4KORA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with 7-aminocephalosporanic acid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords Uncharacterized protein
total genus 45
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4korA00
1UFHA 3DNSA 3G3SA 1NMTA 1IB1E 2VEZA 3F8KA 4KVXA 4KVME 2VBQA 4KOUA 1S7LA 4XPDB 5F46A 2VI7A 2J8RA 1LRZA 3S6HA 4ZBGA 1WWZA 3FIXA 1PUAA 5H86A 3EY5A 3CXQA 2FE7A 1XIXA 1YLEA 5IX3A 3SHPA 1RXTA 4MI4A 4F6AA 1Q2YA 4E2AA 2FS5A 3CXPA 3R9EA 4KZTA 4AG7A 4XPDC 2ZXVA 4F0YA 1KZFA 2B3VA 2ATRA 4NCZA 2RC4A 2CY2A 3DDDA 5GCNA 2OH1A 2HUZA 4DNCA 2NMTA 5JPHA 1XEBA 1Y7RA 5HMNA 2Z0ZA 2G3AA 4H6ZA 4RS2A 3W6XA 4B5OA 2JDCA 3N7ZA 4KVOE 2QMLA 1GHEA 4U9ZA 3D2PA 2Z11A 4R9MA 5F49A 3TTHA 1YREA 3TCVA 2BL1A 1IIDA 3GY9A 3I9SA 4X5KA 4CAVA 1NE9A 2FL4A 2Q04A 5EBVA 2B4DB 4LX9A 2JEVA 2Z10A 4E0AA 2ZW6A 1L0CA 4PV6A 4AG9A 2GIVA 2OZHA 2C27A 2PR8A 2IL4A 2WPXA 3ZJ0A 4L8AA 1S5KA 4KLWA 1BOBA 1B87A 1IYLA 2VZYA 4HNXB 2QECA 1Z4EA 4IUSA 3I3GA 4FD5A 2J8MA 4LUAA 2K5TA 2B4BA 2PR1A 2HQYA 2REEA 2B4DA 5IV0A 3E0KA 4NSQA 3BJ7A 2X7BA 5I0CA 1U6MA 4BMHA 5C88A 2PSWA 3PZJA 3P2HA 4CRYB 4ORFA 1XF8A 1YVKA 2J8NA 4GS4A 2EVNA 3QAHA 3VWDA 3K9UA 2PRBA 4MY3A 2KCWA 4MJ8A 3TO9A 1YR0A 3GYAA 3SXNA 3PGPA 5H84A 3R96A 5J8FA 2G0BA 5J8CA 3R95A 3GKRA 2REFA 1I1DA 2CNMA 3D2MA 1Z9UA 4YGOA 5IB0A 2A4NA 3FNCA 2G3TA 5KTDA 4FD6A 3EXNA 1PU9A 4R3KA 2ZW4A 1S7FA 4HNYB 1QSNA 3P2FA 4KOVA 5E96A 4UBRA 4AVBA 2BSWA 1Z4RA 4UA3A 4JJXA 3LD2A 1OZPA 2PC1A 4KUAA 2CNTA 2OU2A 3T9YA 1NSLA 2VXKA 3TFYA 2Q44A 1MJ9A 4PK2A 1QSOA 4YRHA 2GANA 4YFJA 1SQHA 4CAXA 5DWMA 1Q2CA 3R1KA 2FIWA 1S7KA 3FB3A 4U5YA 1QSMA 2ZW7A 3QB8A 4OADA 2D4OA 2Q7BA 2P6GA 2JLMA 2Q4VA 3T90A 4KOTA 2Q0YA 5DWNA 4PSXA 1QSRA 3FRMA 3TOBA 3TO7A 4MBUA 3RYOA 1MJBA 1S7NA 2R1IA 2I79A 4Y49C 2FXFA 4K30A 2BUEA 2OZGA 2P6EA 3JUWA 3LODA 1KUXA 4M85A 4JD6A 5C82A 1ON0A 1YVOA 2B3UA 3IGRA 4FD7A 2ARHA 2OZUA 4MHDA 1J4JA 4CRZB 4ONUA 3F0AA 1WK4A 5F47A 2H5MA 5KTAA 2R8VA 3DR8A 3H4QA 3B8GA 4PK3A 1V0CA 4NF1A 4L89A 1I21A 2F5IA 2Q4YA 3MGDA 4JWPA 4KOXA 4Y49B 2GE3A 2B58A 2P6FA 2DXQA 3NE7A 4XPLA 3TO6A 3V8IA 4AVAA 3TT2A 3W91A 4QBJA 1P4NA 4RI1A 1KUYA 3BLNA 4H6UA 3FBUA 4B5PB 1TIQA 1XMTA 2OB0A 1M4GA 4UWIA 3G8WA 4KOWA 3D3SA 4EVYA 1S3ZA 1Y9WA 4R87A 2FT0A 2JDDA 4R3LA 4NXYA 2FIAA 3EFAA 3DR6A 3TE4A 1IICA 4QC6A 4M3SA 1YK3A 1M4IA 4UWJA 1R57A 3VWEA 1XE4A 2FSRA 2P0WA 1I12A 3R9FA 2QIRA 3DSBA 1S60A 3FXTA 5F48A 4PSWA 3F5BA 4E8OA 1K4JA 2FCKA 1B6BA 5KTCA 1FY7A 2O28A 3D8PA 2EUIA 4QB9A 2D4PA 4IF5A 3W6SA 4II9A 4OLLA 1MK4A 3S6FA 3EC4A 4AVCA 4KORA 3KKWA 2VQYA 2B5GA 5EC4A 1BO4A 4JXQA 5HH1A 4R57A 2AJ6A 4CAWA 1IYKA 4OAEA 3OWCA 2R7HA 4XNHB 3S6GA 5ISVA 1M1DA 4MY0A 5FVJA 2ZPAA 2BEIA 3PP9A 1YX0A 3JVNA 1CM0A 1RO5A 2PQ8A 4I49A 4HNWB 3ZZIA 4QVTA 1QSTA 3S6KA 5JQ4A 4XPKA 3FYNA 4HKFA 1VKCA 2AE6A 2CNSA 4NEXA 1CJWA 4B5PA 2B5GB 2I00A 1Y9KA 4JXRA 4U9YA 4XNHC 4J3GA 2ZW5A 1KUVA 4H89A 3CXSA 3R9GA 3UY5A 3C26A 4JLYA 3EO4A 1Q2DA 5CNPA 1MJAA 2WPWA 3IWGA 4FD4A 4KOSA 1P0HA 2VZZA 4QUSA 1YGHA 4KOYA 4KLVA 1M4DA 2R98A 2Y0MA 4CS0B 1N71A 4AB7A 3SXOA 4KUBA 1VHSA 3BJ8A 2HV2A 3WR7A 3TOAA 2PDOA 1M44A
chains in the Genus database with same CATH superfamily
1UFHA 1M4LA 3DNSA 4Q7AA 3G3SA 1NMTA 2XEGA 1IB1E 2VEZA 3F8KA 4KVXA 4KVME 5JH9A 5AG4A 4C2YA 2VBQA 3B3SA 4KOUA 4EMEA 1S7LA 4XPDB 5F46A 3KR5A 2VI7A 3H8GA 2CIJA 2BOAA 2J8RA 1FNOA 2ZENA 4LQGA 1IU8A 3FF3A 1LRZA 2ZEHA 2GFQA 3IC1A 3S6HA 6CPAA 4ZBGA 4OC0A 1WWZA 5K8PA 3FIXA 2GU2A 3HUVA 1PUAA 4NGSA 1LFWA 3D7DA 1Z8WA 5H86A 5D8NA 2PIYA 2PJ6A 3EY5A 3CXQA 3FJUA 2FE7A 1XIXA 1YLEA 2Q51A 1FT7A 2EK9A 5IX3A 4MFPA 3FX6A 3PBEA 3SHPA 1RXTA 4MI4A 3DLJA 4NGQA 4F6AA 1Q7LA 3KZWA 1Q2YA 4E2AA 1AMPA 2FS5A 4C68A 2ZOFA 3NA6A 3CXPA 3R9EA 4KZTA 4PXDA 4AG7A 3S9NA 4XPDC 4P4DA 2ZXVA 2GREA 4F0YA 3RZAA 5JGFA 1KZFA 1X10A 2B3VA 2ATRA 4NCZA 3FVLA 2RC4A 2CY2A 3DDDA 5GCNA 2I3CA 2OH1A 2YNCA 2HUZA 4DNCA 5THWA 2NMTA 5JPHA 2QVPA 1XEBA 1Y7RA 3B3VA 3NH8A 1PCAA 1A2ZA 5LYFA 2Q4ZA 5HMNA 2Z0ZA 1QQ9A 3LWUA 1VGYA 4CYQA 4X8IA 4NGTA 3SI1A 1IGBA 2G3AA 3GLJA 4PXBA 3SJGA 4H6ZA 4RS2A 3W6XA 4B5OA 4DJLA 2JDCA 3N7ZA 4UCNA 5AG7A 2AFMA 4KVOE 2QMLA 4X3RA 3D67A 3NH5A 1GHEA 2OR4A 4U9ZA 2CXAA 2YNCC 3MRUA 3D2PA 2Z11A 4R9MA 5F49A 4PXCA 1LAPA 4GXHA 3PB9X 3TTHA 1YREA 4ZY1A 4Q36A 3TCVA 3KL9A 2BL1A 1ZO0A 4OMEA 1IIDA 2ZEGA 2CTCA 2YGWA 3GY9A 1DE4C 1CPSA 2ANPA 3QAYA 4WJBA 2PVVA 3I9SA 4CGMA 3SI2A 5BWAB 4TWEA 3KHZA 2JBKA 4X5KA 1NE9A 4CAVA 2Q04A 2FL4A 2O53A 5EBVA 1F57A 2B4DB 4LX9A 4CYPA 2JEVA 2ZEFA 5LRGA 2Z10A 4E0AA 2ZW6A 3S9MA 1L0CA 3WT4A 4PV6A 4ZY0A 4KSFA 2ABZA 4AG9A 2XEFA 3PB8X 2GIVA 2OZHA 2V8GA 3PB7X 2C27A 4IK2A 2PR8A 4GM5A 2IL4A 1NSAA 1TF8A 2WPXA 3ZJ0A 4L8AA 2JBJA 3GB0A 1S5KA 4KLWA 1B87A 1BOBA 1IY7A 1IYLA 3PRTA 3RBUA 2JEWA 2VZYA 4HNXB 4A2ZA 3JTKA 2QECA 2Z3PA 1YLOA 2ZELA 3VATA 4ZI6A 1Z4EA 4IUSA 4CYNA 4C7IA 4CGNA 3I3GA 2J8MA 3BI0A 4FD5A 2ZEMA 4LUAA 2K5TA 4C7HA 2B4BA 2PR1A 4MMOA 3B3WA 2HQYA 4UFWA 4WWVA 2REEA 4YWYA 2B4DA 4CAEA 4F8ZA 1ARLA 1Z8LA 2PJ4A 3B2YA 3E0KA 5IV0A 2PJAA 3B35A 4NSQA 3BJ7A 4IHMA 2X7BA 5I0CA 3BI1A 2ZEEA 4A33A 1U6MA 4BMHA 4MXUA 5C88A 2CF4A 2PSWA 2FVGA 3H5ZA 3PZJA 4NGPA 3P2HA 4OC1A 4B13A 1AYEA 4UF4A 4CRYB 4ORFA 1XF8A 1YVKA 2J8NA 4F0XA 3FH4A 4GS4A 2EVNA 3WC5A 2YNDA 2AFXA 2DF5A 4C2XA 3QAHA 1Y0RA 4OC3A 1IOFA 3VWDA 2ZEOA 4ZY2A 2J9AA 3K9UA 2Q7SA 1XFOA 2HB6A 2PRBA 4FBEA 1LANA 4MY3A 2KCWA 4MJ8A 4G1PA 3TO9A 4MFJA 1YR0A 3IU2A 3JRUA 4A39A 4EFDA 3GYAA 3FECA 5LYDA 4BD9A 4NGRA 1TKJA 4MCQA 3D66A 3SXNA 3L2NA 2AFOA 3PGPA 4UCPA 5H84A 3R96A 2PJCA 4CGOA 2G0BA 5J8FA 5J8CA 2XEIA 3NH4A 4HPSA 4OC2A 3R95A 3GKRA 2REFA 1Z5RA 5A27A 1I1DA 2CNMA 3D2MA 1Z9UA 4YGOA 1JQGA 4BBHA 1VIXA 3KGQA 5IB0A 2A4NA 3FNCA 3SJFA 1TXRA 2G3TA 5KTDA 4UFVA 2F7VA 1BPMA 2PJ3A 4FD6A 2DPTA 1ZLHA 3EXNA 1Y0YA 4R76A 5AG5A 1PU9A 4R3KA 4ZYQA 5J1QA 2ZW4A 3ISZA 1R43A 1S7FA 4HNYB 4A37A 1BAVA 5AGEA 3PFOA 1QSNA 3P2FA 4KOVA 5E96A 4CYOA 2HC9A 4UBRA 5AG6A 4B11A 4AVBA 2BSWA 1Z4RA 4UA3A 4JJXA 3LD2A 4MHYA 4W9YA 4ZX9A 4LQ6A 1OZPA 4OKOA 2PC1A 2PJ0A 4KUAA 2CNTA 2OU2A 3T9YA 1HDQA 1NSLA 1TKHA 3TX8A 2VXKA 4B6ZA 4P45A 2Q44A 3TFYA 2AFZA 2Z3OA 1MJ9A 4PK2A 1QSOA 4YRHA 4RUHA 2GANA 4YFJA 1SQHA 4CAXA 1XBUA 3SJEA 5DWMA 1Q2CA 2POKA 3IO1A 2ODFA 2FIWA 1S7KA 3R1KA 4H2KA 3V7ZA 2G9DA 2V8VA 3FB3A 4FWUA 4A32A 2AFWA 4UFXA 4PPZA 2RFHA 4U5YA 3IJ3A 5LRKA 1QSMA 2ZW7A 3KASA 3QB8A 2D4OA 4OADA 2Q7BA 4MCRA 4YU9A 2P6GA 4NJQA 2JLMA 2Q4VA 5CPAA 1XRYA 3T90A 4KOTA 2Q0YA 4MCSA 5DWNA 2Z3KA 1BPNA 4PSXA 1QSRA 3FRMA 3TOBA 3TO7A 4MBUA 3RYOA 1MJBA 2IQ6A 1S7NA 3PBBA 2CTBA 2R1IA 2I79A 5JM6A 4A30A 4Y49C 2ZEDA 3LACA 2FXFA 3VARA 4K30A 4Q38A 2NYQA 4Z65A 1Y7EA 2BUEA 2OZGA 2P6EA 3JUWA 3LODA 4F9VA 1KUXA 1Z8TA 2C6CA 5LRJA 3SJXA 4M85A 2Z3NA 4JD6A 2WSAA 3KI9A 5C82A 3TOAA 1RTQA 4MFLA 3RO0A 2ZOGA 1ON0A 1YVOA 3T8WA 2B3UA 2AFUA 3IGRA 1LAMA 4FD7A 4ONWA 4C2ZA 2ARHA 2C6PA 2OZUA 2WYRA 2O4HA 4MHDA 1J4JA 4CRZB 4ONUA 3D68A 2C1CA 3IIBA 3F0AA 1WK4A 2AFSA 3A9LA 5F47A 4MHPA 2H5MA 2IJZA 2R8VA 5KTAA 3DR8A 3PB4X 3H4QA 3B8GA 4PK3A 1V0CA 4NF1A 4OIDA 3TC8A 4L89A 3K9TA 4DYOA 1PYTB 4JZ0A 3NFZA 1I21A 5D29A 2F5IA 2Q4YA 1DTDA 3MGDA 4UEFA 3SI0A 4CGLA 4JWPA 2YNEA 4KOXA 4Y49B 4UEEA 4P4EA 5K8OA 2GE3A 2B58A 1Z8XA 3K2KA 4MHZA 2P6FA 4F9UA 2OOTA 1X12A 2DXQA 3NE7A 1KWMA 4MFZA 3IFEA 3RAMA 4XPLA 3TO6A 3V8IA 4AVAA 4MCPA 3TT2A 3W91A 4KS9A 4QBJA 1P4NA 4RI1A 1KUYA 3BLNA 4H6UA 2V8DA 3FBUA 4B5PB 4EWTA 2PRQA 1Z2LA 1TIQA 1XMTA 4CPAA 4TNUA 2OB0A 1M4GA 2PE3A 3GUXA 3G8WA 4KOWA 4UWIA 5G20A 3V38A 3D3SA 4EVYA 1S3ZA 7CPAA 1Y9WA 4R87A 2FT0A 2JDDA 4R3LA 3B3TA 4NXYA 2FIAA 2NSMA 3KQZA 3EFAA 5G21A 3DR6A 2BCOA 3PFEA 4NJRA 3KR4A 5G22A 3TE4A 1IICA 4OC4A 4QC6A 4UEZA 2RB7A 3ISXA 4M3SA 1GYTA 4P4IA 1YK3A 1ZG9A 3FMCA 1M4IA 1XJOA 5HVFA 5JQ4A 3D7GA 1R3NA 3IEHA 4UWJA 1R57A 4FAIA 2PVWA 1UWYA 3QNVA 4MFKA 3VWEA 1XE4A 5HXDA 4R6TA 2FSRA 2P0WA 1I12A 3R9FA 2QIRA 3DSBA 3B3CA 3D7HA 1S60A 3FXTA 1IOIA 2PJ8A 2PIZA 2DPSA 2EO8A 3PB6X 4M6IA 4PSWA 5F48A 3F5BA 4E8OA 1K4JA 2IMOA 2FCKA 1YW4A 1VHEA 4M6GA 1B6BA 4PXEA 2EBJA 1YW6A 5DS0A 4A95A 1XOVA 5KTCA 3WC6A 1FY7A 2O28A 3KHXA 3D8PA 3VH9A 4AXVA 2EUIA 4ZX8A 1BLLE 2BO9A 4QB9A 4FUUA 2D4PA 1VHOA 4IF5A 3W6SA 4II9A 3NE8A 1MK4A 3MN8A 4OLLA 4MFQA 3S6FA 1ZG7A 5HVHA 1LOKA 3EC4A 4AVCA 4KORA 3S9LA 3KKWA 4KSIA 3CPAA 4NFRA 4P10A 5HVGA 2VQYA 2B5GA 3WABA 2Q43A 1AUGA 1QMUA 1F2PA 3I1UA 3H8EA 4PQAA 3B7IA 5EC4A 1CX8A 1CG2A 1BO4A 4JXQA 5LYLA 2PJ2A 5HH1A 2EWBA 2QYVA 3LMSA 5K8NA 1H8LA 4R57A 2AJ6A 2F8HA 4R8FA 4CAWA 1IYKA 1HDUA 4OAEA 4ZGYB 3OWCA 2R7HA 4KSAA 4P4BA 4XNHB 3S6GA 5ISVA 3BHXA 3FEDA 1M1DA 4MY0A 2PJ9A 4NGNA 3CPXA 3GIUA 5FVJA 2C6GA 4K3NA 2ZPAA 2BEIA 3PP9A 4MRIA 1YX0A 3KQXA 4X2TA 3JVNA 1CM0A 4RN7A 3PEIA 4A31A 1RO5A 2PQ8A 4B10A 3FEEA 4I49A 5LYIA 4HNWB 4NGMA 3ZZIA 3CZXA 3DGVA 1CBXA 1QSTA 2GLFA 4QVTA 2PJ7A 4XPKA 2ZEPA 3FYNA 3RNZA 3S6KA 2VL1A 8CPAA 4CAFA 4HKFA 4UIAA 1F2OA 4JYWA 1TF9A 3HLPA 1VKCA 2AE6A 2CNSA 3BXMA 4B14A 1ELLP 4NEXA 5F09A 2PJ1A 1CJWA 3CDXA 3IWWA 1OBRA 2QJ8A 4B5PA 4BINA 5CBMA 2B5GB 1LCPA 4OP4A 2I00A 1Y9KA 4JXRA 4MHNA 4R7MA 4P44A 3D7FA 4U9YA 4XNHC 5IB9A 1YSJA 2WUUA 4J3GA 1HEEA 2ZW5A 3N5FA 1KUVA 2Z3LA 3D4UA 5I4MA 4H89A 1ZG8A 4UCMA 1YMEA 3CXSA 4M6HA 4DUKA 5G1ZA 4OIWA 3R9GA 2GLJA 4P4JA 2PJ5A 5K8MA 4CGPA 3UY5A 3C26A 4JLYA 1YQEA 2XEJA 4IAVA 3EO4A 4OC5A 3CT9A 3IWEA 1ELMP 1Q2DA 5CNPA 1ARMA 1MJAA 2V8HA 2WPWA 1XMBA 3IWGA 4P4FA 4FD4A 5ELYA 4KOSA 2EK8A 2Z3MA 1P0HA 2VZZA 4QUSA 3H8FA 4O23A 1YGHA 4KOYA 1EE3P 2WZNA 1CP7A 3IU1A 4A38A 4KLVA 1M4DA 2DEAA 1CP6A 4A94A 2R98A 2Y0MA 4CS0B 2PCUA 1CPXA 4B12A 4P6YA 1N71A 4AB7A 1JWQA 3SXOA 1TKFA 4KUBA 1VHSA 3BJ8A 1ZLIA 2HV2A 5EMIA 3WC7A 3WR7A 5A28A 4UIBA 2PDOA 2V77A 2PJBA 1M44A
chains in the Genus database with same CATH topology
1UFHA 3DNSA 3G3SA 1NMTA 1IB1E 2VEZA 3F8KA 4KVXA 4KVME 5AG4A 4C2YA 2VBQA 4KOUA 1S7LA 4XPDB 5F46A 2VI7A 2J8RA 1LRZA 3S6HA 4ZBGA 1WWZA 3FIXA 1PUAA 5H86A 3EY5A 3CXQA 2FE7A 1XIXA 1YLEA 5IX3A 4MFPA 3SHPA 1RXTA 4MI4A 4F6AA 1Q2YA 4E2AA 2FS5A 4C68A 3CXPA 3R9EA 4KZTA 4AG7A 4XPDC 2ZXVA 4F0YA 1KZFA 2B3VA 2ATRA 4NCZA 2RC4A 2CY2A 3DDDA 5GCNA 2OH1A 2YNCA 2HUZA 4DNCA 2NMTA 5JPHA 1XEBA 1Y7RA 5HMNA 2Z0ZA 4CYQA 2G3AA 4H6ZA 4RS2A 3W6XA 4B5OA 2JDCA 3N7ZA 4UCNA 5AG7A 4KVOE 2QMLA 1GHEA 4U9ZA 2CXAA 2YNCC 3D2PA 2Z11A 4R9MA 5F49A 3TTHA 1YREA 4Q36A 3TCVA 2BL1A 1ZO0A 1IIDA 2YGWA 3GY9A 4CGMA 3I9SA 5BWAB 4X5KA 4CAVA 1NE9A 2FL4A 2Q04A 5EBVA 2B4DB 4LX9A 4CYPA 2JEVA 2Z10A 4E0AA 2ZW6A 1L0CA 4PV6A 4KSFA 4AG9A 2GIVA 2OZHA 2C27A 2PR8A 2IL4A 2WPXA 3ZJ0A 4L8AA 1S5KA 4KLWA 1BOBA 1B87A 1IYLA 2VZYA 4HNXB 4A2ZA 3JTKA 2QECA 2Z3PA 1Z4EA 4IUSA 4CYNA 4C7IA 4CGNA 3I3GA 4FD5A 2J8MA 4LUAA 2K5TA 4C7HA 2B4BA 2PR1A 2HQYA 4UFWA 2REEA 2B4DA 4CAEA 5IV0A 3E0KA 4NSQA 3BJ7A 2X7BA 5I0CA 4A33A 1U6MA 4BMHA 5C88A 2PSWA 3H5ZA 3PZJA 3P2HA 4B13A 4CRYB 4ORFA 1XF8A 1YVKA 2J8NA 4F0XA 4GS4A 2EVNA 2YNDA 4C2XA 3QAHA 3VWDA 3K9UA 2PRBA 4MY3A 2KCWA 4MJ8A 3TO9A 4MFJA 1YR0A 3IU2A 3GYAA 3SXNA 4UCPA 3PGPA 5H84A 3R96A 4CGOA 2G0BA 5J8FA 5J8CA 3R95A 3GKRA 2REFA 5A27A 1I1DA 2CNMA 3D2MA 1Z9UA 4YGOA 4BBHA 5IB0A 2A4NA 3FNCA 2G3TA 5KTDA 4UFVA 4FD6A 2DPTA 3EXNA 5AG5A 1PU9A 4R3KA 2ZW4A 1S7FA 4HNYB 5AGEA 1QSNA 4KOVA 3P2FA 5E96A 4CYOA 4UBRA 5AG6A 4B11A 4AVBA 2BSWA 1Z4RA 4UA3A 4JJXA 3LD2A 1OZPA 2PC1A 4KUAA 2CNTA 2OU2A 3T9YA 1NSLA 2VXKA 3TFYA 2Q44A 2Z3OA 1MJ9A 4PK2A 1QSOA 4YRHA 2GANA 4YFJA 1SQHA 4CAXA 5DWMA 1Q2CA 3R1KA 2FIWA 1S7KA 3FB3A 4A32A 4UFXA 4U5YA 1QSMA 2ZW7A 3QB8A 4OADA 2D4OA 2Q7BA 2P6GA 2JLMA 2Q4VA 3T90A 4KOTA 2Q0YA 5DWNA 2Z3KA 4PSXA 1QSRA 3FRMA 3TOBA 3TO7A 4MBUA 3RYOA 1MJBA 1S7NA 2R1IA 2I79A 4A30A 4Y49C 2FXFA 4K30A 4Q38A 2BUEA 2OZGA 2P6EA 3JUWA 3LODA 1KUXA 4M85A 2Z3NA 4JD6A 2WSAA 5C82A 4MFLA 1ON0A 1YVOA 2B3UA 3IGRA 4FD7A 4C2ZA 2ARHA 2OZUA 4MHDA 1J4JA 4CRZB 4ONUA 3F0AA 1WK4A 3A9LA 5F47A 2H5MA 5KTAA 2R8VA 3DR8A 3H4QA 3B8GA 4PK3A 1V0CA 4NF1A 4L89A 1I21A 2F5IA 2Q4YA 3MGDA 4CGLA 4JWPA 2YNEA 4KOXA 4Y49B 2GE3A 2B58A 2P6FA 2DXQA 3NE7A 4MFZA 4XPLA 3TO6A 3V8IA 4AVAA 3TT2A 3W91A 4KS9A 4QBJA 1P4NA 4RI1A 1KUYA 3BLNA 4H6UA 3FBUA 4B5PB 1TIQA 1XMTA 2OB0A 1M4GA 4UWIA 5G20A 3G8WA 4KOWA 3D3SA 4EVYA 1S3ZA 1Y9WA 4R87A 2FT0A 2JDDA 4R3LA 4NXYA 2FIAA 3EFAA 5G21A 3DR6A 5G22A 3TE4A 1IICA 4QC6A 4M3SA 1YK3A 1M4IA 4UWJA 1R57A 4MFKA 3VWEA 1XE4A 2FSRA 2P0WA 1I12A 3R9FA 2QIRA 3DSBA 1S60A 3FXTA 2DPSA 5F48A 4PSWA 3F5BA 4E8OA 1K4JA 2FCKA 1B6BA 4A95A 5KTCA 1FY7A 2O28A 3D8PA 2EUIA 4QB9A 2D4PA 4IF5A 3W6SA 4II9A 4OLLA 1MK4A 3S6FA 4MFQA 3EC4A 4AVCA 4KORA 3KKWA 2VQYA 2B5GA 5EC4A 1BO4A 4JXQA 5HH1A 4R57A 2AJ6A 4CAWA 1IYKA 4OAEA 4ZGYB 3OWCA 2R7HA 4KSAA 4XNHB 3S6GA 5ISVA 1M1DA 4MY0A 5FVJA 2ZPAA 2BEIA 3PP9A 1YX0A 3JVNA 1CM0A 4A31A 1RO5A 2PQ8A 4B10A 4I49A 4HNWB 3ZZIA 4QVTA 1QSTA 3S6KA 5JQ4A 4XPKA 3FYNA 4CAFA 4HKFA 1VKCA 2AE6A 2CNSA 4B14A 4NEXA 1CJWA 4B5PA 2B5GB 2I00A 1Y9KA 4JXRA 4U9YA 4XNHC 2WUUA 4J3GA 2ZW5A 1KUVA 2Z3LA 4H89A 4UCMA 3CXSA 5G1ZA 3R9GA 4CGPA 3UY5A 3C26A 4JLYA 3EO4A 3IWEA 1Q2DA 5CNPA 1MJAA 2WPWA 3IWGA 4FD4A 4KOSA 2Z3MA 1P0HA 2VZZA 4QUSA 1YGHA 4KOYA 3IU1A 4KLVA 1M4DA 2R98A 2Y0MA 4CS0B 4B12A 1N71A 4AB7A 3SXOA 4KUBA 1VHSA 3BJ8A 2HV2A 3WR7A 5A28A 3TOAA 2PDOA 1M44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UFH A;  3DNS A;  3G3S A;  1NMT A;  1IB1 E;  2VEZ A;  3F8K A;  4KVX A;  4KVM E;  2VBQ A;  4KOU A;  1S7L A;  4XPD B;  5F46 A;  2VI7 A;  2J8R A;  1LRZ A;  3S6H A;  4ZBG A;  1WWZ A;  3FIX A;  1PUA A;  5H86 A;  3EY5 A;  3CXQ A;  2FE7 A;  1XIX A;  1YLE A;  5IX3 A;  3SHP A;  1RXT A;  4MI4 A;  4F6A A;  1Q2Y A;  4E2A A;  2FS5 A;  3CXP A;  3R9E A;  4KZT A;  4AG7 A;  4XPD C;  2ZXV A;  4F0Y A;  1KZF A;  2B3V A;  2ATR A;  4NCZ A;  2RC4 A;  2CY2 A;  3DDD A;  5GCN A;  2OH1 A;  2HUZ A;  4DNC A;  2NMT A;  5JPH A;  1XEB A;  1Y7R A;  5HMN A;  2Z0Z A;  2G3A A;  4H6Z A;  4RS2 A;  3W6X A;  4B5O A;  2JDC A;  3N7Z A;  4KVO E;  2QML A;  1GHE A;  4U9Z A;  3D2P A;  2Z11 A;  4R9M A;  5F49 A;  3TTH A;  1YRE A;  3TCV A;  2BL1 A;  1IID A;  3GY9 A;  3I9S A;  4X5K A;  4CAV A;  1NE9 A;  2FL4 A;  2Q04 A;  5EBV A;  2B4D B;  4LX9 A;  2JEV A;  2Z10 A;  4E0A A;  2ZW6 A;  1L0C A;  4PV6 A;  4AG9 A;  2GIV A;  2OZH A;  2C27 A;  2PR8 A;  2IL4 A;  2WPX A;  3ZJ0 A;  4L8A A;  1S5K A;  4KLW A;  1BOB A;  1B87 A;  1IYL A;  2VZY A;  4HNX B;  2QEC A;  1Z4E A;  4IUS A;  3I3G A;  4FD5 A;  2J8M A;  4LUA A;  2K5T A;  2B4B A;  2PR1 A;  2HQY A;  2REE A;  2B4D A;  5IV0 A;  3E0K A;  4NSQ A;  3BJ7 A;  2X7B A;  5I0C A;  1U6M A;  4BMH A;  5C88 A;  2PSW A;  3PZJ A;  3P2H A;  4CRY B;  4ORF A;  1XF8 A;  1YVK A;  2J8N A;  4GS4 A;  2EVN A;  3QAH A;  3VWD A;  3K9U A;  2PRB A;  4MY3 A;  2KCW A;  4MJ8 A;  3TO9 A;  1YR0 A;  3GYA A;  3SXN A;  3PGP A;  5H84 A;  3R96 A;  5J8F A;  2G0B A;  5J8C A;  3R95 A;  3GKR A;  2REF A;  1I1D A;  2CNM A;  3D2M A;  1Z9U A;  4YGO A;  5IB0 A;  2A4N A;  3FNC A;  2G3T A;  5KTD A;  4FD6 A;  3EXN A;  1PU9 A;  4R3K A;  2ZW4 A;  1S7F A;  4HNY B;  1QSN A;  3P2F A;  4KOV A;  5E96 A;  4UBR A;  4AVB A;  2BSW A;  1Z4R A;  4UA3 A;  4JJX A;  3LD2 A;  1OZP A;  2PC1 A;  4KUA A;  2CNT A;  2OU2 A;  3T9Y A;  1NSL A;  2VXK A;  3TFY A;  2Q44 A;  1MJ9 A;  4PK2 A;  1QSO A;  4YRH A;  2GAN A;  4YFJ A;  1SQH A;  4CAX A;  5DWM A;  1Q2C A;  3R1K A;  2FIW A;  1S7K A;  3FB3 A;  4U5Y A;  1QSM A;  2ZW7 A;  3QB8 A;  4OAD A;  2D4O A;  2Q7B A;  2P6G A;  2JLM A;  2Q4V A;  3T90 A;  4KOT A;  2Q0Y A;  5DWN A;  4PSX A;  1QSR A;  3FRM A;  3TOB A;  3TO7 A;  4MBU A;  3RYO A;  1MJB A;  1S7N A;  2R1I A;  2I79 A;  4Y49 C;  2FXF A;  4K30 A;  2BUE A;  2OZG A;  2P6E A;  3JUW A;  3LOD A;  1KUX A;  4M85 A;  4JD6 A;  5C82 A;  1ON0 A;  1YVO A;  2B3U A;  3IGR A;  4FD7 A;  2ARH A;  2OZU A;  4MHD A;  1J4J A;  4CRZ B;  4ONU A;  3F0A A;  1WK4 A;  5F47 A;  2H5M A;  5KTA A;  2R8V A;  3DR8 A;  3H4Q A;  3B8G A;  4PK3 A;  1V0C A;  4NF1 A;  4L89 A;  1I21 A;  2F5I A;  2Q4Y A;  3MGD A;  4JWP A;  4KOX A;  4Y49 B;  2GE3 A;  2B58 A;  2P6F A;  2DXQ A;  3NE7 A;  4XPL A;  3TO6 A;  3V8I A;  4AVA A;  3TT2 A;  3W91 A;  4QBJ A;  1P4N A;  4RI1 A;  1KUY A;  3BLN A;  4H6U A;  3FBU A;  4B5P B;  1TIQ A;  1XMT A;  2OB0 A;  1M4G A;  4UWI A;  3G8W A;  4KOW A;  3D3S A;  4EVY A;  1S3Z A;  1Y9W A;  4R87 A;  2FT0 A;  2JDD A;  4R3L A;  4NXY A;  2FIA A;  3EFA A;  3DR6 A;  3TE4 A;  1IIC A;  4QC6 A;  4M3S A;  1YK3 A;  1M4I A;  4UWJ A;  1R57 A;  3VWE A;  1XE4 A;  2FSR A;  2P0W A;  1I12 A;  3R9F A;  2QIR A;  3DSB A;  1S60 A;  3FXT A;  5F48 A;  4PSW A;  3F5B A;  4E8O A;  1K4J A;  2FCK A;  1B6B A;  5KTC A;  1FY7 A;  2O28 A;  3D8P A;  2EUI A;  4QB9 A;  2D4P A;  4IF5 A;  3W6S A;  4II9 A;  4OLL A;  1MK4 A;  3S6F A;  3EC4 A;  4AVC A;  4KOR A;  3KKW A;  2VQY A;  2B5G A;  5EC4 A;  1BO4 A;  4JXQ A;  5HH1 A;  4R57 A;  2AJ6 A;  4CAW A;  1IYK A;  4OAE A;  3OWC A;  2R7H A;  4XNH B;  3S6G A;  5ISV A;  1M1D A;  4MY0 A;  5FVJ A;  2ZPA A;  2BEI A;  3PP9 A;  1YX0 A;  3JVN A;  1CM0 A;  1RO5 A;  2PQ8 A;  4I49 A;  4HNW B;  3ZZI A;  4QVT A;  1QST A;  3S6K A;  5JQ4 A;  4XPK A;  3FYN A;  4HKF A;  1VKC A;  2AE6 A;  2CNS A;  4NEX A;  1CJW A;  4B5P A;  2B5G B;  2I00 A;  1Y9K A;  4JXR A;  4U9Y A;  4XNH C;  4J3G A;  2ZW5 A;  1KUV A;  4H89 A;  3CXS A;  3R9G A;  3UY5 A;  3C26 A;  4JLY A;  3EO4 A;  1Q2D A;  5CNP A;  1MJA A;  2WPW A;  3IWG A;  4FD4 A;  4KOS A;  1P0H A;  2VZZ A;  4QUS A;  1YGH A;  4KOY A;  4KLV A;  1M4D A;  2R98 A;  2Y0M A;  4CS0 B;  1N71 A;  4AB7 A;  3SXO A;  4KUB A;  1VHS A;  3BJ8 A;  2HV2 A;  3WR7 A;  3TOA A;  2PDO A;  1M44 A; 
#chains in the Genus database with same CATH topology
 1UFH A;  1M4L A;  3DNS A;  4Q7A A;  3G3S A;  1NMT A;  2XEG A;  1IB1 E;  2VEZ A;  3F8K A;  4KVX A;  4KVM E;  5JH9 A;  5AG4 A;  4C2Y A;  2VBQ A;  3B3S A;  4KOU A;  4EME A;  1S7L A;  4XPD B;  5F46 A;  3KR5 A;  2VI7 A;  3H8G A;  2CIJ A;  2BOA A;  2J8R A;  1FNO A;  2ZEN A;  4LQG A;  1IU8 A;  3FF3 A;  1LRZ A;  2ZEH A;  2GFQ A;  3IC1 A;  3S6H A;  6CPA A;  4ZBG A;  4OC0 A;  1WWZ A;  5K8P A;  3FIX A;  2GU2 A;  3HUV A;  1PUA A;  4NGS A;  1LFW A;  3D7D A;  1Z8W A;  5H86 A;  5D8N A;  2PIY A;  2PJ6 A;  3EY5 A;  3CXQ A;  3FJU A;  2FE7 A;  1XIX A;  1YLE A;  2Q51 A;  1FT7 A;  2EK9 A;  5IX3 A;  4MFP A;  3FX6 A;  3PBE A;  3SHP A;  1RXT A;  4MI4 A;  3DLJ A;  4NGQ A;  4F6A A;  1Q7L A;  3KZW A;  1Q2Y A;  4E2A A;  1AMP A;  2FS5 A;  4C68 A;  2ZOF A;  3NA6 A;  3CXP A;  3R9E A;  4KZT A;  4PXD A;  4AG7 A;  3S9N A;  4XPD C;  4P4D A;  2ZXV A;  2GRE A;  4F0Y A;  3RZA A;  5JGF A;  1KZF A;  1X10 A;  2B3V A;  2ATR A;  4NCZ A;  3FVL A;  2RC4 A;  2CY2 A;  3DDD A;  5GCN A;  2I3C A;  2OH1 A;  2YNC A;  2HUZ A;  4DNC A;  5THW A;  2NMT A;  5JPH A;  2QVP A;  1XEB A;  1Y7R A;  3B3V A;  3NH8 A;  1PCA A;  1A2Z A;  5LYF A;  2Q4Z A;  5HMN A;  2Z0Z A;  1QQ9 A;  3LWU A;  1VGY A;  4CYQ A;  4X8I A;  4NGT A;  3SI1 A;  1IGB A;  2G3A A;  3GLJ A;  4PXB A;  3SJG A;  4H6Z A;  4RS2 A;  3W6X A;  4B5O A;  4DJL A;  2JDC A;  3N7Z A;  4UCN A;  5AG7 A;  2AFM A;  4KVO E;  2QML A;  4X3R A;  3D67 A;  3NH5 A;  1GHE A;  2OR4 A;  4U9Z A;  2CXA A;  2YNC C;  3MRU A;  3D2P A;  2Z11 A;  4R9M A;  5F49 A;  4PXC A;  1LAP A;  4GXH A;  3PB9 X;  3TTH A;  1YRE A;  4ZY1 A;  4Q36 A;  3TCV A;  3KL9 A;  2BL1 A;  1ZO0 A;  4OME A;  1IID A;  2ZEG A;  2CTC A;  2YGW A;  3GY9 A;  1DE4 C;  1CPS A;  2ANP A;  3QAY A;  4WJB A;  2PVV A;  3I9S A;  4CGM A;  3SI2 A;  5BWA B;  4TWE A;  3KHZ A;  2JBK A;  4X5K A;  1NE9 A;  4CAV A;  2Q04 A;  2FL4 A;  2O53 A;  5EBV A;  1F57 A;  2B4D B;  4LX9 A;  4CYP A;  2JEV A;  2ZEF A;  5LRG A;  2Z10 A;  4E0A A;  2ZW6 A;  3S9M A;  1L0C A;  3WT4 A;  4PV6 A;  4ZY0 A;  4KSF A;  2ABZ A;  4AG9 A;  2XEF A;  3PB8 X;  2GIV A;  2OZH A;  2V8G A;  3PB7 X;  2C27 A;  4IK2 A;  2PR8 A;  4GM5 A;  2IL4 A;  1NSA A;  1TF8 A;  2WPX A;  3ZJ0 A;  4L8A A;  2JBJ A;  3GB0 A;  1S5K A;  4KLW A;  1B87 A;  1BOB A;  1IY7 A;  1IYL A;  3PRT A;  3RBU A;  2JEW A;  2VZY A;  4HNX B;  4A2Z A;  3JTK A;  2QEC A;  2Z3P A;  1YLO A;  2ZEL A;  3VAT A;  4ZI6 A;  1Z4E A;  4IUS A;  4CYN A;  4C7I A;  4CGN A;  3I3G A;  2J8M A;  3BI0 A;  4FD5 A;  2ZEM A;  4LUA A;  2K5T A;  4C7H A;  2B4B A;  2PR1 A;  4MMO A;  3B3W A;  2HQY A;  4UFW A;  4WWV A;  2REE A;  4YWY A;  2B4D A;  4CAE A;  4F8Z A;  1ARL A;  1Z8L A;  2PJ4 A;  3B2Y A;  3E0K A;  5IV0 A;  2PJA A;  3B35 A;  4NSQ A;  3BJ7 A;  4IHM A;  2X7B A;  5I0C A;  3BI1 A;  2ZEE A;  4A33 A;  1U6M A;  4BMH A;  4MXU A;  5C88 A;  2CF4 A;  2PSW A;  2FVG A;  3H5Z A;  3PZJ A;  4NGP A;  3P2H A;  4OC1 A;  4B13 A;  1AYE A;  4UF4 A;  4CRY B;  4ORF A;  1XF8 A;  1YVK A;  2J8N A;  4F0X A;  3FH4 A;  4GS4 A;  2EVN A;  3WC5 A;  2YND A;  2AFX A;  2DF5 A;  4C2X A;  3QAH A;  1Y0R A;  4OC3 A;  1IOF A;  3VWD A;  2ZEO A;  4ZY2 A;  2J9A A;  3K9U A;  2Q7S A;  1XFO A;  2HB6 A;  2PRB A;  4FBE A;  1LAN A;  4MY3 A;  2KCW A;  4MJ8 A;  4G1P A;  3TO9 A;  4MFJ A;  1YR0 A;  3IU2 A;  3JRU A;  4A39 A;  4EFD A;  3GYA A;  3FEC A;  5LYD A;  4BD9 A;  4NGR A;  1TKJ A;  4MCQ A;  3D66 A;  3SXN A;  3L2N A;  2AFO A;  3PGP A;  4UCP A;  5H84 A;  3R96 A;  2PJC A;  4CGO A;  2G0B A;  5J8F A;  5J8C A;  2XEI A;  3NH4 A;  4HPS A;  4OC2 A;  3R95 A;  3GKR A;  2REF A;  1Z5R A;  5A27 A;  1I1D A;  2CNM A;  3D2M A;  1Z9U A;  4YGO A;  1JQG A;  4BBH A;  1VIX A;  3KGQ A;  5IB0 A;  2A4N A;  3FNC A;  3SJF A;  1TXR A;  2G3T A;  5KTD A;  4UFV A;  2F7V A;  1BPM A;  2PJ3 A;  4FD6 A;  2DPT A;  1ZLH A;  3EXN A;  1Y0Y A;  4R76 A;  5AG5 A;  1PU9 A;  4R3K A;  4ZYQ A;  5J1Q A;  2ZW4 A;  3ISZ A;  1R43 A;  1S7F A;  4HNY B;  4A37 A;  1BAV A;  5AGE A;  3PFO A;  1QSN A;  3P2F A;  4KOV A;  5E96 A;  4CYO A;  2HC9 A;  4UBR A;  5AG6 A;  4B11 A;  4AVB A;  2BSW A;  1Z4R A;  4UA3 A;  4JJX A;  3LD2 A;  4MHY A;  4W9Y A;  4ZX9 A;  4LQ6 A;  1OZP A;  4OKO A;  2PC1 A;  2PJ0 A;  4KUA A;  2CNT A;  2OU2 A;  3T9Y A;  1HDQ A;  1NSL A;  1TKH A;  3TX8 A;  2VXK A;  4B6Z A;  4P45 A;  2Q44 A;  3TFY A;  2AFZ A;  2Z3O A;  1MJ9 A;  4PK2 A;  1QSO A;  4YRH A;  4RUH A;  2GAN A;  4YFJ A;  1SQH A;  4CAX A;  1XBU A;  3SJE A;  5DWM A;  1Q2C A;  2POK A;  3IO1 A;  2ODF A;  2FIW A;  1S7K A;  3R1K A;  4H2K A;  3V7Z A;  2G9D A;  2V8V A;  3FB3 A;  4FWU A;  4A32 A;  2AFW A;  4UFX A;  4PPZ A;  2RFH A;  4U5Y A;  3IJ3 A;  5LRK A;  1QSM A;  2ZW7 A;  3KAS A;  3QB8 A;  2D4O A;  4OAD A;  2Q7B A;  4MCR A;  4YU9 A;  2P6G A;  4NJQ A;  2JLM A;  2Q4V A;  5CPA A;  1XRY A;  3T90 A;  4KOT A;  2Q0Y A;  4MCS A;  5DWN A;  2Z3K A;  1BPN A;  4PSX A;  1QSR A;  3FRM A;  3TOB A;  3TO7 A;  4MBU A;  3RYO A;  1MJB A;  2IQ6 A;  1S7N A;  3PBB A;  2CTB A;  2R1I A;  2I79 A;  5JM6 A;  4A30 A;  4Y49 C;  2ZED A;  3LAC A;  2FXF A;  3VAR A;  4K30 A;  4Q38 A;  2NYQ A;  4Z65 A;  1Y7E A;  2BUE A;  2OZG A;  2P6E A;  3JUW A;  3LOD A;  4F9V A;  1KUX A;  1Z8T A;  2C6C A;  5LRJ A;  3SJX A;  4M85 A;  2Z3N A;  4JD6 A;  2WSA A;  3KI9 A;  5C82 A;  3TOA A;  1RTQ A;  4MFL A;  3RO0 A;  2ZOG A;  1ON0 A;  1YVO A;  3T8W A;  2B3U A;  2AFU A;  3IGR A;  1LAM A;  4FD7 A;  4ONW A;  4C2Z A;  2ARH A;  2C6P A;  2OZU A;  2WYR A;  2O4H A;  4MHD A;  1J4J A;  4CRZ B;  4ONU A;  3D68 A;  2C1C A;  3IIB A;  3F0A A;  1WK4 A;  2AFS A;  3A9L A;  5F47 A;  4MHP A;  2H5M A;  2IJZ A;  2R8V A;  5KTA A;  3DR8 A;  3PB4 X;  3H4Q A;  3B8G A;  4PK3 A;  1V0C A;  4NF1 A;  4OID A;  3TC8 A;  4L89 A;  3K9T A;  4DYO A;  1PYT B;  4JZ0 A;  3NFZ A;  1I21 A;  5D29 A;  2F5I A;  2Q4Y A;  1DTD A;  3MGD A;  4UEF A;  3SI0 A;  4CGL A;  4JWP A;  2YNE A;  4KOX A;  4Y49 B;  4UEE A;  4P4E A;  5K8O A;  2GE3 A;  2B58 A;  1Z8X A;  3K2K A;  4MHZ A;  2P6F A;  4F9U A;  2OOT A;  1X12 A;  2DXQ A;  3NE7 A;  1KWM A;  4MFZ A;  3IFE A;  3RAM A;  4XPL A;  3TO6 A;  3V8I A;  4AVA A;  4MCP A;  3TT2 A;  3W91 A;  4KS9 A;  4QBJ A;  1P4N A;  4RI1 A;  1KUY A;  3BLN A;  4H6U A;  2V8D A;  3FBU A;  4B5P B;  4EWT A;  2PRQ A;  1Z2L A;  1TIQ A;  1XMT A;  4CPA A;  4TNU A;  2OB0 A;  1M4G A;  2PE3 A;  3GUX A;  3G8W A;  4KOW A;  4UWI A;  5G20 A;  3V38 A;  3D3S A;  4EVY A;  1S3Z A;  7CPA A;  1Y9W A;  4R87 A;  2FT0 A;  2JDD A;  4R3L A;  3B3T A;  4NXY A;  2FIA A;  2NSM A;  3KQZ A;  3EFA A;  5G21 A;  3DR6 A;  2BCO A;  3PFE A;  4NJR A;  3KR4 A;  5G22 A;  3TE4 A;  1IIC A;  4OC4 A;  4QC6 A;  4UEZ A;  2RB7 A;  3ISX A;  4M3S A;  1GYT A;  4P4I A;  1YK3 A;  1ZG9 A;  3FMC A;  1M4I A;  1XJO A;  5HVF A;  5JQ4 A;  3D7G A;  1R3N A;  3IEH A;  4UWJ A;  1R57 A;  4FAI A;  2PVW A;  1UWY A;  3QNV A;  4MFK A;  3VWE A;  1XE4 A;  5HXD A;  4R6T A;  2FSR A;  2P0W A;  1I12 A;  3R9F A;  2QIR A;  3DSB A;  3B3C A;  3D7H A;  1S60 A;  3FXT A;  1IOI A;  2PJ8 A;  2PIZ A;  2DPS A;  2EO8 A;  3PB6 X;  4M6I A;  4PSW A;  5F48 A;  3F5B A;  4E8O A;  1K4J A;  2IMO A;  2FCK A;  1YW4 A;  1VHE A;  4M6G A;  1B6B A;  4PXE A;  2EBJ A;  1YW6 A;  5DS0 A;  4A95 A;  1XOV A;  5KTC A;  3WC6 A;  1FY7 A;  2O28 A;  3KHX A;  3D8P A;  3VH9 A;  4AXV A;  2EUI A;  4ZX8 A;  1BLL E;  2BO9 A;  4QB9 A;  4FUU A;  2D4P A;  1VHO A;  4IF5 A;  3W6S A;  4II9 A;  3NE8 A;  1MK4 A;  3MN8 A;  4OLL A;  4MFQ A;  3S6F A;  1ZG7 A;  5HVH A;  1LOK A;  3EC4 A;  4AVC A;  4KOR A;  3S9L A;  3KKW A;  4KSI A;  3CPA A;  4NFR A;  4P10 A;  5HVG A;  2VQY A;  2B5G A;  3WAB A;  2Q43 A;  1AUG A;  1QMU A;  1F2P A;  3I1U A;  3H8E A;  4PQA A;  3B7I A;  5EC4 A;  1CX8 A;  1CG2 A;  1BO4 A;  4JXQ A;  5LYL A;  2PJ2 A;  5HH1 A;  2EWB A;  2QYV A;  3LMS A;  5K8N A;  1H8L A;  4R57 A;  2AJ6 A;  2F8H A;  4R8F A;  4CAW A;  1IYK A;  1HDU A;  4OAE A;  4ZGY B;  3OWC A;  2R7H A;  4KSA A;  4P4B A;  4XNH B;  3S6G A;  5ISV A;  3BHX A;  3FED A;  1M1D A;  4MY0 A;  2PJ9 A;  4NGN A;  3CPX A;  3GIU A;  5FVJ A;  2C6G A;  4K3N A;  2ZPA A;  2BEI A;  3PP9 A;  4MRI A;  1YX0 A;  3KQX A;  4X2T A;  3JVN A;  1CM0 A;  4RN7 A;  3PEI A;  4A31 A;  1RO5 A;  2PQ8 A;  4B10 A;  3FEE A;  4I49 A;  5LYI A;  4HNW B;  4NGM A;  3ZZI A;  3CZX A;  3DGV A;  1CBX A;  1QST A;  2GLF A;  4QVT A;  2PJ7 A;  4XPK A;  2ZEP A;  3FYN A;  3RNZ A;  3S6K A;  2VL1 A;  8CPA A;  4CAF A;  4HKF A;  4UIA A;  1F2O A;  4JYW A;  1TF9 A;  3HLP A;  1VKC A;  2AE6 A;  2CNS A;  3BXM A;  4B14 A;  1ELL P;  4NEX A;  5F09 A;  2PJ1 A;  1CJW A;  3CDX A;  3IWW A;  1OBR A;  2QJ8 A;  4B5P A;  4BIN A;  5CBM A;  2B5G B;  1LCP A;  4OP4 A;  2I00 A;  1Y9K A;  4JXR A;  4MHN A;  4R7M A;  4P44 A;  3D7F A;  4U9Y A;  4XNH C;  5IB9 A;  1YSJ A;  2WUU A;  4J3G A;  1HEE A;  2ZW5 A;  3N5F A;  1KUV A;  2Z3L A;  3D4U A;  5I4M A;  4H89 A;  1ZG8 A;  4UCM A;  1YME A;  3CXS A;  4M6H A;  4DUK A;  5G1Z A;  4OIW A;  3R9G A;  2GLJ A;  4P4J A;  2PJ5 A;  5K8M A;  4CGP A;  3UY5 A;  3C26 A;  4JLY A;  1YQE A;  2XEJ A;  4IAV A;  3EO4 A;  4OC5 A;  3CT9 A;  3IWE A;  1ELM P;  1Q2D A;  5CNP A;  1ARM A;  1MJA A;  2V8H A;  2WPW A;  1XMB A;  3IWG A;  4P4F A;  4FD4 A;  5ELY A;  4KOS A;  2EK8 A;  2Z3M A;  1P0H A;  2VZZ A;  4QUS A;  3H8F A;  4O23 A;  1YGH A;  4KOY A;  1EE3 P;  2WZN A;  1CP7 A;  3IU1 A;  4A38 A;  4KLV A;  1M4D A;  2DEA A;  1CP6 A;  4A94 A;  2R98 A;  2Y0M A;  4CS0 B;  2PCU A;  1CPX A;  4B12 A;  4P6Y A;  1N71 A;  4AB7 A;  1JWQ A;  3SXO A;  1TKF A;  4KUB A;  1VHS A;  3BJ8 A;  1ZLI A;  2HV2 A;  5EMI A;  3WC7 A;  3WR7 A;  5A28 A;  4UIB A;  2PDO A;  2V77 A;  2PJB A;  1M44 A; 
#chains in the Genus database with same CATH homology
 1UFH A;  3DNS A;  3G3S A;  1NMT A;  1IB1 E;  2VEZ A;  3F8K A;  4KVX A;  4KVM E;  5AG4 A;  4C2Y A;  2VBQ A;  4KOU A;  1S7L A;  4XPD B;  5F46 A;  2VI7 A;  2J8R A;  1LRZ A;  3S6H A;  4ZBG A;  1WWZ A;  3FIX A;  1PUA A;  5H86 A;  3EY5 A;  3CXQ A;  2FE7 A;  1XIX A;  1YLE A;  5IX3 A;  4MFP A;  3SHP A;  1RXT A;  4MI4 A;  4F6A A;  1Q2Y A;  4E2A A;  2FS5 A;  4C68 A;  3CXP A;  3R9E A;  4KZT A;  4AG7 A;  4XPD C;  2ZXV A;  4F0Y A;  1KZF A;  2B3V A;  2ATR A;  4NCZ A;  2RC4 A;  2CY2 A;  3DDD A;  5GCN A;  2OH1 A;  2YNC A;  2HUZ A;  4DNC A;  2NMT A;  5JPH A;  1XEB A;  1Y7R A;  5HMN A;  2Z0Z A;  4CYQ A;  2G3A A;  4H6Z A;  4RS2 A;  3W6X A;  4B5O A;  2JDC A;  3N7Z A;  4UCN A;  5AG7 A;  4KVO E;  2QML A;  1GHE A;  4U9Z A;  2CXA A;  2YNC C;  3D2P A;  2Z11 A;  4R9M A;  5F49 A;  3TTH A;  1YRE A;  4Q36 A;  3TCV A;  2BL1 A;  1ZO0 A;  1IID A;  2YGW A;  3GY9 A;  4CGM A;  3I9S A;  5BWA B;  4X5K A;  4CAV A;  1NE9 A;  2FL4 A;  2Q04 A;  5EBV A;  2B4D B;  4LX9 A;  4CYP A;  2JEV A;  2Z10 A;  4E0A A;  2ZW6 A;  1L0C A;  4PV6 A;  4KSF A;  4AG9 A;  2GIV A;  2OZH A;  2C27 A;  2PR8 A;  2IL4 A;  2WPX A;  3ZJ0 A;  4L8A A;  1S5K A;  4KLW A;  1BOB A;  1B87 A;  1IYL A;  2VZY A;  4HNX B;  4A2Z A;  3JTK A;  2QEC A;  2Z3P A;  1Z4E A;  4IUS A;  4CYN A;  4C7I A;  4CGN A;  3I3G A;  4FD5 A;  2J8M A;  4LUA A;  2K5T A;  4C7H A;  2B4B A;  2PR1 A;  2HQY A;  4UFW A;  2REE A;  2B4D A;  4CAE A;  5IV0 A;  3E0K A;  4NSQ A;  3BJ7 A;  2X7B A;  5I0C A;  4A33 A;  1U6M A;  4BMH A;  5C88 A;  2PSW A;  3H5Z A;  3PZJ A;  3P2H A;  4B13 A;  4CRY B;  4ORF A;  1XF8 A;  1YVK A;  2J8N A;  4F0X A;  4GS4 A;  2EVN A;  2YND A;  4C2X A;  3QAH A;  3VWD A;  3K9U A;  2PRB A;  4MY3 A;  2KCW A;  4MJ8 A;  3TO9 A;  4MFJ A;  1YR0 A;  3IU2 A;  3GYA A;  3SXN A;  4UCP A;  3PGP A;  5H84 A;  3R96 A;  4CGO A;  2G0B A;  5J8F A;  5J8C A;  3R95 A;  3GKR A;  2REF A;  5A27 A;  1I1D A;  2CNM A;  3D2M A;  1Z9U A;  4YGO A;  4BBH A;  5IB0 A;  2A4N A;  3FNC A;  2G3T A;  5KTD A;  4UFV A;  4FD6 A;  2DPT A;  3EXN A;  5AG5 A;  1PU9 A;  4R3K A;  2ZW4 A;  1S7F A;  4HNY B;  5AGE A;  1QSN A;  4KOV A;  3P2F A;  5E96 A;  4CYO A;  4UBR A;  5AG6 A;  4B11 A;  4AVB A;  2BSW A;  1Z4R A;  4UA3 A;  4JJX A;  3LD2 A;  1OZP A;  2PC1 A;  4KUA A;  2CNT A;  2OU2 A;  3T9Y A;  1NSL A;  2VXK A;  3TFY A;  2Q44 A;  2Z3O A;  1MJ9 A;  4PK2 A;  1QSO A;  4YRH A;  2GAN A;  4YFJ A;  1SQH A;  4CAX A;  5DWM A;  1Q2C A;  3R1K A;  2FIW A;  1S7K A;  3FB3 A;  4A32 A;  4UFX A;  4U5Y A;  1QSM A;  2ZW7 A;  3QB8 A;  4OAD A;  2D4O A;  2Q7B A;  2P6G A;  2JLM A;  2Q4V A;  3T90 A;  4KOT A;  2Q0Y A;  5DWN A;  2Z3K A;  4PSX A;  1QSR A;  3FRM A;  3TOB A;  3TO7 A;  4MBU A;  3RYO A;  1MJB A;  1S7N A;  2R1I A;  2I79 A;  4A30 A;  4Y49 C;  2FXF A;  4K30 A;  4Q38 A;  2BUE A;  2OZG A;  2P6E A;  3JUW A;  3LOD A;  1KUX A;  4M85 A;  2Z3N A;  4JD6 A;  2WSA A;  5C82 A;  4MFL A;  1ON0 A;  1YVO A;  2B3U A;  3IGR A;  4FD7 A;  4C2Z A;  2ARH A;  2OZU A;  4MHD A;  1J4J A;  4CRZ B;  4ONU A;  3F0A A;  1WK4 A;  3A9L A;  5F47 A;  2H5M A;  5KTA A;  2R8V A;  3DR8 A;  3H4Q A;  3B8G A;  4PK3 A;  1V0C A;  4NF1 A;  4L89 A;  1I21 A;  2F5I A;  2Q4Y A;  3MGD A;  4CGL A;  4JWP A;  2YNE A;  4KOX A;  4Y49 B;  2GE3 A;  2B58 A;  2P6F A;  2DXQ A;  3NE7 A;  4MFZ A;  4XPL A;  3TO6 A;  3V8I A;  4AVA A;  3TT2 A;  3W91 A;  4KS9 A;  4QBJ A;  1P4N A;  4RI1 A;  1KUY A;  3BLN A;  4H6U A;  3FBU A;  4B5P B;  1TIQ A;  1XMT A;  2OB0 A;  1M4G A;  4UWI A;  5G20 A;  3G8W A;  4KOW A;  3D3S A;  4EVY A;  1S3Z A;  1Y9W A;  4R87 A;  2FT0 A;  2JDD A;  4R3L A;  4NXY A;  2FIA A;  3EFA A;  5G21 A;  3DR6 A;  5G22 A;  3TE4 A;  1IIC A;  4QC6 A;  4M3S A;  1YK3 A;  1M4I A;  4UWJ A;  1R57 A;  4MFK A;  3VWE A;  1XE4 A;  2FSR A;  2P0W A;  1I12 A;  3R9F A;  2QIR A;  3DSB A;  1S60 A;  3FXT A;  2DPS A;  5F48 A;  4PSW A;  3F5B A;  4E8O A;  1K4J A;  2FCK A;  1B6B A;  4A95 A;  5KTC A;  1FY7 A;  2O28 A;  3D8P A;  2EUI A;  4QB9 A;  2D4P A;  4IF5 A;  3W6S A;  4II9 A;  4OLL A;  1MK4 A;  3S6F A;  4MFQ A;  3EC4 A;  4AVC A;  4KOR A;  3KKW A;  2VQY A;  2B5G A;  5EC4 A;  1BO4 A;  4JXQ A;  5HH1 A;  4R57 A;  2AJ6 A;  4CAW A;  1IYK A;  4OAE A;  4ZGY B;  3OWC A;  2R7H A;  4KSA A;  4XNH B;  3S6G A;  5ISV A;  1M1D A;  4MY0 A;  5FVJ A;  2ZPA A;  2BEI A;  3PP9 A;  1YX0 A;  3JVN A;  1CM0 A;  4A31 A;  1RO5 A;  2PQ8 A;  4B10 A;  4I49 A;  4HNW B;  3ZZI A;  4QVT A;  1QST A;  3S6K A;  5JQ4 A;  4XPK A;  3FYN A;  4CAF A;  4HKF A;  1VKC A;  2AE6 A;  2CNS A;  4B14 A;  4NEX A;  1CJW A;  4B5P A;  2B5G B;  2I00 A;  1Y9K A;  4JXR A;  4U9Y A;  4XNH C;  2WUU A;  4J3G A;  2ZW5 A;  1KUV A;  2Z3L A;  4H89 A;  4UCM A;  3CXS A;  5G1Z A;  3R9G A;  4CGP A;  3UY5 A;  3C26 A;  4JLY A;  3EO4 A;  3IWE A;  1Q2D A;  5CNP A;  1MJA A;  2WPW A;  3IWG A;  4FD4 A;  4KOS A;  2Z3M A;  1P0H A;  2VZZ A;  4QUS A;  1YGH A;  4KOY A;  3IU1 A;  4KLV A;  1M4D A;  2R98 A;  2Y0M A;  4CS0 B;  4B12 A;  1N71 A;  4AB7 A;  3SXO A;  4KUB A;  1VHS A;  3BJ8 A;  2HV2 A;  3WR7 A;  5A28 A;  3TOA A;  2PDO A;  1M44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...