4A33A

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a pyrazole sulphonamide ligand
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of a novel class of orally active trypanocidal N-myristoyltransferase inhibitors.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 117
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4a33A00
5AG5A 4A2ZA 2YNDA 4B13A 4A30A 4CYQA 4CGMA 4B14A 5A27A 3JTKA 4CAEA 4UCMA 3IU1A 5AG6A 4B12A 4C2XA 4CYPA 5G20A 4CYOA 4UFVA 4BBHA 4A32A 4C7HA 3IU2A 3H5ZA 2YNCC 4C2ZA 4A33A 4CGPA 5AG7A 4UCPA 4C2YA 5AGEA 2WUUA 5G22A 5G21A 4B10A 5G1ZA 4CAFA 4CYNA 4CGLA 4C7IA 2YNEA 5AG4A 4CGNA 4B11A 2WSAA 4CGOA 4UFXA 3IWEA 4UFWA 2YNCA 4A31A 4UCNA 5A28A 4C68A 4A95A
chains in the Genus database with same CATH superfamily
3WC5A 3KQXA 2P6EA 1S7LA 3P2FA 4KSAA 3G8WA 3CDXA 5J1QA 2AFMA 3HUVA 3SXOA 2IMOA 4CYPA 4OP4A 2DXQA 1M4IA 1DE4C 2Z3LA 4NXYA 3CXPA 1S3ZA 2PR1A 4UBRA 3B3TA 3S6HA 4EMEA 5IB0A 2JDCA 2PVWA 4PXEA 2G3AA 2ATRA 3K9UA 7CPAA 4MCQA 5LYLA 3FNCA 1PYTB 2VZZA 5E96A 2AFOA 2CNTA 2ZW6A 1IGBA 4MMOA 3B35A 4P4FA 1MJBA 4UFXA 4X8IA 3D4UA 4MHNA 1P0HA 2GE3A 4NGSA 1LAMA 2G0BA 4Y49C 4A95A 1YVOA 2R1IA 2XEIA 2C6PA 3K2KA 2A4NA 1GYTA 3KI9A 4M85A 4CRZB 3NE7A 2BSWA 2R8VA 5GCNA 3D2PA 2ZW4A 3SJXA 4OC4A 2DF5A 4MCRA 2CNMA 3UY5A 2K5TA 3TTHA 3IEHA 3FVLA 3F8KA 4CPAA 2OZUA 1IOFA 4JXQA 5AGEA 4O23A 5G21A 1Q7LA 3TO6A 2R7HA 4C7IA 2PJ1A 2Q4VA 4HNYB 4PSWA 4EWTA 2RB7A 3BHXA 4R6TA 3D66A 3GUXA 4XPDB 4AVCA 3NA6A 4JWPA 2YGWA 3IWEA 1Z4RA 3PBEA 3FECA 1V0CA 2D4PA 4H89A 5JM6A 5HVHA 2ANPA 1M4DA 3S9MA 2FIAA 4PQAA 2PDOA 2XEJA 5AG5A 2H5MA 3PB7X 2CTBA 1BLLE 5LRKA 3T8WA 3KR4A 4YRHA 3IU1A 4R57A 5F46A 2AFZA 2J9AA 2V8HA 3KR5A 4ONUA 3SXNA 4OAEA 4BBHA 2PJ8A 1P4NA 4EFDA 2G9DA 4I49A 3R95A 3FYNA 4QBJA 4FUUA 1BPNA 2OR4A 4QUSA 2NYQA 4C2ZA 3FMCA 4UEFA 4UCPA 3WR7A 4JLYA 1AYEA 4WJBA 1NMTA 1X10A 4A39A 1KUYA 4MFZA 2Q4ZA 4MCPA 2EVNA 3FBUA 4PXDA 4L8AA 1IYLA 4B5PA 5K8OA 3BLNA 4NJRA 4ONWA 1Z2LA 4R3LA 3B2YA 2B58A 1R57A 1IIDA 2Q7SA 3RBUA 1TF8A 2B3UA 4KOUA 1QSOA 1CBXA 5IV0A 1BO4A 1DTDA 4FD5A 4UEZA 3S9NA 1ELMP 1HEEA 1ZG8A 2HB6A 3PRTA 1YVKA 2AFXA 4UFVA 4MFKA 3GLJA 4P4IA 3KHZA 4AVAA 1B6BA 2ZEOA 1LANA 4A33A 4C2YA 2BEIA 1ARLA 1QSRA 2VBQA 4P4JA 2Z3NA 1CPXA 4P45A 3RZAA 3MRUA 1I12A 3SJEA 2CXAA 3R9FA 4CRYB 4MXUA 3FH4A 4CGOA 3CPXA 2GIVA 4MFPA 4W9YA 4E2AA 2EK8A 3R9GA 1Y0RA 1QSMA 4OC0A 1KUVA 1RXTA 3IGRA 4UIBA 4A2ZA 5JGFA 1Y7EA 2KCWA 4Q36A 2VXKA 1PUAA 1YLOA 4YWYA 4Q7AA 5F47A 5AG6A 3IO1A 4EVYA 4CYOA 4OC1A 4KOXA 4UWJA 5EC4A 2VI7A 1F57A 3I1UA 5IX3A 2I3CA 2FCKA 2JLMA 2PIZA 4P4EA 2FL4A 5EBVA 1MJ9A 4F0XA 2J8NA 3KL9A 1Y0YA 1PCAA 2PJ0A 1UFHA 2OZGA 3PB4X 4B11A 2ZPAA 2VQYA 2HC9A 3LACA 1Z8TA 2ODFA 4R87A 4MHDA 3IWGA 2XEGA 3PFOA 5EMIA 5A27A 2B5GA 4LX9A 1M44A 4FBEA 1ZG7A 1KZFA 2RFHA 1UWYA 4A94A 1CP6A 4MHZA 3W91A 3A9LA 1XJOA 1R43A 3BI0A 3D7GA 4RS2A 3SI0A 3GIUA 3KQZA 3VATA 3H8GA 4MJ8A 2OZHA 4KOYA 4FD7A 4HNXB 2HQYA 1LCPA 2I00A 2BOAA 2NMTA 2REEA 5H84A 4DNCA 2YNEA 2AFUA 2P0WA 3KGQA 3ZZIA 4YU9A 1Y9WA 1VHEA 2GLFA 2POKA 3D68A 4XPLA 5C82A 3D7HA 3S6FA 1MK4A 4A37A 2Z3KA 2ZEEA 4X3RA 3TOAA 4IUSA 3TOBA 2ZW5A 4IHMA 4F9VA 4OADA 4B14A 2FVGA 4TNUA 1A2ZA 2PR8A 4A38A 4P6YA 4P44A 3DLJA 4B5PB 1XMBA 3E0KA 4OKOA 1IB1E 2V8VA 1NSLA 1Z4EA 1JQGA 2PJ2A 4NGNA 1M4GA 2X7BA 1CP7A 4MY0A 2ZELA 3PB8X 4M6HA 1Q2CA 2WZNA 2F7VA 2WUUA 4HKFA 4KORA 5CNPA 3C26A 2PJ7A 2ABZA 2HV2A 4MHPA 4M6GA 2Q43A 4NGPA 2ZEMA 5THWA 3I9SA 5DWNA 4Z65A 4R8FA 3W6SA 4KLVA 2ZEGA 4P4BA 1ELLP 2PJ4A 4NSQA 2EBJA 1CJWA 4UF4A 4ZX8A 3G3SA 3B3CA 5JPHA 2PQ8A 4R76A 5KTAA 1QQ9A 1S7NA 4QB9A 3VWDA 4KLWA 3EXNA 2QJ8A 4OC5A 5DS0A 3RYOA 4J3GA 1AUGA 1YMEA 2BL1A 4KOWA 1IU8A 4A32A 2PJ6A 4C7HA 3VWEA 3IU2A 4FAIA 1XMTA 2Z3OA 3N5FA 3FB3A 2PJCA 1PU9A 1XRYA 3IWWA 4KOVA 4NEXA 3GB0A 3S6GA 3KASA 2DEAA 2ZEDA 2O53A 3KZWA 1YR0A 3PB9X 3TC8A 3TO9A 3JVNA 3K9TA 4G1PA 3JUWA 1XBUA 4ZYQA 4Y49B 4NGTA 2ZENA 4KVME 4JYWA 1TKFA 2O28A 4A30A 1J4JA 5BWAB 1H8LA 2IL4A 4C2XA 3S9LA 1FY7A 3MGDA 1VKCA 3B3SA 5KTCA 3BJ8A 3NFZA 4ZBGA 1CM0A 4OLLA 1RO5A 4KVOE 3V8IA 4CAVA 4GM5A 4CAWA 4OMEA 4XNHC 3ISXA 2JEWA 2OOTA 3B3WA 3BJ7A 3IJ3A 2PJBA 4ZY0A 5HXDA 2B5GB 4UA3A 1TKJA 1VHOA 4KSIA 4II9A 4JZ0A 5J8FA 1JWQA 1ZLHA 4MY3A 1Q2YA 3TE4A 5JH9A 4UFWA 3CPAA 3H5ZA 4NGRA 4KUAA 2QMLA 1F2OA 1OBRA 4PK3A 2B4BA 2ZXVA 2REFA 4M6IA 4U9YA 4CYQA 2D4OA 4MCSA 4AG9A 4KUBA 3NH8A 2R98A 4RN7A 4ZI6A 2JEVA 4XPKA 3H8EA 1XF8A 2B4DA 2CTCA 4NFRA 4PV6A 3CXSA 4PXCA 3WABA 2FIWA 1XIXA 1Z8WA 4F6AA 1YW6A 2ZOGA 4HPSA 5F09A 4BINA 2Z3PA 5G1ZA 5H86A 1VGYA 3W6XA 2V8DA 5JQ4A 3MN8A 3D7FA 4CGNA 1VIXA 1TXRA 2ZW7A 2WSAA 1YSJA 2CY2A 2JBKA 1IY7A 3NH4A 4LQ6A 3D67A 2Z11A 4L89A 2B3VA 4R3KA 4NCZA 1Z5RA 1IICA 2Z3MA 4IAVA 4MFLA 2FSRA 1QSNA 2GLJA 2QVPA 3SJGA 4DYOA 3DDDA 1WWZA 3GYAA 5HMNA 3FEEA 3WC7A 1M4LA 4F8ZA 2PRQA 2ZEHA 3KHXA 2IJZA 4K30A 4UEEA 1TIQA 2ZEPA 2Q7BA 3R1KA 4QVTA 4GS4A 3TO7A 1TKHA 2VEZA 3EY5A 4CGPA 1LFWA 4M3SA 2O4HA 1YX0A 2Q0YA 2ZEFA 2HUZA 3LODA 1S5KA 2C27A 5G22A 3RO0A 1EE3P 4K3NA 1KWMA 4CYNA 3PZJA 4F9UA 3V7ZA 1YK3A 2V8GA 2JBJA 4RI1A 4CAXA 4XPDC 3P2HA 2PJ5A 3GKRA 5F49A 2FS5A 2FT0A 1Y9KA 4F0YA 3CZXA 3EC4A 1S7FA 3QB8A 5CBMA 4NGQA 4B13A 2C6CA 1NSAA 4QC6A 4BMHA 5K8MA 4B6ZA 4UCMA 4X5KA 1SQHA 4PK2A 4AB7A 3EO4A 3PGPA 5HVFA 4ZGYB 4MHYA 4E8OA 1I21A 4H6ZA 4AXVA 5LYIA 4FD6A 1IYKA 2YNCC 3F5BA 1R3NA 2XEFA 4KVXA 5K8NA 3PEIA 4UIAA 1LAPA 4MI4A 4NGMA 3H4QA 2GANA 2PVVA 1U6MA 1YLEA 5AG4A 3PP9A 5C88A 1KUXA 2PE3A 4NF1A 4YGOA 1FNOA 4U9ZA 2BUEA 1BPMA 4JD6A 4LUAA 2WYRA 4LQGA 1OZPA 4JJXA 2AJ6A 3RNZA 1HDUA 2RC4A 1WK4A 2WPXA 5CPAA 1ARMA 2QECA 3EFAA 2PC1A 3N7ZA 1ZO0A 4MRIA 4MFJA 1YW4A 3DSBA 5FVJA 4DUKA 3KKWA 4CGMA 3JTKA 3S6KA 2Q51A 5IB9A 4KS9A 2P6FA 4MFQA 1YREA 3QAYA 1M1DA 5HH1A 3FEDA 3PFEA 4FD4A 2AFSA 2F8HA 1HDQA 4NJQA 3SJFA 3JRUA 5I4MA 4FWUA 5ELYA 4CAFA 2NSMA 3PB6X 3DGVA 3V38A 3F0AA 4R7MA 3TFYA 5D8NA 1XOVA 2CNSA 2Z10A 2B4DB 4JXRA 3IFEA 2PRBA 2Q44A 1AMPA 3GY9A 3IIBA 4IK2A 5D29A 4H2KA 2PJAA 1K4JA 3FF3A 2GU2A 3B7IA 3DR6A 3QAHA 3BI1A 1RTQA 2YNDA 3BXMA 3D8PA 3FXTA 3NH5A 2ARHA 4X2TA 1S60A 2IQ6A 2GFQA 1Z9UA 3DR8A 3HLPA 2EWBA 2Q4YA 4KOSA 1XE4A 3ZJ0A 4CAEA 1VHSA 4B12A 4CS0B 1Q2DA 5HVGA 3R96A 4R9MA 3TCVA 2Y0MA 4H6UA 2Q04A 2J8MA 4ZY1A 3PBBA 1S7KA 3SI1A 5AG7A 4OIDA 4P10A 5LRGA 2OH1A 2AE6A 1NE9A 2VL1A 3VARA 3T90A 1X12A 3DNSA 4HNWB 4RUHA 5LRJA 1LOKA 1I1DA 2WPWA 3WT4A 2C1CA 2P6GA 2PJ3A 3FX6A 3SHPA 4UWIA 1N71A 3VH9A 5K8PA 1B87A 4OC2A 4WWVA 3R9EA 1ON0A 1QMUA 3NE8A 2VZYA 4A31A 4BD9A 4UCNA 3TT2A 1Z8XA 5A28A 2ZOFA 2DPSA 5F48A 4ORFA 2AFWA 2F5IA 2OU2A 1Z8LA 1YQEA 2C6GA 2CF4A 2PIYA 2PJ9A 4TWEA 3CXQA 3FIXA 6CPAA 1BAVA 2I79A 1BOBA 1MJAA 1XFOA 2DPTA 3WC6A 4KSFA 3LD2A 2JDDA 2PCUA 5G20A 3TX8A 3T9YA 5DWMA 4E0AA 1TF9A 4ZX9A 1YGHA 3IC1A 4KZTA 3L2NA 1CX8A 2G3TA 2PSWA 4P4DA 1LRZA 1F2PA 4PXBA 1QSTA 1ZLIA 3I3GA 3FRMA 2OB0A 2FXFA 5ISVA 1GHEA 1IOIA 3SI2A 4OIWA 2BO9A 2EK9A 4KOTA 4YFJA 2YNCA 2EO8A 1CPSA 4U5YA 4C68A 1Y7RA 4AVBA 2QYVA 2Z0ZA 5I0CA 3D3SA 4GXHA 3OWCA 4Q38A 3FJUA 4IF5A 4ZY2A 2QIRA 1XEBA 2CIJA 2EUIA 3QNVA 3D2MA 3RAMA 4OC3A 3B3VA 4B5OA 4DJLA 4XNHB 4AG7A 2FE7A 5LYDA 8CPAA 4B10A 4CGLA 2BCOA 2V77A 3LMSA 5LYFA 3CT9A 1FT7A 4MBUA 5J8CA 1ZG9A 3LWUA 5KTDA 4PSXA 3D7DA 3H8FA 1L0CA 4PPZA 2J8RA 3B8GA 2GREA 3ISZA 1CG2A
chains in the Genus database with same CATH topology
2P6EA 1S7LA 3P2FA 4KSAA 3G8WA 3SXOA 4CYPA 2DXQA 1M4IA 2Z3LA 4NXYA 3CXPA 1S3ZA 2PR1A 4UBRA 3S6HA 5IB0A 2JDCA 2G3AA 2ATRA 3K9UA 3FNCA 2VZZA 5E96A 2CNTA 2ZW6A 4UFXA 1MJBA 1P0HA 2GE3A 2G0BA 4Y49C 4A95A 1YVOA 2R1IA 2A4NA 4M85A 4CRZB 3NE7A 2BSWA 2R8VA 5GCNA 3D2PA 2ZW4A 2CNMA 2K5TA 3TTHA 3F8KA 2OZUA 4JXQA 5AGEA 5G21A 3TO6A 2R7HA 4C7IA 4PSWA 2Q4VA 4HNYB 4XPDB 4AVCA 4JWPA 2YGWA 3IWEA 1Z4RA 4H89A 1V0CA 2D4PA 1M4DA 2FIAA 2PDOA 5AG5A 2H5MA 4YRHA 3IU1A 4R57A 5F46A 4ONUA 3SXNA 4OAEA 4BBHA 1P4NA 4I49A 3R95A 4QBJA 3FYNA 4QUSA 4C2ZA 4UCPA 3WR7A 4JLYA 1NMTA 1KUYA 4MFZA 2EVNA 3FBUA 4L8AA 1IYLA 4B5PA 3BLNA 4R3LA 2B58A 1R57A 1IIDA 2B3UA 4KOUA 1QSOA 5IV0A 1BO4A 4FD5A 1YVKA 4UFVA 4MFKA 4AVAA 1B6BA 4A33A 4C2YA 2BEIA 1QSRA 2VBQA 2Z3NA 1I12A 2CXAA 3R9FA 4CRYB 4CGOA 2GIVA 4MFPA 4E2AA 3R9GA 1QSMA 1KUVA 1RXTA 3IGRA 4A2ZA 2KCWA 4Q36A 2VXKA 1PUAA 5F47A 5AG6A 4EVYA 4CYOA 4UWJA 4KOXA 5EC4A 5IX3A 2VI7A 2FCKA 2JLMA 2FL4A 5EBVA 1MJ9A 4F0XA 2J8NA 1UFHA 2OZGA 4B11A 2ZPAA 2VQYA 4R87A 4MHDA 3IWGA 5A27A 2B5GA 4LX9A 1M44A 1KZFA 3W91A 3A9LA 4RS2A 4MJ8A 2OZHA 4KOYA 4FD7A 4HNXB 2HQYA 2I00A 2NMTA 4DNCA 2REEA 5H84A 2YNEA 2P0WA 3ZZIA 1Y9WA 4XPLA 5C82A 3S6FA 1MK4A 2Z3KA 3TOAA 4IUSA 3TOBA 2ZW5A 4OADA 4B14A 2PR8A 4B5PB 3E0KA 1NSLA 1IB1E 1Z4EA 1M4GA 2X7BA 4MY0A 1Q2CA 2WUUA 4HKFA 4KORA 5CNPA 3C26A 2HV2A 3I9SA 5DWNA 3W6SA 4KLVA 4NSQA 1CJWA 3G3SA 5JPHA 2PQ8A 5KTAA 1S7NA 4QB9A 3VWDA 4KLWA 3EXNA 3RYOA 4J3GA 2BL1A 4KOWA 4A32A 4C7HA 3VWEA 3IU2A 1XMTA 2Z3OA 3FB3A 1PU9A 4KOVA 4NEXA 3S6GA 1YR0A 3TO9A 3JVNA 3JUWA 4Y49B 4KVME 2O28A 4A30A 1J4JA 5BWAB 2IL4A 4C2XA 1FY7A 3MGDA 1VKCA 5KTCA 3BJ8A 4ZBGA 1CM0A 4OLLA 1RO5A 4KVOE 3V8IA 4CAVA 4CAWA 4XNHC 3BJ7A 2B5GB 4UA3A 4II9A 5J8FA 4MY3A 1Q2YA 3TE4A 4UFWA 3H5ZA 4KUAA 2QMLA 4PK3A 2B4BA 2ZXVA 2REFA 4U9YA 4CYQA 2D4OA 4AG9A 4KUBA 2R98A 2JEVA 4XPKA 1XF8A 2B4DA 4PV6A 3CXSA 2FIWA 1XIXA 4F6AA 2Z3PA 5G1ZA 5H86A 3W6XA 5JQ4A 4CGNA 2ZW7A 2WSAA 2CY2A 2Z11A 4L89A 2B3VA 4R3KA 4NCZA 1IICA 2Z3MA 4MFLA 2FSRA 1QSNA 3DDDA 1WWZA 3GYAA 5HMNA 4K30A 1TIQA 2Q7BA 3R1KA 4QVTA 4GS4A 3TO7A 2VEZA 3EY5A 4CGPA 4M3SA 2Q0YA 1YX0A 3LODA 2HUZA 5G22A 1S5KA 2C27A 4CYNA 3PZJA 1YK3A 4CAXA 4RI1A 4XPDC 3P2HA 3GKRA 5F49A 2FS5A 2FT0A 1Y9KA 4F0YA 3EC4A 1S7FA 3QB8A 4B13A 4QC6A 4BMHA 4UCMA 4X5KA 1SQHA 4PK2A 4AB7A 3EO4A 3PGPA 4ZGYB 4E8OA 1I21A 4H6ZA 4FD6A 1IYKA 2YNCC 3F5BA 4KVXA 4MI4A 3H4QA 2GANA 1U6MA 1YLEA 5AG4A 3PP9A 5C88A 1KUXA 4YGOA 4NF1A 4U9ZA 2BUEA 4JD6A 4LUAA 1OZPA 4JJXA 2AJ6A 2RC4A 1WK4A 2WPXA 3EFAA 2QECA 3N7ZA 2PC1A 1ZO0A 4MFJA 3DSBA 5FVJA 3KKWA 4CGMA 3JTKA 3S6KA 4KS9A 2P6FA 4MFQA 1YREA 1M1DA 5HH1A 4FD4A 4CAFA 3TFYA 3F0AA 2CNSA 2Z10A 2B4DB 4JXRA 2PRBA 2Q44A 3GY9A 1K4JA 3DR6A 3QAHA 2YNDA 3FXTA 3D8PA 3UY5A 2ARHA 1S60A 4KOSA 1Z9UA 3DR8A 3ZJ0A 2Q4YA 4CAEA 1XE4A 1VHSA 4B12A 4CS0B 1Q2DA 3R96A 4R9MA 3TCVA 2Y0MA 4H6UA 2Q04A 2J8MA 1S7KA 5AG7A 2OH1A 2AE6A 1NE9A 3T90A 3DNSA 4HNWB 1I1DA 2WPWA 2P6GA 3SHPA 4UWIA 1N71A 1B87A 3R9EA 1ON0A 2VZYA 4A31A 4UCNA 3TT2A 5A28A 2DPSA 5F48A 4ORFA 2OU2A 2F5IA 3CXQA 3FIXA 2I79A 1BOBA 1MJAA 2DPTA 4KSFA 3LD2A 2JDDA 5G20A 4E0AA 3T9YA 5DWMA 1YGHA 4KZTA 2G3TA 2PSWA 1LRZA 1QSTA 3I3GA 3FRMA 2OB0A 2FXFA 5ISVA 1GHEA 4KOTA 4YFJA 2YNCA 4U5YA 4C68A 1Y7RA 4AVBA 2Z0ZA 5I0CA 3D3SA 3OWCA 4Q38A 4IF5A 2QIRA 1XEBA 2EUIA 3D2MA 4B5OA 4XNHB 4AG7A 2FE7A 4B10A 4CGLA 4MBUA 5J8CA 5KTDA 4PSXA 1L0CA 2J8RA 3B8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AG5 A;  4A2Z A;  2YND A;  4B13 A;  4A30 A;  4CYQ A;  4CGM A;  4B14 A;  5A27 A;  3JTK A;  4CAE A;  4UCM A;  3IU1 A;  5AG6 A;  4B12 A;  4C2X A;  4CYP A;  5G20 A;  4CYO A;  4UFV A;  4BBH A;  4A32 A;  4C7H A;  3IU2 A;  3H5Z A;  2YNC C;  4C2Z A;  4A33 A;  4CGP A;  5AG7 A;  4UCP A;  4C2Y A;  5AGE A;  2WUU A;  5G22 A;  5G21 A;  4B10 A;  5G1Z A;  4CAF A;  4CYN A;  4CGL A;  4C7I A;  2YNE A;  5AG4 A;  4CGN A;  4B11 A;  2WSA A;  4CGO A;  4UFX A;  3IWE A;  4UFW A;  2YNC A;  4A31 A;  4UCN A;  5A28 A;  4C68 A;  4A95 A; 
#chains in the Genus database with same CATH topology
 3WC5 A;  3KQX A;  2P6E A;  1S7L A;  3P2F A;  4KSA A;  3G8W A;  3CDX A;  5J1Q A;  2AFM A;  3HUV A;  3SXO A;  2IMO A;  4CYP A;  4OP4 A;  2DXQ A;  1M4I A;  1DE4 C;  2Z3L A;  4NXY A;  3CXP A;  1S3Z A;  2PR1 A;  4UBR A;  3B3T A;  3S6H A;  4EME A;  5IB0 A;  2JDC A;  2PVW A;  4PXE A;  2G3A A;  2ATR A;  3K9U A;  7CPA A;  4MCQ A;  5LYL A;  3FNC A;  1PYT B;  2VZZ A;  5E96 A;  2AFO A;  2CNT A;  2ZW6 A;  1IGB A;  4MMO A;  3B35 A;  4P4F A;  1MJB A;  4UFX A;  4X8I A;  3D4U A;  4MHN A;  1P0H A;  2GE3 A;  4NGS A;  1LAM A;  2G0B A;  4Y49 C;  4A95 A;  1YVO A;  2R1I A;  2XEI A;  2C6P A;  3K2K A;  2A4N A;  1GYT A;  3KI9 A;  4M85 A;  4CRZ B;  3NE7 A;  2BSW A;  2R8V A;  5GCN A;  3D2P A;  2ZW4 A;  3SJX A;  4OC4 A;  2DF5 A;  4MCR A;  2CNM A;  3UY5 A;  2K5T A;  3TTH A;  3IEH A;  3FVL A;  3F8K A;  4CPA A;  2OZU A;  1IOF A;  4JXQ A;  5AGE A;  4O23 A;  5G21 A;  1Q7L A;  3TO6 A;  2R7H A;  4C7I A;  2PJ1 A;  2Q4V A;  4HNY B;  4PSW A;  4EWT A;  2RB7 A;  3BHX A;  4R6T A;  3D66 A;  3GUX A;  4XPD B;  4AVC A;  3NA6 A;  4JWP A;  2YGW A;  3IWE A;  1Z4R A;  3PBE A;  3FEC A;  1V0C A;  2D4P A;  4H89 A;  5JM6 A;  5HVH A;  2ANP A;  1M4D A;  3S9M A;  2FIA A;  4PQA A;  2PDO A;  2XEJ A;  5AG5 A;  2H5M A;  3PB7 X;  2CTB A;  1BLL E;  5LRK A;  3T8W A;  3KR4 A;  4YRH A;  3IU1 A;  4R57 A;  5F46 A;  2AFZ A;  2J9A A;  2V8H A;  3KR5 A;  4ONU A;  3SXN A;  4OAE A;  4BBH A;  2PJ8 A;  1P4N A;  4EFD A;  2G9D A;  4I49 A;  3R95 A;  3FYN A;  4QBJ A;  4FUU A;  1BPN A;  2OR4 A;  4QUS A;  2NYQ A;  4C2Z A;  3FMC A;  4UEF A;  4UCP A;  3WR7 A;  4JLY A;  1AYE A;  4WJB A;  1NMT A;  1X10 A;  4A39 A;  1KUY A;  4MFZ A;  2Q4Z A;  4MCP A;  2EVN A;  3FBU A;  4PXD A;  4L8A A;  1IYL A;  4B5P A;  5K8O A;  3BLN A;  4NJR A;  4ONW A;  1Z2L A;  4R3L A;  3B2Y A;  2B58 A;  1R57 A;  1IID A;  2Q7S A;  3RBU A;  1TF8 A;  2B3U A;  4KOU A;  1QSO A;  1CBX A;  5IV0 A;  1BO4 A;  1DTD A;  4FD5 A;  4UEZ A;  3S9N A;  1ELM P;  1HEE A;  1ZG8 A;  2HB6 A;  3PRT A;  1YVK A;  2AFX A;  4UFV A;  4MFK A;  3GLJ A;  4P4I A;  3KHZ A;  4AVA A;  1B6B A;  2ZEO A;  1LAN A;  4A33 A;  4C2Y A;  2BEI A;  1ARL A;  1QSR A;  2VBQ A;  4P4J A;  2Z3N A;  1CPX A;  4P45 A;  3RZA A;  3MRU A;  1I12 A;  3SJE A;  2CXA A;  3R9F A;  4CRY B;  4MXU A;  3FH4 A;  4CGO A;  3CPX A;  2GIV A;  4MFP A;  4W9Y A;  4E2A A;  2EK8 A;  3R9G A;  1Y0R A;  1QSM A;  4OC0 A;  1KUV A;  1RXT A;  3IGR A;  4UIB A;  4A2Z A;  5JGF A;  1Y7E A;  2KCW A;  4Q36 A;  2VXK A;  1PUA A;  1YLO A;  4YWY A;  4Q7A A;  5F47 A;  5AG6 A;  3IO1 A;  4EVY A;  4CYO A;  4OC1 A;  4KOX A;  4UWJ A;  5EC4 A;  2VI7 A;  1F57 A;  3I1U A;  5IX3 A;  2I3C A;  2FCK A;  2JLM A;  2PIZ A;  4P4E A;  2FL4 A;  5EBV A;  1MJ9 A;  4F0X A;  2J8N A;  3KL9 A;  1Y0Y A;  1PCA A;  2PJ0 A;  1UFH A;  2OZG A;  3PB4 X;  4B11 A;  2ZPA A;  2VQY A;  2HC9 A;  3LAC A;  1Z8T A;  2ODF A;  4R87 A;  4MHD A;  3IWG A;  2XEG A;  3PFO A;  5EMI A;  5A27 A;  2B5G A;  4LX9 A;  1M44 A;  4FBE A;  1ZG7 A;  1KZF A;  2RFH A;  1UWY A;  4A94 A;  1CP6 A;  4MHZ A;  3W91 A;  3A9L A;  1XJO A;  1R43 A;  3BI0 A;  3D7G A;  4RS2 A;  3SI0 A;  3GIU A;  3KQZ A;  3VAT A;  3H8G A;  4MJ8 A;  2OZH A;  4KOY A;  4FD7 A;  4HNX B;  2HQY A;  1LCP A;  2I00 A;  2BOA A;  2NMT A;  2REE A;  5H84 A;  4DNC A;  2YNE A;  2AFU A;  2P0W A;  3KGQ A;  3ZZI A;  4YU9 A;  1Y9W A;  1VHE A;  2GLF A;  2POK A;  3D68 A;  4XPL A;  5C82 A;  3D7H A;  3S6F A;  1MK4 A;  4A37 A;  2Z3K A;  2ZEE A;  4X3R A;  3TOA A;  4IUS A;  3TOB A;  2ZW5 A;  4IHM A;  4F9V A;  4OAD A;  4B14 A;  2FVG A;  4TNU A;  1A2Z A;  2PR8 A;  4A38 A;  4P6Y A;  4P44 A;  3DLJ A;  4B5P B;  1XMB A;  3E0K A;  4OKO A;  1IB1 E;  2V8V A;  1NSL A;  1Z4E A;  1JQG A;  2PJ2 A;  4NGN A;  1M4G A;  2X7B A;  1CP7 A;  4MY0 A;  2ZEL A;  3PB8 X;  4M6H A;  1Q2C A;  2WZN A;  2F7V A;  2WUU A;  4HKF A;  4KOR A;  5CNP A;  3C26 A;  2PJ7 A;  2ABZ A;  2HV2 A;  4MHP A;  4M6G A;  2Q43 A;  4NGP A;  2ZEM A;  5THW A;  3I9S A;  5DWN A;  4Z65 A;  4R8F A;  3W6S A;  4KLV A;  2ZEG A;  4P4B A;  1ELL P;  2PJ4 A;  4NSQ A;  2EBJ A;  1CJW A;  4UF4 A;  4ZX8 A;  3G3S A;  3B3C A;  5JPH A;  2PQ8 A;  4R76 A;  5KTA A;  1QQ9 A;  1S7N A;  4QB9 A;  3VWD A;  4KLW A;  3EXN A;  2QJ8 A;  4OC5 A;  5DS0 A;  3RYO A;  4J3G A;  1AUG A;  1YME A;  2BL1 A;  4KOW A;  1IU8 A;  4A32 A;  2PJ6 A;  4C7H A;  3VWE A;  3IU2 A;  4FAI A;  1XMT A;  2Z3O A;  3N5F A;  3FB3 A;  2PJC A;  1PU9 A;  1XRY A;  3IWW A;  4KOV A;  4NEX A;  3GB0 A;  3S6G A;  3KAS A;  2DEA A;  2ZED A;  2O53 A;  3KZW A;  1YR0 A;  3PB9 X;  3TC8 A;  3TO9 A;  3JVN A;  3K9T A;  4G1P A;  3JUW A;  1XBU A;  4ZYQ A;  4Y49 B;  4NGT A;  2ZEN A;  4KVM E;  4JYW A;  1TKF A;  2O28 A;  4A30 A;  1J4J A;  5BWA B;  1H8L A;  2IL4 A;  4C2X A;  3S9L A;  1FY7 A;  3MGD A;  1VKC A;  3B3S A;  5KTC A;  3BJ8 A;  3NFZ A;  4ZBG A;  1CM0 A;  4OLL A;  1RO5 A;  4KVO E;  3V8I A;  4CAV A;  4GM5 A;  4CAW A;  4OME A;  4XNH C;  3ISX A;  2JEW A;  2OOT A;  3B3W A;  3BJ7 A;  3IJ3 A;  2PJB A;  4ZY0 A;  5HXD A;  2B5G B;  4UA3 A;  1TKJ A;  1VHO A;  4KSI A;  4II9 A;  4JZ0 A;  5J8F A;  1JWQ A;  1ZLH A;  4MY3 A;  1Q2Y A;  3TE4 A;  5JH9 A;  4UFW A;  3CPA A;  3H5Z A;  4NGR A;  4KUA A;  2QML A;  1F2O A;  1OBR A;  4PK3 A;  2B4B A;  2ZXV A;  2REF A;  4M6I A;  4U9Y A;  4CYQ A;  2D4O A;  4MCS A;  4AG9 A;  4KUB A;  3NH8 A;  2R98 A;  4RN7 A;  4ZI6 A;  2JEV A;  4XPK A;  3H8E A;  1XF8 A;  2B4D A;  2CTC A;  4NFR A;  4PV6 A;  3CXS A;  4PXC A;  3WAB A;  2FIW A;  1XIX A;  1Z8W A;  4F6A A;  1YW6 A;  2ZOG A;  4HPS A;  5F09 A;  4BIN A;  2Z3P A;  5G1Z A;  5H86 A;  1VGY A;  3W6X A;  2V8D A;  5JQ4 A;  3MN8 A;  3D7F A;  4CGN A;  1VIX A;  1TXR A;  2ZW7 A;  2WSA A;  1YSJ A;  2CY2 A;  2JBK A;  1IY7 A;  3NH4 A;  4LQ6 A;  3D67 A;  2Z11 A;  4L89 A;  2B3V A;  4R3K A;  4NCZ A;  1Z5R A;  1IIC A;  2Z3M A;  4IAV A;  4MFL A;  2FSR A;  1QSN A;  2GLJ A;  2QVP A;  3SJG A;  4DYO A;  3DDD A;  1WWZ A;  3GYA A;  5HMN A;  3FEE A;  3WC7 A;  1M4L A;  4F8Z A;  2PRQ A;  2ZEH A;  3KHX A;  2IJZ A;  4K30 A;  4UEE A;  1TIQ A;  2ZEP A;  2Q7B A;  3R1K A;  4QVT A;  4GS4 A;  3TO7 A;  1TKH A;  2VEZ A;  3EY5 A;  4CGP A;  1LFW A;  4M3S A;  2O4H A;  1YX0 A;  2Q0Y A;  2ZEF A;  2HUZ A;  3LOD A;  1S5K A;  2C27 A;  5G22 A;  3RO0 A;  1EE3 P;  4K3N A;  1KWM A;  4CYN A;  3PZJ A;  4F9U A;  3V7Z A;  1YK3 A;  2V8G A;  2JBJ A;  4RI1 A;  4CAX A;  4XPD C;  3P2H A;  2PJ5 A;  3GKR A;  5F49 A;  2FS5 A;  2FT0 A;  1Y9K A;  4F0Y A;  3CZX A;  3EC4 A;  1S7F A;  3QB8 A;  5CBM A;  4NGQ A;  4B13 A;  2C6C A;  1NSA A;  4QC6 A;  4BMH A;  5K8M A;  4B6Z A;  4UCM A;  4X5K A;  1SQH A;  4PK2 A;  4AB7 A;  3EO4 A;  3PGP A;  5HVF A;  4ZGY B;  4MHY A;  4E8O A;  1I21 A;  4H6Z A;  4AXV A;  5LYI A;  4FD6 A;  1IYK A;  2YNC C;  3F5B A;  1R3N A;  2XEF A;  4KVX A;  5K8N A;  3PEI A;  4UIA A;  1LAP A;  4MI4 A;  4NGM A;  3H4Q A;  2GAN A;  2PVV A;  1U6M A;  1YLE A;  5AG4 A;  3PP9 A;  5C88 A;  1KUX A;  2PE3 A;  4NF1 A;  4YGO A;  1FNO A;  4U9Z A;  2BUE A;  1BPM A;  4JD6 A;  4LUA A;  2WYR A;  4LQG A;  1OZP A;  4JJX A;  2AJ6 A;  3RNZ A;  1HDU A;  2RC4 A;  1WK4 A;  2WPX A;  5CPA A;  1ARM A;  2QEC A;  3EFA A;  2PC1 A;  3N7Z A;  1ZO0 A;  4MRI A;  4MFJ A;  1YW4 A;  3DSB A;  5FVJ A;  4DUK A;  3KKW A;  4CGM A;  3JTK A;  3S6K A;  2Q51 A;  5IB9 A;  4KS9 A;  2P6F A;  4MFQ A;  1YRE A;  3QAY A;  1M1D A;  5HH1 A;  3FED A;  3PFE A;  4FD4 A;  2AFS A;  2F8H A;  1HDQ A;  4NJQ A;  3SJF A;  3JRU A;  5I4M A;  4FWU A;  5ELY A;  4CAF A;  2NSM A;  3PB6 X;  3DGV A;  3V38 A;  3F0A A;  4R7M A;  3TFY A;  5D8N A;  1XOV A;  2CNS A;  2Z10 A;  2B4D B;  4JXR A;  3IFE A;  2PRB A;  2Q44 A;  1AMP A;  3GY9 A;  3IIB A;  4IK2 A;  5D29 A;  4H2K A;  2PJA A;  1K4J A;  3FF3 A;  2GU2 A;  3B7I A;  3DR6 A;  3QAH A;  3BI1 A;  1RTQ A;  2YND A;  3BXM A;  3D8P A;  3FXT A;  3NH5 A;  2ARH A;  4X2T A;  1S60 A;  2IQ6 A;  2GFQ A;  1Z9U A;  3DR8 A;  3HLP A;  2EWB A;  2Q4Y A;  4KOS A;  1XE4 A;  3ZJ0 A;  4CAE A;  1VHS A;  4B12 A;  4CS0 B;  1Q2D A;  5HVG A;  3R96 A;  4R9M A;  3TCV A;  2Y0M A;  4H6U A;  2Q04 A;  2J8M A;  4ZY1 A;  3PBB A;  1S7K A;  3SI1 A;  5AG7 A;  4OID A;  4P10 A;  5LRG A;  2OH1 A;  2AE6 A;  1NE9 A;  2VL1 A;  3VAR A;  3T90 A;  1X12 A;  3DNS A;  4HNW B;  4RUH A;  5LRJ A;  1LOK A;  1I1D A;  2WPW A;  3WT4 A;  2C1C A;  2P6G A;  2PJ3 A;  3FX6 A;  3SHP A;  4UWI A;  1N71 A;  3VH9 A;  5K8P A;  1B87 A;  4OC2 A;  4WWV A;  3R9E A;  1ON0 A;  1QMU A;  3NE8 A;  2VZY A;  4A31 A;  4BD9 A;  4UCN A;  3TT2 A;  1Z8X A;  5A28 A;  2ZOF A;  2DPS A;  5F48 A;  4ORF A;  2AFW A;  2F5I A;  2OU2 A;  1Z8L A;  1YQE A;  2C6G A;  2CF4 A;  2PIY A;  2PJ9 A;  4TWE A;  3CXQ A;  3FIX A;  6CPA A;  1BAV A;  2I79 A;  1BOB A;  1MJA A;  1XFO A;  2DPT A;  3WC6 A;  4KSF A;  3LD2 A;  2JDD A;  2PCU A;  5G20 A;  3TX8 A;  3T9Y A;  5DWM A;  4E0A A;  1TF9 A;  4ZX9 A;  1YGH A;  3IC1 A;  4KZT A;  3L2N A;  1CX8 A;  2G3T A;  2PSW A;  4P4D A;  1LRZ A;  1F2P A;  4PXB A;  1QST A;  1ZLI A;  3I3G A;  3FRM A;  2OB0 A;  2FXF A;  5ISV A;  1GHE A;  1IOI A;  3SI2 A;  4OIW A;  2BO9 A;  2EK9 A;  4KOT A;  4YFJ A;  2YNC A;  2EO8 A;  1CPS A;  4U5Y A;  4C68 A;  1Y7R A;  4AVB A;  2QYV A;  2Z0Z A;  5I0C A;  3D3S A;  4GXH A;  3OWC A;  4Q38 A;  3FJU A;  4IF5 A;  4ZY2 A;  2QIR A;  1XEB A;  2CIJ A;  2EUI A;  3QNV A;  3D2M A;  3RAM A;  4OC3 A;  3B3V A;  4B5O A;  4DJL A;  4XNH B;  4AG7 A;  2FE7 A;  5LYD A;  8CPA A;  4B10 A;  4CGL A;  2BCO A;  2V77 A;  3LMS A;  5LYF A;  3CT9 A;  1FT7 A;  4MBU A;  5J8C A;  1ZG9 A;  3LWU A;  5KTD A;  4PSX A;  3D7D A;  3H8F A;  1L0C A;  4PPZ A;  2J8R A;  3B8G A;  2GRE A;  3ISZ A;  1CG2 A; 
#chains in the Genus database with same CATH homology
 2P6E A;  1S7L A;  3P2F A;  4KSA A;  3G8W A;  3SXO A;  4CYP A;  2DXQ A;  1M4I A;  2Z3L A;  4NXY A;  3CXP A;  1S3Z A;  2PR1 A;  4UBR A;  3S6H A;  5IB0 A;  2JDC A;  2G3A A;  2ATR A;  3K9U A;  3FNC A;  2VZZ A;  5E96 A;  2CNT A;  2ZW6 A;  4UFX A;  1MJB A;  1P0H A;  2GE3 A;  2G0B A;  4Y49 C;  4A95 A;  1YVO A;  2R1I A;  2A4N A;  4M85 A;  4CRZ B;  3NE7 A;  2BSW A;  2R8V A;  5GCN A;  3D2P A;  2ZW4 A;  2CNM A;  2K5T A;  3TTH A;  3F8K A;  2OZU A;  4JXQ A;  5AGE A;  5G21 A;  3TO6 A;  2R7H A;  4C7I A;  4PSW A;  2Q4V A;  4HNY B;  4XPD B;  4AVC A;  4JWP A;  2YGW A;  3IWE A;  1Z4R A;  4H89 A;  1V0C A;  2D4P A;  1M4D A;  2FIA A;  2PDO A;  5AG5 A;  2H5M A;  4YRH A;  3IU1 A;  4R57 A;  5F46 A;  4ONU A;  3SXN A;  4OAE A;  4BBH A;  1P4N A;  4I49 A;  3R95 A;  4QBJ A;  3FYN A;  4QUS A;  4C2Z A;  4UCP A;  3WR7 A;  4JLY A;  1NMT A;  1KUY A;  4MFZ A;  2EVN A;  3FBU A;  4L8A A;  1IYL A;  4B5P A;  3BLN A;  4R3L A;  2B58 A;  1R57 A;  1IID A;  2B3U A;  4KOU A;  1QSO A;  5IV0 A;  1BO4 A;  4FD5 A;  1YVK A;  4UFV A;  4MFK A;  4AVA A;  1B6B A;  4A33 A;  4C2Y A;  2BEI A;  1QSR A;  2VBQ A;  2Z3N A;  1I12 A;  2CXA A;  3R9F A;  4CRY B;  4CGO A;  2GIV A;  4MFP A;  4E2A A;  3R9G A;  1QSM A;  1KUV A;  1RXT A;  3IGR A;  4A2Z A;  2KCW A;  4Q36 A;  2VXK A;  1PUA A;  5F47 A;  5AG6 A;  4EVY A;  4CYO A;  4UWJ A;  4KOX A;  5EC4 A;  5IX3 A;  2VI7 A;  2FCK A;  2JLM A;  2FL4 A;  5EBV A;  1MJ9 A;  4F0X A;  2J8N A;  1UFH A;  2OZG A;  4B11 A;  2ZPA A;  2VQY A;  4R87 A;  4MHD A;  3IWG A;  5A27 A;  2B5G A;  4LX9 A;  1M44 A;  1KZF A;  3W91 A;  3A9L A;  4RS2 A;  4MJ8 A;  2OZH A;  4KOY A;  4FD7 A;  4HNX B;  2HQY A;  2I00 A;  2NMT A;  4DNC A;  2REE A;  5H84 A;  2YNE A;  2P0W A;  3ZZI A;  1Y9W A;  4XPL A;  5C82 A;  3S6F A;  1MK4 A;  2Z3K A;  3TOA A;  4IUS A;  3TOB A;  2ZW5 A;  4OAD A;  4B14 A;  2PR8 A;  4B5P B;  3E0K A;  1NSL A;  1IB1 E;  1Z4E A;  1M4G A;  2X7B A;  4MY0 A;  1Q2C A;  2WUU A;  4HKF A;  4KOR A;  5CNP A;  3C26 A;  2HV2 A;  3I9S A;  5DWN A;  3W6S A;  4KLV A;  4NSQ A;  1CJW A;  3G3S A;  5JPH A;  2PQ8 A;  5KTA A;  1S7N A;  4QB9 A;  3VWD A;  4KLW A;  3EXN A;  3RYO A;  4J3G A;  2BL1 A;  4KOW A;  4A32 A;  4C7H A;  3VWE A;  3IU2 A;  1XMT A;  2Z3O A;  3FB3 A;  1PU9 A;  4KOV A;  4NEX A;  3S6G A;  1YR0 A;  3TO9 A;  3JVN A;  3JUW A;  4Y49 B;  4KVM E;  2O28 A;  4A30 A;  1J4J A;  5BWA B;  2IL4 A;  4C2X A;  1FY7 A;  3MGD A;  1VKC A;  5KTC A;  3BJ8 A;  4ZBG A;  1CM0 A;  4OLL A;  1RO5 A;  4KVO E;  3V8I A;  4CAV A;  4CAW A;  4XNH C;  3BJ7 A;  2B5G B;  4UA3 A;  4II9 A;  5J8F A;  4MY3 A;  1Q2Y A;  3TE4 A;  4UFW A;  3H5Z A;  4KUA A;  2QML A;  4PK3 A;  2B4B A;  2ZXV A;  2REF A;  4U9Y A;  4CYQ A;  2D4O A;  4AG9 A;  4KUB A;  2R98 A;  2JEV A;  4XPK A;  1XF8 A;  2B4D A;  4PV6 A;  3CXS A;  2FIW A;  1XIX A;  4F6A A;  2Z3P A;  5G1Z A;  5H86 A;  3W6X A;  5JQ4 A;  4CGN A;  2ZW7 A;  2WSA A;  2CY2 A;  2Z11 A;  4L89 A;  2B3V A;  4R3K A;  4NCZ A;  1IIC A;  2Z3M A;  4MFL A;  2FSR A;  1QSN A;  3DDD A;  1WWZ A;  3GYA A;  5HMN A;  4K30 A;  1TIQ A;  2Q7B A;  3R1K A;  4QVT A;  4GS4 A;  3TO7 A;  2VEZ A;  3EY5 A;  4CGP A;  4M3S A;  2Q0Y A;  1YX0 A;  3LOD A;  2HUZ A;  5G22 A;  1S5K A;  2C27 A;  4CYN A;  3PZJ A;  1YK3 A;  4CAX A;  4RI1 A;  4XPD C;  3P2H A;  3GKR A;  5F49 A;  2FS5 A;  2FT0 A;  1Y9K A;  4F0Y A;  3EC4 A;  1S7F A;  3QB8 A;  4B13 A;  4QC6 A;  4BMH A;  4UCM A;  4X5K A;  1SQH A;  4PK2 A;  4AB7 A;  3EO4 A;  3PGP A;  4ZGY B;  4E8O A;  1I21 A;  4H6Z A;  4FD6 A;  1IYK A;  2YNC C;  3F5B A;  4KVX A;  4MI4 A;  3H4Q A;  2GAN A;  1U6M A;  1YLE A;  5AG4 A;  3PP9 A;  5C88 A;  1KUX A;  4YGO A;  4NF1 A;  4U9Z A;  2BUE A;  4JD6 A;  4LUA A;  1OZP A;  4JJX A;  2AJ6 A;  2RC4 A;  1WK4 A;  2WPX A;  3EFA A;  2QEC A;  3N7Z A;  2PC1 A;  1ZO0 A;  4MFJ A;  3DSB A;  5FVJ A;  3KKW A;  4CGM A;  3JTK A;  3S6K A;  4KS9 A;  2P6F A;  4MFQ A;  1YRE A;  1M1D A;  5HH1 A;  4FD4 A;  4CAF A;  3TFY A;  3F0A A;  2CNS A;  2Z10 A;  2B4D B;  4JXR A;  2PRB A;  2Q44 A;  3GY9 A;  1K4J A;  3DR6 A;  3QAH A;  2YND A;  3FXT A;  3D8P A;  3UY5 A;  2ARH A;  1S60 A;  4KOS A;  1Z9U A;  3DR8 A;  3ZJ0 A;  2Q4Y A;  4CAE A;  1XE4 A;  1VHS A;  4B12 A;  4CS0 B;  1Q2D A;  3R96 A;  4R9M A;  3TCV A;  2Y0M A;  4H6U A;  2Q04 A;  2J8M A;  1S7K A;  5AG7 A;  2OH1 A;  2AE6 A;  1NE9 A;  3T90 A;  3DNS A;  4HNW B;  1I1D A;  2WPW A;  2P6G A;  3SHP A;  4UWI A;  1N71 A;  1B87 A;  3R9E A;  1ON0 A;  2VZY A;  4A31 A;  4UCN A;  3TT2 A;  5A28 A;  2DPS A;  5F48 A;  4ORF A;  2OU2 A;  2F5I A;  3CXQ A;  3FIX A;  2I79 A;  1BOB A;  1MJA A;  2DPT A;  4KSF A;  3LD2 A;  2JDD A;  5G20 A;  4E0A A;  3T9Y A;  5DWM A;  1YGH A;  4KZT A;  2G3T A;  2PSW A;  1LRZ A;  1QST A;  3I3G A;  3FRM A;  2OB0 A;  2FXF A;  5ISV A;  1GHE A;  4KOT A;  4YFJ A;  2YNC A;  4U5Y A;  4C68 A;  1Y7R A;  4AVB A;  2Z0Z A;  5I0C A;  3D3S A;  3OWC A;  4Q38 A;  4IF5 A;  2QIR A;  1XEB A;  2EUI A;  3D2M A;  4B5O A;  4XNH B;  4AG7 A;  2FE7 A;  4B10 A;  4CGL A;  4MBU A;  5J8C A;  5KTD A;  4PSX A;  1L0C A;  2J8R A;  3B8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...