1ZO0A

Nmr structure of antizyme isoform 1 from rat
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
126
structure length
126
Chain Sequence
ILYSDERLNVTEEPTSNDKTRVLSIQCTLTEAKQVTWRAVWNGGGLYIELPAGPLPEGSKDSFAALLEFAEEQLRADHVFICFPKNREDRAALLRTFSFLGFEIVRPGHPLVPKRPDACFMVYTLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ornithine decarboxylase antizyme
publication title NMR structure of antizyme isoform 1 from rat
rcsb
source organism Rattus norvegicus
molecule tags Lyase inhibitor
total genus 20
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02100 ODC_AZ Ornithine decarboxylase antizyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.60 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1zo0A00
4ZGYB 5BWAB 1ZO0A
chains in the Genus database with same CATH superfamily
1Y7EA 2P0WA 4HNXB 4UEZA 1TF9A 5LRKA 5EC4A 1XMTA 3B3WA 1CX8A 4RS2A 2Z11A 1CG2A 4JYWA 4OC1A 4YGOA 4ZX8A 1ARLA 2B58A 1IGBA 1S7KA 2FL4A 2RFHA 2ZXVA 3F8KA 4MFKA 1DE4C 2WUUA 4PXEA 2PE3A 4QC6A 4A2ZA 4OC4A 4TWEA 1A2ZA 3B8GA 2B4DA 3TO9A 3VATA 3ZJ0A 3V7ZA 1XIXA 3TFYA 5LYLA 3IO1A 1ELLP 5HVHA 3BJ7A 5GCNA 2Q7SA 4FAIA 4BMHA 3PP9A 4M6HA 4CYNA 4KZTA 4GM5A 2WZNA 4R6TA 1ZLHA 3EC4A 3DR6A 3SJFA 1Y0RA 2PJ1A 1GYTA 1VKCA 1XF8A 1Z8WA 2AJ6A 2ZEGA 2OOTA 2XEJA 4F0XA 4FD5A 1B6BA 2IL4A 5A27A 4QB9A 2QECA 4KVME 4NJQA 4P6YA 2Q43A 4F6AA 1TKHA 2RB7A 4ZBGA 1R57A 1M1DA 2B3VA 2PJBA 3LMSA 4H2KA 3JTKA 3JRUA 4KOTA 2R8VA 3PB9X 5C88A 4R57A 3BHXA 3KGQA 2REFA 1RTQA 3CDXA 3D7DA 1Y7RA 1Z4EA 2ZEDA 4UBRA 4OADA 3F0AA 2PC1A 4A39A 1H8LA 2OZHA 4UFVA 5DWNA 3TOAA 2ZOGA 2HC9A 4MHNA 2EUIA 1IIDA 4C7IA 1IU8A 1QSNA 2FCKA 2ZEFA 4CGOA 3R1KA 2PSWA 2I3CA 1CP6A 5ISVA 4M85A 4OC2A 4PPZA 3R96A 4FD7A 4RI1A 1YMEA 1YSJA 3FX6A 4A37A 4CYQA 2V8GA 2Z3PA 2VXKA 3PBBA 4H6ZA 3LD2A 5K8NA 3ISXA 2EVNA 1ARMA 1S3ZA 1XEBA 3FEDA 5LRGA 4ZI6A 1F2PA 3SI2A 4W9YA 4MHZA 4CGNA 4NEXA 4QBJA 5DWMA 3PFOA 1YVOA 1Z8XA 3S6FA 1YX0A 3IU1A 3T8WA 3TC8A 1KUVA 2B3UA 4AVCA 4JD6A 2Q4VA 2Q4ZA 2HV2A 2CXAA 2V8DA 4KORA 1R43A 4UWJA 4KSIA 3IGRA 1MJAA 4OKOA 1IYLA 3IIBA 4KOUA 4E2AA 1XMBA 5ELYA 1M4GA 2Q51A 3NE7A 5D29A 3RZAA 3W6XA 3FJUA 5EMIA 3WR7A 3C26A 3D2PA 3K9TA 1IOFA 5AGEA 4DNCA 4EVYA 2J8NA 4MFPA 3QB8A 2OZGA 1ON0A 4OC3A 3EO4A 1MJ9A 4R3KA 4A95A 3W6SA 3H8GA 3K2KA 2FT0A 4HNYB 4OIWA 1M4DA 2I79A 3H4QA 4JWPA 4UA3A 5D8NA 3DNSA 5JPHA 4Q7AA 4P44A 3WC7A 3B35A 4UCMA 3SXOA 4Y49B 2J8RA 1QMUA 3QNVA 4MCRA 8CPAA 4DYOA 2GREA 1CP7A 3N7ZA 4R8FA 5K8PA 2CTBA 5BWAB 1CPXA 3EY5A 1Y9KA 5JH9A 4X5KA 3KHXA 4OMEA 3D3SA 2CNSA 1Q7LA 4K3NA 2C6PA 1YW6A 4KOSA 2PJ0A 4UWIA 4MXUA 4E8OA 2ZEOA 2QJ8A 2C27A 1HDQA 1LAPA 3PB8X 1VGYA 4B5PA 1BPMA 1S7LA 3CPAA 5H86A 4MCSA 1IY7A 4EWTA 2ZW7A 1I12A 3TT2A 3S9NA 2VEZA 1S5KA 1UFHA 4TNUA 2AFMA 3HUVA 4XNHB 2PJ3A 4CGLA 2R7HA 2YNEA 4KOXA 2GLJA 4NF1A 4B11A 1BLLE 2DEAA 2JBJA 2PIYA 2Z0ZA 4HPSA 3PB7X 3GUXA 1DTDA 4F9VA 2AFXA 4B6ZA 2Y0MA 2ZW5A 4KOYA 1PCAA 2CIJA 4LUAA 2F5IA 2CY2A 4CPAA 5G22A 7CPAA 1LANA 5G20A 3FECA 1Z5RA 4CYPA 3OWCA 1YREA 2P6FA 1TIQA 2PJ5A 3RO0A 4JZ0A 1CM0A 4PK2A 2X7BA 5LYIA 4CAVA 5JQ4A 3D66A 2QVPA 1XJOA 4UFWA 1UWYA 1YR0A 2OB0A 3QAYA 4YWYA 4CGMA 5K8OA 3RAMA 1Z2LA 1YLOA 4LX9A 5G21A 3PGPA 3RBUA 4F8ZA 4Z65A 1AMPA 3CXQA 4ONWA 4UIAA 2VZYA 4BINA 4Y49C 1M4LA 2YGWA 1AUGA 2FXFA 4P4JA 3VARA 2JDCA 1MJBA 4BBHA 2Z10A 4G1PA 5AG4A 4P4FA 1I21A 5LYFA 4JLYA 3KQZA 3G3SA 2F7VA 3B7IA 4DUKA 1FT7A 3R95A 4A38A 2AFSA 3CPXA 4ONUA 5E96A 2I00A 2GE3A 1NMTA 3KI9A 5JM6A 4X8IA 1BO4A 2Q44A 3BLNA 1IOIA 3KKWA 4MJ8A 4UCNA 3VWEA 3GLJA 2EK9A 4P4EA 1K4JA 1VHEA 4UIBA 4OC5A 1I1DA 4CRYB 2EO8A 3TTHA 4XNHC 5HVFA 3W91A 3WC6A 4A30A 2ANPA 4U9ZA 4ZX9A 3R9EA 2ZPAA 1BAVA 1KZFA 3FYNA 5HXDA 2BOAA 1EE3P 2ZOFA 4H89A 4ZY1A 2ZEMA 4PSWA 3FEEA 3MGDA 1VHSA 2EK8A 1CPSA 2PRBA 2GIVA 3SI0A 3PFEA 2BEIA 4R7MA 1S7NA 1Y0YA 3T90A 4DJLA 2QMLA 3WABA 1CJWA 4UEEA 2PIZA 3D7HA 3D7GA 2GU2A 4MRIA 4A33A 2ODFA 2OZUA 3D68A 4CYOA 3L2NA 2IJZA 1U6MA 4FD4A 4Q38A 4UF4A 3SJGA 4H6UA 1ZG9A 3D7FA 3B3CA 1LRZA 4KUAA 4KVXA 2REEA 2PJ8A 4X2TA 4CAWA 1CBXA 2G9DA 5A28A 2ZEEA 2Q4YA 3DR8A 4PXCA 3DDDA 1GHEA 1LOKA 2H5MA 4AG7A 1XRYA 2B5GB 4LQGA 3V8IA 4MY3A 3FNCA 1F2OA 4I49A 1ZG7A 4YFJA 1IB1E 1NSLA 1RO5A 1M44A 4R9MA 5LRJA 3ZZIA 2ARHA 4KS9A 1KUYA 2JEVA 3R9FA 6CPAA 3FBUA 1KUXA 4C7HA 4WJBA 2XEIA 3N5FA 2VL1A 3LODA 4XPDB 2DXQA 4MHYA 3BI1A 4JXRA 4PSXA 4E0AA 1Z8TA 3TOBA 3HLPA 3NH8A 4NGMA 5F46A 2Q0YA 4C2XA 2D4OA 2PJCA 4PXDA 4P45A 4FBEA 1P4NA 2GFQA 2YNDA 2Z3LA 3B2YA 3LWUA 1P0HA 4MFLA 4R3LA 3S9MA 4WWVA 3KHZA 4PV6A 2CTCA 4F9UA 2PRQA 2YNCC 4FUUA 4XPKA 4KOVA 4JXQA 3KQXA 3E0KA 2KCWA 4CS0B 2PQ8A 4L89A 2VI7A 2XEFA 1NSAA 4MCQA 4OC0A 4CGPA 3IWGA 2NYQA 2C6CA 4F0YA 3GYAA 4A31A 1PU9A 3F5BA 1RXTA 4MBUA 1MK4A 1OZPA 3DSBA 1N71A 4P10A 4P4DA 2ZEHA 4PXBA 4LQ6A 2P6EA 2DPSA 2AFZA 3PRTA 3SJXA 3NH5A 4HNWB 4ZGYB 1JWQA 3H5ZA 1AYEA 2C6GA 4B14A 3FIXA 2A4NA 4IK2A 2AE6A 4MMOA 2PCUA 2PJ2A 2ZW6A 3GY9A 4NGPA 1L0CA 4MHPA 4NJRA 2PJ9A 4Q36A 3NE8A 1TKJA 4AVBA 1IYKA 4J3GA 2YNCA 1R3NA 2V77A 4HKFA 4EMEA 3EXNA 4MI4A 3VWDA 3S9LA 2JLMA 2NMTA 1Q2YA 3DLJA 4NGQA 4AXVA 3IJ3A 4R87A 1B87A 2O4HA 3SXNA 2JDDA 2C1CA 4XPLA 3SJEA 2K5TA 1S7FA 3R9GA 4OIDA 4A94A 4XPDC 3IWWA 5I4MA 3S6HA 3MRUA 3TE4A 3IU2A 4NGTA 4OP4A 1F57A 4KOWA 1XE4A 3I9SA 1FY7A 1Z4RA 4L8AA 4PK3A 2DF5A 3CT9A 4IAVA 2PDOA 3NA6A 4RN7A 4MHDA 4UCPA 3PZJA 2FVGA 5KTDA 1ZG8A 1NE9A 3KR5A 2HQYA 3UY5A 3B3SA 3JUWA 3KASA 2PJ6A 1ZO0A 2CNTA 5K8MA 1FNOA 4KSAA 2Z3NA 3B3VA 3D4UA 2B5GA 5J8FA 5DS0A 4B13A 3P2HA 5F47A 3FF3A 5IV0A 4NGSA 4QVTA 2JBKA 1QSRA 3D8PA 4BD9A 3PB4X 2PVWA 4MCPA 2OH1A 5CPAA 1X12A 2BCOA 4X3RA 3VH9A 4CAEA 4CAXA 3MN8A 4IF5A 1Y9WA 4M3SA 4R76A 2D4PA 3BI0A 3K9UA 2FE7A 3PB6X 4MFJA 5FVJA 2AFOA 4CRZB 4KVOE 4P4BA 3KR4A 5AG5A 3H8FA 2FIAA 4MFQA 2AFUA 3QAHA 1YVKA 2JEWA 2ZENA 3WT4A 2CF4A 5KTCA 5AG7A 5LYDA 2PVVA 2IMOA 3KL9A 2R98A 2NSMA 4MFZA 4B10A 3FH4A 4AB7A 2WSAA 1WK4A 3CZXA 3FB3A 3G8WA 4UFXA 5J8CA 4B5PB 2WYRA 2FS5A 2QYVA 3CXSA 2O53A 3LACA 2Z3KA 3NH4A 4IHMA 5H84A 5F48A 3FRMA 3FVLA 4O23A 4U5YA 2OR4A 2RC4A 3H8EA 4KSFA 3GIUA 5AG6A 4EFDA 1YGHA 3I3GA 3GKRA 3IC1A 2PJAA 5HMNA 3IEHA 2PJ4A 4P4IA 3S6GA 2ZW4A 1LCPA 4RUHA 5F49A 1QSOA 4KLWA 2R1IA 3S6KA 2QIRA 3PBEA 4M6GA 1KWMA 2G3AA 3TX8A 2G0BA 5EBVA 1J4JA 1Q2DA 2O28A 5C82A 3CXPA 4ORFA 1BOBA 3T9YA 5IX3A 1YQEA 3BJ8A 1BPNA 3DGVA 2AFWA 1VHOA 3P2FA 4KUBA 2Z3MA 4ZYQA 1PUAA 3B3TA 4FWUA 1SQHA 1LAMA 2B4DB 5THWA 5G1ZA 2J9AA 1ZLIA 2EBJA 2V8HA 2FIWA 5HVGA 4NXYA 2P6GA 1M4IA 1OBRA 3RYOA 5F09A 1YLEA 4NGNA 1X10A 2J8MA 2ATRA 3D67A 5HH1A 1TXRA 2BO9A 2ZELA 2FSRA 2G3TA 4K30A 3EFAA 1WWZA 1HDUA 4UEFA 1TF8A 4OLLA 2ABZA 2VZZA 4NSQA 2PJ7A 2ZEPA 4NGRA 4PQAA 4C2YA 5IB0A 4AG9A 5KTAA 3PEIA 2OU2A 4A32A 4C68A 4IUSA 4U9YA 2F8HA 1ELMP 1Z8LA 4M6IA 2VQYA 2WPXA 2PR8A 2VBQA 5CBMA 4ZY0A 4YU9A 4OAEA 5CNPA 4AVAA 4C2ZA 5I0CA 1JQGA 4B5OA 2IQ6A 1V0CA 1IICA 1VIXA 2HB6A 4KLVA 1Z9UA 4GS4A 4QUSA 1PYTB 1LFWA 3IFEA 4NFRA 3FXTA 2EWBA 4FD6A 5JGFA 4MY0A 3IWEA 1Q2CA 1XFOA 3SI1A 2BSWA 2WPWA 3D2MA 2Q7BA 3WC5A 2HUZA 2BUEA 4YRHA 1TKFA 3GB0A 2POKA 4CAFA 5J1QA 4II9A 2GANA 4ZY2A 3RNZA 4JJXA 3BXMA 1XOVA 2BL1A 4GXHA 2B4BA 2V8VA 3FMCA 1QQ9A 1HEEA 2PR1A 3NFZA 3V38A 1YW4A 3KZWA 2GLFA 2Q04A 2CNMA 2Z3OA 3TO7A 3TO6A 3JVNA 4B12A 1YK3A 3TCVA 1QSTA 1XBUA 2XEGA 3SHPA 3A9LA 1QSMA 5IB9A 3ISZA 3I1UA 4NCZA 2DPTA 1S60A
chains in the Genus database with same CATH topology
2P0WA 4HNXB 5EC4A 1XMTA 4RS2A 2Z11A 4YGOA 2B58A 1S7KA 2FL4A 2ZXVA 3F8KA 4MFKA 4QC6A 2WUUA 4A2ZA 3B8GA 2B4DA 3TO9A 3ZJ0A 1XIXA 3TFYA 3BJ7A 5GCNA 4BMHA 3PP9A 4CYNA 4KZTA 3EC4A 3DR6A 1VKCA 2AJ6A 1XF8A 4F0XA 4FD5A 1B6BA 2IL4A 5A27A 4QB9A 2QECA 4KVME 4F6AA 4ZBGA 1R57A 1M1DA 2B3VA 3JTKA 4KOTA 2R8VA 5C88A 4R57A 2REFA 1Y7RA 1Z4EA 4UBRA 4OADA 3F0AA 2PC1A 4UFVA 2OZHA 5DWNA 3TOAA 2EUIA 1IIDA 4C7IA 1QSNA 2FCKA 4CGOA 3R1KA 2PSWA 5ISVA 4M85A 3R96A 4FD7A 4RI1A 4CYQA 2Z3PA 2VXKA 4H6ZA 3LD2A 2EVNA 1S3ZA 1XEBA 4CGNA 4NEXA 4QBJA 5DWMA 1YVOA 3S6FA 1YX0A 3IU1A 1KUVA 2B3UA 4AVCA 4JD6A 2Q4VA 2HV2A 2CXAA 4KORA 4UWJA 3IGRA 1MJAA 1IYLA 4KOUA 4E2AA 1M4GA 3NE7A 3W6XA 3WR7A 3C26A 3D2PA 5AGEA 4DNCA 4EVYA 2J8NA 4MFPA 3QB8A 2OZGA 1ON0A 3EO4A 1MJ9A 4R3KA 4A95A 3W6SA 2FT0A 4HNYB 1M4DA 2I79A 3H4QA 4JWPA 4UA3A 3DNSA 5JPHA 4UCMA 3SXOA 4Y49B 2J8RA 3N7ZA 5BWAB 3EY5A 1Y9KA 4X5KA 3D3SA 2CNSA 4KOSA 4UWIA 4E8OA 2C27A 4B5PA 1S7LA 5H86A 2ZW7A 1I12A 3TT2A 2VEZA 1S5KA 1UFHA 4XNHB 4CGLA 2R7HA 2YNEA 4KOXA 4NF1A 4B11A 2Z0ZA 2Y0MA 2ZW5A 4KOYA 4LUAA 2F5IA 2CY2A 5G22A 5G20A 4CYPA 3OWCA 1YREA 2P6FA 1TIQA 1CM0A 4PK2A 2X7BA 4CAVA 5JQ4A 4UFWA 1YR0A 2OB0A 4CGMA 5G21A 4LX9A 3PGPA 3CXQA 2VZYA 4Y49C 2YGWA 2FXFA 2JDCA 1MJBA 4BBHA 2Z10A 5AG4A 1I21A 3G3SA 3R95A 4ONUA 5E96A 2I00A 2GE3A 1NMTA 1BO4A 2Q44A 3BLNA 3KKWA 4MJ8A 4UCNA 3VWEA 1K4JA 1I1DA 4CRYB 3TTHA 4XNHC 3W91A 4A30A 4U9ZA 3R9EA 2ZPAA 1KZFA 3FYNA 4H89A 4PSWA 3MGDA 1VHSA 2PRBA 2GIVA 2BEIA 1S7NA 3T90A 2QMLA 1CJWA 4A33A 2OZUA 4CYOA 4Q38A 4FD4A 1U6MA 4H6UA 1LRZA 4KUAA 4KVXA 2REEA 5A28A 4CAWA 2Q4YA 3DR8A 3DDDA 1GHEA 2H5MA 4AG7A 2B5GB 3V8IA 4MY3A 3FNCA 4I49A 4YFJA 1IB1E 1NSLA 1RO5A 1M44A 4R9MA 3ZZIA 2ARHA 4KS9A 1KUYA 2JEVA 3R9FA 3FBUA 1KUXA 4C7HA 3LODA 4XPDB 2DXQA 4JXRA 4PSXA 4E0AA 3TOBA 5F46A 2Q0YA 4C2XA 2D4OA 1P4NA 2YNDA 2Z3LA 4MFLA 1P0HA 4R3LA 4PV6A 2YNCC 4XPKA 4KOVA 4JXQA 3E0KA 2KCWA 4CS0B 2PQ8A 4L89A 2VI7A 4CGPA 3IWGA 4F0YA 3GYAA 4A31A 1PU9A 3F5BA 1RXTA 4MBUA 1MK4A 1OZPA 3DSBA 1N71A 2P6EA 2DPSA 4HNWB 4ZGYB 3H5ZA 4B14A 3FIXA 2A4NA 2AE6A 2ZW6A 3GY9A 1L0CA 4Q36A 4AVBA 1IYKA 4J3GA 2YNCA 4HKFA 3EXNA 4MI4A 3VWDA 2JLMA 2NMTA 1Q2YA 4R87A 1B87A 3SXNA 2JDDA 4XPLA 2K5TA 1S7FA 3R9GA 4XPDC 3S6HA 3TE4A 3IU2A 4KOWA 1XE4A 3I9SA 1FY7A 1Z4RA 4L8AA 4PK3A 4UCPA 2PDOA 4MHDA 3PZJA 5KTDA 1NE9A 2HQYA 3UY5A 3JUWA 1ZO0A 2CNTA 4KSAA 2Z3NA 2B5GA 5J8FA 4B13A 3P2HA 5F47A 5IV0A 4QVTA 1QSRA 3D8PA 2OH1A 4CAEA 4CAXA 4IF5A 1Y9WA 4M3SA 2D4PA 3K9UA 2FE7A 4MFJA 5FVJA 4CRZB 4KVOE 5AG5A 2FIAA 4MFQA 3QAHA 1YVKA 5KTCA 5AG7A 2R98A 4MFZA 4B10A 4AB7A 2WSAA 1WK4A 3G8WA 3FB3A 4UFXA 5J8CA 4B5PB 2FS5A 3CXSA 2Z3KA 5H84A 5F48A 3FRMA 4U5YA 2RC4A 5AG6A 4KSFA 1YGHA 3I3GA 3GKRA 5HMNA 3S6GA 2ZW4A 5F49A 1QSOA 4KLWA 2R1IA 3S6KA 2QIRA 2G3AA 2G0BA 5EBVA 1J4JA 1Q2DA 2O28A 5C82A 3CXPA 4ORFA 1BOBA 3T9YA 5IX3A 3BJ8A 4KUBA 3P2FA 2Z3MA 1PUAA 1SQHA 2B4DB 5G1ZA 2FIWA 4NXYA 2P6GA 1M4IA 3RYOA 1YLEA 2J8MA 2ATRA 5HH1A 2FSRA 2G3TA 4K30A 3EFAA 1WWZA 4OLLA 4NSQA 2VZZA 4C2YA 5IB0A 4AG9A 5KTAA 2OU2A 4A32A 4C68A 4IUSA 4U9YA 2VQYA 2WPXA 2PR8A 2VBQA 4AVAA 4OAEA 5CNPA 5I0CA 4C2ZA 4B5OA 1V0CA 1IICA 4KLVA 1Z9UA 4GS4A 4QUSA 3FXTA 4FD6A 4MY0A 3IWEA 1Q2CA 2BSWA 2WPWA 3D2MA 2Q7BA 2HUZA 2BUEA 4YRHA 4CAFA 4II9A 2GANA 4JJXA 2BL1A 2B4BA 2PR1A 2Q04A 2CNMA 2Z3OA 3TO7A 3TO6A 4B12A 1YK3A 3TCVA 1QSTA 3SHPA 3A9LA 1QSMA 3JVNA 4JLYA 4NCZA 2DPTA 1S60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZGY B;  5BWA B;  1ZO0 A; 
#chains in the Genus database with same CATH topology
 1Y7E A;  2P0W A;  4HNX B;  4UEZ A;  1TF9 A;  5LRK A;  5EC4 A;  1XMT A;  3B3W A;  1CX8 A;  4RS2 A;  2Z11 A;  1CG2 A;  4JYW A;  4OC1 A;  4YGO A;  4ZX8 A;  1ARL A;  2B58 A;  1IGB A;  1S7K A;  2FL4 A;  2RFH A;  2ZXV A;  3F8K A;  4MFK A;  1DE4 C;  2WUU A;  4PXE A;  2PE3 A;  4QC6 A;  4A2Z A;  4OC4 A;  4TWE A;  1A2Z A;  3B8G A;  2B4D A;  3TO9 A;  3VAT A;  3ZJ0 A;  3V7Z A;  1XIX A;  3TFY A;  5LYL A;  3IO1 A;  1ELL P;  5HVH A;  3BJ7 A;  5GCN A;  2Q7S A;  4FAI A;  4BMH A;  3PP9 A;  4M6H A;  4CYN A;  4KZT A;  4GM5 A;  2WZN A;  4R6T A;  1ZLH A;  3EC4 A;  3DR6 A;  3SJF A;  1Y0R A;  2PJ1 A;  1GYT A;  1VKC A;  1XF8 A;  1Z8W A;  2AJ6 A;  2ZEG A;  2OOT A;  2XEJ A;  4F0X A;  4FD5 A;  1B6B A;  2IL4 A;  5A27 A;  4QB9 A;  2QEC A;  4KVM E;  4NJQ A;  4P6Y A;  2Q43 A;  4F6A A;  1TKH A;  2RB7 A;  4ZBG A;  1R57 A;  1M1D A;  2B3V A;  2PJB A;  3LMS A;  4H2K A;  3JTK A;  3JRU A;  4KOT A;  2R8V A;  3PB9 X;  5C88 A;  4R57 A;  3BHX A;  3KGQ A;  2REF A;  1RTQ A;  3CDX A;  3D7D A;  1Y7R A;  1Z4E A;  2ZED A;  4UBR A;  4OAD A;  3F0A A;  2PC1 A;  4A39 A;  1H8L A;  2OZH A;  4UFV A;  5DWN A;  3TOA A;  2ZOG A;  2HC9 A;  4MHN A;  2EUI A;  1IID A;  4C7I A;  1IU8 A;  1QSN A;  2FCK A;  2ZEF A;  4CGO A;  3R1K A;  2PSW A;  2I3C A;  1CP6 A;  5ISV A;  4M85 A;  4OC2 A;  4PPZ A;  3R96 A;  4FD7 A;  4RI1 A;  1YME A;  1YSJ A;  3FX6 A;  4A37 A;  4CYQ A;  2V8G A;  2Z3P A;  2VXK A;  3PBB A;  4H6Z A;  3LD2 A;  5K8N A;  3ISX A;  2EVN A;  1ARM A;  1S3Z A;  1XEB A;  3FED A;  5LRG A;  4ZI6 A;  1F2P A;  3SI2 A;  4W9Y A;  4MHZ A;  4CGN A;  4NEX A;  4QBJ A;  5DWM A;  3PFO A;  1YVO A;  1Z8X A;  3S6F A;  1YX0 A;  3IU1 A;  3T8W A;  3TC8 A;  1KUV A;  2B3U A;  4AVC A;  4JD6 A;  2Q4V A;  2Q4Z A;  2HV2 A;  2CXA A;  2V8D A;  4KOR A;  1R43 A;  4UWJ A;  4KSI A;  3IGR A;  1MJA A;  4OKO A;  1IYL A;  3IIB A;  4KOU A;  4E2A A;  1XMB A;  5ELY A;  1M4G A;  2Q51 A;  3NE7 A;  5D29 A;  3RZA A;  3W6X A;  3FJU A;  5EMI A;  3WR7 A;  3C26 A;  3D2P A;  3K9T A;  1IOF A;  5AGE A;  4DNC A;  4EVY A;  2J8N A;  4MFP A;  3QB8 A;  2OZG A;  1ON0 A;  4OC3 A;  3EO4 A;  1MJ9 A;  4R3K A;  4A95 A;  3W6S A;  3H8G A;  3K2K A;  2FT0 A;  4HNY B;  4OIW A;  1M4D A;  2I79 A;  3H4Q A;  4JWP A;  4UA3 A;  5D8N A;  3DNS A;  5JPH A;  4Q7A A;  4P44 A;  3WC7 A;  3B35 A;  4UCM A;  3SXO A;  4Y49 B;  2J8R A;  1QMU A;  3QNV A;  4MCR A;  8CPA A;  4DYO A;  2GRE A;  1CP7 A;  3N7Z A;  4R8F A;  5K8P A;  2CTB A;  5BWA B;  1CPX A;  3EY5 A;  1Y9K A;  5JH9 A;  4X5K A;  3KHX A;  4OME A;  3D3S A;  2CNS A;  1Q7L A;  4K3N A;  2C6P A;  1YW6 A;  4KOS A;  2PJ0 A;  4UWI A;  4MXU A;  4E8O A;  2ZEO A;  2QJ8 A;  2C27 A;  1HDQ A;  1LAP A;  3PB8 X;  1VGY A;  4B5P A;  1BPM A;  1S7L A;  3CPA A;  5H86 A;  4MCS A;  1IY7 A;  4EWT A;  2ZW7 A;  1I12 A;  3TT2 A;  3S9N A;  2VEZ A;  1S5K A;  1UFH A;  4TNU A;  2AFM A;  3HUV A;  4XNH B;  2PJ3 A;  4CGL A;  2R7H A;  2YNE A;  4KOX A;  2GLJ A;  4NF1 A;  4B11 A;  1BLL E;  2DEA A;  2JBJ A;  2PIY A;  2Z0Z A;  4HPS A;  3PB7 X;  3GUX A;  1DTD A;  4F9V A;  2AFX A;  4B6Z A;  2Y0M A;  2ZW5 A;  4KOY A;  1PCA A;  2CIJ A;  4LUA A;  2F5I A;  2CY2 A;  4CPA A;  5G22 A;  7CPA A;  1LAN A;  5G20 A;  3FEC A;  1Z5R A;  4CYP A;  3OWC A;  1YRE A;  2P6F A;  1TIQ A;  2PJ5 A;  3RO0 A;  4JZ0 A;  1CM0 A;  4PK2 A;  2X7B A;  5LYI A;  4CAV A;  5JQ4 A;  3D66 A;  2QVP A;  1XJO A;  4UFW A;  1UWY A;  1YR0 A;  2OB0 A;  3QAY A;  4YWY A;  4CGM A;  5K8O A;  3RAM A;  1Z2L A;  1YLO A;  4LX9 A;  5G21 A;  3PGP A;  3RBU A;  4F8Z A;  4Z65 A;  1AMP A;  3CXQ A;  4ONW A;  4UIA A;  2VZY A;  4BIN A;  4Y49 C;  1M4L A;  2YGW A;  1AUG A;  2FXF A;  4P4J A;  3VAR A;  2JDC A;  1MJB A;  4BBH A;  2Z10 A;  4G1P A;  5AG4 A;  4P4F A;  1I21 A;  5LYF A;  4JLY A;  3KQZ A;  3G3S A;  2F7V A;  3B7I A;  4DUK A;  1FT7 A;  3R95 A;  4A38 A;  2AFS A;  3CPX A;  4ONU A;  5E96 A;  2I00 A;  2GE3 A;  1NMT A;  3KI9 A;  5JM6 A;  4X8I A;  1BO4 A;  2Q44 A;  3BLN A;  1IOI A;  3KKW A;  4MJ8 A;  4UCN A;  3VWE A;  3GLJ A;  2EK9 A;  4P4E A;  1K4J A;  1VHE A;  4UIB A;  4OC5 A;  1I1D A;  4CRY B;  2EO8 A;  3TTH A;  4XNH C;  5HVF A;  3W91 A;  3WC6 A;  4A30 A;  2ANP A;  4U9Z A;  4ZX9 A;  3R9E A;  2ZPA A;  1BAV A;  1KZF A;  3FYN A;  5HXD A;  2BOA A;  1EE3 P;  2ZOF A;  4H89 A;  4ZY1 A;  2ZEM A;  4PSW A;  3FEE A;  3MGD A;  1VHS A;  2EK8 A;  1CPS A;  2PRB A;  2GIV A;  3SI0 A;  3PFE A;  2BEI A;  4R7M A;  1S7N A;  1Y0Y A;  3T90 A;  4DJL A;  2QML A;  3WAB A;  1CJW A;  4UEE A;  2PIZ A;  3D7H A;  3D7G A;  2GU2 A;  4MRI A;  4A33 A;  2ODF A;  2OZU A;  3D68 A;  4CYO A;  3L2N A;  2IJZ A;  1U6M A;  4FD4 A;  4Q38 A;  4UF4 A;  3SJG A;  4H6U A;  1ZG9 A;  3D7F A;  3B3C A;  1LRZ A;  4KUA A;  4KVX A;  2REE A;  2PJ8 A;  4X2T A;  4CAW A;  1CBX A;  2G9D A;  5A28 A;  2ZEE A;  2Q4Y A;  3DR8 A;  4PXC A;  3DDD A;  1GHE A;  1LOK A;  2H5M A;  4AG7 A;  1XRY A;  2B5G B;  4LQG A;  3V8I A;  4MY3 A;  3FNC A;  1F2O A;  4I49 A;  1ZG7 A;  4YFJ A;  1IB1 E;  1NSL A;  1RO5 A;  1M44 A;  4R9M A;  5LRJ A;  3ZZI A;  2ARH A;  4KS9 A;  1KUY A;  2JEV A;  3R9F A;  6CPA A;  3FBU A;  1KUX A;  4C7H A;  4WJB A;  2XEI A;  3N5F A;  2VL1 A;  3LOD A;  4XPD B;  2DXQ A;  4MHY A;  3BI1 A;  4JXR A;  4PSX A;  4E0A A;  1Z8T A;  3TOB A;  3HLP A;  3NH8 A;  4NGM A;  5F46 A;  2Q0Y A;  4C2X A;  2D4O A;  2PJC A;  4PXD A;  4P45 A;  4FBE A;  1P4N A;  2GFQ A;  2YND A;  2Z3L A;  3B2Y A;  3LWU A;  1P0H A;  4MFL A;  4R3L A;  3S9M A;  4WWV A;  3KHZ A;  4PV6 A;  2CTC A;  4F9U A;  2PRQ A;  2YNC C;  4FUU A;  4XPK A;  4KOV A;  4JXQ A;  3KQX A;  3E0K A;  2KCW A;  4CS0 B;  2PQ8 A;  4L89 A;  2VI7 A;  2XEF A;  1NSA A;  4MCQ A;  4OC0 A;  4CGP A;  3IWG A;  2NYQ A;  2C6C A;  4F0Y A;  3GYA A;  4A31 A;  1PU9 A;  3F5B A;  1RXT A;  4MBU A;  1MK4 A;  1OZP A;  3DSB A;  1N71 A;  4P10 A;  4P4D A;  2ZEH A;  4PXB A;  4LQ6 A;  2P6E A;  2DPS A;  2AFZ A;  3PRT A;  3SJX A;  3NH5 A;  4HNW B;  4ZGY B;  1JWQ A;  3H5Z A;  1AYE A;  2C6G A;  4B14 A;  3FIX A;  2A4N A;  4IK2 A;  2AE6 A;  4MMO A;  2PCU A;  2PJ2 A;  2ZW6 A;  3GY9 A;  4NGP A;  1L0C A;  4MHP A;  4NJR A;  2PJ9 A;  4Q36 A;  3NE8 A;  1TKJ A;  4AVB A;  1IYK A;  4J3G A;  2YNC A;  1R3N A;  2V77 A;  4HKF A;  4EME A;  3EXN A;  4MI4 A;  3VWD A;  3S9L A;  2JLM A;  2NMT A;  1Q2Y A;  3DLJ A;  4NGQ A;  4AXV A;  3IJ3 A;  4R87 A;  1B87 A;  2O4H A;  3SXN A;  2JDD A;  2C1C A;  4XPL A;  3SJE A;  2K5T A;  1S7F A;  3R9G A;  4OID A;  4A94 A;  4XPD C;  3IWW A;  5I4M A;  3S6H A;  3MRU A;  3TE4 A;  3IU2 A;  4NGT A;  4OP4 A;  1F57 A;  4KOW A;  1XE4 A;  3I9S A;  1FY7 A;  1Z4R A;  4L8A A;  4PK3 A;  2DF5 A;  3CT9 A;  4IAV A;  2PDO A;  3NA6 A;  4RN7 A;  4MHD A;  4UCP A;  3PZJ A;  2FVG A;  5KTD A;  1ZG8 A;  1NE9 A;  3KR5 A;  2HQY A;  3UY5 A;  3B3S A;  3JUW A;  3KAS A;  2PJ6 A;  1ZO0 A;  2CNT A;  5K8M A;  1FNO A;  4KSA A;  2Z3N A;  3B3V A;  3D4U A;  2B5G A;  5J8F A;  5DS0 A;  4B13 A;  3P2H A;  5F47 A;  3FF3 A;  5IV0 A;  4NGS A;  4QVT A;  2JBK A;  1QSR A;  3D8P A;  4BD9 A;  3PB4 X;  2PVW A;  4MCP A;  2OH1 A;  5CPA A;  1X12 A;  2BCO A;  4X3R A;  3VH9 A;  4CAE A;  4CAX A;  3MN8 A;  4IF5 A;  1Y9W A;  4M3S A;  4R76 A;  2D4P A;  3BI0 A;  3K9U A;  2FE7 A;  3PB6 X;  4MFJ A;  5FVJ A;  2AFO A;  4CRZ B;  4KVO E;  4P4B A;  3KR4 A;  5AG5 A;  3H8F A;  2FIA A;  4MFQ A;  2AFU A;  3QAH A;  1YVK A;  2JEW A;  2ZEN A;  3WT4 A;  2CF4 A;  5KTC A;  5AG7 A;  5LYD A;  2PVV A;  2IMO A;  3KL9 A;  2R98 A;  2NSM A;  4MFZ A;  4B10 A;  3FH4 A;  4AB7 A;  2WSA A;  1WK4 A;  3CZX A;  3FB3 A;  3G8W A;  4UFX A;  5J8C A;  4B5P B;  2WYR A;  2FS5 A;  2QYV A;  3CXS A;  2O53 A;  3LAC A;  2Z3K A;  3NH4 A;  4IHM A;  5H84 A;  5F48 A;  3FRM A;  3FVL A;  4O23 A;  4U5Y A;  2OR4 A;  2RC4 A;  3H8E A;  4KSF A;  3GIU A;  5AG6 A;  4EFD A;  1YGH A;  3I3G A;  3GKR A;  3IC1 A;  2PJA A;  5HMN A;  3IEH A;  2PJ4 A;  4P4I A;  3S6G A;  2ZW4 A;  1LCP A;  4RUH A;  5F49 A;  1QSO A;  4KLW A;  2R1I A;  3S6K A;  2QIR A;  3PBE A;  4M6G A;  1KWM A;  2G3A A;  3TX8 A;  2G0B A;  5EBV A;  1J4J A;  1Q2D A;  2O28 A;  5C82 A;  3CXP A;  4ORF A;  1BOB A;  3T9Y A;  5IX3 A;  1YQE A;  3BJ8 A;  1BPN A;  3DGV A;  2AFW A;  1VHO A;  3P2F A;  4KUB A;  2Z3M A;  4ZYQ A;  1PUA A;  3B3T A;  4FWU A;  1SQH A;  1LAM A;  2B4D B;  5THW A;  5G1Z A;  2J9A A;  1ZLI A;  2EBJ A;  2V8H A;  2FIW A;  5HVG A;  4NXY A;  2P6G A;  1M4I A;  1OBR A;  3RYO A;  5F09 A;  1YLE A;  4NGN A;  1X10 A;  2J8M A;  2ATR A;  3D67 A;  5HH1 A;  1TXR A;  2BO9 A;  2ZEL A;  2FSR A;  2G3T A;  4K30 A;  3EFA A;  1WWZ A;  1HDU A;  4UEF A;  1TF8 A;  4OLL A;  2ABZ A;  2VZZ A;  4NSQ A;  2PJ7 A;  2ZEP A;  4NGR A;  4PQA A;  4C2Y A;  5IB0 A;  4AG9 A;  5KTA A;  3PEI A;  2OU2 A;  4A32 A;  4C68 A;  4IUS A;  4U9Y A;  2F8H A;  1ELM P;  1Z8L A;  4M6I A;  2VQY A;  2WPX A;  2PR8 A;  2VBQ A;  5CBM A;  4ZY0 A;  4YU9 A;  4OAE A;  5CNP A;  4AVA A;  4C2Z A;  5I0C A;  1JQG A;  4B5O A;  2IQ6 A;  1V0C A;  1IIC A;  1VIX A;  2HB6 A;  4KLV A;  1Z9U A;  4GS4 A;  4QUS A;  1PYT B;  1LFW A;  3IFE A;  4NFR A;  3FXT A;  2EWB A;  4FD6 A;  5JGF A;  4MY0 A;  3IWE A;  1Q2C A;  1XFO A;  3SI1 A;  2BSW A;  2WPW A;  3D2M A;  2Q7B A;  3WC5 A;  2HUZ A;  2BUE A;  4YRH A;  1TKF A;  3GB0 A;  2POK A;  4CAF A;  5J1Q A;  4II9 A;  2GAN A;  4ZY2 A;  3RNZ A;  4JJX A;  3BXM A;  1XOV A;  2BL1 A;  4GXH A;  2B4B A;  2V8V A;  3FMC A;  1QQ9 A;  1HEE A;  2PR1 A;  3NFZ A;  3V38 A;  1YW4 A;  3KZW A;  2GLF A;  2Q04 A;  2CNM A;  2Z3O A;  3TO7 A;  3TO6 A;  3JVN A;  4B12 A;  1YK3 A;  3TCV A;  1QST A;  1XBU A;  2XEG A;  3SHP A;  3A9L A;  1QSM A;  5IB9 A;  3ISZ A;  3I1U A;  4NCZ A;  2DPT A;  1S60 A; 
#chains in the Genus database with same CATH homology
 2P0W A;  4HNX B;  5EC4 A;  1XMT A;  4RS2 A;  2Z11 A;  4YGO A;  2B58 A;  1S7K A;  2FL4 A;  2ZXV A;  3F8K A;  4MFK A;  4QC6 A;  2WUU A;  4A2Z A;  3B8G A;  2B4D A;  3TO9 A;  3ZJ0 A;  1XIX A;  3TFY A;  3BJ7 A;  5GCN A;  4BMH A;  3PP9 A;  4CYN A;  4KZT A;  3EC4 A;  3DR6 A;  1VKC A;  2AJ6 A;  1XF8 A;  4F0X A;  4FD5 A;  1B6B A;  2IL4 A;  5A27 A;  4QB9 A;  2QEC A;  4KVM E;  4F6A A;  4ZBG A;  1R57 A;  1M1D A;  2B3V A;  3JTK A;  4KOT A;  2R8V A;  5C88 A;  4R57 A;  2REF A;  1Y7R A;  1Z4E A;  4UBR A;  4OAD A;  3F0A A;  2PC1 A;  4UFV A;  2OZH A;  5DWN A;  3TOA A;  2EUI A;  1IID A;  4C7I A;  1QSN A;  2FCK A;  4CGO A;  3R1K A;  2PSW A;  5ISV A;  4M85 A;  3R96 A;  4FD7 A;  4RI1 A;  4CYQ A;  2Z3P A;  2VXK A;  4H6Z A;  3LD2 A;  2EVN A;  1S3Z A;  1XEB A;  4CGN A;  4NEX A;  4QBJ A;  5DWM A;  1YVO A;  3S6F A;  1YX0 A;  3IU1 A;  1KUV A;  2B3U A;  4AVC A;  4JD6 A;  2Q4V A;  2HV2 A;  2CXA A;  4KOR A;  4UWJ A;  3IGR A;  1MJA A;  1IYL A;  4KOU A;  4E2A A;  1M4G A;  3NE7 A;  3W6X A;  3WR7 A;  3C26 A;  3D2P A;  5AGE A;  4DNC A;  4EVY A;  2J8N A;  4MFP A;  3QB8 A;  2OZG A;  1ON0 A;  3EO4 A;  1MJ9 A;  4R3K A;  4A95 A;  3W6S A;  2FT0 A;  4HNY B;  1M4D A;  2I79 A;  3H4Q A;  4JWP A;  4UA3 A;  3DNS A;  5JPH A;  4UCM A;  3SXO A;  4Y49 B;  2J8R A;  3N7Z A;  5BWA B;  3EY5 A;  1Y9K A;  4X5K A;  3D3S A;  2CNS A;  4KOS A;  4UWI A;  4E8O A;  2C27 A;  4B5P A;  1S7L A;  5H86 A;  2ZW7 A;  1I12 A;  3TT2 A;  2VEZ A;  1S5K A;  1UFH A;  4XNH B;  4CGL A;  2R7H A;  2YNE A;  4KOX A;  4NF1 A;  4B11 A;  2Z0Z A;  2Y0M A;  2ZW5 A;  4KOY A;  4LUA A;  2F5I A;  2CY2 A;  5G22 A;  5G20 A;  4CYP A;  3OWC A;  1YRE A;  2P6F A;  1TIQ A;  1CM0 A;  4PK2 A;  2X7B A;  4CAV A;  5JQ4 A;  4UFW A;  1YR0 A;  2OB0 A;  4CGM A;  5G21 A;  4LX9 A;  3PGP A;  3CXQ A;  2VZY A;  4Y49 C;  2YGW A;  2FXF A;  2JDC A;  1MJB A;  4BBH A;  2Z10 A;  5AG4 A;  1I21 A;  3G3S A;  3R95 A;  4ONU A;  5E96 A;  2I00 A;  2GE3 A;  1NMT A;  1BO4 A;  2Q44 A;  3BLN A;  3KKW A;  4MJ8 A;  4UCN A;  3VWE A;  1K4J A;  1I1D A;  4CRY B;  3TTH A;  4XNH C;  3W91 A;  4A30 A;  4U9Z A;  3R9E A;  2ZPA A;  1KZF A;  3FYN A;  4H89 A;  4PSW A;  3MGD A;  1VHS A;  2PRB A;  2GIV A;  2BEI A;  1S7N A;  3T90 A;  2QML A;  1CJW A;  4A33 A;  2OZU A;  4CYO A;  4Q38 A;  4FD4 A;  1U6M A;  4H6U A;  1LRZ A;  4KUA A;  4KVX A;  2REE A;  5A28 A;  4CAW A;  2Q4Y A;  3DR8 A;  3DDD A;  1GHE A;  2H5M A;  4AG7 A;  2B5G B;  3V8I A;  4MY3 A;  3FNC A;  4I49 A;  4YFJ A;  1IB1 E;  1NSL A;  1RO5 A;  1M44 A;  4R9M A;  3ZZI A;  2ARH A;  4KS9 A;  1KUY A;  2JEV A;  3R9F A;  3FBU A;  1KUX A;  4C7H A;  3LOD A;  4XPD B;  2DXQ A;  4JXR A;  4PSX A;  4E0A A;  3TOB A;  5F46 A;  2Q0Y A;  4C2X A;  2D4O A;  1P4N A;  2YND A;  2Z3L A;  4MFL A;  1P0H A;  4R3L A;  4PV6 A;  2YNC C;  4XPK A;  4KOV A;  4JXQ A;  3E0K A;  2KCW A;  4CS0 B;  2PQ8 A;  4L89 A;  2VI7 A;  4CGP A;  3IWG A;  4F0Y A;  3GYA A;  4A31 A;  1PU9 A;  3F5B A;  1RXT A;  4MBU A;  1MK4 A;  1OZP A;  3DSB A;  1N71 A;  2P6E A;  2DPS A;  4HNW B;  4ZGY B;  3H5Z A;  4B14 A;  3FIX A;  2A4N A;  2AE6 A;  2ZW6 A;  3GY9 A;  1L0C A;  4Q36 A;  4AVB A;  1IYK A;  4J3G A;  2YNC A;  4HKF A;  3EXN A;  4MI4 A;  3VWD A;  2JLM A;  2NMT A;  1Q2Y A;  4R87 A;  1B87 A;  3SXN A;  2JDD A;  4XPL A;  2K5T A;  1S7F A;  3R9G A;  4XPD C;  3S6H A;  3TE4 A;  3IU2 A;  4KOW A;  1XE4 A;  3I9S A;  1FY7 A;  1Z4R A;  4L8A A;  4PK3 A;  4UCP A;  2PDO A;  4MHD A;  3PZJ A;  5KTD A;  1NE9 A;  2HQY A;  3UY5 A;  3JUW A;  1ZO0 A;  2CNT A;  4KSA A;  2Z3N A;  2B5G A;  5J8F A;  4B13 A;  3P2H A;  5F47 A;  5IV0 A;  4QVT A;  1QSR A;  3D8P A;  2OH1 A;  4CAE A;  4CAX A;  4IF5 A;  1Y9W A;  4M3S A;  2D4P A;  3K9U A;  2FE7 A;  4MFJ A;  5FVJ A;  4CRZ B;  4KVO E;  5AG5 A;  2FIA A;  4MFQ A;  3QAH A;  1YVK A;  5KTC A;  5AG7 A;  2R98 A;  4MFZ A;  4B10 A;  4AB7 A;  2WSA A;  1WK4 A;  3G8W A;  3FB3 A;  4UFX A;  5J8C A;  4B5P B;  2FS5 A;  3CXS A;  2Z3K A;  5H84 A;  5F48 A;  3FRM A;  4U5Y A;  2RC4 A;  5AG6 A;  4KSF A;  1YGH A;  3I3G A;  3GKR A;  5HMN A;  3S6G A;  2ZW4 A;  5F49 A;  1QSO A;  4KLW A;  2R1I A;  3S6K A;  2QIR A;  2G3A A;  2G0B A;  5EBV A;  1J4J A;  1Q2D A;  2O28 A;  5C82 A;  3CXP A;  4ORF A;  1BOB A;  3T9Y A;  5IX3 A;  3BJ8 A;  4KUB A;  3P2F A;  2Z3M A;  1PUA A;  1SQH A;  2B4D B;  5G1Z A;  2FIW A;  4NXY A;  2P6G A;  1M4I A;  3RYO A;  1YLE A;  2J8M A;  2ATR A;  5HH1 A;  2FSR A;  2G3T A;  4K30 A;  3EFA A;  1WWZ A;  4OLL A;  4NSQ A;  2VZZ A;  4C2Y A;  5IB0 A;  4AG9 A;  5KTA A;  2OU2 A;  4A32 A;  4C68 A;  4IUS A;  4U9Y A;  2VQY A;  2WPX A;  2PR8 A;  2VBQ A;  4AVA A;  4OAE A;  5CNP A;  5I0C A;  4C2Z A;  4B5O A;  1V0C A;  1IIC A;  4KLV A;  1Z9U A;  4GS4 A;  4QUS A;  3FXT A;  4FD6 A;  4MY0 A;  3IWE A;  1Q2C A;  2BSW A;  2WPW A;  3D2M A;  2Q7B A;  2HUZ A;  2BUE A;  4YRH A;  4CAF A;  4II9 A;  2GAN A;  4JJX A;  2BL1 A;  2B4B A;  2PR1 A;  2Q04 A;  2CNM A;  2Z3O A;  3TO7 A;  3TO6 A;  4B12 A;  1YK3 A;  3TCV A;  1QST A;  3SHP A;  3A9L A;  1QSM A;  3JVN A;  4JLY A;  4NCZ A;  2DPT A;  1S60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...