4KORA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with 7-aminocephalosporanic acid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 45
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4korA00
5HH1A 3F5BA 2NMTA 4NF1A 4B5OA 3OWCA 2OZGA 4MJ8A 2P0WA 3D8PA 1Y7RA 3DR6A 1CJWA 3TE4A 3EC4A 5H84A 2D4PA 1S7NA 2CNTA 3QAHA 2VXKA 2HUZA 3G8WA 1Q2YA 1VHSA 4LX9A 4YRHA 2REFA 2IL4A 3FNCA 1M4DA 1M4IA 1MJ9A 4L89A 3H4QA 1R57A 4XPDC 2FIWA 4AVCA 4DNCA 5E96A 4CAWA 2CNSA 1XMTA 4OADA 1Y9WA 3S6HA 1UFHA 4ORFA 1P4NA 2Q04A 4R3LA 3PGPA 4E0AA 1S7LA 4Y49C 1YK3A 4IF5A 4AG7A 2B5GA 4KOVA 4MHDA 4KOWA 5DWMA 2FL4A 3QB8A 1LRZA 4AVAA 2ARHA 1YVKA 2ZW7A 3ZZIA 3BLNA 5EC4A 4HNXB 3TO9A 4R9MA 1NSLA 2C27A 2GANA 3IWGA 2JLMA 4FD7A 2B4DA 4KUBA 1WWZA 3RYOA 2G3AA 2Q44A 4AB7A 2Q4VA 4R3KA 1ON0A 1YLEA 4KUAA 3EY5A 2X7BA 4E2AA 4ZBGA 4PK2A 1QSNA 2O28A 5J8FA 3W6XA 5KTCA 3TTHA 2GE3A 4CRZB 2B5GB 1GHEA 4QBJA 2PRBA 3UY5A 3MGDA 3D2PA 2JEVA 3T90A 4PK3A 4U9YA 3JUWA 4PSWA 4KOSA 4NXYA 1Q2CA 3N7ZA 2D4OA 4II9A 4KVXA 3SXNA 4H6UA 3SHPA 2OB0A 5I0CA 1FY7A 5IV0A 2OZUA 4XPLA 3SXOA 1M1DA 2Q4YA 2VEZA 1OZPA 4MBUA 2B4DB 1XEBA 4LUAA 1S7KA 2HV2A 4R87A 4UBRA 4B5PA 5EBVA 5ISVA 5HMNA 2OH1A 2AE6A 3IGRA 2ZW6A 3FRMA 4JJXA 4IUSA 4YFJA 2JDDA 3V8IA 2ZW5A 5F49A 2OZHA 1XE4A 2VBQA 1SQHA 2I00A 4H89A 3DR8A 2Q7BA 2ZXVA 1WK4A 3K9UA 1QSRA 3P2HA 1S5KA 4FD5A 1KUXA 4J3GA 3BJ7A 2FS5A 4PSXA 1PU9A 2PDOA 5FVJA 3PP9A 3LD2A 2FT0A 5H86A 2FCKA 3R9GA 3GYAA 4ONUA 3TOBA 2B3UA 2I79A 3TO6A 3VWDA 4B5PB 3D2MA 4KLWA 4NSQA 2P6EA 2Z10A 3FYNA 4QVTA 4QUSA 3R96A 4HNWB 5F48A 1S3ZA 4KOUA 1NE9A 2GIVA 2VZYA 2BL1A 4I49A 4XPDB 4MI4A 1YREA 5GCNA 2J8MA 2P6FA 1VKCA 2VQYA 4K30A 2QIRA 4HNYB 1CM0A 4UA3A 4F6AA 1Q2DA 4CAXA 1XIXA 2CNMA 4H6ZA 4XPKA 4Y49B 4MY3A 1RO5A 2QMLA 1KZFA 5IX3A 1MJAA 2ZW4A 4UWJA 4AVBA 3DSBA 1BOBA 2EVNA 2K5TA 1QSMA 2H5MA 1MK4A 5KTDA 3F8KA 3ZJ0A 2AJ6A 1KUYA 3NE7A 3B8GA 3F0AA 5JPHA 2PR1A 3W91A 2WPWA 1I1DA 2B3VA 1B87A 3LODA 4HKFA 4XNHB 2B4BA 4CRYB 3FB3A 2PR8A 4JXQA 2J8NA 3R95A 1YX0A 2R98A 5C88A 3GKRA 4KVOE 3G3SA 2FXFA 4QC6A 2FIAA 4KLVA 4GS4A 2JDCA 3C26A 4CAVA 1S7FA 4M3SA 1RXTA 2J8RA 2Z11A 1IYLA 4JXRA 4QB9A 3DNSA 1Y9KA 5F47A 1M4GA 4PV6A 2HQYA 4FD4A 4KOXA 2WPXA 4CS0B 1XF8A 4BMHA 4FD6A 2PSWA 1PUAA 3FXTA 1YGHA 3P2FA 4OAEA 2ZPAA 3CXQA 1J4JA 4OLLA 3EO4A 1K4JA 5F46A 4RI1A 1TIQA 2A4NA 2Y0MA 1Z4EA 4KOYA 4EVYA 3CXPA 5JQ4A 3GY9A 1V0CA 1QSTA 3EFAA 3S6KA 4KOTA 1N71A 3JVNA 3WR7A 3TCVA 2BUEA 3CXSA 1U6MA 2VZZA 2R1IA 2R8VA 3TFYA 4X5KA 2BEIA 4KVME 3TT2A 4YGOA 4F0YA 3D3SA 1YR0A 1IYKA 1Z9UA 3S6GA 2VI7A 2G0BA 3FBUA 2P6GA 3R1KA 2FSRA 4RS2A 4JD6A 5DWNA 4E8OA 1Z4RA 4XNHC 2OU2A 3R9FA 4UWIA 4R57A 1I21A 5KTAA 4KORA 1YVOA 5C82A 4KZTA 4U5YA 4AG9A 3FIXA 1MJBA 1BO4A 3TO7A 2PC1A 3W6SA 2B58A 2F5IA 3TOAA 1IICA 4JWPA 2REEA 4JLYA 2DXQA 3EXNA 1B6BA 2FE7A 4U9ZA 5J8CA 2Z0ZA 2R7HA 1IIDA 1M44A 2Q0YA 1NMTA 5CNPA 3VWEA 2CY2A 3KKWA 4L8AA 3BJ8A 2QECA 3I9SA 2PQ8A 1S60A 2RC4A 4M85A 4MY0A 3S6FA 1KUVA 2BSWA 3I3GA 3E0KA 4NCZA 3PZJA 1QSOA 2KCWA 3T9YA 1L0CA 2G3TA 5IB0A 3R9EA 2ATRA 1IB1E 1I12A 2EUIA 3DDDA 1P0HA 4NEXA
chains in the Genus database with same CATH superfamily
5HH1A 4A30A 3FEEA 3F5BA 2NMTA 1F2OA 3BI1A 4NF1A 4B5OA 4CGLA 3OWCA 2OZGA 4ZY1A 4MJ8A 2P0WA 3IIBA 4OC4A 1VIXA 3D8PA 4NGMA 4MCRA 4C7IA 1LOKA 1Y7RA 3DR6A 1CJWA 1AYEA 3TE4A 2V77A 3EC4A 5H84A 2D4PA 2Z3NA 4CAFA 1S7NA 3PB4X 2CNTA 2GFQA 3QAHA 2VXKA 2HUZA 4R8FA 4UEZA 5BWAB 3N5FA 3G8WA 1Q2YA 1VHSA 3NA6A 4LX9A 4YRHA 2REFA 2IL4A 3SI2A 1GYTA 3FNCA 4P4DA 5HVHA 2PRQA 1M4DA 1M4IA 3PBBA 1MJ9A 1YW4A 2Z3KA 4UIBA 1ARMA 1YLOA 1JWQA 4L89A 3RAMA 3H4QA 1R57A 4XPDC 2FIWA 4UEFA 2GLJA 2V8GA 3KQXA 4AVCA 4DNCA 5E96A 4A38A 4CAWA 2CNSA 3B3CA 1TKHA 1XMTA 3GIUA 4OADA 1F2PA 1Y9WA 2ZOFA 3S6HA 3V7ZA 4NGQA 4C2XA 1UFHA 4ORFA 1NSAA 1P4NA 2Q04A 4M6HA 1LANA 4R3LA 3PGPA 4E0AA 3QAYA 1S7LA 2ZENA 4OIDA 4Y49C 1A2ZA 1YK3A 4PPZA 3DGVA 1TXRA 4IF5A 4AG7A 2B5GA 4KOVA 4MHDA 4IHMA 3TX8A 1X12A 4NGRA 4BINA 4KOWA 5DWMA 4IK2A 2FL4A 3QB8A 3PRTA 1LRZA 1Z8TA 3BHXA 3KASA 3CPAA 2WYRA 4AVAA 3PEIA 4R7MA 4MCPA 2ARHA 3JRUA 1CPSA 1ARLA 1KWMA 1YVKA 2ZW7A 3A9LA 3ZZIA 1RTQA 2EO8A 3V38A 2C1CA 3BLNA 1XBUA 5EC4A 1Z8XA 4HNXB 1IGBA 4MFJA 1Y0YA 3TO9A 4R9MA 4CGNA 1NSLA 5HVGA 4CGPA 3T8WA 2C27A 2GANA 4M6GA 2F8HA 3IWGA 2JLMA 2PJ9A 4FD7A 3VARA 3IWEA 3RZAA 2OOTA 2XEIA 2B4DA 1BLLE 1WWZA 4KUBA 3RYOA 2PJBA 3MN8A 2G3AA 4OC0A 2Q44A 2YNCC 3JTKA 4DJLA 4B11A 4AB7A 2Q4VA 2WUUA 3IWWA 4MXUA 4R3KA 3RBUA 1ON0A 4Q7AA 4CYNA 1YLEA 4KUAA 2V8HA 1CG2A 3EY5A 4DYOA 2X7BA 3GLJA 4KSFA 4E2AA 1XFOA 4ZBGA 2PJ0A 2JEWA 4PK2A 1CBXA 4NGPA 1QSNA 2O28A 1P0HA 5J8FA 3SJFA 3W6XA 4MFKA 5KTCA 2XEFA 3KHXA 3TTHA 3H8EA 2GE3A 4CRZB 5HVFA 4CPAA 2B5GB 1GHEA 1HDUA 4QBJA 2PRBA 3UY5A 3MGDA 2VL1A 8CPAA 1FNOA 3D2PA 2FVGA 3KL9A 2JEVA 3T90A 3B2YA 3WC5A 4PK3A 4U9YA 1HDQA 2IMOA 3JUWA 4NGNA 2AFSA 2ZEEA 4KOSA 1TF8A 4PSWA 4MMOA 4NXYA 4B10A 4C2ZA 1Q2CA 3N7ZA 2PJ5A 5I4MA 1ZG9A 2D4OA 4C7HA 4II9A 2Q7SA 4KVXA 2YGWA 3B35A 4H6UA 3SXNA 3SHPA 2GLFA 2OB0A 5I0CA 1FY7A 4B6ZA 3L2NA 4JZ0A 5IV0A 2YNDA 1XMBA 1AUGA 2OZUA 4ZX9A 4XPLA 3IO1A 3SXOA 1M1DA 2IJZA 2Q4YA 2VEZA 4AXVA 1OZPA 3K9TA 4MBUA 2B4DB 1XEBA 2AFOA 4LUAA 1S7KA 3NFZA 1M4LA 1X10A 2HV2A 4R87A 4NJQA 1ZO0A 4UBRA 2ZELA 3KHZA 2POKA 5EBVA 4B5PA 5AG6A 2CIJA 4OMEA 3VH9A 1BAVA 5HMNA 4OIWA 5ISVA 2OH1A 2GREA 2PIYA 2AE6A 1R43A 4UCMA 3FX6A 4NFRA 4F9UA 3IC1A 2QYVA 3IGRA 4R76A 1CX8A 2RB7A 2Z3OA 4WJBA 1OBRA 4CYQA 2YNEA 2PJ1A 1LAMA 4MCSA 2PJ8A 2PJAA 2ZW6A 4FAIA 2PIZA 3D7GA 3SI1A 2AFUA 3FRMA 4JJXA 3GUXA 1Z5RA 4IUSA 4A37A 4YFJA 2JDDA 3V8IA 2ZW5A 4MFZA 5F49A 2ODFA 3D67A 4A95A 3HUVA 4P44A 2RFHA 4ZGYB 2OZHA 1XE4A 2VBQA 3IU1A 4H2KA 1JQGA 5LYIA 1SQHA 2I00A 5AG4A 2ZEHA 3WC6A 4H89A 1XOVA 3DR8A 5K8PA 2Q7BA 1F57A 2ZXVA 2ANPA 4MHYA 1WK4A 1Z8LA 4NGSA 4P4FA 3K9UA 3K2KA 4CYPA 2BO9A 1QSRA 3P2HA 1CPXA 5DS0A 4RN7A 1CP6A 1S5KA 4FD5A 1KUXA 5CBMA 1ZG8A 4J3GA 3BJ7A 2FS5A 3PFOA 4PSXA 1PU9A 1QMUA 4ZI6A 2V8VA 2PDOA 3PB7X 5FVJA 3PP9A 3LD2A 1Q7LA 3QNVA 1Z2LA 1FT7A 2FT0A 5H86A 2FCKA 4X2TA 3R9GA 4DUKA 2EWBA 4CAEA 3GYAA 1ZLIA 4ONUA 3ISZA 3TOBA 4R6TA 2PCUA 5G22A 2QJ8A 2B3UA 3SJGA 2DPSA 2I79A 5AGEA 3TO6A 3VWDA 4B5PB 2AFXA 3D2MA 4TWEA 4KLWA 4NSQA 2P6EA 2Z10A 3FYNA 2CTCA 4P10A 4QVTA 5D8NA 4QUSA 4MFPA 3R96A 4HNWB 4HPSA 5F48A 3S9LA 1S3ZA 4YWYA 2AFMA 4KOUA 1NE9A 2YNCA 2GIVA 3PB9X 3FMCA 1IOIA 3SJXA 2VZYA 1TF9A 2BL1A 4PXDA 1IY7A 4I49A 4XPDB 4KS9A 1YREA 4MI4A 2J8MA 1ZG7A 2P6FA 5GCNA 3RNZA 1VKCA 2VQYA 4K30A 2QIRA 4C2YA 4HNYB 5G1ZA 1IOFA 3MRUA 5A27A 2PJ7A 1CM0A 4UA3A 4F6AA 1Q2DA 3B3WA 4CAXA 7CPAA 2Q43A 1XIXA 2CNMA 4UIAA 4CYOA 4H6ZA 4XPKA 2GU2A 4B12A 4Y49B 4MY3A 1RO5A 2QMLA 1KZFA 3DLJA 4FUUA 5IX3A 1MJAA 3WABA 5K8NA 2ZEDA 2ZW4A 4UWJA 1TKJA 4AVBA 3DSBA 4OC1A 3BI0A 4OP4A 1TKFA 2JBJA 4UEEA 1AMPA 2NSMA 1BOBA 1QQ9A 2WZNA 2EVNA 4GXHA 5LYFA 2PVWA 5K8OA 1YMEA 4FBEA 3RO0A 2K5TA 1QSMA 4MHNA 6CPAA 2H5MA 1MK4A 3NH8A 2ZEPA 5KTDA 3SI0A 3F8KA 4F9VA 2OR4A 3KI9A 3ZJ0A 2AJ6A 3S9NA 4UFWA 1KUYA 3NE7A 4MCQA 3B8GA 3F0AA 5JPHA 2PR1A 4MRIA 3W91A 2J9AA 3TOAA 2WPWA 1I1DA 4P45A 3D68A 5AG7A 5JM6A 4K3NA 2B3VA 1DE4C 1B87A 4ZY2A 3WT4A 3LODA 4HKFA 4XNHB 4A2ZA 2DPTA 3GB0A 2B4BA 2ABZA 4NGTA 4B14A 3PB6X 2PVVA 1PYTB 3CDXA 5CPAA 4A31A 4CRYB 2C6PA 2PR8A 3FB3A 4JXQA 4P4JA 5J1QA 4GM5A 4W9YA 4Z65A 2J8NA 4A32A 4OC2A 3R95A 4X3RA 1YX0A 2AFZA 4FWUA 2R98A 4X8IA 1LFWA 5C88A 3GKRA 4KVOE 2CF4A 1XRYA 3G3SA 5LRKA 2FXFA 4QC6A 5IB9A 2FIAA 4LQGA 4KLVA 4GS4A 2EK9A 2JDCA 3C26A 4UCPA 4CAVA 1S7FA 2XEGA 1RXTA 4M3SA 1R3NA 4ZX8A 3CZXA 2J8RA 1UWYA 2Z11A 1IYLA 5HXDA 4JXRA 4JYWA 4QB9A 3DNSA 3B3TA 1Y9KA 5F47A 4MFQA 2Z3PA 4P4BA 4OKOA 4OC5A 1M4GA 5F09A 3FECA 4A94A 4PV6A 3FVLA 2HQYA 3H8FA 2PE3A 2CTBA 5A28A 1YSJA 4FD4A 2Q51A 4KOXA 2WPXA 3D4UA 4A33A 1XF8A 2ZEMA 2ZEGA 4CS0B 5JH9A 4MHPA 4BMHA 3NH4A 4FD6A 4NJRA 4F8ZA 2PSWA 1PUAA 2PJ2A 3FXTA 4IAVA 4P4IA 1YGHA 3P2FA 4OAEA 4PQAA 2ZPAA 4UCNA 1PCAA 3PBEA 1J4JA 3CXQA 4OLLA 4PXEA 3EO4A 4EWTA 5AG5A 4ZY0A 1K4JA 5F46A 3KZWA 4RI1A 3H8GA 1TIQA 2A4NA 1DTDA 1EE3P 2Y0MA 3IFEA 2PJ6A 1ELLP 5D29A 3VATA 2AFWA 3HLPA 1Z4EA 4KOYA 4EVYA 3CXPA 2IQ6A 5JQ4A 2Q4ZA 1VGYA 3GY9A 3CT9A 3ISXA 4LQ6A 1V0CA 1QSTA 2QVPA 3H5ZA 3EFAA 3S6KA 1CP7A 3LACA 4KOTA 4UFVA 3B3VA 1N71A 2EBJA 3JVNA 3WR7A 4CGOA 3TCVA 2BUEA 1BPNA 3CXSA 4MFLA 1U6MA 1H8LA 2VZZA 5G20A 3FEDA 2R1IA 1YW6A 2EK8A 1ELMP 2R8VA 4P6YA 3TFYA 4X5KA 2BEIA 3I1UA 4KVME 3TT2A 2ZEOA 4YGOA 4UF4A 3KGQA 4F0YA 3D3SA 1YR0A 3LWUA 3S9MA 4CGMA 4ONWA 3PB8X 1IYKA 1Z9UA 2HC9A 3FF3A 3S6GA 2VI7A 3IJ3A 1YQEA 2G0BA 3D7FA 2P6GA 3FBUA 2DF5A 3KR4A 3R1KA 2PJ4A 4P4EA 2FSRA 5LRGA 4EMEA 1ZLHA 4RS2A 4JD6A 5DWNA 4E8OA 1Z4RA 4XNHC 2OU2A 5G21A 4TNUA 5ELYA 4M6IA 4UWIA 3R9FA 2BCOA 4R57A 4KSIA 4B13A 2PJ3A 4BBHA 1I21A 3D7DA 5KTAA 5THWA 3TC8A 4KORA 1YVOA 5C82A 3NE8A 4YU9A 4PXBA 5LRJA 4OC3A 4KZTA 4U5YA 2O53A 4AG9A 3FIXA 1MJBA 1BO4A 2HB6A 3TO7A 4G1PA 2DEAA 2PC1A 3W6SA 3B7IA 5JGFA 2B58A 2F5IA 2PJCA 1IICA 3NH5A 2F7VA 1IU8A 2C6GA 2REEA 2WSAA 4JWPA 5EMIA 4JLYA 4BD9A 2DXQA 3EXNA 1B6BA 2FE7A 4U9ZA 3D7HA 3SJEA 5J8CA 2Z0ZA 2R7HA 1IIDA 1M44A 2JBKA 4KSAA 3KQZA 2Q0YA 1NMTA 3BXMA 1Y7EA 4MHZA 4Q36A 3IU2A 5CNPA 3VWEA 2CY2A 3KKWA 1VHOA 2V8DA 4L8AA 2ZEFA 4A39A 4C68A 5LYDA 3FJUA 1HEEA 3BJ8A 3LMSA 5LYLA 4UFXA 2Z3LA 2QECA 4RUHA 3I9SA 2BOAA 2PQ8A 3IEHA 3PFEA 1S60A 1LCPA 2RC4A 4M85A 4MY0A 3S6FA 3KR5A 4PXCA 4EFDA 3B3SA 2ZOGA 4ZYQA 1Y0RA 1LAPA 1KUVA 2BSWA 2CXAA 1XJOA 3CPXA 3E0KA 3I3GA 4NCZA 2Z3MA 3WC7A 3PZJA 1Z8WA 1QSOA 2NYQA 2KCWA 3FH4A 2XEJA 2C6CA 4Q38A 3T9YA 4O23A 1L0CA 2G3TA 2O4HA 4WWVA 3R9EA 4F0XA 5IB0A 2ATRA 2I3CA 1IB1E 1I12A 1VHEA 2EUIA 3DDDA 5K8MA 2G9DA 4NEXA 1BPMA 3D66A
chains in the Genus database with same CATH topology
5HH1A 4A30A 3F5BA 2NMTA 4NF1A 4CGLA 4B5OA 3OWCA 2OZGA 4MJ8A 2P0WA 3D8PA 4C7IA 1Y7RA 3DR6A 1CJWA 3TE4A 3EC4A 5H84A 2D4PA 2Z3NA 4CAFA 1S7NA 2CNTA 3QAHA 2VXKA 2HUZA 5BWAB 3G8WA 1Q2YA 1VHSA 4LX9A 4YRHA 2REFA 2IL4A 3FNCA 1M4DA 1M4IA 1MJ9A 2Z3KA 4L89A 3H4QA 1R57A 4XPDC 2FIWA 4AVCA 4DNCA 5E96A 4CAWA 2CNSA 1XMTA 4OADA 1Y9WA 3S6HA 4C2XA 1UFHA 4ORFA 1P4NA 2Q04A 4R3LA 3PGPA 4E0AA 1S7LA 4Y49C 1YK3A 4IF5A 4AG7A 2B5GA 4KOVA 4MHDA 4KOWA 5DWMA 2FL4A 3QB8A 1LRZA 4AVAA 2ARHA 1YVKA 2ZW7A 3A9LA 3ZZIA 3BLNA 5EC4A 4HNXB 4MFJA 3TO9A 4R9MA 4CGNA 1NSLA 4CGPA 2C27A 2GANA 3IWGA 2JLMA 4FD7A 3IWEA 2B4DA 4KUBA 1WWZA 3RYOA 2G3AA 2Q44A 2YNCC 3JTKA 4B11A 4AB7A 2Q4VA 2WUUA 4R3KA 1ON0A 4CYNA 1YLEA 4KUAA 3EY5A 2X7BA 4KSFA 4E2AA 4ZBGA 4PK2A 1QSNA 2O28A 5J8FA 3W6XA 4MFKA 5KTCA 3TTHA 2GE3A 4CRZB 2B5GB 1GHEA 4QBJA 2PRBA 3UY5A 3MGDA 3D2PA 2JEVA 3T90A 4PK3A 4U9YA 3JUWA 4PSWA 4KOSA 4NXYA 4B10A 4C2ZA 1Q2CA 3N7ZA 2D4OA 4C7HA 4II9A 4KVXA 2YGWA 3SXNA 4H6UA 3SHPA 2OB0A 5I0CA 1FY7A 5IV0A 2YNDA 2OZUA 4XPLA 3SXOA 1M1DA 2Q4YA 2VEZA 1OZPA 4MBUA 2B4DB 1XEBA 4LUAA 1S7KA 2HV2A 4R87A 1ZO0A 4UBRA 4B5PA 5EBVA 5AG6A 5ISVA 5HMNA 2OH1A 2AE6A 4UCMA 3IGRA 2Z3OA 4CYQA 2YNEA 2ZW6A 3FRMA 4JJXA 4IUSA 4YFJA 2JDDA 3V8IA 2ZW5A 4MFZA 5F49A 4A95A 4ZGYB 2OZHA 1XE4A 2VBQA 3IU1A 5AG4A 1SQHA 2I00A 4H89A 3DR8A 2Q7BA 2ZXVA 1WK4A 3K9UA 4CYPA 1QSRA 3P2HA 1S5KA 4FD5A 1KUXA 4J3GA 3BJ7A 2FS5A 4PSXA 1PU9A 2PDOA 5FVJA 3PP9A 3LD2A 2FT0A 5H86A 2FCKA 3R9GA 4CAEA 3GYAA 4ONUA 3TOBA 5G22A 2B3UA 2DPSA 2I79A 5AGEA 3TO6A 3VWDA 4B5PB 3D2MA 4KLWA 4NSQA 2P6EA 2Z10A 3FYNA 4QVTA 4QUSA 4MFPA 3R96A 4HNWB 5F48A 1S3ZA 4KOUA 1NE9A 2YNCA 2GIVA 2VZYA 2BL1A 4I49A 4XPDB 4KS9A 1YREA 4MI4A 2J8MA 5GCNA 2P6FA 1VKCA 2VQYA 4K30A 2QIRA 4C2YA 4HNYB 5G1ZA 5A27A 1CM0A 4UA3A 4F6AA 1Q2DA 4CAXA 1XIXA 2CNMA 4CYOA 4H6ZA 4XPKA 4B12A 4Y49B 4MY3A 1RO5A 2QMLA 1KZFA 5IX3A 1MJAA 2ZW4A 4UWJA 4AVBA 3DSBA 1BOBA 2EVNA 2K5TA 1QSMA 2H5MA 1MK4A 5KTDA 3F8KA 3ZJ0A 2AJ6A 4UFWA 1KUYA 3NE7A 3B8GA 3F0AA 5JPHA 2PR1A 3W91A 2WPWA 1I1DA 5AG7A 2B3VA 1B87A 4A2ZA 3LODA 4HKFA 4XNHB 2DPTA 2B4BA 4B14A 4A31A 4CRYB 3FB3A 2PR8A 4JXQA 2J8NA 4A32A 3R95A 1YX0A 2R98A 5C88A 3GKRA 4KVOE 3G3SA 2FXFA 4QC6A 2FIAA 4KLVA 4GS4A 2JDCA 3C26A 4UCPA 4CAVA 1S7FA 4M3SA 1RXTA 2J8RA 2Z11A 1IYLA 4JXRA 4QB9A 3DNSA 1Y9KA 5F47A 4MFQA 2Z3PA 1M4GA 4PV6A 2HQYA 5A28A 4FD4A 4KOXA 4A33A 2WPXA 4CS0B 1XF8A 4BMHA 4FD6A 2PSWA 1PUAA 3FXTA 1YGHA 3P2FA 4OAEA 2ZPAA 4UCNA 3CXQA 1J4JA 4OLLA 3EO4A 5AG5A 1K4JA 5F46A 4RI1A 1TIQA 2A4NA 2Y0MA 1Z4EA 4KOYA 4EVYA 3CXPA 5JQ4A 3GY9A 1V0CA 1QSTA 3H5ZA 3EFAA 3S6KA 4KOTA 4UFVA 1N71A 3JVNA 3WR7A 4CGOA 3TCVA 2BUEA 3CXSA 4MFLA 1U6MA 2VZZA 5G20A 2R1IA 2R8VA 3TFYA 4X5KA 2BEIA 4KVME 3TT2A 4YGOA 4F0YA 3D3SA 1YR0A 4CGMA 1IYKA 1Z9UA 3S6GA 2VI7A 2G0BA 3FBUA 2P6GA 3R1KA 2FSRA 4RS2A 4JD6A 5DWNA 4E8OA 1Z4RA 4XNHC 2OU2A 5G21A 3R9FA 4UWIA 4B13A 4R57A 4BBHA 1I21A 5KTAA 4KORA 1YVOA 5C82A 4KZTA 4U5YA 4AG9A 3FIXA 1MJBA 1BO4A 3TO7A 2PC1A 3W6SA 2B58A 2F5IA 3TOAA 1IICA 4JWPA 2REEA 2WSAA 4JLYA 2DXQA 3EXNA 1B6BA 2FE7A 4U9ZA 5J8CA 2Z0ZA 2R7HA 1IIDA 1M44A 4KSAA 2Q0YA 1NMTA 4Q36A 3IU2A 5CNPA 3VWEA 2CY2A 3KKWA 4L8AA 4C68A 3BJ8A 4UFXA 2Z3LA 2QECA 3I9SA 2PQ8A 1S60A 2RC4A 4M85A 4MY0A 3S6FA 1KUVA 2BSWA 2CXAA 3I3GA 3E0KA 4NCZA 2Z3MA 3PZJA 1QSOA 2KCWA 4Q38A 3T9YA 1L0CA 2G3TA 5IB0A 3R9EA 4F0XA 2ATRA 1IB1E 1I12A 2EUIA 3DDDA 1P0HA 4NEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HH1 A;  3F5B A;  2NMT A;  4NF1 A;  4B5O A;  3OWC A;  2OZG A;  4MJ8 A;  2P0W A;  3D8P A;  1Y7R A;  3DR6 A;  1CJW A;  3TE4 A;  3EC4 A;  5H84 A;  2D4P A;  1S7N A;  2CNT A;  3QAH A;  2VXK A;  2HUZ A;  3G8W A;  1Q2Y A;  1VHS A;  4LX9 A;  4YRH A;  2REF A;  2IL4 A;  3FNC A;  1M4D A;  1M4I A;  1MJ9 A;  4L89 A;  3H4Q A;  1R57 A;  4XPD C;  2FIW A;  4AVC A;  4DNC A;  5E96 A;  4CAW A;  2CNS A;  1XMT A;  4OAD A;  1Y9W A;  3S6H A;  1UFH A;  4ORF A;  1P4N A;  2Q04 A;  4R3L A;  3PGP A;  4E0A A;  1S7L A;  4Y49 C;  1YK3 A;  4IF5 A;  4AG7 A;  2B5G A;  4KOV A;  4MHD A;  4KOW A;  5DWM A;  2FL4 A;  3QB8 A;  1LRZ A;  4AVA A;  2ARH A;  1YVK A;  2ZW7 A;  3ZZI A;  3BLN A;  5EC4 A;  4HNX B;  3TO9 A;  4R9M A;  1NSL A;  2C27 A;  2GAN A;  3IWG A;  2JLM A;  4FD7 A;  2B4D A;  4KUB A;  1WWZ A;  3RYO A;  2G3A A;  2Q44 A;  4AB7 A;  2Q4V A;  4R3K A;  1ON0 A;  1YLE A;  4KUA A;  3EY5 A;  2X7B A;  4E2A A;  4ZBG A;  4PK2 A;  1QSN A;  2O28 A;  5J8F A;  3W6X A;  5KTC A;  3TTH A;  2GE3 A;  4CRZ B;  2B5G B;  1GHE A;  4QBJ A;  2PRB A;  3UY5 A;  3MGD A;  3D2P A;  2JEV A;  3T90 A;  4PK3 A;  4U9Y A;  3JUW A;  4PSW A;  4KOS A;  4NXY A;  1Q2C A;  3N7Z A;  2D4O A;  4II9 A;  4KVX A;  3SXN A;  4H6U A;  3SHP A;  2OB0 A;  5I0C A;  1FY7 A;  5IV0 A;  2OZU A;  4XPL A;  3SXO A;  1M1D A;  2Q4Y A;  2VEZ A;  1OZP A;  4MBU A;  2B4D B;  1XEB A;  4LUA A;  1S7K A;  2HV2 A;  4R87 A;  4UBR A;  4B5P A;  5EBV A;  5ISV A;  5HMN A;  2OH1 A;  2AE6 A;  3IGR A;  2ZW6 A;  3FRM A;  4JJX A;  4IUS A;  4YFJ A;  2JDD A;  3V8I A;  2ZW5 A;  5F49 A;  2OZH A;  1XE4 A;  2VBQ A;  1SQH A;  2I00 A;  4H89 A;  3DR8 A;  2Q7B A;  2ZXV A;  1WK4 A;  3K9U A;  1QSR A;  3P2H A;  1S5K A;  4FD5 A;  1KUX A;  4J3G A;  3BJ7 A;  2FS5 A;  4PSX A;  1PU9 A;  2PDO A;  5FVJ A;  3PP9 A;  3LD2 A;  2FT0 A;  5H86 A;  2FCK A;  3R9G A;  3GYA A;  4ONU A;  3TOB A;  2B3U A;  2I79 A;  3TO6 A;  3VWD A;  4B5P B;  3D2M A;  4KLW A;  4NSQ A;  2P6E A;  2Z10 A;  3FYN A;  4QVT A;  4QUS A;  3R96 A;  4HNW B;  5F48 A;  1S3Z A;  4KOU A;  1NE9 A;  2GIV A;  2VZY A;  2BL1 A;  4I49 A;  4XPD B;  4MI4 A;  1YRE A;  5GCN A;  2J8M A;  2P6F A;  1VKC A;  2VQY A;  4K30 A;  2QIR A;  4HNY B;  1CM0 A;  4UA3 A;  4F6A A;  1Q2D A;  4CAX A;  1XIX A;  2CNM A;  4H6Z A;  4XPK A;  4Y49 B;  4MY3 A;  1RO5 A;  2QML A;  1KZF A;  5IX3 A;  1MJA A;  2ZW4 A;  4UWJ A;  4AVB A;  3DSB A;  1BOB A;  2EVN A;  2K5T A;  1QSM A;  2H5M A;  1MK4 A;  5KTD A;  3F8K A;  3ZJ0 A;  2AJ6 A;  1KUY A;  3NE7 A;  3B8G A;  3F0A A;  5JPH A;  2PR1 A;  3W91 A;  2WPW A;  1I1D A;  2B3V A;  1B87 A;  3LOD A;  4HKF A;  4XNH B;  2B4B A;  4CRY B;  3FB3 A;  2PR8 A;  4JXQ A;  2J8N A;  3R95 A;  1YX0 A;  2R98 A;  5C88 A;  3GKR A;  4KVO E;  3G3S A;  2FXF A;  4QC6 A;  2FIA A;  4KLV A;  4GS4 A;  2JDC A;  3C26 A;  4CAV A;  1S7F A;  4M3S A;  1RXT A;  2J8R A;  2Z11 A;  1IYL A;  4JXR A;  4QB9 A;  3DNS A;  1Y9K A;  5F47 A;  1M4G A;  4PV6 A;  2HQY A;  4FD4 A;  4KOX A;  2WPX A;  4CS0 B;  1XF8 A;  4BMH A;  4FD6 A;  2PSW A;  1PUA A;  3FXT A;  1YGH A;  3P2F A;  4OAE A;  2ZPA A;  3CXQ A;  1J4J A;  4OLL A;  3EO4 A;  1K4J A;  5F46 A;  4RI1 A;  1TIQ A;  2A4N A;  2Y0M A;  1Z4E A;  4KOY A;  4EVY A;  3CXP A;  5JQ4 A;  3GY9 A;  1V0C A;  1QST A;  3EFA A;  3S6K A;  4KOT A;  1N71 A;  3JVN A;  3WR7 A;  3TCV A;  2BUE A;  3CXS A;  1U6M A;  2VZZ A;  2R1I A;  2R8V A;  3TFY A;  4X5K A;  2BEI A;  4KVM E;  3TT2 A;  4YGO A;  4F0Y A;  3D3S A;  1YR0 A;  1IYK A;  1Z9U A;  3S6G A;  2VI7 A;  2G0B A;  3FBU A;  2P6G A;  3R1K A;  2FSR A;  4RS2 A;  4JD6 A;  5DWN A;  4E8O A;  1Z4R A;  4XNH C;  2OU2 A;  3R9F A;  4UWI A;  4R57 A;  1I21 A;  5KTA A;  4KOR A;  1YVO A;  5C82 A;  4KZT A;  4U5Y A;  4AG9 A;  3FIX A;  1MJB A;  1BO4 A;  3TO7 A;  2PC1 A;  3W6S A;  2B58 A;  2F5I A;  3TOA A;  1IIC A;  4JWP A;  2REE A;  4JLY A;  2DXQ A;  3EXN A;  1B6B A;  2FE7 A;  4U9Z A;  5J8C A;  2Z0Z A;  2R7H A;  1IID A;  1M44 A;  2Q0Y A;  1NMT A;  5CNP A;  3VWE A;  2CY2 A;  3KKW A;  4L8A A;  3BJ8 A;  2QEC A;  3I9S A;  2PQ8 A;  1S60 A;  2RC4 A;  4M85 A;  4MY0 A;  3S6F A;  1KUV A;  2BSW A;  3I3G A;  3E0K A;  4NCZ A;  3PZJ A;  1QSO A;  2KCW A;  3T9Y A;  1L0C A;  2G3T A;  5IB0 A;  3R9E A;  2ATR A;  1IB1 E;  1I12 A;  2EUI A;  3DDD A;  1P0H A;  4NEX A; 
#chains in the Genus database with same CATH topology
 5HH1 A;  4A30 A;  3FEE A;  3F5B A;  2NMT A;  1F2O A;  3BI1 A;  4NF1 A;  4B5O A;  4CGL A;  3OWC A;  2OZG A;  4ZY1 A;  4MJ8 A;  2P0W A;  3IIB A;  4OC4 A;  1VIX A;  3D8P A;  4NGM A;  4MCR A;  4C7I A;  1LOK A;  1Y7R A;  3DR6 A;  1CJW A;  1AYE A;  3TE4 A;  2V77 A;  3EC4 A;  5H84 A;  2D4P A;  2Z3N A;  4CAF A;  1S7N A;  3PB4 X;  2CNT A;  2GFQ A;  3QAH A;  2VXK A;  2HUZ A;  4R8F A;  4UEZ A;  5BWA B;  3N5F A;  3G8W A;  1Q2Y A;  1VHS A;  3NA6 A;  4LX9 A;  4YRH A;  2REF A;  2IL4 A;  3SI2 A;  1GYT A;  3FNC A;  4P4D A;  5HVH A;  2PRQ A;  1M4D A;  1M4I A;  3PBB A;  1MJ9 A;  1YW4 A;  2Z3K A;  4UIB A;  1ARM A;  1YLO A;  1JWQ A;  4L89 A;  3RAM A;  3H4Q A;  1R57 A;  4XPD C;  2FIW A;  4UEF A;  2GLJ A;  2V8G A;  3KQX A;  4AVC A;  4DNC A;  5E96 A;  4A38 A;  4CAW A;  2CNS A;  3B3C A;  1TKH A;  1XMT A;  3GIU A;  4OAD A;  1F2P A;  1Y9W A;  2ZOF A;  3S6H A;  3V7Z A;  4NGQ A;  4C2X A;  1UFH A;  4ORF A;  1NSA A;  1P4N A;  2Q04 A;  4M6H A;  1LAN A;  4R3L A;  3PGP A;  4E0A A;  3QAY A;  1S7L A;  2ZEN A;  4OID A;  4Y49 C;  1A2Z A;  1YK3 A;  4PPZ A;  3DGV A;  1TXR A;  4IF5 A;  4AG7 A;  2B5G A;  4KOV A;  4MHD A;  4IHM A;  3TX8 A;  1X12 A;  4NGR A;  4BIN A;  4KOW A;  5DWM A;  4IK2 A;  2FL4 A;  3QB8 A;  3PRT A;  1LRZ A;  1Z8T A;  3BHX A;  3KAS A;  3CPA A;  2WYR A;  4AVA A;  3PEI A;  4R7M A;  4MCP A;  2ARH A;  3JRU A;  1CPS A;  1ARL A;  1KWM A;  1YVK A;  2ZW7 A;  3A9L A;  3ZZI A;  1RTQ A;  2EO8 A;  3V38 A;  2C1C A;  3BLN A;  1XBU A;  5EC4 A;  1Z8X A;  4HNX B;  1IGB A;  4MFJ A;  1Y0Y A;  3TO9 A;  4R9M A;  4CGN A;  1NSL A;  5HVG A;  4CGP A;  3T8W A;  2C27 A;  2GAN A;  4M6G A;  2F8H A;  3IWG A;  2JLM A;  2PJ9 A;  4FD7 A;  3VAR A;  3IWE A;  3RZA A;  2OOT A;  2XEI A;  2B4D A;  1BLL E;  1WWZ A;  4KUB A;  3RYO A;  2PJB A;  3MN8 A;  2G3A A;  4OC0 A;  2Q44 A;  2YNC C;  3JTK A;  4DJL A;  4B11 A;  4AB7 A;  2Q4V A;  2WUU A;  3IWW A;  4MXU A;  4R3K A;  3RBU A;  1ON0 A;  4Q7A A;  4CYN A;  1YLE A;  4KUA A;  2V8H A;  1CG2 A;  3EY5 A;  4DYO A;  2X7B A;  3GLJ A;  4KSF A;  4E2A A;  1XFO A;  4ZBG A;  2PJ0 A;  2JEW A;  4PK2 A;  1CBX A;  4NGP A;  1QSN A;  2O28 A;  1P0H A;  5J8F A;  3SJF A;  3W6X A;  4MFK A;  5KTC A;  2XEF A;  3KHX A;  3TTH A;  3H8E A;  2GE3 A;  4CRZ B;  5HVF A;  4CPA A;  2B5G B;  1GHE A;  1HDU A;  4QBJ A;  2PRB A;  3UY5 A;  3MGD A;  2VL1 A;  8CPA A;  1FNO A;  3D2P A;  2FVG A;  3KL9 A;  2JEV A;  3T90 A;  3B2Y A;  3WC5 A;  4PK3 A;  4U9Y A;  1HDQ A;  2IMO A;  3JUW A;  4NGN A;  2AFS A;  2ZEE A;  4KOS A;  1TF8 A;  4PSW A;  4MMO A;  4NXY A;  4B10 A;  4C2Z A;  1Q2C A;  3N7Z A;  2PJ5 A;  5I4M A;  1ZG9 A;  2D4O A;  4C7H A;  4II9 A;  2Q7S A;  4KVX A;  2YGW A;  3B35 A;  4H6U A;  3SXN A;  3SHP A;  2GLF A;  2OB0 A;  5I0C A;  1FY7 A;  4B6Z A;  3L2N A;  4JZ0 A;  5IV0 A;  2YND A;  1XMB A;  1AUG A;  2OZU A;  4ZX9 A;  4XPL A;  3IO1 A;  3SXO A;  1M1D A;  2IJZ A;  2Q4Y A;  2VEZ A;  4AXV A;  1OZP A;  3K9T A;  4MBU A;  2B4D B;  1XEB A;  2AFO A;  4LUA A;  1S7K A;  3NFZ A;  1M4L A;  1X10 A;  2HV2 A;  4R87 A;  4NJQ A;  1ZO0 A;  4UBR A;  2ZEL A;  3KHZ A;  2POK A;  5EBV A;  4B5P A;  5AG6 A;  2CIJ A;  4OME A;  3VH9 A;  1BAV A;  5HMN A;  4OIW A;  5ISV A;  2OH1 A;  2GRE A;  2PIY A;  2AE6 A;  1R43 A;  4UCM A;  3FX6 A;  4NFR A;  4F9U A;  3IC1 A;  2QYV A;  3IGR A;  4R76 A;  1CX8 A;  2RB7 A;  2Z3O A;  4WJB A;  1OBR A;  4CYQ A;  2YNE A;  2PJ1 A;  1LAM A;  4MCS A;  2PJ8 A;  2PJA A;  2ZW6 A;  4FAI A;  2PIZ A;  3D7G A;  3SI1 A;  2AFU A;  3FRM A;  4JJX A;  3GUX A;  1Z5R A;  4IUS A;  4A37 A;  4YFJ A;  2JDD A;  3V8I A;  2ZW5 A;  4MFZ A;  5F49 A;  2ODF A;  3D67 A;  4A95 A;  3HUV A;  4P44 A;  2RFH A;  4ZGY B;  2OZH A;  1XE4 A;  2VBQ A;  3IU1 A;  4H2K A;  1JQG A;  5LYI A;  1SQH A;  2I00 A;  5AG4 A;  2ZEH A;  3WC6 A;  4H89 A;  1XOV A;  3DR8 A;  5K8P A;  2Q7B A;  1F57 A;  2ZXV A;  2ANP A;  4MHY A;  1WK4 A;  1Z8L A;  4NGS A;  4P4F A;  3K9U A;  3K2K A;  4CYP A;  2BO9 A;  1QSR A;  3P2H A;  1CPX A;  5DS0 A;  4RN7 A;  1CP6 A;  1S5K A;  4FD5 A;  1KUX A;  5CBM A;  1ZG8 A;  4J3G A;  3BJ7 A;  2FS5 A;  3PFO A;  4PSX A;  1PU9 A;  1QMU A;  4ZI6 A;  2V8V A;  2PDO A;  3PB7 X;  5FVJ A;  3PP9 A;  3LD2 A;  1Q7L A;  3QNV A;  1Z2L A;  1FT7 A;  2FT0 A;  5H86 A;  2FCK A;  4X2T A;  3R9G A;  4DUK A;  2EWB A;  4CAE A;  3GYA A;  1ZLI A;  4ONU A;  3ISZ A;  3TOB A;  4R6T A;  2PCU A;  5G22 A;  2QJ8 A;  2B3U A;  3SJG A;  2DPS A;  2I79 A;  5AGE A;  3TO6 A;  3VWD A;  4B5P B;  2AFX A;  3D2M A;  4TWE A;  4KLW A;  4NSQ A;  2P6E A;  2Z10 A;  3FYN A;  2CTC A;  4P10 A;  4QVT A;  5D8N A;  4QUS A;  4MFP A;  3R96 A;  4HNW B;  4HPS A;  5F48 A;  3S9L A;  1S3Z A;  4YWY A;  2AFM A;  4KOU A;  1NE9 A;  2YNC A;  2GIV A;  3PB9 X;  3FMC A;  1IOI A;  3SJX A;  2VZY A;  1TF9 A;  2BL1 A;  4PXD A;  1IY7 A;  4I49 A;  4XPD B;  4KS9 A;  1YRE A;  4MI4 A;  2J8M A;  1ZG7 A;  2P6F A;  5GCN A;  3RNZ A;  1VKC A;  2VQY A;  4K30 A;  2QIR A;  4C2Y A;  4HNY B;  5G1Z A;  1IOF A;  3MRU A;  5A27 A;  2PJ7 A;  1CM0 A;  4UA3 A;  4F6A A;  1Q2D A;  3B3W A;  4CAX A;  7CPA A;  2Q43 A;  1XIX A;  2CNM A;  4UIA A;  4CYO A;  4H6Z A;  4XPK A;  2GU2 A;  4B12 A;  4Y49 B;  4MY3 A;  1RO5 A;  2QML A;  1KZF A;  3DLJ A;  4FUU A;  5IX3 A;  1MJA A;  3WAB A;  5K8N A;  2ZED A;  2ZW4 A;  4UWJ A;  1TKJ A;  4AVB A;  3DSB A;  4OC1 A;  3BI0 A;  4OP4 A;  1TKF A;  2JBJ A;  4UEE A;  1AMP A;  2NSM A;  1BOB A;  1QQ9 A;  2WZN A;  2EVN A;  4GXH A;  5LYF A;  2PVW A;  5K8O A;  1YME A;  4FBE A;  3RO0 A;  2K5T A;  1QSM A;  4MHN A;  6CPA A;  2H5M A;  1MK4 A;  3NH8 A;  2ZEP A;  5KTD A;  3SI0 A;  3F8K A;  4F9V A;  2OR4 A;  3KI9 A;  3ZJ0 A;  2AJ6 A;  3S9N A;  4UFW A;  1KUY A;  3NE7 A;  4MCQ A;  3B8G A;  3F0A A;  5JPH A;  2PR1 A;  4MRI A;  3W91 A;  2J9A A;  3TOA A;  2WPW A;  1I1D A;  4P45 A;  3D68 A;  5AG7 A;  5JM6 A;  4K3N A;  2B3V A;  1DE4 C;  1B87 A;  4ZY2 A;  3WT4 A;  3LOD A;  4HKF A;  4XNH B;  4A2Z A;  2DPT A;  3GB0 A;  2B4B A;  2ABZ A;  4NGT A;  4B14 A;  3PB6 X;  2PVV A;  1PYT B;  3CDX A;  5CPA A;  4A31 A;  4CRY B;  2C6P A;  2PR8 A;  3FB3 A;  4JXQ A;  4P4J A;  5J1Q A;  4GM5 A;  4W9Y A;  4Z65 A;  2J8N A;  4A32 A;  4OC2 A;  3R95 A;  4X3R A;  1YX0 A;  2AFZ A;  4FWU A;  2R98 A;  4X8I A;  1LFW A;  5C88 A;  3GKR A;  4KVO E;  2CF4 A;  1XRY A;  3G3S A;  5LRK A;  2FXF A;  4QC6 A;  5IB9 A;  2FIA A;  4LQG A;  4KLV A;  4GS4 A;  2EK9 A;  2JDC A;  3C26 A;  4UCP A;  4CAV A;  1S7F A;  2XEG A;  1RXT A;  4M3S A;  1R3N A;  4ZX8 A;  3CZX A;  2J8R A;  1UWY A;  2Z11 A;  1IYL A;  5HXD A;  4JXR A;  4JYW A;  4QB9 A;  3DNS A;  3B3T A;  1Y9K A;  5F47 A;  4MFQ A;  2Z3P A;  4P4B A;  4OKO A;  4OC5 A;  1M4G A;  5F09 A;  3FEC A;  4A94 A;  4PV6 A;  3FVL A;  2HQY A;  3H8F A;  2PE3 A;  2CTB A;  5A28 A;  1YSJ A;  4FD4 A;  2Q51 A;  4KOX A;  2WPX A;  3D4U A;  4A33 A;  1XF8 A;  2ZEM A;  2ZEG A;  4CS0 B;  5JH9 A;  4MHP A;  4BMH A;  3NH4 A;  4FD6 A;  4NJR A;  4F8Z A;  2PSW A;  1PUA A;  2PJ2 A;  3FXT A;  4IAV A;  4P4I A;  1YGH A;  3P2F A;  4OAE A;  4PQA A;  2ZPA A;  4UCN A;  1PCA A;  3PBE A;  1J4J A;  3CXQ A;  4OLL A;  4PXE A;  3EO4 A;  4EWT A;  5AG5 A;  4ZY0 A;  1K4J A;  5F46 A;  3KZW A;  4RI1 A;  3H8G A;  1TIQ A;  2A4N A;  1DTD A;  1EE3 P;  2Y0M A;  3IFE A;  2PJ6 A;  1ELL P;  5D29 A;  3VAT A;  2AFW A;  3HLP A;  1Z4E A;  4KOY A;  4EVY A;  3CXP A;  2IQ6 A;  5JQ4 A;  2Q4Z A;  1VGY A;  3GY9 A;  3CT9 A;  3ISX A;  4LQ6 A;  1V0C A;  1QST A;  2QVP A;  3H5Z A;  3EFA A;  3S6K A;  1CP7 A;  3LAC A;  4KOT A;  4UFV A;  3B3V A;  1N71 A;  2EBJ A;  3JVN A;  3WR7 A;  4CGO A;  3TCV A;  2BUE A;  1BPN A;  3CXS A;  4MFL A;  1U6M A;  1H8L A;  2VZZ A;  5G20 A;  3FED A;  2R1I A;  1YW6 A;  2EK8 A;  1ELM P;  2R8V A;  4P6Y A;  3TFY A;  4X5K A;  2BEI A;  3I1U A;  4KVM E;  3TT2 A;  2ZEO A;  4YGO A;  4UF4 A;  3KGQ A;  4F0Y A;  3D3S A;  1YR0 A;  3LWU A;  3S9M A;  4CGM A;  4ONW A;  3PB8 X;  1IYK A;  1Z9U A;  2HC9 A;  3FF3 A;  3S6G A;  2VI7 A;  3IJ3 A;  1YQE A;  2G0B A;  3D7F A;  2P6G A;  3FBU A;  2DF5 A;  3KR4 A;  3R1K A;  2PJ4 A;  4P4E A;  2FSR A;  5LRG A;  4EME A;  1ZLH A;  4RS2 A;  4JD6 A;  5DWN A;  4E8O A;  1Z4R A;  4XNH C;  2OU2 A;  5G21 A;  4TNU A;  5ELY A;  4M6I A;  4UWI A;  3R9F A;  2BCO A;  4R57 A;  4KSI A;  4B13 A;  2PJ3 A;  4BBH A;  1I21 A;  3D7D A;  5KTA A;  5THW A;  3TC8 A;  4KOR A;  1YVO A;  5C82 A;  3NE8 A;  4YU9 A;  4PXB A;  5LRJ A;  4OC3 A;  4KZT A;  4U5Y A;  2O53 A;  4AG9 A;  3FIX A;  1MJB A;  1BO4 A;  2HB6 A;  3TO7 A;  4G1P A;  2DEA A;  2PC1 A;  3W6S A;  3B7I A;  5JGF A;  2B58 A;  2F5I A;  2PJC A;  1IIC A;  3NH5 A;  2F7V A;  1IU8 A;  2C6G A;  2REE A;  2WSA A;  4JWP A;  5EMI A;  4JLY A;  4BD9 A;  2DXQ A;  3EXN A;  1B6B A;  2FE7 A;  4U9Z A;  3D7H A;  3SJE A;  5J8C A;  2Z0Z A;  2R7H A;  1IID A;  1M44 A;  2JBK A;  4KSA A;  3KQZ A;  2Q0Y A;  1NMT A;  3BXM A;  1Y7E A;  4MHZ A;  4Q36 A;  3IU2 A;  5CNP A;  3VWE A;  2CY2 A;  3KKW A;  1VHO A;  2V8D A;  4L8A A;  2ZEF A;  4A39 A;  4C68 A;  5LYD A;  3FJU A;  1HEE A;  3BJ8 A;  3LMS A;  5LYL A;  4UFX A;  2Z3L A;  2QEC A;  4RUH A;  3I9S A;  2BOA A;  2PQ8 A;  3IEH A;  3PFE A;  1S60 A;  1LCP A;  2RC4 A;  4M85 A;  4MY0 A;  3S6F A;  3KR5 A;  4PXC A;  4EFD A;  3B3S A;  2ZOG A;  4ZYQ A;  1Y0R A;  1LAP A;  1KUV A;  2BSW A;  2CXA A;  1XJO A;  3CPX A;  3E0K A;  3I3G A;  4NCZ A;  2Z3M A;  3WC7 A;  3PZJ A;  1Z8W A;  1QSO A;  2NYQ A;  2KCW A;  3FH4 A;  2XEJ A;  2C6C A;  4Q38 A;  3T9Y A;  4O23 A;  1L0C A;  2G3T A;  2O4H A;  4WWV A;  3R9E A;  4F0X A;  5IB0 A;  2ATR A;  2I3C A;  1IB1 E;  1I12 A;  1VHE A;  2EUI A;  3DDD A;  5K8M A;  2G9D A;  4NEX A;  1BPM A;  3D66 A; 
#chains in the Genus database with same CATH homology
 5HH1 A;  4A30 A;  3F5B A;  2NMT A;  4NF1 A;  4CGL A;  4B5O A;  3OWC A;  2OZG A;  4MJ8 A;  2P0W A;  3D8P A;  4C7I A;  1Y7R A;  3DR6 A;  1CJW A;  3TE4 A;  3EC4 A;  5H84 A;  2D4P A;  2Z3N A;  4CAF A;  1S7N A;  2CNT A;  3QAH A;  2VXK A;  2HUZ A;  5BWA B;  3G8W A;  1Q2Y A;  1VHS A;  4LX9 A;  4YRH A;  2REF A;  2IL4 A;  3FNC A;  1M4D A;  1M4I A;  1MJ9 A;  2Z3K A;  4L89 A;  3H4Q A;  1R57 A;  4XPD C;  2FIW A;  4AVC A;  4DNC A;  5E96 A;  4CAW A;  2CNS A;  1XMT A;  4OAD A;  1Y9W A;  3S6H A;  4C2X A;  1UFH A;  4ORF A;  1P4N A;  2Q04 A;  4R3L A;  3PGP A;  4E0A A;  1S7L A;  4Y49 C;  1YK3 A;  4IF5 A;  4AG7 A;  2B5G A;  4KOV A;  4MHD A;  4KOW A;  5DWM A;  2FL4 A;  3QB8 A;  1LRZ A;  4AVA A;  2ARH A;  1YVK A;  2ZW7 A;  3A9L A;  3ZZI A;  3BLN A;  5EC4 A;  4HNX B;  4MFJ A;  3TO9 A;  4R9M A;  4CGN A;  1NSL A;  4CGP A;  2C27 A;  2GAN A;  3IWG A;  2JLM A;  4FD7 A;  3IWE A;  2B4D A;  4KUB A;  1WWZ A;  3RYO A;  2G3A A;  2Q44 A;  2YNC C;  3JTK A;  4B11 A;  4AB7 A;  2Q4V A;  2WUU A;  4R3K A;  1ON0 A;  4CYN A;  1YLE A;  4KUA A;  3EY5 A;  2X7B A;  4KSF A;  4E2A A;  4ZBG A;  4PK2 A;  1QSN A;  2O28 A;  5J8F A;  3W6X A;  4MFK A;  5KTC A;  3TTH A;  2GE3 A;  4CRZ B;  2B5G B;  1GHE A;  4QBJ A;  2PRB A;  3UY5 A;  3MGD A;  3D2P A;  2JEV A;  3T90 A;  4PK3 A;  4U9Y A;  3JUW A;  4PSW A;  4KOS A;  4NXY A;  4B10 A;  4C2Z A;  1Q2C A;  3N7Z A;  2D4O A;  4C7H A;  4II9 A;  4KVX A;  2YGW A;  3SXN A;  4H6U A;  3SHP A;  2OB0 A;  5I0C A;  1FY7 A;  5IV0 A;  2YND A;  2OZU A;  4XPL A;  3SXO A;  1M1D A;  2Q4Y A;  2VEZ A;  1OZP A;  4MBU A;  2B4D B;  1XEB A;  4LUA A;  1S7K A;  2HV2 A;  4R87 A;  1ZO0 A;  4UBR A;  4B5P A;  5EBV A;  5AG6 A;  5ISV A;  5HMN A;  2OH1 A;  2AE6 A;  4UCM A;  3IGR A;  2Z3O A;  4CYQ A;  2YNE A;  2ZW6 A;  3FRM A;  4JJX A;  4IUS A;  4YFJ A;  2JDD A;  3V8I A;  2ZW5 A;  4MFZ A;  5F49 A;  4A95 A;  4ZGY B;  2OZH A;  1XE4 A;  2VBQ A;  3IU1 A;  5AG4 A;  1SQH A;  2I00 A;  4H89 A;  3DR8 A;  2Q7B A;  2ZXV A;  1WK4 A;  3K9U A;  4CYP A;  1QSR A;  3P2H A;  1S5K A;  4FD5 A;  1KUX A;  4J3G A;  3BJ7 A;  2FS5 A;  4PSX A;  1PU9 A;  2PDO A;  5FVJ A;  3PP9 A;  3LD2 A;  2FT0 A;  5H86 A;  2FCK A;  3R9G A;  4CAE A;  3GYA A;  4ONU A;  3TOB A;  5G22 A;  2B3U A;  2DPS A;  2I79 A;  5AGE A;  3TO6 A;  3VWD A;  4B5P B;  3D2M A;  4KLW A;  4NSQ A;  2P6E A;  2Z10 A;  3FYN A;  4QVT A;  4QUS A;  4MFP A;  3R96 A;  4HNW B;  5F48 A;  1S3Z A;  4KOU A;  1NE9 A;  2YNC A;  2GIV A;  2VZY A;  2BL1 A;  4I49 A;  4XPD B;  4KS9 A;  1YRE A;  4MI4 A;  2J8M A;  5GCN A;  2P6F A;  1VKC A;  2VQY A;  4K30 A;  2QIR A;  4C2Y A;  4HNY B;  5G1Z A;  5A27 A;  1CM0 A;  4UA3 A;  4F6A A;  1Q2D A;  4CAX A;  1XIX A;  2CNM A;  4CYO A;  4H6Z A;  4XPK A;  4B12 A;  4Y49 B;  4MY3 A;  1RO5 A;  2QML A;  1KZF A;  5IX3 A;  1MJA A;  2ZW4 A;  4UWJ A;  4AVB A;  3DSB A;  1BOB A;  2EVN A;  2K5T A;  1QSM A;  2H5M A;  1MK4 A;  5KTD A;  3F8K A;  3ZJ0 A;  2AJ6 A;  4UFW A;  1KUY A;  3NE7 A;  3B8G A;  3F0A A;  5JPH A;  2PR1 A;  3W91 A;  2WPW A;  1I1D A;  5AG7 A;  2B3V A;  1B87 A;  4A2Z A;  3LOD A;  4HKF A;  4XNH B;  2DPT A;  2B4B A;  4B14 A;  4A31 A;  4CRY B;  3FB3 A;  2PR8 A;  4JXQ A;  2J8N A;  4A32 A;  3R95 A;  1YX0 A;  2R98 A;  5C88 A;  3GKR A;  4KVO E;  3G3S A;  2FXF A;  4QC6 A;  2FIA A;  4KLV A;  4GS4 A;  2JDC A;  3C26 A;  4UCP A;  4CAV A;  1S7F A;  4M3S A;  1RXT A;  2J8R A;  2Z11 A;  1IYL A;  4JXR A;  4QB9 A;  3DNS A;  1Y9K A;  5F47 A;  4MFQ A;  2Z3P A;  1M4G A;  4PV6 A;  2HQY A;  5A28 A;  4FD4 A;  4KOX A;  4A33 A;  2WPX A;  4CS0 B;  1XF8 A;  4BMH A;  4FD6 A;  2PSW A;  1PUA A;  3FXT A;  1YGH A;  3P2F A;  4OAE A;  2ZPA A;  4UCN A;  3CXQ A;  1J4J A;  4OLL A;  3EO4 A;  5AG5 A;  1K4J A;  5F46 A;  4RI1 A;  1TIQ A;  2A4N A;  2Y0M A;  1Z4E A;  4KOY A;  4EVY A;  3CXP A;  5JQ4 A;  3GY9 A;  1V0C A;  1QST A;  3H5Z A;  3EFA A;  3S6K A;  4KOT A;  4UFV A;  1N71 A;  3JVN A;  3WR7 A;  4CGO A;  3TCV A;  2BUE A;  3CXS A;  4MFL A;  1U6M A;  2VZZ A;  5G20 A;  2R1I A;  2R8V A;  3TFY A;  4X5K A;  2BEI A;  4KVM E;  3TT2 A;  4YGO A;  4F0Y A;  3D3S A;  1YR0 A;  4CGM A;  1IYK A;  1Z9U A;  3S6G A;  2VI7 A;  2G0B A;  3FBU A;  2P6G A;  3R1K A;  2FSR A;  4RS2 A;  4JD6 A;  5DWN A;  4E8O A;  1Z4R A;  4XNH C;  2OU2 A;  5G21 A;  3R9F A;  4UWI A;  4B13 A;  4R57 A;  4BBH A;  1I21 A;  5KTA A;  4KOR A;  1YVO A;  5C82 A;  4KZT A;  4U5Y A;  4AG9 A;  3FIX A;  1MJB A;  1BO4 A;  3TO7 A;  2PC1 A;  3W6S A;  2B58 A;  2F5I A;  3TOA A;  1IIC A;  4JWP A;  2REE A;  2WSA A;  4JLY A;  2DXQ A;  3EXN A;  1B6B A;  2FE7 A;  4U9Z A;  5J8C A;  2Z0Z A;  2R7H A;  1IID A;  1M44 A;  4KSA A;  2Q0Y A;  1NMT A;  4Q36 A;  3IU2 A;  5CNP A;  3VWE A;  2CY2 A;  3KKW A;  4L8A A;  4C68 A;  3BJ8 A;  4UFX A;  2Z3L A;  2QEC A;  3I9S A;  2PQ8 A;  1S60 A;  2RC4 A;  4M85 A;  4MY0 A;  3S6F A;  1KUV A;  2BSW A;  2CXA A;  3I3G A;  3E0K A;  4NCZ A;  2Z3M A;  3PZJ A;  1QSO A;  2KCW A;  4Q38 A;  3T9Y A;  1L0C A;  2G3T A;  5IB0 A;  3R9E A;  4F0X A;  2ATR A;  1IB1 E;  1I12 A;  2EUI A;  3DDD A;  1P0H A;  4NEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...