4A33A

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a pyrazole sulphonamide ligand
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of a novel class of orally active trypanocidal N-myristoyltransferase inhibitors.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 117
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4a33A00
5G1ZA 4B11A 2YNCC 4BBHA 4C2YA 4UCMA 4C7IA 4B14A 4CGPA 4UFXA 4CAFA 5A27A 5AGEA 5AG4A 3IU2A 4CGNA 4B12A 4C68A 5G22A 4A30A 2YNEA 2YNCA 4UCNA 4A95A 4C2XA 4A31A 4CGOA 2WUUA 5AG5A 4UFWA 5AG7A 5G21A 2WSAA 5AG6A 4CAEA 4CGLA 3IU1A 4A32A 4UCPA 4B13A 5A28A 4A2ZA 4CYQA 4CYPA 2YNDA 3H5ZA 4C2ZA 4UFVA 4C7HA 5G20A 4CGMA 4CYOA 4CYNA 4A33A 3JTKA 4B10A 3IWEA
chains in the Genus database with same CATH superfamily
4HNYB 2GANA 3H8FA 2ZENA 1YQEA 1X12A 5BWAB 2WPWA 4P6YA 3SI2A 5LYIA 5LRGA 2Y0MA 4YRHA 1YVOA 2CNTA 3KR4A 2BOAA 3ZJ0A 4AXVA 5A27A 2O53A 3S9LA 2ZEFA 1S7LA 2NSMA 3W6XA 3DGVA 4R57A 4B5PB 3D67A 3S6HA 3DDDA 1TKJA 2B58A 4I49A 1M4GA 4U9YA 3QB8A 4A95A 4X2TA 3GYAA 1CJWA 2BEIA 3D2MA 1S3ZA 3BI1A 4UFWA 1YLOA 1I1DA 4EMEA 2Q7SA 2FS5A 4UCPA 2XEFA 1AYEA 1XOVA 4A2ZA 5J8FA 3SHPA 1YK3A 1Z9UA 4UFVA 3FYNA 3RZAA 1Y7RA 1IYKA 1S7FA 2ZEPA 2PIYA 3B8GA 1ELLP 4KOWA 3BLNA 1BPMA 1Z5RA 2B3UA 8CPAA 4OAEA 1QSNA 1V0CA 4IHMA 4HNXB 4MFJA 4OLLA 1M44A 4MFQA 2OZHA 2V8DA 3QAHA 2JBJA 4PPZA 5GCNA 1YREA 4Z65A 3S6KA 4OC1A 1S7KA 1ON0A 3PFOA 4KOSA 4KOTA 3K9TA 1ARLA 1QSTA 3B3CA 3BHXA 4OKOA 1PCAA 4QB9A 2OZUA 4C2ZA 2VZYA 1Q2YA 2Q4YA 3CPAA 3JVNA 4MY3A 2CNSA 3LD2A 4MHNA 3TO9A 5CBMA 1FY7A 4MI4A 3PB6X 4JD6A 2PIZA 2Q4VA 2Q43A 2ZW4A 4RS2A 4UWIA 3MGDA 4UCMA 3TCVA 4B14A 1CX8A 2XEJA 4KORA 4JJXA 2CNMA 3IIBA 5AG4A 2Z11A 2OH1A 2QYVA 5HVGA 2Z3MA 1Z2LA 3UY5A 4PK3A 3LODA 4CAWA 4OC4A 4A39A 1Z4RA 3TFYA 2ZOFA 5FVJA 4H6ZA 2JDCA 1XMBA 1IGBA 2PJ8A 3KASA 2HQYA 3D7GA 4PXEA 2K5TA 4KOUA 5G20A 4FBEA 1EE3P 1F57A 3PB9X 2PQ8A 3SXOA 2GE3A 2VI7A 4AVAA 2ARHA 2F8HA 2Z3LA 5EC4A 2REFA 5IX3A 1Y0YA 4MJ8A 1Y0RA 2HUZA 3KHXA 4TNUA 3KHZA 3WR7A 5D8NA 3B3WA 4UFXA 4ZYQA 2ZELA 3GKRA 4PXBA 5LRKA 3FECA 2V8VA 3IGRA 1I12A 4KSFA 4MMOA 5LYDA 2B4BA 4KVXA 4Y49C 1K4JA 1QQ9A 1IOIA 4KSAA 4NGSA 1LCPA 4MHYA 5CNPA 3P2HA 1Y9KA 1XBUA 4LX9A 5AG7A 1ZG8A 2PJBA 4P4BA 2Q44A 1YMEA 5J1QA 1U6MA 2HB6A 1LFWA 4F9UA 5JH9A 2PR1A 4IAVA 4GXHA 2Z3OA 1MJ9A 2R1IA 1XJOA 1JQGA 4IUSA 3BXMA 5F48A 2G3AA 5G1ZA 4E0AA 2YGWA 1JWQA 4P4IA 2ZEOA 5IB9A 5H84A 2ZEHA 4QUSA 5IB0A 1Z4EA 3S9NA 3LACA 4M85A 1P0HA 4OC2A 3RYOA 4DJLA 4U9ZA 3HLPA 3NE7A 4KUAA 1VGYA 2AFXA 4KOVA 3SJEA 3PBEA 1CPXA 4EFDA 3R9GA 4M3SA 2DXQA 3V8IA 4E8OA 1ZLHA 2V8HA 1PUAA 2EWBA 3R9EA 4X8IA 5ISVA 4OC5A 2AFZA 2FIWA 2YNDA 4JXQA 2IMOA 4O23A 3SI1A 1TXRA 2VL1A 3TC8A 3VH9A 3W91A 4B10A 4MCSA 4NXYA 4HPSA 2DPSA 4Q38A 3D4UA 2CIJA 4NGTA 1CP7A 2AFUA 3B2YA 1YR0A 4MFPA 4P44A 4QC6A 1ZG7A 3TOBA 1YGHA 2CY2A 2O28A 1RTQA 3KQXA 2AFSA 4FUUA 4YGOA 3S9MA 5K8OA 1Y7EA 2G3TA 2WYRA 4LQGA 1YLEA 4KLVA 4A37A 1IOFA 1VIXA 4CPAA 2PRBA 3FF3A 1IB1E 1MK4A 3D8PA 4NCZA 3TO7A 1QSRA 4MFKA 1KZFA 1Q2CA 2HC9A 1R43A 2P6FA 2JEVA 3I1UA 2CTCA 4XNHC 5AG6A 4AVBA 2PJ2A 3PFEA 1HDUA 1I21A 2F7VA 2NYQA 3LMSA 2D4PA 3T9YA 1OBRA 1NSAA 1LANA 1MJBA 4UEFA 4CGMA 1M4LA 1Y9WA 2FIAA 3F5BA 2V8GA 4UIBA 4UIAA 2OOTA 4DNCA 3NH5A 4XPKA 4P4JA 3DSBA 5JGFA 5JM6A 3D7HA 5KTAA 1L0CA 2P6GA 2PJ1A 3PGPA 2QMLA 2Q51A 4NFRA 5DWNA 2C6GA 2ZW7A 3S6GA 3I3GA 2RB7A 3FXTA 3JUWA 4UA3A 3QAYA 4JZ0A 5C88A 5LRJA 4IF5A 3SJXA 4FD5A 4B5PA 2ZXVA 1KUYA 5LYLA 2OB0A 1VHEA 3I9SA 3V38A 4CGOA 2WUUA 2GLJA 5AG5A 4P4FA 3VWDA 1BO4A 4A32A 5F09A 4JYWA 2EBJA 1B87A 2DF5A 4CYOA 2AJ6A 3DNSA 3CXPA 4M6HA 2QECA 3KZWA 1RXTA 3D7FA 2ZOGA 5HVFA 3FIXA 1KUXA 3FBUA 3TO6A 2Z3KA 4U5YA 4AG7A 3ZZIA 4MHPA 2EUIA 2Q4ZA 2R98A 3KQZA 4MFZA 2PVWA 4H2KA 4NGRA 1YW6A 4NF1A 4P4EA 5G22A 1FNOA 4C68A 1YSJA 1F2OA 1IICA 2IQ6A 4ZY1A 2B5GA 3TT2A 3D3SA 2BSWA 2QIRA 3FX6A 4UCNA 1VKCA 3CT9A 3B3SA 1XIXA 1R57A 2GLFA 4IK2A 2Q0YA 2J8MA 4BD9A 2DPTA 2PJ6A 1R3NA 3NFZA 3IU1A 3FVLA 4CS0B 2Z0ZA 1QSMA 1TF8A 4OMEA 5K8PA 1GHEA 4MCPA 4OIDA 4XPDC 4YWYA 2PCUA 2VEZA 2IJZA 2O4HA 4ZX9A 7CPAA 2G9DA 4KOYA 5D29A 4FWUA 5JQ4A 5ELYA 2XEGA 4UEZA 1ZO0A 2EO8A 2PJ9A 3B35A 4PV6A 3QNVA 3VARA 4UBRA 4YU9A 5F47A 4P10A 2REEA 1IY7A 1XF8A 4CRZB 3B7IA 2RFHA 3PB8X 3OWCA 1QSOA 4EWTA 2G0BA 4P45A 1UWYA 3CDXA 3D68A 4NSQA 3PRTA 4KS9A 3RO0A 5G21A 3SXNA 1CM0A 4CAXA 4MRIA 2OZGA 4GM5A 4M6IA 1LAMA 3F0AA 1LOKA 1NSLA 4R3KA 4B13A 2I79A 4A94A 4MBUA 2BL1A 3NE8A 3B3VA 3KR5A 2GU2A 4H6UA 4C2YA 1MJAA 4OIWA 4K30A 2HV2A 2B3VA 2PJ0A 1LAPA 4G1PA 1B6BA 3F8KA 4NJRA 1TIQA 2VXKA 5HVHA 2FSRA 2ODFA 3EXNA 3KKWA 3KGQA 1F2PA 2PR8A 3H4QA 1XEBA 4MHZA 2YNCA 3RBUA 2QJ8A 1Q7LA 1Z8LA 2PJ7A 2ZEGA 4FD6A 2EK8A 3A9LA 2I00A 2C6PA 4JWPA 1IU8A 5EMIA 4CYQA 4ZI6A 4UWJA 2B4DA 3EO4A 1XFOA 4CYNA 3VWEA 2IL4A 4B11A 1IIDA 2BUEA 2YNCC 2ATRA 3JRUA 1S60A 3IWWA 1HDQA 3GB0A 2FT0A 1YW4A 4CAFA 2CXAA 5AGEA 1SQHA 2PSWA 2DEAA 4CGNA 2XEIA 4XNHB 1BAVA 2PJ5A 3G3SA 3G8WA 2PDOA 4R8FA 2ZPAA 3DLJA 3PP9A 2PJAA 3WABA 4R3LA 4H89A 4PSXA 2I3CA 1FT7A 1KUVA 5A28A 3BJ7A 1ZLIA 5HMNA 1KWMA 4A33A 3JTKA 1Z8TA 3PB7X 2J8RA 4F9VA 4DUKA 1CBXA 3CPXA 3T8WA 2PJ4A 3FMCA 1YX0A 3T90A 4HNWB 5EBVA 3FRMA 3VATA 4OP4A 2RC4A 1NE9A 5F49A 3GLJA 4BMHA 1XMTA 4LUAA 3EC4A 2FE7A 2VZZA 3FEDA 3GUXA 4KUBA 3R96A 4RN7A 5IV0A 4A30A 4ZGYB 3IC1A 4ONWA 3H8GA 5I4MA 4Y49B 4X3RA 4C2XA 1WK4A 2P6EA 3D7DA 4P4DA 4Q36A 5JPHA 4RUHA 2CTBA 5HXDA 4CGLA 4X5KA 1YVKA 3TE4A 2V77A 1CP6A 3IO1A 1XE4A 2JLMA 2C1CA 3H5ZA 4PQAA 3SI0A 2EK9A 4PSWA 4QBJA 1ARMA 2ABZA 3BJ8A 4JLYA 5CPAA 1LRZA 5E96A 3SJFA 4R76A 4F6AA 2FXFA 4BBHA 4RI1A 1N71A 2H5MA 3W6SA 1P4NA 2F5IA 4PXCA 3PBBA 3CZXA 3WC7A 2QVPA 4F0YA 4QVTA 4EVYA 4ZY0A 3FJUA 4AVCA 4F0XA 1Z8XA 4XPLA 5F46A 3KI9A 2ZEDA 2JBKA 1OZPA 1TKHA 1BLLE 1XRYA 3CXSA 2J9AA 2JDDA 4JXRA 2PJCA 4L89A 4M6GA 3R9FA 3K9UA 1Q2DA 3V7ZA 2PE3A 4UF4A 3RAMA 4R87A 4YFJA 2FCKA 4PXDA 2P0WA 4CAEA 4DYOA 4F8ZA 1M4DA 2WPXA 4CRYB 5K8MA 1Z8WA 4TWEA 3L2NA 3MRUA 4CYPA 2Q7BA 4R7MA 2NMTA 3PEIA 4NGPA 2AFWA 4WJBA 2WZNA 4E2AA 2Z3NA 2Z10A 4II9A 1GYTA 2BCOA 2D4OA 2VQYA 2ZW5A 2PC1A 2BO9A 2CF4A 4CGPA 2J8NA 1H8LA 3WC5A 4WWVA 1M1DA 3N7ZA 4PK2A 2ZW6A 2FVGA 4R9MA 1BOBA 4MXUA 1QMUA 3NH8A 2YNEA 3IJ3A 4FD4A 4ONUA 4KZTA 1S5KA 2B5GB 4OC3A 4MHDA 5KTDA 4J3GA 3E0KA 4A38A 2ANPA 1ZG9A 4OADA 4MFLA 2AFOA 4NGMA 1J4JA 4C7HA 3EY5A 2Q04A 3FEEA 2A4NA 4K3NA 4ZX8A 3IWGA 1X10A 2OR4A 3EFAA 3IWEA 5HH1A 3TTHA 2C27A 3PB4X 5C82A 1IYLA 4KLWA 3NA6A 3D2PA 4LQ6A 1S7NA 4C7IA 3LWUA 3R1KA 2VBQA 3C26A 3CXQA 2GFQA 4ORFA 3ISZA 3IU2A 3NH4A 5H86A 3R95A 4B12A 4FAIA 4NEXA 2OU2A 4BINA 4FD7A 3WC6A 4B6ZA 2B4DB 4R6TA 3TOAA 2JEWA 4NGNA 4ZY2A 3HUVA 1CG2A 4A31A 3N5FA 1VHOA 3KL9A 2Z3PA 3P2FA 3SJGA 6CPAA 4ZBGA 4NGQA 3IEHA 3IFEA 3K2KA 1WWZA 5DWMA 4B5OA 3B3TA 3S6FA 4AB7A 5DS0A 3FH4A 3MN8A 5LYFA 1ELMP 2EVNA 3GY9A 2R8VA 1AUGA 3FB3A 4KOXA 4UEEA 1TKFA 1DTDA 2PRQA 4GS4A 1CPSA 4AG9A 2X7BA 2PJ3A 2AFMA 3TX8A 4CAVA 1RO5A 2GREA 3FNCA 4MY0A 2AE6A 3ISXA 2GIVA 2ZEEA 1AMPA 3WT4A 3BI0A 1BPNA 1HEEA 2KCWA 2FL4A 4KVOE 1TF9A 5K8NA 5KTCA 1NMTA 4L8AA 3GIUA 1PYTB 4MCQA 5THWA 1A2ZA 4Q7AA 3D66A 1UFHA 4MCRA 3DR6A 4NJQA 2ZEMA 3DR8A 4OC0A 5J8CA 4KVME 4HKFA 2C6CA 4W9YA 4KSIA 1M4IA 2WSAA 3RNZA 1DE4C 3H8EA 2R7HA 3PZJA 2POKA 2PVVA 4XPDB 1PU9A 1VHSA 5I0CA
chains in the Genus database with same CATH topology
4HNYB 2GANA 5BWAB 2WPWA 2Y0MA 4YRHA 1YVOA 2CNTA 3ZJ0A 5A27A 3W6XA 1S7LA 4R57A 4B5PB 3S6HA 3DDDA 2B58A 4I49A 1M4GA 4U9YA 3QB8A 4A95A 3GYAA 1CJWA 2BEIA 3D2MA 1S3ZA 4UFWA 1I1DA 2FS5A 4UCPA 5J8FA 4A2ZA 3SHPA 1YK3A 1Z9UA 4UFVA 3FYNA 1Y7RA 1IYKA 1S7FA 3B8GA 4KOWA 3BLNA 2B3UA 4OAEA 1QSNA 1V0CA 4OLLA 4HNXB 4MFJA 1M44A 4MFQA 2OZHA 3QAHA 5GCNA 1YREA 3S6KA 1S7KA 1ON0A 4KOSA 4KOTA 1QSTA 4QB9A 2OZUA 4C2ZA 2VZYA 3JVNA 1Q2YA 2Q4YA 4MY3A 3TO9A 3LD2A 2CNSA 1FY7A 4MI4A 4JD6A 2Q4VA 2ZW4A 4RS2A 4UWIA 3MGDA 4UCMA 3TCVA 4B14A 4KORA 4JJXA 2CNMA 5AG4A 2OH1A 2Z3MA 3UY5A 4PK3A 3LODA 4CAWA 1Z4RA 3TFYA 5FVJA 4H6ZA 2JDCA 2HQYA 2K5TA 4KOUA 5G20A 2PQ8A 3SXOA 2GE3A 2VI7A 4AVAA 2ARHA 2Z3LA 5EC4A 2REFA 5IX3A 4MJ8A 2HUZA 3WR7A 4UFXA 3GKRA 3IGRA 4KSFA 1I12A 2B4BA 4KVXA 4Y49C 1K4JA 4KSAA 5CNPA 3P2HA 1Y9KA 4LX9A 5AG7A 2Q44A 1U6MA 2PR1A 2Z3OA 1MJ9A 2R1IA 4IUSA 5F48A 2G3AA 5G1ZA 4E0AA 2YGWA 5H84A 4QUSA 5IB0A 1Z4EA 4M85A 1P0HA 3RYOA 4U9ZA 3NE7A 4KUAA 4KOVA 3R9GA 4M3SA 2DXQA 3V8IA 4E8OA 1PUAA 3R9EA 5ISVA 2YNDA 2FIWA 4JXQA 3W91A 4B10A 4Q38A 4NXYA 2DPSA 4MFPA 1YR0A 4QC6A 3TOBA 1YGHA 2CY2A 2O28A 4YGOA 2G3TA 1YLEA 4KLVA 2PRBA 1IB1E 1MK4A 3D8PA 4NCZA 3TO7A 1QSRA 4MFKA 1KZFA 1Q2CA 2P6FA 2JEVA 4XNHC 4AVBA 5AG6A 1I21A 3T9YA 2D4PA 1MJBA 4CGMA 1Y9WA 3F5BA 2FIAA 4DNCA 4XPKA 3DSBA 5KTAA 1L0CA 2P6GA 3PGPA 2QMLA 5DWNA 3S6GA 2ZW7A 3I3GA 3FXTA 3JUWA 4UA3A 5C88A 4IF5A 4B5PA 4FD5A 2ZXVA 1KUYA 2OB0A 3I9SA 4CGOA 2WUUA 5AG5A 3VWDA 1BO4A 4A32A 1B87A 4CYOA 2AJ6A 3DNSA 3CXPA 2QECA 1RXTA 3FIXA 1KUXA 3FBUA 3TO6A 2Z3KA 4U5YA 4AG7A 3ZZIA 2EUIA 2R98A 4MFZA 4NF1A 4C68A 5G22A 1IICA 2B5GA 3TT2A 3D3SA 2BSWA 2QIRA 4UCNA 1VKCA 1XIXA 1R57A 2Q0YA 2J8MA 2DPTA 3IU1A 4CS0B 2Z0ZA 1QSMA 1GHEA 4XPDC 2VEZA 4KOYA 5JQ4A 1ZO0A 4PV6A 4UBRA 5F47A 2REEA 1XF8A 4CRZB 3OWCA 1QSOA 2G0BA 4NSQA 4KS9A 5G21A 3SXNA 1CM0A 4CAXA 2OZGA 4B13A 3F0AA 1NSLA 1PU9A 4R3KA 2I79A 4MBUA 2BL1A 4H6UA 4C2YA 1MJAA 4K30A 2HV2A 2B3VA 1B6BA 3F8KA 1TIQA 2VXKA 2FSRA 3EXNA 3KKWA 2PR8A 3H4QA 1XEBA 2YNCA 4FD6A 3A9LA 2I00A 4JWPA 4CYQA 4UWJA 2B4DA 3EO4A 4CYNA 3VWEA 2IL4A 4B11A 1IIDA 2BUEA 2YNCC 2ATRA 1S60A 2FT0A 4CAFA 2CXAA 5AGEA 1SQHA 2PSWA 4CGNA 4XNHB 3G8WA 3G3SA 2PDOA 2ZPAA 3PP9A 4R3LA 4H89A 4PSXA 1KUVA 5A28A 3BJ7A 5HMNA 4A33A 3JTKA 2J8RA 1YX0A 3T90A 4HNWB 5EBVA 3FRMA 2RC4A 1NE9A 5F49A 4BMHA 1XMTA 4LUAA 3EC4A 2FE7A 2VZZA 4KUBA 3R96A 5IV0A 4A30A 4ZGYB 4Y49B 4C2XA 1WK4A 2P6EA 4Q36A 5JPHA 4CGLA 4X5KA 1YVKA 3TE4A 1XE4A 2JLMA 3H5ZA 4PSWA 4QBJA 3BJ8A 4JLYA 5E96A 1LRZA 4F6AA 2FXFA 4BBHA 4RI1A 1N71A 2H5MA 3W6SA 1P4NA 2F5IA 4F0YA 4QVTA 4EVYA 4AVCA 4F0XA 4XPLA 5F46A 1OZPA 3CXSA 4JXRA 4L89A 2JDDA 3R9FA 3K9UA 1Q2DA 4R87A 4YFJA 2FCKA 4CAEA 2P0WA 1M4DA 2WPXA 4CRYB 4CYPA 2Q7BA 2NMTA 4E2AA 2Z3NA 2Z10A 4II9A 2D4OA 2VQYA 2ZW5A 2PC1A 4CGPA 2J8NA 1M1DA 3N7ZA 4PK2A 2ZW6A 4R9MA 1BOBA 4FD4A 2YNEA 4ONUA 4KZTA 1S5KA 2B5GB 4MHDA 5KTDA 4J3GA 3E0KA 4OADA 4MFLA 1J4JA 4C7HA 3EY5A 2Q04A 2A4NA 3TTHA 3IWGA 3EFAA 3IWEA 5HH1A 2C27A 5C82A 1IYLA 4KLWA 3D2PA 4C7IA 1S7NA 3R1KA 2VBQA 3C26A 3CXQA 4ORFA 3IU2A 5H86A 3R95A 4B12A 4NEXA 2OU2A 4FD7A 2B4DB 3TOAA 4A31A 3P2FA 2Z3PA 4ZBGA 1WWZA 5DWMA 4B5OA 3S6FA 4AB7A 3GY9A 2EVNA 2R8VA 3FB3A 4KOXA 4GS4A 4AG9A 2X7BA 4CAVA 1RO5A 3FNCA 4MY0A 2AE6A 2GIVA 2KCWA 2FL4A 4KVOE 5KTCA 1NMTA 4L8AA 1UFHA 3DR6A 3DR8A 5J8CA 4KVME 4HKFA 1M4IA 2WSAA 2R7HA 3PZJA 4XPDB 2Z11A 1VHSA 5I0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G1Z A;  4B11 A;  2YNC C;  4BBH A;  4C2Y A;  4UCM A;  4C7I A;  4B14 A;  4CGP A;  4UFX A;  4CAF A;  5A27 A;  5AGE A;  5AG4 A;  3IU2 A;  4CGN A;  4B12 A;  4C68 A;  5G22 A;  4A30 A;  2YNE A;  2YNC A;  4UCN A;  4A95 A;  4C2X A;  4A31 A;  4CGO A;  2WUU A;  5AG5 A;  4UFW A;  5AG7 A;  5G21 A;  2WSA A;  5AG6 A;  4CAE A;  4CGL A;  3IU1 A;  4A32 A;  4UCP A;  4B13 A;  5A28 A;  4A2Z A;  4CYQ A;  4CYP A;  2YND A;  3H5Z A;  4C2Z A;  4UFV A;  4C7H A;  5G20 A;  4CGM A;  4CYO A;  4CYN A;  4A33 A;  3JTK A;  4B10 A;  3IWE A; 
#chains in the Genus database with same CATH topology
 4HNY B;  2GAN A;  3H8F A;  2ZEN A;  1YQE A;  1X12 A;  5BWA B;  2WPW A;  4P6Y A;  3SI2 A;  5LYI A;  5LRG A;  2Y0M A;  4YRH A;  1YVO A;  2CNT A;  3KR4 A;  2BOA A;  3ZJ0 A;  4AXV A;  5A27 A;  2O53 A;  3S9L A;  2ZEF A;  1S7L A;  2NSM A;  3W6X A;  3DGV A;  4R57 A;  4B5P B;  3D67 A;  3S6H A;  3DDD A;  1TKJ A;  2B58 A;  4I49 A;  1M4G A;  4U9Y A;  3QB8 A;  4A95 A;  4X2T A;  3GYA A;  1CJW A;  2BEI A;  3D2M A;  1S3Z A;  3BI1 A;  4UFW A;  1YLO A;  1I1D A;  4EME A;  2Q7S A;  2FS5 A;  4UCP A;  2XEF A;  1AYE A;  1XOV A;  4A2Z A;  5J8F A;  3SHP A;  1YK3 A;  1Z9U A;  4UFV A;  3FYN A;  3RZA A;  1Y7R A;  1IYK A;  1S7F A;  2ZEP A;  2PIY A;  3B8G A;  1ELL P;  4KOW A;  3BLN A;  1BPM A;  1Z5R A;  2B3U A;  8CPA A;  4OAE A;  1QSN A;  1V0C A;  4IHM A;  4HNX B;  4MFJ A;  4OLL A;  1M44 A;  4MFQ A;  2OZH A;  2V8D A;  3QAH A;  2JBJ A;  4PPZ A;  5GCN A;  1YRE A;  4Z65 A;  3S6K A;  4OC1 A;  1S7K A;  1ON0 A;  3PFO A;  4KOS A;  4KOT A;  3K9T A;  1ARL A;  1QST A;  3B3C A;  3BHX A;  4OKO A;  1PCA A;  4QB9 A;  2OZU A;  4C2Z A;  2VZY A;  1Q2Y A;  2Q4Y A;  3CPA A;  3JVN A;  4MY3 A;  2CNS A;  3LD2 A;  4MHN A;  3TO9 A;  5CBM A;  1FY7 A;  4MI4 A;  3PB6 X;  4JD6 A;  2PIZ A;  2Q4V A;  2Q43 A;  2ZW4 A;  4RS2 A;  4UWI A;  3MGD A;  4UCM A;  3TCV A;  4B14 A;  1CX8 A;  2XEJ A;  4KOR A;  4JJX A;  2CNM A;  3IIB A;  5AG4 A;  2Z11 A;  2OH1 A;  2QYV A;  5HVG A;  2Z3M A;  1Z2L A;  3UY5 A;  4PK3 A;  3LOD A;  4CAW A;  4OC4 A;  4A39 A;  1Z4R A;  3TFY A;  2ZOF A;  5FVJ A;  4H6Z A;  2JDC A;  1XMB A;  1IGB A;  2PJ8 A;  3KAS A;  2HQY A;  3D7G A;  4PXE A;  2K5T A;  4KOU A;  5G20 A;  4FBE A;  1EE3 P;  1F57 A;  3PB9 X;  2PQ8 A;  3SXO A;  2GE3 A;  2VI7 A;  4AVA A;  2ARH A;  2F8H A;  2Z3L A;  5EC4 A;  2REF A;  5IX3 A;  1Y0Y A;  4MJ8 A;  1Y0R A;  2HUZ A;  3KHX A;  4TNU A;  3KHZ A;  3WR7 A;  5D8N A;  3B3W A;  4UFX A;  4ZYQ A;  2ZEL A;  3GKR A;  4PXB A;  5LRK A;  3FEC A;  2V8V A;  3IGR A;  1I12 A;  4KSF A;  4MMO A;  5LYD A;  2B4B A;  4KVX A;  4Y49 C;  1K4J A;  1QQ9 A;  1IOI A;  4KSA A;  4NGS A;  1LCP A;  4MHY A;  5CNP A;  3P2H A;  1Y9K A;  1XBU A;  4LX9 A;  5AG7 A;  1ZG8 A;  2PJB A;  4P4B A;  2Q44 A;  1YME A;  5J1Q A;  1U6M A;  2HB6 A;  1LFW A;  4F9U A;  5JH9 A;  2PR1 A;  4IAV A;  4GXH A;  2Z3O A;  1MJ9 A;  2R1I A;  1XJO A;  1JQG A;  4IUS A;  3BXM A;  5F48 A;  2G3A A;  5G1Z A;  4E0A A;  2YGW A;  1JWQ A;  4P4I A;  2ZEO A;  5IB9 A;  5H84 A;  2ZEH A;  4QUS A;  5IB0 A;  1Z4E A;  3S9N A;  3LAC A;  4M85 A;  1P0H A;  4OC2 A;  3RYO A;  4DJL A;  4U9Z A;  3HLP A;  3NE7 A;  4KUA A;  1VGY A;  2AFX A;  4KOV A;  3SJE A;  3PBE A;  1CPX A;  4EFD A;  3R9G A;  4M3S A;  2DXQ A;  3V8I A;  4E8O A;  1ZLH A;  2V8H A;  1PUA A;  2EWB A;  3R9E A;  4X8I A;  5ISV A;  4OC5 A;  2AFZ A;  2FIW A;  2YND A;  4JXQ A;  2IMO A;  4O23 A;  3SI1 A;  1TXR A;  2VL1 A;  3TC8 A;  3VH9 A;  3W91 A;  4B10 A;  4MCS A;  4NXY A;  4HPS A;  2DPS A;  4Q38 A;  3D4U A;  2CIJ A;  4NGT A;  1CP7 A;  2AFU A;  3B2Y A;  1YR0 A;  4MFP A;  4P44 A;  4QC6 A;  1ZG7 A;  3TOB A;  1YGH A;  2CY2 A;  2O28 A;  1RTQ A;  3KQX A;  2AFS A;  4FUU A;  4YGO A;  3S9M A;  5K8O A;  1Y7E A;  2G3T A;  2WYR A;  4LQG A;  1YLE A;  4KLV A;  4A37 A;  1IOF A;  1VIX A;  4CPA A;  2PRB A;  3FF3 A;  1IB1 E;  1MK4 A;  3D8P A;  4NCZ A;  3TO7 A;  1QSR A;  4MFK A;  1KZF A;  1Q2C A;  2HC9 A;  1R43 A;  2P6F A;  2JEV A;  3I1U A;  2CTC A;  4XNH C;  5AG6 A;  4AVB A;  2PJ2 A;  3PFE A;  1HDU A;  1I21 A;  2F7V A;  2NYQ A;  3LMS A;  2D4P A;  3T9Y A;  1OBR A;  1NSA A;  1LAN A;  1MJB A;  4UEF A;  4CGM A;  1M4L A;  1Y9W A;  2FIA A;  3F5B A;  2V8G A;  4UIB A;  4UIA A;  2OOT A;  4DNC A;  3NH5 A;  4XPK A;  4P4J A;  3DSB A;  5JGF A;  5JM6 A;  3D7H A;  5KTA A;  1L0C A;  2P6G A;  2PJ1 A;  3PGP A;  2QML A;  2Q51 A;  4NFR A;  5DWN A;  2C6G A;  2ZW7 A;  3S6G A;  3I3G A;  2RB7 A;  3FXT A;  3JUW A;  4UA3 A;  3QAY A;  4JZ0 A;  5C88 A;  5LRJ A;  4IF5 A;  3SJX A;  4FD5 A;  4B5P A;  2ZXV A;  1KUY A;  5LYL A;  2OB0 A;  1VHE A;  3I9S A;  3V38 A;  4CGO A;  2WUU A;  2GLJ A;  5AG5 A;  4P4F A;  3VWD A;  1BO4 A;  4A32 A;  5F09 A;  4JYW A;  2EBJ A;  1B87 A;  2DF5 A;  4CYO A;  2AJ6 A;  3DNS A;  3CXP A;  4M6H A;  2QEC A;  3KZW A;  1RXT A;  3D7F A;  2ZOG A;  5HVF A;  3FIX A;  1KUX A;  3FBU A;  3TO6 A;  2Z3K A;  4U5Y A;  4AG7 A;  3ZZI A;  4MHP A;  2EUI A;  2Q4Z A;  2R98 A;  3KQZ A;  4MFZ A;  2PVW A;  4H2K A;  4NGR A;  1YW6 A;  4NF1 A;  4P4E A;  5G22 A;  1FNO A;  4C68 A;  1YSJ A;  1F2O A;  1IIC A;  2IQ6 A;  4ZY1 A;  2B5G A;  3TT2 A;  3D3S A;  2BSW A;  2QIR A;  3FX6 A;  4UCN A;  1VKC A;  3CT9 A;  3B3S A;  1XIX A;  1R57 A;  2GLF A;  4IK2 A;  2Q0Y A;  2J8M A;  4BD9 A;  2DPT A;  2PJ6 A;  1R3N A;  3NFZ A;  3IU1 A;  3FVL A;  4CS0 B;  2Z0Z A;  1QSM A;  1TF8 A;  4OME A;  5K8P A;  1GHE A;  4MCP A;  4OID A;  4XPD C;  4YWY A;  2PCU A;  2VEZ A;  2IJZ A;  2O4H A;  4ZX9 A;  7CPA A;  2G9D A;  4KOY A;  5D29 A;  4FWU A;  5JQ4 A;  5ELY A;  2XEG A;  4UEZ A;  1ZO0 A;  2EO8 A;  2PJ9 A;  3B35 A;  4PV6 A;  3QNV A;  3VAR A;  4UBR A;  4YU9 A;  5F47 A;  4P10 A;  2REE A;  1IY7 A;  1XF8 A;  4CRZ B;  3B7I A;  2RFH A;  3PB8 X;  3OWC A;  1QSO A;  4EWT A;  2G0B A;  4P45 A;  1UWY A;  3CDX A;  3D68 A;  4NSQ A;  3PRT A;  4KS9 A;  3RO0 A;  5G21 A;  3SXN A;  1CM0 A;  4CAX A;  4MRI A;  2OZG A;  4GM5 A;  4M6I A;  1LAM A;  3F0A A;  1LOK A;  1NSL A;  4R3K A;  4B13 A;  2I79 A;  4A94 A;  4MBU A;  2BL1 A;  3NE8 A;  3B3V A;  3KR5 A;  2GU2 A;  4H6U A;  4C2Y A;  1MJA A;  4OIW A;  4K30 A;  2HV2 A;  2B3V A;  2PJ0 A;  1LAP A;  4G1P A;  1B6B A;  3F8K A;  4NJR A;  1TIQ A;  2VXK A;  5HVH A;  2FSR A;  2ODF A;  3EXN A;  3KKW A;  3KGQ A;  1F2P A;  2PR8 A;  3H4Q A;  1XEB A;  4MHZ A;  2YNC A;  3RBU A;  2QJ8 A;  1Q7L A;  1Z8L A;  2PJ7 A;  2ZEG A;  4FD6 A;  2EK8 A;  3A9L A;  2I00 A;  2C6P A;  4JWP A;  1IU8 A;  5EMI A;  4CYQ A;  4ZI6 A;  4UWJ A;  2B4D A;  3EO4 A;  1XFO A;  4CYN A;  3VWE A;  2IL4 A;  4B11 A;  1IID A;  2BUE A;  2YNC C;  2ATR A;  3JRU A;  1S60 A;  3IWW A;  1HDQ A;  3GB0 A;  2FT0 A;  1YW4 A;  4CAF A;  2CXA A;  5AGE A;  1SQH A;  2PSW A;  2DEA A;  4CGN A;  2XEI A;  4XNH B;  1BAV A;  2PJ5 A;  3G3S A;  3G8W A;  2PDO A;  4R8F A;  2ZPA A;  3DLJ A;  3PP9 A;  2PJA A;  3WAB A;  4R3L A;  4H89 A;  4PSX A;  2I3C A;  1FT7 A;  1KUV A;  5A28 A;  3BJ7 A;  1ZLI A;  5HMN A;  1KWM A;  4A33 A;  3JTK A;  1Z8T A;  3PB7 X;  2J8R A;  4F9V A;  4DUK A;  1CBX A;  3CPX A;  3T8W A;  2PJ4 A;  3FMC A;  1YX0 A;  3T90 A;  4HNW B;  5EBV A;  3FRM A;  3VAT A;  4OP4 A;  2RC4 A;  1NE9 A;  5F49 A;  3GLJ A;  4BMH A;  1XMT A;  4LUA A;  3EC4 A;  2FE7 A;  2VZZ A;  3FED A;  3GUX A;  4KUB A;  3R96 A;  4RN7 A;  5IV0 A;  4A30 A;  4ZGY B;  3IC1 A;  4ONW A;  3H8G A;  5I4M A;  4Y49 B;  4X3R A;  4C2X A;  1WK4 A;  2P6E A;  3D7D A;  4P4D A;  4Q36 A;  5JPH A;  4RUH A;  2CTB A;  5HXD A;  4CGL A;  4X5K A;  1YVK A;  3TE4 A;  2V77 A;  1CP6 A;  3IO1 A;  1XE4 A;  2JLM A;  2C1C A;  3H5Z A;  4PQA A;  3SI0 A;  2EK9 A;  4PSW A;  4QBJ A;  1ARM A;  2ABZ A;  3BJ8 A;  4JLY A;  5CPA A;  1LRZ A;  5E96 A;  3SJF A;  4R76 A;  4F6A A;  2FXF A;  4BBH A;  4RI1 A;  1N71 A;  2H5M A;  3W6S A;  1P4N A;  2F5I A;  4PXC A;  3PBB A;  3CZX A;  3WC7 A;  2QVP A;  4F0Y A;  4QVT A;  4EVY A;  4ZY0 A;  3FJU A;  4AVC A;  4F0X A;  1Z8X A;  4XPL A;  5F46 A;  3KI9 A;  2ZED A;  2JBK A;  1OZP A;  1TKH A;  1BLL E;  1XRY A;  3CXS A;  2J9A A;  2JDD A;  4JXR A;  2PJC A;  4L89 A;  4M6G A;  3R9F A;  3K9U A;  1Q2D A;  3V7Z A;  2PE3 A;  4UF4 A;  3RAM A;  4R87 A;  4YFJ A;  2FCK A;  4PXD A;  2P0W A;  4CAE A;  4DYO A;  4F8Z A;  1M4D A;  2WPX A;  4CRY B;  5K8M A;  1Z8W A;  4TWE A;  3L2N A;  3MRU A;  4CYP A;  2Q7B A;  4R7M A;  2NMT A;  3PEI A;  4NGP A;  2AFW A;  4WJB A;  2WZN A;  4E2A A;  2Z3N A;  2Z10 A;  4II9 A;  1GYT A;  2BCO A;  2D4O A;  2VQY A;  2ZW5 A;  2PC1 A;  2BO9 A;  2CF4 A;  4CGP A;  2J8N A;  1H8L A;  3WC5 A;  4WWV A;  1M1D A;  3N7Z A;  4PK2 A;  2ZW6 A;  2FVG A;  4R9M A;  1BOB A;  4MXU A;  1QMU A;  3NH8 A;  2YNE A;  3IJ3 A;  4FD4 A;  4ONU A;  4KZT A;  1S5K A;  2B5G B;  4OC3 A;  4MHD A;  5KTD A;  4J3G A;  3E0K A;  4A38 A;  2ANP A;  1ZG9 A;  4OAD A;  4MFL A;  2AFO A;  4NGM A;  1J4J A;  4C7H A;  3EY5 A;  2Q04 A;  3FEE A;  2A4N A;  4K3N A;  4ZX8 A;  3IWG A;  1X10 A;  2OR4 A;  3EFA A;  3IWE A;  5HH1 A;  3TTH A;  2C27 A;  3PB4 X;  5C82 A;  1IYL A;  4KLW A;  3NA6 A;  3D2P A;  4LQ6 A;  1S7N A;  4C7I A;  3LWU A;  3R1K A;  2VBQ A;  3C26 A;  3CXQ A;  2GFQ A;  4ORF A;  3ISZ A;  3IU2 A;  3NH4 A;  5H86 A;  3R95 A;  4B12 A;  4FAI A;  4NEX A;  2OU2 A;  4BIN A;  4FD7 A;  3WC6 A;  4B6Z A;  2B4D B;  4R6T A;  3TOA A;  2JEW A;  4NGN A;  4ZY2 A;  3HUV A;  1CG2 A;  4A31 A;  3N5F A;  1VHO A;  3KL9 A;  2Z3P A;  3P2F A;  3SJG A;  6CPA A;  4ZBG A;  4NGQ A;  3IEH A;  3IFE A;  3K2K A;  1WWZ A;  5DWM A;  4B5O A;  3B3T A;  3S6F A;  4AB7 A;  5DS0 A;  3FH4 A;  3MN8 A;  5LYF A;  1ELM P;  2EVN A;  3GY9 A;  2R8V A;  1AUG A;  3FB3 A;  4KOX A;  4UEE A;  1TKF A;  1DTD A;  2PRQ A;  4GS4 A;  1CPS A;  4AG9 A;  2X7B A;  2PJ3 A;  2AFM A;  3TX8 A;  4CAV A;  1RO5 A;  2GRE A;  3FNC A;  4MY0 A;  2AE6 A;  3ISX A;  2GIV A;  2ZEE A;  1AMP A;  3WT4 A;  3BI0 A;  1BPN A;  1HEE A;  2KCW A;  2FL4 A;  4KVO E;  1TF9 A;  5K8N A;  5KTC A;  1NMT A;  4L8A A;  3GIU A;  1PYT B;  4MCQ A;  5THW A;  1A2Z A;  4Q7A A;  3D66 A;  1UFH A;  4MCR A;  3DR6 A;  4NJQ A;  2ZEM A;  3DR8 A;  4OC0 A;  5J8C A;  4KVM E;  4HKF A;  2C6C A;  4W9Y A;  4KSI A;  1M4I A;  2WSA A;  3RNZ A;  1DE4 C;  3H8E A;  2R7H A;  3PZJ A;  2POK A;  2PVV A;  4XPD B;  1PU9 A;  1VHS A;  5I0C A; 
#chains in the Genus database with same CATH homology
 4HNY B;  2GAN A;  5BWA B;  2WPW A;  2Y0M A;  4YRH A;  1YVO A;  2CNT A;  3ZJ0 A;  5A27 A;  3W6X A;  1S7L A;  4R57 A;  4B5P B;  3S6H A;  3DDD A;  2B58 A;  4I49 A;  1M4G A;  4U9Y A;  3QB8 A;  4A95 A;  3GYA A;  1CJW A;  2BEI A;  3D2M A;  1S3Z A;  4UFW A;  1I1D A;  2FS5 A;  4UCP A;  5J8F A;  4A2Z A;  3SHP A;  1YK3 A;  1Z9U A;  4UFV A;  3FYN A;  1Y7R A;  1IYK A;  1S7F A;  3B8G A;  4KOW A;  3BLN A;  2B3U A;  4OAE A;  1QSN A;  1V0C A;  4OLL A;  4HNX B;  4MFJ A;  1M44 A;  4MFQ A;  2OZH A;  3QAH A;  5GCN A;  1YRE A;  3S6K A;  1S7K A;  1ON0 A;  4KOS A;  4KOT A;  1QST A;  4QB9 A;  2OZU A;  4C2Z A;  2VZY A;  3JVN A;  1Q2Y A;  2Q4Y A;  4MY3 A;  3TO9 A;  3LD2 A;  2CNS A;  1FY7 A;  4MI4 A;  4JD6 A;  2Q4V A;  2ZW4 A;  4RS2 A;  4UWI A;  3MGD A;  4UCM A;  3TCV A;  4B14 A;  4KOR A;  4JJX A;  2CNM A;  5AG4 A;  2OH1 A;  2Z3M A;  3UY5 A;  4PK3 A;  3LOD A;  4CAW A;  1Z4R A;  3TFY A;  5FVJ A;  4H6Z A;  2JDC A;  2HQY A;  2K5T A;  4KOU A;  5G20 A;  2PQ8 A;  3SXO A;  2GE3 A;  2VI7 A;  4AVA A;  2ARH A;  2Z3L A;  5EC4 A;  2REF A;  5IX3 A;  4MJ8 A;  2HUZ A;  3WR7 A;  4UFX A;  3GKR A;  3IGR A;  4KSF A;  1I12 A;  2B4B A;  4KVX A;  4Y49 C;  1K4J A;  4KSA A;  5CNP A;  3P2H A;  1Y9K A;  4LX9 A;  5AG7 A;  2Q44 A;  1U6M A;  2PR1 A;  2Z3O A;  1MJ9 A;  2R1I A;  4IUS A;  5F48 A;  2G3A A;  5G1Z A;  4E0A A;  2YGW A;  5H84 A;  4QUS A;  5IB0 A;  1Z4E A;  4M85 A;  1P0H A;  3RYO A;  4U9Z A;  3NE7 A;  4KUA A;  4KOV A;  3R9G A;  4M3S A;  2DXQ A;  3V8I A;  4E8O A;  1PUA A;  3R9E A;  5ISV A;  2YND A;  2FIW A;  4JXQ A;  3W91 A;  4B10 A;  4Q38 A;  4NXY A;  2DPS A;  4MFP A;  1YR0 A;  4QC6 A;  3TOB A;  1YGH A;  2CY2 A;  2O28 A;  4YGO A;  2G3T A;  1YLE A;  4KLV A;  2PRB A;  1IB1 E;  1MK4 A;  3D8P A;  4NCZ A;  3TO7 A;  1QSR A;  4MFK A;  1KZF A;  1Q2C A;  2P6F A;  2JEV A;  4XNH C;  4AVB A;  5AG6 A;  1I21 A;  3T9Y A;  2D4P A;  1MJB A;  4CGM A;  1Y9W A;  3F5B A;  2FIA A;  4DNC A;  4XPK A;  3DSB A;  5KTA A;  1L0C A;  2P6G A;  3PGP A;  2QML A;  5DWN A;  3S6G A;  2ZW7 A;  3I3G A;  3FXT A;  3JUW A;  4UA3 A;  5C88 A;  4IF5 A;  4B5P A;  4FD5 A;  2ZXV A;  1KUY A;  2OB0 A;  3I9S A;  4CGO A;  2WUU A;  5AG5 A;  3VWD A;  1BO4 A;  4A32 A;  1B87 A;  4CYO A;  2AJ6 A;  3DNS A;  3CXP A;  2QEC A;  1RXT A;  3FIX A;  1KUX A;  3FBU A;  3TO6 A;  2Z3K A;  4U5Y A;  4AG7 A;  3ZZI A;  2EUI A;  2R98 A;  4MFZ A;  4NF1 A;  4C68 A;  5G22 A;  1IIC A;  2B5G A;  3TT2 A;  3D3S A;  2BSW A;  2QIR A;  4UCN A;  1VKC A;  1XIX A;  1R57 A;  2Q0Y A;  2J8M A;  2DPT A;  3IU1 A;  4CS0 B;  2Z0Z A;  1QSM A;  1GHE A;  4XPD C;  2VEZ A;  4KOY A;  5JQ4 A;  1ZO0 A;  4PV6 A;  4UBR A;  5F47 A;  2REE A;  1XF8 A;  4CRZ B;  3OWC A;  1QSO A;  2G0B A;  4NSQ A;  4KS9 A;  5G21 A;  3SXN A;  1CM0 A;  4CAX A;  2OZG A;  4B13 A;  3F0A A;  1NSL A;  1PU9 A;  4R3K A;  2I79 A;  4MBU A;  2BL1 A;  4H6U A;  4C2Y A;  1MJA A;  4K30 A;  2HV2 A;  2B3V A;  1B6B A;  3F8K A;  1TIQ A;  2VXK A;  2FSR A;  3EXN A;  3KKW A;  2PR8 A;  3H4Q A;  1XEB A;  2YNC A;  4FD6 A;  3A9L A;  2I00 A;  4JWP A;  4CYQ A;  4UWJ A;  2B4D A;  3EO4 A;  4CYN A;  3VWE A;  2IL4 A;  4B11 A;  1IID A;  2BUE A;  2YNC C;  2ATR A;  1S60 A;  2FT0 A;  4CAF A;  2CXA A;  5AGE A;  1SQH A;  2PSW A;  4CGN A;  4XNH B;  3G8W A;  3G3S A;  2PDO A;  2ZPA A;  3PP9 A;  4R3L A;  4H89 A;  4PSX A;  1KUV A;  5A28 A;  3BJ7 A;  5HMN A;  4A33 A;  3JTK A;  2J8R A;  1YX0 A;  3T90 A;  4HNW B;  5EBV A;  3FRM A;  2RC4 A;  1NE9 A;  5F49 A;  4BMH A;  1XMT A;  4LUA A;  3EC4 A;  2FE7 A;  2VZZ A;  4KUB A;  3R96 A;  5IV0 A;  4A30 A;  4ZGY B;  4Y49 B;  4C2X A;  1WK4 A;  2P6E A;  4Q36 A;  5JPH A;  4CGL A;  4X5K A;  1YVK A;  3TE4 A;  1XE4 A;  2JLM A;  3H5Z A;  4PSW A;  4QBJ A;  3BJ8 A;  4JLY A;  5E96 A;  1LRZ A;  4F6A A;  2FXF A;  4BBH A;  4RI1 A;  1N71 A;  2H5M A;  3W6S A;  1P4N A;  2F5I A;  4F0Y A;  4QVT A;  4EVY A;  4AVC A;  4F0X A;  4XPL A;  5F46 A;  1OZP A;  3CXS A;  4JXR A;  4L89 A;  2JDD A;  3R9F A;  3K9U A;  1Q2D A;  4R87 A;  4YFJ A;  2FCK A;  4CAE A;  2P0W A;  1M4D A;  2WPX A;  4CRY B;  4CYP A;  2Q7B A;  2NMT A;  4E2A A;  2Z3N A;  2Z10 A;  4II9 A;  2D4O A;  2VQY A;  2ZW5 A;  2PC1 A;  4CGP A;  2J8N A;  1M1D A;  3N7Z A;  4PK2 A;  2ZW6 A;  4R9M A;  1BOB A;  4FD4 A;  2YNE A;  4ONU A;  4KZT A;  1S5K A;  2B5G B;  4MHD A;  5KTD A;  4J3G A;  3E0K A;  4OAD A;  4MFL A;  1J4J A;  4C7H A;  3EY5 A;  2Q04 A;  2A4N A;  3TTH A;  3IWG A;  3EFA A;  3IWE A;  5HH1 A;  2C27 A;  5C82 A;  1IYL A;  4KLW A;  3D2P A;  4C7I A;  1S7N A;  3R1K A;  2VBQ A;  3C26 A;  3CXQ A;  4ORF A;  3IU2 A;  5H86 A;  3R95 A;  4B12 A;  4NEX A;  2OU2 A;  4FD7 A;  2B4D B;  3TOA A;  4A31 A;  3P2F A;  2Z3P A;  4ZBG A;  1WWZ A;  5DWM A;  4B5O A;  3S6F A;  4AB7 A;  3GY9 A;  2EVN A;  2R8V A;  3FB3 A;  4KOX A;  4GS4 A;  4AG9 A;  2X7B A;  4CAV A;  1RO5 A;  3FNC A;  4MY0 A;  2AE6 A;  2GIV A;  2KCW A;  2FL4 A;  4KVO E;  5KTC A;  1NMT A;  4L8A A;  1UFH A;  3DR6 A;  3DR8 A;  5J8C A;  4KVM E;  4HKF A;  1M4I A;  2WSA A;  2R7H A;  3PZJ A;  4XPD B;  2Z11 A;  1VHS A;  5I0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...