3F5BA

The crystal structure of aminoglycoside n(6')acetyltransferase from legionella pneumophila subsp. pneumophila str. philadelphia 1.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
172
Chain Sequence
NAMMEFRFCFKQMNKSQHELVLGWIHQPHINEWLHGDGLSNTIKDLHEFLNDGKPWATHWIAYDNEIPFAYLITSEIEKSEEYPDGAVTLDLFICRLDYIGKGLSVQMIHEFILSQFSDTKIVLINPEISNERAVHVYKKAGFEIIGEFIASWHPVPHYKMKLCIEDLKKQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside N(6')acetyltransferase
publication title The crystal structure of aminoglycoside N(6')acetyltransferase from Legionella pneumophila subsp. pneumophila str. Philadelphia 1.
rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Transferase
total genus 47
structure length 172
sequence length 178
ec nomenclature
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3f5bA00
3GY9A 5JPHA 2J8RA 2HUZA 4AVCA 2FE7A 1NSLA 3C26A 2ZW5A 4YRHA 1M1DA 3TOAA 5IV0A 4R9MA 1I21A 2B3VA 2C27A 3N7ZA 4YFJA 4MI4A 4JXQA 4DNCA 4JD6A 1QSTA 3R96A 2QIRA 3SXNA 3R9EA 5GCNA 4ONUA 1WWZA 1Y9KA 1IYLA 2I00A 4MY3A 4NF1A 4E0AA 5KTAA 1Q2CA 2GIVA 3EFAA 2G0BA 2QECA 3D2MA 2F5IA 2B5GA 3E0KA 1VKCA 1YK3A 1QSMA 5F47A 3LODA 4UWJA 3PZJA 2GE3A 4PSWA 2BUEA 2B5GB 2VXKA 3EY5A 3SHPA 1RXTA 3VWDA 3CXSA 2FS5A 1M4GA 4QB9A 1YVKA 3UY5A 1IICA 5J8FA 4QC6A 3R9FA 2R1IA 1M4IA 4B5OA 2BL1A 4RI1A 4F0YA 3JUWA 2R98A 4U9YA 4KOVA 1MJ9A 3S6GA 2JEVA 3I9SA 1K4JA 1S60A 4OAEA 3P2HA 1SQHA 4R3LA 3TCVA 2H5MA 2WPXA 4FD4A 2PR1A 4PSXA 3JVNA 4UBRA 1Q2DA 4MY0A 1XIXA 2P6GA 3MGDA 3V8IA 5DWMA 2PC1A 3OWCA 2JDDA 4K30A 1OZPA 1I1DA 4NXYA 2OZUA 4HNYB 3S6KA 2ZW4A 2B3UA 2Q0YA 4IF5A 3FBUA 4KOYA 3I3GA 3DR6A 2OU2A 3QB8A 1N71A 1S3ZA 3TT2A 4L8AA 2I79A 3CXPA 2HQYA 3PGPA 4NEXA 2OZHA 2FXFA 5J8CA 1UFHA 4JWPA 4CS0B 4AG7A 2ATRA 3R1KA 1U6MA 3NE7A 4KLVA 3TO9A 3S6FA 3EC4A 3TO7A 1QSOA 2EUIA 3SXOA 4CAVA 1B87A 3FYNA 1Z4EA 2D4OA 4KOSA 2D4PA 3IWGA 3EO4A 5KTCA 1M44A 2Q44A 2PR8A 4HNWB 2P0WA 3TTHA 4UA3A 4AB7A 4CRZB 4IUSA 1S7LA 4MBUA 2ZXVA 5H84A 1IIDA 4RS2A 5C88A 3DSBA 1NE9A 1IYKA 1KZFA 1YX0A 3R9GA 2GANA 4KUBA 1TIQA 4R3KA 2G3TA 3FRMA 1VHSA 4AG9A 3FB3A 4H89A 4X5KA 5F49A 3P2FA 4FD5A 3D3SA 4H6UA 3W91A 3ZJ0A 5E96A 1LRZA 1ON0A 3TE4A 4XPDC 1XF8A 1MJAA 4M3SA 1NMTA 2Z0ZA 4KOUA 5KTDA 2IL4A 3DR8A 1KUYA 3W6XA 4KUAA 4ORFA 5JQ4A 2REEA 3F5BA 2Q4VA 2B58A 2Z11A 2Q4YA 4JLYA 2Y0MA 3R95A 3FNCA 4CAXA 4FD7A 1Y7RA 2OZGA 3BJ7A 4EVYA 2JDCA 1YREA 2ARHA 2X7BA 4KOTA 2B4DA 2Q04A 2ZW6A 3BLNA 4ZBGA 1I12A 1QSNA 5HH1A 4KLWA 2R8VA 4H6ZA 4JJXA 2B4DB 4KVOE 3FIXA 2KCWA 4NSQA 4MJ8A 4II9A 2ZPAA 2AE6A 4QBJA 1CM0A 1Q2YA 4F6AA 3W6SA 2RC4A 4E2AA 4HKFA 3RYOA 1PUAA 4KOWA 2BEIA 3K9UA 2J8MA 1Z9UA 4KVME 2FIWA 1RO5A 3F8KA 4B5PB 4UWIA 3DNSA 4R57A 5HMNA 1B6BA 3QAHA 2P6EA 4AVAA 1BOBA 2DXQA 1PU9A 4U9ZA 3FXTA 2PRBA 4YGOA 5F46A 3T90A 3ZZIA 1S7KA 1KUVA 4L89A 1YGHA 4KORA 4HNXB 2VZZA 3T9YA 1XEBA 5IX3A 1IB1E 4JXRA 4KZTA 2OB0A 2VZYA 4OLLA 4PV6A 3VWEA 2P6FA 3G8WA 1MJBA 1QSRA 1BO4A 4KVXA 5EC4A 5H86A 4AVBA 2K5TA 1M4DA 4XPLA 4GS4A 1J4JA 2VI7A 3G3SA 5FVJA 3GYAA 5EBVA 4I49A 4LX9A 3B8GA 5IB0A 4FD6A 1S7FA 2B4BA 2OH1A 5F48A 4MHDA 2FIAA 1S7NA 4XPKA 2PSWA 4M85A 1MK4A 2QMLA 1V0CA 2O28A 4KOXA 2VEZA 2CNMA 2G3AA 4LUAA 1P0HA 2REFA 1KUXA 3D8PA 4OADA 1FY7A 5DWNA 2FCKA 3BJ8A 3GKRA 4XPDB 2Q7BA 4XNHC 3KKWA 4CRYB 2PQ8A 2NMTA 3EXNA 3LD2A 3CXQA 2BSWA 2VBQA 2R7HA 1XMTA 4CAWA 4PK2A 2EVNA 2CNSA 1Z4RA 3WR7A 1L0CA 4QUSA 2J8NA 4Y49C 5CNPA 4U5YA 4XNHB 2A4NA 2CNTA 2FL4A 5I0CA 2JLMA 4PK3A 1Y9WA 2Z10A 1YVOA 4QVTA 3PP9A 3TO6A 4B5PA 2VQYA 4BMHA 1GHEA 1YR0A 4J3GA 3D2PA 4NCZA 1CJWA 1S5KA 4Y49B 2HV2A 2PDOA 1P4NA 3F0AA 3DDDA 2ZW7A 3H4QA 3TFYA 1R57A 5C82A 2CY2A 4E8OA 2FT0A 3TOBA 2AJ6A 1WK4A 1YLEA 5ISVA 4R87A 2WPWA 1XE4A 3IGRA 3S6HA 2FSRA
chains in the Genus database with same CATH superfamily
3GY9A 5JPHA 4OC0A 3PB8X 1IU8A 2J8RA 4MFQA 2HUZA 4AVCA 3CPXA 2FE7A 1NSLA 4ZGYB 4F9VA 3A9LA 3C26A 2ZW5A 3IU1A 1M1DA 4YRHA 3TOAA 4ZY0A 5IV0A 4R9MA 4P4FA 1I21A 2B3VA 2C27A 3BHXA 3D7HA 2PVVA 3N7ZA 2POKA 4YFJA 4MI4A 4JXQA 4OC5A 5AG5A 4DNCA 1ELLP 4JD6A 4UEEA 1ZG7A 2AFZA 1QSTA 2AFSA 3R96A 5LYIA 4ZY1A 3FEDA 4UFVA 3SI0A 2QIRA 2ZENA 4JZ0A 4X2TA 2WSAA 3SXNA 3R9EA 3KR4A 4R76A 2Z3OA 4ONUA 5GCNA 5DS0A 1WWZA 1Y9KA 4GXHA 1PCAA 1IYLA 3B3VA 2I00A 3NFZA 4HPSA 2VL1A 2WZNA 2PJ8A 4MY3A 1TXRA 4NF1A 3K9TA 5LYLA 4E0AA 2EK8A 5KTAA 1Q2CA 2JBKA 2GIVA 2PRQA 3EFAA 1EE3P 2G0BA 3H8GA 2NSMA 4CYOA 1F2PA 4ZX9A 2Q4ZA 3DGVA 3FECA 3FX6A 4G1PA 1ZLIA 2QECA 3PB4X 1ARLA 2PE3A 3D2MA 4PXCA 1Y0YA 4A31A 1VHEA 2B5GA 2F5IA 1VKCA 3E0KA 3WC7A 2HC9A 1YK3A 1QSMA 5F47A 2V8DA 2JBJA 3LODA 3SJGA 4UWJA 3PZJA 1TF8A 4NGSA 2GE3A 4PSWA 2CTBA 3IC1A 4Q38A 2BUEA 4UCPA 2ZEFA 2B5GB 2VXKA 2Z3KA 3EY5A 3FH4A 3FF3A 3SHPA 1X10A 2RFHA 1RXTA 3VWDA 2ZELA 3CXSA 2FS5A 5EMIA 1M4GA 4QB9A 1YVKA 3UY5A 1IICA 1YQEA 4QC6A 4F0XA 1NSAA 3R9FA 2NYQA 5J8FA 2AFMA 3KHXA 2R1IA 1M4IA 1Z8XA 4B5OA 3BI0A 1KWMA 2BL1A 3BI1A 4RI1A 4F0YA 3JUWA 2R98A 1Z5RA 3PFEA 4U9YA 4KOVA 2PJ9A 1MJ9A 3S6GA 2JEVA 3I9SA 4NGMA 1K4JA 1S60A 2PJAA 4OAEA 3P2HA 1SQHA 4R3LA 4YU9A 3TCVA 4OC4A 2H5MA 4EFDA 2WPXA 4FD4A 4Q7AA 2PR1A 4MCRA 3D7FA 4PSXA 3JVNA 4UBRA 1Q2DA 1Y0RA 5A27A 3T8WA 4MY0A 1XIXA 2P6GA 5G20A 3MGDA 4P6YA 2ODFA 4ZYQA 1JQGA 4W9YA 3V8IA 5DWMA 4MHNA 2PC1A 3OWCA 2JDDA 3NE8A 2PJ5A 4K30A 1OZPA 4X8IA 1I1DA 4NXYA 2O4HA 5AG7A 5AGEA 4FBEA 1Q7LA 2OZUA 4P4EA 1DE4C 3ISZA 3IJ3A 4HNYB 2PJ3A 4ZI6A 3MRUA 3S6KA 4CGPA 2ZW4A 2ZEHA 2B3UA 2Q0YA 4IF5A 4M6IA 3FBUA 4KOYA 4LQGA 3I3GA 4UIAA 3D67A 2BOAA 4A2ZA 2YNEA 3DR6A 2OU2A 4C2YA 4Z65A 1CPXA 2YGWA 1S3ZA 1N71A 3QB8A 3TT2A 4L8AA 3NH5A 2I79A 2HQYA 3CXPA 3PB7X 3PGPA 4NEXA 2QVPA 4KSAA 4CGOA 2YNDA 4MFPA 3B3SA 2OZHA 2FXFA 5J8CA 3JRUA 1UFHA 3DLJA 4JWPA 4B14A 4CS0B 3RNZA 4AG7A 3IFEA 3SI2A 4UIBA 2WUUA 3VATA 2ATRA 3R1KA 1U6MA 3NE7A 3D4UA 4KLVA 3TO9A 3S6FA 3EC4A 3TO7A 1QSOA 2ZOGA 2EUIA 4P4BA 4CAFA 3SXOA 1HDUA 1CBXA 4CAVA 1B87A 4C7IA 3FYNA 1Z4EA 4MXUA 2ZEEA 2D4OA 1VIXA 2D4PA 4KOSA 2IJZA 3IWGA 1ARMA 3EO4A 4UFWA 1A2ZA 5KTCA 1M44A 2Q44A 4KSIA 2PR8A 4HNWB 2P0WA 3TTHA 3NH8A 4UA3A 2PJ6A 4AB7A 4CRZB 5CBMA 1QMUA 4IUSA 1S7LA 5F09A 4CYNA 4TWEA 4EWTA 4MBUA 3NH4A 4YWYA 1FNOA 4BBHA 1LCPA 2V8VA 4LQ6A 3SI1A 2ZXVA 1AUGA 5H84A 3PBEA 3IEHA 3WABA 3CZXA 1IIDA 4RS2A 5C88A 3DSBA 3KR5A 1AYEA 4JYWA 4UCMA 1NE9A 1IYKA 4P4IA 3N5FA 1KZFA 1YX0A 3R9GA 2GANA 3PB6X 1YLOA 1TIQA 1XJOA 4KUBA 2G3TA 2PJ7A 4R3KA 4B10A 2PJBA 3FRMA 2GU2A 4OC3A 2Z3MA 4F8ZA 2DPTA 2GLJA 1XBUA 1VHSA 4CGMA 4AG9A 1VHOA 3B3WA 4MCSA 3FB3A 4A32A 4H89A 1CG2A 2WYRA 2IQ6A 4NGPA 3WC6A 4X5KA 5F49A 2ZEDA 3P2FA 4FD5A 1LFWA 1R3NA 2J9AA 3D3SA 4H6UA 3W91A 3ZJ0A 3WT4A 3VH9A 5IB9A 2PVWA 1HDQA 5ELYA 1ZG8A 5E96A 4NJRA 2EBJA 4KSFA 3K2KA 2CF4A 1LRZA 1ON0A 4AXVA 3TE4A 4DYOA 4NGTA 4P10A 3ISXA 4XPDC 3S9MA 5K8MA 1XF8A 1MJAA 1LANA 4RN7A 3B3CA 3BXMA 4M3SA 3GIUA 4FWUA 1NMTA 2Z0ZA 4P4DA 1F57A 4KOUA 5AG6A 7CPAA 5KTDA 2IL4A 3DR8A 1VGYA 3LWUA 1KUYA 4B13A 4OIWA 4P4JA 3W6XA 4KUAA 4MFZA 4ORFA 4A37A 4BD9A 5JQ4A 4NJQA 2REEA 3PB9X 4OKOA 3F5BA 2Q4VA 2B58A 3IWWA 2AFOA 4R8FA 2Z11A 2EWBA 2Q4YA 4H2KA 5LRJA 4JLYA 4CGLA 5I4MA 5LRGA 3GUXA 2Z3PA 2Y0MA 3R95A 1BLLE 3FNCA 4CAXA 1M4LA 4PXEA 4TNUA 1IGBA 5LYDA 4FD7A 2ZEGA 1Y7RA 4WWVA 2OZGA 3BJ7A 4P44A 4EVYA 2JDCA 3S9NA 2Z3LA 4PPZA 4ZX8A 2DEAA 2C6PA 3RZAA 1YREA 1XOVA 1LOKA 2ARHA 3HUVA 4FAIA 2X7BA 2GREA 4KOTA 1IY7A 2B4DA 2Q04A 1QQ9A 3FMCA 2ZW6A 3BLNA 4ZBGA 4C2XA 1I12A 1QSNA 3CPAA 3H5ZA 5HH1A 3RAMA 2F7VA 4KLWA 2R8VA 4H6ZA 4JJXA 4MFJA 4UFXA 2B4DB 3WC5A 4KVOE 4KS9A 3D66A 4A94A 4DJLA 3FIXA 2KCWA 3KZWA 4NSQA 4A39A 1TKHA 3FJUA 4MJ8A 3B7IA 5BWAB 4CYQA 4A95A 2YNCC 4II9A 4M6HA 4Q36A 1LAMA 3SJEA 5LRKA 2BO9A 4NGNA 2ZPAA 2AE6A 4IK2A 2CIJA 4QBJA 1CM0A 1Q2YA 3KGQA 4F6AA 5K8PA 4UEFA 5G22A 2RC4A 3W6SA 4E2AA 4HKFA 1BAVA 3RYOA 3GLJA 1PUAA 4KOWA 2BEIA 3B35A 1DTDA 2AFWA 3K9UA 1Z8WA 2J8MA 2PIZA 3SJXA 5HVHA 1Z9UA 2EK9A 4KVME 2FIWA 1RO5A 3F8KA 3KQZA 4B5PB 4UWIA 5D8NA 5JH9A 1Z8LA 1LAPA 5G1ZA 3DNSA 3GB0A 2V77A 3PFOA 5AG4A 2ZEPA 4R57A 5HVFA 1GYTA 2CTCA 1BPNA 5HMNA 1B6BA 2BCOA 3QAHA 4B11A 5J1QA 2O53A 1AMPA 2P6EA 3FEEA 4AVAA 6CPAA 1CPSA 1BOBA 1CP6A 2DXQA 1PU9A 4U9ZA 3FXTA 2PRBA 1TKFA 2C6CA 4YGOA 5F46A 3T90A 3ZZIA 1S7KA 2IMOA 4A38A 3PBBA 1KUVA 1PYTB 1YGHA 4L89A 4KORA 4OC2A 4HNXB 4O23A 3B3TA 1H8LA 1IOFA 2VZZA 3LACA 2OR4A 1FT7A 3T9YA 1XEBA 4M6GA 5D29A 3D7DA 5IX3A 1IB1E 3KQXA 4JXRA 2XEFA 3IO1A 4KZTA 4DUKA 4UEZA 2OB0A 2VZYA 4OLLA 4PV6A 3VWEA 1IOIA 3RO0A 4NGRA 2P6FA 3G8WA 1MJBA 4BINA 1QSRA 1UWYA 5HVGA 1BO4A 1Z2LA 4KVXA 2Z3NA 4UF4A 5EC4A 5H86A 4AVBA 1CP7A 2K5TA 1M4DA 2AFUA 3H8FA 4XPLA 4GS4A 4K3NA 2XEIA 1YW4A 1J4JA 2VI7A 3G3SA 5FVJA 2Q7SA 3GYAA 5EBVA 2OOTA 4C7HA 4I49A 4C68A 2RB7A 4EMEA 1TF9A 3B8GA 4LX9A 5IB0A 2C6GA 2DF5A 1ZG9A 4FD6A 1S7FA 1JWQA 2B4BA 2OH1A 1YMEA 5F48A 4MHDA 2XEJA 2FIAA 4MHPA 2XEGA 1S7NA 4XPKA 4IAVA 3VARA 3KASA 2PSWA 1Y7EA 4FUUA 4M85A 1ELMP 4OIDA 2I3CA 1MK4A 1CX8A 1V0CA 2QMLA 2O28A 2PCUA 2C1CA 4CYPA 2ZOFA 3QAYA 3SJFA 4KOXA 2VEZA 2CNMA 2G3AA 4LUAA 1P0HA 3KL9A 3CDXA 2REFA 4X3RA 2V8HA 2FVGA 1KUXA 4GM5A 3D8PA 2PIYA 4OADA 1F2OA 1FY7A 1OBRA 2JEWA 2PJCA 5DWNA 3B2YA 4PQAA 1TKJA 2FCKA 1XFOA 2PJ4A 3BJ8A 3GKRA 4XPDB 2Q7BA 4P45A 3KI9A 3S9LA 3NA6A 4WJBA 2CXAA 2V8GA 4PXDA 4XNHC 1ZLHA 5LYFA 3KKWA 4R7MA 3IWEA 1RTQA 2Q51A 4ONWA 4CRYB 2QJ8A 2PQ8A 2NMTA 3EXNA 1BPMA 3LD2A 3CXQA 2DPSA 2BSWA 4OMEA 2VBQA 2EO8A 2R7HA 1XMTA 4CAWA 4PK2A 2EVNA 3PEIA 2CNSA 4R6TA 4MCQA 2PJ1A 2ANPA 4PXBA 1Z4RA 4F9UA 3WR7A 1L0CA 4MFLA 1Z8TA 2G9DA 4QUSA 2PJ2A 2J8NA 4Y49C 4CAEA 3PRTA 3L2NA 4MRIA 4OP4A 5HXDA 5A28A 2ZEMA 3FVLA 5CNPA 1R43A 2QYVA 4NGQA 4U5YA 4XNHB 3QNVA 2A4NA 5K8OA 5JM6A 2CNTA 2FL4A 5I0CA 2GFQA 3MN8A 3IIBA 3TX8A 4MFKA 1XRYA 2JLMA 4PK3A 3RBUA 4B12A 1Y9WA 4RUHA 2Z10A 1YVOA 2GLFA 3PP9A 4MCPA 4QVTA 5K8NA 2ABZA 3HLPA 3TO6A 4B5PA 3KHZA 2VQYA 4BMHA 1GHEA 1YR0A 4J3GA 3CT9A 3D2PA 3D7GA 3H8EA 4NCZA 5G21A 3TC8A 8CPAA 1CJWA 1S5KA 4Y49B 2YNCA 3LMSA 2HV2A 2PDOA 1P4NA 3F0AA 2AFXA 3DDDA 4NFRA 3D68A 2ZW7A 4OC1A 3H4QA 3TFYA 5THWA 1R57A 3V38A 5C82A 2CY2A 1YSJA 4C2ZA 5JGFA 4E8OA 1ZO0A 4A33A 4A30A 2FT0A 2F8HA 3I1UA 4MHZA 2HB6A 3TOBA 4CGNA 2AJ6A 2Q43A 1HEEA 4UCNA 2ZEOA 1WK4A 2PJ0A 3V7ZA 1YLEA 4CPAA 4MMOA 3IU2A 5ISVA 3JTKA 4IHMA 4R87A 4B6ZA 1YW6A 2WPWA 4MHYA 4ZY2A 5CPAA 1XMBA 1XE4A 1X12A 3IGRA 3S6HA 2FSRA
chains in the Genus database with same CATH topology
3GY9A 5JPHA 2J8RA 4MFQA 2HUZA 4AVCA 2FE7A 1NSLA 4ZGYB 3A9LA 3C26A 2ZW5A 3IU1A 1M1DA 4YRHA 3TOAA 5IV0A 4R9MA 1I21A 2B3VA 2C27A 3N7ZA 4YFJA 4MI4A 4JXQA 5AG5A 4DNCA 4JD6A 1QSTA 3R96A 4UFVA 2QIRA 2WSAA 3SXNA 3R9EA 2Z3OA 4ONUA 5GCNA 1WWZA 1Y9KA 1IYLA 2I00A 4MY3A 4NF1A 4E0AA 5KTAA 1Q2CA 2GIVA 3EFAA 2G0BA 4CYOA 2QECA 3D2MA 4A31A 2F5IA 2B5GA 3E0KA 1VKCA 1YK3A 1QSMA 5F47A 3LODA 4UWJA 3PZJA 2GE3A 4PSWA 4Q38A 2BUEA 4UCPA 2B5GB 2VXKA 2Z3KA 3EY5A 3SHPA 1RXTA 3VWDA 3CXSA 2FS5A 1M4GA 4QB9A 1YVKA 3UY5A 1IICA 5J8FA 4QC6A 4F0XA 3R9FA 2R1IA 1M4IA 4B5OA 2BL1A 4RI1A 4F0YA 3JUWA 2R98A 4U9YA 4KOVA 1MJ9A 3S6GA 2JEVA 3I9SA 1K4JA 1S60A 4OAEA 3P2HA 1SQHA 4R3LA 3TCVA 2H5MA 2WPXA 4FD4A 2PR1A 4PSXA 3JVNA 4UBRA 1Q2DA 5A27A 4MY0A 1XIXA 2P6GA 5G20A 3MGDA 3V8IA 5DWMA 2PC1A 3OWCA 2JDDA 4K30A 1OZPA 1I1DA 4NXYA 5AG7A 5AGEA 2OZUA 4HNYB 3S6KA 4CGPA 2ZW4A 2B3UA 2Q0YA 4IF5A 3FBUA 4KOYA 3I3GA 4A2ZA 2YNEA 3DR6A 2OU2A 4C2YA 2YGWA 3QB8A 1N71A 1S3ZA 3TT2A 4L8AA 2I79A 3CXPA 2HQYA 3PGPA 4NEXA 4KSAA 4CGOA 2YNDA 4MFPA 2OZHA 2FXFA 5J8CA 1UFHA 4JWPA 4B14A 4CS0B 4AG7A 2WUUA 2ATRA 3R1KA 1U6MA 3NE7A 4KLVA 3TO9A 3S6FA 3EC4A 3TO7A 1QSOA 2EUIA 4CAFA 3SXOA 4CAVA 1B87A 4C7IA 3FYNA 1Z4EA 2D4OA 4KOSA 2D4PA 3IWGA 3EO4A 4UFWA 5KTCA 1M44A 2Q44A 2PR8A 4HNWB 2P0WA 3TTHA 4UA3A 4AB7A 4CRZB 4IUSA 1S7LA 4CYNA 4MBUA 4BBHA 2ZXVA 5H84A 1IIDA 4RS2A 5C88A 3DSBA 4UCMA 1NE9A 1IYKA 1KZFA 1YX0A 3R9GA 2GANA 4KUBA 1TIQA 4R3KA 2G3TA 4B10A 3FRMA 2Z3MA 2DPTA 1VHSA 4CGMA 4AG9A 3FB3A 4A32A 4H89A 4X5KA 5F49A 3P2FA 4FD5A 3D3SA 4H6UA 3W91A 3ZJ0A 5E96A 4KSFA 1LRZA 1ON0A 3TE4A 4XPDC 1XF8A 1MJAA 4M3SA 5AG6A 1NMTA 2Z0ZA 4KOUA 5KTDA 2IL4A 3DR8A 1KUYA 4B13A 3W6XA 4KUAA 4MFZA 4ORFA 5JQ4A 2REEA 3F5BA 2Q4VA 2B58A 2Z11A 2Q4YA 4JLYA 4CGLA 2Z3PA 2Y0MA 3R95A 3FNCA 4CAXA 4FD7A 1Y7RA 2OZGA 3BJ7A 4EVYA 2JDCA 2Z3LA 1YREA 2ARHA 2X7BA 4KOTA 2B4DA 2Q04A 2ZW6A 3BLNA 4ZBGA 4C2XA 1I12A 1QSNA 3H5ZA 5HH1A 4KLWA 2R8VA 4H6ZA 4JJXA 4MFJA 4UFXA 2B4DB 4KVOE 4KS9A 3FIXA 2KCWA 4NSQA 4MJ8A 5BWAB 4CYQA 4A95A 2YNCC 4II9A 4Q36A 2ZPAA 2AE6A 4QBJA 1CM0A 1Q2YA 4F6AA 5G22A 2RC4A 3W6SA 4E2AA 4HKFA 3RYOA 1PUAA 4KOWA 2BEIA 3K9UA 2J8MA 1Z9UA 4KVME 2FIWA 1RO5A 3F8KA 4B5PB 4UWIA 5G1ZA 3DNSA 5AG4A 4R57A 5HMNA 1B6BA 3QAHA 4B11A 2P6EA 4AVAA 1BOBA 2DXQA 1PU9A 4U9ZA 3FXTA 2PRBA 4YGOA 5F46A 3T90A 3ZZIA 1S7KA 1KUVA 1YGHA 4L89A 4KORA 4HNXB 2VZZA 3T9YA 1XEBA 5IX3A 1IB1E 4JXRA 4KZTA 2OB0A 2VZYA 4OLLA 4PV6A 3VWEA 2P6FA 3G8WA 1MJBA 1QSRA 1BO4A 4KVXA 2Z3NA 5EC4A 5H86A 4AVBA 2K5TA 1M4DA 4XPLA 4GS4A 1J4JA 2VI7A 3G3SA 5FVJA 3GYAA 5EBVA 4C7HA 4I49A 4C68A 3B8GA 4LX9A 5IB0A 4FD6A 1S7FA 2B4BA 2OH1A 5F48A 4MHDA 2FIAA 1S7NA 4XPKA 2PSWA 4M85A 1MK4A 2QMLA 1V0CA 2O28A 4CYPA 4KOXA 2VEZA 2CNMA 2G3AA 4LUAA 1P0HA 2REFA 1KUXA 3D8PA 4OADA 1FY7A 5DWNA 2FCKA 3BJ8A 3GKRA 4XPDB 2Q7BA 2CXAA 4XNHC 3KKWA 3IWEA 4CRYB 2PQ8A 2NMTA 3EXNA 3LD2A 3CXQA 2DPSA 2BSWA 2VBQA 2R7HA 1XMTA 4CAWA 4PK2A 2EVNA 2CNSA 1Z4RA 3WR7A 1L0CA 4MFLA 4QUSA 2J8NA 4Y49C 4CAEA 5A28A 5CNPA 4U5YA 4XNHB 2A4NA 2CNTA 2FL4A 5I0CA 4MFKA 2JLMA 4PK3A 4B12A 1Y9WA 2Z10A 1YVOA 4QVTA 3PP9A 3TO6A 4B5PA 2VQYA 4BMHA 1GHEA 1YR0A 4J3GA 3D2PA 4NCZA 5G21A 1CJWA 1S5KA 4Y49B 2YNCA 2HV2A 2PDOA 1P4NA 3F0AA 3DDDA 2ZW7A 3H4QA 3TFYA 1R57A 5C82A 2CY2A 4C2ZA 4E8OA 1ZO0A 4A33A 4A30A 2FT0A 3TOBA 4CGNA 2AJ6A 4UCNA 1WK4A 1YLEA 5ISVA 3IU2A 3JTKA 4R87A 2WPWA 1XE4A 3IGRA 3S6HA 2FSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GY9 A;  5JPH A;  2J8R A;  2HUZ A;  4AVC A;  2FE7 A;  1NSL A;  3C26 A;  2ZW5 A;  4YRH A;  1M1D A;  3TOA A;  5IV0 A;  4R9M A;  1I21 A;  2B3V A;  2C27 A;  3N7Z A;  4YFJ A;  4MI4 A;  4JXQ A;  4DNC A;  4JD6 A;  1QST A;  3R96 A;  2QIR A;  3SXN A;  3R9E A;  5GCN A;  4ONU A;  1WWZ A;  1Y9K A;  1IYL A;  2I00 A;  4MY3 A;  4NF1 A;  4E0A A;  5KTA A;  1Q2C A;  2GIV A;  3EFA A;  2G0B A;  2QEC A;  3D2M A;  2F5I A;  2B5G A;  3E0K A;  1VKC A;  1YK3 A;  1QSM A;  5F47 A;  3LOD A;  4UWJ A;  3PZJ A;  2GE3 A;  4PSW A;  2BUE A;  2B5G B;  2VXK A;  3EY5 A;  3SHP A;  1RXT A;  3VWD A;  3CXS A;  2FS5 A;  1M4G A;  4QB9 A;  1YVK A;  3UY5 A;  1IIC A;  5J8F A;  4QC6 A;  3R9F A;  2R1I A;  1M4I A;  4B5O A;  2BL1 A;  4RI1 A;  4F0Y A;  3JUW A;  2R98 A;  4U9Y A;  4KOV A;  1MJ9 A;  3S6G A;  2JEV A;  3I9S A;  1K4J A;  1S60 A;  4OAE A;  3P2H A;  1SQH A;  4R3L A;  3TCV A;  2H5M A;  2WPX A;  4FD4 A;  2PR1 A;  4PSX A;  3JVN A;  4UBR A;  1Q2D A;  4MY0 A;  1XIX A;  2P6G A;  3MGD A;  3V8I A;  5DWM A;  2PC1 A;  3OWC A;  2JDD A;  4K30 A;  1OZP A;  1I1D A;  4NXY A;  2OZU A;  4HNY B;  3S6K A;  2ZW4 A;  2B3U A;  2Q0Y A;  4IF5 A;  3FBU A;  4KOY A;  3I3G A;  3DR6 A;  2OU2 A;  3QB8 A;  1N71 A;  1S3Z A;  3TT2 A;  4L8A A;  2I79 A;  3CXP A;  2HQY A;  3PGP A;  4NEX A;  2OZH A;  2FXF A;  5J8C A;  1UFH A;  4JWP A;  4CS0 B;  4AG7 A;  2ATR A;  3R1K A;  1U6M A;  3NE7 A;  4KLV A;  3TO9 A;  3S6F A;  3EC4 A;  3TO7 A;  1QSO A;  2EUI A;  3SXO A;  4CAV A;  1B87 A;  3FYN A;  1Z4E A;  2D4O A;  4KOS A;  2D4P A;  3IWG A;  3EO4 A;  5KTC A;  1M44 A;  2Q44 A;  2PR8 A;  4HNW B;  2P0W A;  3TTH A;  4UA3 A;  4AB7 A;  4CRZ B;  4IUS A;  1S7L A;  4MBU A;  2ZXV A;  5H84 A;  1IID A;  4RS2 A;  5C88 A;  3DSB A;  1NE9 A;  1IYK A;  1KZF A;  1YX0 A;  3R9G A;  2GAN A;  4KUB A;  1TIQ A;  4R3K A;  2G3T A;  3FRM A;  1VHS A;  4AG9 A;  3FB3 A;  4H89 A;  4X5K A;  5F49 A;  3P2F A;  4FD5 A;  3D3S A;  4H6U A;  3W91 A;  3ZJ0 A;  5E96 A;  1LRZ A;  1ON0 A;  3TE4 A;  4XPD C;  1XF8 A;  1MJA A;  4M3S A;  1NMT A;  2Z0Z A;  4KOU A;  5KTD A;  2IL4 A;  3DR8 A;  1KUY A;  3W6X A;  4KUA A;  4ORF A;  5JQ4 A;  2REE A;  3F5B A;  2Q4V A;  2B58 A;  2Z11 A;  2Q4Y A;  4JLY A;  2Y0M A;  3R95 A;  3FNC A;  4CAX A;  4FD7 A;  1Y7R A;  2OZG A;  3BJ7 A;  4EVY A;  2JDC A;  1YRE A;  2ARH A;  2X7B A;  4KOT A;  2B4D A;  2Q04 A;  2ZW6 A;  3BLN A;  4ZBG A;  1I12 A;  1QSN A;  5HH1 A;  4KLW A;  2R8V A;  4H6Z A;  4JJX A;  2B4D B;  4KVO E;  3FIX A;  2KCW A;  4NSQ A;  4MJ8 A;  4II9 A;  2ZPA A;  2AE6 A;  4QBJ A;  1CM0 A;  1Q2Y A;  4F6A A;  3W6S A;  2RC4 A;  4E2A A;  4HKF A;  3RYO A;  1PUA A;  4KOW A;  2BEI A;  3K9U A;  2J8M A;  1Z9U A;  4KVM E;  2FIW A;  1RO5 A;  3F8K A;  4B5P B;  4UWI A;  3DNS A;  4R57 A;  5HMN A;  1B6B A;  3QAH A;  2P6E A;  4AVA A;  1BOB A;  2DXQ A;  1PU9 A;  4U9Z A;  3FXT A;  2PRB A;  4YGO A;  5F46 A;  3T90 A;  3ZZI A;  1S7K A;  1KUV A;  4L89 A;  1YGH A;  4KOR A;  4HNX B;  2VZZ A;  3T9Y A;  1XEB A;  5IX3 A;  1IB1 E;  4JXR A;  4KZT A;  2OB0 A;  2VZY A;  4OLL A;  4PV6 A;  3VWE A;  2P6F A;  3G8W A;  1MJB A;  1QSR A;  1BO4 A;  4KVX A;  5EC4 A;  5H86 A;  4AVB A;  2K5T A;  1M4D A;  4XPL A;  4GS4 A;  1J4J A;  2VI7 A;  3G3S A;  5FVJ A;  3GYA A;  5EBV A;  4I49 A;  4LX9 A;  3B8G A;  5IB0 A;  4FD6 A;  1S7F A;  2B4B A;  2OH1 A;  5F48 A;  4MHD A;  2FIA A;  1S7N A;  4XPK A;  2PSW A;  4M85 A;  1MK4 A;  2QML A;  1V0C A;  2O28 A;  4KOX A;  2VEZ A;  2CNM A;  2G3A A;  4LUA A;  1P0H A;  2REF A;  1KUX A;  3D8P A;  4OAD A;  1FY7 A;  5DWN A;  2FCK A;  3BJ8 A;  3GKR A;  4XPD B;  2Q7B A;  4XNH C;  3KKW A;  4CRY B;  2PQ8 A;  2NMT A;  3EXN A;  3LD2 A;  3CXQ A;  2BSW A;  2VBQ A;  2R7H A;  1XMT A;  4CAW A;  4PK2 A;  2EVN A;  2CNS A;  1Z4R A;  3WR7 A;  1L0C A;  4QUS A;  2J8N A;  4Y49 C;  5CNP A;  4U5Y A;  4XNH B;  2A4N A;  2CNT A;  2FL4 A;  5I0C A;  2JLM A;  4PK3 A;  1Y9W A;  2Z10 A;  1YVO A;  4QVT A;  3PP9 A;  3TO6 A;  4B5P A;  2VQY A;  4BMH A;  1GHE A;  1YR0 A;  4J3G A;  3D2P A;  4NCZ A;  1CJW A;  1S5K A;  4Y49 B;  2HV2 A;  2PDO A;  1P4N A;  3F0A A;  3DDD A;  2ZW7 A;  3H4Q A;  3TFY A;  1R57 A;  5C82 A;  2CY2 A;  4E8O A;  2FT0 A;  3TOB A;  2AJ6 A;  1WK4 A;  1YLE A;  5ISV A;  4R87 A;  2WPW A;  1XE4 A;  3IGR A;  3S6H A;  2FSR A; 
#chains in the Genus database with same CATH topology
 3GY9 A;  5JPH A;  4OC0 A;  3PB8 X;  1IU8 A;  2J8R A;  4MFQ A;  2HUZ A;  4AVC A;  3CPX A;  2FE7 A;  1NSL A;  4ZGY B;  4F9V A;  3A9L A;  3C26 A;  2ZW5 A;  3IU1 A;  1M1D A;  4YRH A;  3TOA A;  4ZY0 A;  5IV0 A;  4R9M A;  4P4F A;  1I21 A;  2B3V A;  2C27 A;  3BHX A;  3D7H A;  2PVV A;  3N7Z A;  2POK A;  4YFJ A;  4MI4 A;  4JXQ A;  4OC5 A;  5AG5 A;  4DNC A;  1ELL P;  4JD6 A;  4UEE A;  1ZG7 A;  2AFZ A;  1QST A;  2AFS A;  3R96 A;  5LYI A;  4ZY1 A;  3FED A;  4UFV A;  3SI0 A;  2QIR A;  2ZEN A;  4JZ0 A;  4X2T A;  2WSA A;  3SXN A;  3R9E A;  3KR4 A;  4R76 A;  2Z3O A;  4ONU A;  5GCN A;  5DS0 A;  1WWZ A;  1Y9K A;  4GXH A;  1PCA A;  1IYL A;  3B3V A;  2I00 A;  3NFZ A;  4HPS A;  2VL1 A;  2WZN A;  2PJ8 A;  4MY3 A;  1TXR A;  4NF1 A;  3K9T A;  5LYL A;  4E0A A;  2EK8 A;  5KTA A;  1Q2C A;  2JBK A;  2GIV A;  2PRQ A;  3EFA A;  1EE3 P;  2G0B A;  3H8G A;  2NSM A;  4CYO A;  1F2P A;  4ZX9 A;  2Q4Z A;  3DGV A;  3FEC A;  3FX6 A;  4G1P A;  1ZLI A;  2QEC A;  3PB4 X;  1ARL A;  2PE3 A;  3D2M A;  4PXC A;  1Y0Y A;  4A31 A;  1VHE A;  2B5G A;  2F5I A;  1VKC A;  3E0K A;  3WC7 A;  2HC9 A;  1YK3 A;  1QSM A;  5F47 A;  2V8D A;  2JBJ A;  3LOD A;  3SJG A;  4UWJ A;  3PZJ A;  1TF8 A;  4NGS A;  2GE3 A;  4PSW A;  2CTB A;  3IC1 A;  4Q38 A;  2BUE A;  4UCP A;  2ZEF A;  2B5G B;  2VXK A;  2Z3K A;  3EY5 A;  3FH4 A;  3FF3 A;  3SHP A;  1X10 A;  2RFH A;  1RXT A;  3VWD A;  2ZEL A;  3CXS A;  2FS5 A;  5EMI A;  1M4G A;  4QB9 A;  1YVK A;  3UY5 A;  1IIC A;  1YQE A;  4QC6 A;  4F0X A;  1NSA A;  3R9F A;  2NYQ A;  5J8F A;  2AFM A;  3KHX A;  2R1I A;  1M4I A;  1Z8X A;  4B5O A;  3BI0 A;  1KWM A;  2BL1 A;  3BI1 A;  4RI1 A;  4F0Y A;  3JUW A;  2R98 A;  1Z5R A;  3PFE A;  4U9Y A;  4KOV A;  2PJ9 A;  1MJ9 A;  3S6G A;  2JEV A;  3I9S A;  4NGM A;  1K4J A;  1S60 A;  2PJA A;  4OAE A;  3P2H A;  1SQH A;  4R3L A;  4YU9 A;  3TCV A;  4OC4 A;  2H5M A;  4EFD A;  2WPX A;  4FD4 A;  4Q7A A;  2PR1 A;  4MCR A;  3D7F A;  4PSX A;  3JVN A;  4UBR A;  1Q2D A;  1Y0R A;  5A27 A;  3T8W A;  4MY0 A;  1XIX A;  2P6G A;  5G20 A;  3MGD A;  4P6Y A;  2ODF A;  4ZYQ A;  1JQG A;  4W9Y A;  3V8I A;  5DWM A;  4MHN A;  2PC1 A;  3OWC A;  2JDD A;  3NE8 A;  2PJ5 A;  4K30 A;  1OZP A;  4X8I A;  1I1D A;  4NXY A;  2O4H A;  5AG7 A;  5AGE A;  4FBE A;  1Q7L A;  2OZU A;  4P4E A;  1DE4 C;  3ISZ A;  3IJ3 A;  4HNY B;  2PJ3 A;  4ZI6 A;  3MRU A;  3S6K A;  4CGP A;  2ZW4 A;  2ZEH A;  2B3U A;  2Q0Y A;  4IF5 A;  4M6I A;  3FBU A;  4KOY A;  4LQG A;  3I3G A;  4UIA A;  3D67 A;  2BOA A;  4A2Z A;  2YNE A;  3DR6 A;  2OU2 A;  4C2Y A;  4Z65 A;  1CPX A;  2YGW A;  1S3Z A;  1N71 A;  3QB8 A;  3TT2 A;  4L8A A;  3NH5 A;  2I79 A;  2HQY A;  3CXP A;  3PB7 X;  3PGP A;  4NEX A;  2QVP A;  4KSA A;  4CGO A;  2YND A;  4MFP A;  3B3S A;  2OZH A;  2FXF A;  5J8C A;  3JRU A;  1UFH A;  3DLJ A;  4JWP A;  4B14 A;  4CS0 B;  3RNZ A;  4AG7 A;  3IFE A;  3SI2 A;  4UIB A;  2WUU A;  3VAT A;  2ATR A;  3R1K A;  1U6M A;  3NE7 A;  3D4U A;  4KLV A;  3TO9 A;  3S6F A;  3EC4 A;  3TO7 A;  1QSO A;  2ZOG A;  2EUI A;  4P4B A;  4CAF A;  3SXO A;  1HDU A;  1CBX A;  4CAV A;  1B87 A;  4C7I A;  3FYN A;  1Z4E A;  4MXU A;  2ZEE A;  2D4O A;  1VIX A;  2D4P A;  4KOS A;  2IJZ A;  3IWG A;  1ARM A;  3EO4 A;  4UFW A;  1A2Z A;  5KTC A;  1M44 A;  2Q44 A;  4KSI A;  2PR8 A;  4HNW B;  2P0W A;  3TTH A;  3NH8 A;  4UA3 A;  2PJ6 A;  4AB7 A;  4CRZ B;  5CBM A;  1QMU A;  4IUS A;  1S7L A;  5F09 A;  4CYN A;  4TWE A;  4EWT A;  4MBU A;  3NH4 A;  4YWY A;  1FNO A;  4BBH A;  1LCP A;  2V8V A;  4LQ6 A;  3SI1 A;  2ZXV A;  1AUG A;  5H84 A;  3PBE A;  3IEH A;  3WAB A;  3CZX A;  1IID A;  4RS2 A;  5C88 A;  3DSB A;  3KR5 A;  1AYE A;  4JYW A;  4UCM A;  1NE9 A;  1IYK A;  4P4I A;  3N5F A;  1KZF A;  1YX0 A;  3R9G A;  2GAN A;  3PB6 X;  1YLO A;  1TIQ A;  1XJO A;  4KUB A;  2G3T A;  2PJ7 A;  4R3K A;  4B10 A;  2PJB A;  3FRM A;  2GU2 A;  4OC3 A;  2Z3M A;  4F8Z A;  2DPT A;  2GLJ A;  1XBU A;  1VHS A;  4CGM A;  4AG9 A;  1VHO A;  3B3W A;  4MCS A;  3FB3 A;  4A32 A;  4H89 A;  1CG2 A;  2WYR A;  2IQ6 A;  4NGP A;  3WC6 A;  4X5K A;  5F49 A;  2ZED A;  3P2F A;  4FD5 A;  1LFW A;  1R3N A;  2J9A A;  3D3S A;  4H6U A;  3W91 A;  3ZJ0 A;  3WT4 A;  3VH9 A;  5IB9 A;  2PVW A;  1HDQ A;  5ELY A;  1ZG8 A;  5E96 A;  4NJR A;  2EBJ A;  4KSF A;  3K2K A;  2CF4 A;  1LRZ A;  1ON0 A;  4AXV A;  3TE4 A;  4DYO A;  4NGT A;  4P10 A;  3ISX A;  4XPD C;  3S9M A;  5K8M A;  1XF8 A;  1MJA A;  1LAN A;  4RN7 A;  3B3C A;  3BXM A;  4M3S A;  3GIU A;  4FWU A;  1NMT A;  2Z0Z A;  4P4D A;  1F57 A;  4KOU A;  5AG6 A;  7CPA A;  5KTD A;  2IL4 A;  3DR8 A;  1VGY A;  3LWU A;  1KUY A;  4B13 A;  4OIW A;  4P4J A;  3W6X A;  4KUA A;  4MFZ A;  4ORF A;  4A37 A;  4BD9 A;  5JQ4 A;  4NJQ A;  2REE A;  3PB9 X;  4OKO A;  3F5B A;  2Q4V A;  2B58 A;  3IWW A;  2AFO A;  4R8F A;  2Z11 A;  2EWB A;  2Q4Y A;  4H2K A;  5LRJ A;  4JLY A;  4CGL A;  5I4M A;  5LRG A;  3GUX A;  2Z3P A;  2Y0M A;  3R95 A;  1BLL E;  3FNC A;  4CAX A;  1M4L A;  4PXE A;  4TNU A;  1IGB A;  5LYD A;  4FD7 A;  2ZEG A;  1Y7R A;  4WWV A;  2OZG A;  3BJ7 A;  4P44 A;  4EVY A;  2JDC A;  3S9N A;  2Z3L A;  4PPZ A;  4ZX8 A;  2DEA A;  2C6P A;  3RZA A;  1YRE A;  1XOV A;  1LOK A;  2ARH A;  3HUV A;  4FAI A;  2X7B A;  2GRE A;  4KOT A;  1IY7 A;  2B4D A;  2Q04 A;  1QQ9 A;  3FMC A;  2ZW6 A;  3BLN A;  4ZBG A;  4C2X A;  1I12 A;  1QSN A;  3CPA A;  3H5Z A;  5HH1 A;  3RAM A;  2F7V A;  4KLW A;  2R8V A;  4H6Z A;  4JJX A;  4MFJ A;  4UFX A;  2B4D B;  3WC5 A;  4KVO E;  4KS9 A;  3D66 A;  4A94 A;  4DJL A;  3FIX A;  2KCW A;  3KZW A;  4NSQ A;  4A39 A;  1TKH A;  3FJU A;  4MJ8 A;  3B7I A;  5BWA B;  4CYQ A;  4A95 A;  2YNC C;  4II9 A;  4M6H A;  4Q36 A;  1LAM A;  3SJE A;  5LRK A;  2BO9 A;  4NGN A;  2ZPA A;  2AE6 A;  4IK2 A;  2CIJ A;  4QBJ A;  1CM0 A;  1Q2Y A;  3KGQ A;  4F6A A;  5K8P A;  4UEF A;  5G22 A;  2RC4 A;  3W6S A;  4E2A A;  4HKF A;  1BAV A;  3RYO A;  3GLJ A;  1PUA A;  4KOW A;  2BEI A;  3B35 A;  1DTD A;  2AFW A;  3K9U A;  1Z8W A;  2J8M A;  2PIZ A;  3SJX A;  5HVH A;  1Z9U A;  2EK9 A;  4KVM E;  2FIW A;  1RO5 A;  3F8K A;  3KQZ A;  4B5P B;  4UWI A;  5D8N A;  5JH9 A;  1Z8L A;  1LAP A;  5G1Z A;  3DNS A;  3GB0 A;  2V77 A;  3PFO A;  5AG4 A;  2ZEP A;  4R57 A;  5HVF A;  1GYT A;  2CTC A;  1BPN A;  5HMN A;  1B6B A;  2BCO A;  3QAH A;  4B11 A;  5J1Q A;  2O53 A;  1AMP A;  2P6E A;  3FEE A;  4AVA A;  6CPA A;  1CPS A;  1BOB A;  1CP6 A;  2DXQ A;  1PU9 A;  4U9Z A;  3FXT A;  2PRB A;  1TKF A;  2C6C A;  4YGO A;  5F46 A;  3T90 A;  3ZZI A;  1S7K A;  2IMO A;  4A38 A;  3PBB A;  1KUV A;  1PYT B;  1YGH A;  4L89 A;  4KOR A;  4OC2 A;  4HNX B;  4O23 A;  3B3T A;  1H8L A;  1IOF A;  2VZZ A;  3LAC A;  2OR4 A;  1FT7 A;  3T9Y A;  1XEB A;  4M6G A;  5D29 A;  3D7D A;  5IX3 A;  1IB1 E;  3KQX A;  4JXR A;  2XEF A;  3IO1 A;  4KZT A;  4DUK A;  4UEZ A;  2OB0 A;  2VZY A;  4OLL A;  4PV6 A;  3VWE A;  1IOI A;  3RO0 A;  4NGR A;  2P6F A;  3G8W A;  1MJB A;  4BIN A;  1QSR A;  1UWY A;  5HVG A;  1BO4 A;  1Z2L A;  4KVX A;  2Z3N A;  4UF4 A;  5EC4 A;  5H86 A;  4AVB A;  1CP7 A;  2K5T A;  1M4D A;  2AFU A;  3H8F A;  4XPL A;  4GS4 A;  4K3N A;  2XEI A;  1YW4 A;  1J4J A;  2VI7 A;  3G3S A;  5FVJ A;  2Q7S A;  3GYA A;  5EBV A;  2OOT A;  4C7H A;  4I49 A;  4C68 A;  2RB7 A;  4EME A;  1TF9 A;  3B8G A;  4LX9 A;  5IB0 A;  2C6G A;  2DF5 A;  1ZG9 A;  4FD6 A;  1S7F A;  1JWQ A;  2B4B A;  2OH1 A;  1YME A;  5F48 A;  4MHD A;  2XEJ A;  2FIA A;  4MHP A;  2XEG A;  1S7N A;  4XPK A;  4IAV A;  3VAR A;  3KAS A;  2PSW A;  1Y7E A;  4FUU A;  4M85 A;  1ELM P;  4OID A;  2I3C A;  1MK4 A;  1CX8 A;  1V0C A;  2QML A;  2O28 A;  2PCU A;  2C1C A;  4CYP A;  2ZOF A;  3QAY A;  3SJF A;  4KOX A;  2VEZ A;  2CNM A;  2G3A A;  4LUA A;  1P0H A;  3KL9 A;  3CDX A;  2REF A;  4X3R A;  2V8H A;  2FVG A;  1KUX A;  4GM5 A;  3D8P A;  2PIY A;  4OAD A;  1F2O A;  1FY7 A;  1OBR A;  2JEW A;  2PJC A;  5DWN A;  3B2Y A;  4PQA A;  1TKJ A;  2FCK A;  1XFO A;  2PJ4 A;  3BJ8 A;  3GKR A;  4XPD B;  2Q7B A;  4P45 A;  3KI9 A;  3S9L A;  3NA6 A;  4WJB A;  2CXA A;  2V8G A;  4PXD A;  4XNH C;  1ZLH A;  5LYF A;  3KKW A;  4R7M A;  3IWE A;  1RTQ A;  2Q51 A;  4ONW A;  4CRY B;  2QJ8 A;  2PQ8 A;  2NMT A;  3EXN A;  1BPM A;  3LD2 A;  3CXQ A;  2DPS A;  2BSW A;  4OME A;  2VBQ A;  2EO8 A;  2R7H A;  1XMT A;  4CAW A;  4PK2 A;  2EVN A;  3PEI A;  2CNS A;  4R6T A;  4MCQ A;  2PJ1 A;  2ANP A;  4PXB A;  1Z4R A;  4F9U A;  3WR7 A;  1L0C A;  4MFL A;  1Z8T A;  2G9D A;  4QUS A;  2PJ2 A;  2J8N A;  4Y49 C;  4CAE A;  3PRT A;  3L2N A;  4MRI A;  4OP4 A;  5HXD A;  5A28 A;  2ZEM A;  3FVL A;  5CNP A;  1R43 A;  2QYV A;  4NGQ A;  4U5Y A;  4XNH B;  3QNV A;  2A4N A;  5K8O A;  5JM6 A;  2CNT A;  2FL4 A;  5I0C A;  2GFQ A;  3MN8 A;  3IIB A;  3TX8 A;  4MFK A;  1XRY A;  2JLM A;  4PK3 A;  3RBU A;  4B12 A;  1Y9W A;  4RUH A;  2Z10 A;  1YVO A;  2GLF A;  3PP9 A;  4MCP A;  4QVT A;  5K8N A;  2ABZ A;  3HLP A;  3TO6 A;  4B5P A;  3KHZ A;  2VQY A;  4BMH A;  1GHE A;  1YR0 A;  4J3G A;  3CT9 A;  3D2P A;  3D7G A;  3H8E A;  4NCZ A;  5G21 A;  3TC8 A;  8CPA A;  1CJW A;  1S5K A;  4Y49 B;  2YNC A;  3LMS A;  2HV2 A;  2PDO A;  1P4N A;  3F0A A;  2AFX A;  3DDD A;  4NFR A;  3D68 A;  2ZW7 A;  4OC1 A;  3H4Q A;  3TFY A;  5THW A;  1R57 A;  3V38 A;  5C82 A;  2CY2 A;  1YSJ A;  4C2Z A;  5JGF A;  4E8O A;  1ZO0 A;  4A33 A;  4A30 A;  2FT0 A;  2F8H A;  3I1U A;  4MHZ A;  2HB6 A;  3TOB A;  4CGN A;  2AJ6 A;  2Q43 A;  1HEE A;  4UCN A;  2ZEO A;  1WK4 A;  2PJ0 A;  3V7Z A;  1YLE A;  4CPA A;  4MMO A;  3IU2 A;  5ISV A;  3JTK A;  4IHM A;  4R87 A;  4B6Z A;  1YW6 A;  2WPW A;  4MHY A;  4ZY2 A;  5CPA A;  1XMB A;  1XE4 A;  1X12 A;  3IGR A;  3S6H A;  2FSR A; 
#chains in the Genus database with same CATH homology
 3GY9 A;  5JPH A;  2J8R A;  4MFQ A;  2HUZ A;  4AVC A;  2FE7 A;  1NSL A;  4ZGY B;  3A9L A;  3C26 A;  2ZW5 A;  3IU1 A;  1M1D A;  4YRH A;  3TOA A;  5IV0 A;  4R9M A;  1I21 A;  2B3V A;  2C27 A;  3N7Z A;  4YFJ A;  4MI4 A;  4JXQ A;  5AG5 A;  4DNC A;  4JD6 A;  1QST A;  3R96 A;  4UFV A;  2QIR A;  2WSA A;  3SXN A;  3R9E A;  2Z3O A;  4ONU A;  5GCN A;  1WWZ A;  1Y9K A;  1IYL A;  2I00 A;  4MY3 A;  4NF1 A;  4E0A A;  5KTA A;  1Q2C A;  2GIV A;  3EFA A;  2G0B A;  4CYO A;  2QEC A;  3D2M A;  4A31 A;  2F5I A;  2B5G A;  3E0K A;  1VKC A;  1YK3 A;  1QSM A;  5F47 A;  3LOD A;  4UWJ A;  3PZJ A;  2GE3 A;  4PSW A;  4Q38 A;  2BUE A;  4UCP A;  2B5G B;  2VXK A;  2Z3K A;  3EY5 A;  3SHP A;  1RXT A;  3VWD A;  3CXS A;  2FS5 A;  1M4G A;  4QB9 A;  1YVK A;  3UY5 A;  1IIC A;  5J8F A;  4QC6 A;  4F0X A;  3R9F A;  2R1I A;  1M4I A;  4B5O A;  2BL1 A;  4RI1 A;  4F0Y A;  3JUW A;  2R98 A;  4U9Y A;  4KOV A;  1MJ9 A;  3S6G A;  2JEV A;  3I9S A;  1K4J A;  1S60 A;  4OAE A;  3P2H A;  1SQH A;  4R3L A;  3TCV A;  2H5M A;  2WPX A;  4FD4 A;  2PR1 A;  4PSX A;  3JVN A;  4UBR A;  1Q2D A;  5A27 A;  4MY0 A;  1XIX A;  2P6G A;  5G20 A;  3MGD A;  3V8I A;  5DWM A;  2PC1 A;  3OWC A;  2JDD A;  4K30 A;  1OZP A;  1I1D A;  4NXY A;  5AG7 A;  5AGE A;  2OZU A;  4HNY B;  3S6K A;  4CGP A;  2ZW4 A;  2B3U A;  2Q0Y A;  4IF5 A;  3FBU A;  4KOY A;  3I3G A;  4A2Z A;  2YNE A;  3DR6 A;  2OU2 A;  4C2Y A;  2YGW A;  3QB8 A;  1N71 A;  1S3Z A;  3TT2 A;  4L8A A;  2I79 A;  3CXP A;  2HQY A;  3PGP A;  4NEX A;  4KSA A;  4CGO A;  2YND A;  4MFP A;  2OZH A;  2FXF A;  5J8C A;  1UFH A;  4JWP A;  4B14 A;  4CS0 B;  4AG7 A;  2WUU A;  2ATR A;  3R1K A;  1U6M A;  3NE7 A;  4KLV A;  3TO9 A;  3S6F A;  3EC4 A;  3TO7 A;  1QSO A;  2EUI A;  4CAF A;  3SXO A;  4CAV A;  1B87 A;  4C7I A;  3FYN A;  1Z4E A;  2D4O A;  4KOS A;  2D4P A;  3IWG A;  3EO4 A;  4UFW A;  5KTC A;  1M44 A;  2Q44 A;  2PR8 A;  4HNW B;  2P0W A;  3TTH A;  4UA3 A;  4AB7 A;  4CRZ B;  4IUS A;  1S7L A;  4CYN A;  4MBU A;  4BBH A;  2ZXV A;  5H84 A;  1IID A;  4RS2 A;  5C88 A;  3DSB A;  4UCM A;  1NE9 A;  1IYK A;  1KZF A;  1YX0 A;  3R9G A;  2GAN A;  4KUB A;  1TIQ A;  4R3K A;  2G3T A;  4B10 A;  3FRM A;  2Z3M A;  2DPT A;  1VHS A;  4CGM A;  4AG9 A;  3FB3 A;  4A32 A;  4H89 A;  4X5K A;  5F49 A;  3P2F A;  4FD5 A;  3D3S A;  4H6U A;  3W91 A;  3ZJ0 A;  5E96 A;  4KSF A;  1LRZ A;  1ON0 A;  3TE4 A;  4XPD C;  1XF8 A;  1MJA A;  4M3S A;  5AG6 A;  1NMT A;  2Z0Z A;  4KOU A;  5KTD A;  2IL4 A;  3DR8 A;  1KUY A;  4B13 A;  3W6X A;  4KUA A;  4MFZ A;  4ORF A;  5JQ4 A;  2REE A;  3F5B A;  2Q4V A;  2B58 A;  2Z11 A;  2Q4Y A;  4JLY A;  4CGL A;  2Z3P A;  2Y0M A;  3R95 A;  3FNC A;  4CAX A;  4FD7 A;  1Y7R A;  2OZG A;  3BJ7 A;  4EVY A;  2JDC A;  2Z3L A;  1YRE A;  2ARH A;  2X7B A;  4KOT A;  2B4D A;  2Q04 A;  2ZW6 A;  3BLN A;  4ZBG A;  4C2X A;  1I12 A;  1QSN A;  3H5Z A;  5HH1 A;  4KLW A;  2R8V A;  4H6Z A;  4JJX A;  4MFJ A;  4UFX A;  2B4D B;  4KVO E;  4KS9 A;  3FIX A;  2KCW A;  4NSQ A;  4MJ8 A;  5BWA B;  4CYQ A;  4A95 A;  2YNC C;  4II9 A;  4Q36 A;  2ZPA A;  2AE6 A;  4QBJ A;  1CM0 A;  1Q2Y A;  4F6A A;  5G22 A;  2RC4 A;  3W6S A;  4E2A A;  4HKF A;  3RYO A;  1PUA A;  4KOW A;  2BEI A;  3K9U A;  2J8M A;  1Z9U A;  4KVM E;  2FIW A;  1RO5 A;  3F8K A;  4B5P B;  4UWI A;  5G1Z A;  3DNS A;  5AG4 A;  4R57 A;  5HMN A;  1B6B A;  3QAH A;  4B11 A;  2P6E A;  4AVA A;  1BOB A;  2DXQ A;  1PU9 A;  4U9Z A;  3FXT A;  2PRB A;  4YGO A;  5F46 A;  3T90 A;  3ZZI A;  1S7K A;  1KUV A;  1YGH A;  4L89 A;  4KOR A;  4HNX B;  2VZZ A;  3T9Y A;  1XEB A;  5IX3 A;  1IB1 E;  4JXR A;  4KZT A;  2OB0 A;  2VZY A;  4OLL A;  4PV6 A;  3VWE A;  2P6F A;  3G8W A;  1MJB A;  1QSR A;  1BO4 A;  4KVX A;  2Z3N A;  5EC4 A;  5H86 A;  4AVB A;  2K5T A;  1M4D A;  4XPL A;  4GS4 A;  1J4J A;  2VI7 A;  3G3S A;  5FVJ A;  3GYA A;  5EBV A;  4C7H A;  4I49 A;  4C68 A;  3B8G A;  4LX9 A;  5IB0 A;  4FD6 A;  1S7F A;  2B4B A;  2OH1 A;  5F48 A;  4MHD A;  2FIA A;  1S7N A;  4XPK A;  2PSW A;  4M85 A;  1MK4 A;  2QML A;  1V0C A;  2O28 A;  4CYP A;  4KOX A;  2VEZ A;  2CNM A;  2G3A A;  4LUA A;  1P0H A;  2REF A;  1KUX A;  3D8P A;  4OAD A;  1FY7 A;  5DWN A;  2FCK A;  3BJ8 A;  3GKR A;  4XPD B;  2Q7B A;  2CXA A;  4XNH C;  3KKW A;  3IWE A;  4CRY B;  2PQ8 A;  2NMT A;  3EXN A;  3LD2 A;  3CXQ A;  2DPS A;  2BSW A;  2VBQ A;  2R7H A;  1XMT A;  4CAW A;  4PK2 A;  2EVN A;  2CNS A;  1Z4R A;  3WR7 A;  1L0C A;  4MFL A;  4QUS A;  2J8N A;  4Y49 C;  4CAE A;  5A28 A;  5CNP A;  4U5Y A;  4XNH B;  2A4N A;  2CNT A;  2FL4 A;  5I0C A;  4MFK A;  2JLM A;  4PK3 A;  4B12 A;  1Y9W A;  2Z10 A;  1YVO A;  4QVT A;  3PP9 A;  3TO6 A;  4B5P A;  2VQY A;  4BMH A;  1GHE A;  1YR0 A;  4J3G A;  3D2P A;  4NCZ A;  5G21 A;  1CJW A;  1S5K A;  4Y49 B;  2YNC A;  2HV2 A;  2PDO A;  1P4N A;  3F0A A;  3DDD A;  2ZW7 A;  3H4Q A;  3TFY A;  1R57 A;  5C82 A;  2CY2 A;  4C2Z A;  4E8O A;  1ZO0 A;  4A33 A;  4A30 A;  2FT0 A;  3TOB A;  4CGN A;  2AJ6 A;  4UCN A;  1WK4 A;  1YLE A;  5ISV A;  3IU2 A;  3JTK A;  4R87 A;  2WPW A;  1XE4 A;  3IGR A;  3S6H A;  2FSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...