4A33A

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a pyrazole sulphonamide ligand
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
411
structure length
411
Chain Sequence
b'AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of a novel class of orally active trypanocidal N-myristoyltransferase inhibitors.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 117
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4a33A00
4B13A 2YNCC 4C7HA 3IU2A 4CYQA 4C2ZA 4UCMA 4CAFA 4CGNA 4B10A 5A27A 4A31A 3H5ZA 4CYNA 2YNDA 5AG6A 4A33A 4CGMA 2WUUA 4C68A 2YNEA 4CAEA 4B12A 4UFXA 3IWEA 4A2ZA 5AG4A 2WSAA 3IU1A 2YNCA 4UFWA 5G21A 4B11A 4CGLA 4CYOA 4CYPA 5G1ZA 4BBHA 5G22A 4C7IA 4C2YA 4B14A 4UCPA 4A32A 4A30A 4C2XA 5AGEA 4CGPA 4UCNA 5AG7A 5A28A 5G20A 5AG5A 4CGOA 4UFVA 3JTKA 4A95A
chains in the Genus database with same CATH superfamily
3PZJA 1NMTA 5F46A 3IU2A 1BLLE 4QVTA 2GIVA 1YLOA 4LUAA 3G3SA 3T9YA 4B5PB 2HB6A 4NGQA 3S6GA 2VZYA 4K3NA 3TO7A 1VGYA 3B35A 4YRHA 3VARA 2CY2A 3TE4A 1QSMA 1ZO0A 2BUEA 2Q7SA 3R95A 3MRUA 3B3TA 5JM6A 4F9VA 2PIZA 1B6BA 5LRKA 3PB8X 2YNCA 5G21A 4A37A 4W9YA 3IO1A 4EVYA 5FVJA 1Y7EA 3S6FA 2HUZA 2JBJA 4MCSA 1LOKA 2EUIA 4CS0B 4ZI6A 3IIBA 4FD4A 4KOTA 2PJ5A 4KOSA 1TKFA 4EFDA 4KS9A 1QSRA 2PJ2A 5LRGA 4CAEA 2QECA 2QMLA 1HEEA 2YNCC 4KOVA 5J8FA 2O53A 4CGNA 5A27A 3FEEA 4KSFA 4X8IA 2BSWA 3B3SA 1IYLA 4A31A 1XF8A 5CNPA 3S9LA 3NH4A 3IWWA 4M6GA 4UWIA 3NE7A 2C6CA 2B4DB 4B12A 4CRZB 4UFXA 5JGFA 5HVHA 3D7HA 2EK9A 3ISXA 1X10A 5G1ZA 5G22A 2Q7BA 4DUKA 1I12A 3ZJ0A 1LANA 1V0CA 2ZEGA 4MFPA 1Z2LA 1WWZA 2GANA 3NH5A 5HXDA 4P45A 5AG5A 1TF9A 4PQAA 1M1DA 1YGHA 2BOAA 5IX3A 3PFOA 5KTCA 2O28A 2Z3OA 4PSXA 3RNZA 5KTDA 1ZG9A 1YMEA 1KUYA 2P6GA 2PJ1A 1CP6A 1TIQA 4E8OA 1FT7A 1AUGA 3H8FA 4MFJA 2Q4ZA 4B6ZA 4B5PA 1NSAA 3QAHA 2Z3NA 5DWMA 1CM0A 2Z10A 3EXNA 4ONUA 4AVBA 5AG4A 2WSAA 1NE9A 1BAVA 2G9DA 4YGOA 1F57A 4KORA 3FX6A 4CAXA 3B8GA 4XNHB 4FD6A 3GUXA 3CXSA 5KTAA 1WK4A 4M85A 4A30A 2EWBA 2WPWA 2CNSA 4F0YA 1M4GA 1TF8A 4QBJA 4FAIA 3N7ZA 3FBUA 5K8OA 2RFHA 4BD9A 3K2KA 2JEVA 4X3RA 1M4LA 1M4DA 4YWYA 4H89A 3TO9A 1S7NA 1Z5RA 5D8NA 3W6SA 4AG7A 1Z4RA 5I4MA 2D4OA 1IY7A 3HLPA 4MHZA 4X2TA 1TXRA 2AFWA 2REFA 3B7IA 3SI0A 6CPAA 4Y49B 3JVNA 4MCQA 4UFWA 4UEZA 4KVOE 2B4DA 2ZW5A 2GREA 2IMOA 2V8VA 1JWQA 2X7BA 4B14A 1YQEA 2AFXA 1CX8A 3WC6A 1XBUA 2FSRA 2IL4A 4GXHA 4MHPA 4B5OA 4NFRA 4OP4A 2P0WA 2OZUA 3CDXA 3FJUA 4H2KA 4R3LA 3VATA 3KQZA 4OC4A 1ZG8A 1U6MA 2FT0A 4MFKA 2OZGA 4RN7A 2NMTA 4RI1A 4MJ8A 3FRMA 4ZX9A 1UWYA 1HDUA 5AG6A 4A33A 4PXBA 5JH9A 1Y9WA 1YLEA 2GLFA 2ZEOA 3F0AA 1LAMA 2PVVA 4NGNA 4EMEA 2P6EA 5IV0A 4P4DA 4B11A 2CIJA 2D4PA 3KKWA 2ZEPA 3H4QA 2GLJA 4C7IA 1IOIA 5HVGA 1IYKA 1YW6A 2B5GB 2REEA 3B2YA 4G1PA 4OC5A 4TNUA 4A32A 5AG7A 2PE3A 2C6PA 2CF4A 2H5MA 3DDDA 3D2PA 1Q2YA 4A95A 3HUVA 2NYQA 1GYTA 5JQ4A 3P2FA 1XFOA 3PFEA 2YGWA 4BINA 1XEBA 4PXCA 2BCOA 4OIWA 1AMPA 3PRTA 2OZHA 2PR8A 1Y0YA 4MI4A 1VHOA 3TCVA 3KQXA 3D68A 4XNHC 2FE7A 3FMCA 3TFYA 3BI0A 4PPZA 1Z9UA 4P4BA 2B3VA 3LWUA 4PXEA 2Q43A 2G3AA 3WABA 1YR0A 1Z4EA 3NE8A 4NCZA 2IJZA 1CPXA 5LYLA 1SQHA 3GIUA 2AFOA 2Q0YA 1I1DA 5A28A 3SJXA 3KL9A 4X5KA 4E0AA 3EO4A 3PB4X 2ATRA 3JTKA 2OH1A 2ZXVA 4R76A 1I21A 4Q7AA 3I3GA 4UWJA 3MN8A 4PV6A 4OC0A 3SJGA 4UEFA 4JLYA 5CPAA 4CAFA 4Y49C 2PCUA 5K8PA 1QQ9A 1ARMA 1LAPA 2QYVA 4LQGA 1XOVA 1LCPA 3I9SA 4CYNA 1DTDA 3BHXA 1CP7A 5BWAB 2R8VA 1ELMP 2I79A 4MY0A 4U5YA 4UIBA 4HPSA 4C68A 7CPAA 2OR4A 2FXFA 4L8AA 3V7ZA 1R3NA 4M3SA 4A2ZA 5ISVA 4UF4A 4CYPA 2F8HA 3S9NA 2AFZA 3CZXA 3R9EA 2XEFA 3KI9A 3QNVA 4WJBA 5E96A 2QIRA 3B3CA 4AVAA 3NFZA 4RUHA 2A4NA 3A9LA 1Q2CA 4MRIA 1S5KA 3K9UA 4MBUA 2B5GA 1F2OA 4A94A 4CPAA 4DYOA 3L2NA 4IK2A 4ORFA 4JWPA 2DPSA 5LYIA 3RZAA 2AFUA 2OOTA 3B3VA 1Y0RA 4YFJA 2ZW7A 2G0BA 3KR4A 4CYQA 2HC9A 1Q2DA 2EO8A 2PDOA 3RO0A 2AFMA 2C6GA 2ZW4A 4DJLA 4HNYB 4F6AA 3D3SA 2ZW6A 4ZX8A 2XEIA 1Z8XA 3R9GA 3D7DA 2BEIA 1DE4C 3CT9A 3NA6A 3V38A 4KLVA 2PJ0A 4KVXA 3ISZA 2ODFA 1YSJA 5H86A 4HNWB 4Q36A 1XIXA 1Q7LA 2ZEDA 4H6UA 4XPLA 5K8NA 4CGPA 2R98A 5EMIA 3D4UA 2FIWA 3GB0A 1ZLIA 1OBRA 3WC5A 1VHSA 3TX8A 4GM5A 4FD7A 1J4JA 4PXDA 4CRYB 2PJ6A 4KOUA 4FBEA 1LRZA 1A2ZA 2C1CA 2POKA 3LACA 3FIXA 4IF5A 4KOXA 2ZELA 4P44A 4TWEA 2J9AA 1LFWA 2PJAA 2WZNA 2PIYA 4KVME 3EC4A 4JXQA 3SHPA 5F09A 4II9A 4F0XA 4MHYA 2PC1A 5IB0A 3KHXA 2CTBA 2AJ6A 1XE4A 2JDDA 3GKRA 4ZY0A 1XMBA 3N5FA 1L0CA 3DNSA 3VWEA 3F8KA 4R7MA 3QB8A 2Z3KA 3LD2A 4OMEA 2Z3MA 2JLMA 4DNCA 3B3WA 2ZEMA 1K4JA 4XPDB 1IIDA 3IC1A 3KZWA 5ELYA 1N71A 4FWUA 3PB6X 3E0KA 2ANPA 2FVGA 4OAEA 2ARHA 4C2ZA 2PJ7A 1CBXA 1S7LA 4OKOA 1IICA 4ZBGA 1CJWA 2ZEHA 3T90A 4P4EA 3EFAA 2V8DA 3OWCA 2JEWA 4KOWA 2PQ8A 2WUUA 2J8MA 1Z8WA 3P2HA 4PSWA 2WYRA 4K30A 4KOYA 3KHZA 3FXTA 3IU1A 4QC6A 3S6HA 4KUBA 4A38A 1FY7A 3DGVA 1FNOA 4ZYQA 1QMUA 2VQYA 4LX9A 1F2PA 3K9TA 4U9ZA 4Q38A 3CPXA 3DR6A 3FH4A 2PRBA 4JJXA 3SJFA 2ZENA 3CXPA 4CGOA 2QJ8A 3V8IA 2PJ8A 3JRUA 4JYWA 4EWTA 5THWA 3RAMA 4E2AA 3RYOA 4MHNA 4UCMA 4NJQA 4OIDA 2O4HA 3D67A 1RXTA 3FEDA 2J8RA 3IEHA 3BXMA 5IB9A 4JZ0A 4KSIA 4OLLA 1YREA 4R57A 4L89A 1P0HA 3IWEA 3PEIA 2ZEFA 5LYFA 4IHMA 2FS5A 5JPHA 4RS2A 4P6YA 2PSWA 1PUAA 1XJOA 2V8HA 4MXUA 4PK2A 1TKJA 1RTQA 2WPXA 2DXQA 1CG2A 1ZG7A 2GFQA 2ZOFA 3BJ8A 1CPSA 1H8LA 2Q4YA 3VWDA 4Z65A 3W6XA 1IB1E 1QSNA 1Y9KA 1Z8LA 2AFSA 2FL4A 2JBKA 3DR8A 4GS4A 4O23A 2Z3LA 3D8PA 2R1IA 2B3UA 2Y0MA 3BJ7A 4J3GA 3TTHA 1ZLHA 3H8GA 3DLJA 2YNDA 2ABZA 5F48A 2VL1A 1KUXA 4R6TA 4QUSA 2C27A 2BO9A 3ZZIA 1B87A 1M44A 2IQ6A 4NGMA 5K8MA 2P6FA 2GU2A 2DPTA 2VXKA 2BL1A 1PCAA 4U9YA 4UBRA 4P4JA 1R57A 3FB3A 4XPDC 5HMNA 1YX0A 1YK3A 4P4IA 1NSLA 1TKHA 3TOAA 4HKFA 3WC7A 2Z0ZA 4MFLA 4R87A 1MJAA 3C26A 4NGRA 3LODA 1R43A 4UIAA 5J8CA 2ZEEA 4P4FA 1S7KA 3TOBA 3DSBA 2F5IA 1JQGA 4MCPA 3W91A 2HQYA 4NGSA 4B13A 5GCNA 5EBVA 1BPMA 1EE3P 2PJ9A 2Z3PA 3S6KA 1MJBA 1AYEA 2VI7A 2KCWA 5DS0A 3KGQA 2PRQA 2VBQA 3GY9A 3H5ZA 2PVWA 3SI1A 3TO6A 4ZGYB 2Q04A 4KSAA 2OB0A 1KUVA 3PBBA 4ONWA 2VZZA 2YNEA 3FYNA 4R3KA 3KASA 4NGTA 5F47A 3LMSA 2I00A 2V8GA 5D29A 5F49A 4BMHA 2R7HA 1MJ9A 4MHDA 3SXOA 3PBEA 3WR7A 1ELLP 1VHEA 4KZTA 5AGEA 4QB9A 4UCNA 3IGRA 2XEGA 4IUSA 2GE3A 3T8WA 1XRYA 5LYDA 2PJ3A 3CXQA 3JUWA 3R1KA 2PJ4A 4F8ZA 3KR5A 2RC4A 3FF3A 1S60A 4AXVA 3PB7X 4OC3A 2EVNA 3VH9A 1BOBA 4OADA 4P10A 4ZY2A 4M6HA 1P4NA 2B58A 4F9UA 4FUUA 4LQ6A 3PGPA 3S9MA 4MCRA 1BO4A 5HVFA 4M6IA 1XMTA 1Y7RA 4XPKA 2ZOGA 3EY5A 5EC4A 3RBUA 2ZPAA 1VKCA 4A39A 5J1QA 4C2YA 1IGBA 3D66A 1S3ZA 2DEAA 3F5BA 5H84A 2RB7A 2F7VA 2V77A 3WT4A 2NSMA 1BPNA 3PP9A 4KUAA 1ARLA 1UFHA 3MGDA 4CAVA 3QAYA 2CNTA 2DF5A 1HDQA 1KZFA 3FNCA 4I49A 4NJRA 4UA3A 2Q44A 4WWVA 3BI1A 4JD6A 2HV2A 3R96A 3IWGA 2CTCA 1YVKA 3IJ3A 2I3CA 1OZPA 2J8NA 4MFQA 4OC2A 4NF1A 3NH8A 4AG9A 2CNMA 3G8WA 1GHEA 1YVOA 4CGMA 3IFEA 2VEZA 1VIXA 3BLNA 4OC1A 4AB7A 4CAWA 5I0CA 2PJCA 1QSTA 2G3TA 1MK4A 2PJBA 4CGLA 5C88A 3PB9X 3FVLA 2Z11A 4R8FA 4ZY1A 4BBHA 5C82A 4IAVA 4NXYA 4UCPA 2OU2A 1PYTB 1Z8TA 2EK8A 1IU8A 1IOFA 1KWMA 1M4IA 2Q51A 2QVPA 3GYAA 4HNXB 4NEXA 3D7FA 2CXAA 2Q4VA 3TC8A 4UFVA 5DWNA 1RO5A 4MMOA 4MY3A 2EBJA 2FCKA 3UY5A 2PR1A 2AE6A 2K5TA 4C7HA 4NGPA 4R9MA 2JDCA 3SXNA 5HH1A 4B10A 4YU9A 3D2MA 1PU9A 3GLJA 5LRJA 2FIAA 1X12A 3SI2A 4AVCA 5CBMA 1ON0A 8CPAA 3FECA 3CPAA 4H6ZA 3TT2A 4KLWA 3D7GA 4FD5A 3I1UA 4CYOA 1S7FA 4PK3A 4UEEA 2XEJA 4C2XA 1QSOA 1YW4A 4NSQA 3SJEA 3R9FA 3H8EA 5G20A 4JXRA 4MFZA 2B4BA
chains in the Genus database with same CATH topology
3PZJA 1NMTA 5F46A 3IU2A 4QVTA 2GIVA 4LUAA 3G3SA 3T9YA 4B5PB 3S6GA 2VZYA 3TO7A 4YRHA 2CY2A 3TE4A 1QSMA 1ZO0A 2BUEA 3R95A 1B6BA 2YNCA 5G21A 4EVYA 5FVJA 3S6FA 4CS0B 2HUZA 2EUIA 4FD4A 4KOTA 4KOSA 4KS9A 1QSRA 4CAEA 2QECA 2QMLA 2YNCC 4KOVA 5J8FA 4CGNA 5A27A 4KSFA 2BSWA 4A31A 1IYLA 1XF8A 5CNPA 4UWIA 3NE7A 2B4DB 4B12A 4CRZB 4UFXA 5G1ZA 5G22A 2Q7BA 1I12A 3ZJ0A 1V0CA 4MFPA 1WWZA 2GANA 5AG5A 1M1DA 1YGHA 5IX3A 5KTCA 2O28A 2Z3OA 4PSXA 5KTDA 1KUYA 2P6GA 1TIQA 4E8OA 4MFJA 4B5PA 3QAHA 2Z3NA 5DWMA 1CM0A 2Z10A 3EXNA 4ONUA 4AVBA 5AG4A 2WSAA 1NE9A 4YGOA 4KORA 4CAXA 3B8GA 4XNHB 4FD6A 3CXSA 5KTAA 1WK4A 4M85A 4A30A 2WPWA 2CNSA 4F0YA 1M4GA 4QBJA 3N7ZA 3FBUA 2JEVA 1M4DA 4H89A 3TO9A 1S7NA 4AG7A 1Z4RA 2D4OA 2REFA 4Y49B 3JVNA 4UFWA 4KVOE 2B4DA 2ZW5A 2X7BA 4B14A 2FSRA 2IL4A 4B5OA 2P0WA 2OZUA 4R3LA 1U6MA 2FT0A 4MFKA 2OZGA 2NMTA 4RI1A 4MJ8A 3FRMA 5AG6A 4A33A 1Y9WA 1YLEA 3F0AA 5IV0A 2P6EA 4B11A 2D4PA 3KKWA 3H4QA 4C7IA 1IYKA 2B5GB 2REEA 4A32A 5AG7A 2H5MA 3DDDA 3D2PA 1Q2YA 4A95A 5JQ4A 3P2FA 2YGWA 1XEBA 3TCVA 2OZHA 2PR8A 4MI4A 4XNHC 2FE7A 3TFYA 1Z9UA 2B3VA 2G3AA 1YR0A 1Z4EA 4NCZA 1SQHA 2Q0YA 1I1DA 5A28A 4X5KA 4E0AA 3EO4A 2ATRA 3JTKA 2OH1A 2ZXVA 1I21A 3I3GA 4UWJA 4PV6A 4JLYA 4CAFA 4Y49C 3I9SA 4CYNA 5BWAB 2R8VA 4MY0A 2I79A 4U5YA 4C68A 2FXFA 4L8AA 4M3SA 4A2ZA 5ISVA 4CYPA 3R9EA 5E96A 2QIRA 4AVAA 2A4NA 3A9LA 1Q2CA 1S5KA 3K9UA 4MBUA 2B5GA 4ORFA 4JWPA 2DPSA 4YFJA 2ZW7A 2G0BA 4CYQA 1Q2DA 2PDOA 2ZW4A 4HNYB 4F6AA 3D3SA 2ZW6A 3R9GA 2BEIA 4KLVA 4KVXA 5H86A 4HNWB 4Q36A 1XIXA 4H6UA 4XPLA 4CGPA 2R98A 2FIWA 1VHSA 4FD7A 1J4JA 4CRYB 4KOUA 1LRZA 3FIXA 4IF5A 4KOXA 4KVME 3EC4A 4JXQA 3SHPA 4II9A 4F0XA 5IB0A 2PC1A 2AJ6A 1XE4A 2JDDA 3GKRA 3VWEA 1L0CA 3DNSA 3F8KA 3QB8A 2Z3KA 3LD2A 2Z3MA 2JLMA 4DNCA 1K4JA 4XPDB 1IIDA 1N71A 4OAEA 3E0KA 2ARHA 4C2ZA 1S7LA 1IICA 4ZBGA 1CJWA 3T90A 3EFAA 3OWCA 4KOWA 2PQ8A 2WUUA 2J8MA 3P2HA 3W6SA 4PSWA 4K30A 4QC6A 4KOYA 3S6HA 3FXTA 3IU1A 4KUBA 1FY7A 4LX9A 2VQYA 4U9ZA 4Q38A 3DR6A 4JJXA 2PRBA 3CXPA 4CGOA 3V8IA 4E2AA 3RYOA 4UCMA 1RXTA 2J8RA 4OLLA 4R57A 1YREA 4L89A 1P0HA 3IWEA 2FS5A 5JPHA 4RS2A 2PSWA 1PUAA 4PK2A 2WPXA 2DXQA 3BJ8A 2Q4YA 3VWDA 3W6XA 1IB1E 1QSNA 1Y9KA 2FL4A 3DR8A 4GS4A 2Z3LA 3D8PA 2R1IA 2B3UA 2Y0MA 3BJ7A 4J3GA 3TTHA 2YNDA 5F48A 1KUXA 4QUSA 2C27A 3ZZIA 1B87A 1M44A 2P6FA 2DPTA 2VXKA 2BL1A 4U9YA 4UBRA 4XPDC 5HMNA 1R57A 3FB3A 1YX0A 1YK3A 1NSLA 3TOAA 4HKFA 2Z0ZA 4MFLA 4R87A 1MJAA 3C26A 3LODA 5J8CA 1S7KA 3TOBA 3DSBA 2F5IA 3W91A 2HQYA 4B13A 5GCNA 2Z3PA 3S6KA 1MJBA 2VI7A 2KCWA 4ZGYB 2VBQA 3GY9A 3H5ZA 3TO6A 2Q04A 4KSAA 2OB0A 1KUVA 2VZZA 2YNEA 3FYNA 4R3KA 5F47A 2I00A 5F49A 4BMHA 2R7HA 1MJ9A 4MHDA 3SXOA 3WR7A 4KZTA 5AGEA 4QB9A 4UCNA 3IGRA 4IUSA 2GE3A 3CXQA 3JUWA 3R1KA 2RC4A 1S60A 2EVNA 1BOBA 4OADA 1P4NA 2B58A 3PGPA 1BO4A 1XMTA 1Y7RA 4XPKA 3EY5A 5EC4A 2ZPAA 1VKCA 4C2YA 1S3ZA 3F5BA 5H84A 3PP9A 4KUAA 1UFHA 3MGDA 4CAVA 2CNTA 3FNCA 1KZFA 4I49A 4UA3A 5EBVA 3R96A 2Q44A 4JD6A 2HV2A 3IWGA 1YVKA 1OZPA 2J8NA 4MFQA 4NF1A 4AG9A 2CNMA 3G8WA 1GHEA 1YVOA 4CGMA 5I0CA 2VEZA 3BLNA 4AB7A 4CAWA 1QSTA 2G3TA 1MK4A 5C88A 4CGLA 2Z11A 5C82A 4BBHA 4NXYA 4UCPA 2OU2A 4HNXB 1M4IA 3GYAA 4NEXA 2CXAA 2Q4VA 4UFVA 5DWNA 1RO5A 4MY3A 2FCKA 3UY5A 2PR1A 2AE6A 2K5TA 4C7HA 4R9MA 2JDCA 3SXNA 5HH1A 4B10A 3D2MA 1PU9A 4AVCA 2FIAA 1ON0A 4H6ZA 3TT2A 4KLWA 4FD5A 4CYOA 1S7FA 4PK3A 4C2XA 1QSOA 4NSQA 3R9FA 5G20A 4JXRA 4MFZA 2B4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B13 A;  2YNC C;  4C7H A;  3IU2 A;  4CYQ A;  4C2Z A;  4UCM A;  4CAF A;  4CGN A;  4B10 A;  5A27 A;  4A31 A;  3H5Z A;  4CYN A;  2YND A;  5AG6 A;  4A33 A;  4CGM A;  2WUU A;  4C68 A;  2YNE A;  4CAE A;  4B12 A;  4UFX A;  3IWE A;  4A2Z A;  5AG4 A;  2WSA A;  3IU1 A;  2YNC A;  4UFW A;  5G21 A;  4B11 A;  4CGL A;  4CYO A;  4CYP A;  5G1Z A;  4BBH A;  5G22 A;  4C7I A;  4C2Y A;  4B14 A;  4UCP A;  4A32 A;  4A30 A;  4C2X A;  5AGE A;  4CGP A;  4UCN A;  5AG7 A;  5A28 A;  5G20 A;  5AG5 A;  4CGO A;  4UFV A;  3JTK A;  4A95 A; 
#chains in the Genus database with same CATH topology
 3PZJ A;  1NMT A;  5F46 A;  3IU2 A;  1BLL E;  4QVT A;  2GIV A;  1YLO A;  4LUA A;  3G3S A;  3T9Y A;  4B5P B;  2HB6 A;  4NGQ A;  3S6G A;  2VZY A;  4K3N A;  3TO7 A;  1VGY A;  3B35 A;  4YRH A;  3VAR A;  2CY2 A;  3TE4 A;  1QSM A;  1ZO0 A;  2BUE A;  2Q7S A;  3R95 A;  3MRU A;  3B3T A;  5JM6 A;  4F9V A;  2PIZ A;  1B6B A;  5LRK A;  3PB8 X;  2YNC A;  5G21 A;  4A37 A;  4W9Y A;  3IO1 A;  4EVY A;  5FVJ A;  1Y7E A;  3S6F A;  2HUZ A;  2JBJ A;  4MCS A;  1LOK A;  2EUI A;  4CS0 B;  4ZI6 A;  3IIB A;  4FD4 A;  4KOT A;  2PJ5 A;  4KOS A;  1TKF A;  4EFD A;  4KS9 A;  1QSR A;  2PJ2 A;  5LRG A;  4CAE A;  2QEC A;  2QML A;  1HEE A;  2YNC C;  4KOV A;  5J8F A;  2O53 A;  4CGN A;  5A27 A;  3FEE A;  4KSF A;  4X8I A;  2BSW A;  3B3S A;  1IYL A;  4A31 A;  1XF8 A;  5CNP A;  3S9L A;  3NH4 A;  3IWW A;  4M6G A;  4UWI A;  3NE7 A;  2C6C A;  2B4D B;  4B12 A;  4CRZ B;  4UFX A;  5JGF A;  5HVH A;  3D7H A;  2EK9 A;  3ISX A;  1X10 A;  5G1Z A;  5G22 A;  2Q7B A;  4DUK A;  1I12 A;  3ZJ0 A;  1LAN A;  1V0C A;  2ZEG A;  4MFP A;  1Z2L A;  1WWZ A;  2GAN A;  3NH5 A;  5HXD A;  4P45 A;  5AG5 A;  1TF9 A;  4PQA A;  1M1D A;  1YGH A;  2BOA A;  5IX3 A;  3PFO A;  5KTC A;  2O28 A;  2Z3O A;  4PSX A;  3RNZ A;  5KTD A;  1ZG9 A;  1YME A;  1KUY A;  2P6G A;  2PJ1 A;  1CP6 A;  1TIQ A;  4E8O A;  1FT7 A;  1AUG A;  3H8F A;  4MFJ A;  2Q4Z A;  4B6Z A;  4B5P A;  1NSA A;  3QAH A;  2Z3N A;  5DWM A;  1CM0 A;  2Z10 A;  3EXN A;  4ONU A;  4AVB A;  5AG4 A;  2WSA A;  1NE9 A;  1BAV A;  2G9D A;  4YGO A;  1F57 A;  4KOR A;  3FX6 A;  4CAX A;  3B8G A;  4XNH B;  4FD6 A;  3GUX A;  3CXS A;  5KTA A;  1WK4 A;  4M85 A;  4A30 A;  2EWB A;  2WPW A;  2CNS A;  4F0Y A;  1M4G A;  1TF8 A;  4QBJ A;  4FAI A;  3N7Z A;  3FBU A;  5K8O A;  2RFH A;  4BD9 A;  3K2K A;  2JEV A;  4X3R A;  1M4L A;  1M4D A;  4YWY A;  4H89 A;  3TO9 A;  1S7N A;  1Z5R A;  5D8N A;  3W6S A;  4AG7 A;  1Z4R A;  5I4M A;  2D4O A;  1IY7 A;  3HLP A;  4MHZ A;  4X2T A;  1TXR A;  2AFW A;  2REF A;  3B7I A;  3SI0 A;  6CPA A;  4Y49 B;  3JVN A;  4MCQ A;  4UFW A;  4UEZ A;  4KVO E;  2B4D A;  2ZW5 A;  2GRE A;  2IMO A;  2V8V A;  1JWQ A;  2X7B A;  4B14 A;  1YQE A;  2AFX A;  1CX8 A;  3WC6 A;  1XBU A;  2FSR A;  2IL4 A;  4GXH A;  4MHP A;  4B5O A;  4NFR A;  4OP4 A;  2P0W A;  2OZU A;  3CDX A;  3FJU A;  4H2K A;  4R3L A;  3VAT A;  3KQZ A;  4OC4 A;  1ZG8 A;  1U6M A;  2FT0 A;  4MFK A;  2OZG A;  4RN7 A;  2NMT A;  4RI1 A;  4MJ8 A;  3FRM A;  4ZX9 A;  1UWY A;  1HDU A;  5AG6 A;  4A33 A;  4PXB A;  5JH9 A;  1Y9W A;  1YLE A;  2GLF A;  2ZEO A;  3F0A A;  1LAM A;  2PVV A;  4NGN A;  4EME A;  2P6E A;  5IV0 A;  4P4D A;  4B11 A;  2CIJ A;  2D4P A;  3KKW A;  2ZEP A;  3H4Q A;  2GLJ A;  4C7I A;  1IOI A;  5HVG A;  1IYK A;  1YW6 A;  2B5G B;  2REE A;  3B2Y A;  4G1P A;  4OC5 A;  4TNU A;  4A32 A;  5AG7 A;  2PE3 A;  2C6P A;  2CF4 A;  2H5M A;  3DDD A;  3D2P A;  1Q2Y A;  4A95 A;  3HUV A;  2NYQ A;  1GYT A;  5JQ4 A;  3P2F A;  1XFO A;  3PFE A;  2YGW A;  4BIN A;  1XEB A;  4PXC A;  2BCO A;  4OIW A;  1AMP A;  3PRT A;  2OZH A;  2PR8 A;  1Y0Y A;  4MI4 A;  1VHO A;  3TCV A;  3KQX A;  3D68 A;  4XNH C;  2FE7 A;  3FMC A;  3TFY A;  3BI0 A;  4PPZ A;  1Z9U A;  4P4B A;  2B3V A;  3LWU A;  4PXE A;  2Q43 A;  2G3A A;  3WAB A;  1YR0 A;  1Z4E A;  3NE8 A;  4NCZ A;  2IJZ A;  1CPX A;  5LYL A;  1SQH A;  3GIU A;  2AFO A;  2Q0Y A;  1I1D A;  5A28 A;  3SJX A;  3KL9 A;  4X5K A;  4E0A A;  3EO4 A;  3PB4 X;  2ATR A;  3JTK A;  2OH1 A;  2ZXV A;  4R76 A;  1I21 A;  4Q7A A;  3I3G A;  4UWJ A;  3MN8 A;  4PV6 A;  4OC0 A;  3SJG A;  4UEF A;  4JLY A;  5CPA A;  4CAF A;  4Y49 C;  2PCU A;  5K8P A;  1QQ9 A;  1ARM A;  1LAP A;  2QYV A;  4LQG A;  1XOV A;  1LCP A;  3I9S A;  4CYN A;  1DTD A;  3BHX A;  1CP7 A;  5BWA B;  2R8V A;  1ELM P;  2I79 A;  4MY0 A;  4U5Y A;  4UIB A;  4HPS A;  4C68 A;  7CPA A;  2OR4 A;  2FXF A;  4L8A A;  3V7Z A;  1R3N A;  4M3S A;  4A2Z A;  5ISV A;  4UF4 A;  4CYP A;  2F8H A;  3S9N A;  2AFZ A;  3CZX A;  3R9E A;  2XEF A;  3KI9 A;  3QNV A;  4WJB A;  5E96 A;  2QIR A;  3B3C A;  4AVA A;  3NFZ A;  4RUH A;  2A4N A;  3A9L A;  1Q2C A;  4MRI A;  1S5K A;  3K9U A;  4MBU A;  2B5G A;  1F2O A;  4A94 A;  4CPA A;  4DYO A;  3L2N A;  4IK2 A;  4ORF A;  4JWP A;  2DPS A;  5LYI A;  3RZA A;  2AFU A;  2OOT A;  3B3V A;  1Y0R A;  4YFJ A;  2ZW7 A;  2G0B A;  3KR4 A;  4CYQ A;  2HC9 A;  1Q2D A;  2EO8 A;  2PDO A;  3RO0 A;  2AFM A;  2C6G A;  2ZW4 A;  4DJL A;  4HNY B;  4F6A A;  3D3S A;  2ZW6 A;  4ZX8 A;  2XEI A;  1Z8X A;  3R9G A;  3D7D A;  2BEI A;  1DE4 C;  3CT9 A;  3NA6 A;  3V38 A;  4KLV A;  2PJ0 A;  4KVX A;  3ISZ A;  2ODF A;  1YSJ A;  5H86 A;  4HNW B;  4Q36 A;  1XIX A;  1Q7L A;  2ZED A;  4H6U A;  4XPL A;  5K8N A;  4CGP A;  2R98 A;  5EMI A;  3D4U A;  2FIW A;  3GB0 A;  1ZLI A;  1OBR A;  3WC5 A;  1VHS A;  3TX8 A;  4GM5 A;  4FD7 A;  1J4J A;  4PXD A;  4CRY B;  2PJ6 A;  4KOU A;  4FBE A;  1LRZ A;  1A2Z A;  2C1C A;  2POK A;  3LAC A;  3FIX A;  4IF5 A;  4KOX A;  2ZEL A;  4P44 A;  4TWE A;  2J9A A;  1LFW A;  2PJA A;  2WZN A;  2PIY A;  4KVM E;  3EC4 A;  4JXQ A;  3SHP A;  5F09 A;  4II9 A;  4F0X A;  4MHY A;  2PC1 A;  5IB0 A;  3KHX A;  2CTB A;  2AJ6 A;  1XE4 A;  2JDD A;  3GKR A;  4ZY0 A;  1XMB A;  3N5F A;  1L0C A;  3DNS A;  3VWE A;  3F8K A;  4R7M A;  3QB8 A;  2Z3K A;  3LD2 A;  4OME A;  2Z3M A;  2JLM A;  4DNC A;  3B3W A;  2ZEM A;  1K4J A;  4XPD B;  1IID A;  3IC1 A;  3KZW A;  5ELY A;  1N71 A;  4FWU A;  3PB6 X;  3E0K A;  2ANP A;  2FVG A;  4OAE A;  2ARH A;  4C2Z A;  2PJ7 A;  1CBX A;  1S7L A;  4OKO A;  1IIC A;  4ZBG A;  1CJW A;  2ZEH A;  3T90 A;  4P4E A;  3EFA A;  2V8D A;  3OWC A;  2JEW A;  4KOW A;  2PQ8 A;  2WUU A;  2J8M A;  1Z8W A;  3P2H A;  4PSW A;  2WYR A;  4K30 A;  4KOY A;  3KHZ A;  3FXT A;  3IU1 A;  4QC6 A;  3S6H A;  4KUB A;  4A38 A;  1FY7 A;  3DGV A;  1FNO A;  4ZYQ A;  1QMU A;  2VQY A;  4LX9 A;  1F2P A;  3K9T A;  4U9Z A;  4Q38 A;  3CPX A;  3DR6 A;  3FH4 A;  2PRB A;  4JJX A;  3SJF A;  2ZEN A;  3CXP A;  4CGO A;  2QJ8 A;  3V8I A;  2PJ8 A;  3JRU A;  4JYW A;  4EWT A;  5THW A;  3RAM A;  4E2A A;  3RYO A;  4MHN A;  4UCM A;  4NJQ A;  4OID A;  2O4H A;  3D67 A;  1RXT A;  3FED A;  2J8R A;  3IEH A;  3BXM A;  5IB9 A;  4JZ0 A;  4KSI A;  4OLL A;  1YRE A;  4R57 A;  4L89 A;  1P0H A;  3IWE A;  3PEI A;  2ZEF A;  5LYF A;  4IHM A;  2FS5 A;  5JPH A;  4RS2 A;  4P6Y A;  2PSW A;  1PUA A;  1XJO A;  2V8H A;  4MXU A;  4PK2 A;  1TKJ A;  1RTQ A;  2WPX A;  2DXQ A;  1CG2 A;  1ZG7 A;  2GFQ A;  2ZOF A;  3BJ8 A;  1CPS A;  1H8L A;  2Q4Y A;  3VWD A;  4Z65 A;  3W6X A;  1IB1 E;  1QSN A;  1Y9K A;  1Z8L A;  2AFS A;  2FL4 A;  2JBK A;  3DR8 A;  4GS4 A;  4O23 A;  2Z3L A;  3D8P A;  2R1I A;  2B3U A;  2Y0M A;  3BJ7 A;  4J3G A;  3TTH A;  1ZLH A;  3H8G A;  3DLJ A;  2YND A;  2ABZ A;  5F48 A;  2VL1 A;  1KUX A;  4R6T A;  4QUS A;  2C27 A;  2BO9 A;  3ZZI A;  1B87 A;  1M44 A;  2IQ6 A;  4NGM A;  5K8M A;  2P6F A;  2GU2 A;  2DPT A;  2VXK A;  2BL1 A;  1PCA A;  4U9Y A;  4UBR A;  4P4J A;  1R57 A;  3FB3 A;  4XPD C;  5HMN A;  1YX0 A;  1YK3 A;  4P4I A;  1NSL A;  1TKH A;  3TOA A;  4HKF A;  3WC7 A;  2Z0Z A;  4MFL A;  4R87 A;  1MJA A;  3C26 A;  4NGR A;  3LOD A;  1R43 A;  4UIA A;  5J8C A;  2ZEE A;  4P4F A;  1S7K A;  3TOB A;  3DSB A;  2F5I A;  1JQG A;  4MCP A;  3W91 A;  2HQY A;  4NGS A;  4B13 A;  5GCN A;  5EBV A;  1BPM A;  1EE3 P;  2PJ9 A;  2Z3P A;  3S6K A;  1MJB A;  1AYE A;  2VI7 A;  2KCW A;  5DS0 A;  3KGQ A;  2PRQ A;  2VBQ A;  3GY9 A;  3H5Z A;  2PVW A;  3SI1 A;  3TO6 A;  4ZGY B;  2Q04 A;  4KSA A;  2OB0 A;  1KUV A;  3PBB A;  4ONW A;  2VZZ A;  2YNE A;  3FYN A;  4R3K A;  3KAS A;  4NGT A;  5F47 A;  3LMS A;  2I00 A;  2V8G A;  5D29 A;  5F49 A;  4BMH A;  2R7H A;  1MJ9 A;  4MHD A;  3SXO A;  3PBE A;  3WR7 A;  1ELL P;  1VHE A;  4KZT A;  5AGE A;  4QB9 A;  4UCN A;  3IGR A;  2XEG A;  4IUS A;  2GE3 A;  3T8W A;  1XRY A;  5LYD A;  2PJ3 A;  3CXQ A;  3JUW A;  3R1K A;  2PJ4 A;  4F8Z A;  3KR5 A;  2RC4 A;  3FF3 A;  1S60 A;  4AXV A;  3PB7 X;  4OC3 A;  2EVN A;  3VH9 A;  1BOB A;  4OAD A;  4P10 A;  4ZY2 A;  4M6H A;  1P4N A;  2B58 A;  4F9U A;  4FUU A;  4LQ6 A;  3PGP A;  3S9M A;  4MCR A;  1BO4 A;  5HVF A;  4M6I A;  1XMT A;  1Y7R A;  4XPK A;  2ZOG A;  3EY5 A;  5EC4 A;  3RBU A;  2ZPA A;  1VKC A;  4A39 A;  5J1Q A;  4C2Y A;  1IGB A;  3D66 A;  1S3Z A;  2DEA A;  3F5B A;  5H84 A;  2RB7 A;  2F7V A;  2V77 A;  3WT4 A;  2NSM A;  1BPN A;  3PP9 A;  4KUA A;  1ARL A;  1UFH A;  3MGD A;  4CAV A;  3QAY A;  2CNT A;  2DF5 A;  1HDQ A;  1KZF A;  3FNC A;  4I49 A;  4NJR A;  4UA3 A;  2Q44 A;  4WWV A;  3BI1 A;  4JD6 A;  2HV2 A;  3R96 A;  3IWG A;  2CTC A;  1YVK A;  3IJ3 A;  2I3C A;  1OZP A;  2J8N A;  4MFQ A;  4OC2 A;  4NF1 A;  3NH8 A;  4AG9 A;  2CNM A;  3G8W A;  1GHE A;  1YVO A;  4CGM A;  3IFE A;  2VEZ A;  1VIX A;  3BLN A;  4OC1 A;  4AB7 A;  4CAW A;  5I0C A;  2PJC A;  1QST A;  2G3T A;  1MK4 A;  2PJB A;  4CGL A;  5C88 A;  3PB9 X;  3FVL A;  2Z11 A;  4R8F A;  4ZY1 A;  4BBH A;  5C82 A;  4IAV A;  4NXY A;  4UCP A;  2OU2 A;  1PYT B;  1Z8T A;  2EK8 A;  1IU8 A;  1IOF A;  1KWM A;  1M4I A;  2Q51 A;  2QVP A;  3GYA A;  4HNX B;  4NEX A;  3D7F A;  2CXA A;  2Q4V A;  3TC8 A;  4UFV A;  5DWN A;  1RO5 A;  4MMO A;  4MY3 A;  2EBJ A;  2FCK A;  3UY5 A;  2PR1 A;  2AE6 A;  2K5T A;  4C7H A;  4NGP A;  4R9M A;  2JDC A;  3SXN A;  5HH1 A;  4B10 A;  4YU9 A;  3D2M A;  1PU9 A;  3GLJ A;  5LRJ A;  2FIA A;  1X12 A;  3SI2 A;  4AVC A;  5CBM A;  1ON0 A;  8CPA A;  3FEC A;  3CPA A;  4H6Z A;  3TT2 A;  4KLW A;  3D7G A;  4FD5 A;  3I1U A;  4CYO A;  1S7F A;  4PK3 A;  4UEE A;  2XEJ A;  4C2X A;  1QSO A;  1YW4 A;  4NSQ A;  3SJE A;  3R9F A;  3H8E A;  5G20 A;  4JXR A;  4MFZ A;  2B4B A; 
#chains in the Genus database with same CATH homology
 3PZJ A;  1NMT A;  5F46 A;  3IU2 A;  4QVT A;  2GIV A;  4LUA A;  3G3S A;  3T9Y A;  4B5P B;  3S6G A;  2VZY A;  3TO7 A;  4YRH A;  2CY2 A;  3TE4 A;  1QSM A;  1ZO0 A;  2BUE A;  3R95 A;  1B6B A;  2YNC A;  5G21 A;  4EVY A;  5FVJ A;  3S6F A;  4CS0 B;  2HUZ A;  2EUI A;  4FD4 A;  4KOT A;  4KOS A;  4KS9 A;  1QSR A;  4CAE A;  2QEC A;  2QML A;  2YNC C;  4KOV A;  5J8F A;  4CGN A;  5A27 A;  4KSF A;  2BSW A;  4A31 A;  1IYL A;  1XF8 A;  5CNP A;  4UWI A;  3NE7 A;  2B4D B;  4B12 A;  4CRZ B;  4UFX A;  5G1Z A;  5G22 A;  2Q7B A;  1I12 A;  3ZJ0 A;  1V0C A;  4MFP A;  1WWZ A;  2GAN A;  5AG5 A;  1M1D A;  1YGH A;  5IX3 A;  5KTC A;  2O28 A;  2Z3O A;  4PSX A;  5KTD A;  1KUY A;  2P6G A;  1TIQ A;  4E8O A;  4MFJ A;  4B5P A;  3QAH A;  2Z3N A;  5DWM A;  1CM0 A;  2Z10 A;  3EXN A;  4ONU A;  4AVB A;  5AG4 A;  2WSA A;  1NE9 A;  4YGO A;  4KOR A;  4CAX A;  3B8G A;  4XNH B;  4FD6 A;  3CXS A;  5KTA A;  1WK4 A;  4M85 A;  4A30 A;  2WPW A;  2CNS A;  4F0Y A;  1M4G A;  4QBJ A;  3N7Z A;  3FBU A;  2JEV A;  1M4D A;  4H89 A;  3TO9 A;  1S7N A;  4AG7 A;  1Z4R A;  2D4O A;  2REF A;  4Y49 B;  3JVN A;  4UFW A;  4KVO E;  2B4D A;  2ZW5 A;  2X7B A;  4B14 A;  2FSR A;  2IL4 A;  4B5O A;  2P0W A;  2OZU A;  4R3L A;  1U6M A;  2FT0 A;  4MFK A;  2OZG A;  2NMT A;  4RI1 A;  4MJ8 A;  3FRM A;  5AG6 A;  4A33 A;  1Y9W A;  1YLE A;  3F0A A;  5IV0 A;  2P6E A;  4B11 A;  2D4P A;  3KKW A;  3H4Q A;  4C7I A;  1IYK A;  2B5G B;  2REE A;  4A32 A;  5AG7 A;  2H5M A;  3DDD A;  3D2P A;  1Q2Y A;  4A95 A;  5JQ4 A;  3P2F A;  2YGW A;  1XEB A;  3TCV A;  2OZH A;  2PR8 A;  4MI4 A;  4XNH C;  2FE7 A;  3TFY A;  1Z9U A;  2B3V A;  2G3A A;  1YR0 A;  1Z4E A;  4NCZ A;  1SQH A;  2Q0Y A;  1I1D A;  5A28 A;  4X5K A;  4E0A A;  3EO4 A;  2ATR A;  3JTK A;  2OH1 A;  2ZXV A;  1I21 A;  3I3G A;  4UWJ A;  4PV6 A;  4JLY A;  4CAF A;  4Y49 C;  3I9S A;  4CYN A;  5BWA B;  2R8V A;  4MY0 A;  2I79 A;  4U5Y A;  4C68 A;  2FXF A;  4L8A A;  4M3S A;  4A2Z A;  5ISV A;  4CYP A;  3R9E A;  5E96 A;  2QIR A;  4AVA A;  2A4N A;  3A9L A;  1Q2C A;  1S5K A;  3K9U A;  4MBU A;  2B5G A;  4ORF A;  4JWP A;  2DPS A;  4YFJ A;  2ZW7 A;  2G0B A;  4CYQ A;  1Q2D A;  2PDO A;  2ZW4 A;  4HNY B;  4F6A A;  3D3S A;  2ZW6 A;  3R9G A;  2BEI A;  4KLV A;  4KVX A;  5H86 A;  4HNW B;  4Q36 A;  1XIX A;  4H6U A;  4XPL A;  4CGP A;  2R98 A;  2FIW A;  1VHS A;  4FD7 A;  1J4J A;  4CRY B;  4KOU A;  1LRZ A;  3FIX A;  4IF5 A;  4KOX A;  4KVM E;  3EC4 A;  4JXQ A;  3SHP A;  4II9 A;  4F0X A;  5IB0 A;  2PC1 A;  2AJ6 A;  1XE4 A;  2JDD A;  3GKR A;  3VWE A;  1L0C A;  3DNS A;  3F8K A;  3QB8 A;  2Z3K A;  3LD2 A;  2Z3M A;  2JLM A;  4DNC A;  1K4J A;  4XPD B;  1IID A;  1N71 A;  4OAE A;  3E0K A;  2ARH A;  4C2Z A;  1S7L A;  1IIC A;  4ZBG A;  1CJW A;  3T90 A;  3EFA A;  3OWC A;  4KOW A;  2PQ8 A;  2WUU A;  2J8M A;  3P2H A;  3W6S A;  4PSW A;  4K30 A;  4QC6 A;  4KOY A;  3S6H A;  3FXT A;  3IU1 A;  4KUB A;  1FY7 A;  4LX9 A;  2VQY A;  4U9Z A;  4Q38 A;  3DR6 A;  4JJX A;  2PRB A;  3CXP A;  4CGO A;  3V8I A;  4E2A A;  3RYO A;  4UCM A;  1RXT A;  2J8R A;  4OLL A;  4R57 A;  1YRE A;  4L89 A;  1P0H A;  3IWE A;  2FS5 A;  5JPH A;  4RS2 A;  2PSW A;  1PUA A;  4PK2 A;  2WPX A;  2DXQ A;  3BJ8 A;  2Q4Y A;  3VWD A;  3W6X A;  1IB1 E;  1QSN A;  1Y9K A;  2FL4 A;  3DR8 A;  4GS4 A;  2Z3L A;  3D8P A;  2R1I A;  2B3U A;  2Y0M A;  3BJ7 A;  4J3G A;  3TTH A;  2YND A;  5F48 A;  1KUX A;  4QUS A;  2C27 A;  3ZZI A;  1B87 A;  1M44 A;  2P6F A;  2DPT A;  2VXK A;  2BL1 A;  4U9Y A;  4UBR A;  4XPD C;  5HMN A;  1R57 A;  3FB3 A;  1YX0 A;  1YK3 A;  1NSL A;  3TOA A;  4HKF A;  2Z0Z A;  4MFL A;  4R87 A;  1MJA A;  3C26 A;  3LOD A;  5J8C A;  1S7K A;  3TOB A;  3DSB A;  2F5I A;  3W91 A;  2HQY A;  4B13 A;  5GCN A;  2Z3P A;  3S6K A;  1MJB A;  2VI7 A;  2KCW A;  4ZGY B;  2VBQ A;  3GY9 A;  3H5Z A;  3TO6 A;  2Q04 A;  4KSA A;  2OB0 A;  1KUV A;  2VZZ A;  2YNE A;  3FYN A;  4R3K A;  5F47 A;  2I00 A;  5F49 A;  4BMH A;  2R7H A;  1MJ9 A;  4MHD A;  3SXO A;  3WR7 A;  4KZT A;  5AGE A;  4QB9 A;  4UCN A;  3IGR A;  4IUS A;  2GE3 A;  3CXQ A;  3JUW A;  3R1K A;  2RC4 A;  1S60 A;  2EVN A;  1BOB A;  4OAD A;  1P4N A;  2B58 A;  3PGP A;  1BO4 A;  1XMT A;  1Y7R A;  4XPK A;  3EY5 A;  5EC4 A;  2ZPA A;  1VKC A;  4C2Y A;  1S3Z A;  3F5B A;  5H84 A;  3PP9 A;  4KUA A;  1UFH A;  3MGD A;  4CAV A;  2CNT A;  3FNC A;  1KZF A;  4I49 A;  4UA3 A;  5EBV A;  3R96 A;  2Q44 A;  4JD6 A;  2HV2 A;  3IWG A;  1YVK A;  1OZP A;  2J8N A;  4MFQ A;  4NF1 A;  4AG9 A;  2CNM A;  3G8W A;  1GHE A;  1YVO A;  4CGM A;  5I0C A;  2VEZ A;  3BLN A;  4AB7 A;  4CAW A;  1QST A;  2G3T A;  1MK4 A;  5C88 A;  4CGL A;  2Z11 A;  5C82 A;  4BBH A;  4NXY A;  4UCP A;  2OU2 A;  4HNX B;  1M4I A;  3GYA A;  4NEX A;  2CXA A;  2Q4V A;  4UFV A;  5DWN A;  1RO5 A;  4MY3 A;  2FCK A;  3UY5 A;  2PR1 A;  2AE6 A;  2K5T A;  4C7H A;  4R9M A;  2JDC A;  3SXN A;  5HH1 A;  4B10 A;  3D2M A;  1PU9 A;  4AVC A;  2FIA A;  1ON0 A;  4H6Z A;  3TT2 A;  4KLW A;  4FD5 A;  4CYO A;  1S7F A;  4PK3 A;  4C2X A;  1QSO A;  4NSQ A;  3R9F A;  5G20 A;  4JXR A;  4MFZ A;  2B4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...