3F5BA

The crystal structure of aminoglycoside n(6')acetyltransferase from legionella pneumophila subsp. pneumophila str. philadelphia 1.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
172
Chain Sequence
NAMMEFRFCFKQMNKSQHELVLGWIHQPHINEWLHGDGLSNTIKDLHEFLNDGKPWATHWIAYDNEIPFAYLITSEIEKSEEYPDGAVTLDLFICRLDYIGKGLSVQMIHEFILSQFSDTKIVLINPEISNERAVHVYKKAGFEIIGEFIASWHPVPHYKMKLCIEDLKKQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside N(6')acetyltransferase
publication title The crystal structure of aminoglycoside N(6')acetyltransferase from Legionella pneumophila subsp. pneumophila str. Philadelphia 1.
rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Transferase
total genus 47
structure length 172
sequence length 178
ec nomenclature
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3f5bA00
4KUBA 4UA3A 2O28A 3FXTA 2HQYA 5KTCA 3C26A 3TCVA 4EVYA 4RS2A 4JXQA 2VI7A 3R96A 1MJAA 4YFJA 2ZXVA 3SXOA 2Q7BA 4MHDA 4CRZB 2FSRA 1BO4A 3R1KA 4PV6A 4Y49B 2VZYA 2PC1A 1L0CA 1QSMA 4MJ8A 2OZHA 2FS5A 4FD5A 2Q0YA 2CY2A 3K9UA 3KKWA 2ATRA 1KUYA 4E2AA 1S5KA 5DWNA 1CM0A 4QVTA 1B6BA 4AVCA 5ISVA 1BOBA 3FNCA 3ZZIA 4NEXA 1IYKA 5GCNA 2DXQA 3JUWA 2B3VA 3TO9A 2EUIA 1M1DA 4B5OA 4K30A 3IGRA 1OZPA 3OWCA 3DNSA 4UWJA 1NMTA 2B4BA 3T90A 1VKCA 3PGPA 2ZW6A 1J4JA 5KTAA 3FB3A 2JDDA 4ORFA 3G3SA 4AG7A 3TFYA 3D2PA 2RC4A 1Y9KA 4R87A 3TOBA 3GYAA 2AJ6A 5F47A 5HMNA 4KUAA 2Q4YA 3EC4A 1IYLA 2HV2A 2R98A 1V0CA 1GHEA 3DDDA 3TTHA 2B4DB 1CJWA 3T9YA 4ONUA 4NCZA 4KVME 4CAWA 5IB0A 4R9MA 1YVKA 4E0AA 3MGDA 3UY5A 2ARHA 3QAHA 1KZFA 2JEVA 2GANA 4H89A 1IB1E 4NXYA 4KLVA 4UWIA 1QSOA 4H6UA 3LODA 2GE3A 3F5BA 2CNMA 4QC6A 2VZZA 2ZW5A 2R1IA 1P4NA 1YGHA 2B4DA 4H6ZA 2HUZA 4B5PA 2REFA 1Y9WA 2J8MA 3JVNA 4HNYB 1KUXA 2R7HA 2FE7A 2JDCA 4FD7A 5HH1A 2NMTA 4XPDB 4U9YA 3SHPA 3BJ7A 1Q2CA 4PSXA 4LX9A 2FCKA 1M4GA 1Q2DA 3ZJ0A 3TOAA 4F6AA 3TO7A 3E0KA 4U5YA 4I49A 5J8FA 2F5IA 3H4QA 2Q4VA 4KOVA 1XE4A 4KOUA 2Z10A 3S6GA 4JLYA 4QBJA 4GS4A 3R9FA 4AG9A 5JPHA 3FYNA 2OH1A 3EY5A 1QSTA 4YGOA 2B5GB 3CXSA 3EFAA 4M85A 1M4IA 3FIXA 3R9GA 1SQHA 1S7LA 1WWZA 3G8WA 3BJ8A 2PR8A 3TO6A 2Z11A 4CS0B 3S6HA 1Q2YA 4XPLA 2VQYA 4QUSA 5J8CA 2OZGA 2ZPAA 1UFHA 2C27A 2G3TA 1WK4A 4HNXB 2BSWA 1LRZA 1I12A 4XPKA 4OAEA 3I3GA 4XNHC 4CAVA 3CXQA 1YR0A 4KOXA 2B5GA 1RXTA 2AE6A 3P2HA 3PP9A 4KOTA 2Z0ZA 2B58A 4LUAA 4CAXA 1IIDA 2OB0A 4KORA 3RYOA 1XF8A 5CNPA 3IWGA 3S6KA 4JWPA 4Y49C 2IL4A 2G0BA 4OADA 4MI4A 2CNTA 1RO5A 4AVAA 2I79A 1Y7RA 3PZJA 5H84A 2OU2A 4HNWB 4PSWA 1P0HA 1XEBA 5EC4A 5DWMA 2P0WA 3D3SA 5JQ4A 1YLEA 2FIAA 3DR6A 3GY9A 2WPXA 4PK2A 2FIWA 2B3UA 1XMTA 1S60A 1K4JA 2BUEA 3FRMA 3B8GA 3W6SA 3F8KA 3WR7A 2BEIA 1S7KA 3R95A 2CNSA 2A4NA 4M3SA 1NE9A 4F0YA 2I00A 2PR1A 3LD2A 4MY3A 4JJXA 5H86A 1S7FA 1R57A 2ZW4A 2Y0MA 3D8PA 4AVBA 3DSBA 2BL1A 5C88A 4KOWA 5F49A 2QIRA 3DR8A 1Z9UA 2J8NA 4KZTA 4OLLA 2PSWA 1Z4EA 2J8RA 4NSQA 3CXPA 1U6MA 2D4OA 4BMHA 2K5TA 5IX3A 1VHSA 1PU9A 4DNCA 5KTDA 3TT2A 4MBUA 3QB8A 1MK4A 3V8IA 2FL4A 4PK3A 5C82A 3N7ZA 2ZW7A 4IF5A 1MJBA 1IICA 1I21A 2VXKA 2REEA 1YREA 2WPWA 3VWEA 2D4PA 2Q44A 3FBUA 3W6XA 5F48A 1MJ9A 3EXNA 3D2MA 2EVNA 3S6FA 1PUAA 4XPDC 3GKRA 2P6FA 2PQ8A 5F46A 2OZUA 1N71A 3I9SA 1QSRA 4ZBGA 4AB7A 4JD6A 2X7BA 2FXFA 3TE4A 4II9A 4U9ZA 1I1DA 2H5MA 4FD6A 4KLWA 4KVXA 4MY0A 4QB9A 1ON0A 2KCWA 4L8AA 4UBRA 1M44A 3VWDA 2P6GA 1YVOA 4JXRA 3SXNA 4IUSA 3R9EA 1TIQA 1M4DA 2R8VA 2P6EA 3EO4A 1Z4RA 2Q04A 3W91A 1FY7A 1S7NA 4B5PB 2JLMA 5E96A 3BLNA 1NSLA 4KOYA 2FT0A 4KVOE 5EBVA 4CRYB 2QMLA 3F0AA 4J3GA 1KUVA 2QECA 4NF1A 2PDOA 4R3LA 4FD4A 1B87A 1YK3A 5IV0A 1XIXA 2PRBA 1YX0A 4HKFA 4R57A 2VBQA 3P2FA 4RI1A 2G3AA 5I0CA 4L89A 4E8OA 4YRHA 1S3ZA 4R3KA 4KOSA 5FVJA 2GIVA 3NE7A 1QSNA 4X5KA 2VEZA 4XNHB
chains in the Genus database with same CATH superfamily
4FWUA 1PCAA 4WJBA 1DTDA 4KUBA 4UA3A 2O28A 4ZI6A 3D7HA 3FXTA 3K9TA 4B6ZA 2HQYA 3IU2A 4UFVA 4C2XA 5KTCA 3B3TA 5G21A 2VL1A 3C26A 3TCVA 4EVYA 1TXRA 3H8GA 4RS2A 4JXQA 2VI7A 3R96A 1MJAA 2C6PA 4YFJA 4ZYQA 2ZXVA 3SXOA 2Q7BA 4MHDA 2GLJA 4GXHA 2YGWA 3WABA 4CRZB 4A37A 2FSRA 5LRJA 1YW4A 2PJ2A 1BO4A 1Z8XA 3R1KA 4PV6A 2ZENA 1XOVA 4Y49B 1LOKA 2VZYA 2PC1A 2RB7A 1L0CA 2V8DA 3D4UA 1QSMA 4MJ8A 4MFKA 2OZHA 2FS5A 4FD5A 5EMIA 2PJ5A 2Q0YA 4JYWA 4UEZA 1CBXA 2CY2A 3KHZA 3BHXA 2ZEOA 1XRYA 3K9UA 3KKWA 2ATRA 1KUYA 4EWTA 3S9LA 4E2AA 1S5KA 5DWNA 2PIYA 1CM0A 4QVTA 2DF5A 2IJZA 2PJCA 1B6BA 2YNCC 3KHXA 3V38A 4AVCA 4DYOA 1BOBA 5ISVA 3FNCA 2CIJA 3SI2A 3ZZIA 4M6IA 4NEXA 3FF3A 3I1UA 2NYQA 4UF4A 4BBHA 1IYKA 4EFDA 4P6YA 1Y7EA 2DXQA 5GCNA 1TF8A 3JUWA 2B3VA 4OC0A 2EUIA 1M1DA 2QJ8A 3TO9A 4B5OA 1TF9A 4K30A 4C2ZA 2EK9A 3IGRA 1OZPA 3OWCA 4ONWA 5K8PA 1FNOA 3SI1A 3DNSA 4UWJA 1NMTA 1R3NA 2B4BA 3T90A 3LACA 1VKCA 2QYVA 3FVLA 5F09A 3PGPA 3PFEA 4MHZA 2ZW6A 3GLJA 2QVPA 2Q43A 3WT4A 4ZY1A 2WYRA 2XEFA 1J4JA 2PJBA 5KTAA 2Z3KA 4YU9A 3FB3A 1DE4C 4Q36A 1XFOA 1X12A 2JDDA 5AGEA 1ELMP 4ORFA 4X2TA 5AG5A 3FJUA 4FUUA 4A95A 3G3SA 4PPZA 4MFLA 3BI0A 3D2PA 2RC4A 2FVGA 4AG7A 4ZY0A 4IAVA 3TFYA 4OIDA 2G9DA 2PE3A 1Y9KA 4NGSA 4NGPA 4R87A 5A27A 4B12A 1EE3P 3TOBA 3GYAA 2AJ6A 5F47A 4OC4A 4DUKA 5HMNA 1HDQA 4KUAA 2Q4ZA 2Q4YA 3KASA 3EC4A 1IYLA 3DGVA 4CPAA 5K8OA 2HV2A 2R98A 1V0CA 3HLPA 1GHEA 4P4BA 3DDDA 3TTHA 4CGOA 2B4DB 1CJWA 1ZG9A 2CXAA 4PXBA 4W9YA 3D7GA 3T9YA 5J1QA 2EBJA 3PRTA 3TX8A 1IY7A 3FH4A 3WC7A 4ONUA 2WZNA 3JRUA 4NCZA 2CTCA 1CP7A 4KVME 4UFXA 4CAWA 4P10A 3PEIA 5JH9A 5HXDA 5IB0A 4R9MA 1YVKA 4E0AA 3MGDA 3UY5A 5G20A 2J9AA 4B11A 2ARHA 3QAHA 1KZFA 2AFWA 1UWYA 2JEVA 4A38A 2GANA 4H89A 2ZEHA 1IB1E 4KSAA 4NXYA 4KLVA 4UWIA 1QSOA 4C7HA 4H6UA 4UEEA 2PJ4A 3LODA 1CG2A 1TKJA 2DPTA 2GE3A 2PIZA 2Z3MA 3L2NA 3F5BA 2CNMA 4QC6A 3NFZA 4NGTA 3SJXA 2VZZA 2ZW5A 4P45A 4R6TA 4UCMA 1ARLA 2R1IA 1QQ9A 1P4NA 1YGHA 2B4DA 3CPAA 3MN8A 5A28A 4H6ZA 2HUZA 2WUUA 4PXCA 4Q7AA 4B5PA 5THWA 2REFA 4X8IA 4MCQA 1Y9WA 2J8MA 2O4HA 3JVNA 4HNYB 4LQ6A 1KUXA 5LRGA 5AG7A 7CPAA 2R7HA 2FE7A 2JDCA 3CDXA 4FD7A 5HH1A 2PJ8A 2NMTA 4MCRA 4U9YA 4XPDB 4Z65A 1ZO0A 2Z3OA 3KL9A 4UIAA 2PJ3A 3IC1A 5D8NA 3SHPA 4DJLA 2ABZA 3BJ7A 1Q2CA 4OC3A 4G1PA 4LX9A 4PSXA 5BWAB 2FCKA 1M4GA 3GIUA 1F57A 2PJ1A 5LYDA 1Q2DA 4F8ZA 4OMEA 3TOAA 3ZJ0A 3TO7A 4F6AA 4F9VA 1VHEA 5HVGA 1AUGA 3E0KA 4A94A 4U5YA 3NA6A 1LANA 1BLLE 3PBBA 4I49A 2F5IA 3H4QA 5J8FA 2CTBA 2Q4VA 4KOVA 1XE4A 4KOUA 1Y0YA 2Z10A 1Z2LA 3ISZA 3S6GA 1YW6A 4C68A 4JLYA 4QBJA 4GS4A 3R9FA 4AG9A 2C6GA 2GREA 5JPHA 3FYNA 1VHOA 2OH1A 1A2ZA 2DPSA 3EY5A 1QSTA 2C6CA 4MCSA 4YGOA 1CP6A 3B3CA 3N5FA 1TKHA 4FBEA 2B5GB 3CXSA 5IB9A 3D7FA 2AFMA 1M4IA 3EFAA 3FIXA 2OR4A 4M85A 5JGFA 2BOAA 3R9GA 4F9UA 2VEZA 1SQHA 1S7LA 4Q38A 4A32A 1WWZA 3G8WA 3BJ8A 2PR8A 4OC5A 1YQEA 3TO6A 3FEEA 2Z11A 2ZEEA 2ZOGA 3PB8X 4UIBA 1LAPA 4A33A 2POKA 4CS0B 4CAEA 3S6HA 1Q2YA 3H8EA 4XPLA 1BAVA 2VQYA 1AMPA 4QUSA 1ZLIA 2AFXA 5J8CA 2OZGA 2I3CA 2ZPAA 1UFHA 4P4FA 5HVHA 2JBJA 4ZX8A 2JBKA 2C27A 1LFWA 2G3TA 1M4LA 1WK4A 2YNDA 4HNXB 1Z8LA 2BSWA 3IWEA 1LRZA 1I12A 3B3VA 4XPKA 3IEHA 4IK2A 2PVVA 2V8VA 4MFPA 3I3GA 4OAEA 2PJ6A 4RN7A 4XNHC 2OOTA 3CXQA 4CAVA 3IO1A 1YR0A 4KOXA 5AG4A 3H5ZA 3SI0A 2B5GA 4WWVA 1RXTA 3FMCA 3NH8A 2AE6A 3P2HA 4CGNA 3PP9A 4KOTA 2Z0ZA 2B58A 4LUAA 3CZXA 4CAXA 2JEWA 1IIDA 2OB0A 4KORA 4MHYA 3NH4A 3RYOA 2ANPA 1XF8A 5CNPA 4CGPA 4M6GA 4KSFA 3VARA 1IGBA 3PB9X 4UFWA 3IWGA 3A9LA 1ZLHA 3DLJA 3S6KA 4JWPA 4F0XA 2XEJA 4Y49C 4NGNA 1HDUA 2IL4A 2G0BA 4OADA 4MI4A 2CNTA 2GLFA 1RO5A 3PBEA 2O53A 4H2KA 4AVAA 5AG6A 4C2YA 2I79A 1Y7RA 3PZJA 3D66A 4CYQA 2F8HA 3BXMA 4A2ZA 5H84A 2OU2A 4NJRA 4P4DA 3RO0A 4M6HA 1IOIA 3FEDA 4HNWB 4PSWA 1P0HA 4GM5A 1XEBA 1F2OA 5EC4A 3SJGA 2EO8A 5DWMA 2CF4A 5ELYA 2P0WA 5JM6A 3B3SA 3D3SA 2ODFA 4CYOA 4MCPA 5JQ4A 4CGMA 4R7MA 1YLEA 2FIAA 5K8MA 3RZAA 4EMEA 3DR6A 3GY9A 4NGRA 5G22A 2AFZA 2WPXA 4PK2A 2FIWA 2B3UA 3NH5A 4P4IA 3GB0A 1BPMA 1XMTA 3K2KA 4P4EA 1LCPA 1R43A 1S60A 1K4JA 2BUEA 2PJ9A 3FRMA 4MFQA 3B8GA 4NGQA 1Y0RA 3W6SA 2GU2A 3F8KA 3WR7A 2XEIA 1OBRA 2BEIA 4MFZA 1ZG8A 1S7KA 3R95A 1CX8A 2CNSA 2XEGA 4K3NA 4M3SA 1NE9A 3KQXA 4F0YA 2EWBA 2I00A 3V7ZA 2BO9A 2AFOA 1FT7A 2PR1A 4PXEA 4CGLA 4RUHA 5I4MA 3LD2A 2PJ7A 1GYTA 1LAMA 3S9MA 3FECA 5CBMA 4MY3A 1Z8WA 3GUXA 4JJXA 5H86A 5HVFA 1NSAA 1S7FA 1R57A 2ZW4A 2Y0MA 8CPAA 2HB6A 3D8PA 3PB4X 2PRQA 4BINA 3BI1A 4A30A 5K8NA 4ZGYB 4MXUA 4KSIA 4OIWA 3DSBA 3WC6A 4AVBA 4TWEA 2BL1A 2YNCA 4CAFA 2BCOA 3PB6X 5C88A 3QAYA 3RNZA 4KOWA 1VIXA 3PB7X 5F49A 2F7VA 2QIRA 4ZY2A 2Z3PA 2DEAA 3DR8A 1Z9UA 2J8NA 4KZTA 4OLLA 4P4JA 4R76A 2PSWA 3SJEA 1AYEA 1Z4EA 2J8RA 3B35A 4NSQA 3CXPA 1U6MA 2D4OA 4BMHA 3JTKA 1X10A 3B7IA 2K5TA 4YWYA 5IX3A 1VHSA 2HC9A 3ISXA 1HEEA 1PU9A 1ELLP 4PXDA 4DNCA 5KTDA 3MRUA 3TT2A 4MBUA 4CYNA 2AFUA 3QB8A 2PJAA 1MK4A 3RAMA 2IMOA 4C7IA 1YMEA 3V8IA 1XJOA 3IJ3A 4FAIA 2FL4A 1IU8A 4PK3A 2GFQA 2ZEMA 3N7ZA 4JZ0A 3D7DA 2ZW7A 3IFEA 4OC1A 5C82A 4IF5A 3S9NA 4NFRA 1MJBA 3LWUA 1IICA 1KWMA 1I21A 4MRIA 2VXKA 2REEA 1YREA 2PCUA 2WPWA 3VWEA 2D4PA 2Q44A 3FBUA 4UEFA 4AXVA 4CYPA 3W6XA 5F48A 1YLOA 1MJ9A 3KGQA 4R8FA 2IQ6A 3WC5A 3EXNA 3D2MA 2EVNA 2Q51A 3D68A 5DS0A 4A39A 3S6FA 1PUAA 1CPXA 3B2YA 3LMSA 4XPDC 3GKRA 2P6FA 2PQ8A 5F46A 2ZEPA 4OC2A 1BPNA 2WSAA 2OZUA 2RFHA 2V77A 1N71A 3I9SA 3D67A 6CPAA 4B10A 1QSRA 2ZEDA 4NGMA 4ZBGA 4AB7A 4PQAA 3QNVA 4JD6A 3HUVA 1RTQA 2X7BA 3H8FA 2ZELA 2FXFA 3KR4A 5G1ZA 3TE4A 4II9A 4U9ZA 1I1DA 2H5MA 2ZEGA 4FD6A 2V8GA 3CT9A 2PJ0A 4KLWA 4KVXA 4MY0A 4QB9A 1ON0A 2Z3LA 2Z3NA 2KCWA 4L8AA 4UBRA 2EK8A 1IOFA 4MHNA 1M44A 1Z5RA 3VWDA 2P6GA 4P44A 3CPXA 3KQZA 3RBUA 5LYFA 1YVOA 1JQGA 3IIBA 4KS9A 4JXRA 1CPSA 3SXNA 4IUSA 3R9EA 2PVWA 3T8WA 3VATA 1TIQA 1VGYA 1M4DA 2R8VA 5CPAA 5D29A 4ZX9A 4B13A 2AFSA 2P6EA 3EO4A 2ZEFA 4MHPA 1Z4RA 4UCNA 2Q04A 3KI9A 3B3WA 3W91A 1FY7A 4TNUA 1S7NA 4IHMA 4B5PB 1Z8TA 2JLMA 5E96A 3BLNA 4NJQA 1NSLA 4KOYA 1QMUA 2FT0A 4KVOE 1XMBA 1YSJA 3PFOA 4LQGA 3SJFA 5EBVA 1PYTB 4CRYB 2QMLA 2Q7SA 3F0AA 3IWWA 1KUVA 2ZOFA 1ZG7A 4J3GA 2NSMA 4A31A 2QECA 2V8HA 1H8LA 4NF1A 2YNEA 3KR5A 3VH9A 4BD9A 3NE8A 2PDOA 4UCPA 4R3LA 4FD4A 1Q7LA 5LYLA 1B87A 1YK3A 4HPSA 5IV0A 1XIXA 3TC8A 2PRBA 1YX0A 3KZWA 4HKFA 4R57A 4MMOA 1F2PA 5LYIA 2VBQA 3IU1A 1JWQA 4B14A 3P2FA 4RI1A 1TKFA 2G3AA 4X3RA 5I0CA 2C1CA 3FX6A 4MFJA 4L89A 4E8OA 4YRHA 1ARMA 1S3ZA 4R3KA 4KOSA 5FVJA 2GIVA 3NE7A 5LRKA 1XBUA 1QSNA 4OKOA 4OP4A 4O23A 4X5KA 2A4NA 4XNHB
chains in the Genus database with same CATH topology
4KUBA 4UA3A 2O28A 3FXTA 2HQYA 3IU2A 4UFVA 4C2XA 5KTCA 5G21A 3C26A 3TCVA 4EVYA 4RS2A 4JXQA 2VI7A 3R96A 1MJAA 4YFJA 2ZXVA 3SXOA 2Q7BA 4MHDA 2YGWA 4CRZB 2FSRA 1BO4A 3R1KA 4PV6A 4Y49B 2VZYA 2PC1A 1L0CA 1QSMA 4MJ8A 4MFKA 2OZHA 2FS5A 4FD5A 2Q0YA 2CY2A 3K9UA 3KKWA 2ATRA 1KUYA 4E2AA 1S5KA 5DWNA 1CM0A 4QVTA 2YNCC 1B6BA 4AVCA 5ISVA 1BOBA 3FNCA 3ZZIA 4NEXA 4BBHA 1IYKA 5GCNA 2DXQA 3JUWA 2B3VA 3TO9A 2EUIA 1M1DA 4B5OA 4K30A 4C2ZA 3IGRA 1OZPA 3OWCA 3DNSA 4UWJA 1NMTA 2B4BA 3T90A 1VKCA 3PGPA 2ZW6A 1J4JA 5KTAA 2Z3KA 3FB3A 4Q36A 2JDDA 5AGEA 4ORFA 5AG5A 4A95A 3G3SA 4AG7A 4MFLA 3TFYA 3D2PA 2RC4A 1Y9KA 5A27A 4R87A 4B12A 3TOBA 3GYAA 2AJ6A 5F47A 5HMNA 4KUAA 2Q4YA 3EC4A 1IYLA 2HV2A 2R98A 1V0CA 1GHEA 3DDDA 3TTHA 4CGOA 2B4DB 1CJWA 2CXAA 3T9YA 4ONUA 4NCZA 4KVME 4UFXA 4CAWA 5IB0A 4R9MA 1YVKA 4E0AA 3MGDA 3UY5A 5G20A 4B11A 2ARHA 3QAHA 1KZFA 2JEVA 2GANA 4H89A 1IB1E 4KSAA 4NXYA 4KLVA 4UWIA 1QSOA 4C7HA 4H6UA 3LODA 2DPTA 2GE3A 2Z3MA 3F5BA 2CNMA 4QC6A 2VZZA 2ZW5A 4UCMA 2R1IA 1P4NA 1YGHA 2B4DA 5A28A 4H6ZA 2HUZA 2WUUA 4B5PA 2REFA 1Y9WA 2J8MA 3JVNA 4HNYB 1KUXA 5AG7A 2R7HA 2FE7A 2JDCA 4FD7A 5HH1A 2NMTA 4XPDB 4U9YA 1ZO0A 2Z3OA 3SHPA 3BJ7A 5BWAB 1Q2CA 4PSXA 4LX9A 2FCKA 1M4GA 1Q2DA 3ZJ0A 3TOAA 4F6AA 3TO7A 3E0KA 4U5YA 4I49A 5J8FA 2F5IA 3H4QA 2Q4VA 4KOVA 1XE4A 4KOUA 2Z10A 3S6GA 4C68A 4JLYA 4QBJA 4GS4A 3R9FA 4AG9A 5JPHA 3FYNA 2DPSA 2OH1A 3EY5A 1QSTA 4YGOA 2B5GB 3CXSA 3EFAA 4M85A 1M4IA 3FIXA 3R9GA 1SQHA 1S7LA 4Q38A 4A32A 1WWZA 3G8WA 3BJ8A 2PR8A 3TO6A 2Z11A 4A33A 4CS0B 4CAEA 3S6HA 1Q2YA 4XPLA 2VQYA 4QUSA 5J8CA 2OZGA 2ZPAA 1UFHA 2C27A 2G3TA 2YNDA 1WK4A 4HNXB 2BSWA 3IWEA 1LRZA 1I12A 4XPKA 4OAEA 4MFPA 3I3GA 4XNHC 4CAVA 3CXQA 1YR0A 4KOXA 5AG4A 3H5ZA 2B5GA 1RXTA 2AE6A 3P2HA 4CGNA 3PP9A 4KOTA 2Z0ZA 2B58A 4LUAA 4CAXA 1IIDA 2OB0A 4KORA 3RYOA 1XF8A 5CNPA 4CGPA 4KSFA 4UFWA 3IWGA 3A9LA 3S6KA 4JWPA 4F0XA 4Y49C 2IL4A 2G0BA 4OADA 4MI4A 2CNTA 1RO5A 4AVAA 5AG6A 4C2YA 2I79A 1Y7RA 3PZJA 4CYQA 4A2ZA 5H84A 2OU2A 4HNWB 4PSWA 1P0HA 1XEBA 5EC4A 5DWMA 2P0WA 3D3SA 4CYOA 5JQ4A 4CGMA 1YLEA 2FIAA 3DR6A 3GY9A 5G22A 2WPXA 4PK2A 2FIWA 2B3UA 1XMTA 1S60A 1K4JA 2BUEA 3FRMA 4MFQA 3B8GA 3W6SA 3F8KA 3WR7A 2BEIA 4MFZA 1S7KA 3R95A 2CNSA 2A4NA 4M3SA 1NE9A 4F0YA 2I00A 4CGLA 2PR1A 3LD2A 4MY3A 4JJXA 5H86A 1S7FA 1R57A 2ZW4A 2Y0MA 3D8PA 4A30A 4ZGYB 4AVBA 3DSBA 2BL1A 2YNCA 4CAFA 5C88A 4KOWA 5F49A 2QIRA 2Z3PA 3DR8A 1Z9UA 2J8NA 4KZTA 4OLLA 2PSWA 1Z4EA 2J8RA 4NSQA 3CXPA 1U6MA 2D4OA 4BMHA 3JTKA 2K5TA 5IX3A 1VHSA 1PU9A 4DNCA 5KTDA 3TT2A 4MBUA 4CYNA 3QB8A 1MK4A 4C7IA 3V8IA 2FL4A 4PK3A 5C82A 3N7ZA 2ZW7A 4IF5A 1MJBA 1IICA 1I21A 2VXKA 2REEA 1YREA 2WPWA 3VWEA 2D4PA 2Q44A 3FBUA 4CYPA 3W6XA 5F48A 1MJ9A 3EXNA 3D2MA 2EVNA 3S6FA 1PUAA 4XPDC 3GKRA 2P6FA 2PQ8A 5F46A 2WSAA 2OZUA 1N71A 3I9SA 4B10A 1QSRA 4ZBGA 4AB7A 4JD6A 2X7BA 2FXFA 5G1ZA 3TE4A 4II9A 4U9ZA 1I1DA 2H5MA 4FD6A 4KLWA 4KVXA 4MY0A 4QB9A 1ON0A 2Z3LA 2Z3NA 2KCWA 4L8AA 4UBRA 1M44A 3VWDA 2P6GA 1YVOA 4KS9A 4JXRA 3SXNA 4IUSA 3R9EA 1TIQA 1M4DA 2R8VA 4B13A 2P6EA 3EO4A 1Z4RA 4UCNA 2Q04A 3W91A 1FY7A 1S7NA 4B5PB 2JLMA 5E96A 3BLNA 1NSLA 4KOYA 2FT0A 4KVOE 5EBVA 4CRYB 2QMLA 3F0AA 4J3GA 1KUVA 4A31A 2QECA 4NF1A 2YNEA 4UCPA 2PDOA 4R3LA 4FD4A 1B87A 1YK3A 5IV0A 1XIXA 2PRBA 1YX0A 4HKFA 4R57A 2VBQA 3IU1A 4B14A 3P2FA 4RI1A 2G3AA 5I0CA 4MFJA 4L89A 4E8OA 4YRHA 1S3ZA 4R3KA 4KOSA 5FVJA 2GIVA 3NE7A 1QSNA 4X5KA 2VEZA 4XNHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KUB A;  4UA3 A;  2O28 A;  3FXT A;  2HQY A;  5KTC A;  3C26 A;  3TCV A;  4EVY A;  4RS2 A;  4JXQ A;  2VI7 A;  3R96 A;  1MJA A;  4YFJ A;  2ZXV A;  3SXO A;  2Q7B A;  4MHD A;  4CRZ B;  2FSR A;  1BO4 A;  3R1K A;  4PV6 A;  4Y49 B;  2VZY A;  2PC1 A;  1L0C A;  1QSM A;  4MJ8 A;  2OZH A;  2FS5 A;  4FD5 A;  2Q0Y A;  2CY2 A;  3K9U A;  3KKW A;  2ATR A;  1KUY A;  4E2A A;  1S5K A;  5DWN A;  1CM0 A;  4QVT A;  1B6B A;  4AVC A;  5ISV A;  1BOB A;  3FNC A;  3ZZI A;  4NEX A;  1IYK A;  5GCN A;  2DXQ A;  3JUW A;  2B3V A;  3TO9 A;  2EUI A;  1M1D A;  4B5O A;  4K30 A;  3IGR A;  1OZP A;  3OWC A;  3DNS A;  4UWJ A;  1NMT A;  2B4B A;  3T90 A;  1VKC A;  3PGP A;  2ZW6 A;  1J4J A;  5KTA A;  3FB3 A;  2JDD A;  4ORF A;  3G3S A;  4AG7 A;  3TFY A;  3D2P A;  2RC4 A;  1Y9K A;  4R87 A;  3TOB A;  3GYA A;  2AJ6 A;  5F47 A;  5HMN A;  4KUA A;  2Q4Y A;  3EC4 A;  1IYL A;  2HV2 A;  2R98 A;  1V0C A;  1GHE A;  3DDD A;  3TTH A;  2B4D B;  1CJW A;  3T9Y A;  4ONU A;  4NCZ A;  4KVM E;  4CAW A;  5IB0 A;  4R9M A;  1YVK A;  4E0A A;  3MGD A;  3UY5 A;  2ARH A;  3QAH A;  1KZF A;  2JEV A;  2GAN A;  4H89 A;  1IB1 E;  4NXY A;  4KLV A;  4UWI A;  1QSO A;  4H6U A;  3LOD A;  2GE3 A;  3F5B A;  2CNM A;  4QC6 A;  2VZZ A;  2ZW5 A;  2R1I A;  1P4N A;  1YGH A;  2B4D A;  4H6Z A;  2HUZ A;  4B5P A;  2REF A;  1Y9W A;  2J8M A;  3JVN A;  4HNY B;  1KUX A;  2R7H A;  2FE7 A;  2JDC A;  4FD7 A;  5HH1 A;  2NMT A;  4XPD B;  4U9Y A;  3SHP A;  3BJ7 A;  1Q2C A;  4PSX A;  4LX9 A;  2FCK A;  1M4G A;  1Q2D A;  3ZJ0 A;  3TOA A;  4F6A A;  3TO7 A;  3E0K A;  4U5Y A;  4I49 A;  5J8F A;  2F5I A;  3H4Q A;  2Q4V A;  4KOV A;  1XE4 A;  4KOU A;  2Z10 A;  3S6G A;  4JLY A;  4QBJ A;  4GS4 A;  3R9F A;  4AG9 A;  5JPH A;  3FYN A;  2OH1 A;  3EY5 A;  1QST A;  4YGO A;  2B5G B;  3CXS A;  3EFA A;  4M85 A;  1M4I A;  3FIX A;  3R9G A;  1SQH A;  1S7L A;  1WWZ A;  3G8W A;  3BJ8 A;  2PR8 A;  3TO6 A;  2Z11 A;  4CS0 B;  3S6H A;  1Q2Y A;  4XPL A;  2VQY A;  4QUS A;  5J8C A;  2OZG A;  2ZPA A;  1UFH A;  2C27 A;  2G3T A;  1WK4 A;  4HNX B;  2BSW A;  1LRZ A;  1I12 A;  4XPK A;  4OAE A;  3I3G A;  4XNH C;  4CAV A;  3CXQ A;  1YR0 A;  4KOX A;  2B5G A;  1RXT A;  2AE6 A;  3P2H A;  3PP9 A;  4KOT A;  2Z0Z A;  2B58 A;  4LUA A;  4CAX A;  1IID A;  2OB0 A;  4KOR A;  3RYO A;  1XF8 A;  5CNP A;  3IWG A;  3S6K A;  4JWP A;  4Y49 C;  2IL4 A;  2G0B A;  4OAD A;  4MI4 A;  2CNT A;  1RO5 A;  4AVA A;  2I79 A;  1Y7R A;  3PZJ A;  5H84 A;  2OU2 A;  4HNW B;  4PSW A;  1P0H A;  1XEB A;  5EC4 A;  5DWM A;  2P0W A;  3D3S A;  5JQ4 A;  1YLE A;  2FIA A;  3DR6 A;  3GY9 A;  2WPX A;  4PK2 A;  2FIW A;  2B3U A;  1XMT A;  1S60 A;  1K4J A;  2BUE A;  3FRM A;  3B8G A;  3W6S A;  3F8K A;  3WR7 A;  2BEI A;  1S7K A;  3R95 A;  2CNS A;  2A4N A;  4M3S A;  1NE9 A;  4F0Y A;  2I00 A;  2PR1 A;  3LD2 A;  4MY3 A;  4JJX A;  5H86 A;  1S7F A;  1R57 A;  2ZW4 A;  2Y0M A;  3D8P A;  4AVB A;  3DSB A;  2BL1 A;  5C88 A;  4KOW A;  5F49 A;  2QIR A;  3DR8 A;  1Z9U A;  2J8N A;  4KZT A;  4OLL A;  2PSW A;  1Z4E A;  2J8R A;  4NSQ A;  3CXP A;  1U6M A;  2D4O A;  4BMH A;  2K5T A;  5IX3 A;  1VHS A;  1PU9 A;  4DNC A;  5KTD A;  3TT2 A;  4MBU A;  3QB8 A;  1MK4 A;  3V8I A;  2FL4 A;  4PK3 A;  5C82 A;  3N7Z A;  2ZW7 A;  4IF5 A;  1MJB A;  1IIC A;  1I21 A;  2VXK A;  2REE A;  1YRE A;  2WPW A;  3VWE A;  2D4P A;  2Q44 A;  3FBU A;  3W6X A;  5F48 A;  1MJ9 A;  3EXN A;  3D2M A;  2EVN A;  3S6F A;  1PUA A;  4XPD C;  3GKR A;  2P6F A;  2PQ8 A;  5F46 A;  2OZU A;  1N71 A;  3I9S A;  1QSR A;  4ZBG A;  4AB7 A;  4JD6 A;  2X7B A;  2FXF A;  3TE4 A;  4II9 A;  4U9Z A;  1I1D A;  2H5M A;  4FD6 A;  4KLW A;  4KVX A;  4MY0 A;  4QB9 A;  1ON0 A;  2KCW A;  4L8A A;  4UBR A;  1M44 A;  3VWD A;  2P6G A;  1YVO A;  4JXR A;  3SXN A;  4IUS A;  3R9E A;  1TIQ A;  1M4D A;  2R8V A;  2P6E A;  3EO4 A;  1Z4R A;  2Q04 A;  3W91 A;  1FY7 A;  1S7N A;  4B5P B;  2JLM A;  5E96 A;  3BLN A;  1NSL A;  4KOY A;  2FT0 A;  4KVO E;  5EBV A;  4CRY B;  2QML A;  3F0A A;  4J3G A;  1KUV A;  2QEC A;  4NF1 A;  2PDO A;  4R3L A;  4FD4 A;  1B87 A;  1YK3 A;  5IV0 A;  1XIX A;  2PRB A;  1YX0 A;  4HKF A;  4R57 A;  2VBQ A;  3P2F A;  4RI1 A;  2G3A A;  5I0C A;  4L89 A;  4E8O A;  4YRH A;  1S3Z A;  4R3K A;  4KOS A;  5FVJ A;  2GIV A;  3NE7 A;  1QSN A;  4X5K A;  2VEZ A;  4XNH B; 
#chains in the Genus database with same CATH topology
 4FWU A;  1PCA A;  4WJB A;  1DTD A;  4KUB A;  4UA3 A;  2O28 A;  4ZI6 A;  3D7H A;  3FXT A;  3K9T A;  4B6Z A;  2HQY A;  3IU2 A;  4UFV A;  4C2X A;  5KTC A;  3B3T A;  5G21 A;  2VL1 A;  3C26 A;  3TCV A;  4EVY A;  1TXR A;  3H8G A;  4RS2 A;  4JXQ A;  2VI7 A;  3R96 A;  1MJA A;  2C6P A;  4YFJ A;  4ZYQ A;  2ZXV A;  3SXO A;  2Q7B A;  4MHD A;  2GLJ A;  4GXH A;  2YGW A;  3WAB A;  4CRZ B;  4A37 A;  2FSR A;  5LRJ A;  1YW4 A;  2PJ2 A;  1BO4 A;  1Z8X A;  3R1K A;  4PV6 A;  2ZEN A;  1XOV A;  4Y49 B;  1LOK A;  2VZY A;  2PC1 A;  2RB7 A;  1L0C A;  2V8D A;  3D4U A;  1QSM A;  4MJ8 A;  4MFK A;  2OZH A;  2FS5 A;  4FD5 A;  5EMI A;  2PJ5 A;  2Q0Y A;  4JYW A;  4UEZ A;  1CBX A;  2CY2 A;  3KHZ A;  3BHX A;  2ZEO A;  1XRY A;  3K9U A;  3KKW A;  2ATR A;  1KUY A;  4EWT A;  3S9L A;  4E2A A;  1S5K A;  5DWN A;  2PIY A;  1CM0 A;  4QVT A;  2DF5 A;  2IJZ A;  2PJC A;  1B6B A;  2YNC C;  3KHX A;  3V38 A;  4AVC A;  4DYO A;  1BOB A;  5ISV A;  3FNC A;  2CIJ A;  3SI2 A;  3ZZI A;  4M6I A;  4NEX A;  3FF3 A;  3I1U A;  2NYQ A;  4UF4 A;  4BBH A;  1IYK A;  4EFD A;  4P6Y A;  1Y7E A;  2DXQ A;  5GCN A;  1TF8 A;  3JUW A;  2B3V A;  4OC0 A;  2EUI A;  1M1D A;  2QJ8 A;  3TO9 A;  4B5O A;  1TF9 A;  4K30 A;  4C2Z A;  2EK9 A;  3IGR A;  1OZP A;  3OWC A;  4ONW A;  5K8P A;  1FNO A;  3SI1 A;  3DNS A;  4UWJ A;  1NMT A;  1R3N A;  2B4B A;  3T90 A;  3LAC A;  1VKC A;  2QYV A;  3FVL A;  5F09 A;  3PGP A;  3PFE A;  4MHZ A;  2ZW6 A;  3GLJ A;  2QVP A;  2Q43 A;  3WT4 A;  4ZY1 A;  2WYR A;  2XEF A;  1J4J A;  2PJB A;  5KTA A;  2Z3K A;  4YU9 A;  3FB3 A;  1DE4 C;  4Q36 A;  1XFO A;  1X12 A;  2JDD A;  5AGE A;  1ELM P;  4ORF A;  4X2T A;  5AG5 A;  3FJU A;  4FUU A;  4A95 A;  3G3S A;  4PPZ A;  4MFL A;  3BI0 A;  3D2P A;  2RC4 A;  2FVG A;  4AG7 A;  4ZY0 A;  4IAV A;  3TFY A;  4OID A;  2G9D A;  2PE3 A;  1Y9K A;  4NGS A;  4NGP A;  4R87 A;  5A27 A;  4B12 A;  1EE3 P;  3TOB A;  3GYA A;  2AJ6 A;  5F47 A;  4OC4 A;  4DUK A;  5HMN A;  1HDQ A;  4KUA A;  2Q4Z A;  2Q4Y A;  3KAS A;  3EC4 A;  1IYL A;  3DGV A;  4CPA A;  5K8O A;  2HV2 A;  2R98 A;  1V0C A;  3HLP A;  1GHE A;  4P4B A;  3DDD A;  3TTH A;  4CGO A;  2B4D B;  1CJW A;  1ZG9 A;  2CXA A;  4PXB A;  4W9Y A;  3D7G A;  3T9Y A;  5J1Q A;  2EBJ A;  3PRT A;  3TX8 A;  1IY7 A;  3FH4 A;  3WC7 A;  4ONU A;  2WZN A;  3JRU A;  4NCZ A;  2CTC A;  1CP7 A;  4KVM E;  4UFX A;  4CAW A;  4P10 A;  3PEI A;  5JH9 A;  5HXD A;  5IB0 A;  4R9M A;  1YVK A;  4E0A A;  3MGD A;  3UY5 A;  5G20 A;  2J9A A;  4B11 A;  2ARH A;  3QAH A;  1KZF A;  2AFW A;  1UWY A;  2JEV A;  4A38 A;  2GAN A;  4H89 A;  2ZEH A;  1IB1 E;  4KSA A;  4NXY A;  4KLV A;  4UWI A;  1QSO A;  4C7H A;  4H6U A;  4UEE A;  2PJ4 A;  3LOD A;  1CG2 A;  1TKJ A;  2DPT A;  2GE3 A;  2PIZ A;  2Z3M A;  3L2N A;  3F5B A;  2CNM A;  4QC6 A;  3NFZ A;  4NGT A;  3SJX A;  2VZZ A;  2ZW5 A;  4P45 A;  4R6T A;  4UCM A;  1ARL A;  2R1I A;  1QQ9 A;  1P4N A;  1YGH A;  2B4D A;  3CPA A;  3MN8 A;  5A28 A;  4H6Z A;  2HUZ A;  2WUU A;  4PXC A;  4Q7A A;  4B5P A;  5THW A;  2REF A;  4X8I A;  4MCQ A;  1Y9W A;  2J8M A;  2O4H A;  3JVN A;  4HNY B;  4LQ6 A;  1KUX A;  5LRG A;  5AG7 A;  7CPA A;  2R7H A;  2FE7 A;  2JDC A;  3CDX A;  4FD7 A;  5HH1 A;  2PJ8 A;  2NMT A;  4MCR A;  4U9Y A;  4XPD B;  4Z65 A;  1ZO0 A;  2Z3O A;  3KL9 A;  4UIA A;  2PJ3 A;  3IC1 A;  5D8N A;  3SHP A;  4DJL A;  2ABZ A;  3BJ7 A;  1Q2C A;  4OC3 A;  4G1P A;  4LX9 A;  4PSX A;  5BWA B;  2FCK A;  1M4G A;  3GIU A;  1F57 A;  2PJ1 A;  5LYD A;  1Q2D A;  4F8Z A;  4OME A;  3TOA A;  3ZJ0 A;  3TO7 A;  4F6A A;  4F9V A;  1VHE A;  5HVG A;  1AUG A;  3E0K A;  4A94 A;  4U5Y A;  3NA6 A;  1LAN A;  1BLL E;  3PBB A;  4I49 A;  2F5I A;  3H4Q A;  5J8F A;  2CTB A;  2Q4V A;  4KOV A;  1XE4 A;  4KOU A;  1Y0Y A;  2Z10 A;  1Z2L A;  3ISZ A;  3S6G A;  1YW6 A;  4C68 A;  4JLY A;  4QBJ A;  4GS4 A;  3R9F A;  4AG9 A;  2C6G A;  2GRE A;  5JPH A;  3FYN A;  1VHO A;  2OH1 A;  1A2Z A;  2DPS A;  3EY5 A;  1QST A;  2C6C A;  4MCS A;  4YGO A;  1CP6 A;  3B3C A;  3N5F A;  1TKH A;  4FBE A;  2B5G B;  3CXS A;  5IB9 A;  3D7F A;  2AFM A;  1M4I A;  3EFA A;  3FIX A;  2OR4 A;  4M85 A;  5JGF A;  2BOA A;  3R9G A;  4F9U A;  2VEZ A;  1SQH A;  1S7L A;  4Q38 A;  4A32 A;  1WWZ A;  3G8W A;  3BJ8 A;  2PR8 A;  4OC5 A;  1YQE A;  3TO6 A;  3FEE A;  2Z11 A;  2ZEE A;  2ZOG A;  3PB8 X;  4UIB A;  1LAP A;  4A33 A;  2POK A;  4CS0 B;  4CAE A;  3S6H A;  1Q2Y A;  3H8E A;  4XPL A;  1BAV A;  2VQY A;  1AMP A;  4QUS A;  1ZLI A;  2AFX A;  5J8C A;  2OZG A;  2I3C A;  2ZPA A;  1UFH A;  4P4F A;  5HVH A;  2JBJ A;  4ZX8 A;  2JBK A;  2C27 A;  1LFW A;  2G3T A;  1M4L A;  1WK4 A;  2YND A;  4HNX B;  1Z8L A;  2BSW A;  3IWE A;  1LRZ A;  1I12 A;  3B3V A;  4XPK A;  3IEH A;  4IK2 A;  2PVV A;  2V8V A;  4MFP A;  3I3G A;  4OAE A;  2PJ6 A;  4RN7 A;  4XNH C;  2OOT A;  3CXQ A;  4CAV A;  3IO1 A;  1YR0 A;  4KOX A;  5AG4 A;  3H5Z A;  3SI0 A;  2B5G A;  4WWV A;  1RXT A;  3FMC A;  3NH8 A;  2AE6 A;  3P2H A;  4CGN A;  3PP9 A;  4KOT A;  2Z0Z A;  2B58 A;  4LUA A;  3CZX A;  4CAX A;  2JEW A;  1IID A;  2OB0 A;  4KOR A;  4MHY A;  3NH4 A;  3RYO A;  2ANP A;  1XF8 A;  5CNP A;  4CGP A;  4M6G A;  4KSF A;  3VAR A;  1IGB A;  3PB9 X;  4UFW A;  3IWG A;  3A9L A;  1ZLH A;  3DLJ A;  3S6K A;  4JWP A;  4F0X A;  2XEJ A;  4Y49 C;  4NGN A;  1HDU A;  2IL4 A;  2G0B A;  4OAD A;  4MI4 A;  2CNT A;  2GLF A;  1RO5 A;  3PBE A;  2O53 A;  4H2K A;  4AVA A;  5AG6 A;  4C2Y A;  2I79 A;  1Y7R A;  3PZJ A;  3D66 A;  4CYQ A;  2F8H A;  3BXM A;  4A2Z A;  5H84 A;  2OU2 A;  4NJR A;  4P4D A;  3RO0 A;  4M6H A;  1IOI A;  3FED A;  4HNW B;  4PSW A;  1P0H A;  4GM5 A;  1XEB A;  1F2O A;  5EC4 A;  3SJG A;  2EO8 A;  5DWM A;  2CF4 A;  5ELY A;  2P0W A;  5JM6 A;  3B3S A;  3D3S A;  2ODF A;  4CYO A;  4MCP A;  5JQ4 A;  4CGM A;  4R7M A;  1YLE A;  2FIA A;  5K8M A;  3RZA A;  4EME A;  3DR6 A;  3GY9 A;  4NGR A;  5G22 A;  2AFZ A;  2WPX A;  4PK2 A;  2FIW A;  2B3U A;  3NH5 A;  4P4I A;  3GB0 A;  1BPM A;  1XMT A;  3K2K A;  4P4E A;  1LCP A;  1R43 A;  1S60 A;  1K4J A;  2BUE A;  2PJ9 A;  3FRM A;  4MFQ A;  3B8G A;  4NGQ A;  1Y0R A;  3W6S A;  2GU2 A;  3F8K A;  3WR7 A;  2XEI A;  1OBR A;  2BEI A;  4MFZ A;  1ZG8 A;  1S7K A;  3R95 A;  1CX8 A;  2CNS A;  2XEG A;  4K3N A;  4M3S A;  1NE9 A;  3KQX A;  4F0Y A;  2EWB A;  2I00 A;  3V7Z A;  2BO9 A;  2AFO A;  1FT7 A;  2PR1 A;  4PXE A;  4CGL A;  4RUH A;  5I4M A;  3LD2 A;  2PJ7 A;  1GYT A;  1LAM A;  3S9M A;  3FEC A;  5CBM A;  4MY3 A;  1Z8W A;  3GUX A;  4JJX A;  5H86 A;  5HVF A;  1NSA A;  1S7F A;  1R57 A;  2ZW4 A;  2Y0M A;  8CPA A;  2HB6 A;  3D8P A;  3PB4 X;  2PRQ A;  4BIN A;  3BI1 A;  4A30 A;  5K8N A;  4ZGY B;  4MXU A;  4KSI A;  4OIW A;  3DSB A;  3WC6 A;  4AVB A;  4TWE A;  2BL1 A;  2YNC A;  4CAF A;  2BCO A;  3PB6 X;  5C88 A;  3QAY A;  3RNZ A;  4KOW A;  1VIX A;  3PB7 X;  5F49 A;  2F7V A;  2QIR A;  4ZY2 A;  2Z3P A;  2DEA A;  3DR8 A;  1Z9U A;  2J8N A;  4KZT A;  4OLL A;  4P4J A;  4R76 A;  2PSW A;  3SJE A;  1AYE A;  1Z4E A;  2J8R A;  3B35 A;  4NSQ A;  3CXP A;  1U6M A;  2D4O A;  4BMH A;  3JTK A;  1X10 A;  3B7I A;  2K5T A;  4YWY A;  5IX3 A;  1VHS A;  2HC9 A;  3ISX A;  1HEE A;  1PU9 A;  1ELL P;  4PXD A;  4DNC A;  5KTD A;  3MRU A;  3TT2 A;  4MBU A;  4CYN A;  2AFU A;  3QB8 A;  2PJA A;  1MK4 A;  3RAM A;  2IMO A;  4C7I A;  1YME A;  3V8I A;  1XJO A;  3IJ3 A;  4FAI A;  2FL4 A;  1IU8 A;  4PK3 A;  2GFQ A;  2ZEM A;  3N7Z A;  4JZ0 A;  3D7D A;  2ZW7 A;  3IFE A;  4OC1 A;  5C82 A;  4IF5 A;  3S9N A;  4NFR A;  1MJB A;  3LWU A;  1IIC A;  1KWM A;  1I21 A;  4MRI A;  2VXK A;  2REE A;  1YRE A;  2PCU A;  2WPW A;  3VWE A;  2D4P A;  2Q44 A;  3FBU A;  4UEF A;  4AXV A;  4CYP A;  3W6X A;  5F48 A;  1YLO A;  1MJ9 A;  3KGQ A;  4R8F A;  2IQ6 A;  3WC5 A;  3EXN A;  3D2M A;  2EVN A;  2Q51 A;  3D68 A;  5DS0 A;  4A39 A;  3S6F A;  1PUA A;  1CPX A;  3B2Y A;  3LMS A;  4XPD C;  3GKR A;  2P6F A;  2PQ8 A;  5F46 A;  2ZEP A;  4OC2 A;  1BPN A;  2WSA A;  2OZU A;  2RFH A;  2V77 A;  1N71 A;  3I9S A;  3D67 A;  6CPA A;  4B10 A;  1QSR A;  2ZED A;  4NGM A;  4ZBG A;  4AB7 A;  4PQA A;  3QNV A;  4JD6 A;  3HUV A;  1RTQ A;  2X7B A;  3H8F A;  2ZEL A;  2FXF A;  3KR4 A;  5G1Z A;  3TE4 A;  4II9 A;  4U9Z A;  1I1D A;  2H5M A;  2ZEG A;  4FD6 A;  2V8G A;  3CT9 A;  2PJ0 A;  4KLW A;  4KVX A;  4MY0 A;  4QB9 A;  1ON0 A;  2Z3L A;  2Z3N A;  2KCW A;  4L8A A;  4UBR A;  2EK8 A;  1IOF A;  4MHN A;  1M44 A;  1Z5R A;  3VWD A;  2P6G A;  4P44 A;  3CPX A;  3KQZ A;  3RBU A;  5LYF A;  1YVO A;  1JQG A;  3IIB A;  4KS9 A;  4JXR A;  1CPS A;  3SXN A;  4IUS A;  3R9E A;  2PVW A;  3T8W A;  3VAT A;  1TIQ A;  1VGY A;  1M4D A;  2R8V A;  5CPA A;  5D29 A;  4ZX9 A;  4B13 A;  2AFS A;  2P6E A;  3EO4 A;  2ZEF A;  4MHP A;  1Z4R A;  4UCN A;  2Q04 A;  3KI9 A;  3B3W A;  3W91 A;  1FY7 A;  4TNU A;  1S7N A;  4IHM A;  4B5P B;  1Z8T A;  2JLM A;  5E96 A;  3BLN A;  4NJQ A;  1NSL A;  4KOY A;  1QMU A;  2FT0 A;  4KVO E;  1XMB A;  1YSJ A;  3PFO A;  4LQG A;  3SJF A;  5EBV A;  1PYT B;  4CRY B;  2QML A;  2Q7S A;  3F0A A;  3IWW A;  1KUV A;  2ZOF A;  1ZG7 A;  4J3G A;  2NSM A;  4A31 A;  2QEC A;  2V8H A;  1H8L A;  4NF1 A;  2YNE A;  3KR5 A;  3VH9 A;  4BD9 A;  3NE8 A;  2PDO A;  4UCP A;  4R3L A;  4FD4 A;  1Q7L A;  5LYL A;  1B87 A;  1YK3 A;  4HPS A;  5IV0 A;  1XIX A;  3TC8 A;  2PRB A;  1YX0 A;  3KZW A;  4HKF A;  4R57 A;  4MMO A;  1F2P A;  5LYI A;  2VBQ A;  3IU1 A;  1JWQ A;  4B14 A;  3P2F A;  4RI1 A;  1TKF A;  2G3A A;  4X3R A;  5I0C A;  2C1C A;  3FX6 A;  4MFJ A;  4L89 A;  4E8O A;  4YRH A;  1ARM A;  1S3Z A;  4R3K A;  4KOS A;  5FVJ A;  2GIV A;  3NE7 A;  5LRK A;  1XBU A;  1QSN A;  4OKO A;  4OP4 A;  4O23 A;  4X5K A;  2A4N A;  4XNH B; 
#chains in the Genus database with same CATH homology
 4KUB A;  4UA3 A;  2O28 A;  3FXT A;  2HQY A;  3IU2 A;  4UFV A;  4C2X A;  5KTC A;  5G21 A;  3C26 A;  3TCV A;  4EVY A;  4RS2 A;  4JXQ A;  2VI7 A;  3R96 A;  1MJA A;  4YFJ A;  2ZXV A;  3SXO A;  2Q7B A;  4MHD A;  2YGW A;  4CRZ B;  2FSR A;  1BO4 A;  3R1K A;  4PV6 A;  4Y49 B;  2VZY A;  2PC1 A;  1L0C A;  1QSM A;  4MJ8 A;  4MFK A;  2OZH A;  2FS5 A;  4FD5 A;  2Q0Y A;  2CY2 A;  3K9U A;  3KKW A;  2ATR A;  1KUY A;  4E2A A;  1S5K A;  5DWN A;  1CM0 A;  4QVT A;  2YNC C;  1B6B A;  4AVC A;  5ISV A;  1BOB A;  3FNC A;  3ZZI A;  4NEX A;  4BBH A;  1IYK A;  5GCN A;  2DXQ A;  3JUW A;  2B3V A;  3TO9 A;  2EUI A;  1M1D A;  4B5O A;  4K30 A;  4C2Z A;  3IGR A;  1OZP A;  3OWC A;  3DNS A;  4UWJ A;  1NMT A;  2B4B A;  3T90 A;  1VKC A;  3PGP A;  2ZW6 A;  1J4J A;  5KTA A;  2Z3K A;  3FB3 A;  4Q36 A;  2JDD A;  5AGE A;  4ORF A;  5AG5 A;  4A95 A;  3G3S A;  4AG7 A;  4MFL A;  3TFY A;  3D2P A;  2RC4 A;  1Y9K A;  5A27 A;  4R87 A;  4B12 A;  3TOB A;  3GYA A;  2AJ6 A;  5F47 A;  5HMN A;  4KUA A;  2Q4Y A;  3EC4 A;  1IYL A;  2HV2 A;  2R98 A;  1V0C A;  1GHE A;  3DDD A;  3TTH A;  4CGO A;  2B4D B;  1CJW A;  2CXA A;  3T9Y A;  4ONU A;  4NCZ A;  4KVM E;  4UFX A;  4CAW A;  5IB0 A;  4R9M A;  1YVK A;  4E0A A;  3MGD A;  3UY5 A;  5G20 A;  4B11 A;  2ARH A;  3QAH A;  1KZF A;  2JEV A;  2GAN A;  4H89 A;  1IB1 E;  4KSA A;  4NXY A;  4KLV A;  4UWI A;  1QSO A;  4C7H A;  4H6U A;  3LOD A;  2DPT A;  2GE3 A;  2Z3M A;  3F5B A;  2CNM A;  4QC6 A;  2VZZ A;  2ZW5 A;  4UCM A;  2R1I A;  1P4N A;  1YGH A;  2B4D A;  5A28 A;  4H6Z A;  2HUZ A;  2WUU A;  4B5P A;  2REF A;  1Y9W A;  2J8M A;  3JVN A;  4HNY B;  1KUX A;  5AG7 A;  2R7H A;  2FE7 A;  2JDC A;  4FD7 A;  5HH1 A;  2NMT A;  4XPD B;  4U9Y A;  1ZO0 A;  2Z3O A;  3SHP A;  3BJ7 A;  5BWA B;  1Q2C A;  4PSX A;  4LX9 A;  2FCK A;  1M4G A;  1Q2D A;  3ZJ0 A;  3TOA A;  4F6A A;  3TO7 A;  3E0K A;  4U5Y A;  4I49 A;  5J8F A;  2F5I A;  3H4Q A;  2Q4V A;  4KOV A;  1XE4 A;  4KOU A;  2Z10 A;  3S6G A;  4C68 A;  4JLY A;  4QBJ A;  4GS4 A;  3R9F A;  4AG9 A;  5JPH A;  3FYN A;  2DPS A;  2OH1 A;  3EY5 A;  1QST A;  4YGO A;  2B5G B;  3CXS A;  3EFA A;  4M85 A;  1M4I A;  3FIX A;  3R9G A;  1SQH A;  1S7L A;  4Q38 A;  4A32 A;  1WWZ A;  3G8W A;  3BJ8 A;  2PR8 A;  3TO6 A;  2Z11 A;  4A33 A;  4CS0 B;  4CAE A;  3S6H A;  1Q2Y A;  4XPL A;  2VQY A;  4QUS A;  5J8C A;  2OZG A;  2ZPA A;  1UFH A;  2C27 A;  2G3T A;  2YND A;  1WK4 A;  4HNX B;  2BSW A;  3IWE A;  1LRZ A;  1I12 A;  4XPK A;  4OAE A;  4MFP A;  3I3G A;  4XNH C;  4CAV A;  3CXQ A;  1YR0 A;  4KOX A;  5AG4 A;  3H5Z A;  2B5G A;  1RXT A;  2AE6 A;  3P2H A;  4CGN A;  3PP9 A;  4KOT A;  2Z0Z A;  2B58 A;  4LUA A;  4CAX A;  1IID A;  2OB0 A;  4KOR A;  3RYO A;  1XF8 A;  5CNP A;  4CGP A;  4KSF A;  4UFW A;  3IWG A;  3A9L A;  3S6K A;  4JWP A;  4F0X A;  4Y49 C;  2IL4 A;  2G0B A;  4OAD A;  4MI4 A;  2CNT A;  1RO5 A;  4AVA A;  5AG6 A;  4C2Y A;  2I79 A;  1Y7R A;  3PZJ A;  4CYQ A;  4A2Z A;  5H84 A;  2OU2 A;  4HNW B;  4PSW A;  1P0H A;  1XEB A;  5EC4 A;  5DWM A;  2P0W A;  3D3S A;  4CYO A;  5JQ4 A;  4CGM A;  1YLE A;  2FIA A;  3DR6 A;  3GY9 A;  5G22 A;  2WPX A;  4PK2 A;  2FIW A;  2B3U A;  1XMT A;  1S60 A;  1K4J A;  2BUE A;  3FRM A;  4MFQ A;  3B8G A;  3W6S A;  3F8K A;  3WR7 A;  2BEI A;  4MFZ A;  1S7K A;  3R95 A;  2CNS A;  2A4N A;  4M3S A;  1NE9 A;  4F0Y A;  2I00 A;  4CGL A;  2PR1 A;  3LD2 A;  4MY3 A;  4JJX A;  5H86 A;  1S7F A;  1R57 A;  2ZW4 A;  2Y0M A;  3D8P A;  4A30 A;  4ZGY B;  4AVB A;  3DSB A;  2BL1 A;  2YNC A;  4CAF A;  5C88 A;  4KOW A;  5F49 A;  2QIR A;  2Z3P A;  3DR8 A;  1Z9U A;  2J8N A;  4KZT A;  4OLL A;  2PSW A;  1Z4E A;  2J8R A;  4NSQ A;  3CXP A;  1U6M A;  2D4O A;  4BMH A;  3JTK A;  2K5T A;  5IX3 A;  1VHS A;  1PU9 A;  4DNC A;  5KTD A;  3TT2 A;  4MBU A;  4CYN A;  3QB8 A;  1MK4 A;  4C7I A;  3V8I A;  2FL4 A;  4PK3 A;  5C82 A;  3N7Z A;  2ZW7 A;  4IF5 A;  1MJB A;  1IIC A;  1I21 A;  2VXK A;  2REE A;  1YRE A;  2WPW A;  3VWE A;  2D4P A;  2Q44 A;  3FBU A;  4CYP A;  3W6X A;  5F48 A;  1MJ9 A;  3EXN A;  3D2M A;  2EVN A;  3S6F A;  1PUA A;  4XPD C;  3GKR A;  2P6F A;  2PQ8 A;  5F46 A;  2WSA A;  2OZU A;  1N71 A;  3I9S A;  4B10 A;  1QSR A;  4ZBG A;  4AB7 A;  4JD6 A;  2X7B A;  2FXF A;  5G1Z A;  3TE4 A;  4II9 A;  4U9Z A;  1I1D A;  2H5M A;  4FD6 A;  4KLW A;  4KVX A;  4MY0 A;  4QB9 A;  1ON0 A;  2Z3L A;  2Z3N A;  2KCW A;  4L8A A;  4UBR A;  1M44 A;  3VWD A;  2P6G A;  1YVO A;  4KS9 A;  4JXR A;  3SXN A;  4IUS A;  3R9E A;  1TIQ A;  1M4D A;  2R8V A;  4B13 A;  2P6E A;  3EO4 A;  1Z4R A;  4UCN A;  2Q04 A;  3W91 A;  1FY7 A;  1S7N A;  4B5P B;  2JLM A;  5E96 A;  3BLN A;  1NSL A;  4KOY A;  2FT0 A;  4KVO E;  5EBV A;  4CRY B;  2QML A;  3F0A A;  4J3G A;  1KUV A;  4A31 A;  2QEC A;  4NF1 A;  2YNE A;  4UCP A;  2PDO A;  4R3L A;  4FD4 A;  1B87 A;  1YK3 A;  5IV0 A;  1XIX A;  2PRB A;  1YX0 A;  4HKF A;  4R57 A;  2VBQ A;  3IU1 A;  4B14 A;  3P2F A;  4RI1 A;  2G3A A;  5I0C A;  4MFJ A;  4L89 A;  4E8O A;  4YRH A;  1S3Z A;  4R3K A;  4KOS A;  5FVJ A;  2GIV A;  3NE7 A;  1QSN A;  4X5K A;  2VEZ A;  4XNH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...