3F5BA

The crystal structure of aminoglycoside n(6')acetyltransferase from legionella pneumophila subsp. pneumophila str. philadelphia 1.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
172
Chain Sequence
NAMMEFRFCFKQMNKSQHELVLGWIHQPHINEWLHGDGLSNTIKDLHEFLNDGKPWATHWIAYDNEIPFAYLITSEIEKSEEYPDGAVTLDLFICRLDYIGKGLSVQMIHEFILSQFSDTKIVLINPEISNERAVHVYKKAGFEIIGEFIASWHPVPHYKMKLCIEDLKKQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Aminoglycoside N(6')acetyltransferase
publication title The crystal structure of aminoglycoside N(6')acetyltransferase from Legionella pneumophila subsp. pneumophila str. Philadelphia 1.
rcsb
source organism Legionella pneumophila subsp. pneumophila
total genus 47
structure length 172
sequence length 178
ec nomenclature
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3f5bA00
4KUBA 4NXYA 1IIDA 4YRHA 5H86A 4KVOE 4HKFA 3G3SA 4FD5A 2WPWA 2A4NA 5HH1A 1YGHA 3TT2A 3SXNA 4MI4A 4Y49B 1QSMA 2REEA 2Z11A 4KOWA 4Y49C 3EY5A 3EO4A 2HUZA 3D2MA 4QB9A 1OZPA 4KVME 4KORA 3TE4A 4MY3A 1S5KA 1Y9WA 4OADA 4XPDB 4CAVA 4R3LA 5HMNA 2OZGA 4XPDC 3TO6A 1VKCA 4KOUA 3S6KA 2ARHA 3S6GA 3DNSA 1GHEA 3FYNA 2AE6A 4B5PB 5F49A 3GKRA 4XNHB 3C26A 3QB8A 2Q44A 4E2AA 2ZW6A 2ZPAA 4ZBGA 2GE3A 3B8GA 4XNHC 1S3ZA 1YR0A 1M4GA 1YK3A 2Q4VA 5DWNA 1NMTA 2R98A 1UFHA 3JUWA 3TOAA 2CNMA 4CRZB 3DSBA 3I3GA 2G3AA 4RS2A 2JDCA 3F8KA 3TCVA 2I00A 5IX3A 2HV2A 5IV0A 1BOBA 3P2FA 2PDOA 3I9SA 4R3KA 2ZW5A 3BJ8A 4L8AA 5J8FA 1S7FA 2BEIA 2B3UA 1B6BA 1Q2YA 5JQ4A 3WR7A 3N7ZA 5I0CA 3ZJ0A 1SQHA 1M4DA 2GANA 5F48A 1YX0A 3PGPA 3T90A 2KCWA 3R9FA 4JJXA 3W6XA 2FSRA 2DXQA 2FIAA 2CY2A 3NE7A 3BJ7A 1Y9KA 1S60A 3TFYA 3EC4A 2BSWA 4MJ8A 3OWCA 1B87A 1KUXA 4AG7A 1Q2DA 4PSWA 4CAWA 2FL4A 4KVXA 4KOTA 3FNCA 3FRMA 4QUSA 4B5OA 2FXFA 4PV6A 4FD4A 4NSQA 4ORFA 2P6GA 4QC6A 2OB0A 2X7BA 5FVJA 4AVCA 2ZXVA 3RYOA 5DWMA 2B4DB 5KTCA 4NF1A 2JLMA 2G0BA 4KOYA 1WWZA 4IUSA 2VEZA 4KLWA 2VZZA 3K9UA 2VZYA 1MK4A 1XIXA 2GIVA 4FD6A 4KOXA 4R87A 1I21A 4PSXA 2B3VA 2P6FA 1IB1E 1L0CA 3D3SA 4B5PA 4CRYB 1PUAA 2EVNA 3FBUA 4R9MA 5ISVA 1RO5A 2ZW4A 3W91A 2REFA 1IICA 2QMLA 4UWJA 3R96A 4AB7A 5E96A 3SXOA 4CAXA 4JD6A 4KZTA 4JXQA 1YLEA 1MJAA 4NCZA 3S6HA 1I12A 3P2HA 1LRZA 1IYKA 2R7HA 1R57A 4H6ZA 1K4JA 5CNPA 3MGDA 4CS0B 1XE4A 4JWPA 3W6SA 2B4BA 4AVBA 5H84A 4I49A 5C82A 3TO7A 1YVKA 5F47A 4BMHA 3IWGA 1S7LA 2J8RA 3EFAA 3CXSA 1PU9A 4XPKA 1Z9UA 3DDDA 5KTDA 2Q4YA 3D2PA 1I1DA 3PP9A 1KUVA 4KOSA 4DNCA 4HNYB 2FCKA 4U9YA 5IB0A 5C88A 3H4QA 3VWEA 2JEVA 2P6EA 4MHDA 3CXPA 4JXRA 2OZHA 1MJ9A 1P4NA 1M1DA 4R57A 4YFJA 2B5GB 2Y0MA 4QBJA 2H5MA 3R95A 2B4DA 3GYAA 1RXTA 5JPHA 2J8NA 4EVYA 3GY9A 2QECA 5KTAA 2Q7BA 1Z4EA 3TOBA 2PC1A 1S7NA 2CNTA 3T9YA 2PSWA 1NSLA 4YGOA 3FXTA 4JLYA 1XMTA 4E0AA 2FE7A 4KLVA 2OZUA 1QSRA 1TIQA 1Q2CA 3DR6A 3UY5A 4RI1A 3R9GA 2Z0ZA 2OU2A 3E0KA 1QSNA 1Y7RA 4MY0A 1M4IA 2R1IA 4LX9A 2WPXA 1XEBA 1ON0A 1WK4A 1P0HA 2VBQA 2QIRA 4HNXB 4II9A 3VWDA 4XPLA 4J3GA 2NMTA 2ATRA 3JVNA 3BLNA 4M85A 1XF8A 2PQ8A 2I79A 3F5BA 1V0CA 3LD2A 1J4JA 3PZJA 4LUAA 3IGRA 5EC4A 3TO9A 3DR8A 1QSOA 1CJWA 4K30A 3R9EA 4AVAA 4H89A 4PK3A 4U9ZA 4PK2A 3FIXA 4KUAA 4F0YA 2K5TA 4U5YA 2BL1A 2FS5A 2HQYA 2VI7A 4UA3A 1CM0A 4UWIA 2F5IA 2OH1A 2Q04A 1U6MA 2VXKA 4F6AA 4E8OA 2J8MA 3F0AA 2CNSA 2RC4A 3G8WA 1QSTA 2D4OA 3SHPA 2ZW7A 1FY7A 4IF5A 2B58A 5J8CA 4H6UA 4QVTA 4KOVA 2C27A 4L89A 3R1KA 1MJBA 1VHSA 4OAEA 2AJ6A 4MBUA 1BO4A 2PRBA 1N71A 2B5GA 5EBVA 1KUYA 2O28A 3V8IA 1Z4RA 2IL4A 4ONUA 2P0WA 5F46A 3ZZIA 3S6FA 3D8PA 4NEXA 4X5KA 5GCNA 2Q0YA 1S7KA 4M3SA 4OLLA 1IYLA 2FIWA 3EXNA 2JDDA 1M44A 2BUEA 2VQYA 3FB3A 3TTHA 2R8VA 1YVOA 1YREA 1KZFA 1NE9A 2EUIA 3LODA 4AG9A 3CXQA 3QAHA 4FD7A 2G3TA 2PR8A 2Z10A 4GS4A 2FT0A 2D4PA 2PR1A 4UBRA 3KKWA 4HNWB
chains in the Genus database with same CATH superfamily
4CGOA 4KUBA 4OC5A 4NXYA 3V38A 4A2ZA 2ANPA 4CAEA 1IIDA 4YRHA 5H86A 4KVOE 4HKFA 3G3SA 4FD5A 4F8ZA 1YW4A 2ZENA 4C7HA 2WPWA 4HPSA 4NGQA 2QYVA 3IJ3A 2A4NA 4ONWA 5HH1A 1YGHA 3TT2A 2DF5A 4MFZA 3SXNA 2AFXA 4MCQA 1YMEA 3IIBA 4MI4A 4OC4A 4Y49B 4FBEA 5ELYA 2EO8A 1QSMA 4EWTA 1CPXA 2REEA 2Z11A 2ZOGA 3D68A 4KOWA 1LAMA 1Z8TA 3EY5A 3KHXA 3PFEA 4Y49C 3RAMA 3NFZA 4P4IA 5HVFA 3EO4A 3GB0A 4JYWA 2HUZA 3D2MA 4QB9A 4A32A 1ELMP 1OZPA 2Z3LA 4KORA 1IGBA 4KVME 4OC2A 4UFWA 4CYPA 3TE4A 4CAFA 4MY3A 4FWUA 4A37A 1S5KA 1Y9WA 1PYTB 4OADA 4XPDB 4CAVA 3T8WA 4R3LA 4C2YA 5HMNA 3WC5A 2OZGA 3KGQA 4G1PA 1HDQA 4XPDC 3TO6A 1VKCA 1Z2LA 4KOUA 1CP6A 3L2NA 3S6KA 3D7FA 2POKA 2ARHA 3S6GA 4R8FA 4B13A 4F9VA 3DNSA 1GHEA 3FYNA 2O53A 3SJFA 1HDUA 3PFOA 5CBMA 2AE6A 1NSAA 4B5PB 1ZO0A 5F49A 3PBBA 3GKRA 4XNHB 2V8DA 3C26A 3QB8A 2Q44A 4E2AA 3NH5A 2ZW6A 3A9LA 2ZPAA 1TKHA 2AFWA 2EK9A 2PIZA 4ZBGA 2GE3A 3B8GA 4XNHC 1S3ZA 1YR0A 1M4GA 1R3NA 2RFHA 4C68A 1LAPA 1YK3A 2Q4VA 4UEFA 5DWNA 1NMTA 5LRJA 4A33A 4F0XA 1ARLA 2R98A 4Q38A 3BHXA 1UFHA 3JUWA 2PJ3A 3TOAA 4RUHA 6CPAA 1RTQA 3PB8X 2CNMA 4CRZB 2PIYA 3DSBA 3I3GA 4NGNA 2G3AA 4RS2A 3PB9X 2JDCA 3PEIA 3F8KA 3TCVA 3CDXA 2I00A 5IX3A 1UWYA 2HV2A 5IV0A 3QNVA 4R6TA 4EFDA 1Z8XA 4MMOA 4A38A 3P2FA 2PDOA 3I9SA 4IAVA 1JQGA 2YNCC 4Q7AA 4R3KA 3NE8A 5F09A 2BCOA 2ZW5A 3WC7A 3BJ8A 4L8AA 1XJOA 3D66A 5J8FA 1S7FA 2BEIA 4ZI6A 4R76A 2DPSA 2B3UA 4CYQA 2CXAA 1B6BA 2ZEGA 1Q2YA 3NH4A 1HEEA 1ZG8A 5JQ4A 3WR7A 1X10A 2PRQA 2QJ8A 4B12A 4DJLA 3N7ZA 5I0CA 1XBUA 3ZJ0A 1F57A 1SQHA 4FUUA 1M4DA 2GANA 5F48A 1YX0A 3PGPA 1IY7A 3T90A 2KCWA 4M6GA 3R9FA 4JJXA 5JGFA 4YWYA 3W6XA 2FSRA 4AVCA 2DXQA 2FIAA 2PJ5A 3B3TA 4MFLA 2CY2A 1Q7LA 4NGSA 1ARMA 3PB6X 1VHEA 3NE7A 3BJ7A 1Y9KA 4M6HA 4BBHA 3IEHA 1S60A 3TFYA 1CPSA 3EC4A 4TWEA 1VHOA 2BSWA 4MJ8A 4OC0A 2GREA 3OWCA 1B87A 2Q7SA 3PBEA 3VH9A 3CZXA 2CF4A 3RNZA 1KUXA 1BAVA 2YNDA 3D7DA 4PXBA 3S9MA 3CPAA 4MFJA 4AG7A 3FEEA 2ZOFA 4UIBA 5AG4A 1Q2DA 4PSWA 3V7ZA 4CAWA 1Y0RA 2JBJA 2FL4A 4KVXA 4F9UA 4KOTA 3FNCA 3FRMA 4QUSA 4B11A 4B5OA 2IQ6A 3KASA 4TNUA 4C2ZA 3FMCA 5G22A 2FXFA 2BO9A 2NYQA 2PJ6A 1BPMA 4X8IA 4PV6A 4FD4A 4IK2A 4NSQA 4NGTA 5LRGA 4MRIA 4ORFA 2P6GA 4QC6A 4UFXA 4MHNA 2OB0A 3FF3A 2X7BA 5FVJA 2DPTA 2WZNA 2ZXVA 5DWMA 1DTDA 1FT7A 2XEGA 4K3NA 2B4DB 4OC1A 4NF1A 5KTCA 1H8LA 4CGLA 2JLMA 4UCMA 2G0BA 3BI0A 4KOYA 1WWZA 4A30A 4IUSA 4KSIA 2VEZA 4KLWA 2WYRA 2VZZA 1IOIA 1ZG7A 2F7VA 4CYOA 3QAYA 4CPAA 3RZAA 3K9UA 2V8HA 2PJ0A 2VZYA 4Q36A 4WJBA 3S9LA 1MK4A 1XIXA 3I1UA 4NGRA 4NGMA 2GIVA 3IWEA 4FD6A 4KOXA 4R87A 5IB9A 2V8GA 1I21A 4PSXA 2B3VA 2P6FA 1ZLIA 1CG2A 1IB1E 3TC8A 1L0CA 2GLFA 3D3SA 3LACA 4B5PA 1AMPA 3WC6A 3HLPA 4CRYB 1PUAA 1VIXA 2EVNA 2VL1A 2WUUA 4OP4A 4FAIA 5LRKA 5AG6A 3FBUA 2V8VA 4R9MA 4A31A 2ZEPA 5ISVA 1F2PA 1RO5A 2ZW4A 3W91A 2Z3KA 2REFA 1IICA 2IMOA 2QMLA 4CYNA 4UWJA 3R96A 4AB7A 5E96A 3SXOA 1FNOA 3D7HA 4ZGYB 5A27A 4P6YA 4CAXA 4JD6A 4KZTA 4MHPA 2GLJA 2BOAA 4OIWA 1TF9A 1TXRA 4JXQA 3K2KA 3D67A 2G9DA 1LOKA 1MJAA 1YLEA 4KSFA 4NCZA 5DS0A 3S6HA 4B6ZA 5JH9A 1I12A 3P2HA 1LRZA 5G21A 1IYKA 2YNCA 4GXHA 1Y7EA 2R7HA 2ZEMA 1R57A 3ISZA 4OIDA 3SI2A 2PJ4A 4H6ZA 1K4JA 5CNPA 3KL9A 4A94A 3B3SA 4H2KA 2EBJA 3MGDA 4CS0B 4PXEA 1XE4A 4JWPA 3W6SA 2B4BA 3FECA 1CP7A 4NFRA 4MFQA 2AFSA 2ZEDA 3LMSA 4CGPA 2YNEA 4AVBA 5H84A 4DUKA 4I49A 2PVWA 4P4EA 1XRYA 5C82A 2O4HA 5AG5A 2PE3A 2Q51A 1YVKA 3TO7A 5F47A 4UEEA 4JZ0A 4BMHA 1R43A 3IWGA 3B2YA 7CPAA 1S7LA 2J8RA 3EFAA 3CXSA 3SJGA 2NSMA 1Z8LA 5J1QA 3DLJA 1PU9A 4XPKA 1Z9UA 3DDDA 2Z3MA 4LQGA 2Q4YA 3D2PA 5KTDA 4P45A 1I1DA 4B14A 4C7IA 3PP9A 1KUVA 4KOSA 4CGMA 4DNCA 4HNYB 2ZELA 3H8EA 1BLLE 1CX8A 2FCKA 4U9YA 5IB0A 5C88A 5LYLA 1ZG9A 4MFPA 4MCPA 4ZY2A 3H4QA 3VWEA 2DEAA 2JEVA 2P6EA 4MHDA 4P4DA 2PJ2A 3CXPA 4GM5A 3IFEA 2IJZA 4JXRA 2OZHA 1MJ9A 2CIJA 3FVLA 1IU8A 1ZLHA 2JEWA 3SI0A 1P4NA 3H5ZA 1M1DA 1QQ9A 4ZX8A 2XEJA 4R57A 4YFJA 2B5GB 3B3VA 3RO0A 2Y0MA 4QBJA 2H5MA 4X2TA 3R95A 1YW6A 3VARA 2Z3OA 2B4DA 3GYAA 1RXTA 5JPHA 4NJRA 2J8NA 4EVYA 4UEZA 1AYEA 3GY9A 2QECA 5KTAA 2Q7BA 1Z4EA 3TOBA 2PC1A 1S7NA 2CNTA 2CTBA 4X3RA 4W9YA 2HC9A 3T9YA 5HVGA 5I4MA 5THWA 2ODFA 2PSWA 3PB7X 1LFWA 4YGOA 1NSLA 2AFZA 5AGEA 2ZEOA 3FXTA 3MN8A 1XMTA 3N5FA 4JLYA 4E0AA 2FE7A 3B3WA 3FH4A 4KLVA 2OZUA 1QSRA 2C6PA 1TIQA 2Z3PA 2XEIA 4CGNA 5G20A 1Q2CA 3DR6A 3MRUA 3UY5A 1M4LA 1XOVA 4RI1A 3HUVA 3R9GA 2GU2A 2OR4A 2GFQA 2Z0ZA 3FJUA 4KS9A 4PPZA 2OU2A 1TKFA 3DGVA 1Y0YA 2PJ8A 1AUGA 3GLJA 1BPNA 3NA6A 2AFOA 3E0KA 3ISXA 4EMEA 3KR5A 5K8MA 1QSNA 4MHZA 1Y7RA 4MY0A 2PJ7A 1M4IA 2R1IA 3CPXA 1Z8WA 1IOFA 2WSAA 2WPXA 4LX9A 1XEBA 1YQEA 5K8PA 4MCSA 1ON0A 4R7MA 1JWQA 1WK4A 5D8NA 4ZY1A 4OC3A 4MXUA 1P0HA 2VBQA 2QIRA 3RYOA 4HNXB 5G1ZA 4II9A 1ELLP 4XPLA 3VWDA 4J3GA 1Z5RA 2NMTA 4C2XA 2ATRA 3B7IA 2HB6A 4YU9A 1GYTA 3JVNA 2YGWA 2XEFA 3BLNA 4M85A 1XF8A 2PQ8A 5HXDA 2I79A 3F5BA 1V0CA 3LD2A 1J4JA 1X12A 3PZJA 4MHYA 3GIUA 4LUAA 3IGRA 5EC4A 4NJQA 4PXCA 3TO9A 3DR8A 1QSOA 3BXMA 3KHZA 1CJWA 3KKWA 2ABZA 3RBUA 4K30A 3PRTA 5A28A 3R9EA 4AVAA 4H89A 4PK3A 4BD9A 4U9ZA 2C6CA 2AFMA 2ZEFA 3KZWA 1LANA 1OBRA 4OKOA 4PK2A 2FVGA 3FIXA 4KUAA 3B3CA 4F0YA 5LYFA 4MFKA 2K5TA 4UCNA 3GUXA 4U5YA 3NH8A 4ZX9A 5K8NA 1XMBA 2BL1A 2FS5A 1YLOA 2HQYA 2VI7A 4UA3A 4UIAA 1CM0A 4UWIA 4P4FA 2F5IA 5AG7A 2OH1A 5HVHA 2Q04A 3PB4X 1U6MA 3SJXA 2VXKA 2C6GA 4F6AA 4E8OA 2J8MA 4ZYQA 3F0AA 2CNSA 2RC4A 1QMUA 1YSJA 3G8WA 1QSTA 2D4OA 4Z65A 4PQAA 3SHPA 4UFVA 2ZW7A 4O23A 1XFOA 1FY7A 5D29A 4IF5A 2B58A 3FX6A 5J8CA 4H6UA 4QVTA 2PJ1A 3JRUA 4BINA 2I3CA 2EWBA 4KOVA 3WABA 2OOTA 2C27A 4L89A 4A95A 1VGYA 2PJAA 4NGPA 3H8FA 2PJ9A 3R1KA 1MJBA 3CT9A 1VHSA 3IO1A 5EMIA 4OAEA 3H8GA 2AJ6A 4MBUA 1BO4A 2PRBA 3LWUA 1CBXA 1N71A 3SJEA 4MCRA 2B5GA 2Q4ZA 2ZEHA 1KUYA 5EBVA 2EK8A 2O28A 3D7GA 3V8IA 3K9TA 5LYIA 4ZY0A 3JTKA 2Z3NA 3KR4A 1Z4RA 2IL4A 4ONUA 5CPAA 2P0WA 3BI1A 5F46A 5JM6A 5K8OA 4UF4A 3FEDA 4M6IA 4DYOA 3ZZIA 2AFUA 3S6FA 3D8PA 4NEXA 3IU2A 4X5KA 4P44A 5GCNA 4KSAA 5LYDA 2C1CA 2Q0YA 4PXDA 4WWVA 2F8HA 1S7KA 3IU1A 1EE3P 4M3SA 1F2OA 2JBKA 1IYLA 2PJCA 3D4UA 4OLLA 2ZEEA 3KQXA 3SI1A 3VATA 2J9AA 2FIWA 3EXNA 4A39A 2JDDA 1M44A 4P10A 1A2ZA 2BUEA 1TF8A 2QVPA 3KQZA 3TX8A 2VQYA 4AXVA 4OMEA 3WT4A 4P4BA 4IHMA 3FB3A 3TTHA 2PCUA 3B35A 1KWMA 2V77A 2CTCA 4LQ6A 2R8VA 2Q43A 3IWWA 3S9NA 1YVOA 1DE4C 1YREA 3KI9A 4RN7A 1KZFA 1NE9A 2EUIA 3LODA 4AG9A 1TKJA 3CXQA 1LCPA 3QAHA 4P4JA 4FD7A 2PJBA 4B10A 2G3TA 2PR8A 2Z10A 4GS4A 5BWAB 2FT0A 2D4PA 4UCPA 2PR1A 3IC1A 2RB7A 1PCAA 4UBRA 8CPAA 2PVVA 1BOBA 4HNWB
chains in the Genus database with same CATH topology
4CGOA 4KUBA 4NXYA 4A2ZA 4CAEA 1IIDA 4YRHA 5H86A 4KVOE 4HKFA 3G3SA 4FD5A 4C7HA 2WPWA 2A4NA 5HH1A 1YGHA 3TT2A 4MFZA 3SXNA 4MI4A 4Y49B 1QSMA 2REEA 2Z11A 4KOWA 4Y49C 3EY5A 3EO4A 2HUZA 3D2MA 4QB9A 4A32A 1OZPA 2Z3LA 4KORA 4KVME 4CYPA 4UFWA 3TE4A 4CAFA 4MY3A 1S5KA 1Y9WA 4OADA 4XPDB 4CAVA 4R3LA 4C2YA 5HMNA 2OZGA 4XPDC 3TO6A 1VKCA 4KOUA 3S6KA 2ARHA 3S6GA 4B13A 3DNSA 1GHEA 3FYNA 2AE6A 4B5PB 1ZO0A 5F49A 3GKRA 4XNHB 3C26A 3QB8A 2Q44A 4E2AA 2ZW6A 3A9LA 2ZPAA 4ZBGA 2GE3A 3B8GA 4XNHC 1S3ZA 1YR0A 1M4GA 4C68A 1YK3A 2Q4VA 5DWNA 1NMTA 4A33A 4F0XA 4Q38A 2R98A 1UFHA 3JUWA 3TOAA 2CNMA 4CRZB 3DSBA 3I3GA 2G3AA 4RS2A 2JDCA 3F8KA 3TCVA 2I00A 5IX3A 2HV2A 5IV0A 1BOBA 3P2FA 2PDOA 3I9SA 2YNCC 4R3KA 2ZW5A 3BJ8A 4L8AA 5J8FA 1S7FA 2BEIA 2DPSA 2B3UA 4CYQA 2CXAA 1B6BA 1Q2YA 5JQ4A 3WR7A 4B12A 3N7ZA 5I0CA 3ZJ0A 1SQHA 4CGLA 1M4DA 2GANA 5F48A 1YX0A 3PGPA 3T90A 2KCWA 3R9FA 4JJXA 3W6XA 2FSRA 2DXQA 2FIAA 4MFLA 2CY2A 3NE7A 3BJ7A 1Y9KA 4BBHA 1S60A 3TFYA 3EC4A 2BSWA 4MJ8A 3OWCA 1B87A 1KUXA 2YNDA 4MFJA 4AG7A 5AG4A 1Q2DA 4PSWA 4CAWA 2FL4A 4KVXA 4KOTA 3FNCA 3FRMA 4QUSA 4B11A 4B5OA 4C2ZA 5G22A 2FXFA 4PV6A 4FD4A 4NSQA 4ORFA 2P6GA 4QC6A 4UFXA 2OB0A 2X7BA 5FVJA 2DPTA 2ZXVA 3RYOA 5DWMA 4AVCA 2B4DB 5KTCA 4NF1A 2JLMA 4UCMA 2G0BA 4KOYA 1WWZA 4A30A 4IUSA 2VEZA 4KLWA 2VZZA 4CYOA 3K9UA 2VZYA 4Q36A 1MK4A 1XIXA 2GIVA 3IWEA 4FD6A 4KOXA 4R87A 1I21A 4PSXA 2B3VA 2P6FA 1IB1E 1L0CA 3D3SA 4B5PA 4CRYB 1PUAA 2EVNA 2WUUA 5AG6A 3FBUA 4R9MA 4A31A 5ISVA 1RO5A 2ZW4A 3W91A 2Z3KA 2REFA 1IICA 2QMLA 4CYNA 4UWJA 3R96A 4AB7A 5E96A 3SXOA 4ZGYB 5A27A 4CAXA 4JD6A 4KZTA 4JXQA 4KSFA 1YLEA 1MJAA 4NCZA 3S6HA 1I12A 3P2HA 1LRZA 5G21A 1IYKA 2YNCA 2R7HA 1R57A 4H6ZA 1K4JA 5CNPA 3MGDA 4CS0B 1XE4A 4JWPA 3W6SA 2B4BA 4MFQA 4CGPA 2YNEA 4AVBA 5H84A 4I49A 5C82A 5AG5A 3TO7A 1YVKA 5F47A 4BMHA 3IWGA 1S7LA 2J8RA 3EFAA 3CXSA 1PU9A 4XPKA 1Z9UA 3DDDA 2Z3MA 5KTDA 2Q4YA 3D2PA 1I1DA 4B14A 4C7IA 3PP9A 1KUVA 4KOSA 4CGMA 4DNCA 4HNYB 2FCKA 4U9YA 5IB0A 5C88A 4MFPA 3H4QA 3VWEA 2JEVA 2P6EA 4MHDA 3CXPA 4JXRA 2OZHA 1MJ9A 1P4NA 3H5ZA 1M1DA 4R57A 4YFJA 2B5GB 2Y0MA 4QBJA 2H5MA 3R95A 2Z3OA 2B4DA 3GYAA 1RXTA 5JPHA 2J8NA 4EVYA 3GY9A 2QECA 5KTAA 2Q7BA 1Z4EA 3TOBA 2PC1A 1S7NA 2CNTA 3T9YA 2PSWA 1NSLA 4YGOA 5AGEA 3FXTA 4JLYA 1XMTA 4E0AA 2FE7A 4KLVA 2OZUA 1QSRA 2Z3PA 1TIQA 4CGNA 5G20A 1Q2CA 3DR6A 3UY5A 4RI1A 3R9GA 2Z0ZA 4KS9A 2OU2A 3E0KA 1QSNA 1Y7RA 4MY0A 1M4IA 2R1IA 4LX9A 2WSAA 2WPXA 1XEBA 1ON0A 1WK4A 1P0HA 2VBQA 2QIRA 4HNXB 5G1ZA 4II9A 3VWDA 4XPLA 4J3GA 2NMTA 4C2XA 2ATRA 3JVNA 2YGWA 3BLNA 4M85A 1XF8A 2PQ8A 2I79A 3F5BA 1V0CA 3LD2A 1J4JA 3PZJA 4LUAA 3IGRA 5EC4A 3TO9A 3DR8A 1QSOA 1CJWA 4K30A 5A28A 3R9EA 4AVAA 4H89A 4PK3A 4U9ZA 4PK2A 3FIXA 4KUAA 4F0YA 4MFKA 2K5TA 4UCNA 4U5YA 2BL1A 2FS5A 2HQYA 2VI7A 4UA3A 1CM0A 4UWIA 2F5IA 5AG7A 2OH1A 2Q04A 1U6MA 2VXKA 4F6AA 4E8OA 2J8MA 3F0AA 2CNSA 2RC4A 3G8WA 1QSTA 2D4OA 3SHPA 4UFVA 2ZW7A 1FY7A 4IF5A 2B58A 5J8CA 4H6UA 4QVTA 4KOVA 4A95A 2C27A 4L89A 3R1KA 1MJBA 1VHSA 4OAEA 2AJ6A 4MBUA 1BO4A 2PRBA 1N71A 2B5GA 5EBVA 1KUYA 2O28A 3V8IA 3JTKA 2Z3NA 1Z4RA 2IL4A 4ONUA 2P0WA 5F46A 3ZZIA 3S6FA 3D8PA 4NEXA 3IU2A 4X5KA 5GCNA 4KSAA 2Q0YA 3IU1A 1S7KA 4M3SA 4OLLA 1IYLA 2FIWA 3EXNA 2JDDA 1M44A 2BUEA 2VQYA 3FB3A 3TTHA 2R8VA 1YVOA 1YREA 1KZFA 1NE9A 2EUIA 3LODA 4AG9A 3CXQA 3QAHA 4FD7A 4B10A 2G3TA 2PR8A 2Z10A 4GS4A 5BWAB 2FT0A 2D4PA 4UCPA 2PR1A 4UBRA 3KKWA 4HNWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KUB A;  4NXY A;  1IID A;  4YRH A;  5H86 A;  4KVO E;  4HKF A;  3G3S A;  4FD5 A;  2WPW A;  2A4N A;  5HH1 A;  1YGH A;  3TT2 A;  3SXN A;  4MI4 A;  4Y49 B;  1QSM A;  2REE A;  2Z11 A;  4KOW A;  4Y49 C;  3EY5 A;  3EO4 A;  2HUZ A;  3D2M A;  4QB9 A;  1OZP A;  4KVM E;  4KOR A;  3TE4 A;  4MY3 A;  1S5K A;  1Y9W A;  4OAD A;  4XPD B;  4CAV A;  4R3L A;  5HMN A;  2OZG A;  4XPD C;  3TO6 A;  1VKC A;  4KOU A;  3S6K A;  2ARH A;  3S6G A;  3DNS A;  1GHE A;  3FYN A;  2AE6 A;  4B5P B;  5F49 A;  3GKR A;  4XNH B;  3C26 A;  3QB8 A;  2Q44 A;  4E2A A;  2ZW6 A;  2ZPA A;  4ZBG A;  2GE3 A;  3B8G A;  4XNH C;  1S3Z A;  1YR0 A;  1M4G A;  1YK3 A;  2Q4V A;  5DWN A;  1NMT A;  2R98 A;  1UFH A;  3JUW A;  3TOA A;  2CNM A;  4CRZ B;  3DSB A;  3I3G A;  2G3A A;  4RS2 A;  2JDC A;  3F8K A;  3TCV A;  2I00 A;  5IX3 A;  2HV2 A;  5IV0 A;  1BOB A;  3P2F A;  2PDO A;  3I9S A;  4R3K A;  2ZW5 A;  3BJ8 A;  4L8A A;  5J8F A;  1S7F A;  2BEI A;  2B3U A;  1B6B A;  1Q2Y A;  5JQ4 A;  3WR7 A;  3N7Z A;  5I0C A;  3ZJ0 A;  1SQH A;  1M4D A;  2GAN A;  5F48 A;  1YX0 A;  3PGP A;  3T90 A;  2KCW A;  3R9F A;  4JJX A;  3W6X A;  2FSR A;  2DXQ A;  2FIA A;  2CY2 A;  3NE7 A;  3BJ7 A;  1Y9K A;  1S60 A;  3TFY A;  3EC4 A;  2BSW A;  4MJ8 A;  3OWC A;  1B87 A;  1KUX A;  4AG7 A;  1Q2D A;  4PSW A;  4CAW A;  2FL4 A;  4KVX A;  4KOT A;  3FNC A;  3FRM A;  4QUS A;  4B5O A;  2FXF A;  4PV6 A;  4FD4 A;  4NSQ A;  4ORF A;  2P6G A;  4QC6 A;  2OB0 A;  2X7B A;  5FVJ A;  4AVC A;  2ZXV A;  3RYO A;  5DWM A;  2B4D B;  5KTC A;  4NF1 A;  2JLM A;  2G0B A;  4KOY A;  1WWZ A;  4IUS A;  2VEZ A;  4KLW A;  2VZZ A;  3K9U A;  2VZY A;  1MK4 A;  1XIX A;  2GIV A;  4FD6 A;  4KOX A;  4R87 A;  1I21 A;  4PSX A;  2B3V A;  2P6F A;  1IB1 E;  1L0C A;  3D3S A;  4B5P A;  4CRY B;  1PUA A;  2EVN A;  3FBU A;  4R9M A;  5ISV A;  1RO5 A;  2ZW4 A;  3W91 A;  2REF A;  1IIC A;  2QML A;  4UWJ A;  3R96 A;  4AB7 A;  5E96 A;  3SXO A;  4CAX A;  4JD6 A;  4KZT A;  4JXQ A;  1YLE A;  1MJA A;  4NCZ A;  3S6H A;  1I12 A;  3P2H A;  1LRZ A;  1IYK A;  2R7H A;  1R57 A;  4H6Z A;  1K4J A;  5CNP A;  3MGD A;  4CS0 B;  1XE4 A;  4JWP A;  3W6S A;  2B4B A;  4AVB A;  5H84 A;  4I49 A;  5C82 A;  3TO7 A;  1YVK A;  5F47 A;  4BMH A;  3IWG A;  1S7L A;  2J8R A;  3EFA A;  3CXS A;  1PU9 A;  4XPK A;  1Z9U A;  3DDD A;  5KTD A;  2Q4Y A;  3D2P A;  1I1D A;  3PP9 A;  1KUV A;  4KOS A;  4DNC A;  4HNY B;  2FCK A;  4U9Y A;  5IB0 A;  5C88 A;  3H4Q A;  3VWE A;  2JEV A;  2P6E A;  4MHD A;  3CXP A;  4JXR A;  2OZH A;  1MJ9 A;  1P4N A;  1M1D A;  4R57 A;  4YFJ A;  2B5G B;  2Y0M A;  4QBJ A;  2H5M A;  3R95 A;  2B4D A;  3GYA A;  1RXT A;  5JPH A;  2J8N A;  4EVY A;  3GY9 A;  2QEC A;  5KTA A;  2Q7B A;  1Z4E A;  3TOB A;  2PC1 A;  1S7N A;  2CNT A;  3T9Y A;  2PSW A;  1NSL A;  4YGO A;  3FXT A;  4JLY A;  1XMT A;  4E0A A;  2FE7 A;  4KLV A;  2OZU A;  1QSR A;  1TIQ A;  1Q2C A;  3DR6 A;  3UY5 A;  4RI1 A;  3R9G A;  2Z0Z A;  2OU2 A;  3E0K A;  1QSN A;  1Y7R A;  4MY0 A;  1M4I A;  2R1I A;  4LX9 A;  2WPX A;  1XEB A;  1ON0 A;  1WK4 A;  1P0H A;  2VBQ A;  2QIR A;  4HNX B;  4II9 A;  3VWD A;  4XPL A;  4J3G A;  2NMT A;  2ATR A;  3JVN A;  3BLN A;  4M85 A;  1XF8 A;  2PQ8 A;  2I79 A;  3F5B A;  1V0C A;  3LD2 A;  1J4J A;  3PZJ A;  4LUA A;  3IGR A;  5EC4 A;  3TO9 A;  3DR8 A;  1QSO A;  1CJW A;  4K30 A;  3R9E A;  4AVA A;  4H89 A;  4PK3 A;  4U9Z A;  4PK2 A;  3FIX A;  4KUA A;  4F0Y A;  2K5T A;  4U5Y A;  2BL1 A;  2FS5 A;  2HQY A;  2VI7 A;  4UA3 A;  1CM0 A;  4UWI A;  2F5I A;  2OH1 A;  2Q04 A;  1U6M A;  2VXK A;  4F6A A;  4E8O A;  2J8M A;  3F0A A;  2CNS A;  2RC4 A;  3G8W A;  1QST A;  2D4O A;  3SHP A;  2ZW7 A;  1FY7 A;  4IF5 A;  2B58 A;  5J8C A;  4H6U A;  4QVT A;  4KOV A;  2C27 A;  4L89 A;  3R1K A;  1MJB A;  1VHS A;  4OAE A;  2AJ6 A;  4MBU A;  1BO4 A;  2PRB A;  1N71 A;  2B5G A;  5EBV A;  1KUY A;  2O28 A;  3V8I A;  1Z4R A;  2IL4 A;  4ONU A;  2P0W A;  5F46 A;  3ZZI A;  3S6F A;  3D8P A;  4NEX A;  4X5K A;  5GCN A;  2Q0Y A;  1S7K A;  4M3S A;  4OLL A;  1IYL A;  2FIW A;  3EXN A;  2JDD A;  1M44 A;  2BUE A;  2VQY A;  3FB3 A;  3TTH A;  2R8V A;  1YVO A;  1YRE A;  1KZF A;  1NE9 A;  2EUI A;  3LOD A;  4AG9 A;  3CXQ A;  3QAH A;  4FD7 A;  2G3T A;  2PR8 A;  2Z10 A;  4GS4 A;  2FT0 A;  2D4P A;  2PR1 A;  4UBR A;  3KKW A;  4HNW B; 
#chains in the Genus database with same CATH topology
 4CGO A;  4KUB A;  4OC5 A;  4NXY A;  3V38 A;  4A2Z A;  2ANP A;  4CAE A;  1IID A;  4YRH A;  5H86 A;  4KVO E;  4HKF A;  3G3S A;  4FD5 A;  4F8Z A;  1YW4 A;  2ZEN A;  4C7H A;  2WPW A;  4HPS A;  4NGQ A;  2QYV A;  3IJ3 A;  2A4N A;  4ONW A;  5HH1 A;  1YGH A;  3TT2 A;  2DF5 A;  4MFZ A;  3SXN A;  2AFX A;  4MCQ A;  1YME A;  3IIB A;  4MI4 A;  4OC4 A;  4Y49 B;  4FBE A;  5ELY A;  2EO8 A;  1QSM A;  4EWT A;  1CPX A;  2REE A;  2Z11 A;  2ZOG A;  3D68 A;  4KOW A;  1LAM A;  1Z8T A;  3EY5 A;  3KHX A;  3PFE A;  4Y49 C;  3RAM A;  3NFZ A;  4P4I A;  5HVF A;  3EO4 A;  3GB0 A;  4JYW A;  2HUZ A;  3D2M A;  4QB9 A;  4A32 A;  1ELM P;  1OZP A;  2Z3L A;  4KOR A;  1IGB A;  4KVM E;  4OC2 A;  4UFW A;  4CYP A;  3TE4 A;  4CAF A;  4MY3 A;  4FWU A;  4A37 A;  1S5K A;  1Y9W A;  1PYT B;  4OAD A;  4XPD B;  4CAV A;  3T8W A;  4R3L A;  4C2Y A;  5HMN A;  3WC5 A;  2OZG A;  3KGQ A;  4G1P A;  1HDQ A;  4XPD C;  3TO6 A;  1VKC A;  1Z2L A;  4KOU A;  1CP6 A;  3L2N A;  3S6K A;  3D7F A;  2POK A;  2ARH A;  3S6G A;  4R8F A;  4B13 A;  4F9V A;  3DNS A;  1GHE A;  3FYN A;  2O53 A;  3SJF A;  1HDU A;  3PFO A;  5CBM A;  2AE6 A;  1NSA A;  4B5P B;  1ZO0 A;  5F49 A;  3PBB A;  3GKR A;  4XNH B;  2V8D A;  3C26 A;  3QB8 A;  2Q44 A;  4E2A A;  3NH5 A;  2ZW6 A;  3A9L A;  2ZPA A;  1TKH A;  2AFW A;  2EK9 A;  2PIZ A;  4ZBG A;  2GE3 A;  3B8G A;  4XNH C;  1S3Z A;  1YR0 A;  1M4G A;  1R3N A;  2RFH A;  4C68 A;  1LAP A;  1YK3 A;  2Q4V A;  4UEF A;  5DWN A;  1NMT A;  5LRJ A;  4A33 A;  4F0X A;  1ARL A;  2R98 A;  4Q38 A;  3BHX A;  1UFH A;  3JUW A;  2PJ3 A;  3TOA A;  4RUH A;  6CPA A;  1RTQ A;  3PB8 X;  2CNM A;  4CRZ B;  2PIY A;  3DSB A;  3I3G A;  4NGN A;  2G3A A;  4RS2 A;  3PB9 X;  2JDC A;  3PEI A;  3F8K A;  3TCV A;  3CDX A;  2I00 A;  5IX3 A;  1UWY A;  2HV2 A;  5IV0 A;  3QNV A;  4R6T A;  4EFD A;  1Z8X A;  4MMO A;  4A38 A;  3P2F A;  2PDO A;  3I9S A;  4IAV A;  1JQG A;  2YNC C;  4Q7A A;  4R3K A;  3NE8 A;  5F09 A;  2BCO A;  2ZW5 A;  3WC7 A;  3BJ8 A;  4L8A A;  1XJO A;  3D66 A;  5J8F A;  1S7F A;  2BEI A;  4ZI6 A;  4R76 A;  2DPS A;  2B3U A;  4CYQ A;  2CXA A;  1B6B A;  2ZEG A;  1Q2Y A;  3NH4 A;  1HEE A;  1ZG8 A;  5JQ4 A;  3WR7 A;  1X10 A;  2PRQ A;  2QJ8 A;  4B12 A;  4DJL A;  3N7Z A;  5I0C A;  1XBU A;  3ZJ0 A;  1F57 A;  1SQH A;  4FUU A;  1M4D A;  2GAN A;  5F48 A;  1YX0 A;  3PGP A;  1IY7 A;  3T90 A;  2KCW A;  4M6G A;  3R9F A;  4JJX A;  5JGF A;  4YWY A;  3W6X A;  2FSR A;  4AVC A;  2DXQ A;  2FIA A;  2PJ5 A;  3B3T A;  4MFL A;  2CY2 A;  1Q7L A;  4NGS A;  1ARM A;  3PB6 X;  1VHE A;  3NE7 A;  3BJ7 A;  1Y9K A;  4M6H A;  4BBH A;  3IEH A;  1S60 A;  3TFY A;  1CPS A;  3EC4 A;  4TWE A;  1VHO A;  2BSW A;  4MJ8 A;  4OC0 A;  2GRE A;  3OWC A;  1B87 A;  2Q7S A;  3PBE A;  3VH9 A;  3CZX A;  2CF4 A;  3RNZ A;  1KUX A;  1BAV A;  2YND A;  3D7D A;  4PXB A;  3S9M A;  3CPA A;  4MFJ A;  4AG7 A;  3FEE A;  2ZOF A;  4UIB A;  5AG4 A;  1Q2D A;  4PSW A;  3V7Z A;  4CAW A;  1Y0R A;  2JBJ A;  2FL4 A;  4KVX A;  4F9U A;  4KOT A;  3FNC A;  3FRM A;  4QUS A;  4B11 A;  4B5O A;  2IQ6 A;  3KAS A;  4TNU A;  4C2Z A;  3FMC A;  5G22 A;  2FXF A;  2BO9 A;  2NYQ A;  2PJ6 A;  1BPM A;  4X8I A;  4PV6 A;  4FD4 A;  4IK2 A;  4NSQ A;  4NGT A;  5LRG A;  4MRI A;  4ORF A;  2P6G A;  4QC6 A;  4UFX A;  4MHN A;  2OB0 A;  3FF3 A;  2X7B A;  5FVJ A;  2DPT A;  2WZN A;  2ZXV A;  5DWM A;  1DTD A;  1FT7 A;  2XEG A;  4K3N A;  2B4D B;  4OC1 A;  4NF1 A;  5KTC A;  1H8L A;  4CGL A;  2JLM A;  4UCM A;  2G0B A;  3BI0 A;  4KOY A;  1WWZ A;  4A30 A;  4IUS A;  4KSI A;  2VEZ A;  4KLW A;  2WYR A;  2VZZ A;  1IOI A;  1ZG7 A;  2F7V A;  4CYO A;  3QAY A;  4CPA A;  3RZA A;  3K9U A;  2V8H A;  2PJ0 A;  2VZY A;  4Q36 A;  4WJB A;  3S9L A;  1MK4 A;  1XIX A;  3I1U A;  4NGR A;  4NGM A;  2GIV A;  3IWE A;  4FD6 A;  4KOX A;  4R87 A;  5IB9 A;  2V8G A;  1I21 A;  4PSX A;  2B3V A;  2P6F A;  1ZLI A;  1CG2 A;  1IB1 E;  3TC8 A;  1L0C A;  2GLF A;  3D3S A;  3LAC A;  4B5P A;  1AMP A;  3WC6 A;  3HLP A;  4CRY B;  1PUA A;  1VIX A;  2EVN A;  2VL1 A;  2WUU A;  4OP4 A;  4FAI A;  5LRK A;  5AG6 A;  3FBU A;  2V8V A;  4R9M A;  4A31 A;  2ZEP A;  5ISV A;  1F2P A;  1RO5 A;  2ZW4 A;  3W91 A;  2Z3K A;  2REF A;  1IIC A;  2IMO A;  2QML A;  4CYN A;  4UWJ A;  3R96 A;  4AB7 A;  5E96 A;  3SXO A;  1FNO A;  3D7H A;  4ZGY B;  5A27 A;  4P6Y A;  4CAX A;  4JD6 A;  4KZT A;  4MHP A;  2GLJ A;  2BOA A;  4OIW A;  1TF9 A;  1TXR A;  4JXQ A;  3K2K A;  3D67 A;  2G9D A;  1LOK A;  1MJA A;  1YLE A;  4KSF A;  4NCZ A;  5DS0 A;  3S6H A;  4B6Z A;  5JH9 A;  1I12 A;  3P2H A;  1LRZ A;  5G21 A;  1IYK A;  2YNC A;  4GXH A;  1Y7E A;  2R7H A;  2ZEM A;  1R57 A;  3ISZ A;  4OID A;  3SI2 A;  2PJ4 A;  4H6Z A;  1K4J A;  5CNP A;  3KL9 A;  4A94 A;  3B3S A;  4H2K A;  2EBJ A;  3MGD A;  4CS0 B;  4PXE A;  1XE4 A;  4JWP A;  3W6S A;  2B4B A;  3FEC A;  1CP7 A;  4NFR A;  4MFQ A;  2AFS A;  2ZED A;  3LMS A;  4CGP A;  2YNE A;  4AVB A;  5H84 A;  4DUK A;  4I49 A;  2PVW A;  4P4E A;  1XRY A;  5C82 A;  2O4H A;  5AG5 A;  2PE3 A;  2Q51 A;  1YVK A;  3TO7 A;  5F47 A;  4UEE A;  4JZ0 A;  4BMH A;  1R43 A;  3IWG A;  3B2Y A;  7CPA A;  1S7L A;  2J8R A;  3EFA A;  3CXS A;  3SJG A;  2NSM A;  1Z8L A;  5J1Q A;  3DLJ A;  1PU9 A;  4XPK A;  1Z9U A;  3DDD A;  2Z3M A;  4LQG A;  2Q4Y A;  3D2P A;  5KTD A;  4P45 A;  1I1D A;  4B14 A;  4C7I A;  3PP9 A;  1KUV A;  4KOS A;  4CGM A;  4DNC A;  4HNY B;  2ZEL A;  3H8E A;  1BLL E;  1CX8 A;  2FCK A;  4U9Y A;  5IB0 A;  5C88 A;  5LYL A;  1ZG9 A;  4MFP A;  4MCP A;  4ZY2 A;  3H4Q A;  3VWE A;  2DEA A;  2JEV A;  2P6E A;  4MHD A;  4P4D A;  2PJ2 A;  3CXP A;  4GM5 A;  3IFE A;  2IJZ A;  4JXR A;  2OZH A;  1MJ9 A;  2CIJ A;  3FVL A;  1IU8 A;  1ZLH A;  2JEW A;  3SI0 A;  1P4N A;  3H5Z A;  1M1D A;  1QQ9 A;  4ZX8 A;  2XEJ A;  4R57 A;  4YFJ A;  2B5G B;  3B3V A;  3RO0 A;  2Y0M A;  4QBJ A;  2H5M A;  4X2T A;  3R95 A;  1YW6 A;  3VAR A;  2Z3O A;  2B4D A;  3GYA A;  1RXT A;  5JPH A;  4NJR A;  2J8N A;  4EVY A;  4UEZ A;  1AYE A;  3GY9 A;  2QEC A;  5KTA A;  2Q7B A;  1Z4E A;  3TOB A;  2PC1 A;  1S7N A;  2CNT A;  2CTB A;  4X3R A;  4W9Y A;  2HC9 A;  3T9Y A;  5HVG A;  5I4M A;  5THW A;  2ODF A;  2PSW A;  3PB7 X;  1LFW A;  4YGO A;  1NSL A;  2AFZ A;  5AGE A;  2ZEO A;  3FXT A;  3MN8 A;  1XMT A;  3N5F A;  4JLY A;  4E0A A;  2FE7 A;  3B3W A;  3FH4 A;  4KLV A;  2OZU A;  1QSR A;  2C6P A;  1TIQ A;  2Z3P A;  2XEI A;  4CGN A;  5G20 A;  1Q2C A;  3DR6 A;  3MRU A;  3UY5 A;  1M4L A;  1XOV A;  4RI1 A;  3HUV A;  3R9G A;  2GU2 A;  2OR4 A;  2GFQ A;  2Z0Z A;  3FJU A;  4KS9 A;  4PPZ A;  2OU2 A;  1TKF A;  3DGV A;  1Y0Y A;  2PJ8 A;  1AUG A;  3GLJ A;  1BPN A;  3NA6 A;  2AFO A;  3E0K A;  3ISX A;  4EME A;  3KR5 A;  5K8M A;  1QSN A;  4MHZ A;  1Y7R A;  4MY0 A;  2PJ7 A;  1M4I A;  2R1I A;  3CPX A;  1Z8W A;  1IOF A;  2WSA A;  2WPX A;  4LX9 A;  1XEB A;  1YQE A;  5K8P A;  4MCS A;  1ON0 A;  4R7M A;  1JWQ A;  1WK4 A;  5D8N A;  4ZY1 A;  4OC3 A;  4MXU A;  1P0H A;  2VBQ A;  2QIR A;  3RYO A;  4HNX B;  5G1Z A;  4II9 A;  1ELL P;  4XPL A;  3VWD A;  4J3G A;  1Z5R A;  2NMT A;  4C2X A;  2ATR A;  3B7I A;  2HB6 A;  4YU9 A;  1GYT A;  3JVN A;  2YGW A;  2XEF A;  3BLN A;  4M85 A;  1XF8 A;  2PQ8 A;  5HXD A;  2I79 A;  3F5B A;  1V0C A;  3LD2 A;  1J4J A;  1X12 A;  3PZJ A;  4MHY A;  3GIU A;  4LUA A;  3IGR A;  5EC4 A;  4NJQ A;  4PXC A;  3TO9 A;  3DR8 A;  1QSO A;  3BXM A;  3KHZ A;  1CJW A;  3KKW A;  2ABZ A;  3RBU A;  4K30 A;  3PRT A;  5A28 A;  3R9E A;  4AVA A;  4H89 A;  4PK3 A;  4BD9 A;  4U9Z A;  2C6C A;  2AFM A;  2ZEF A;  3KZW A;  1LAN A;  1OBR A;  4OKO A;  4PK2 A;  2FVG A;  3FIX A;  4KUA A;  3B3C A;  4F0Y A;  5LYF A;  4MFK A;  2K5T A;  4UCN A;  3GUX A;  4U5Y A;  3NH8 A;  4ZX9 A;  5K8N A;  1XMB A;  2BL1 A;  2FS5 A;  1YLO A;  2HQY A;  2VI7 A;  4UA3 A;  4UIA A;  1CM0 A;  4UWI A;  4P4F A;  2F5I A;  5AG7 A;  2OH1 A;  5HVH A;  2Q04 A;  3PB4 X;  1U6M A;  3SJX A;  2VXK A;  2C6G A;  4F6A A;  4E8O A;  2J8M A;  4ZYQ A;  3F0A A;  2CNS A;  2RC4 A;  1QMU A;  1YSJ A;  3G8W A;  1QST A;  2D4O A;  4Z65 A;  4PQA A;  3SHP A;  4UFV A;  2ZW7 A;  4O23 A;  1XFO A;  1FY7 A;  5D29 A;  4IF5 A;  2B58 A;  3FX6 A;  5J8C A;  4H6U A;  4QVT A;  2PJ1 A;  3JRU A;  4BIN A;  2I3C A;  2EWB A;  4KOV A;  3WAB A;  2OOT A;  2C27 A;  4L89 A;  4A95 A;  1VGY A;  2PJA A;  4NGP A;  3H8F A;  2PJ9 A;  3R1K A;  1MJB A;  3CT9 A;  1VHS A;  3IO1 A;  5EMI A;  4OAE A;  3H8G A;  2AJ6 A;  4MBU A;  1BO4 A;  2PRB A;  3LWU A;  1CBX A;  1N71 A;  3SJE A;  4MCR A;  2B5G A;  2Q4Z A;  2ZEH A;  1KUY A;  5EBV A;  2EK8 A;  2O28 A;  3D7G A;  3V8I A;  3K9T A;  5LYI A;  4ZY0 A;  3JTK A;  2Z3N A;  3KR4 A;  1Z4R A;  2IL4 A;  4ONU A;  5CPA A;  2P0W A;  3BI1 A;  5F46 A;  5JM6 A;  5K8O A;  4UF4 A;  3FED A;  4M6I A;  4DYO A;  3ZZI A;  2AFU A;  3S6F A;  3D8P A;  4NEX A;  3IU2 A;  4X5K A;  4P44 A;  5GCN A;  4KSA A;  5LYD A;  2C1C A;  2Q0Y A;  4PXD A;  4WWV A;  2F8H A;  1S7K A;  3IU1 A;  1EE3 P;  4M3S A;  1F2O A;  2JBK A;  1IYL A;  2PJC A;  3D4U A;  4OLL A;  2ZEE A;  3KQX A;  3SI1 A;  3VAT A;  2J9A A;  2FIW A;  3EXN A;  4A39 A;  2JDD A;  1M44 A;  4P10 A;  1A2Z A;  2BUE A;  1TF8 A;  2QVP A;  3KQZ A;  3TX8 A;  2VQY A;  4AXV A;  4OME A;  3WT4 A;  4P4B A;  4IHM A;  3FB3 A;  3TTH A;  2PCU A;  3B35 A;  1KWM A;  2V77 A;  2CTC A;  4LQ6 A;  2R8V A;  2Q43 A;  3IWW A;  3S9N A;  1YVO A;  1DE4 C;  1YRE A;  3KI9 A;  4RN7 A;  1KZF A;  1NE9 A;  2EUI A;  3LOD A;  4AG9 A;  1TKJ A;  3CXQ A;  1LCP A;  3QAH A;  4P4J A;  4FD7 A;  2PJB A;  4B10 A;  2G3T A;  2PR8 A;  2Z10 A;  4GS4 A;  5BWA B;  2FT0 A;  2D4P A;  4UCP A;  2PR1 A;  3IC1 A;  2RB7 A;  1PCA A;  4UBR A;  8CPA A;  2PVV A;  1BOB A;  4HNW B; 
#chains in the Genus database with same CATH homology
 4CGO A;  4KUB A;  4NXY A;  4A2Z A;  4CAE A;  1IID A;  4YRH A;  5H86 A;  4KVO E;  4HKF A;  3G3S A;  4FD5 A;  4C7H A;  2WPW A;  2A4N A;  5HH1 A;  1YGH A;  3TT2 A;  4MFZ A;  3SXN A;  4MI4 A;  4Y49 B;  1QSM A;  2REE A;  2Z11 A;  4KOW A;  4Y49 C;  3EY5 A;  3EO4 A;  2HUZ A;  3D2M A;  4QB9 A;  4A32 A;  1OZP A;  2Z3L A;  4KOR A;  4KVM E;  4CYP A;  4UFW A;  3TE4 A;  4CAF A;  4MY3 A;  1S5K A;  1Y9W A;  4OAD A;  4XPD B;  4CAV A;  4R3L A;  4C2Y A;  5HMN A;  2OZG A;  4XPD C;  3TO6 A;  1VKC A;  4KOU A;  3S6K A;  2ARH A;  3S6G A;  4B13 A;  3DNS A;  1GHE A;  3FYN A;  2AE6 A;  4B5P B;  1ZO0 A;  5F49 A;  3GKR A;  4XNH B;  3C26 A;  3QB8 A;  2Q44 A;  4E2A A;  2ZW6 A;  3A9L A;  2ZPA A;  4ZBG A;  2GE3 A;  3B8G A;  4XNH C;  1S3Z A;  1YR0 A;  1M4G A;  4C68 A;  1YK3 A;  2Q4V A;  5DWN A;  1NMT A;  4A33 A;  4F0X A;  4Q38 A;  2R98 A;  1UFH A;  3JUW A;  3TOA A;  2CNM A;  4CRZ B;  3DSB A;  3I3G A;  2G3A A;  4RS2 A;  2JDC A;  3F8K A;  3TCV A;  2I00 A;  5IX3 A;  2HV2 A;  5IV0 A;  1BOB A;  3P2F A;  2PDO A;  3I9S A;  2YNC C;  4R3K A;  2ZW5 A;  3BJ8 A;  4L8A A;  5J8F A;  1S7F A;  2BEI A;  2DPS A;  2B3U A;  4CYQ A;  2CXA A;  1B6B A;  1Q2Y A;  5JQ4 A;  3WR7 A;  4B12 A;  3N7Z A;  5I0C A;  3ZJ0 A;  1SQH A;  4CGL A;  1M4D A;  2GAN A;  5F48 A;  1YX0 A;  3PGP A;  3T90 A;  2KCW A;  3R9F A;  4JJX A;  3W6X A;  2FSR A;  2DXQ A;  2FIA A;  4MFL A;  2CY2 A;  3NE7 A;  3BJ7 A;  1Y9K A;  4BBH A;  1S60 A;  3TFY A;  3EC4 A;  2BSW A;  4MJ8 A;  3OWC A;  1B87 A;  1KUX A;  2YND A;  4MFJ A;  4AG7 A;  5AG4 A;  1Q2D A;  4PSW A;  4CAW A;  2FL4 A;  4KVX A;  4KOT A;  3FNC A;  3FRM A;  4QUS A;  4B11 A;  4B5O A;  4C2Z A;  5G22 A;  2FXF A;  4PV6 A;  4FD4 A;  4NSQ A;  4ORF A;  2P6G A;  4QC6 A;  4UFX A;  2OB0 A;  2X7B A;  5FVJ A;  2DPT A;  2ZXV A;  3RYO A;  5DWM A;  4AVC A;  2B4D B;  5KTC A;  4NF1 A;  2JLM A;  4UCM A;  2G0B A;  4KOY A;  1WWZ A;  4A30 A;  4IUS A;  2VEZ A;  4KLW A;  2VZZ A;  4CYO A;  3K9U A;  2VZY A;  4Q36 A;  1MK4 A;  1XIX A;  2GIV A;  3IWE A;  4FD6 A;  4KOX A;  4R87 A;  1I21 A;  4PSX A;  2B3V A;  2P6F A;  1IB1 E;  1L0C A;  3D3S A;  4B5P A;  4CRY B;  1PUA A;  2EVN A;  2WUU A;  5AG6 A;  3FBU A;  4R9M A;  4A31 A;  5ISV A;  1RO5 A;  2ZW4 A;  3W91 A;  2Z3K A;  2REF A;  1IIC A;  2QML A;  4CYN A;  4UWJ A;  3R96 A;  4AB7 A;  5E96 A;  3SXO A;  4ZGY B;  5A27 A;  4CAX A;  4JD6 A;  4KZT A;  4JXQ A;  4KSF A;  1YLE A;  1MJA A;  4NCZ A;  3S6H A;  1I12 A;  3P2H A;  1LRZ A;  5G21 A;  1IYK A;  2YNC A;  2R7H A;  1R57 A;  4H6Z A;  1K4J A;  5CNP A;  3MGD A;  4CS0 B;  1XE4 A;  4JWP A;  3W6S A;  2B4B A;  4MFQ A;  4CGP A;  2YNE A;  4AVB A;  5H84 A;  4I49 A;  5C82 A;  5AG5 A;  3TO7 A;  1YVK A;  5F47 A;  4BMH A;  3IWG A;  1S7L A;  2J8R A;  3EFA A;  3CXS A;  1PU9 A;  4XPK A;  1Z9U A;  3DDD A;  2Z3M A;  5KTD A;  2Q4Y A;  3D2P A;  1I1D A;  4B14 A;  4C7I A;  3PP9 A;  1KUV A;  4KOS A;  4CGM A;  4DNC A;  4HNY B;  2FCK A;  4U9Y A;  5IB0 A;  5C88 A;  4MFP A;  3H4Q A;  3VWE A;  2JEV A;  2P6E A;  4MHD A;  3CXP A;  4JXR A;  2OZH A;  1MJ9 A;  1P4N A;  3H5Z A;  1M1D A;  4R57 A;  4YFJ A;  2B5G B;  2Y0M A;  4QBJ A;  2H5M A;  3R95 A;  2Z3O A;  2B4D A;  3GYA A;  1RXT A;  5JPH A;  2J8N A;  4EVY A;  3GY9 A;  2QEC A;  5KTA A;  2Q7B A;  1Z4E A;  3TOB A;  2PC1 A;  1S7N A;  2CNT A;  3T9Y A;  2PSW A;  1NSL A;  4YGO A;  5AGE A;  3FXT A;  4JLY A;  1XMT A;  4E0A A;  2FE7 A;  4KLV A;  2OZU A;  1QSR A;  2Z3P A;  1TIQ A;  4CGN A;  5G20 A;  1Q2C A;  3DR6 A;  3UY5 A;  4RI1 A;  3R9G A;  2Z0Z A;  4KS9 A;  2OU2 A;  3E0K A;  1QSN A;  1Y7R A;  4MY0 A;  1M4I A;  2R1I A;  4LX9 A;  2WSA A;  2WPX A;  1XEB A;  1ON0 A;  1WK4 A;  1P0H A;  2VBQ A;  2QIR A;  4HNX B;  5G1Z A;  4II9 A;  3VWD A;  4XPL A;  4J3G A;  2NMT A;  4C2X A;  2ATR A;  3JVN A;  2YGW A;  3BLN A;  4M85 A;  1XF8 A;  2PQ8 A;  2I79 A;  3F5B A;  1V0C A;  3LD2 A;  1J4J A;  3PZJ A;  4LUA A;  3IGR A;  5EC4 A;  3TO9 A;  3DR8 A;  1QSO A;  1CJW A;  4K30 A;  5A28 A;  3R9E A;  4AVA A;  4H89 A;  4PK3 A;  4U9Z A;  4PK2 A;  3FIX A;  4KUA A;  4F0Y A;  4MFK A;  2K5T A;  4UCN A;  4U5Y A;  2BL1 A;  2FS5 A;  2HQY A;  2VI7 A;  4UA3 A;  1CM0 A;  4UWI A;  2F5I A;  5AG7 A;  2OH1 A;  2Q04 A;  1U6M A;  2VXK A;  4F6A A;  4E8O A;  2J8M A;  3F0A A;  2CNS A;  2RC4 A;  3G8W A;  1QST A;  2D4O A;  3SHP A;  4UFV A;  2ZW7 A;  1FY7 A;  4IF5 A;  2B58 A;  5J8C A;  4H6U A;  4QVT A;  4KOV A;  4A95 A;  2C27 A;  4L89 A;  3R1K A;  1MJB A;  1VHS A;  4OAE A;  2AJ6 A;  4MBU A;  1BO4 A;  2PRB A;  1N71 A;  2B5G A;  5EBV A;  1KUY A;  2O28 A;  3V8I A;  3JTK A;  2Z3N A;  1Z4R A;  2IL4 A;  4ONU A;  2P0W A;  5F46 A;  3ZZI A;  3S6F A;  3D8P A;  4NEX A;  3IU2 A;  4X5K A;  5GCN A;  4KSA A;  2Q0Y A;  3IU1 A;  1S7K A;  4M3S A;  4OLL A;  1IYL A;  2FIW A;  3EXN A;  2JDD A;  1M44 A;  2BUE A;  2VQY A;  3FB3 A;  3TTH A;  2R8V A;  1YVO A;  1YRE A;  1KZF A;  1NE9 A;  2EUI A;  3LOD A;  4AG9 A;  3CXQ A;  3QAH A;  4FD7 A;  4B10 A;  2G3T A;  2PR8 A;  2Z10 A;  4GS4 A;  5BWA B;  2FT0 A;  2D4P A;  4UCP A;  2PR1 A;  4UBR A;  3KKW A;  4HNW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...