4A33A

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a pyrazole sulphonamide ligand
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of a novel class of orally active trypanocidal N-myristoyltransferase inhibitors.
pubmed doi rcsb
source organism Leishmania major
total genus 117
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4a33A00
4B11A 4CYQA 4UCNA 3IU1A 4UCMA 4A2ZA 4CGPA 4B14A 4C68A 4CGNA 3IU2A 4B10A 5AG6A 4A30A 4CAFA 5A27A 4CYPA 4UCPA 2WSAA 4C7IA 2WUUA 2YNCA 4A32A 4A31A 4C2YA 5G21A 4CGMA 4C2ZA 5G1ZA 4UFXA 4CYNA 5A28A 2YNDA 3IWEA 4CAEA 4CGLA 5AG5A 5AGEA 5AG7A 5G22A 4B12A 4UFWA 4C2XA 5AG4A 4C7HA 4A95A 4CYOA 4CGOA 2YNEA 2YNCC 3H5ZA 3JTKA 5G20A 4A33A 4BBHA 4UFVA 4B13A
chains in the Genus database with same CATH superfamily
4KORA 4CGPA 4MHNA 2EVNA 2PCUA 4YU9A 3PB8X 1YLOA 2ZENA 4PQAA 4JWPA 4QVTA 5LYDA 3S6HA 1TIQA 4IF5A 3CXPA 2AJ6A 2CNSA 4MI4A 5IX3A 4FD5A 2GE3A 2WSAA 1BOBA 3BI0A 2CTCA 3HLPA 3QAYA 4ORFA 3WC6A 4YFJA 4B6ZA 2J8MA 2OR4A 1XIXA 4AVAA 3LD2A 4R8FA 4MCPA 4MHYA 3F5BA 3D7DA 4F8ZA 3KGQA 4KUBA 4IUSA 4A39A 2Q4VA 5CBMA 2YGWA 4MHPA 4PXCA 4HNWB 4FD7A 4MY0A 2P0WA 4CAEA 4CS0B 2BO9A 2G0BA 1HDUA 3V38A 2V8VA 1Y7RA 2Q44A 4MFLA 1MJ9A 2ZW7A 3NE7A 4P10A 4TWEA 3WC7A 2Q43A 3B3SA 1VKCA 1Z8WA 2B4BA 2G3TA 4Q38A 1Z8LA 3IWGA 1P0HA 4AXVA 1BPNA 1IYKA 2HC9A 4UA3A 2OOTA 1YLEA 4GXHA 2ZOFA 4JYWA 1S7LA 2PSWA 5HVFA 5GCNA 2Z3KA 3T9YA 2CY2A 3SJFA 4CPAA 1Z4EA 4CYPA 3SI2A 1XEBA 2WUUA 1JQGA 5J8CA 1B6BA 4KLWA 4KOSA 3BI1A 3PEIA 2RB7A 3PB4X 2VXKA 5DS0A 5A28A 2ZXVA 2C27A 8CPAA 1S7NA 1WWZA 1Y0YA 1XE4A 4OC2A 2HUZA 2PJCA 2Q7BA 3KR5A 3PGPA 3FEDA 2HQYA 4MFJA 1PYTB 3TT2A 1S7KA 7CPAA 4P6YA 5IB0A 4MRIA 1FNOA 2VL1A 4AG7A 4MFPA 3G3SA 4B11A 2ZEEA 3IU1A 4QC6A 3SI1A 2PJ2A 2GFQA 2JDCA 3I9SA 4WJBA 4PK2A 4P4JA 1GHEA 4Q36A 5LRJA 5D29A 1KUYA 3RZAA 5F46A 4XNHB 4KLVA 1ZLHA 1JWQA 1K4JA 5CPAA 4FBEA 3S9MA 4IAVA 3FH4A 2IQ6A 2QYVA 2FIAA 3TTHA 1X10A 4K30A 1EE3P 4NEXA 4BMHA 4BINA 4E8OA 4F0YA 5AG5A 4XPLA 1NMTA 3SXOA 5AG4A 2I00A 4UIBA 4PXDA 2YNCC 2QIRA 2ANPA 4L89A 2Z3LA 3FECA 4FD4A 1CBXA 3FBUA 4KOUA 4P45A 3D7HA 3IGRA 4Z65A 4R3KA 5E96A 1Z5RA 1TF8A 4H6UA 4CGNA 3B8GA 1S7FA 1S5KA 3IO1A 2Z10A 4KOXA 5H86A 2XEJA 1L0CA 5EMIA 4DUKA 2ODFA 3TFYA 2CNTA 2PJ0A 1FY7A 1OZPA 2F7VA 3FEEA 1AMPA 1QSOA 4A31A 2FSRA 2PJBA 4B5OA 2DEAA 5HXDA 2GU2A 5D8NA 2PVWA 2WZNA 2XEFA 2PIZA 1YQEA 5AG7A 4OC3A 2QVPA 4B12A 2AFXA 1Y9KA 1TKHA 3JRUA 4KUAA 5JGFA 4OC1A 5C88A 1Z2LA 2C6PA 2RFHA 3QB8A 4JXQA 2CNMA 3KL9A 4MMOA 4OKOA 5H84A 4A2ZA 2I3CA 3RAMA 4RN7A 4NGSA 1BLLE 2AFWA 1M4IA 4CAXA 3D66A 3PB9X 4NGMA 3VH9A 4KSIA 3SHPA 5F48A 3KQZA 1Q2YA 3NH4A 1Y9WA 2Q51A 4A32A 2P6EA 2PJ8A 3JUWA 3D8PA 3GY9A 4ZY1A 1YK3A 4X2TA 3B3VA 4A94A 1IYLA 1M4LA 1Z9UA 3KHXA 4OP4A 4XPKA 1LAMA 3C26A 2YNEA 4C7HA 4DNCA 1F2OA 2G9DA 1IU8A 1PUAA 2Q4ZA 3RO0A 1Q7LA 1LFWA 3CPXA 1XMTA 4H6ZA 3KHZA 3TC8A 3GKRA 1LCPA 4TNUA 1A2ZA 4M3SA 1MJBA 2V8GA 3JVNA 2POKA 1LANA 1BAVA 4NGTA 4L8AA 3F0AA 3HUVA 1CM0A 3S6KA 2ATRA 2Q04A 2R98A 3N5FA 3NE8A 3TE4A 2EUIA 3GB0A 1R43A 2PRQA 5HVGA 2H5MA 4MFQA 4C2YA 2JDDA 2QECA 4ZYQA 2BSWA 1IIDA 4M6HA 5G1ZA 5THWA 2C1CA 4AVBA 1Q2CA 4ZY0A 1NSAA 3IWEA 2FT0A 4FUUA 2VZZA 1YW4A 4NJQA 2FCKA 1ZG9A 4NGRA 4CGOA 2WPWA 3H4QA 2VEZA 1XF8A 3QAHA 4E0AA 2PC1A 4NGQA 3PB6X 4NSQA 3FXTA 5ELYA 4UFVA 2CTBA 1M4GA 4CYQA 1YGHA 2V77A 3LMSA 4OADA 4GM5A 1M4DA 4WWVA 4RI1A 1VHEA 3D2PA 1R57A 2PJ5A 1DE4C 2B58A 1M44A 4MFKA 4P4EA 3TX8A 1U6MA 3I3GA 3DR8A 3SI0A 2OZHA 3TOBA 3B7IA 3VARA 4A38A 3B3WA 2ARHA 4R6TA 1I1DA 1QSMA 2I79A 2PJ1A 3CPAA 4IK2A 4YGOA 3PBEA 2BL1A 3GUXA 3H8EA 3R95A 1X12A 5IB9A 3IJ3A 1AUGA 1H8LA 3DNSA 4HNYB 4B5PB 4B5PA 4NFRA 4A95A 3IIBA 4AG9A 4A33A 1SQHA 3KKWA 3SJGA 4KOTA 3RNZA 2D4OA 4HNXB 2PR8A 2ZEPA 2PJAA 2WPXA 3FMCA 4M6GA 1P4NA 4CAVA 4ZX9A 2JLMA 4MCRA 1YVKA 4B14A 2XEIA 3BJ8A 5EBVA 2FXFA 3S6GA 1J4JA 4Y49B 5C82A 4EVYA 4ONWA 4DJLA 3L2NA 4P4DA 3WC5A 3FNCA 3VWDA 1IB1E 2FVGA 4IHMA 1CJWA 1WK4A 1UFHA 3TO9A 2Q4YA 3DLJA 1YSJA 3KR4A 6CPAA 5K8NA 3IEHA 4UFWA 4C2XA 2ZOGA 3E0KA 4LQGA 4CYOA 1QMUA 1KZFA 2F5IA 1Y0RA 4I49A 3PFEA 1XRYA 4HPSA 4R76A 3MRUA 4KVME 5JQ4A 1CX8A 3D3SA 4B13A 1Z8TA 2Z0ZA 5ISVA 4UWJA 4G1PA 3CXQA 2R1IA 2JBKA 1ON0A 2QMLA 2FL4A 1YW6A 2EWBA 3W6XA 3PRTA 2BCOA 3P2HA 5I0CA 1Y7EA 1HDQA 2B5GB 2B5GA 4C7IA 4JD6A 3IWWA 4UEFA 1TXRA 4AVCA 3R1KA 1VHSA 5G21A 3TO6A 4R3LA 3UY5A 4C2ZA 3CDXA 3D7FA 4KVXA 3EO4A 2PJ6A 3F8KA 2REEA 3VWEA 1XMBA 5AGEA 4CRZB 1RO5A 1Z4RA 1ARLA 4P4FA 4OAEA 2R7HA 2PJ3A 3TO7A 1N71A 2CXAA 2Z11A 4KVOE 4MCSA 2OZUA 2JEVA 2ZEHA 3BJ7A 3BLNA 3BHXA 4LX9A 5KTAA 4LQ6A 3D7GA 2EK8A 3D68A 4UIAA 3IFEA 2VI7A 1LOKA 3GYAA 3IC1A 4OC5A 1RXTA 2FIWA 2BEIA 4QUSA 4OC0A 5AG6A 4MHDA 4A30A 4CAFA 3W91A 2Q7SA 4ZY2A 1OBRA 1I12A 2C6CA 3EFAA 4PSWA 5LYLA 2J8RA 1PU9A 2GREA 3OWCA 4UFXA 1KWMA 1F2PA 1YREA 4PV6A 4R87A 4YWYA 2EK9A 3H8GA 2B3VA 2A4NA 4J3GA 3WABA 3S9NA 4MBUA 3FIXA 4FWUA 3CXSA 4OC4A 1NE9A 1CPSA 1ELMP 2D4PA 4LUAA 3RYOA 2GANA 5K8OA 2AFSA 3R9EA 3B35A 3D4UA 4UCMA 1ELLP 2JEWA 1MJAA 1KUVA 3G8WA 3FYNA 4JJXA 3KASA 3IU2A 4XPDB 3V8IA 2IL4A 2PVVA 4PXBA 3WR7A 3EY5A 4U9ZA 1YR0A 4NCZA 1F57A 2GLFA 4II9A 1DTDA 4A37A 1YX0A 5BWAB 4FD6A 2QJ8A 2GIVA 3LWUA 1Z8XA 4JLYA 1M1DA 2ZW6A 4PPZA 4UEZA 2AE6A 4Y49C 2VZYA 4OIDA 2Z3NA 4OLLA 1YMEA 1LAPA 4KSAA 2EO8A 4XNHC 2C6GA 1GYTA 3S6FA 2FS5A 3WT4A 3R9GA 3RBUA 5J1QA 5F47A 4ZBGA 3FVLA 1CPXA 2ZEDA 2NYQA 2AFZA 3FRMA 4UF4A 4C68A 5LRGA 2V8DA 2EBJA 3PBBA 3P2FA 5FVJA 2Z3OA 2J9AA 2VQYA 4ONUA 4KS9A 4M6IA 2O53A 4MY3A 2Z3MA 4UCPA 5F49A 4QBJA 1I21A 1KUXA 2AFMA 3R9FA 5JH9A 3ZJ0A 3ISZA 1S3ZA 2ZELA 4KOVA 1S60A 2VBQA 2Z3PA 4DYOA 5K8MA 2PJ7A 2O28A 2OB0A 3TCVA 3H8FA 2PIYA 3MN8A 5G22A 1CP6A 1ZG8A 2Y0MA 3FX6A 4F6AA 2G3AA 1QQ9A 4R57A 1PCAA 3CZXA 3SJXA 1FT7A 3K2KA 4BBHA 1MK4A 4F9VA 1TKJA 4QB9A 2P6GA 5CNPA 3W6SA 3PFOA 4ZX8A 1BPMA 2AFUA 3A9LA 2B4DB 1NSLA 2B4DA 3KQXA 3ZZIA 3NH5A 5KTCA 4KZTA 4B10A 2BUEA 2OU2A 3DSBA 1XJOA 3EC4A 2ZPAA 4KOWA 2PE3A 4O23A 2PJ4A 3LODA 3PB7X 1CP7A 2Q0YA 3GLJA 2ZEGA 3B3CA 1ZLIA 2RC4A 3FJUA 4CAWA 4K3NA 4CGLA 4EMEA 3PZJA 5EC4A 4RS2A 1IGBA 4W9YA 1RTQA 1IOIA 2B3UA 3KI9A 2XEGA 2FE7A 3D2MA 5G20A 2CIJA 4R7MA 4FAIA 4ZGYB 5HVHA 5JM6A 2DXQA 2HB6A 4CRYB 5KTDA 3FB3A 2ZW4A 4MXUA 2ZEMA 2X7BA 5DWNA 5HH1A 3QNVA 4P4BA 4MHZA 2PJ9A 3DDDA 4NF1A 3D67A 4UWIA 2NMTA 3R96A 4AB7A 4Q7AA 4M85A 4NJRA 3B3TA 4E2AA 1IICA 2F8HA 1QSTA 3SXNA 3CT9A 4EFDA 4KSFA 4OIWA 3B2YA 1QSRA 3DGVA 2ZEOA 4JXRA 4NGPA 3DR6A 4XPDC 4RUHA 2YNDA 4P44A 5HMNA 4YRHA 4PSXA 4F9UA 1TF9A 4ZI6A 4H89A 1IY7A 3I1UA 2CF4A 1ZO0A 4PK3A 3K9UA 4MJ8A 1R3NA 1UWYA 2DF5A 3K9TA 2AFOA 2IJZA 2V8HA 4H2KA 4MFZA 2ABZA 2WYRA 4NGNA 2DPTA 2R8VA 1ZG7A 3T8WA 1VIXA 4JZ0A 5A27A 1QSNA 2OZGA 4PXEA 2JBJA 3V7ZA 2REFA 3MGDA 2IMOA 3ISXA 4CGMA 1AYEA 1IOFA 4CYNA 2J8NA 2HV2A 4U5YA 5IV0A 2GLJA 5J8FA 1XBUA 2OH1A 3LACA 1HEEA 2P6FA 4X8IA 2ZEFA 4R9MA 5LYIA 3BXMA 3GIUA 4KOYA 1TKFA 5LRKA 3JTKA 3EXNA 3NA6A 3PP9A 2DPSA 2NSMA 3NFZA 4OMEA 4BD9A 1V0CA 4UEEA 4X5KA 2KCWA 1YVOA 4U9YA 4X3RA 2PRBA 4UCNA 2K5TA 4MCQA 2PR1A 1XOVA 3KZWA 3S9LA 2O4HA 1CG2A 3VATA 2YNCA 5K8PA 4NXYA 1B87A 5LYFA 5F09A 3FF3A 3N7ZA 3NH8A 4GS4A 5DWMA 3SJEA 4F0XA 2ZW5A 4HKFA 3TOAA 3T90A 4EWTA 1VGYA 1LRZA 5I4MA 3H5ZA 4P4IA 1Q2DA 2PDOA 1ARMA 4UBRA 5JPHA 1XFOA 2BOAA 1BO4A 2PQ8A 1VHOA
chains in the Genus database with same CATH topology
4KORA 4CGPA 2EVNA 3S6HA 4QVTA 4JWPA 1TIQA 4IF5A 3CXPA 2AJ6A 2CNSA 4MI4A 5IX3A 4FD5A 2GE3A 2WSAA 1BOBA 4ORFA 4YFJA 2J8MA 1XIXA 4AVAA 3LD2A 3F5BA 4KUBA 4IUSA 2Q4VA 2YGWA 4CAEA 4HNWB 4FD7A 4MY0A 2P0WA 4CS0B 2G0BA 1Y7RA 2Q44A 4MFLA 1MJ9A 2ZW7A 3NE7A 1VKCA 2B4BA 2G3TA 4Q38A 3IWGA 1P0HA 1IYKA 4UA3A 1YLEA 1S7LA 2PSWA 3T9YA 5GCNA 2Z3KA 2CY2A 1Z4EA 4CYPA 1XEBA 2WUUA 5J8CA 1B6BA 4KLWA 4KOSA 2VXKA 5A28A 2ZXVA 2C27A 1S7NA 1WWZA 1XE4A 2HUZA 2Q7BA 3PGPA 2HQYA 4MFJA 3TT2A 1S7KA 5IB0A 4AG7A 4MFPA 3G3SA 4B11A 3IU1A 4QC6A 2JDCA 3I9SA 4PK2A 1GHEA 4Q36A 1KUYA 5F46A 4XNHB 4KLVA 1K4JA 3TTHA 2FIAA 4K30A 4NEXA 4BMHA 4E8OA 4F0YA 5AG5A 4XPLA 1NMTA 3SXOA 5AG4A 2I00A 2YNCC 2QIRA 4L89A 2Z3LA 4FD4A 3FBUA 4KOUA 3IGRA 4R3KA 5E96A 4H6UA 4CGNA 3B8GA 1S7FA 1S5KA 2Z10A 4KOXA 5H86A 1L0CA 3TFYA 2CNTA 1FY7A 1OZPA 4A31A 1QSOA 2FSRA 4B5OA 5AG7A 4B12A 1Y9KA 4KUAA 5C88A 3QB8A 4JXQA 2CNMA 5H84A 4A2ZA 1M4IA 4CAXA 3SHPA 5F48A 1Q2YA 1Y9WA 4A32A 2P6EA 3JUWA 3D8PA 3GY9A 1YK3A 1IYLA 1Z9UA 4C7HA 4DNCA 4XPKA 3C26A 2YNEA 1PUAA 1XMTA 4H6ZA 3GKRA 4M3SA 1MJBA 3JVNA 4L8AA 3F0AA 1CM0A 3S6KA 2ATRA 2Q04A 2R98A 3TE4A 2EUIA 2H5MA 4MFQA 4C2YA 2JDDA 2QECA 2BSWA 1IIDA 5G1ZA 4AVBA 1Q2CA 3IWEA 2FT0A 2VZZA 2FCKA 4CGOA 2WPWA 3H4QA 2VEZA 1XF8A 3QAHA 4E0AA 2PC1A 4NSQA 3FXTA 4UFVA 1M4GA 4CYQA 1YGHA 4OADA 1M4DA 4RI1A 3D2PA 1R57A 2B58A 1M44A 4MFKA 1U6MA 3I3GA 3DR8A 2OZHA 3TOBA 2ARHA 1I1DA 1QSMA 2I79A 4YGOA 2BL1A 3R95A 3DNSA 4HNYB 4B5PB 4B5PA 4A95A 4AG9A 4A33A 1SQHA 3KKWA 4KOTA 2D4OA 4HNXB 2PR8A 4CAVA 2WPXA 1P4NA 2JLMA 1YVKA 4B14A 5EBVA 3BJ8A 2FXFA 3S6GA 1J4JA 4Y49B 5C82A 4EVYA 3FNCA 3VWDA 1IB1E 1CJWA 1WK4A 1UFHA 3TO9A 2Q4YA 4UFWA 4C2XA 3E0KA 4CYOA 1KZFA 2F5IA 4I49A 4KVME 5JQ4A 3D3SA 4B13A 2Z0ZA 5ISVA 4UWJA 3CXQA 2R1IA 1ON0A 2QMLA 2FL4A 3W6XA 3P2HA 5I0CA 2B5GB 2B5GA 4C7IA 4JD6A 4AVCA 3R1KA 1VHSA 5G21A 3TO6A 4R3LA 3UY5A 4C2ZA 3VWEA 4KVXA 3EO4A 3F8KA 2REEA 5AGEA 4CRZB 1RO5A 1Z4RA 4OAEA 2R7HA 3TO7A 1N71A 2CXAA 2Z11A 4KVOE 2OZUA 2JEVA 3BJ7A 3BLNA 4LX9A 5KTAA 2VI7A 3GYAA 1RXTA 2FIWA 2BEIA 4QUSA 5AG6A 4MHDA 4A30A 4CAFA 3W91A 1I12A 3EFAA 4PSWA 2J8RA 1PU9A 3OWCA 4UFXA 1YREA 4PV6A 4R87A 2B3VA 2A4NA 4J3GA 4MBUA 3FIXA 3CXSA 1NE9A 2D4PA 4LUAA 3RYOA 2GANA 3R9EA 4UCMA 1MJAA 1KUVA 3G8WA 3FYNA 4JJXA 4XPDB 3IU2A 3V8IA 2IL4A 3WR7A 3EY5A 4U9ZA 1YR0A 4NCZA 4II9A 1YX0A 5BWAB 4FD6A 2GIVA 4JLYA 1M1DA 2ZW6A 2AE6A 4Y49C 2VZYA 2Z3NA 4OLLA 4KSAA 4XNHC 3S6FA 2FS5A 3R9GA 5F47A 4ZBGA 3FRMA 4C68A 3P2FA 5FVJA 2Z3OA 4ONUA 2VQYA 4KS9A 4MY3A 2Z3MA 4UCPA 5F49A 4QBJA 1I21A 1KUXA 3R9FA 3ZJ0A 1S3ZA 4KOVA 1S60A 2VBQA 2Z3PA 2O28A 2OB0A 3TCVA 5G22A 2Y0MA 4F6AA 2G3AA 4R57A 4BBHA 1MK4A 4QB9A 5CNPA 2P6GA 3W6SA 3A9LA 2B4DB 1NSLA 2B4DA 3ZZIA 5KTCA 4KZTA 4B10A 2BUEA 2OU2A 3DSBA 3EC4A 2ZPAA 4KOWA 3LODA 2Q0YA 2RC4A 4CAWA 4CGLA 3PZJA 5EC4A 4RS2A 2B3UA 2FE7A 3D2MA 5G20A 4ZGYB 2DXQA 4CRYB 5KTDA 3FB3A 2ZW4A 2X7BA 5DWNA 5HH1A 4NF1A 3DDDA 4UWIA 4AB7A 2NMTA 3R96A 4M85A 4E2AA 1IICA 1QSTA 3SXNA 4KSFA 1QSRA 4JXRA 3DR6A 4XPDC 2YNDA 5HMNA 4YRHA 4PSXA 4H89A 1ZO0A 4PK3A 3K9UA 4MJ8A 4MFZA 2DPTA 2R8VA 5A27A 1QSNA 2OZGA 2REFA 3MGDA 4CGMA 4CYNA 2J8NA 2HV2A 4U5YA 5IV0A 5J8FA 2OH1A 2P6FA 4R9MA 4KOYA 3JTKA 3EXNA 3PP9A 2DPSA 1V0CA 4X5KA 2KCWA 1YVOA 4U9YA 2PRBA 4UCNA 2K5TA 2PR1A 2YNCA 4NXYA 1B87A 3N7ZA 4GS4A 4F0XA 5DWMA 2ZW5A 4HKFA 3TOAA 3T90A 1LRZA 3H5ZA 1Q2DA 2PDOA 4UBRA 1BO4A 2PQ8A 5JPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B11 A;  4CYQ A;  4UCN A;  3IU1 A;  4UCM A;  4A2Z A;  4CGP A;  4B14 A;  4C68 A;  4CGN A;  3IU2 A;  4B10 A;  5AG6 A;  4A30 A;  4CAF A;  5A27 A;  4CYP A;  4UCP A;  2WSA A;  4C7I A;  2WUU A;  2YNC A;  4A32 A;  4A31 A;  4C2Y A;  5G21 A;  4CGM A;  4C2Z A;  5G1Z A;  4UFX A;  4CYN A;  5A28 A;  2YND A;  3IWE A;  4CAE A;  4CGL A;  5AG5 A;  5AGE A;  5AG7 A;  5G22 A;  4B12 A;  4UFW A;  4C2X A;  5AG4 A;  4C7H A;  4A95 A;  4CYO A;  4CGO A;  2YNE A;  2YNC C;  3H5Z A;  3JTK A;  5G20 A;  4A33 A;  4BBH A;  4UFV A;  4B13 A; 
#chains in the Genus database with same CATH topology
 4KOR A;  4CGP A;  4MHN A;  2EVN A;  2PCU A;  4YU9 A;  3PB8 X;  1YLO A;  2ZEN A;  4PQA A;  4JWP A;  4QVT A;  5LYD A;  3S6H A;  1TIQ A;  4IF5 A;  3CXP A;  2AJ6 A;  2CNS A;  4MI4 A;  5IX3 A;  4FD5 A;  2GE3 A;  2WSA A;  1BOB A;  3BI0 A;  2CTC A;  3HLP A;  3QAY A;  4ORF A;  3WC6 A;  4YFJ A;  4B6Z A;  2J8M A;  2OR4 A;  1XIX A;  4AVA A;  3LD2 A;  4R8F A;  4MCP A;  4MHY A;  3F5B A;  3D7D A;  4F8Z A;  3KGQ A;  4KUB A;  4IUS A;  4A39 A;  2Q4V A;  5CBM A;  2YGW A;  4MHP A;  4PXC A;  4HNW B;  4FD7 A;  4MY0 A;  2P0W A;  4CAE A;  4CS0 B;  2BO9 A;  2G0B A;  1HDU A;  3V38 A;  2V8V A;  1Y7R A;  2Q44 A;  4MFL A;  1MJ9 A;  2ZW7 A;  3NE7 A;  4P10 A;  4TWE A;  3WC7 A;  2Q43 A;  3B3S A;  1VKC A;  1Z8W A;  2B4B A;  2G3T A;  4Q38 A;  1Z8L A;  3IWG A;  1P0H A;  4AXV A;  1BPN A;  1IYK A;  2HC9 A;  4UA3 A;  2OOT A;  1YLE A;  4GXH A;  2ZOF A;  4JYW A;  1S7L A;  2PSW A;  5HVF A;  5GCN A;  2Z3K A;  3T9Y A;  2CY2 A;  3SJF A;  4CPA A;  1Z4E A;  4CYP A;  3SI2 A;  1XEB A;  2WUU A;  1JQG A;  5J8C A;  1B6B A;  4KLW A;  4KOS A;  3BI1 A;  3PEI A;  2RB7 A;  3PB4 X;  2VXK A;  5DS0 A;  5A28 A;  2ZXV A;  2C27 A;  8CPA A;  1S7N A;  1WWZ A;  1Y0Y A;  1XE4 A;  4OC2 A;  2HUZ A;  2PJC A;  2Q7B A;  3KR5 A;  3PGP A;  3FED A;  2HQY A;  4MFJ A;  1PYT B;  3TT2 A;  1S7K A;  7CPA A;  4P6Y A;  5IB0 A;  4MRI A;  1FNO A;  2VL1 A;  4AG7 A;  4MFP A;  3G3S A;  4B11 A;  2ZEE A;  3IU1 A;  4QC6 A;  3SI1 A;  2PJ2 A;  2GFQ A;  2JDC A;  3I9S A;  4WJB A;  4PK2 A;  4P4J A;  1GHE A;  4Q36 A;  5LRJ A;  5D29 A;  1KUY A;  3RZA A;  5F46 A;  4XNH B;  4KLV A;  1ZLH A;  1JWQ A;  1K4J A;  5CPA A;  4FBE A;  3S9M A;  4IAV A;  3FH4 A;  2IQ6 A;  2QYV A;  2FIA A;  3TTH A;  1X10 A;  4K30 A;  1EE3 P;  4NEX A;  4BMH A;  4BIN A;  4E8O A;  4F0Y A;  5AG5 A;  4XPL A;  1NMT A;  3SXO A;  5AG4 A;  2I00 A;  4UIB A;  4PXD A;  2YNC C;  2QIR A;  2ANP A;  4L89 A;  2Z3L A;  3FEC A;  4FD4 A;  1CBX A;  3FBU A;  4KOU A;  4P45 A;  3D7H A;  3IGR A;  4Z65 A;  4R3K A;  5E96 A;  1Z5R A;  1TF8 A;  4H6U A;  4CGN A;  3B8G A;  1S7F A;  1S5K A;  3IO1 A;  2Z10 A;  4KOX A;  5H86 A;  2XEJ A;  1L0C A;  5EMI A;  4DUK A;  2ODF A;  3TFY A;  2CNT A;  2PJ0 A;  1FY7 A;  1OZP A;  2F7V A;  3FEE A;  1AMP A;  1QSO A;  4A31 A;  2FSR A;  2PJB A;  4B5O A;  2DEA A;  5HXD A;  2GU2 A;  5D8N A;  2PVW A;  2WZN A;  2XEF A;  2PIZ A;  1YQE A;  5AG7 A;  4OC3 A;  2QVP A;  4B12 A;  2AFX A;  1Y9K A;  1TKH A;  3JRU A;  4KUA A;  5JGF A;  4OC1 A;  5C88 A;  1Z2L A;  2C6P A;  2RFH A;  3QB8 A;  4JXQ A;  2CNM A;  3KL9 A;  4MMO A;  4OKO A;  5H84 A;  4A2Z A;  2I3C A;  3RAM A;  4RN7 A;  4NGS A;  1BLL E;  2AFW A;  1M4I A;  4CAX A;  3D66 A;  3PB9 X;  4NGM A;  3VH9 A;  4KSI A;  3SHP A;  5F48 A;  3KQZ A;  1Q2Y A;  3NH4 A;  1Y9W A;  2Q51 A;  4A32 A;  2P6E A;  2PJ8 A;  3JUW A;  3D8P A;  3GY9 A;  4ZY1 A;  1YK3 A;  4X2T A;  3B3V A;  4A94 A;  1IYL A;  1M4L A;  1Z9U A;  3KHX A;  4OP4 A;  4XPK A;  1LAM A;  3C26 A;  2YNE A;  4C7H A;  4DNC A;  1F2O A;  2G9D A;  1IU8 A;  1PUA A;  2Q4Z A;  3RO0 A;  1Q7L A;  1LFW A;  3CPX A;  1XMT A;  4H6Z A;  3KHZ A;  3TC8 A;  3GKR A;  1LCP A;  4TNU A;  1A2Z A;  4M3S A;  1MJB A;  2V8G A;  3JVN A;  2POK A;  1LAN A;  1BAV A;  4NGT A;  4L8A A;  3F0A A;  3HUV A;  1CM0 A;  3S6K A;  2ATR A;  2Q04 A;  2R98 A;  3N5F A;  3NE8 A;  3TE4 A;  2EUI A;  3GB0 A;  1R43 A;  2PRQ A;  5HVG A;  2H5M A;  4MFQ A;  4C2Y A;  2JDD A;  2QEC A;  4ZYQ A;  2BSW A;  1IID A;  4M6H A;  5G1Z A;  5THW A;  2C1C A;  4AVB A;  1Q2C A;  4ZY0 A;  1NSA A;  3IWE A;  2FT0 A;  4FUU A;  2VZZ A;  1YW4 A;  4NJQ A;  2FCK A;  1ZG9 A;  4NGR A;  4CGO A;  2WPW A;  3H4Q A;  2VEZ A;  1XF8 A;  3QAH A;  4E0A A;  2PC1 A;  4NGQ A;  3PB6 X;  4NSQ A;  3FXT A;  5ELY A;  4UFV A;  2CTB A;  1M4G A;  4CYQ A;  1YGH A;  2V77 A;  3LMS A;  4OAD A;  4GM5 A;  1M4D A;  4WWV A;  4RI1 A;  1VHE A;  3D2P A;  1R57 A;  2PJ5 A;  1DE4 C;  2B58 A;  1M44 A;  4MFK A;  4P4E A;  3TX8 A;  1U6M A;  3I3G A;  3DR8 A;  3SI0 A;  2OZH A;  3TOB A;  3B7I A;  3VAR A;  4A38 A;  3B3W A;  2ARH A;  4R6T A;  1I1D A;  1QSM A;  2I79 A;  2PJ1 A;  3CPA A;  4IK2 A;  4YGO A;  3PBE A;  2BL1 A;  3GUX A;  3H8E A;  3R95 A;  1X12 A;  5IB9 A;  3IJ3 A;  1AUG A;  1H8L A;  3DNS A;  4HNY B;  4B5P B;  4B5P A;  4NFR A;  4A95 A;  3IIB A;  4AG9 A;  4A33 A;  1SQH A;  3KKW A;  3SJG A;  4KOT A;  3RNZ A;  2D4O A;  4HNX B;  2PR8 A;  2ZEP A;  2PJA A;  2WPX A;  3FMC A;  4M6G A;  1P4N A;  4CAV A;  4ZX9 A;  2JLM A;  4MCR A;  1YVK A;  4B14 A;  2XEI A;  3BJ8 A;  5EBV A;  2FXF A;  3S6G A;  1J4J A;  4Y49 B;  5C82 A;  4EVY A;  4ONW A;  4DJL A;  3L2N A;  4P4D A;  3WC5 A;  3FNC A;  3VWD A;  1IB1 E;  2FVG A;  4IHM A;  1CJW A;  1WK4 A;  1UFH A;  3TO9 A;  2Q4Y A;  3DLJ A;  1YSJ A;  3KR4 A;  6CPA A;  5K8N A;  3IEH A;  4UFW A;  4C2X A;  2ZOG A;  3E0K A;  4LQG A;  4CYO A;  1QMU A;  1KZF A;  2F5I A;  1Y0R A;  4I49 A;  3PFE A;  1XRY A;  4HPS A;  4R76 A;  3MRU A;  4KVM E;  5JQ4 A;  1CX8 A;  3D3S A;  4B13 A;  1Z8T A;  2Z0Z A;  5ISV A;  4UWJ A;  4G1P A;  3CXQ A;  2R1I A;  2JBK A;  1ON0 A;  2QML A;  2FL4 A;  1YW6 A;  2EWB A;  3W6X A;  3PRT A;  2BCO A;  3P2H A;  5I0C A;  1Y7E A;  1HDQ A;  2B5G B;  2B5G A;  4C7I A;  4JD6 A;  3IWW A;  4UEF A;  1TXR A;  4AVC A;  3R1K A;  1VHS A;  5G21 A;  3TO6 A;  4R3L A;  3UY5 A;  4C2Z A;  3CDX A;  3D7F A;  4KVX A;  3EO4 A;  2PJ6 A;  3F8K A;  2REE A;  3VWE A;  1XMB A;  5AGE A;  4CRZ B;  1RO5 A;  1Z4R A;  1ARL A;  4P4F A;  4OAE A;  2R7H A;  2PJ3 A;  3TO7 A;  1N71 A;  2CXA A;  2Z11 A;  4KVO E;  4MCS A;  2OZU A;  2JEV A;  2ZEH A;  3BJ7 A;  3BLN A;  3BHX A;  4LX9 A;  5KTA A;  4LQ6 A;  3D7G A;  2EK8 A;  3D68 A;  4UIA A;  3IFE A;  2VI7 A;  1LOK A;  3GYA A;  3IC1 A;  4OC5 A;  1RXT A;  2FIW A;  2BEI A;  4QUS A;  4OC0 A;  5AG6 A;  4MHD A;  4A30 A;  4CAF A;  3W91 A;  2Q7S A;  4ZY2 A;  1OBR A;  1I12 A;  2C6C A;  3EFA A;  4PSW A;  5LYL A;  2J8R A;  1PU9 A;  2GRE A;  3OWC A;  4UFX A;  1KWM A;  1F2P A;  1YRE A;  4PV6 A;  4R87 A;  4YWY A;  2EK9 A;  3H8G A;  2B3V A;  2A4N A;  4J3G A;  3WAB A;  3S9N A;  4MBU A;  3FIX A;  4FWU A;  3CXS A;  4OC4 A;  1NE9 A;  1CPS A;  1ELM P;  2D4P A;  4LUA A;  3RYO A;  2GAN A;  5K8O A;  2AFS A;  3R9E A;  3B35 A;  3D4U A;  4UCM A;  1ELL P;  2JEW A;  1MJA A;  1KUV A;  3G8W A;  3FYN A;  4JJX A;  3KAS A;  3IU2 A;  4XPD B;  3V8I A;  2IL4 A;  2PVV A;  4PXB A;  3WR7 A;  3EY5 A;  4U9Z A;  1YR0 A;  4NCZ A;  1F57 A;  2GLF A;  4II9 A;  1DTD A;  4A37 A;  1YX0 A;  5BWA B;  4FD6 A;  2QJ8 A;  2GIV A;  3LWU A;  1Z8X A;  4JLY A;  1M1D A;  2ZW6 A;  4PPZ A;  4UEZ A;  2AE6 A;  4Y49 C;  2VZY A;  4OID A;  2Z3N A;  4OLL A;  1YME A;  1LAP A;  4KSA A;  2EO8 A;  4XNH C;  2C6G A;  1GYT A;  3S6F A;  2FS5 A;  3WT4 A;  3R9G A;  3RBU A;  5J1Q A;  5F47 A;  4ZBG A;  3FVL A;  1CPX A;  2ZED A;  2NYQ A;  2AFZ A;  3FRM A;  4UF4 A;  4C68 A;  5LRG A;  2V8D A;  2EBJ A;  3PBB A;  3P2F A;  5FVJ A;  2Z3O A;  2J9A A;  2VQY A;  4ONU A;  4KS9 A;  4M6I A;  2O53 A;  4MY3 A;  2Z3M A;  4UCP A;  5F49 A;  4QBJ A;  1I21 A;  1KUX A;  2AFM A;  3R9F A;  5JH9 A;  3ZJ0 A;  3ISZ A;  1S3Z A;  2ZEL A;  4KOV A;  1S60 A;  2VBQ A;  2Z3P A;  4DYO A;  5K8M A;  2PJ7 A;  2O28 A;  2OB0 A;  3TCV A;  3H8F A;  2PIY A;  3MN8 A;  5G22 A;  1CP6 A;  1ZG8 A;  2Y0M A;  3FX6 A;  4F6A A;  2G3A A;  1QQ9 A;  4R57 A;  1PCA A;  3CZX A;  3SJX A;  1FT7 A;  3K2K A;  4BBH A;  1MK4 A;  4F9V A;  1TKJ A;  4QB9 A;  2P6G A;  5CNP A;  3W6S A;  3PFO A;  4ZX8 A;  1BPM A;  2AFU A;  3A9L A;  2B4D B;  1NSL A;  2B4D A;  3KQX A;  3ZZI A;  3NH5 A;  5KTC A;  4KZT A;  4B10 A;  2BUE A;  2OU2 A;  3DSB A;  1XJO A;  3EC4 A;  2ZPA A;  4KOW A;  2PE3 A;  4O23 A;  2PJ4 A;  3LOD A;  3PB7 X;  1CP7 A;  2Q0Y A;  3GLJ A;  2ZEG A;  3B3C A;  1ZLI A;  2RC4 A;  3FJU A;  4CAW A;  4K3N A;  4CGL A;  4EME A;  3PZJ A;  5EC4 A;  4RS2 A;  1IGB A;  4W9Y A;  1RTQ A;  1IOI A;  2B3U A;  3KI9 A;  2XEG A;  2FE7 A;  3D2M A;  5G20 A;  2CIJ A;  4R7M A;  4FAI A;  4ZGY B;  5HVH A;  5JM6 A;  2DXQ A;  2HB6 A;  4CRY B;  5KTD A;  3FB3 A;  2ZW4 A;  4MXU A;  2ZEM A;  2X7B A;  5DWN A;  5HH1 A;  3QNV A;  4P4B A;  4MHZ A;  2PJ9 A;  3DDD A;  4NF1 A;  3D67 A;  4UWI A;  2NMT A;  3R96 A;  4AB7 A;  4Q7A A;  4M85 A;  4NJR A;  3B3T A;  4E2A A;  1IIC A;  2F8H A;  1QST A;  3SXN A;  3CT9 A;  4EFD A;  4KSF A;  4OIW A;  3B2Y A;  1QSR A;  3DGV A;  2ZEO A;  4JXR A;  4NGP A;  3DR6 A;  4XPD C;  4RUH A;  2YND A;  4P44 A;  5HMN A;  4YRH A;  4PSX A;  4F9U A;  1TF9 A;  4ZI6 A;  4H89 A;  1IY7 A;  3I1U A;  2CF4 A;  1ZO0 A;  4PK3 A;  3K9U A;  4MJ8 A;  1R3N A;  1UWY A;  2DF5 A;  3K9T A;  2AFO A;  2IJZ A;  2V8H A;  4H2K A;  4MFZ A;  2ABZ A;  2WYR A;  4NGN A;  2DPT A;  2R8V A;  1ZG7 A;  3T8W A;  1VIX A;  4JZ0 A;  5A27 A;  1QSN A;  2OZG A;  4PXE A;  2JBJ A;  3V7Z A;  2REF A;  3MGD A;  2IMO A;  3ISX A;  4CGM A;  1AYE A;  1IOF A;  4CYN A;  2J8N A;  2HV2 A;  4U5Y A;  5IV0 A;  2GLJ A;  5J8F A;  1XBU A;  2OH1 A;  3LAC A;  1HEE A;  2P6F A;  4X8I A;  2ZEF A;  4R9M A;  5LYI A;  3BXM A;  3GIU A;  4KOY A;  1TKF A;  5LRK A;  3JTK A;  3EXN A;  3NA6 A;  3PP9 A;  2DPS A;  2NSM A;  3NFZ A;  4OME A;  4BD9 A;  1V0C A;  4UEE A;  4X5K A;  2KCW A;  1YVO A;  4U9Y A;  4X3R A;  2PRB A;  4UCN A;  2K5T A;  4MCQ A;  2PR1 A;  1XOV A;  3KZW A;  3S9L A;  2O4H A;  1CG2 A;  3VAT A;  2YNC A;  5K8P A;  4NXY A;  1B87 A;  5LYF A;  5F09 A;  3FF3 A;  3N7Z A;  3NH8 A;  4GS4 A;  5DWM A;  3SJE A;  4F0X A;  2ZW5 A;  4HKF A;  3TOA A;  3T90 A;  4EWT A;  1VGY A;  1LRZ A;  5I4M A;  3H5Z A;  4P4I A;  1Q2D A;  2PDO A;  1ARM A;  4UBR A;  5JPH A;  1XFO A;  2BOA A;  1BO4 A;  2PQ8 A;  1VHO A; 
#chains in the Genus database with same CATH homology
 4KOR A;  4CGP A;  2EVN A;  3S6H A;  4QVT A;  4JWP A;  1TIQ A;  4IF5 A;  3CXP A;  2AJ6 A;  2CNS A;  4MI4 A;  5IX3 A;  4FD5 A;  2GE3 A;  2WSA A;  1BOB A;  4ORF A;  4YFJ A;  2J8M A;  1XIX A;  4AVA A;  3LD2 A;  3F5B A;  4KUB A;  4IUS A;  2Q4V A;  2YGW A;  4CAE A;  4HNW B;  4FD7 A;  4MY0 A;  2P0W A;  4CS0 B;  2G0B A;  1Y7R A;  2Q44 A;  4MFL A;  1MJ9 A;  2ZW7 A;  3NE7 A;  1VKC A;  2B4B A;  2G3T A;  4Q38 A;  3IWG A;  1P0H A;  1IYK A;  4UA3 A;  1YLE A;  1S7L A;  2PSW A;  3T9Y A;  5GCN A;  2Z3K A;  2CY2 A;  1Z4E A;  4CYP A;  1XEB A;  2WUU A;  5J8C A;  1B6B A;  4KLW A;  4KOS A;  2VXK A;  5A28 A;  2ZXV A;  2C27 A;  1S7N A;  1WWZ A;  1XE4 A;  2HUZ A;  2Q7B A;  3PGP A;  2HQY A;  4MFJ A;  3TT2 A;  1S7K A;  5IB0 A;  4AG7 A;  4MFP A;  3G3S A;  4B11 A;  3IU1 A;  4QC6 A;  2JDC A;  3I9S A;  4PK2 A;  1GHE A;  4Q36 A;  1KUY A;  5F46 A;  4XNH B;  4KLV A;  1K4J A;  3TTH A;  2FIA A;  4K30 A;  4NEX A;  4BMH A;  4E8O A;  4F0Y A;  5AG5 A;  4XPL A;  1NMT A;  3SXO A;  5AG4 A;  2I00 A;  2YNC C;  2QIR A;  4L89 A;  2Z3L A;  4FD4 A;  3FBU A;  4KOU A;  3IGR A;  4R3K A;  5E96 A;  4H6U A;  4CGN A;  3B8G A;  1S7F A;  1S5K A;  2Z10 A;  4KOX A;  5H86 A;  1L0C A;  3TFY A;  2CNT A;  1FY7 A;  1OZP A;  4A31 A;  1QSO A;  2FSR A;  4B5O A;  5AG7 A;  4B12 A;  1Y9K A;  4KUA A;  5C88 A;  3QB8 A;  4JXQ A;  2CNM A;  5H84 A;  4A2Z A;  1M4I A;  4CAX A;  3SHP A;  5F48 A;  1Q2Y A;  1Y9W A;  4A32 A;  2P6E A;  3JUW A;  3D8P A;  3GY9 A;  1YK3 A;  1IYL A;  1Z9U A;  4C7H A;  4DNC A;  4XPK A;  3C26 A;  2YNE A;  1PUA A;  1XMT A;  4H6Z A;  3GKR A;  4M3S A;  1MJB A;  3JVN A;  4L8A A;  3F0A A;  1CM0 A;  3S6K A;  2ATR A;  2Q04 A;  2R98 A;  3TE4 A;  2EUI A;  2H5M A;  4MFQ A;  4C2Y A;  2JDD A;  2QEC A;  2BSW A;  1IID A;  5G1Z A;  4AVB A;  1Q2C A;  3IWE A;  2FT0 A;  2VZZ A;  2FCK A;  4CGO A;  2WPW A;  3H4Q A;  2VEZ A;  1XF8 A;  3QAH A;  4E0A A;  2PC1 A;  4NSQ A;  3FXT A;  4UFV A;  1M4G A;  4CYQ A;  1YGH A;  4OAD A;  1M4D A;  4RI1 A;  3D2P A;  1R57 A;  2B58 A;  1M44 A;  4MFK A;  1U6M A;  3I3G A;  3DR8 A;  2OZH A;  3TOB A;  2ARH A;  1I1D A;  1QSM A;  2I79 A;  4YGO A;  2BL1 A;  3R95 A;  3DNS A;  4HNY B;  4B5P B;  4B5P A;  4A95 A;  4AG9 A;  4A33 A;  1SQH A;  3KKW A;  4KOT A;  2D4O A;  4HNX B;  2PR8 A;  4CAV A;  2WPX A;  1P4N A;  2JLM A;  1YVK A;  4B14 A;  5EBV A;  3BJ8 A;  2FXF A;  3S6G A;  1J4J A;  4Y49 B;  5C82 A;  4EVY A;  3FNC A;  3VWD A;  1IB1 E;  1CJW A;  1WK4 A;  1UFH A;  3TO9 A;  2Q4Y A;  4UFW A;  4C2X A;  3E0K A;  4CYO A;  1KZF A;  2F5I A;  4I49 A;  4KVM E;  5JQ4 A;  3D3S A;  4B13 A;  2Z0Z A;  5ISV A;  4UWJ A;  3CXQ A;  2R1I A;  1ON0 A;  2QML A;  2FL4 A;  3W6X A;  3P2H A;  5I0C A;  2B5G B;  2B5G A;  4C7I A;  4JD6 A;  4AVC A;  3R1K A;  1VHS A;  5G21 A;  3TO6 A;  4R3L A;  3UY5 A;  4C2Z A;  3VWE A;  4KVX A;  3EO4 A;  3F8K A;  2REE A;  5AGE A;  4CRZ B;  1RO5 A;  1Z4R A;  4OAE A;  2R7H A;  3TO7 A;  1N71 A;  2CXA A;  2Z11 A;  4KVO E;  2OZU A;  2JEV A;  3BJ7 A;  3BLN A;  4LX9 A;  5KTA A;  2VI7 A;  3GYA A;  1RXT A;  2FIW A;  2BEI A;  4QUS A;  5AG6 A;  4MHD A;  4A30 A;  4CAF A;  3W91 A;  1I12 A;  3EFA A;  4PSW A;  2J8R A;  1PU9 A;  3OWC A;  4UFX A;  1YRE A;  4PV6 A;  4R87 A;  2B3V A;  2A4N A;  4J3G A;  4MBU A;  3FIX A;  3CXS A;  1NE9 A;  2D4P A;  4LUA A;  3RYO A;  2GAN A;  3R9E A;  4UCM A;  1MJA A;  1KUV A;  3G8W A;  3FYN A;  4JJX A;  4XPD B;  3IU2 A;  3V8I A;  2IL4 A;  3WR7 A;  3EY5 A;  4U9Z A;  1YR0 A;  4NCZ A;  4II9 A;  1YX0 A;  5BWA B;  4FD6 A;  2GIV A;  4JLY A;  1M1D A;  2ZW6 A;  2AE6 A;  4Y49 C;  2VZY A;  2Z3N A;  4OLL A;  4KSA A;  4XNH C;  3S6F A;  2FS5 A;  3R9G A;  5F47 A;  4ZBG A;  3FRM A;  4C68 A;  3P2F A;  5FVJ A;  2Z3O A;  4ONU A;  2VQY A;  4KS9 A;  4MY3 A;  2Z3M A;  4UCP A;  5F49 A;  4QBJ A;  1I21 A;  1KUX A;  3R9F A;  3ZJ0 A;  1S3Z A;  4KOV A;  1S60 A;  2VBQ A;  2Z3P A;  2O28 A;  2OB0 A;  3TCV A;  5G22 A;  2Y0M A;  4F6A A;  2G3A A;  4R57 A;  4BBH A;  1MK4 A;  4QB9 A;  5CNP A;  2P6G A;  3W6S A;  3A9L A;  2B4D B;  1NSL A;  2B4D A;  3ZZI A;  5KTC A;  4KZT A;  4B10 A;  2BUE A;  2OU2 A;  3DSB A;  3EC4 A;  2ZPA A;  4KOW A;  3LOD A;  2Q0Y A;  2RC4 A;  4CAW A;  4CGL A;  3PZJ A;  5EC4 A;  4RS2 A;  2B3U A;  2FE7 A;  3D2M A;  5G20 A;  4ZGY B;  2DXQ A;  4CRY B;  5KTD A;  3FB3 A;  2ZW4 A;  2X7B A;  5DWN A;  5HH1 A;  4NF1 A;  3DDD A;  4UWI A;  4AB7 A;  2NMT A;  3R96 A;  4M85 A;  4E2A A;  1IIC A;  1QST A;  3SXN A;  4KSF A;  1QSR A;  4JXR A;  3DR6 A;  4XPD C;  2YND A;  5HMN A;  4YRH A;  4PSX A;  4H89 A;  1ZO0 A;  4PK3 A;  3K9U A;  4MJ8 A;  4MFZ A;  2DPT A;  2R8V A;  5A27 A;  1QSN A;  2OZG A;  2REF A;  3MGD A;  4CGM A;  4CYN A;  2J8N A;  2HV2 A;  4U5Y A;  5IV0 A;  5J8F A;  2OH1 A;  2P6F A;  4R9M A;  4KOY A;  3JTK A;  3EXN A;  3PP9 A;  2DPS A;  1V0C A;  4X5K A;  2KCW A;  1YVO A;  4U9Y A;  2PRB A;  4UCN A;  2K5T A;  2PR1 A;  2YNC A;  4NXY A;  1B87 A;  3N7Z A;  4GS4 A;  4F0X A;  5DWM A;  2ZW5 A;  4HKF A;  3TOA A;  3T90 A;  1LRZ A;  3H5Z A;  1Q2D A;  2PDO A;  4UBR A;  1BO4 A;  2PQ8 A;  5JPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...