4E8O A;  2FL4 A;  3PFE A;  2J8N A;  1VGY A;  2B4D B;  1CG2 A;  2Z3N A;  2ZW7 A;  4XNH C;  4MY0 A;  4RS2 A;  3C26 A;  4KSI A;  7CPA A;  3H8E A;  1IB1 E;  2V8H A;  3D8P A;  4ZBG A;  5KTD A;  4KOT A;  2PC1 A;  4MCS A;  1IU8 A;  1S5K A;  4LQG A;  2YGW A;  1YVO A;  2PJB A;  3F8K A;  3W91 A;  1BO4 A;  1BLL E;  5HVF A;  2CF4 A;  2FCK A;  4CRY B;  3CDX A;  3FMC A;  2PVV A;  2CTB A;  2B4D A;  4YRH A;  5BWA B;  3PB9 X;  4IUS A;  4MFK A;  2ZEE A;  3WR7 A;  4ZYQ A;  5G22 A;  4DYO A;  1Z4R A;  2AFZ A;  1S7F A;  2BL1 A;  1XF8 A;  3ZZI A;  4C68 A;  1KWM A;  4KS9 A;  1KUV A;  5H86 A;  5F46 A;  2XEG A;  4MHY A;  1YLE A;  1YW6 A;  4UFV A;  4ZX9 A;  2BUE A;  1X12 A;  2CY2 A;  3RO0 A;  4HNY B;  1UWY A;  4L8A A;  1B87 A;  2Z3L A;  2P6E A;  2A4N A;  3CXP A;  3ISX A;  3KHZ A;  3QAY A;  5EC4 A;  3DLJ A;  3NE7 A;  3S6F A;  2WYR A;  4Q7A A;  5JGF A;  3S9L A;  3KQX A;  3RZA A;  1M44 A;  2O28 A;  3DR6 A;  2VZY A;  4R3K A;  4U9Z A;  4A94 A;  3W6S A;  4NJR A;  2Z10 A;  3B8G A;  4EVY A;  4F9V A;  1F2O A;  1YK3 A;  2B5G A;  2QIR A;  4AVA A;  4MCP A;  2G9D A;  4HNX B;  3KL9 A;  4BMH A;  1KZF A;  1Y7R A;  4UWJ A;  2PCU A;  4C7I A;  1Q7L A;  3KR5 A;  4B6Z A;  3CPA A;  1ZO0 A;  3VWE A;  5JPH A;  1DE4 C;  5EMI A;  4JZ0 A;  1XFO A;  3R9E A;  4CYO A;  4P6Y A;  1DTD A;  5DWM A;  4PQA A;  4MHZ A;  1BAV A;  4KOX A;  4IHM A;  1UFH A;  1QSO A;  2J9A A;  4A33 A;  2BOA A;  3NH8 A;  3RYO A;  3WC5 A;  3TO6 A;  3B3T A;  5LRJ A;  4AVC A;  1LAN A;  3FX6 A;  4FD6 A;  4Z65 A;  1QSR A;  4PK2 A;  4GS4 A;  3FF3 A;  2DPT A;  4P44 A;  5FVJ A;  2Z3K A;  4W9Y A;  2Z3M A;  2G3A A;  2HC9 A;  2C6C A;  2AFO A;  2ZOG A;  2ZEM A;  3FEC A;  4FWU A;  4KVM E;  3GUX A;  3V8I A;  4B5P B;  4DUK A;  4BIN A;  2ZW4 A;  4OIW A;  2R8V A;  2FIA A;  4KLW A;  2Y0M A;  2C1C A;  4LQ6 A;  4NGR A;  3B3S A;  3TO7 A;  2VZZ A;  4JJX A;  3DGV A;  3PZJ A;  1OZP A;  1JQG A;  1LAM A;  2D4O A;  1IGB A;  3N5F A;  1YGH A;  1IID A;  2HV2 A;  2O53 A;  2PJ6 A;  4O23 A;  5D8N A;  4XNH B;  4FD5 A;  4EWT A;  2JEW A;  3IGR A;  4PXB A;  3A9L A;  1CPS A;  8CPA A;  1ARL A;  3FED A;  4K30 A;  4M6H A;  3T8W A;  3EO4 A;  5HXD A;  3IU1 A;  4JWP A;  3PB4 X;  3SI2 A;  3GB0 A;  4CPA A;  4TWE A;  1LCP A;  3IIB A;  3QB8 A;  2Q43 A;  2Q4Y A;  5D29 A;  5IV0 A;  3IO1 A;  3VAR A;  3N7Z A;  2VBQ A;  4JXR A;  4MMO A;  3FH4 A;  2P0W A;  4KSA A;  4OID A;  4PV6 A;  4EFD A;  2Q44 A;  2B3U A;  3QAH A;  4M85 A;  5J8F A;  4OC2 A;  3SJG A;  1NE9 A;  4XPL A;  1S3Z A;  3R95 A;  2R7H A;  2PSW A;  3D67 A;  4IAV A;  4LX9 A;  5AGE A;  4MXU A;  2EUI A;  2PRB A;  3RAM A;  2P6F A;  1VKC A;  2EVN A;  1XJO A;  1Q2C A;  1CBX A;  1EE3 P;  2NYQ A;  2ZEP A;  3D7D A;  3H8G A;  3B3V A;  3S9N A;  4ORF A;  4AG7 A;  2IMO A;  4UBR A;  3PB7 X;  4PXE A;  3GY9 A;  1QST A;  4NXY A;  2FSR A;  3TE4 A;  5I4M A;  1VHO A;  3GKR A;  1TKH A;  2CNT A;  3SHP A;  2CIJ A;  1HDQ A;  5JH9 A;  4C2X A;  4R9M A;  3IWW A;  1LFW A;  2WPW A;  5F47 A;  3FBU A;  2AFU A;  3KZW A;  3SJE A;  3TOA A;  2YND A;  1ZG8 A;  2C27 A;  3BJ7 A;  3S9M A;  1BPM A;  4QBJ A;  1PYT B;  5ISV A;  1XOV A;  6CPA A;  3S6H A;  3BLN A;  4A37 A;  3TT2 A;  1Y0R A;  1YW4 A;  2IL4 A;  5K8N A;  5LYF A;  4P4I A;  3R9G A;  3CXS A;  5J8C A;  4AVB A;  4FBE A;  2Q7S A;  2QVP A;  4UFW A;  2CNS A;  3K9T A;  4E0A A;  3PBE A;  4PSX A;  1XIX A;  3TX8 A;  5K8O A;  4UEF A;  3JTK A;  3SJX A;  2EWB A;  3TC8 A;  2JDC A;  3TOB A;  3KQZ A;  2BCO A;  2PDO A;  1GYT A;  3PP9 A;  1YME A;  4Q38 A;  2PRQ A;  4QVT A;  4CAF A;  3S6K A;  1QMU A;  2WPX A;  4P10 A;  3LWU A;  4KZT A;  4XPD C;  4B13 A;  2DPS A;  1WWZ A;  1M4G A;  4NGQ A;  4U5Y A;  3EFA A;  1CP6 A;  3CXQ A;  4HNW B;  2K5T A;  1H8L A;  4OLL A;  2H5M A; 
#chains in the Genus database with same CATH homology
 4M3S A;  2J8R A;  2VXK A;  2B3V A;  2HUZ A;  1Z9U A;  5IB0 A;  4JLY A;  1M4I A;  2PQ8 A;  4NCZ A;  4YGO A;  2R98 A;  4JXQ A;  1FY7 A;  4X5K A;  4MJ8 A;  3LD2 A;  1U6M A;  1I1D A;  4B14 A;  4JD6 A;  1MJA A;  2Q4V A;  5GCN A;  2AE6 A;  2OU2 A;  4PK3 A;  2REF A;  4RI1 A;  3D2P A;  1NMT A;  1ON0 A;  4NSQ A;  4UCN A;  2YNC C;  4CYN A;  4XPK A;  1Y9W A;  2R1I A;  4KOU A;  1S7N A;  4CAX A;  5AG6 A;  5G21 A;  4F0X A;  3IWE A;  3P2H A;  1TIQ A;  4A30 A;  4A95 A;  4R3L A;  1XEB A;  1QSM A;  2FXF A;  4UWI A;  4B5P A;  3TFY A;  5C82 A;  3PGP A;  4CYQ A;  3DR8 A;  3BJ8 A;  4B12 A;  3GYA A;  2F5I A;  4KOY A;  4Y49 C;  3SXO A;  1WK4 A;  2QEC A;  2GIV A;  2Q04 A;  3F0A A;  4XPD B;  5F49 A;  3IWG A;  5E96 A;  4UFX A;  3S6G A;  2ARH A;  5F48 A;  3ZJ0 A;  4MFL A;  3IU2 A;  1S60 A;  1I12 A;  3OWC A;  3EXN A;  1M4D A;  4KSF A;  1S7L A;  1MJ9 A;  1PUA A;  3R1K A;  4C7H A;  1P4N A;  2REE A;  4BBH A;  2WSA A;  3DDD A;  1B6B A;  4CGO A;  5AG4 A;  3D2M A;  5A27 A;  2VEZ A;  5KTA A;  1L0C A;  3KKW A;  4E2A A;  2PR8 A;  2Q7B A;  3FNC A;  4B11 A;  1YRE A;  4A31 A;  1Q2D A;  4ZGY B;  2Z0Z A;  5H84 A;  4QC6 A;  2FE7 A;  4KOW A;  1GHE A;  4U9Y A;  4AB7 A;  2X7B A;  2KCW A;  4F0Y A;  4FD7 A;  2GAN A;  4HKF A;  1XE4 A;  1KUY A;  1Q2Y A;  4KOS A;  3G8W A;  4CGP A;  1Y9K A;  3I9S A;  5CNP A;  4B5O A;  1RO5 A;  2YNC A;  5DWN A;  1RXT A;  1IYK A;  1PU9 A;  1P0H A;  2Z11 A;  3TCV A;  4CYP A;  4H89 A;  1CM0 A;  1VHS A;  4UCM A;  3E0K A;  1NSL A;  4Y49 B;  5KTC A;  1YX0 A;  3FYN A;  4MI4 A;  4MFP A;  2QML A;  4A32 A;  4MFZ A;  2Z3O A;  4F6A A;  1YVK A;  3G3S A;  4I49 A;  2RC4 A;  4YFJ A;  2AJ6 A;  4R87 A;  1SQH A;  4MFQ A;  3TO9 A;  4KOV A;  4II9 A;  1LRZ A;  2DXQ A;  4KLV A;  4LUA A;  2ZW5 A;  3EC4 A;  4CGL A;  5G1Z A;  2B5G B;  2JDD A;  3FIX A;  4R57 A;  4A2Z A;  1QSN A;  2FIW A;  4MBU A;  4OAE A;  2OB0 A;  4UA3 A;  4CGN A;  5AG7 A;  4H6U A;  3JUW A;  2VQY A;  4ONU A;  1R57 A;  4DNC A;  4J3G A;  1M1D A;  2Z3P A;  4NEX A;  3EY5 A;  3W6X A;  4H6Z A;  2HQY A;  3TTH A;  2B58 A;  1YR0 A;  4CAV A;  3F5B A;  2PR1 A;  1S7K A;  3JVN A;  3H4Q A;  4CAW A;  1J4J A;  3R96 A;  4KVX A;  2G3T A;  2ATR A;  4MY3 A;  3VWD A;  5HMN A;  4CS0 B;  4B10 A;  1CJW A;  2ZXV A;  3T9Y A;  4UCP A;  4KVO E;  3FXT A;  4FD4 A;  1BOB A;  5C88 A;  3UY5 A;  2D4P A;  1MJB A;  4KOR A;  3H5Z A;  3P2F A;  2NMT A;  5I0C A;  2G0B A;  4QUS A;  5G20 A;  1N71 A;  2CXA A;  3FRM A;  4QB9 A;  4PSW A;  2FT0 A;  2CNM A;  2YNE A;  2ZW6 A;  4CGM A;  4C2Z A;  2I00 A;  3K9U A;  1IYL A;  1XMT A;  4AG9 A;  4NF1 A;  2WUU A;  3T90 A;  4KUB A;  4MFJ A;  3R9F A;  2FS5 A;  1I21 A;  2OZG A;  2J8M A;  4CAE A;  2B4B A;  4CRZ B;  4MHD A;  2OZH A;  1K4J A;  3DSB A;  5A28 A;  3FB3 A;  3I3G A;  5JQ4 A;  2P6G A;  2JLM A;  2BEI A;  1Z4E A;  2OZU A;  1MK4 A;  2JEV A;  1KUX A;  5EBV A;  4KUA A;  2GE3 A;  5HH1 A;  2ZPA A;  4OAD A;  1IIC A;  2BSW A;  3D3S A;  3LOD A;  4C2Y A;  3MGD A;  4L89 A;  1V0C A;  2Q0Y A;  2OH1 A;  4IF5 A;  5AG5 A;  3DNS A;  4Q36 A;  3SXN A;  2I79 A;  2VI7 A;  4E8O A;  2FL4 A;  2J8N A;  2B4D B;  2ZW7 A;  2Z3N A;  4XNH C;  4MY0 A;  4RS2 A;  3C26 A;  1IB1 E;  3D8P A;  4ZBG A;  5KTD A;  4KOT A;  2PC1 A;  1S5K A;  2YGW A;  1YVO A;  3F8K A;  3W91 A;  4CRY B;  1BO4 A;  2FCK A;  2B4D A;  4YRH A;  4IUS A;  4MFK A;  3WR7 A;  5G22 A;  1Z4R A;  2BL1 A;  1S7F A;  3ZZI A;  1XF8 A;  4C68 A;  4KS9 A;  1KUV A;  5H86 A;  5F46 A;  1YLE A;  4UFV A;  2BUE A;  2CY2 A;  4HNY B;  4L8A A;  1B87 A;  2Z3L A;  2P6E A;  2A4N A;  3CXP A;  5EC4 A;  3S6F A;  5IX3 A;  3NE7 A;  1M44 A;  2O28 A;  3DR6 A;  2VZY A;  4R3K A;  4U9Z A;  3W6S A;  2Z10 A;  3B8G A;  4EVY A;  1YK3 A;  2B5G A;  2QIR A;  4AVA A;  4HNX B;  4BMH A;  1KZF A;  1Y7R A;  4UWJ A;  4C7I A;  5JPH A;  1ZO0 A;  3VWE A;  3R9E A;  4CYO A;  5DWM A;  4KOX A;  1UFH A;  1QSO A;  4A33 A;  3RYO A;  3TO6 A;  4AVC A;  4FD6 A;  1QSR A;  4PK2 A;  4GS4 A;  2DPT A;  5FVJ A;  2Z3K A;  2Z3M A;  2G3A A;  3V8I A;  4KVM E;  4B5P B;  2ZW4 A;  2R8V A;  2FIA A;  4KLW A;  2Y0M A;  3TO7 A;  2VZZ A;  4JJX A;  3PZJ A;  1OZP A;  2D4O A;  1YGH A;  1IID A;  2HV2 A;  4XNH B;  4FD5 A;  3IGR A;  3A9L A;  4K30 A;  3EO4 A;  3IU1 A;  4JWP A;  3QB8 A;  2Q4Y A;  5IV0 A;  3N7Z A;  2VBQ A;  4JXR A;  2P0W A;  4KSA A;  4PV6 A;  2Q44 A;  2B3U A;  3QAH A;  4M85 A;  5J8F A;  1NE9 A;  4XPL A;  1S3Z A;  3R95 A;  2R7H A;  2PSW A;  4LX9 A;  5AGE A;  2EUI A;  2PRB A;  2P6F A;  1VKC A;  2EVN A;  1Q2C A;  4ORF A;  4AG7 A;  4UBR A;  3GY9 A;  1QST A;  4NXY A;  2FSR A;  3TE4 A;  3GKR A;  2CNT A;  3SHP A;  4C2X A;  4R9M A;  2WPW A;  5F47 A;  3FBU A;  3TOA A;  2YND A;  3BJ7 A;  2C27 A;  4QBJ A;  5ISV A;  3S6H A;  3BLN A;  3TT2 A;  2IL4 A;  3R9G A;  3CXS A;  5J8C A;  4AVB A;  4UFW A;  2CNS A;  4E0A A;  4PSX A;  1XIX A;  3JTK A;  3TOB A;  2JDC A;  2PDO A;  3PP9 A;  4Q38 A;  4QVT A;  4CAF A;  5BWA B;  3S6K A;  2WPX A;  4XPD C;  4B13 A;  4KZT A;  2DPS A;  1WWZ A;  1M4G A;  4U5Y A;  3EFA A;  3CXQ A;  4HNW B;  2K5T A;  4OLL A;  2H5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...