1ZO0A

Nmr structure of antizyme isoform 1 from rat
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
126
structure length
126
Chain Sequence
ILYSDERLNVTEEPTSNDKTRVLSIQCTLTEAKQVTWRAVWNGGGLYIELPAGPLPEGSKDSFAALLEFAEEQLRADHVFICFPKNREDRAALLRTFSFLGFEIVRPGHPLVPKRPDACFMVYTLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ornithine decarboxylase antizyme
publication title NMR structure of antizyme isoform 1 from rat
rcsb
source organism Rattus norvegicus
molecule tags Lyase inhibitor
total genus 20
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02100 ODC_AZ Ornithine decarboxylase antizyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.60 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1zo0A00
1ZO0A 5BWAB 4ZGYB
chains in the Genus database with same CATH superfamily
3N5FA 4MCRA 1XMTA 2CNMA 4MJ8A 4MFZA 1Y0YA 2R1IA 3FMCA 1YVOA 4ZY2A 4LQGA 2FIWA 2ZW6A 3TT2A 2J9AA 3PP9A 5H86A 3NA6A 4AVBA 3T9YA 4AG7A 1Q7LA 1Y7RA 1Z8LA 4R7MA 4CYNA 2I3CA 3FBUA 1XBUA 2P6GA 2PJ9A 3NFZA 4C2ZA 2PJ7A 2VBQA 2EO8A 5F46A 1OBRA 4ZY1A 3K2KA 2PRBA 2PJCA 2ZOGA 3D7FA 4MFLA 3TCVA 1LAPA 5G20A 2J8MA 3IWWA 4JZ0A 3G8WA 8CPAA 2G3AA 2BOAA 2GU2A 2WPWA 4UEFA 3FRMA 1M4IA 4PQAA 4UWIA 2JBKA 2FIAA 4MFJA 3PBBA 2OB0A 4MFQA 4KVOE 5EC4A 4P4EA 2HUZA 4XNHC 3TO7A 4CGLA 3IIBA 5IB0A 5AG4A 3V8IA 3VH9A 1P0HA 5H84A 4NSQA 1BAVA 2ZEGA 2PCUA 4A33A 1Y7EA 1S3ZA 2OZUA 3D7GA 4EVYA 4PPZA 1YSJA 2BEIA 4UIAA 3HLPA 4MCPA 5D29A 3JVNA 1LANA 3FH4A 3IFEA 1VHSA 3GIUA 3GYAA 3PFEA 4MRIA 4P4DA 4CGMA 3EXNA 4P10A 2H5MA 4DJLA 1KUXA 3IGRA 2V8VA 4CAEA 2Q4ZA 4LQ6A 4XPDB 2B3UA 4F6AA 3DLJA 1ON0A 4A39A 2RC4A 4M6HA 4LX9A 3SI2A 1CJWA 2Q4YA 2WPXA 4B6ZA 4CRYB 1TIQA 1YW6A 3B7IA 2PJ0A 3DSBA 3MN8A 5I4MA 3TE4A 4CAWA 2B4BA 4XNHB 4C7HA 1Y9WA 4MFPA 1CG2A 4UWJA 4KOWA 3TO9A 4OC3A 1P4NA 2C27A 4OP4A 4NGTA 2ZOFA 4NXYA 2NYQA 2Q0YA 4OIWA 1QSTA 4JWPA 3W6SA 1BPMA 2FXFA 4CAVA 4PXEA 3SI0A 3D2PA 3N7ZA 5I0CA 2OR4A 1Z4RA 2C6GA 5IV0A 5AGEA 4Z65A 3PFOA 5LYFA 3S6HA 2BO9A 4CAXA 2J8RA 3FEDA 3KHXA 4EMEA 1AUGA 2EVNA 1I12A 3R9FA 3PRTA 3PZJA 1J4JA 4ORFA 3QNVA 4P4JA 4MMOA 4GM5A 3WR7A 2REEA 4C2XA 1VHEA 2BUEA 3A9LA 1ARMA 3TFYA 2Q4VA 3VATA 5BWAB 5DWNA 4RN7A 2HQYA 2JLMA 1YX0A 3MGDA 3KASA 2AFZA 1Q2YA 2WZNA 2XEFA 2PJ3A 2I00A 4F9UA 2P6FA 2PJ5A 2XEGA 4DUKA 4HNYB 5LYIA 2PVWA 3RZAA 2XEIA 1QSOA 2QIRA 3F5BA 3VWDA 4M6IA 3LACA 3B8GA 1XRYA 1ZG8A 3LWUA 3QAYA 5G21A 4KOXA 1LRZA 3KR4A 3D7DA 4UA3A 7CPAA 1TF8A 1R43A 4K30A 4UEZA 2RFHA 1HEEA 1XIXA 4QC6A 3V38A 3WABA 4EFDA 2XEJA 2CF4A 2GLJA 3L2NA 3TTHA 5CBMA 4M3SA 4NEXA 3LODA 2ZEFA 3KKWA 4I49A 5G1ZA 5HVGA 2CNSA 1S7LA 2Z3NA 1PU9A 3PB9X 4LUAA 2GREA 4QUSA 4YRHA 2ZEMA 3DR6A 3QAHA 3W91A 2O28A 5A28A 2K5TA 5IX3A 2GLFA 3KL9A 1SQHA 1U6MA 1MJBA 5EMIA 4OAEA 5HVFA 1BPNA 3ISZA 3JUWA 1YVKA 3S9MA 4X2TA 4KZTA 1QMUA 3D68A 3B3WA 2PC1A 4RI1A 4YFJA 4U5YA 4MHDA 1QSNA 3NE7A 1GHEA 3CXQA 3R96A 2EK9A 1X10A 1UFHA 2PJ8A 3EO4A 1HDQA 4UFWA 4CYQA 3P2HA 4Y49C 1IYKA 2ZELA 3D7HA 4KOSA 4CAFA 2HB6A 1M4LA 2DEAA 4TNUA 1ELMP 4A95A 3CXPA 5LRJA 2B4DA 4P45A 3SJFA 3T90A 1R57A 1Z9UA 4H2KA 4Q38A 4E8OA 3IWEA 4UCNA 3WT4A 1QSMA 5J8CA 4R9MA 3RBUA 3CXSA 4PXDA 4AVCA 2A4NA 4FAIA 4F0XA 5AG7A 1N71A 4IHMA 1K4JA 3GB0A 1LCPA 4F8ZA 2J8NA 1XJOA 3BI0A 2ABZA 4YWYA 4NFRA 1Q2DA 3TC8A 2EK8A 1XMBA 3GKRA 3H8FA 2AFUA 2VZZA 2AFSA 2PJ4A 2V77A 3KGQA 4A37A 4B12A 4C7IA 5THWA 4DYOA 1S5KA 4P4FA 2BCOA 3I9SA 3KZWA 2G3TA 2VQYA 3JRUA 3DDDA 4M6GA 5KTDA 1BO4A 4ZYQA 1S7FA 5F49A 2G9DA 4CPAA 2R8VA 3KI9A 4CRZB 2CY2A 1OZPA 4MHNA 1X12A 2AJ6A 5EBVA 1EE3P 4P4BA 4JLYA 3D8PA 2ZEHA 1BOBA 3P2FA 2OOTA 5F48A 3MRUA 2BSWA 2IQ6A 3KQXA 1WK4A 1WWZA 5HH1A 5LRGA 2V8HA 4A32A 1RO5A 3H8EA 1XEBA 1H8LA 1MJ9A 2GFQA 3D2MA 3D4UA 2JEWA 3NE8A 3H4QA 1IY7A 3IWGA 4ZX9A 3KR5A 2D4OA 3WC5A 2NMTA 1TKJA 2QMLA 5CNPA 3VWEA 1MK4A 3ZZIA 1LAMA 5F09A 4MY3A 5AG6A 1ZG7A 4K3NA 2YNCC 5FVJA 2CIJA 4MHZA 1ZLIA 1UWYA 4QBJA 3ZJ0A 1R3NA 1DE4C 2CTCA 2FVGA 4R57A 4CS0B 4CGPA 2P6EA 2V8GA 3C26A 4A31A 2O4HA 2Z11A 3PEIA 4JYWA 2Q43A 1B87A 2WUUA 3IO1A 3FF3A 4GS4A 5K8PA 2ODFA 3QB8A 3S6GA 1M1DA 1B6BA 1KUVA 4FUUA 3S9NA 4XPLA 4X5KA 4ZY0A 3RAMA 2DPTA 1YLOA 1IOFA 3F8KA 3TX8A 5LYLA 4B5PA 4CYPA 4OC1A 3D3SA 3R9GA 4IK2A 2X7BA 4ONWA 1PYTB 2B5GA 4R87A 4CGOA 1ELLP 4Q36A 2DPSA 5ISVA 1L0CA 4RUHA 2PIYA 2Z3LA 2C6CA 2F5IA 1DTDA 4PXCA 2HV2A 1VIXA 3IU2A 4IAVA 3PGPA 5CPAA 6CPAA 2JDDA 2Q51A 4H89A 5HVHA 5DS0A 2PJ2A 2Q7BA 1RXTA 4X8IA 4HNWB 3H8GA 1ZO0A 3EFAA 5G22A 2OZHA 4UEEA 4AXVA 2PQ8A 1VHOA 4E2AA 4KOVA 2IMOA 4MY0A 4UCMA 1S60A 1JQGA 2YNDA 3GY9A 3SJXA 3UY5A 2ZPAA 2QECA 2PDOA 2DF5A 3NH8A 5AG5A 4R8FA 4UCPA 3SJGA 1S7KA 3FYNA 1BLLE 4IF5A 3CPAA 4ZGYB 5JPHA 4OIDA 5ELYA 2ZEEA 3S9LA 2B4DB 3LMSA 3S6KA 4KLVA 1AMPA 2IJZA 3NH5A 2YNCA 1NSAA 4EWTA 4KORA 1CBXA 2PR1A 4KSFA 4R76A 4NGRA 2Y0MA 1KWMA 2AFWA 3KQZA 4G1PA 3I1UA 4ZBGA 4A38A 1Z4EA 4Q7AA 1YK3A 1M4GA 3BJ7A 3PB7X 1YW4A 2AE6A 4MHYA 3V7ZA 1CP6A 2PR8A 1GYTA 1A2ZA 2YGWA 1VGYA 2AFXA 4L8AA 2REFA 2OZGA 3IU1A 1Y9KA 1CPSA 5JQ4A 4U9ZA 3FXTA 2FCKA 2G0BA 1TKFA 4FD6A 4M85A 3FB3A 4OLLA 4C68A 1ARLA 1AYEA 4B10A 4O23A 4YU9A 4ZX8A 1MJAA 2VL1A 2Z3OA 3BHXA 2ZXVA 3NH4A 2PJ6A 3K9TA 4FWUA 4ONUA 4ZI6A 3IC1A 1CM0A 2WYRA 4FD7A 5E96A 4OC5A 1TKHA 3BXMA 4L89A 1FNOA 3B2YA 4PV6A 3HUVA 4OMEA 4E0AA 5JH9A 2Z3PA 4JXQA 2JDCA 1F2PA 2PJ1A 1TXRA 4KOTA 2C1CA 4KVXA 5D8NA 5LYDA 4NF1A 3SJEA 5C82A 2ZEPA 5JM6A 2QVPA 2FSRA 2YNEA 3H5ZA 4KUAA 2Z10A 1I21A 2F8HA 4HPSA 2PVVA 2VI7A 4P44A 4R3LA 1NE9A 2ZW5A 4DNCA 4KSAA 1YGHA 2JEVA 4A2ZA 1Z8WA 4U9YA 3R9EA 1LFWA 4Y49B 5J8FA 2PJAA 2EBJA 2CTBA 1F57A 1Z5RA 3K9UA 4F0YA 2CNTA 3IEHA 2ZEDA 3S6FA 3FJUA 4TWEA 3ISXA 1RTQA 4KOUA 1KZFA 4BMHA 4F9VA 5KTCA 2Q44A 2V8DA 4HKFA 2R7HA 4BBHA 2Q04A 3SHPA 4XPDC 5K8MA 3SXOA 4R3KA 1V0CA 3FECA 2EWBA 5F47A 1YLEA 4R6TA 4B11A 4B5PB 2VZYA 1JWQA 1Q2CA 1VKCA 4BD9A 3WC6A 4OKOA 2B5GB 4MHPA 4OADA 4OC4A 3EY5A 2OU2A 2ZENA 4UFVA 3PBEA 1XOVA 4OC2A 3W6XA 2PE3A 2Z3MA 3IJ3A 4PXBA 1I1DA 4HNXB 3LD2A 4KVME 3CT9A 2Z0ZA 1XF8A 2FT0A 1PUAA 2VEZA 2AFOA 2PSWA 4OC0A 3D67A 4MI4A 4NCZA 4MCSA 2OH1A 4H6ZA 1YREA 1M44A 4A94A 1IICA 2DXQA 4WJBA 4P6YA 2Z3KA 4NGNA 5HMNA 2QJ8A 2RB7A 2IL4A 1NMTA 1XFOA 2ZW4A 3CZXA 3DGVA 5DWMA 5A27A 2F7VA 2ANPA 1TF9A 2CXAA 3FNCA 3TOAA 4AVAA 4BINA 1QSRA 4B13A 1FT7A 2AFMA 4H6UA 4W9YA 3BJ8A 3FEEA 2ARHA 4NJQA 4KSIA 4JXRA 1IOIA 2QYVA 4WWVA 2PJBA 3B3VA 2R98A 3PB6X 3SXNA 1ZLHA 2B3VA 1YR0A 2POKA 2ATRA 4FD5A 4NGPA 1PCAA 3B3SA 5LRKA 3VARA 4PSXA 4A30A 5HXDA 4CGNA 3DR8A 2O53A 4GXHA 4II9A 1Z8TA 3E0KA 4MXUA 2VXKA 4AB7A 4RS2A 3RYOA 4KLWA 3RO0A 2GE3A 2PRQA 1S7NA 3F0AA 3BI1A 4JJXA 4AG9A 5KTAA 1CX8A 5JGFA 4XPKA 2ZEOA 2D4PA 1YMEA 2JBJA 4MBUA 5K8NA 2KCWA 3BLNA 4J3GA 4NGMA 4X3RA 4UIBA 4PSWA 5GCNA 4UBRA 4C2YA 3G3SA 1IYLA 3OWCA 3B35A 4NJRA 1IIDA 3D66A 5J1QA 1HDUA 3TOBA 4CYOA 2P0WA 3KHZA 1CPXA 4MFKA 4B14A 3CDXA 3CPXA 4KOYA 1CP7A 2B58A 3GLJA 2NSMA 4IUSA 3FX6A 2I79A 3PB8X 1FY7A 3B3TA 3WC7A 1IU8A 3R95A 5C88A 2EUIA 3GUXA 4P4IA 4NGSA 3DNSA 5K8OA 1KUYA 3SI1A 2C6PA 4MCQA 1IB1E 3B3CA 2BL1A 2WSAA 4QB9A 3RNZA 2HC9A 3PB4X 4YGOA 2GIVA 1QQ9A 1Z2LA 4KUBA 1XE4A 3FIXA 3T8WA 1LOKA 3R1KA 2ZW7A 4NGQA 4UF4A 4FD4A 2FS5A 4KS9A 2PIZA 4B5OA 1M4DA 1F2OA 2FE7A 3EC4A 4JD6A 4FBEA 1IGBA 3I3GA 4QVTA 4PK2A 1NSLA 3TO6A 1Y0RA 2GANA 4UFXA 2FL4A 3FVLA 5IB9A 2Q7SA 3JTKA 1YQEA 1Z8XA 4PK3A 1ZG9A
chains in the Genus database with same CATH topology
1XMTA 2CNMA 4MJ8A 4MFZA 2R1IA 1YVOA 2FIWA 2ZW6A 3TT2A 3PP9A 5H86A 4AVBA 3T9YA 4AG7A 1Y7RA 4CYNA 3FBUA 2P6GA 4C2ZA 2VBQA 5F46A 2PRBA 3TCVA 4MFLA 5G20A 2J8MA 3G8WA 2G3AA 2WPWA 3FRMA 1M4IA 4UWIA 2FIAA 4MFJA 2OB0A 4MFQA 4KVOE 5EC4A 2HUZA 4XNHC 3TO7A 4CGLA 5IB0A 5AG4A 3V8IA 1P0HA 5H84A 4NSQA 4A33A 1S3ZA 2OZUA 4EVYA 2BEIA 3JVNA 4CGMA 1VHSA 3GYAA 3EXNA 2H5MA 1KUXA 3IGRA 4CAEA 4XPDB 2B3UA 4F6AA 1ON0A 2RC4A 4LX9A 1CJWA 2Q4YA 2WPXA 4CRYB 1TIQA 3TE4A 3DSBA 4CAWA 2B4BA 4XNHB 4C7HA 1Y9WA 4MFPA 4UWJA 4KOWA 3TO9A 1P4NA 2C27A 4NXYA 2Q0YA 1QSTA 4JWPA 3W6SA 2FXFA 4CAVA 3D2PA 3N7ZA 5I0CA 1Z4RA 5IV0A 5AGEA 3S6HA 4CAXA 2J8RA 2EVNA 1I12A 3R9FA 3PZJA 1J4JA 4ORFA 3WR7A 2REEA 4C2XA 2BUEA 3A9LA 3TFYA 2Q4VA 5BWAB 5DWNA 2HQYA 2JLMA 1YX0A 3MGDA 1Q2YA 2I00A 2P6FA 4HNYB 1QSOA 2QIRA 3F5BA 3VWDA 5G21A 3B8GA 4KOXA 1LRZA 4UA3A 4K30A 1XIXA 4QC6A 3TTHA 4M3SA 4NEXA 3LODA 3KKWA 4I49A 5G1ZA 2CNSA 1S7LA 2Z3NA 1PU9A 4LUAA 4QUSA 4YRHA 3DR6A 3QAHA 3W91A 2O28A 5A28A 2K5TA 5IX3A 1SQHA 1U6MA 1MJBA 4OAEA 3JUWA 1YVKA 4KZTA 2PC1A 4RI1A 4YFJA 4U5YA 4MHDA 1QSNA 3NE7A 1GHEA 3CXQA 3R96A 1UFHA 3EO4A 4UFWA 4CYQA 3P2HA 4Y49C 1IYKA 4KOSA 4CAFA 4A95A 3CXPA 2B4DA 3T90A 1R57A 1Z9UA 4Q38A 4E8OA 5J8CA 3IWEA 4UCNA 1QSMA 4R9MA 3CXSA 4AVCA 2A4NA 4F0XA 5AG7A 1N71A 1K4JA 2J8NA 1Q2DA 3GKRA 2VZZA 4B12A 4C7IA 1S5KA 3I9SA 2G3TA 2VQYA 3DDDA 5KTDA 1BO4A 1S7FA 5F49A 2R8VA 4CRZB 2CY2A 1OZPA 2AJ6A 5EBVA 4JLYA 3D8PA 1BOBA 3P2FA 2BSWA 1WK4A 1WWZA 5HH1A 4A32A 1RO5A 1XEBA 1MJ9A 3D2MA 3H4QA 3IWGA 2D4OA 2NMTA 2QMLA 3VWEA 5CNPA 3ZZIA 1MK4A 4MY3A 5AG6A 2YNCC 5FVJA 4QBJA 3ZJ0A 4CS0B 4R57A 4CGPA 2P6EA 3C26A 4A31A 2Z11A 1B87A 2WUUA 4GS4A 3QB8A 3S6GA 1M1DA 1B6BA 1KUVA 4XPLA 4X5KA 2DPTA 3F8KA 4B5PA 4CYPA 3D3SA 3R9GA 2X7BA 2B5GA 4R87A 4CGOA 4Q36A 5ISVA 2DPSA 1L0CA 2Z3LA 2F5IA 2HV2A 3IU2A 3PGPA 2JDDA 4H89A 2Q7BA 1RXTA 4HNWB 1ZO0A 3EFAA 5G22A 2OZHA 2PQ8A 4E2AA 4KOVA 4MY0A 4UCMA 1S60A 2YNDA 3GY9A 3UY5A 2ZPAA 2QECA 2PDOA 5AG5A 4UCPA 1S7KA 3FYNA 4IF5A 5JPHA 4ZGYB 2B4DB 3S6KA 4KLVA 2YNCA 4KORA 2PR1A 4KSFA 2Y0MA 4ZBGA 1Z4EA 1YK3A 1M4GA 3BJ7A 2AE6A 2PR8A 2YGWA 4L8AA 2REFA 2OZGA 3IU1A 1Y9KA 5JQ4A 4U9ZA 3FXTA 2FCKA 2G0BA 4M85A 4FD6A 4C68A 3FB3A 4OLLA 4B10A 1MJAA 2Z3OA 2ZXVA 4ONUA 1CM0A 4FD7A 5E96A 4L89A 4PV6A 4E0AA 2Z3PA 4JXQA 2JDCA 4KOTA 4KVXA 4AVAA 5KTCA 5C82A 4NF1A 2FSRA 2YNEA 3H5ZA 4KUAA 2Z10A 1I21A 5F48A 3SHPA 2VI7A 4R3LA 1NE9A 2ZW5A 4DNCA 4KSAA 1YGHA 2JEVA 4A2ZA 4U9YA 3R9EA 4Y49B 5J8FA 3K9UA 4F0YA 2CNTA 3S6FA 4KOUA 4BMHA 1KZFA 2Q44A 4HKFA 2R7HA 4BBHA 2Q04A 4XPDC 3SXOA 4R3KA 1V0CA 5F47A 1YLEA 4B11A 4B5PB 2VZYA 1Q2CA 1VKCA 2B5GB 4OADA 3EY5A 2OU2A 4UFVA 3W6XA 2Z3MA 1I1DA 4HNXB 3LD2A 4KVME 2Z0ZA 1XF8A 2FT0A 1PUAA 2VEZA 2PSWA 4MI4A 4NCZA 2OH1A 4H6ZA 1YREA 1M44A 1IICA 2DXQA 2Z3KA 5HMNA 2IL4A 1NMTA 5DWMA 2ZW4A 5A27A 3TOAA 2CXAA 3FNCA 1QSRA 4B13A 4H6UA 3BJ8A 2ARHA 4JXRA 2R98A 3SXNA 2B3VA 1YR0A 2ATRA 4FD5A 4PSXA 4A30A 4CGNA 3DR8A 4II9A 3E0KA 2VXKA 4AB7A 4RS2A 3RYOA 4KLWA 2GE3A 4AG9A 1S7NA 3F0AA 4JJXA 5KTAA 4XPKA 2D4PA 4MBUA 2KCWA 3BLNA 4J3GA 4PSWA 5GCNA 4UBRA 4C2YA 3G3SA 1IYLA 3OWCA 1IIDA 3TOBA 4CYOA 2P0WA 4MFKA 4B14A 4KOYA 2B58A 4IUSA 2I79A 1FY7A 3R95A 5C88A 2EUIA 3DNSA 1KUYA 1IB1E 4QB9A 2BL1A 2WSAA 4YGOA 2GIVA 4KUBA 1XE4A 3FIXA 3R1KA 2ZW7A 4FD4A 2FS5A 4KS9A 4B5OA 1M4DA 2FE7A 3EC4A 4JD6A 3I3GA 4QVTA 4PK2A 1NSLA 3TO6A 2GANA 4UFXA 2FL4A 3JTKA 4PK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZO0 A;  5BWA B;  4ZGY B; 
#chains in the Genus database with same CATH topology
 3N5F A;  4MCR A;  1XMT A;  2CNM A;  4MJ8 A;  4MFZ A;  1Y0Y A;  2R1I A;  3FMC A;  1YVO A;  4ZY2 A;  4LQG A;  2FIW A;  2ZW6 A;  3TT2 A;  2J9A A;  3PP9 A;  5H86 A;  3NA6 A;  4AVB A;  3T9Y A;  4AG7 A;  1Q7L A;  1Y7R A;  1Z8L A;  4R7M A;  4CYN A;  2I3C A;  3FBU A;  1XBU A;  2P6G A;  2PJ9 A;  3NFZ A;  4C2Z A;  2PJ7 A;  2VBQ A;  2EO8 A;  5F46 A;  1OBR A;  4ZY1 A;  3K2K A;  2PRB A;  2PJC A;  2ZOG A;  3D7F A;  4MFL A;  3TCV A;  1LAP A;  5G20 A;  2J8M A;  3IWW A;  4JZ0 A;  3G8W A;  8CPA A;  2G3A A;  2BOA A;  2GU2 A;  2WPW A;  4UEF A;  3FRM A;  1M4I A;  4PQA A;  4UWI A;  2JBK A;  2FIA A;  4MFJ A;  3PBB A;  2OB0 A;  4MFQ A;  4KVO E;  5EC4 A;  4P4E A;  2HUZ A;  4XNH C;  3TO7 A;  4CGL A;  3IIB A;  5IB0 A;  5AG4 A;  3V8I A;  3VH9 A;  1P0H A;  5H84 A;  4NSQ A;  1BAV A;  2ZEG A;  2PCU A;  4A33 A;  1Y7E A;  1S3Z A;  2OZU A;  3D7G A;  4EVY A;  4PPZ A;  1YSJ A;  2BEI A;  4UIA A;  3HLP A;  4MCP A;  5D29 A;  3JVN A;  1LAN A;  3FH4 A;  3IFE A;  1VHS A;  3GIU A;  3GYA A;  3PFE A;  4MRI A;  4P4D A;  4CGM A;  3EXN A;  4P10 A;  2H5M A;  4DJL A;  1KUX A;  3IGR A;  2V8V A;  4CAE A;  2Q4Z A;  4LQ6 A;  4XPD B;  2B3U A;  4F6A A;  3DLJ A;  1ON0 A;  4A39 A;  2RC4 A;  4M6H A;  4LX9 A;  3SI2 A;  1CJW A;  2Q4Y A;  2WPX A;  4B6Z A;  4CRY B;  1TIQ A;  1YW6 A;  3B7I A;  2PJ0 A;  3DSB A;  3MN8 A;  5I4M A;  3TE4 A;  4CAW A;  2B4B A;  4XNH B;  4C7H A;  1Y9W A;  4MFP A;  1CG2 A;  4UWJ A;  4KOW A;  3TO9 A;  4OC3 A;  1P4N A;  2C27 A;  4OP4 A;  4NGT A;  2ZOF A;  4NXY A;  2NYQ A;  2Q0Y A;  4OIW A;  1QST A;  4JWP A;  3W6S A;  1BPM A;  2FXF A;  4CAV A;  4PXE A;  3SI0 A;  3D2P A;  3N7Z A;  5I0C A;  2OR4 A;  1Z4R A;  2C6G A;  5IV0 A;  5AGE A;  4Z65 A;  3PFO A;  5LYF A;  3S6H A;  2BO9 A;  4CAX A;  2J8R A;  3FED A;  3KHX A;  4EME A;  1AUG A;  2EVN A;  1I12 A;  3R9F A;  3PRT A;  3PZJ A;  1J4J A;  4ORF A;  3QNV A;  4P4J A;  4MMO A;  4GM5 A;  3WR7 A;  2REE A;  4C2X A;  1VHE A;  2BUE A;  3A9L A;  1ARM A;  3TFY A;  2Q4V A;  3VAT A;  5BWA B;  5DWN A;  4RN7 A;  2HQY A;  2JLM A;  1YX0 A;  3MGD A;  3KAS A;  2AFZ A;  1Q2Y A;  2WZN A;  2XEF A;  2PJ3 A;  2I00 A;  4F9U A;  2P6F A;  2PJ5 A;  2XEG A;  4DUK A;  4HNY B;  5LYI A;  2PVW A;  3RZA A;  2XEI A;  1QSO A;  2QIR A;  3F5B A;  3VWD A;  4M6I A;  3LAC A;  3B8G A;  1XRY A;  1ZG8 A;  3LWU A;  3QAY A;  5G21 A;  4KOX A;  1LRZ A;  3KR4 A;  3D7D A;  4UA3 A;  7CPA A;  1TF8 A;  1R43 A;  4K30 A;  4UEZ A;  2RFH A;  1HEE A;  1XIX A;  4QC6 A;  3V38 A;  3WAB A;  4EFD A;  2XEJ A;  2CF4 A;  2GLJ A;  3L2N A;  3TTH A;  5CBM A;  4M3S A;  4NEX A;  3LOD A;  2ZEF A;  3KKW A;  4I49 A;  5G1Z A;  5HVG A;  2CNS A;  1S7L A;  2Z3N A;  1PU9 A;  3PB9 X;  4LUA A;  2GRE A;  4QUS A;  4YRH A;  2ZEM A;  3DR6 A;  3QAH A;  3W91 A;  2O28 A;  5A28 A;  2K5T A;  5IX3 A;  2GLF A;  3KL9 A;  1SQH A;  1U6M A;  1MJB A;  5EMI A;  4OAE A;  5HVF A;  1BPN A;  3ISZ A;  3JUW A;  1YVK A;  3S9M A;  4X2T A;  4KZT A;  1QMU A;  3D68 A;  3B3W A;  2PC1 A;  4RI1 A;  4YFJ A;  4U5Y A;  4MHD A;  1QSN A;  3NE7 A;  1GHE A;  3CXQ A;  3R96 A;  2EK9 A;  1X10 A;  1UFH A;  2PJ8 A;  3EO4 A;  1HDQ A;  4UFW A;  4CYQ A;  3P2H A;  4Y49 C;  1IYK A;  2ZEL A;  3D7H A;  4KOS A;  4CAF A;  2HB6 A;  1M4L A;  2DEA A;  4TNU A;  1ELM P;  4A95 A;  3CXP A;  5LRJ A;  2B4D A;  4P45 A;  3SJF A;  3T90 A;  1R57 A;  1Z9U A;  4H2K A;  4Q38 A;  4E8O A;  3IWE A;  4UCN A;  3WT4 A;  1QSM A;  5J8C A;  4R9M A;  3RBU A;  3CXS A;  4PXD A;  4AVC A;  2A4N A;  4FAI A;  4F0X A;  5AG7 A;  1N71 A;  4IHM A;  1K4J A;  3GB0 A;  1LCP A;  4F8Z A;  2J8N A;  1XJO A;  3BI0 A;  2ABZ A;  4YWY A;  4NFR A;  1Q2D A;  3TC8 A;  2EK8 A;  1XMB A;  3GKR A;  3H8F A;  2AFU A;  2VZZ A;  2AFS A;  2PJ4 A;  2V77 A;  3KGQ A;  4A37 A;  4B12 A;  4C7I A;  5THW A;  4DYO A;  1S5K A;  4P4F A;  2BCO A;  3I9S A;  3KZW A;  2G3T A;  2VQY A;  3JRU A;  3DDD A;  4M6G A;  5KTD A;  1BO4 A;  4ZYQ A;  1S7F A;  5F49 A;  2G9D A;  4CPA A;  2R8V A;  3KI9 A;  4CRZ B;  2CY2 A;  1OZP A;  4MHN A;  1X12 A;  2AJ6 A;  5EBV A;  1EE3 P;  4P4B A;  4JLY A;  3D8P A;  2ZEH A;  1BOB A;  3P2F A;  2OOT A;  5F48 A;  3MRU A;  2BSW A;  2IQ6 A;  3KQX A;  1WK4 A;  1WWZ A;  5HH1 A;  5LRG A;  2V8H A;  4A32 A;  1RO5 A;  3H8E A;  1XEB A;  1H8L A;  1MJ9 A;  2GFQ A;  3D2M A;  3D4U A;  2JEW A;  3NE8 A;  3H4Q A;  1IY7 A;  3IWG A;  4ZX9 A;  3KR5 A;  2D4O A;  3WC5 A;  2NMT A;  1TKJ A;  2QML A;  5CNP A;  3VWE A;  1MK4 A;  3ZZI A;  1LAM A;  5F09 A;  4MY3 A;  5AG6 A;  1ZG7 A;  4K3N A;  2YNC C;  5FVJ A;  2CIJ A;  4MHZ A;  1ZLI A;  1UWY A;  4QBJ A;  3ZJ0 A;  1R3N A;  1DE4 C;  2CTC A;  2FVG A;  4R57 A;  4CS0 B;  4CGP A;  2P6E A;  2V8G A;  3C26 A;  4A31 A;  2O4H A;  2Z11 A;  3PEI A;  4JYW A;  2Q43 A;  1B87 A;  2WUU A;  3IO1 A;  3FF3 A;  4GS4 A;  5K8P A;  2ODF A;  3QB8 A;  3S6G A;  1M1D A;  1B6B A;  1KUV A;  4FUU A;  3S9N A;  4XPL A;  4X5K A;  4ZY0 A;  3RAM A;  2DPT A;  1YLO A;  1IOF A;  3F8K A;  3TX8 A;  5LYL A;  4B5P A;  4CYP A;  4OC1 A;  3D3S A;  3R9G A;  4IK2 A;  2X7B A;  4ONW A;  1PYT B;  2B5G A;  4R87 A;  4CGO A;  1ELL P;  4Q36 A;  2DPS A;  5ISV A;  1L0C A;  4RUH A;  2PIY A;  2Z3L A;  2C6C A;  2F5I A;  1DTD A;  4PXC A;  2HV2 A;  1VIX A;  3IU2 A;  4IAV A;  3PGP A;  5CPA A;  6CPA A;  2JDD A;  2Q51 A;  4H89 A;  5HVH A;  5DS0 A;  2PJ2 A;  2Q7B A;  1RXT A;  4X8I A;  4HNW B;  3H8G A;  1ZO0 A;  3EFA A;  5G22 A;  2OZH A;  4UEE A;  4AXV A;  2PQ8 A;  1VHO A;  4E2A A;  4KOV A;  2IMO A;  4MY0 A;  4UCM A;  1S60 A;  1JQG A;  2YND A;  3GY9 A;  3SJX A;  3UY5 A;  2ZPA A;  2QEC A;  2PDO A;  2DF5 A;  3NH8 A;  5AG5 A;  4R8F A;  4UCP A;  3SJG A;  1S7K A;  3FYN A;  1BLL E;  4IF5 A;  3CPA A;  4ZGY B;  5JPH A;  4OID A;  5ELY A;  2ZEE A;  3S9L A;  2B4D B;  3LMS A;  3S6K A;  4KLV A;  1AMP A;  2IJZ A;  3NH5 A;  2YNC A;  1NSA A;  4EWT A;  4KOR A;  1CBX A;  2PR1 A;  4KSF A;  4R76 A;  4NGR A;  2Y0M A;  1KWM A;  2AFW A;  3KQZ A;  4G1P A;  3I1U A;  4ZBG A;  4A38 A;  1Z4E A;  4Q7A A;  1YK3 A;  1M4G A;  3BJ7 A;  3PB7 X;  1YW4 A;  2AE6 A;  4MHY A;  3V7Z A;  1CP6 A;  2PR8 A;  1GYT A;  1A2Z A;  2YGW A;  1VGY A;  2AFX A;  4L8A A;  2REF A;  2OZG A;  3IU1 A;  1Y9K A;  1CPS A;  5JQ4 A;  4U9Z A;  3FXT A;  2FCK A;  2G0B A;  1TKF A;  4FD6 A;  4M85 A;  3FB3 A;  4OLL A;  4C68 A;  1ARL A;  1AYE A;  4B10 A;  4O23 A;  4YU9 A;  4ZX8 A;  1MJA A;  2VL1 A;  2Z3O A;  3BHX A;  2ZXV A;  3NH4 A;  2PJ6 A;  3K9T A;  4FWU A;  4ONU A;  4ZI6 A;  3IC1 A;  1CM0 A;  2WYR A;  4FD7 A;  5E96 A;  4OC5 A;  1TKH A;  3BXM A;  4L89 A;  1FNO A;  3B2Y A;  4PV6 A;  3HUV A;  4OME A;  4E0A A;  5JH9 A;  2Z3P A;  4JXQ A;  2JDC A;  1F2P A;  2PJ1 A;  1TXR A;  4KOT A;  2C1C A;  4KVX A;  5D8N A;  5LYD A;  4NF1 A;  3SJE A;  5C82 A;  2ZEP A;  5JM6 A;  2QVP A;  2FSR A;  2YNE A;  3H5Z A;  4KUA A;  2Z10 A;  1I21 A;  2F8H A;  4HPS A;  2PVV A;  2VI7 A;  4P44 A;  4R3L A;  1NE9 A;  2ZW5 A;  4DNC A;  4KSA A;  1YGH A;  2JEV A;  4A2Z A;  1Z8W A;  4U9Y A;  3R9E A;  1LFW A;  4Y49 B;  5J8F A;  2PJA A;  2EBJ A;  2CTB A;  1F57 A;  1Z5R A;  3K9U A;  4F0Y A;  2CNT A;  3IEH A;  2ZED A;  3S6F A;  3FJU A;  4TWE A;  3ISX A;  1RTQ A;  4KOU A;  1KZF A;  4BMH A;  4F9V A;  5KTC A;  2Q44 A;  2V8D A;  4HKF A;  2R7H A;  4BBH A;  2Q04 A;  3SHP A;  4XPD C;  5K8M A;  3SXO A;  4R3K A;  1V0C A;  3FEC A;  2EWB A;  5F47 A;  1YLE A;  4R6T A;  4B11 A;  4B5P B;  2VZY A;  1JWQ A;  1Q2C A;  1VKC A;  4BD9 A;  3WC6 A;  4OKO A;  2B5G B;  4MHP A;  4OAD A;  4OC4 A;  3EY5 A;  2OU2 A;  2ZEN A;  4UFV A;  3PBE A;  1XOV A;  4OC2 A;  3W6X A;  2PE3 A;  2Z3M A;  3IJ3 A;  4PXB A;  1I1D A;  4HNX B;  3LD2 A;  4KVM E;  3CT9 A;  2Z0Z A;  1XF8 A;  2FT0 A;  1PUA A;  2VEZ A;  2AFO A;  2PSW A;  4OC0 A;  3D67 A;  4MI4 A;  4NCZ A;  4MCS A;  2OH1 A;  4H6Z A;  1YRE A;  1M44 A;  4A94 A;  1IIC A;  2DXQ A;  4WJB A;  4P6Y A;  2Z3K A;  4NGN A;  5HMN A;  2QJ8 A;  2RB7 A;  2IL4 A;  1NMT A;  1XFO A;  2ZW4 A;  3CZX A;  3DGV A;  5DWM A;  5A27 A;  2F7V A;  2ANP A;  1TF9 A;  2CXA A;  3FNC A;  3TOA A;  4AVA A;  4BIN A;  1QSR A;  4B13 A;  1FT7 A;  2AFM A;  4H6U A;  4W9Y A;  3BJ8 A;  3FEE A;  2ARH A;  4NJQ A;  4KSI A;  4JXR A;  1IOI A;  2QYV A;  4WWV A;  2PJB A;  3B3V A;  2R98 A;  3PB6 X;  3SXN A;  1ZLH A;  2B3V A;  1YR0 A;  2POK A;  2ATR A;  4FD5 A;  4NGP A;  1PCA A;  3B3S A;  5LRK A;  3VAR A;  4PSX A;  4A30 A;  5HXD A;  4CGN A;  3DR8 A;  2O53 A;  4GXH A;  4II9 A;  1Z8T A;  3E0K A;  4MXU A;  2VXK A;  4AB7 A;  4RS2 A;  3RYO A;  4KLW A;  3RO0 A;  2GE3 A;  2PRQ A;  1S7N A;  3F0A A;  3BI1 A;  4JJX A;  4AG9 A;  5KTA A;  1CX8 A;  5JGF A;  4XPK A;  2ZEO A;  2D4P A;  1YME A;  2JBJ A;  4MBU A;  5K8N A;  2KCW A;  3BLN A;  4J3G A;  4NGM A;  4X3R A;  4UIB A;  4PSW A;  5GCN A;  4UBR A;  4C2Y A;  3G3S A;  1IYL A;  3OWC A;  3B35 A;  4NJR A;  1IID A;  3D66 A;  5J1Q A;  1HDU A;  3TOB A;  4CYO A;  2P0W A;  3KHZ A;  1CPX A;  4MFK A;  4B14 A;  3CDX A;  3CPX A;  4KOY A;  1CP7 A;  2B58 A;  3GLJ A;  2NSM A;  4IUS A;  3FX6 A;  2I79 A;  3PB8 X;  1FY7 A;  3B3T A;  3WC7 A;  1IU8 A;  3R95 A;  5C88 A;  2EUI A;  3GUX A;  4P4I A;  4NGS A;  3DNS A;  5K8O A;  1KUY A;  3SI1 A;  2C6P A;  4MCQ A;  1IB1 E;  3B3C A;  2BL1 A;  2WSA A;  4QB9 A;  3RNZ A;  2HC9 A;  3PB4 X;  4YGO A;  2GIV A;  1QQ9 A;  1Z2L A;  4KUB A;  1XE4 A;  3FIX A;  3T8W A;  1LOK A;  3R1K A;  2ZW7 A;  4NGQ A;  4UF4 A;  4FD4 A;  2FS5 A;  4KS9 A;  2PIZ A;  4B5O A;  1M4D A;  1F2O A;  2FE7 A;  3EC4 A;  4JD6 A;  4FBE A;  1IGB A;  3I3G A;  4QVT A;  4PK2 A;  1NSL A;  3TO6 A;  1Y0R A;  2GAN A;  4UFX A;  2FL4 A;  3FVL A;  5IB9 A;  2Q7S A;  3JTK A;  1YQE A;  1Z8X A;  4PK3 A;  1ZG9 A; 
#chains in the Genus database with same CATH homology
 1XMT A;  2CNM A;  4MJ8 A;  4MFZ A;  2R1I A;  1YVO A;  2FIW A;  2ZW6 A;  3TT2 A;  3PP9 A;  5H86 A;  4AVB A;  3T9Y A;  4AG7 A;  1Y7R A;  4CYN A;  3FBU A;  2P6G A;  4C2Z A;  2VBQ A;  5F46 A;  2PRB A;  3TCV A;  4MFL A;  5G20 A;  2J8M A;  3G8W A;  2G3A A;  2WPW A;  3FRM A;  1M4I A;  4UWI A;  2FIA A;  4MFJ A;  2OB0 A;  4MFQ A;  4KVO E;  5EC4 A;  2HUZ A;  4XNH C;  3TO7 A;  4CGL A;  5IB0 A;  5AG4 A;  3V8I A;  1P0H A;  5H84 A;  4NSQ A;  4A33 A;  1S3Z A;  2OZU A;  4EVY A;  2BEI A;  3JVN A;  4CGM A;  1VHS A;  3GYA A;  3EXN A;  2H5M A;  1KUX A;  3IGR A;  4CAE A;  4XPD B;  2B3U A;  4F6A A;  1ON0 A;  2RC4 A;  4LX9 A;  1CJW A;  2Q4Y A;  2WPX A;  4CRY B;  1TIQ A;  3TE4 A;  3DSB A;  4CAW A;  2B4B A;  4XNH B;  4C7H A;  1Y9W A;  4MFP A;  4UWJ A;  4KOW A;  3TO9 A;  1P4N A;  2C27 A;  4NXY A;  2Q0Y A;  1QST A;  4JWP A;  3W6S A;  2FXF A;  4CAV A;  3D2P A;  3N7Z A;  5I0C A;  1Z4R A;  5IV0 A;  5AGE A;  3S6H A;  4CAX A;  2J8R A;  2EVN A;  1I12 A;  3R9F A;  3PZJ A;  1J4J A;  4ORF A;  3WR7 A;  2REE A;  4C2X A;  2BUE A;  3A9L A;  3TFY A;  2Q4V A;  5BWA B;  5DWN A;  2HQY A;  2JLM A;  1YX0 A;  3MGD A;  1Q2Y A;  2I00 A;  2P6F A;  4HNY B;  1QSO A;  2QIR A;  3F5B A;  3VWD A;  5G21 A;  3B8G A;  4KOX A;  1LRZ A;  4UA3 A;  4K30 A;  1XIX A;  4QC6 A;  3TTH A;  4M3S A;  4NEX A;  3LOD A;  3KKW A;  4I49 A;  5G1Z A;  2CNS A;  1S7L A;  2Z3N A;  1PU9 A;  4LUA A;  4QUS A;  4YRH A;  3DR6 A;  3QAH A;  3W91 A;  2O28 A;  5A28 A;  2K5T A;  5IX3 A;  1SQH A;  1U6M A;  1MJB A;  4OAE A;  3JUW A;  1YVK A;  4KZT A;  2PC1 A;  4RI1 A;  4YFJ A;  4U5Y A;  4MHD A;  1QSN A;  3NE7 A;  1GHE A;  3CXQ A;  3R96 A;  1UFH A;  3EO4 A;  4UFW A;  4CYQ A;  3P2H A;  4Y49 C;  1IYK A;  4KOS A;  4CAF A;  4A95 A;  3CXP A;  2B4D A;  3T90 A;  1R57 A;  1Z9U A;  4Q38 A;  4E8O A;  5J8C A;  3IWE A;  4UCN A;  1QSM A;  4R9M A;  3CXS A;  4AVC A;  2A4N A;  4F0X A;  5AG7 A;  1N71 A;  1K4J A;  2J8N A;  1Q2D A;  3GKR A;  2VZZ A;  4B12 A;  4C7I A;  1S5K A;  3I9S A;  2G3T A;  2VQY A;  3DDD A;  5KTD A;  1BO4 A;  1S7F A;  5F49 A;  2R8V A;  4CRZ B;  2CY2 A;  1OZP A;  2AJ6 A;  5EBV A;  4JLY A;  3D8P A;  1BOB A;  3P2F A;  2BSW A;  1WK4 A;  1WWZ A;  5HH1 A;  4A32 A;  1RO5 A;  1XEB A;  1MJ9 A;  3D2M A;  3H4Q A;  3IWG A;  2D4O A;  2NMT A;  2QML A;  3VWE A;  5CNP A;  3ZZI A;  1MK4 A;  4MY3 A;  5AG6 A;  2YNC C;  5FVJ A;  4QBJ A;  3ZJ0 A;  4CS0 B;  4R57 A;  4CGP A;  2P6E A;  3C26 A;  4A31 A;  2Z11 A;  1B87 A;  2WUU A;  4GS4 A;  3QB8 A;  3S6G A;  1M1D A;  1B6B A;  1KUV A;  4XPL A;  4X5K A;  2DPT A;  3F8K A;  4B5P A;  4CYP A;  3D3S A;  3R9G A;  2X7B A;  2B5G A;  4R87 A;  4CGO A;  4Q36 A;  5ISV A;  2DPS A;  1L0C A;  2Z3L A;  2F5I A;  2HV2 A;  3IU2 A;  3PGP A;  2JDD A;  4H89 A;  2Q7B A;  1RXT A;  4HNW B;  1ZO0 A;  3EFA A;  5G22 A;  2OZH A;  2PQ8 A;  4E2A A;  4KOV A;  4MY0 A;  4UCM A;  1S60 A;  2YND A;  3GY9 A;  3UY5 A;  2ZPA A;  2QEC A;  2PDO A;  5AG5 A;  4UCP A;  1S7K A;  3FYN A;  4IF5 A;  5JPH A;  4ZGY B;  2B4D B;  3S6K A;  4KLV A;  2YNC A;  4KOR A;  2PR1 A;  4KSF A;  2Y0M A;  4ZBG A;  1Z4E A;  1YK3 A;  1M4G A;  3BJ7 A;  2AE6 A;  2PR8 A;  2YGW A;  4L8A A;  2REF A;  2OZG A;  3IU1 A;  1Y9K A;  5JQ4 A;  4U9Z A;  3FXT A;  2FCK A;  2G0B A;  4M85 A;  4FD6 A;  4C68 A;  3FB3 A;  4OLL A;  4B10 A;  1MJA A;  2Z3O A;  2ZXV A;  4ONU A;  1CM0 A;  4FD7 A;  5E96 A;  4L89 A;  4PV6 A;  4E0A A;  2Z3P A;  4JXQ A;  2JDC A;  4KOT A;  4KVX A;  4AVA A;  5KTC A;  5C82 A;  4NF1 A;  2FSR A;  2YNE A;  3H5Z A;  4KUA A;  2Z10 A;  1I21 A;  5F48 A;  3SHP A;  2VI7 A;  4R3L A;  1NE9 A;  2ZW5 A;  4DNC A;  4KSA A;  1YGH A;  2JEV A;  4A2Z A;  4U9Y A;  3R9E A;  4Y49 B;  5J8F A;  3K9U A;  4F0Y A;  2CNT A;  3S6F A;  4KOU A;  4BMH A;  1KZF A;  2Q44 A;  4HKF A;  2R7H A;  4BBH A;  2Q04 A;  4XPD C;  3SXO A;  4R3K A;  1V0C A;  5F47 A;  1YLE A;  4B11 A;  4B5P B;  2VZY A;  1Q2C A;  1VKC A;  2B5G B;  4OAD A;  3EY5 A;  2OU2 A;  4UFV A;  3W6X A;  2Z3M A;  1I1D A;  4HNX B;  3LD2 A;  4KVM E;  2Z0Z A;  1XF8 A;  2FT0 A;  1PUA A;  2VEZ A;  2PSW A;  4MI4 A;  4NCZ A;  2OH1 A;  4H6Z A;  1YRE A;  1M44 A;  1IIC A;  2DXQ A;  2Z3K A;  5HMN A;  2IL4 A;  1NMT A;  5DWM A;  2ZW4 A;  5A27 A;  3TOA A;  2CXA A;  3FNC A;  1QSR A;  4B13 A;  4H6U A;  3BJ8 A;  2ARH A;  4JXR A;  2R98 A;  3SXN A;  2B3V A;  1YR0 A;  2ATR A;  4FD5 A;  4PSX A;  4A30 A;  4CGN A;  3DR8 A;  4II9 A;  3E0K A;  2VXK A;  4AB7 A;  4RS2 A;  3RYO A;  4KLW A;  2GE3 A;  4AG9 A;  1S7N A;  3F0A A;  4JJX A;  5KTA A;  4XPK A;  2D4P A;  4MBU A;  2KCW A;  3BLN A;  4J3G A;  4PSW A;  5GCN A;  4UBR A;  4C2Y A;  3G3S A;  1IYL A;  3OWC A;  1IID A;  3TOB A;  4CYO A;  2P0W A;  4MFK A;  4B14 A;  4KOY A;  2B58 A;  4IUS A;  2I79 A;  1FY7 A;  3R95 A;  5C88 A;  2EUI A;  3DNS A;  1KUY A;  1IB1 E;  4QB9 A;  2BL1 A;  2WSA A;  4YGO A;  2GIV A;  4KUB A;  1XE4 A;  3FIX A;  3R1K A;  2ZW7 A;  4FD4 A;  2FS5 A;  4KS9 A;  4B5O A;  1M4D A;  2FE7 A;  3EC4 A;  4JD6 A;  3I3G A;  4QVT A;  4PK2 A;  1NSL A;  3TO6 A;  2GAN A;  4UFX A;  2FL4 A;  3JTK A;  4PK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...