1ZO0A

Nmr structure of antizyme isoform 1 from rat
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
126
structure length
126
Chain Sequence
ILYSDERLNVTEEPTSNDKTRVLSIQCTLTEAKQVTWRAVWNGGGLYIELPAGPLPEGSKDSFAALLEFAEEQLRADHVFICFPKNREDRAALLRTFSFLGFEIVRPGHPLVPKRPDACFMVYTLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase inhibitor
molecule keywords Ornithine decarboxylase antizyme
publication title NMR structure of antizyme isoform 1 from rat
rcsb
source organism Rattus norvegicus
total genus 20
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02100 ODC_AZ Ornithine decarboxylase antizyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.60 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1zo0A00
4ZGYB 5BWAB 1ZO0A
chains in the Genus database with same CATH superfamily
4B5PA 1IGBA 1CBXA 3TC8A 2AJ6A 1TF8A 3PB8X 3PBEA 4B5OA 2CNMA 4M3SA 3PP9A 3BXMA 2I3CA 4MFQA 3TOBA 4NGSA 2O28A 4M6HA 1XE4A 4H89A 3T9YA 4DUKA 2Q51A 3RYOA 3RO0A 4FAIA 4G1PA 3GIUA 4U9ZA 3P2HA 4WJBA 1NMTA 2IL4A 5A27A 3T90A 3P2FA 3WT4A 1JQGA 5ISVA 1S3ZA 4KORA 4UBRA 1BOBA 1EE3P 4CRYB 2I79A 4R8FA 3G3SA 1QQ9A 5F47A 4TWEA 2Q7BA 4E2AA 4CYOA 1KUVA 4KOUA 2PRQA 1P4NA 2PJ6A 2V77A 3UY5A 1Q2DA 3D2PA 4A95A 2Q4YA 3A9LA 3KHXA 4PSWA 3PRTA 4P44A 2ZEMA 3F5BA 1Z8XA 2WZNA 3FRMA 5KTDA 1YR0A 3D8PA 4NGPA 4P4FA 5CBMA 4OAEA 3BI0A 4NSQA 1I1DA 1Y7EA 2JEVA 2GANA 4KOSA 3IEHA 3CPAA 3FJUA 4XPKA 3SJGA 1VHEA 1I21A 3WC7A 1H8LA 1LANA 2OZHA 2R7HA 3KR5A 3PFEA 2FL4A 5JM6A 1L0CA 3FNCA 3H5ZA 1CX8A 4PK3A 4KUBA 2ZEFA 3FH4A 1DTDA 3FXTA 4YFJA 4ONWA 3WR7A 3NH8A 3B8GA 4R76A 4UFVA 4CAVA 3B35A 4X2TA 2REEA 3ZJ0A 2BO9A 1QSNA 2BL1A 2ZW6A 1WWZA 3GY9A 4H6UA 2Q43A 4JJXA 1Q7LA 2P6FA 3SJXA 3EC4A 2CTCA 3MN8A 2Y0MA 2JLMA 1ZLHA 3SHPA 4MY0A 1YVKA 3MRUA 4NEXA 4UWIA 1U6MA 4MHNA 4NJRA 2AFOA 4R6TA 2RB7A 5J8FA 3TT2A 4OKOA 1YSJA 4UIAA 4LQGA 5HVFA 5JGFA 2C6PA 2PIYA 1Z8WA 4B6ZA 2NYQA 2I00A 4R9MA 2PJ5A 3D7GA 4MI4A 3R9EA 4C7HA 4KOVA 3JTKA 1Q2YA 3RNZA 6CPAA 1ELMP 4IHMA 4EFDA 4C2XA 3LACA 4MXUA 2ZW7A 4HPSA 2CTBA 2QIRA 4L8AA 3WABA 1XBUA 4A39A 4JXQA 1PUAA 3FEDA 1OZPA 2DPTA 5EMIA 3ZZIA 2CY2A 4TNUA 5THWA 3PB7X 4II9A 4YGOA 1S7LA 1IYLA 3PGPA 8CPAA 4NCZA 4UEFA 2RFHA 3PB9X 2GFQA 2OZUA 5LYLA 2J9AA 3NA6A 2IQ6A 2FT0A 1S7NA 4NF1A 2PJ9A 1M1DA 3RAMA 4OP4A 4ZGYB 3CT9A 4FUUA 3VWEA 4AVBA 2Q04A 4M6GA 4NFRA 3CZXA 5AG6A 2OOTA 3R9GA 3KQZA 3RBUA 2CIJA 3KASA 1F57A 4B13A 2ABZA 4PXBA 4CYNA 2AFXA 3GYAA 1QSMA 2BCOA 2DXQA 4M85A 1RO5A 1S7FA 4ZY0A 4CGOA 4CAXA 4MBUA 3N7ZA 2B58A 4LQ6A 3BJ8A 2D4OA 2Q0YA 1FNOA 4MRIA 4PSXA 2GIVA 2PCUA 3MGDA 1I12A 4MHZA 1Y9WA 2REFA 3KQXA 2QVPA 3FF3A 4Z65A 2G9DA 1ZG7A 3PZJA 4AVCA 3S6HA 2C1CA 3I3GA 3F8KA 2EK9A 5HVGA 1LAMA 4W9YA 2R1IA 4P4EA 4R7MA 3H8FA 3JUWA 4OC0A 2J8NA 1S60A 4QBJA 4CAWA 3V8IA 5CPAA 3V7ZA 1GHEA 3NFZA 1CG2A 1K4JA 4CYPA 3PFOA 4F8ZA 2V8HA 4PXEA 2CNTA 4IK2A 3DSBA 2H5MA 1IOIA 1Z9UA 2QYVA 2WSAA 3FEEA 2G3AA 2DEAA 5G20A 5D29A 2PE3A 4UFWA 1XOVA 4X8IA 3SI1A 4HKFA 3E0KA 4H2KA 4A37A 1IOFA 5HMNA 1JWQA 4A33A 2B3VA 1UWYA 4BINA 1FT7A 4Y49B 2ZENA 1BPNA 2WPWA 4I49A 4UFXA 1QSRA 2YGWA 4YWYA 4NJQA 2Z3NA 1UFHA 3SI0A 3CDXA 2VI7A 5AGEA 3SI2A 3TO7A 3TFYA 3D2MA 4P10A 2PJAA 2OR4A 2OH1A 5I4MA 5I0CA 3TCVA 2BOAA 2V8DA 3S9LA 3BJ7A 4WWVA 3TO9A 2J8MA 4MFZA 2EO8A 4UIBA 1VGYA 3GLJA 3KKWA 4ZX8A 4B5PB 4NGQA 3HUVA 3OWCA 4IUSA 3W91A 4CGMA 4EVYA 4FD4A 4U5YA 3N5FA 2Z3OA 3B2YA 3D68A 2XEIA 3GB0A 2WYRA 1FY7A 1VKCA 1RXTA 2P6EA 3QAYA 1B87A 1X10A 2ATRA 2PJ2A 2Z3PA 2NSMA 3K9TA 3NE8A 4C2ZA 4LUAA 4AG9A 2GLFA 4P4BA 1AYEA 1IB1E 1ARLA 3JVNA 2G3TA 3QNVA 3EXNA 2PJ3A 4OADA 1YMEA 2FE7A 4OLLA 4OC5A 2YNCA 4AXVA 2IJZA 2PR1A 4R87A 2AFMA 2B4DA 3CXQA 2AE6A 2FXFA 2Z3KA 1ARMA 1F2OA 3KZWA 1TKJA 4PXDA 3CXPA 3I9SA 5EC4A 4B10A 2AFWA 2HC9A 2GREA 4HNYB 2Q4ZA 1R3NA 2QMLA 4KVXA 4DNCA 1M4IA 5KTAA 4ORFA 2C6CA 2Q4VA 2C6GA 4P6YA 4Y49C 2WUUA 2XEFA 5H86A 2AFUA 5AG7A 1IICA 2GU2A 3IWEA 2JDCA 4MFLA 4OC2A 3FECA 4B14A 2ZW4A 1S5KA 1Z5RA 2VL1A 4FWUA 3TX8A 5HH1A 3LWUA 4MJ8A 5DS0A 5IX3A 3FX6A 2B4DB 2PDOA 1TF9A 4FD5A 2JEWA 4KS9A 4OIDA 2CF4A 4JD6A 1BLLE 3FB3A 4KOYA 3SXNA 2P6GA 3WC6A 2FIAA 1VHOA 1LRZA 1MJBA 1WK4A 2K5TA 3KGQA 4KSAA 5LRGA 2O4HA 2BUEA 5KTCA 4Q7AA 4C2YA 1ZG9A 2PJBA 2XEJA 3RZAA 5E96A 3B3CA 2V8VA 2Z3LA 3V38A 4CYQA 4GS4A 4KZTA 5F48A 3SJEA 4ZI6A 4DJLA 2PJ4A 2PJ7A 2VXKA 2KCWA 2Z0ZA 3PEIA 5J8CA 4JXRA 2FCKA 1X12A 2J8RA 2Z10A 4OC3A 3D3SA 1KZFA 4GXHA 4A32A 4JYWA 4F0YA 1SQHA 1M4LA 1NE9A 2NMTA 1N71A 4R57A 4X3RA 5C82A 4MCSA 1MJ9A 4MHPA 2HV2A 1YVOA 1YK3A 2ZOGA 1Y0RA 1Y9KA 1Y0YA 2QECA 1CPSA 3EFAA 4RN7A 2GLJA 3VARA 4OIWA 4CGPA 1HEEA 2B4BA 2R8VA 4MY3A 2Q7SA 4BMHA 4P45A 3IC1A 4EWTA 2PVWA 1V0CA 2O53A 4MFKA 3WC5A 2YNEA 3VATA 3EO4A 5F09A 1YQEA 1Z4RA 4U9YA 4CAEA 2YNCC 4PV6A 1B6BA 2HUZA 3DR8A 4C68A 4MFJA 4CRZB 4A38A 1Z4EA 2ANPA 1LOKA 2QJ8A 2ZPAA 2EWBA 1TXRA 3CPXA 3L2NA 4JLYA 1ON0A 1XIXA 3I1UA 5IB9A 5HVHA 1QSTA 1AMPA 2GE3A 3B3WA 1IIDA 4CGNA 3VH9A 4X5KA 3IU2A 1VHSA 3GKRA 1CP7A 2F5IA 1RTQA 1CP6A 4HNWB 3IGRA 4F9UA 4ZY1A 3CXSA 4CGLA 3DDDA 1YREA 2AFZA 4JZ0A 4KUAA 1BAVA 2PJ0A 3NH4A 4KLWA 4UEZA 5LRJA 5JH9A 5D8NA 4DYOA 4F6AA 4GM5A 1QSOA 1YLOA 5LRKA 1Y7RA 1NSLA 1ELLP 2Z11A 2HB6A 1Z2LA 2G0BA 3D67A 3K2KA 3DR6A 4P4JA 4BD9A 3ISXA 1XFOA 4R3LA 2BSWA 4UCMA 3QB8A 3LMSA 4AG7A 2F8HA 3D7HA 4KSFA 1OBRA 4MCRA 4UF4A 3B3SA 3D4UA 4ZY2A 2WPXA 5F49A 4YU9A 5JPHA 4PPZA 4CPAA 1YW6A 5DWNA 2XEGA 4KOTA 2ZELA 1ZLIA 4EMEA 3R9FA 1YW4A 4PXCA 4B12A 2Q44A 1Z8LA 4FD7A 3TO6A 4OC4A 4MHYA 1LFWA 4AB7A 2FSRA 5LYFA 4PQAA 2EUIA 2FIWA 4UCPA 3TTHA 2DPSA 4ZYQA 5AG4A 1TIQA 4IF5A 3H4QA 3FVLA 2FS5A 3IO1A 4CAFA 1YX0A 2IMOA 1XMTA 3BLNA 1A2ZA 3QAHA 4RUHA 4QC6A 3TOAA 4KVOE 3D7FA 1LAPA 3IIBA 5GCNA 4ZX9A 3VWDA 2P0WA 4MHDA 4MMOA 1CPXA 4QVTA 2ZW5A 4LX9A 5EBVA 2JBKA 1ZO0A 2EK8A 1QMUA 2ZEHA 4KOWA 1YGHA 5K8PA 4A2ZA 2EBJA 3ISZA 2ARHA 3JRUA 3S6FA 2ZEOA 3K9UA 4MCPA 5IV0A 3TE4A 4J3GA 4IAVA 2R98A 1P0HA 3IWWA 3R96A 1IU8A 2ZXVA 4C7IA 2PQ8A 4O23A 2PC1A 3DLJA 4XPDB 2ZEEA 1KUXA 3G8WA 4K30A 2F7VA 3DGVA 2HQYA 4UCNA 1GYTA 2ZEPA 1XRYA 5DWMA 4F0XA 5LYDA 5G21A 2BEIA 4F9VA 4KLVA 7CPAA 4QUSA 2C27A 3B7IA 1Z8TA 4MFPA 1BO4A 1XJOA 3PB6X 2JDDA 1R43A 4KSIA 2EVNA 4XNHB 1M44A 4FD6A 2OZGA 1Q2CA 5G1ZA 3LD2A 5C88A 4NGRA 2RC4A 5G22A 2PJ1A 2JBJA 2ZOFA 3GUXA 4P4DA 5K8NA 3H8GA 1BPMA 3IWGA 1TKHA 4K3NA 3KR4A 1DE4C 4OMEA 4B11A 1VIXA 5H84A 5A28A 3NE7A 4E8OA 3DNSA 3IU1A 2ZEGA 4Q36A 1MK4A 3B3TA 2VZZA 4RI1A 4A31A 1M4DA 1HDQA 4AVAA 2PIZA 3SXOA 3KHZA 3FBUA 4RS2A 5JQ4A 2Z3MA 3S6GA 1ZG8A 5LYIA 3KL9A 5IB0A 4HNXB 4PK2A 1IYKA 1LCPA 3HLPA 3F0AA 3T8WA 2B5GA 1KWMA 2DF5A 2POKA 2A4NA 2OB0A 4NGTA 3NH5A 4E0AA 1PYTB 4Q38A 2ODFA 1PCAA 5J1QA 1S7KA 4BBHA 4H6ZA 2VBQA 3R1KA 2PJCA 1F2PA 1IY7A 2B3UA 4KOXA 4R3KA 1KUYA 2CXAA 4XPDC 5ELYA 3BI1A 1J4JA 1R57A 5FVJA 4A30A 1PU9A 3FIXA 4CS0B 4ONUA 4NGMA 1TKFA 3FMCA 3BHXA 4FBEA 1HDUA 4OC1A 1XF8A 5K8OA 2VQYA 3W6SA 3H8EA 4M6IA 1M4GA 3S9NA 4JWPA 4L89A 2FVGA 2VZYA 4XPLA 1AUGA 4NGNA 1XMBA 2PR8A 3D66A 2B5GB 4XNHC 4KVME 4NXYA 3B3VA 2PJ8A 3SJFA 2PSWA 2OU2A 3W6XA 2V8GA 3R95A 4ZBGA 1CJWA 4UA3A 3C26A 3S6KA 1MJAA 3KI9A 5HXDA 2ZEDA 3IFEA 5CNPA 2X7BA 3D7DA 5BWAB 3IJ3A 4MCQA 5AG5A 4YRHA 2YNDA 3FYNA 4P4IA 2PRBA 4A94A 2VEZA 2D4PA 3PBBA 4UEEA 4UWJA 5F46A 1YLEA 2PVVA 3EY5A 5K8MA 1CM0A 2CNSA 1XEBA 3S9MA 4QB9A 1NSAA 3LODA 3PB4X 2AFSA
chains in the Genus database with same CATH topology
4B5PA 2AJ6A 4B5OA 2CNMA 4M3SA 3PP9A 4MFQA 3TOBA 2O28A 1XE4A 4H89A 3T9YA 3RYOA 4U9ZA 3P2HA 1NMTA 2IL4A 5A27A 3T90A 3P2FA 5ISVA 1S3ZA 4KORA 4UBRA 1BOBA 4CRYB 2I79A 3G3SA 5F47A 2Q7BA 4E2AA 4CYOA 1KUVA 4KOUA 4CYQA 1P4NA 3UY5A 4A95A 1Q2DA 3D2PA 2Q4YA 3A9LA 4PSWA 3F5BA 3FRMA 5KTDA 1YR0A 3D8PA 4OAEA 4NSQA 1I1DA 2JEVA 4KOSA 2GANA 4XPKA 1I21A 2OZHA 2R7HA 2FL4A 1L0CA 3FNCA 3H5ZA 4PK3A 4KUBA 3FXTA 4YFJA 3WR7A 4UFVA 3B8GA 4CAVA 2REEA 3ZJ0A 1QSNA 2BL1A 2ZW6A 1WWZA 3GY9A 4H6UA 4JJXA 2P6FA 3EC4A 2Y0MA 2JLMA 3SHPA 4MY0A 1YVKA 4NEXA 4UWIA 1U6MA 5J8FA 3TT2A 2I00A 4R9MA 4MI4A 3R9EA 4C7HA 4KOVA 3JTKA 1Q2YA 4C2XA 2ZW7A 2QIRA 4L8AA 4JXQA 1PUAA 1OZPA 2DPTA 3ZZIA 2CY2A 4II9A 4YGOA 1S7LA 1IYLA 3PGPA 4NCZA 2OZUA 2FT0A 1S7NA 4NF1A 1M1DA 4ZGYB 3VWEA 4AVBA 2Q04A 5AG6A 3R9GA 4B13A 4CYNA 3GYAA 1QSMA 2DXQA 4M85A 1RO5A 1S7FA 4CGOA 4CAXA 4MBUA 3N7ZA 2B58A 3BJ8A 2D4OA 2Q0YA 4PSXA 2GIVA 3MGDA 1I12A 1Y9WA 2REFA 3PZJA 4AVCA 3S6HA 3I3GA 3F8KA 2R1IA 3JUWA 2J8NA 1S60A 4QBJA 4CAWA 3V8IA 1GHEA 4CYPA 1K4JA 2CNTA 3DSBA 2H5MA 1Z9UA 2WSAA 5G20A 3TOAA 2G3AA 4UFWA 4HKFA 3E0KA 5HMNA 4A33A 2B3VA 4Y49B 4I49A 2WPWA 4UFXA 1QSRA 2YGWA 2Z3NA 1UFHA 2VI7A 5AGEA 3TO7A 3TFYA 3D2MA 2OH1A 5I0CA 3TCVA 3BJ7A 3TO9A 2J8MA 4MFZA 4B5PB 3KKWA 4IUSA 3OWCA 4CGMA 3W91A 4EVYA 4FD4A 4U5YA 2Z3OA 1FY7A 1VKCA 1RXTA 2P6EA 1B87A 2Z3PA 2ATRA 4C2ZA 4LUAA 4AG9A 1IB1E 3JVNA 2G3TA 3EXNA 4OADA 2FE7A 4OLLA 2YNCA 2PR1A 4R87A 2B4DA 3CXQA 2AE6A 2FXFA 4B10A 3CXPA 3I9SA 5EC4A 4HNYB 2QMLA 4KVXA 4DNCA 1M4IA 5KTAA 4ORFA 2Q4VA 4Y49C 2WUUA 5H86A 5AG7A 1IICA 3IWEA 2JDCA 4MFLA 4B14A 2ZW4A 1S5KA 5HH1A 4MJ8A 5IX3A 2B4DB 2PDOA 4FD5A 4KS9A 4JD6A 3FB3A 4KOYA 3SXNA 2P6GA 2FIAA 1LRZA 1MJBA 1WK4A 2K5TA 4KSAA 2BUEA 5KTCA 4C2YA 5E96A 2Z3LA 4GS4A 4KZTA 5F48A 2VXKA 2KCWA 2Z0ZA 5J8CA 4JXRA 2FCKA 2J8RA 2Z10A 3D3SA 1KZFA 4F0YA 4A32A 1SQHA 1NE9A 2NMTA 1N71A 4R57A 5C82A 1MJ9A 2HV2A 1YVOA 1YK3A 1Y9KA 2QECA 3EFAA 4CGPA 2R8VA 2B4BA 4MY3A 4BMHA 1V0CA 4MFKA 2YNEA 3EO4A 1Z4RA 4U9YA 4CAEA 2YNCC 4PV6A 1B6BA 2HUZA 3DR8A 4C68A 4MFJA 4CRZB 1Z4EA 2ZPAA 4JLYA 1ON0A 1XIXA 1QSTA 2GE3A 1IIDA 4CGNA 4X5KA 3IU2A 1VHSA 3GKRA 2F5IA 4HNWB 3IGRA 3CXSA 4CGLA 3DDDA 1YREA 4KUAA 4KLWA 4F6AA 1QSOA 1Y7RA 1NSLA 2Z11A 2G0BA 3DR6A 4R3LA 2BSWA 4UCMA 3QB8A 4AG7A 4KSFA 2WPXA 5F49A 5JPHA 5DWNA 4KOTA 3R9FA 4B12A 2Q44A 4FD7A 3TO6A 4AB7A 2FSRA 2EUIA 2FIWA 4UCPA 3TTHA 2DPSA 5AG4A 1TIQA 4IF5A 3H4QA 2FS5A 4CAFA 1YX0A 1XMTA 3BLNA 3QAHA 4QC6A 4KVOE 5GCNA 3VWDA 2P0WA 4MHDA 4QVTA 2ZW5A 4LX9A 5EBVA 1ZO0A 4KOWA 1YGHA 4A2ZA 2ARHA 3S6FA 5IV0A 3K9UA 3TE4A 4J3GA 2R98A 1P0HA 3R96A 2ZXVA 4C7IA 2PQ8A 2PC1A 4XPDB 1KUXA 3G8WA 4K30A 4UCNA 2HQYA 5DWMA 4F0XA 5G21A 2BEIA 4KLVA 4QUSA 2C27A 4MFPA 1BO4A 2JDDA 2EVNA 4XNHB 1M44A 4FD6A 2OZGA 1Q2CA 5G1ZA 3LD2A 5C88A 2RC4A 5G22A 3IWGA 4B11A 5A28A 5H84A 3NE7A 4E8OA 3DNSA 3IU1A 4Q36A 1MK4A 4RI1A 2VZZA 4A31A 1M4DA 4AVAA 3SXOA 3FBUA 4RS2A 5JQ4A 2Z3MA 3S6GA 5IB0A 4HNXB 4PK2A 1IYKA 3F0AA 2B5GA 2A4NA 2OB0A 4E0AA 4Q38A 1S7KA 4BBHA 4H6ZA 2VBQA 3R1KA 2B3UA 4KOXA 4R3KA 1KUYA 2CXAA 4XPDC 5FVJA 1J4JA 1R57A 4A30A 1PU9A 3FIXA 4CS0B 4ONUA 1XF8A 2VQYA 3W6SA 1M4GA 4JWPA 4L89A 2VZYA 4XPLA 2PR8A 2B5GB 4XNHC 4KVME 4NXYA 2PSWA 2OU2A 3W6XA 3R95A 4ZBGA 1CJWA 4UA3A 3C26A 3S6KA 1MJAA 5CNPA 2X7BA 5BWAB 5AG5A 4YRHA 2YNDA 3FYNA 2PRBA 2VEZA 2D4PA 4UWJA 5F46A 1YLEA 3EY5A 1CM0A 2CNSA 1XEBA 4QB9A 2Z3KA 3LODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZGY B;  5BWA B;  1ZO0 A; 
#chains in the Genus database with same CATH topology
 4B5P A;  1IGB A;  1CBX A;  3TC8 A;  2AJ6 A;  1TF8 A;  3PB8 X;  3PBE A;  4B5O A;  2CNM A;  4M3S A;  3PP9 A;  3BXM A;  2I3C A;  4MFQ A;  3TOB A;  4NGS A;  2O28 A;  4M6H A;  1XE4 A;  4H89 A;  3T9Y A;  4DUK A;  2Q51 A;  3RYO A;  3RO0 A;  4FAI A;  4G1P A;  3GIU A;  4U9Z A;  3P2H A;  4WJB A;  1NMT A;  2IL4 A;  5A27 A;  3T90 A;  3P2F A;  3WT4 A;  1JQG A;  5ISV A;  1S3Z A;  4KOR A;  4UBR A;  1BOB A;  1EE3 P;  4CRY B;  2I79 A;  4R8F A;  3G3S A;  1QQ9 A;  5F47 A;  4TWE A;  2Q7B A;  4E2A A;  4CYO A;  1KUV A;  4KOU A;  2PRQ A;  1P4N A;  2PJ6 A;  2V77 A;  3UY5 A;  1Q2D A;  3D2P A;  4A95 A;  2Q4Y A;  3A9L A;  3KHX A;  4PSW A;  3PRT A;  4P44 A;  2ZEM A;  3F5B A;  1Z8X A;  2WZN A;  3FRM A;  5KTD A;  1YR0 A;  3D8P A;  4NGP A;  4P4F A;  5CBM A;  4OAE A;  3BI0 A;  4NSQ A;  1I1D A;  1Y7E A;  2JEV A;  2GAN A;  4KOS A;  3IEH A;  3CPA A;  3FJU A;  4XPK A;  3SJG A;  1VHE A;  1I21 A;  3WC7 A;  1H8L A;  1LAN A;  2OZH A;  2R7H A;  3KR5 A;  3PFE A;  2FL4 A;  5JM6 A;  1L0C A;  3FNC A;  3H5Z A;  1CX8 A;  4PK3 A;  4KUB A;  2ZEF A;  3FH4 A;  1DTD A;  3FXT A;  4YFJ A;  4ONW A;  3WR7 A;  3NH8 A;  3B8G A;  4R76 A;  4UFV A;  4CAV A;  3B35 A;  4X2T A;  2REE A;  3ZJ0 A;  2BO9 A;  1QSN A;  2BL1 A;  2ZW6 A;  1WWZ A;  3GY9 A;  4H6U A;  2Q43 A;  4JJX A;  1Q7L A;  2P6F A;  3SJX A;  3EC4 A;  2CTC A;  3MN8 A;  2Y0M A;  2JLM A;  1ZLH A;  3SHP A;  4MY0 A;  1YVK A;  3MRU A;  4NEX A;  4UWI A;  1U6M A;  4MHN A;  4NJR A;  2AFO A;  4R6T A;  2RB7 A;  5J8F A;  3TT2 A;  4OKO A;  1YSJ A;  4UIA A;  4LQG A;  5HVF A;  5JGF A;  2C6P A;  2PIY A;  1Z8W A;  4B6Z A;  2NYQ A;  2I00 A;  4R9M A;  2PJ5 A;  3D7G A;  4MI4 A;  3R9E A;  4C7H A;  4KOV A;  3JTK A;  1Q2Y A;  3RNZ A;  6CPA A;  1ELM P;  4IHM A;  4EFD A;  4C2X A;  3LAC A;  4MXU A;  2ZW7 A;  4HPS A;  2CTB A;  2QIR A;  4L8A A;  3WAB A;  1XBU A;  4A39 A;  4JXQ A;  1PUA A;  3FED A;  1OZP A;  2DPT A;  5EMI A;  3ZZI A;  2CY2 A;  4TNU A;  5THW A;  3PB7 X;  4II9 A;  4YGO A;  1S7L A;  1IYL A;  3PGP A;  8CPA A;  4NCZ A;  4UEF A;  2RFH A;  3PB9 X;  2GFQ A;  2OZU A;  5LYL A;  2J9A A;  3NA6 A;  2IQ6 A;  2FT0 A;  1S7N A;  4NF1 A;  2PJ9 A;  1M1D A;  3RAM A;  4OP4 A;  4ZGY B;  3CT9 A;  4FUU A;  3VWE A;  4AVB A;  2Q04 A;  4M6G A;  4NFR A;  3CZX A;  5AG6 A;  2OOT A;  3R9G A;  3KQZ A;  3RBU A;  2CIJ A;  3KAS A;  1F57 A;  4B13 A;  2ABZ A;  4PXB A;  4CYN A;  2AFX A;  3GYA A;  1QSM A;  2BCO A;  2DXQ A;  4M85 A;  1RO5 A;  1S7F A;  4ZY0 A;  4CGO A;  4CAX A;  4MBU A;  3N7Z A;  2B58 A;  4LQ6 A;  3BJ8 A;  2D4O A;  2Q0Y A;  1FNO A;  4MRI A;  4PSX A;  2GIV A;  2PCU A;  3MGD A;  1I12 A;  4MHZ A;  1Y9W A;  2REF A;  3KQX A;  2QVP A;  3FF3 A;  4Z65 A;  2G9D A;  1ZG7 A;  3PZJ A;  4AVC A;  3S6H A;  2C1C A;  3I3G A;  3F8K A;  2EK9 A;  5HVG A;  1LAM A;  4W9Y A;  2R1I A;  4P4E A;  4R7M A;  3H8F A;  3JUW A;  4OC0 A;  2J8N A;  1S60 A;  4QBJ A;  4CAW A;  3V8I A;  5CPA A;  3V7Z A;  1GHE A;  3NFZ A;  1CG2 A;  1K4J A;  4CYP A;  3PFO A;  4F8Z A;  2V8H A;  4PXE A;  2CNT A;  4IK2 A;  3DSB A;  2H5M A;  1IOI A;  1Z9U A;  2QYV A;  2WSA A;  3FEE A;  2G3A A;  2DEA A;  5G20 A;  5D29 A;  2PE3 A;  4UFW A;  1XOV A;  4X8I A;  3SI1 A;  4HKF A;  3E0K A;  4H2K A;  4A37 A;  1IOF A;  5HMN A;  1JWQ A;  4A33 A;  2B3V A;  1UWY A;  4BIN A;  1FT7 A;  4Y49 B;  2ZEN A;  1BPN A;  2WPW A;  4I49 A;  4UFX A;  1QSR A;  2YGW A;  4YWY A;  4NJQ A;  2Z3N A;  1UFH A;  3SI0 A;  3CDX A;  2VI7 A;  5AGE A;  3SI2 A;  3TO7 A;  3TFY A;  3D2M A;  4P10 A;  2PJA A;  2OR4 A;  2OH1 A;  5I4M A;  5I0C A;  3TCV A;  2BOA A;  2V8D A;  3S9L A;  3BJ7 A;  4WWV A;  3TO9 A;  2J8M A;  4MFZ A;  2EO8 A;  4UIB A;  1VGY A;  3GLJ A;  3KKW A;  4ZX8 A;  4B5P B;  4NGQ A;  3HUV A;  3OWC A;  4IUS A;  3W91 A;  4CGM A;  4EVY A;  4FD4 A;  4U5Y A;  3N5F A;  2Z3O A;  3B2Y A;  3D68 A;  2XEI A;  3GB0 A;  2WYR A;  1FY7 A;  1VKC A;  1RXT A;  2P6E A;  3QAY A;  1B87 A;  1X10 A;  2ATR A;  2PJ2 A;  2Z3P A;  2NSM A;  3K9T A;  3NE8 A;  4C2Z A;  4LUA A;  4AG9 A;  2GLF A;  4P4B A;  1AYE A;  1IB1 E;  1ARL A;  3JVN A;  2G3T A;  3QNV A;  3EXN A;  2PJ3 A;  4OAD A;  1YME A;  2FE7 A;  4OLL A;  4OC5 A;  2YNC A;  4AXV A;  2IJZ A;  2PR1 A;  4R87 A;  2AFM A;  2B4D A;  3CXQ A;  2AE6 A;  2FXF A;  2Z3K A;  1ARM A;  1F2O A;  3KZW A;  1TKJ A;  4PXD A;  3CXP A;  3I9S A;  5EC4 A;  4B10 A;  2AFW A;  2HC9 A;  2GRE A;  4HNY B;  2Q4Z A;  1R3N A;  2QML A;  4KVX A;  4DNC A;  1M4I A;  5KTA A;  4ORF A;  2C6C A;  2Q4V A;  2C6G A;  4P6Y A;  4Y49 C;  2WUU A;  2XEF A;  5H86 A;  2AFU A;  5AG7 A;  1IIC A;  2GU2 A;  3IWE A;  2JDC A;  4MFL A;  4OC2 A;  3FEC A;  4B14 A;  2ZW4 A;  1S5K A;  1Z5R A;  2VL1 A;  4FWU A;  3TX8 A;  5HH1 A;  3LWU A;  4MJ8 A;  5DS0 A;  5IX3 A;  3FX6 A;  2B4D B;  2PDO A;  1TF9 A;  4FD5 A;  2JEW A;  4KS9 A;  4OID A;  2CF4 A;  4JD6 A;  1BLL E;  3FB3 A;  4KOY A;  3SXN A;  2P6G A;  3WC6 A;  2FIA A;  1VHO A;  1LRZ A;  1MJB A;  1WK4 A;  2K5T A;  3KGQ A;  4KSA A;  5LRG A;  2O4H A;  2BUE A;  5KTC A;  4Q7A A;  4C2Y A;  1ZG9 A;  2PJB A;  2XEJ A;  3RZA A;  5E96 A;  3B3C A;  2V8V A;  2Z3L A;  3V38 A;  4CYQ A;  4GS4 A;  4KZT A;  5F48 A;  3SJE A;  4ZI6 A;  4DJL A;  2PJ4 A;  2PJ7 A;  2VXK A;  2KCW A;  2Z0Z A;  3PEI A;  5J8C A;  4JXR A;  2FCK A;  1X12 A;  2J8R A;  2Z10 A;  4OC3 A;  3D3S A;  1KZF A;  4GXH A;  4A32 A;  4JYW A;  4F0Y A;  1SQH A;  1M4L A;  1NE9 A;  2NMT A;  1N71 A;  4R57 A;  4X3R A;  5C82 A;  4MCS A;  1MJ9 A;  4MHP A;  2HV2 A;  1YVO A;  1YK3 A;  2ZOG A;  1Y0R A;  1Y9K A;  1Y0Y A;  2QEC A;  1CPS A;  3EFA A;  4RN7 A;  2GLJ A;  3VAR A;  4OIW A;  4CGP A;  1HEE A;  2B4B A;  2R8V A;  4MY3 A;  2Q7S A;  4BMH A;  4P45 A;  3IC1 A;  4EWT A;  2PVW A;  1V0C A;  2O53 A;  4MFK A;  3WC5 A;  2YNE A;  3VAT A;  3EO4 A;  5F09 A;  1YQE A;  1Z4R A;  4U9Y A;  4CAE A;  2YNC C;  4PV6 A;  1B6B A;  2HUZ A;  3DR8 A;  4C68 A;  4MFJ A;  4CRZ B;  4A38 A;  1Z4E A;  2ANP A;  1LOK A;  2QJ8 A;  2ZPA A;  2EWB A;  1TXR A;  3CPX A;  3L2N A;  4JLY A;  1ON0 A;  1XIX A;  3I1U A;  5IB9 A;  5HVH A;  1QST A;  1AMP A;  2GE3 A;  3B3W A;  1IID A;  4CGN A;  3VH9 A;  4X5K A;  3IU2 A;  1VHS A;  3GKR A;  1CP7 A;  2F5I A;  1RTQ A;  1CP6 A;  4HNW B;  3IGR A;  4F9U A;  4ZY1 A;  3CXS A;  4CGL A;  3DDD A;  1YRE A;  2AFZ A;  4JZ0 A;  4KUA A;  1BAV A;  2PJ0 A;  3NH4 A;  4KLW A;  4UEZ A;  5LRJ A;  5JH9 A;  5D8N A;  4DYO A;  4F6A A;  4GM5 A;  1QSO A;  1YLO A;  5LRK A;  1Y7R A;  1NSL A;  1ELL P;  2Z11 A;  2HB6 A;  1Z2L A;  2G0B A;  3D67 A;  3K2K A;  3DR6 A;  4P4J A;  4BD9 A;  3ISX A;  1XFO A;  4R3L A;  2BSW A;  4UCM A;  3QB8 A;  3LMS A;  4AG7 A;  2F8H A;  3D7H A;  4KSF A;  1OBR A;  4MCR A;  4UF4 A;  3B3S A;  3D4U A;  4ZY2 A;  2WPX A;  5F49 A;  4YU9 A;  5JPH A;  4PPZ A;  4CPA A;  1YW6 A;  5DWN A;  2XEG A;  4KOT A;  2ZEL A;  1ZLI A;  4EME A;  3R9F A;  1YW4 A;  4PXC A;  4B12 A;  2Q44 A;  1Z8L A;  4FD7 A;  3TO6 A;  4OC4 A;  4MHY A;  1LFW A;  4AB7 A;  2FSR A;  5LYF A;  4PQA A;  2EUI A;  2FIW A;  4UCP A;  3TTH A;  2DPS A;  4ZYQ A;  5AG4 A;  1TIQ A;  4IF5 A;  3H4Q A;  3FVL A;  2FS5 A;  3IO1 A;  4CAF A;  1YX0 A;  2IMO A;  1XMT A;  3BLN A;  1A2Z A;  3QAH A;  4RUH A;  4QC6 A;  3TOA A;  4KVO E;  3D7F A;  1LAP A;  3IIB A;  5GCN A;  4ZX9 A;  3VWD A;  2P0W A;  4MHD A;  4MMO A;  1CPX A;  4QVT A;  2ZW5 A;  4LX9 A;  5EBV A;  2JBK A;  1ZO0 A;  2EK8 A;  1QMU A;  2ZEH A;  4KOW A;  1YGH A;  5K8P A;  4A2Z A;  2EBJ A;  3ISZ A;  2ARH A;  3JRU A;  3S6F A;  2ZEO A;  3K9U A;  4MCP A;  5IV0 A;  3TE4 A;  4J3G A;  4IAV A;  2R98 A;  1P0H A;  3IWW A;  3R96 A;  1IU8 A;  2ZXV A;  4C7I A;  2PQ8 A;  4O23 A;  2PC1 A;  3DLJ A;  4XPD B;  2ZEE A;  1KUX A;  3G8W A;  4K30 A;  2F7V A;  3DGV A;  2HQY A;  4UCN A;  1GYT A;  2ZEP A;  1XRY A;  5DWM A;  4F0X A;  5LYD A;  5G21 A;  2BEI A;  4F9V A;  4KLV A;  7CPA A;  4QUS A;  2C27 A;  3B7I A;  1Z8T A;  4MFP A;  1BO4 A;  1XJO A;  3PB6 X;  2JDD A;  1R43 A;  4KSI A;  2EVN A;  4XNH B;  1M44 A;  4FD6 A;  2OZG A;  1Q2C A;  5G1Z A;  3LD2 A;  5C88 A;  4NGR A;  2RC4 A;  5G22 A;  2PJ1 A;  2JBJ A;  2ZOF A;  3GUX A;  4P4D A;  5K8N A;  3H8G A;  1BPM A;  3IWG A;  1TKH A;  4K3N A;  3KR4 A;  1DE4 C;  4OME A;  4B11 A;  1VIX A;  5H84 A;  5A28 A;  3NE7 A;  4E8O A;  3DNS A;  3IU1 A;  2ZEG A;  4Q36 A;  1MK4 A;  3B3T A;  2VZZ A;  4RI1 A;  4A31 A;  1M4D A;  1HDQ A;  4AVA A;  2PIZ A;  3SXO A;  3KHZ A;  3FBU A;  4RS2 A;  5JQ4 A;  2Z3M A;  3S6G A;  1ZG8 A;  5LYI A;  3KL9 A;  5IB0 A;  4HNX B;  4PK2 A;  1IYK A;  1LCP A;  3HLP A;  3F0A A;  3T8W A;  2B5G A;  1KWM A;  2DF5 A;  2POK A;  2A4N A;  2OB0 A;  4NGT A;  3NH5 A;  4E0A A;  1PYT B;  4Q38 A;  2ODF A;  1PCA A;  5J1Q A;  1S7K A;  4BBH A;  4H6Z A;  2VBQ A;  3R1K A;  2PJC A;  1F2P A;  1IY7 A;  2B3U A;  4KOX A;  4R3K A;  1KUY A;  2CXA A;  4XPD C;  5ELY A;  3BI1 A;  1J4J A;  1R57 A;  5FVJ A;  4A30 A;  1PU9 A;  3FIX A;  4CS0 B;  4ONU A;  4NGM A;  1TKF A;  3FMC A;  3BHX A;  4FBE A;  1HDU A;  4OC1 A;  1XF8 A;  5K8O A;  2VQY A;  3W6S A;  3H8E A;  4M6I A;  1M4G A;  3S9N A;  4JWP A;  4L89 A;  2FVG A;  2VZY A;  4XPL A;  1AUG A;  4NGN A;  1XMB A;  2PR8 A;  3D66 A;  2B5G B;  4XNH C;  4KVM E;  4NXY A;  3B3V A;  2PJ8 A;  3SJF A;  2PSW A;  2OU2 A;  3W6X A;  2V8G A;  3R95 A;  4ZBG A;  1CJW A;  4UA3 A;  3C26 A;  3S6K A;  1MJA A;  3KI9 A;  5HXD A;  2ZED A;  3IFE A;  5CNP A;  2X7B A;  3D7D A;  5BWA B;  3IJ3 A;  4MCQ A;  5AG5 A;  4YRH A;  2YND A;  3FYN A;  4P4I A;  2PRB A;  4A94 A;  2VEZ A;  2D4P A;  3PBB A;  4UEE A;  4UWJ A;  5F46 A;  1YLE A;  2PVV A;  3EY5 A;  5K8M A;  1CM0 A;  2CNS A;  1XEB A;  3S9M A;  4QB9 A;  1NSA A;  3LOD A;  3PB4 X;  2AFS A; 
#chains in the Genus database with same CATH homology
 4B5P A;  2AJ6 A;  4B5O A;  2CNM A;  4M3S A;  3PP9 A;  4MFQ A;  3TOB A;  2O28 A;  1XE4 A;  4H89 A;  3T9Y A;  3RYO A;  4U9Z A;  3P2H A;  1NMT A;  2IL4 A;  5A27 A;  3T90 A;  3P2F A;  5ISV A;  1S3Z A;  4KOR A;  4UBR A;  1BOB A;  4CRY B;  2I79 A;  3G3S A;  5F47 A;  2Q7B A;  4E2A A;  4CYO A;  1KUV A;  4KOU A;  4CYQ A;  1P4N A;  3UY5 A;  4A95 A;  1Q2D A;  3D2P A;  2Q4Y A;  3A9L A;  4PSW A;  3F5B A;  3FRM A;  5KTD A;  1YR0 A;  3D8P A;  4OAE A;  4NSQ A;  1I1D A;  2JEV A;  4KOS A;  2GAN A;  4XPK A;  1I21 A;  2OZH A;  2R7H A;  2FL4 A;  1L0C A;  3FNC A;  3H5Z A;  4PK3 A;  4KUB A;  3FXT A;  4YFJ A;  3WR7 A;  4UFV A;  3B8G A;  4CAV A;  2REE A;  3ZJ0 A;  1QSN A;  2BL1 A;  2ZW6 A;  1WWZ A;  3GY9 A;  4H6U A;  4JJX A;  2P6F A;  3EC4 A;  2Y0M A;  2JLM A;  3SHP A;  4MY0 A;  1YVK A;  4NEX A;  4UWI A;  1U6M A;  5J8F A;  3TT2 A;  2I00 A;  4R9M A;  4MI4 A;  3R9E A;  4C7H A;  4KOV A;  3JTK A;  1Q2Y A;  4C2X A;  2ZW7 A;  2QIR A;  4L8A A;  4JXQ A;  1PUA A;  1OZP A;  2DPT A;  3ZZI A;  2CY2 A;  4II9 A;  4YGO A;  1S7L A;  1IYL A;  3PGP A;  4NCZ A;  2OZU A;  2FT0 A;  1S7N A;  4NF1 A;  1M1D A;  4ZGY B;  3VWE A;  4AVB A;  2Q04 A;  5AG6 A;  3R9G A;  4B13 A;  4CYN A;  3GYA A;  1QSM A;  2DXQ A;  4M85 A;  1RO5 A;  1S7F A;  4CGO A;  4CAX A;  4MBU A;  3N7Z A;  2B58 A;  3BJ8 A;  2D4O A;  2Q0Y A;  4PSX A;  2GIV A;  3MGD A;  1I12 A;  1Y9W A;  2REF A;  3PZJ A;  4AVC A;  3S6H A;  3I3G A;  3F8K A;  2R1I A;  3JUW A;  2J8N A;  1S60 A;  4QBJ A;  4CAW A;  3V8I A;  1GHE A;  4CYP A;  1K4J A;  2CNT A;  3DSB A;  2H5M A;  1Z9U A;  2WSA A;  5G20 A;  3TOA A;  2G3A A;  4UFW A;  4HKF A;  3E0K A;  5HMN A;  4A33 A;  2B3V A;  4Y49 B;  4I49 A;  2WPW A;  4UFX A;  1QSR A;  2YGW A;  2Z3N A;  1UFH A;  2VI7 A;  5AGE A;  3TO7 A;  3TFY A;  3D2M A;  2OH1 A;  5I0C A;  3TCV A;  3BJ7 A;  3TO9 A;  2J8M A;  4MFZ A;  4B5P B;  3KKW A;  4IUS A;  3OWC A;  4CGM A;  3W91 A;  4EVY A;  4FD4 A;  4U5Y A;  2Z3O A;  1FY7 A;  1VKC A;  1RXT A;  2P6E A;  1B87 A;  2Z3P A;  2ATR A;  4C2Z A;  4LUA A;  4AG9 A;  1IB1 E;  3JVN A;  2G3T A;  3EXN A;  4OAD A;  2FE7 A;  4OLL A;  2YNC A;  2PR1 A;  4R87 A;  2B4D A;  3CXQ A;  2AE6 A;  2FXF A;  4B10 A;  3CXP A;  3I9S A;  5EC4 A;  4HNY B;  2QML A;  4KVX A;  4DNC A;  1M4I A;  5KTA A;  4ORF A;  2Q4V A;  4Y49 C;  2WUU A;  5H86 A;  5AG7 A;  1IIC A;  3IWE A;  2JDC A;  4MFL A;  4B14 A;  2ZW4 A;  1S5K A;  5HH1 A;  4MJ8 A;  5IX3 A;  2B4D B;  2PDO A;  4FD5 A;  4KS9 A;  4JD6 A;  3FB3 A;  4KOY A;  3SXN A;  2P6G A;  2FIA A;  1LRZ A;  1MJB A;  1WK4 A;  2K5T A;  4KSA A;  2BUE A;  5KTC A;  4C2Y A;  5E96 A;  2Z3L A;  4GS4 A;  4KZT A;  5F48 A;  2VXK A;  2KCW A;  2Z0Z A;  5J8C A;  4JXR A;  2FCK A;  2J8R A;  2Z10 A;  3D3S A;  1KZF A;  4F0Y A;  4A32 A;  1SQH A;  1NE9 A;  2NMT A;  1N71 A;  4R57 A;  5C82 A;  1MJ9 A;  2HV2 A;  1YVO A;  1YK3 A;  1Y9K A;  2QEC A;  3EFA A;  4CGP A;  2R8V A;  2B4B A;  4MY3 A;  4BMH A;  1V0C A;  4MFK A;  2YNE A;  3EO4 A;  1Z4R A;  4U9Y A;  4CAE A;  2YNC C;  4PV6 A;  1B6B A;  2HUZ A;  3DR8 A;  4C68 A;  4MFJ A;  4CRZ B;  1Z4E A;  2ZPA A;  4JLY A;  1ON0 A;  1XIX A;  1QST A;  2GE3 A;  1IID A;  4CGN A;  4X5K A;  3IU2 A;  1VHS A;  3GKR A;  2F5I A;  4HNW B;  3IGR A;  3CXS A;  4CGL A;  3DDD A;  1YRE A;  4KUA A;  4KLW A;  4F6A A;  1QSO A;  1Y7R A;  1NSL A;  2Z11 A;  2G0B A;  3DR6 A;  4R3L A;  2BSW A;  4UCM A;  3QB8 A;  4AG7 A;  4KSF A;  2WPX A;  5F49 A;  5JPH A;  5DWN A;  4KOT A;  3R9F A;  4B12 A;  2Q44 A;  4FD7 A;  3TO6 A;  4AB7 A;  2FSR A;  2EUI A;  2FIW A;  4UCP A;  3TTH A;  2DPS A;  5AG4 A;  1TIQ A;  4IF5 A;  3H4Q A;  2FS5 A;  4CAF A;  1YX0 A;  1XMT A;  3BLN A;  3QAH A;  4QC6 A;  4KVO E;  5GCN A;  3VWD A;  2P0W A;  4MHD A;  4QVT A;  2ZW5 A;  4LX9 A;  5EBV A;  1ZO0 A;  4KOW A;  1YGH A;  4A2Z A;  2ARH A;  3S6F A;  5IV0 A;  3K9U A;  3TE4 A;  4J3G A;  2R98 A;  1P0H A;  3R96 A;  2ZXV A;  4C7I A;  2PQ8 A;  2PC1 A;  4XPD B;  1KUX A;  3G8W A;  4K30 A;  4UCN A;  2HQY A;  5DWM A;  4F0X A;  5G21 A;  2BEI A;  4KLV A;  4QUS A;  2C27 A;  4MFP A;  1BO4 A;  2JDD A;  2EVN A;  4XNH B;  1M44 A;  4FD6 A;  2OZG A;  1Q2C A;  5G1Z A;  3LD2 A;  5C88 A;  2RC4 A;  5G22 A;  3IWG A;  4B11 A;  5A28 A;  5H84 A;  3NE7 A;  4E8O A;  3DNS A;  3IU1 A;  4Q36 A;  1MK4 A;  4RI1 A;  2VZZ A;  4A31 A;  1M4D A;  4AVA A;  3SXO A;  3FBU A;  4RS2 A;  5JQ4 A;  2Z3M A;  3S6G A;  5IB0 A;  4HNX B;  4PK2 A;  1IYK A;  3F0A A;  2B5G A;  2A4N A;  2OB0 A;  4E0A A;  4Q38 A;  1S7K A;  4BBH A;  4H6Z A;  2VBQ A;  3R1K A;  2B3U A;  4KOX A;  4R3K A;  1KUY A;  2CXA A;  4XPD C;  5FVJ A;  1J4J A;  1R57 A;  4A30 A;  1PU9 A;  3FIX A;  4CS0 B;  4ONU A;  1XF8 A;  2VQY A;  3W6S A;  1M4G A;  4JWP A;  4L89 A;  2VZY A;  4XPL A;  2PR8 A;  2B5G B;  4XNH C;  4KVM E;  4NXY A;  2PSW A;  2OU2 A;  3W6X A;  3R95 A;  4ZBG A;  1CJW A;  4UA3 A;  3C26 A;  3S6K A;  1MJA A;  5CNP A;  2X7B A;  5BWA B;  5AG5 A;  4YRH A;  2YND A;  3FYN A;  2PRB A;  2VEZ A;  2D4P A;  4UWJ A;  5F46 A;  1YLE A;  3EY5 A;  1CM0 A;  2CNS A;  1XEB A;  4QB9 A;  2Z3K A;  3LOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...