2PRQA

X-ray crystallographic characterization of the co(ii)-substituted tris-bound form of the aminopeptidase from aeromonas proteolytica
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Bacterial leucyl aminopeptidase
publication title X-ray crystallographic characterization of the Co(II)-substituted Tris-bound form of the aminopeptidase from Aeromonas proteolytica.
pubmed doi rcsb
source organism Vibrio proteolyticus
total genus 116
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2prqA00
2I3CA 3SJGA 4R7MA 5F09A 4O23A 4X2TA 4OC2A 3NFZA 5JGFA 4DYOA 3B3SA 4X3RA 4X8IA 4OC3A 2C6PA 4A39A 2V8HA 3FEEA 5LRGA 4Z65A 5THWA 1YLOA 2ZEHA 4JZ0A 1CBXA 3SJFA 1TF9A 2EK9A 2Q43A 3PRTA 4MCPA 2ZEEA 4IAVA 4OC1A 3RZAA 4OC4A 4MHYA 3FH4A 2PJ9A 2PJ8A 3FJUA 1TKHA 1TKJA 3BI1A 3IFEA 5D29A 3BI0A 4R76A 3NA6A 1CX8A 5IB9A 2C6GA 3B3TA 5LYLA 3K2KA 2CIJA 3WABA 3KL9A 4P4EA 3IEHA 2ZENA 1TXRA 2JBKA 2O53A 1ELLP 5LYIA 3PFEA 2ZOGA 3D7HA 1R43A 1DTDA 5HXDA 1LCPA 2ZELA 3S9LA 1LANA 5HVGA 1BAVA 4UIAA 1OBRA 2C6CA 1FT7A 4NGSA 2PJAA 4ZI6A 2O4HA 4ZY2A 2XEFA 4GM5A 2AFSA 4PQAA 3KHZA 5JH9A 3B3VA 3RBUA 1VGYA 4UF4A 3H8FA 4MCRA 2G9DA 4UEFA 1HDUA 5LRJA 1YSJA 2POKA 4YWYA 5I4MA 2F8HA 4P4BA 2FVGA 2RFHA 4P10A 3LMSA 4AXVA 1LOKA 4MHNA 3VARA 3ISZA 4NGQA 3KGQA 4KSIA 3SI2A 3D4UA 2NYQA 3FMCA 3FEDA 1XJOA 3CT9A 1CPXA 5K8MA 4P4JA 1KWMA 3PEIA 2PJ6A 4NGPA 1BPNA 2OOTA 3B3WA 3D67A 2Q51A 3RAMA 4MMOA 4A37A 4OMEA 2XEGA 1VHOA 3WT4A 4F9UA 1Y7EA 3HUVA 2JBJA 2PIZA 4CPAA 4ONWA 5ELYA 2F7VA 1XRYA 5JM6A 2QVPA 3KR4A 3K9TA 2PJ7A 3D7FA 3L2NA 4WJBA 4WWVA 2DEAA 4A94A 4Q7AA 2PRQA 5K8OA 3CPXA 2ZOFA 1PYTB 3S9NA 3NH5A 4ZY1A 2ZEFA 3FVLA 2PJ4A 2J9AA 4RUHA 1ZLHA 4JYWA 4OC0A 8CPAA 3IJ3A 4IHMA 3BHXA 1GYTA 3CDXA 4PXDA 4EWTA 3TX8A 1AYEA 4OIWA 2ANPA 2PIYA 3FF3A 4FBEA 1F57A 4P44A 5D8NA 1R3NA 1F2PA 4PXEA 3NH4A 4P45A 2V8DA 3H8EA 3PB7X 5LRKA 4OKOA 1Z5RA 4IK2A 1ZG7A 3IC1A 4MHZA 3N5FA 2PJ1A 2ZEOA 3TC8A 3JRUA 2EK8A 1HEEA 4NGNA 1XBUA 2QYVA 1CP7A 1XFOA 4UEEA 3KZWA 3B3CA 2CTCA 1TKFA 3B2YA 3GUXA 5K8NA 4B6ZA 1ZG9A 2AFWA 2AFMA 3IO1A 2WZNA 3D7DA 2GU2A 1H8LA 2V8VA 3SJXA 1DE4C 4W9YA 1EE3P 1RTQA 1HDQA 1ZG8A 4ZX9A 3S9MA 2IQ6A 2GLFA 4P4IA 1BPMA 4NGRA 1LAPA 3PB6X 2ZEMA 5K8PA 2PVVA 4MCSA 3KHXA 3GB0A 3DLJA 3SI1A 2PJCA 3I1UA 2XEJA 3CPAA 4NGTA 1Z2LA 1YW6A 4OIDA 3MRUA 1AMPA 4MHPA 4PPZA 2PJ2A 3D7GA 4F9VA 1TF8A 2BCOA 1NSAA 2ZEPA 4YU9A 3WC6A 3ISXA 1UWYA 4TNUA 1CP6A 2PJ0A 1ELMP 1FNOA 5DS0A 2ABZA 3KASA 3PFOA 4H2KA 4K3NA 1Z8LA 2EWBA 4PXBA 1LFWA 3H8GA 2CTBA 5HVFA 1YMEA 2RB7A 3PB9X 3HLPA 2PCUA 3FECA 4DUKA 4FWUA 3FX6A 3QNVA 4P4DA 2AFXA 2NSMA 2PJ5A 3V38A 2ZEGA 3SI0A 5LYFA 3BXMA 2XEIA 4EMEA 2PE3A 2GLJA 4EFDA 2HC9A 1CG2A 1YW4A 3D66A 3B7IA 7CPAA 5CPAA 2V77A 4UEZA 1Y0RA 2GREA 1CPSA 4ZX8A 2Q4ZA 3KQZA 4MXUA 4F8ZA 3WC7A 1IGBA 3PBBA 4OC5A 1QQ9A 1Y0YA 2C1CA 1BLLE 1LAMA 4NJQA 4LQGA 3IIBA 3LWUA 3T8WA 2WYRA 1F2OA 4MRIA 4TWEA 3NH8A 2VL1A 4OP4A 4NGMA 4R8FA 2BO9A 4P4FA 5J1QA 2PJBA 3VH9A 3V7ZA 2PJ3A 3WC5A 2HB6A 4NFRA 1VHEA 4FAIA 5HVHA 4R6TA 1JQGA 3KI9A 2PVWA 4BD9A 3B35A 3IWWA 4A38A 1Q7LA 3PBEA 1IY7A 4MCQA 1QMUA 4ZY0A 3PB4X 2ZEDA 4DJLA 4UIBA 1XMBA 3MN8A 2AFOA 2OR4A 1M4LA 3KQXA 6CPAA 2BOAA 3PB8X 3D68A 4NJRA 2IJZA 5LYDA 2QJ8A 3VATA 3GLJA 4P6YA 3DGVA 2V8GA 2JEWA 4PXCA 1ARMA 2AFZA 4G1PA 5CBMA 2CF4A 4FUUA 1ZLIA 4ZYQA 3SJEA 1ARLA 3KR5A 2AFUA 2IMOA 1PCAA 1VIXA
chains in the Genus database with same CATH superfamily
2I3CA 3SJGA 4R7MA 3I9SA 5F09A 4ORFA 4O23A 4X2TA 1XMTA 5F46A 2Z3KA 4OC2A 1Z8WA 3NFZA 4LQ6A 5G22A 4EVYA 5AG6A 4C2XA 4XPDC 2AE6A 3KKWA 4M6IA 4DYOA 3B3SA 2Z0ZA 3H4QA 4X3RA 2FCKA 4X8IA 4OC3A 2FXFA 2P6GA 5AG4A 4UCPA 2C6PA 5IB0A 3F5BA 2EO8A 2REEA 4MY3A 4A39A 2CNTA 2DXQA 4JXQA 5A27A 2V8HA 2PR1A 3FEEA 5LRGA 3QAYA 2Q7BA 2DPSA 2OH1A 4Z65A 5IV0A 4CGNA 5THWA 4UFXA 1YLOA 4KOVA 2ZEHA 4JZ0A 1CBXA 2FL4A 1Y9KA 5DWMA 3SJFA 1TF9A 2EK9A 2CNMA 2Q43A 3PRTA 4MCPA 5H86A 5JGFA 4CAXA 2ZEEA 3OWCA 2PQ8A 4JXRA 4M85A 4IAVA 3R9EA 1LRZA 4OC1A 3RZAA 4OC4A 3N7ZA 4MHYA 4CYPA 3TFYA 3FH4A 2PJ9A 4JD6A 2PJ8A 2Q0YA 3FJUA 5FVJA 3TCVA 5IX3A 1TKHA 4Q38A 1TKJA 3BI1A 1Z8XA 3S6HA 4CAFA 4MJ8A 3IFEA 5KTCA 5D29A 1NE9A 3BI0A 4LUAA 4R76A 4B5OA 4CAWA 3PGPA 1Y9WA 4MFQA 3PP9A 2Z3PA 3NA6A 4ONUA 4QUSA 1CX8A 3SXOA 1YVKA 2C6GA 5IB9A 3B3TA 5LYLA 3K2KA 2CIJA 2DPTA 3QB8A 3KL9A 4GS4A 4P4EA 3IEHA 4HPSA 3WABA 2ZENA 4B11A 2AJ6A 1M4GA 2QMLA 1TXRA 2JBKA 2O53A 1ELLP 2WSAA 5LYIA 3PFEA 2ZOGA 1U6MA 1I12A 4A33A 2X7BA 1Z4RA 4K30A 3D7HA 1R43A 1DTDA 1WWZA 2B4BA 4RN7A 5HXDA 1LCPA 2ZELA 3S6KA 3RNZA 1LANA 4U9ZA 5JQ4A 5HVGA 3S9LA 1BAVA 4UIAA 1OBRA 2C6CA 1FT7A 4UFVA 4CGOA 1MJ9A 3B8GA 4NGSA 2PJAA 2Y0MA 4R57A 2B4DA 3EO4A 4ZI6A 3R96A 2O4HA 4ZY2A 3CXSA 2VI7A 2XEFA 4ZBGA 3W91A 4QB9A 4A2ZA 4GM5A 1XIXA 2AFSA 1IYKA 4PQAA 3KHZA 5JH9A 2HUZA 4KOUA 1R57A 3B3VA 3LACA 5KTAA 3RBUA 1VGYA 4UF4A 3H8FA 5GCNA 5E96A 4E8OA 2VEZA 2G9DA 4MCRA 4UEFA 3WR7A 4L89A 1HDUA 4H89A 4BINA 4FD5A 1YQEA 1YSJA 2POKA 5LRJA 2Q04A 1XOVA 4X5KA 4YWYA 2Z10A 3D3SA 4UWJA 1YK3A 3DNSA 1B6BA 4KUBA 1Z9UA 5I4MA 2F8HA 4HNXB 4KOXA 4CS0B 4P4BA 2FVGA 2R7HA 2RFHA 4P10A 3LMSA 4AB7A 2OZHA 4AXVA 4AG9A 1LOKA 4MHNA 5G21A 3IWEA 3VARA 1YGHA 4NXYA 1OZPA 3ISZA 2Z11A 4CGLA 4NGQA 3KGQA 4KSIA 2EUIA 3SI2A 1UFHA 3D4UA 5EMIA 2Z3NA 4C7IA 2NYQA 5A28A 2FIAA 1YR0A 3FMCA 4QBJA 3FIXA 3NE8A 3FEDA 2R1IA 4A32A 1XJOA 1QSMA 3CT9A 1CPXA 5K8MA 1V0CA 3LODA 4E0AA 4P4JA 1KWMA 2R98A 3DR8A 3PEIA 2PJ6A 4NGPA 1BPNA 4C2ZA 2OOTA 4NCZA 3B3WA 2GE3A 3D67A 2P6EA 3CZXA 2Q51A 4Y49B 4MMOA 5G1ZA 3RAMA 4A37A 4OMEA 2R8VA 2XEGA 2G3AA 3TO9A 4A95A 2CNSA 1VHOA 3WT4A 4F9UA 2Q7SA 1Y7EA 4PK2A 3HUVA 2JBJA 4CRYB 2PIZA 2F5IA 4FD6A 4CPAA 4MFPA 3A9LA 2PRBA 4ONWA 5ELYA 2ZW6A 2F7VA 1B87A 1XRYA 2YNCC 5JM6A 1TIQA 2QVPA 4R9MA 1VKCA 4OAEA 3KR4A 4IF5A 4L8AA 2OB0A 2BL1A 4QVTA 5CNPA 1KUVA 3FBUA 4KVME 4DNCA 2B3UA 2FS5A 3K9TA 2PJ7A 3D7FA 3L2NA 4WJBA 5I0CA 2KCWA 3R9FA 4J3GA 5C88A 2B3VA 3ZZIA 4WWVA 5BWAB 2DEAA 2VZYA 5G20A 1L0CA 3P2HA 1A2ZA 2GFQA 4A94A 3FB3A 2PRQA 4Q7AA 3R9GA 5K8OA 1XF8A 3IGRA 4AG7A 1JWQA 2DF5A 2ZOFA 3CPXA 1XE4A 1PYTB 4CAVA 3S9NA 3FXTA 3NH5A 3TO6A 2ZEFA 3FVLA 3W6SA 4ZY1A 4KLWA 3ZJ0A 2H5MA 1CM0A 4CGMA 2PJ4A 2J9AA 4XPKA 2PSWA 3H5ZA 2ARHA 4RUHA 1ZLHA 4JYWA 3TOAA 4OC0A 3JUWA 2I00A 4UFWA 4BBHA 8CPAA 3LD2A 3IJ3A 3P2FA 2VBQA 1CJWA 4IHMA 2REFA 4KOTA 3BHXA 4KVOE 3VWEA 3MGDA 1GYTA 3RO0A 3CDXA 4PXDA 4KOYA 4EWTA 2GANA 4UA3A 1NMTA 2P6FA 1YVOA 2JEVA 1AYEA 2J8RA 2RC4A 3G8WA 4OIWA 3SXNA 1KUXA 4H6UA 1FY7A 1KZFA 2ANPA 2PIYA 3FF3A 3EXNA 1ZO0A 4FBEA 2FSRA 1F57A 4P44A 2A4NA 1X10A 3W6XA 5D8NA 1R3NA 1F2PA 4PXEA 3C26A 4BMHA 2C27A 3NH4A 4P45A 4CGPA 4R3LA 2V8DA 3H8EA 3PB7X 5LRKA 4OKOA 1Z5RA 4KVXA 2BEIA 4IK2A 2B5GA 1ZG7A 1YLEA 4KOWA 3IC1A 4MHZA 2NMTA 3N5FA 3DSBA 2PJ1A 2ZEOA 4F6AA 3TC8A 1BOBA 5EC4A 2D4OA 3GY9A 5AGEA 4YGOA 3JRUA 4CYOA 2ZPAA 2EK8A 1HEEA 2VZZA 4NGNA 3I3GA 2BSWA 4F0XA 1I21A 5AG5A 1XBUA 2QYVA 1CP7A 5EBVA 1XFOA 4UEEA 2QECA 2YNDA 3KZWA 4MBUA 1IOFA 1K4JA 3B3CA 2IL4A 2CTCA 2ZW7A 4KLVA 5J8CA 1TKFA 3IWGA 3B2YA 3NE7A 3GUXA 5K8NA 2BUEA 4B6ZA 5C82A 1ZG9A 5JPHA 2AFWA 1PUAA 2AFMA 3IO1A 2WZNA 1Z8TA 3D7DA 2GU2A 1H8LA 4PSXA 2V8VA 3FRMA 2HV2A 3CXPA 4KOSA 3S6GA 3SJXA 1DE4C 4W9YA 1KUYA 1EE3P 4R3KA 1RTQA 1HDQA 1ZG8A 4ZX9A 3S9MA 2IQ6A 2VXKA 2GLFA 4P4IA 4UBRA 1BPMA 4B14A 4PSWA 4NGRA 2WUUA 1M1DA 4JJXA 2WPXA 1Q2DA 4JLYA 1VHSA 1LAPA 3BJ7A 3PB6X 2ZXVA 3PZJA 5H84A 2ZEMA 4MHDA 5K8PA 1IB1E 2Q4VA 2PVVA 4MCSA 3KHXA 3GB0A 2EBJA 2ODFA 4NSQA 1XEBA 3DLJA 3SI1A 1QSTA 2OZUA 2PJCA 2ZW5A 2XEJA 2YGWA 3F0AA 3I1UA 3EY5A 3CPAA 2FT0A 4NGTA 4M6GA 1Z2LA 1YW6A 4KUAA 4OIDA 4CAEA 3MRUA 5HH1A 1AMPA 4MHPA 4PPZA 4RI1A 2PJ2A 4B10A 3D7GA 1S7NA 3TTHA 1TF8A 4GXHA 4KZTA 1RO5A 4CRZB 4F9VA 2ATRA 2HQYA 1SQHA 2BCOA 1NSAA 3D2PA 2ZEPA 3TE4A 3EC4A 2JDDA 4YU9A 3WC6A 2Q4YA 3ISXA 1UWYA 4TNUA 3SHPA 1CP6A 2Q44A 2PJ0A 3R1KA 3VWDA 1ELMP 2B4DB 1FNOA 4HNYB 2ABZA 3JVNA 3KASA 5DS0A 3PFOA 4H2KA 1Q2YA 2O28A 4K3NA 4M6HA 1Z8LA 2P0WA 2EWBA 4FD7A 1LFWA 4PXBA 4Y49C 1BO4A 3H8GA 2CTBA 5AG7A 4CYNA 4OLLA 4UWIA 5HVFA 1P0HA 3S6FA 1YMEA 4KSAA 2RB7A 3PB9X 3HLPA 2PCUA 3FECA 4DUKA 4C7HA 1J4JA 3G3SA 4FWUA 3FX6A 4MFZA 5J8FA 3QNVA 1S7KA 4P4DA 2GIVA 2AFXA 4C2YA 1S7FA 2QIRA 3T90A 4CYQA 2NSMA 2Z3MA 4MFJA 5ISVA 2PJ5A 3BJ8A 3V38A 2ZEGA 4KORA 3QAHA 3SI0A 5LYFA 4XPLA 5F47A 3BXMA 1WK4A 2XEIA 2OU2A 4EMEA 2PE3A 2GLJA 4EFDA 1MJBA 3BLNA 2CXAA 1IU8A 5HMNA 2HC9A 1X12A 4M3SA 1CG2A 1YW4A 1YX0A 2K5TA 2JLMA 4H6ZA 3IU2A 4LX9A 3D66A 3R95A 3B7IA 7CPAA 5CPAA 1P4NA 2B58A 2V77A 4UEZA 3DR6A 1S5KA 1Y0RA 1YREA 2GREA 1CPSA 4ZX8A 4FD4A 2Q4ZA 3KQZA 4MXUA 2I79A 4B5PA 4F8ZA 3WC7A 2JDCA 4KS9A 1IGBA 2PC1A 4B12A 3PBBA 3FYNA 4OC5A 1QQ9A 4OADA 4AVCA 1Y0YA 2C1CA 1BLLE 4MI4A 1LAMA 4NJQA 4QC6A 3TO7A 1RXTA 2G3TA 4LQGA 2YNCA 4PV6A 3IIBA 4MFKA 3GIUA 4A31A 3LWUA 4AVAA 3T8WA 3TT2A 3E0KA 2WYRA 1F2OA 4A30A 4C68A 1Q2CA 2PR8A 1S7LA 4MRIA 4TWEA 3NH8A 2VL1A 4OP4A 4NGMA 3K9UA 5F48A 4HNWB 1GHEA 2BO9A 2D4PA 4P4FA 2WPWA 4R8FA 4F0YA 3TOBA 5DWNA 3CXQA 1IIDA 5F49A 4RS2A 3V8IA 1QSNA 4R87A 3EFAA 2Z3OA 5J1QA 1PU9A 3DDDA 4HKFA 4UCMA 2FE7A 3D8PA 1NSLA 2PJBA 3VH9A 2FIWA 2ZW4A 3TX8A 3V7ZA 2PJ3A 3WC5A 2HB6A 3JTKA 4NFRA 3T9YA 1MJAA 1QSOA 1VHEA 4FAIA 4XNHB 5HVHA 4R6TA 3F8KA 2YNEA 1Y7RA 4B13A 1JQGA 3KI9A 2PVWA 4PK3A 1S60A 4U5YA 4UCNA 4BD9A 3GYAA 3B35A 4YRHA 1M4DA 1QSRA 3IWWA 4A38A 4I49A 1M44A 4KSFA 4ZGYB 1Q7LA 1MK4A 2EVNA 3PBEA 1IY7A 2G0BA 1QMUA 3GKRA 4MCQA 2OZGA 4NF1A 4ZY0A 3PB4X 2ZEDA 1IICA 4IUSA 4XNHC 4JWPA 4DJLA 4UIBA 1XMBA 3MN8A 4E2AA 2AFOA 2OR4A 1I1DA 1M4LA 4U9YA 5KTDA 3KQXA 6CPAA 2BOAA 3PB8X 3D68A 4NJRA 4II9A 2IJZA 1M4IA 5LYDA 2QJ8A 3VATA 4B5PB 3GLJA 3D2MA 4P6YA 3DGVA 4Q36A 2V8GA 2JEWA 4PXCA 1ARMA 2J8MA 4NEXA 4XPDB 2AFZA 1ON0A 4G1PA 2VQYA 5CBMA 1AUGA 1IOIA 2PDOA 1S3ZA 2CF4A 4FUUA 1ZLIA 3FNCA 4MY0A 3SJEA 4ZYQA 1ARLA 4AVBA 3KR5A 2AFUA 2B5GB 4YFJA 1IYLA 3UY5A 3RYOA 2Z3LA 2IMOA 1N71A 1PCAA 3IU1A 1VIXA 1Z4EA 2J8NA 4MFLA 2CY2A
chains in the Genus database with same CATH topology
2I3CA 3SJGA 4R7MA 5F09A 4O23A 4X2TA 4OC2A 3NFZA 5JGFA 4DYOA 3B3SA 4X3RA 4X8IA 4OC3A 2C6PA 4A39A 2V8HA 3FEEA 5LRGA 4Z65A 5THWA 1YLOA 2ZEHA 4JZ0A 1CBXA 3SJFA 1TF9A 2EK9A 2Q43A 3PRTA 4MCPA 2ZEEA 4IAVA 4OC1A 3RZAA 4OC4A 4MHYA 3FH4A 2PJ9A 2PJ8A 3FJUA 1TKHA 1TKJA 3BI1A 3IFEA 5D29A 3BI0A 4R76A 3NA6A 1CX8A 5IB9A 2C6GA 3B3TA 5LYLA 3K2KA 2CIJA 3WABA 3KL9A 4P4EA 3IEHA 2ZENA 1TXRA 2JBKA 2O53A 1ELLP 5LYIA 3PFEA 2ZOGA 3D7HA 1R43A 1DTDA 5HXDA 1LCPA 2ZELA 3S9LA 1LANA 5HVGA 1BAVA 4UIAA 1OBRA 2C6CA 1FT7A 4NGSA 2PJAA 4ZI6A 2O4HA 4ZY2A 2XEFA 4GM5A 2AFSA 4PQAA 3KHZA 5JH9A 3B3VA 3RBUA 1VGYA 4UF4A 3H8FA 4MCRA 2G9DA 4UEFA 1HDUA 5LRJA 1YSJA 2POKA 4YWYA 5I4MA 2F8HA 4P4BA 2FVGA 2RFHA 4P10A 3LMSA 4AXVA 1LOKA 4MHNA 3VARA 3ISZA 4NGQA 3KGQA 4KSIA 3SI2A 3D4UA 2NYQA 3FMCA 3FEDA 1XJOA 3CT9A 1CPXA 5K8MA 4P4JA 1KWMA 3PEIA 2PJ6A 4NGPA 1BPNA 2OOTA 3B3WA 3D67A 2Q51A 3RAMA 4MMOA 4A37A 4OMEA 2XEGA 1VHOA 3WT4A 4F9UA 1Y7EA 3HUVA 2JBJA 2PIZA 4CPAA 4ONWA 5ELYA 2F7VA 1XRYA 5JM6A 2QVPA 3KR4A 3K9TA 2PJ7A 3D7FA 3L2NA 4WJBA 4WWVA 2DEAA 4A94A 4Q7AA 2PRQA 5K8OA 3CPXA 2ZOFA 1PYTB 3S9NA 3NH5A 4ZY1A 2ZEFA 3FVLA 2PJ4A 2J9AA 4RUHA 1ZLHA 4JYWA 4OC0A 8CPAA 3IJ3A 4IHMA 3BHXA 1GYTA 3CDXA 4PXDA 4EWTA 3TX8A 1AYEA 4OIWA 2ANPA 2PIYA 3FF3A 4FBEA 1F57A 4P44A 5D8NA 1R3NA 1F2PA 4PXEA 3NH4A 4P45A 2V8DA 3H8EA 3PB7X 5LRKA 4OKOA 1Z5RA 4IK2A 1ZG7A 3IC1A 4MHZA 3N5FA 2PJ1A 2ZEOA 3TC8A 3JRUA 2EK8A 1HEEA 4NGNA 1XBUA 2QYVA 1CP7A 1XFOA 4UEEA 3KZWA 3B3CA 2CTCA 1TKFA 3B2YA 3GUXA 5K8NA 4B6ZA 1ZG9A 2AFWA 2AFMA 3IO1A 2WZNA 3D7DA 2GU2A 1H8LA 2V8VA 3SJXA 1DE4C 4W9YA 1EE3P 1RTQA 1HDQA 1ZG8A 4ZX9A 3S9MA 2IQ6A 2GLFA 4P4IA 1BPMA 4NGRA 1LAPA 3PB6X 2ZEMA 5K8PA 2PVVA 4MCSA 3KHXA 3GB0A 3DLJA 3SI1A 2PJCA 3I1UA 2XEJA 3CPAA 4NGTA 1Z2LA 1YW6A 4OIDA 3MRUA 1AMPA 4MHPA 4PPZA 2PJ2A 3D7GA 4F9VA 1TF8A 2BCOA 1NSAA 2ZEPA 4YU9A 3WC6A 3ISXA 1UWYA 4TNUA 1CP6A 2PJ0A 1ELMP 1FNOA 5DS0A 2ABZA 3KASA 3PFOA 4H2KA 4K3NA 1Z8LA 2EWBA 4PXBA 1LFWA 3H8GA 2CTBA 5HVFA 1YMEA 2RB7A 3PB9X 3HLPA 2PCUA 3FECA 4DUKA 4FWUA 3FX6A 3QNVA 4P4DA 2AFXA 2NSMA 2PJ5A 3V38A 2ZEGA 3SI0A 5LYFA 3BXMA 2XEIA 4EMEA 2PE3A 2GLJA 4EFDA 2HC9A 1CG2A 1YW4A 3D66A 3B7IA 7CPAA 5CPAA 2V77A 4UEZA 1Y0RA 2GREA 1CPSA 4ZX8A 2Q4ZA 3KQZA 4MXUA 4F8ZA 3WC7A 1IGBA 3PBBA 4OC5A 1QQ9A 1Y0YA 2C1CA 1BLLE 1LAMA 4NJQA 4LQGA 3IIBA 3LWUA 3T8WA 2WYRA 1F2OA 4MRIA 4TWEA 3NH8A 2VL1A 4OP4A 4NGMA 4R8FA 2BO9A 4P4FA 5J1QA 2PJBA 3VH9A 3V7ZA 2PJ3A 3WC5A 2HB6A 4NFRA 1VHEA 4FAIA 5HVHA 4R6TA 1JQGA 3KI9A 2PVWA 4BD9A 3B35A 3IWWA 4A38A 1Q7LA 3PBEA 1IY7A 4MCQA 1QMUA 4ZY0A 3PB4X 2ZEDA 4DJLA 4UIBA 1XMBA 3MN8A 2AFOA 2OR4A 1M4LA 3KQXA 6CPAA 2BOAA 3PB8X 3D68A 4NJRA 2IJZA 5LYDA 2QJ8A 3VATA 3GLJA 4P6YA 3DGVA 2V8GA 2JEWA 4PXCA 1ARMA 2AFZA 4G1PA 5CBMA 2CF4A 4FUUA 1ZLIA 4ZYQA 3SJEA 1ARLA 3KR5A 2AFUA 2IMOA 1PCAA 1VIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I3C A;  3SJG A;  4R7M A;  5F09 A;  4O23 A;  4X2T A;  4OC2 A;  3NFZ A;  5JGF A;  4DYO A;  3B3S A;  4X3R A;  4X8I A;  4OC3 A;  2C6P A;  4A39 A;  2V8H A;  3FEE A;  5LRG A;  4Z65 A;  5THW A;  1YLO A;  2ZEH A;  4JZ0 A;  1CBX A;  3SJF A;  1TF9 A;  2EK9 A;  2Q43 A;  3PRT A;  4MCP A;  2ZEE A;  4IAV A;  4OC1 A;  3RZA A;  4OC4 A;  4MHY A;  3FH4 A;  2PJ9 A;  2PJ8 A;  3FJU A;  1TKH A;  1TKJ A;  3BI1 A;  3IFE A;  5D29 A;  3BI0 A;  4R76 A;  3NA6 A;  1CX8 A;  5IB9 A;  2C6G A;  3B3T A;  5LYL A;  3K2K A;  2CIJ A;  3WAB A;  3KL9 A;  4P4E A;  3IEH A;  2ZEN A;  1TXR A;  2JBK A;  2O53 A;  1ELL P;  5LYI A;  3PFE A;  2ZOG A;  3D7H A;  1R43 A;  1DTD A;  5HXD A;  1LCP A;  2ZEL A;  3S9L A;  1LAN A;  5HVG A;  1BAV A;  4UIA A;  1OBR A;  2C6C A;  1FT7 A;  4NGS A;  2PJA A;  4ZI6 A;  2O4H A;  4ZY2 A;  2XEF A;  4GM5 A;  2AFS A;  4PQA A;  3KHZ A;  5JH9 A;  3B3V A;  3RBU A;  1VGY A;  4UF4 A;  3H8F A;  4MCR A;  2G9D A;  4UEF A;  1HDU A;  5LRJ A;  1YSJ A;  2POK A;  4YWY A;  5I4M A;  2F8H A;  4P4B A;  2FVG A;  2RFH A;  4P10 A;  3LMS A;  4AXV A;  1LOK A;  4MHN A;  3VAR A;  3ISZ A;  4NGQ A;  3KGQ A;  4KSI A;  3SI2 A;  3D4U A;  2NYQ A;  3FMC A;  3FED A;  1XJO A;  3CT9 A;  1CPX A;  5K8M A;  4P4J A;  1KWM A;  3PEI A;  2PJ6 A;  4NGP A;  1BPN A;  2OOT A;  3B3W A;  3D67 A;  2Q51 A;  3RAM A;  4MMO A;  4A37 A;  4OME A;  2XEG A;  1VHO A;  3WT4 A;  4F9U A;  1Y7E A;  3HUV A;  2JBJ A;  2PIZ A;  4CPA A;  4ONW A;  5ELY A;  2F7V A;  1XRY A;  5JM6 A;  2QVP A;  3KR4 A;  3K9T A;  2PJ7 A;  3D7F A;  3L2N A;  4WJB A;  4WWV A;  2DEA A;  4A94 A;  4Q7A A;  2PRQ A;  5K8O A;  3CPX A;  2ZOF A;  1PYT B;  3S9N A;  3NH5 A;  4ZY1 A;  2ZEF A;  3FVL A;  2PJ4 A;  2J9A A;  4RUH A;  1ZLH A;  4JYW A;  4OC0 A;  8CPA A;  3IJ3 A;  4IHM A;  3BHX A;  1GYT A;  3CDX A;  4PXD A;  4EWT A;  3TX8 A;  1AYE A;  4OIW A;  2ANP A;  2PIY A;  3FF3 A;  4FBE A;  1F57 A;  4P44 A;  5D8N A;  1R3N A;  1F2P A;  4PXE A;  3NH4 A;  4P45 A;  2V8D A;  3H8E A;  3PB7 X;  5LRK A;  4OKO A;  1Z5R A;  4IK2 A;  1ZG7 A;  3IC1 A;  4MHZ A;  3N5F A;  2PJ1 A;  2ZEO A;  3TC8 A;  3JRU A;  2EK8 A;  1HEE A;  4NGN A;  1XBU A;  2QYV A;  1CP7 A;  1XFO A;  4UEE A;  3KZW A;  3B3C A;  2CTC A;  1TKF A;  3B2Y A;  3GUX A;  5K8N A;  4B6Z A;  1ZG9 A;  2AFW A;  2AFM A;  3IO1 A;  2WZN A;  3D7D A;  2GU2 A;  1H8L A;  2V8V A;  3SJX A;  1DE4 C;  4W9Y A;  1EE3 P;  1RTQ A;  1HDQ A;  1ZG8 A;  4ZX9 A;  3S9M A;  2IQ6 A;  2GLF A;  4P4I A;  1BPM A;  4NGR A;  1LAP A;  3PB6 X;  2ZEM A;  5K8P A;  2PVV A;  4MCS A;  3KHX A;  3GB0 A;  3DLJ A;  3SI1 A;  2PJC A;  3I1U A;  2XEJ A;  3CPA A;  4NGT A;  1Z2L A;  1YW6 A;  4OID A;  3MRU A;  1AMP A;  4MHP A;  4PPZ A;  2PJ2 A;  3D7G A;  4F9V A;  1TF8 A;  2BCO A;  1NSA A;  2ZEP A;  4YU9 A;  3WC6 A;  3ISX A;  1UWY A;  4TNU A;  1CP6 A;  2PJ0 A;  1ELM P;  1FNO A;  5DS0 A;  2ABZ A;  3KAS A;  3PFO A;  4H2K A;  4K3N A;  1Z8L A;  2EWB A;  4PXB A;  1LFW A;  3H8G A;  2CTB A;  5HVF A;  1YME A;  2RB7 A;  3PB9 X;  3HLP A;  2PCU A;  3FEC A;  4DUK A;  4FWU A;  3FX6 A;  3QNV A;  4P4D A;  2AFX A;  2NSM A;  2PJ5 A;  3V38 A;  2ZEG A;  3SI0 A;  5LYF A;  3BXM A;  2XEI A;  4EME A;  2PE3 A;  2GLJ A;  4EFD A;  2HC9 A;  1CG2 A;  1YW4 A;  3D66 A;  3B7I A;  7CPA A;  5CPA A;  2V77 A;  4UEZ A;  1Y0R A;  2GRE A;  1CPS A;  4ZX8 A;  2Q4Z A;  3KQZ A;  4MXU A;  4F8Z A;  3WC7 A;  1IGB A;  3PBB A;  4OC5 A;  1QQ9 A;  1Y0Y A;  2C1C A;  1BLL E;  1LAM A;  4NJQ A;  4LQG A;  3IIB A;  3LWU A;  3T8W A;  2WYR A;  1F2O A;  4MRI A;  4TWE A;  3NH8 A;  2VL1 A;  4OP4 A;  4NGM A;  4R8F A;  2BO9 A;  4P4F A;  5J1Q A;  2PJB A;  3VH9 A;  3V7Z A;  2PJ3 A;  3WC5 A;  2HB6 A;  4NFR A;  1VHE A;  4FAI A;  5HVH A;  4R6T A;  1JQG A;  3KI9 A;  2PVW A;  4BD9 A;  3B35 A;  3IWW A;  4A38 A;  1Q7L A;  3PBE A;  1IY7 A;  4MCQ A;  1QMU A;  4ZY0 A;  3PB4 X;  2ZED A;  4DJL A;  4UIB A;  1XMB A;  3MN8 A;  2AFO A;  2OR4 A;  1M4L A;  3KQX A;  6CPA A;  2BOA A;  3PB8 X;  3D68 A;  4NJR A;  2IJZ A;  5LYD A;  2QJ8 A;  3VAT A;  3GLJ A;  4P6Y A;  3DGV A;  2V8G A;  2JEW A;  4PXC A;  1ARM A;  2AFZ A;  4G1P A;  5CBM A;  2CF4 A;  4FUU A;  1ZLI A;  4ZYQ A;  3SJE A;  1ARL A;  3KR5 A;  2AFU A;  2IMO A;  1PCA A;  1VIX A; 
#chains in the Genus database with same CATH topology
 2I3C A;  3SJG A;  4R7M A;  3I9S A;  5F09 A;  4ORF A;  4O23 A;  4X2T A;  1XMT A;  5F46 A;  2Z3K A;  4OC2 A;  1Z8W A;  3NFZ A;  4LQ6 A;  5G22 A;  4EVY A;  5AG6 A;  4C2X A;  4XPD C;  2AE6 A;  3KKW A;  4M6I A;  4DYO A;  3B3S A;  2Z0Z A;  3H4Q A;  4X3R A;  2FCK A;  4X8I A;  4OC3 A;  2FXF A;  2P6G A;  5AG4 A;  4UCP A;  2C6P A;  5IB0 A;  3F5B A;  2EO8 A;  2REE A;  4MY3 A;  4A39 A;  2CNT A;  2DXQ A;  4JXQ A;  5A27 A;  2V8H A;  2PR1 A;  3FEE A;  5LRG A;  3QAY A;  2Q7B A;  2DPS A;  2OH1 A;  4Z65 A;  5IV0 A;  4CGN A;  5THW A;  4UFX A;  1YLO A;  4KOV A;  2ZEH A;  4JZ0 A;  1CBX A;  2FL4 A;  1Y9K A;  5DWM A;  3SJF A;  1TF9 A;  2EK9 A;  2CNM A;  2Q43 A;  3PRT A;  4MCP A;  5H86 A;  5JGF A;  4CAX A;  2ZEE A;  3OWC A;  2PQ8 A;  4JXR A;  4M85 A;  4IAV A;  3R9E A;  1LRZ A;  4OC1 A;  3RZA A;  4OC4 A;  3N7Z A;  4MHY A;  4CYP A;  3TFY A;  3FH4 A;  2PJ9 A;  4JD6 A;  2PJ8 A;  2Q0Y A;  3FJU A;  5FVJ A;  3TCV A;  5IX3 A;  1TKH A;  4Q38 A;  1TKJ A;  3BI1 A;  1Z8X A;  3S6H A;  4CAF A;  4MJ8 A;  3IFE A;  5KTC A;  5D29 A;  1NE9 A;  3BI0 A;  4LUA A;  4R76 A;  4B5O A;  4CAW A;  3PGP A;  1Y9W A;  4MFQ A;  3PP9 A;  2Z3P A;  3NA6 A;  4ONU A;  4QUS A;  1CX8 A;  3SXO A;  1YVK A;  2C6G A;  5IB9 A;  3B3T A;  5LYL A;  3K2K A;  2CIJ A;  2DPT A;  3QB8 A;  3KL9 A;  4GS4 A;  4P4E A;  3IEH A;  4HPS A;  3WAB A;  2ZEN A;  4B11 A;  2AJ6 A;  1M4G A;  2QML A;  1TXR A;  2JBK A;  2O53 A;  1ELL P;  2WSA A;  5LYI A;  3PFE A;  2ZOG A;  1U6M A;  1I12 A;  4A33 A;  2X7B A;  1Z4R A;  4K30 A;  3D7H A;  1R43 A;  1DTD A;  1WWZ A;  2B4B A;  4RN7 A;  5HXD A;  1LCP A;  2ZEL A;  3S6K A;  3RNZ A;  1LAN A;  4U9Z A;  5JQ4 A;  5HVG A;  3S9L A;  1BAV A;  4UIA A;  1OBR A;  2C6C A;  1FT7 A;  4UFV A;  4CGO A;  1MJ9 A;  3B8G A;  4NGS A;  2PJA A;  2Y0M A;  4R57 A;  2B4D A;  3EO4 A;  4ZI6 A;  3R96 A;  2O4H A;  4ZY2 A;  3CXS A;  2VI7 A;  2XEF A;  4ZBG A;  3W91 A;  4QB9 A;  4A2Z A;  4GM5 A;  1XIX A;  2AFS A;  1IYK A;  4PQA A;  3KHZ A;  5JH9 A;  2HUZ A;  4KOU A;  1R57 A;  3B3V A;  3LAC A;  5KTA A;  3RBU A;  1VGY A;  4UF4 A;  3H8F A;  5GCN A;  5E96 A;  4E8O A;  2VEZ A;  2G9D A;  4MCR A;  4UEF A;  3WR7 A;  4L89 A;  1HDU A;  4H89 A;  4BIN A;  4FD5 A;  1YQE A;  1YSJ A;  2POK A;  5LRJ A;  2Q04 A;  1XOV A;  4X5K A;  4YWY A;  2Z10 A;  3D3S A;  4UWJ A;  1YK3 A;  3DNS A;  1B6B A;  4KUB A;  1Z9U A;  5I4M A;  2F8H A;  4HNX B;  4KOX A;  4CS0 B;  4P4B A;  2FVG A;  2R7H A;  2RFH A;  4P10 A;  3LMS A;  4AB7 A;  2OZH A;  4AXV A;  4AG9 A;  1LOK A;  4MHN A;  5G21 A;  3IWE A;  3VAR A;  1YGH A;  4NXY A;  1OZP A;  3ISZ A;  2Z11 A;  4CGL A;  4NGQ A;  3KGQ A;  4KSI A;  2EUI A;  3SI2 A;  1UFH A;  3D4U A;  5EMI A;  2Z3N A;  4C7I A;  2NYQ A;  5A28 A;  2FIA A;  1YR0 A;  3FMC A;  4QBJ A;  3FIX A;  3NE8 A;  3FED A;  2R1I A;  4A32 A;  1XJO A;  1QSM A;  3CT9 A;  1CPX A;  5K8M A;  1V0C A;  3LOD A;  4E0A A;  4P4J A;  1KWM A;  2R98 A;  3DR8 A;  3PEI A;  2PJ6 A;  4NGP A;  1BPN A;  4C2Z A;  2OOT A;  4NCZ A;  3B3W A;  2GE3 A;  3D67 A;  2P6E A;  3CZX A;  2Q51 A;  4Y49 B;  4MMO A;  5G1Z A;  3RAM A;  4A37 A;  4OME A;  2R8V A;  2XEG A;  2G3A A;  3TO9 A;  4A95 A;  2CNS A;  1VHO A;  3WT4 A;  4F9U A;  2Q7S A;  1Y7E A;  4PK2 A;  3HUV A;  2JBJ A;  4CRY B;  2PIZ A;  2F5I A;  4FD6 A;  4CPA A;  4MFP A;  3A9L A;  2PRB A;  4ONW A;  5ELY A;  2ZW6 A;  2F7V A;  1B87 A;  1XRY A;  2YNC C;  5JM6 A;  1TIQ A;  2QVP A;  4R9M A;  1VKC A;  4OAE A;  3KR4 A;  4IF5 A;  4L8A A;  2OB0 A;  2BL1 A;  4QVT A;  5CNP A;  1KUV A;  3FBU A;  4KVM E;  4DNC A;  2B3U A;  2FS5 A;  3K9T A;  2PJ7 A;  3D7F A;  3L2N A;  4WJB A;  5I0C A;  2KCW A;  3R9F A;  4J3G A;  5C88 A;  2B3V A;  3ZZI A;  4WWV A;  5BWA B;  2DEA A;  2VZY A;  5G20 A;  1L0C A;  3P2H A;  1A2Z A;  2GFQ A;  4A94 A;  3FB3 A;  2PRQ A;  4Q7A A;  3R9G A;  5K8O A;  1XF8 A;  3IGR A;  4AG7 A;  1JWQ A;  2DF5 A;  2ZOF A;  3CPX A;  1XE4 A;  1PYT B;  4CAV A;  3S9N A;  3FXT A;  3NH5 A;  3TO6 A;  2ZEF A;  3FVL A;  3W6S A;  4ZY1 A;  4KLW A;  3ZJ0 A;  2H5M A;  1CM0 A;  4CGM A;  2PJ4 A;  2J9A A;  4XPK A;  2PSW A;  3H5Z A;  2ARH A;  4RUH A;  1ZLH A;  4JYW A;  3TOA A;  4OC0 A;  3JUW A;  2I00 A;  4UFW A;  4BBH A;  8CPA A;  3LD2 A;  3IJ3 A;  3P2F A;  2VBQ A;  1CJW A;  4IHM A;  2REF A;  4KOT A;  3BHX A;  4KVO E;  3VWE A;  3MGD A;  1GYT A;  3RO0 A;  3CDX A;  4PXD A;  4KOY A;  4EWT A;  2GAN A;  4UA3 A;  1NMT A;  2P6F A;  1YVO A;  2JEV A;  1AYE A;  2J8R A;  2RC4 A;  3G8W A;  4OIW A;  3SXN A;  1KUX A;  4H6U A;  1FY7 A;  1KZF A;  2ANP A;  2PIY A;  3FF3 A;  3EXN A;  1ZO0 A;  4FBE A;  2FSR A;  1F57 A;  4P44 A;  2A4N A;  1X10 A;  3W6X A;  5D8N A;  1R3N A;  1F2P A;  4PXE A;  3C26 A;  4BMH A;  2C27 A;  3NH4 A;  4P45 A;  4CGP A;  4R3L A;  2V8D A;  3H8E A;  3PB7 X;  5LRK A;  4OKO A;  1Z5R A;  4KVX A;  2BEI A;  4IK2 A;  2B5G A;  1ZG7 A;  1YLE A;  4KOW A;  3IC1 A;  4MHZ A;  2NMT A;  3N5F A;  3DSB A;  2PJ1 A;  2ZEO A;  4F6A A;  3TC8 A;  1BOB A;  5EC4 A;  2D4O A;  3GY9 A;  5AGE A;  4YGO A;  3JRU A;  4CYO A;  2ZPA A;  2EK8 A;  1HEE A;  2VZZ A;  4NGN A;  3I3G A;  2BSW A;  4F0X A;  1I21 A;  5AG5 A;  1XBU A;  2QYV A;  1CP7 A;  5EBV A;  1XFO A;  4UEE A;  2QEC A;  2YND A;  3KZW A;  4MBU A;  1IOF A;  1K4J A;  3B3C A;  2IL4 A;  2CTC A;  2ZW7 A;  4KLV A;  5J8C A;  1TKF A;  3IWG A;  3B2Y A;  3NE7 A;  3GUX A;  5K8N A;  2BUE A;  4B6Z A;  5C82 A;  1ZG9 A;  5JPH A;  2AFW A;  1PUA A;  2AFM A;  3IO1 A;  2WZN A;  1Z8T A;  3D7D A;  2GU2 A;  1H8L A;  4PSX A;  2V8V A;  3FRM A;  2HV2 A;  3CXP A;  4KOS A;  3S6G A;  3SJX A;  1DE4 C;  4W9Y A;  1KUY A;  1EE3 P;  4R3K A;  1RTQ A;  1HDQ A;  1ZG8 A;  4ZX9 A;  3S9M A;  2IQ6 A;  2VXK A;  2GLF A;  4P4I A;  4UBR A;  1BPM A;  4B14 A;  4PSW A;  4NGR A;  2WUU A;  1M1D A;  4JJX A;  2WPX A;  1Q2D A;  4JLY A;  1VHS A;  1LAP A;  3BJ7 A;  3PB6 X;  2ZXV A;  3PZJ A;  5H84 A;  2ZEM A;  4MHD A;  5K8P A;  1IB1 E;  2Q4V A;  2PVV A;  4MCS A;  3KHX A;  3GB0 A;  2EBJ A;  2ODF A;  4NSQ A;  1XEB A;  3DLJ A;  3SI1 A;  1QST A;  2OZU A;  2PJC A;  2ZW5 A;  2XEJ A;  2YGW A;  3F0A A;  3I1U A;  3EY5 A;  3CPA A;  2FT0 A;  4NGT A;  4M6G A;  1Z2L A;  1YW6 A;  4KUA A;  4OID A;  4CAE A;  3MRU A;  5HH1 A;  1AMP A;  4MHP A;  4PPZ A;  4RI1 A;  2PJ2 A;  4B10 A;  3D7G A;  1S7N A;  3TTH A;  1TF8 A;  4GXH A;  4KZT A;  1RO5 A;  4CRZ B;  4F9V A;  2ATR A;  2HQY A;  1SQH A;  2BCO A;  1NSA A;  3D2P A;  2ZEP A;  3TE4 A;  3EC4 A;  2JDD A;  4YU9 A;  3WC6 A;  2Q4Y A;  3ISX A;  1UWY A;  4TNU A;  3SHP A;  1CP6 A;  2Q44 A;  2PJ0 A;  3R1K A;  3VWD A;  1ELM P;  2B4D B;  1FNO A;  4HNY B;  2ABZ A;  3JVN A;  3KAS A;  5DS0 A;  3PFO A;  4H2K A;  1Q2Y A;  2O28 A;  4K3N A;  4M6H A;  1Z8L A;  2P0W A;  2EWB A;  4FD7 A;  1LFW A;  4PXB A;  4Y49 C;  1BO4 A;  3H8G A;  2CTB A;  5AG7 A;  4CYN A;  4OLL A;  4UWI A;  5HVF A;  1P0H A;  3S6F A;  1YME A;  4KSA A;  2RB7 A;  3PB9 X;  3HLP A;  2PCU A;  3FEC A;  4DUK A;  4C7H A;  1J4J A;  3G3S A;  4FWU A;  3FX6 A;  4MFZ A;  5J8F A;  3QNV A;  1S7K A;  4P4D A;  2GIV A;  2AFX A;  4C2Y A;  1S7F A;  2QIR A;  3T90 A;  4CYQ A;  2NSM A;  2Z3M A;  4MFJ A;  5ISV A;  2PJ5 A;  3BJ8 A;  3V38 A;  2ZEG A;  4KOR A;  3QAH A;  3SI0 A;  5LYF A;  4XPL A;  5F47 A;  3BXM A;  1WK4 A;  2XEI A;  2OU2 A;  4EME A;  2PE3 A;  2GLJ A;  4EFD A;  1MJB A;  3BLN A;  2CXA A;  1IU8 A;  5HMN A;  2HC9 A;  1X12 A;  4M3S A;  1CG2 A;  1YW4 A;  1YX0 A;  2K5T A;  2JLM A;  4H6Z A;  3IU2 A;  4LX9 A;  3D66 A;  3R95 A;  3B7I A;  7CPA A;  5CPA A;  1P4N A;  2B58 A;  2V77 A;  4UEZ A;  3DR6 A;  1S5K A;  1Y0R A;  1YRE A;  2GRE A;  1CPS A;  4ZX8 A;  4FD4 A;  2Q4Z A;  3KQZ A;  4MXU A;  2I79 A;  4B5P A;  4F8Z A;  3WC7 A;  2JDC A;  4KS9 A;  1IGB A;  2PC1 A;  4B12 A;  3PBB A;  3FYN A;  4OC5 A;  1QQ9 A;  4OAD A;  4AVC A;  1Y0Y A;  2C1C A;  1BLL E;  4MI4 A;  1LAM A;  4NJQ A;  4QC6 A;  3TO7 A;  1RXT A;  2G3T A;  4LQG A;  2YNC A;  4PV6 A;  3IIB A;  4MFK A;  3GIU A;  4A31 A;  3LWU A;  4AVA A;  3T8W A;  3TT2 A;  3E0K A;  2WYR A;  1F2O A;  4A30 A;  4C68 A;  1Q2C A;  2PR8 A;  1S7L A;  4MRI A;  4TWE A;  3NH8 A;  2VL1 A;  4OP4 A;  4NGM A;  3K9U A;  5F48 A;  4HNW B;  1GHE A;  2BO9 A;  2D4P A;  4P4F A;  2WPW A;  4R8F A;  4F0Y A;  3TOB A;  5DWN A;  3CXQ A;  1IID A;  5F49 A;  4RS2 A;  3V8I A;  1QSN A;  4R87 A;  3EFA A;  2Z3O A;  5J1Q A;  1PU9 A;  3DDD A;  4HKF A;  4UCM A;  2FE7 A;  3D8P A;  1NSL A;  2PJB A;  3VH9 A;  2FIW A;  2ZW4 A;  3TX8 A;  3V7Z A;  2PJ3 A;  3WC5 A;  2HB6 A;  3JTK A;  4NFR A;  3T9Y A;  1MJA A;  1QSO A;  1VHE A;  4FAI A;  4XNH B;  5HVH A;  4R6T A;  3F8K A;  2YNE A;  1Y7R A;  4B13 A;  1JQG A;  3KI9 A;  2PVW A;  4PK3 A;  1S60 A;  4U5Y A;  4UCN A;  4BD9 A;  3GYA A;  3B35 A;  4YRH A;  1M4D A;  1QSR A;  3IWW A;  4A38 A;  4I49 A;  1M44 A;  4KSF A;  4ZGY B;  1Q7L A;  1MK4 A;  2EVN A;  3PBE A;  1IY7 A;  2G0B A;  1QMU A;  3GKR A;  4MCQ A;  2OZG A;  4NF1 A;  4ZY0 A;  3PB4 X;  2ZED A;  1IIC A;  4IUS A;  4XNH C;  4JWP A;  4DJL A;  4UIB A;  1XMB A;  3MN8 A;  4E2A A;  2AFO A;  2OR4 A;  1I1D A;  1M4L A;  4U9Y A;  5KTD A;  3KQX A;  6CPA A;  2BOA A;  3PB8 X;  3D68 A;  4NJR A;  4II9 A;  2IJZ A;  1M4I A;  5LYD A;  2QJ8 A;  3VAT A;  4B5P B;  3GLJ A;  3D2M A;  4P6Y A;  3DGV A;  4Q36 A;  2V8G A;  2JEW A;  4PXC A;  1ARM A;  2J8M A;  4NEX A;  4XPD B;  2AFZ A;  1ON0 A;  4G1P A;  2VQY A;  5CBM A;  1AUG A;  1IOI A;  2PDO A;  1S3Z A;  2CF4 A;  4FUU A;  1ZLI A;  3FNC A;  4MY0 A;  3SJE A;  4ZYQ A;  1ARL A;  4AVB A;  3KR5 A;  2AFU A;  2B5G B;  4YFJ A;  1IYL A;  3UY5 A;  3RYO A;  2Z3L A;  2IMO A;  1N71 A;  1PCA A;  3IU1 A;  1VIX A;  1Z4E A;  2J8N A;  4MFL A;  2CY2 A; 
#chains in the Genus database with same CATH homology
 2I3C A;  3SJG A;  4R7M A;  5F09 A;  4O23 A;  4X2T A;  4OC2 A;  3NFZ A;  5JGF A;  4DYO A;  3B3S A;  4X3R A;  4X8I A;  4OC3 A;  2C6P A;  4A39 A;  2V8H A;  3FEE A;  5LRG A;  4Z65 A;  5THW A;  1YLO A;  2ZEH A;  4JZ0 A;  1CBX A;  3SJF A;  1TF9 A;  2EK9 A;  2Q43 A;  3PRT A;  4MCP A;  2ZEE A;  4IAV A;  4OC1 A;  3RZA A;  4OC4 A;  4MHY A;  3FH4 A;  2PJ9 A;  2PJ8 A;  3FJU A;  1TKH A;  1TKJ A;  3BI1 A;  3IFE A;  5D29 A;  3BI0 A;  4R76 A;  3NA6 A;  1CX8 A;  5IB9 A;  2C6G A;  3B3T A;  5LYL A;  3K2K A;  2CIJ A;  3WAB A;  3KL9 A;  4P4E A;  3IEH A;  2ZEN A;  1TXR A;  2JBK A;  2O53 A;  1ELL P;  5LYI A;  3PFE A;  2ZOG A;  3D7H A;  1R43 A;  1DTD A;  5HXD A;  1LCP A;  2ZEL A;  3S9L A;  1LAN A;  5HVG A;  1BAV A;  4UIA A;  1OBR A;  2C6C A;  1FT7 A;  4NGS A;  2PJA A;  4ZI6 A;  2O4H A;  4ZY2 A;  2XEF A;  4GM5 A;  2AFS A;  4PQA A;  3KHZ A;  5JH9 A;  3B3V A;  3RBU A;  1VGY A;  4UF4 A;  3H8F A;  4MCR A;  2G9D A;  4UEF A;  1HDU A;  5LRJ A;  1YSJ A;  2POK A;  4YWY A;  5I4M A;  2F8H A;  4P4B A;  2FVG A;  2RFH A;  4P10 A;  3LMS A;  4AXV A;  1LOK A;  4MHN A;  3VAR A;  3ISZ A;  4NGQ A;  3KGQ A;  4KSI A;  3SI2 A;  3D4U A;  2NYQ A;  3FMC A;  3FED A;  1XJO A;  3CT9 A;  1CPX A;  5K8M A;  4P4J A;  1KWM A;  3PEI A;  2PJ6 A;  4NGP A;  1BPN A;  2OOT A;  3B3W A;  3D67 A;  2Q51 A;  3RAM A;  4MMO A;  4A37 A;  4OME A;  2XEG A;  1VHO A;  3WT4 A;  4F9U A;  1Y7E A;  3HUV A;  2JBJ A;  2PIZ A;  4CPA A;  4ONW A;  5ELY A;  2F7V A;  1XRY A;  5JM6 A;  2QVP A;  3KR4 A;  3K9T A;  2PJ7 A;  3D7F A;  3L2N A;  4WJB A;  4WWV A;  2DEA A;  4A94 A;  4Q7A A;  2PRQ A;  5K8O A;  3CPX A;  2ZOF A;  1PYT B;  3S9N A;  3NH5 A;  4ZY1 A;  2ZEF A;  3FVL A;  2PJ4 A;  2J9A A;  4RUH A;  1ZLH A;  4JYW A;  4OC0 A;  8CPA A;  3IJ3 A;  4IHM A;  3BHX A;  1GYT A;  3CDX A;  4PXD A;  4EWT A;  3TX8 A;  1AYE A;  4OIW A;  2ANP A;  2PIY A;  3FF3 A;  4FBE A;  1F57 A;  4P44 A;  5D8N A;  1R3N A;  1F2P A;  4PXE A;  3NH4 A;  4P45 A;  2V8D A;  3H8E A;  3PB7 X;  5LRK A;  4OKO A;  1Z5R A;  4IK2 A;  1ZG7 A;  3IC1 A;  4MHZ A;  3N5F A;  2PJ1 A;  2ZEO A;  3TC8 A;  3JRU A;  2EK8 A;  1HEE A;  4NGN A;  1XBU A;  2QYV A;  1CP7 A;  1XFO A;  4UEE A;  3KZW A;  3B3C A;  2CTC A;  1TKF A;  3B2Y A;  3GUX A;  5K8N A;  4B6Z A;  1ZG9 A;  2AFW A;  2AFM A;  3IO1 A;  2WZN A;  3D7D A;  2GU2 A;  1H8L A;  2V8V A;  3SJX A;  1DE4 C;  4W9Y A;  1EE3 P;  1RTQ A;  1HDQ A;  1ZG8 A;  4ZX9 A;  3S9M A;  2IQ6 A;  2GLF A;  4P4I A;  1BPM A;  4NGR A;  1LAP A;  3PB6 X;  2ZEM A;  5K8P A;  2PVV A;  4MCS A;  3KHX A;  3GB0 A;  3DLJ A;  3SI1 A;  2PJC A;  3I1U A;  2XEJ A;  3CPA A;  4NGT A;  1Z2L A;  1YW6 A;  4OID A;  3MRU A;  1AMP A;  4MHP A;  4PPZ A;  2PJ2 A;  3D7G A;  4F9V A;  1TF8 A;  2BCO A;  1NSA A;  2ZEP A;  4YU9 A;  3WC6 A;  3ISX A;  1UWY A;  4TNU A;  1CP6 A;  2PJ0 A;  1ELM P;  1FNO A;  5DS0 A;  2ABZ A;  3KAS A;  3PFO A;  4H2K A;  4K3N A;  1Z8L A;  2EWB A;  4PXB A;  1LFW A;  3H8G A;  2CTB A;  5HVF A;  1YME A;  2RB7 A;  3PB9 X;  3HLP A;  2PCU A;  3FEC A;  4DUK A;  4FWU A;  3FX6 A;  3QNV A;  4P4D A;  2AFX A;  2NSM A;  2PJ5 A;  3V38 A;  2ZEG A;  3SI0 A;  5LYF A;  3BXM A;  2XEI A;  4EME A;  2PE3 A;  2GLJ A;  4EFD A;  2HC9 A;  1CG2 A;  1YW4 A;  3D66 A;  3B7I A;  7CPA A;  5CPA A;  2V77 A;  4UEZ A;  1Y0R A;  2GRE A;  1CPS A;  4ZX8 A;  2Q4Z A;  3KQZ A;  4MXU A;  4F8Z A;  3WC7 A;  1IGB A;  3PBB A;  4OC5 A;  1QQ9 A;  1Y0Y A;  2C1C A;  1BLL E;  1LAM A;  4NJQ A;  4LQG A;  3IIB A;  3LWU A;  3T8W A;  2WYR A;  1F2O A;  4MRI A;  4TWE A;  3NH8 A;  2VL1 A;  4OP4 A;  4NGM A;  4R8F A;  2BO9 A;  4P4F A;  5J1Q A;  2PJB A;  3VH9 A;  3V7Z A;  2PJ3 A;  3WC5 A;  2HB6 A;  4NFR A;  1VHE A;  4FAI A;  5HVH A;  4R6T A;  1JQG A;  3KI9 A;  2PVW A;  4BD9 A;  3B35 A;  3IWW A;  4A38 A;  1Q7L A;  3PBE A;  1IY7 A;  4MCQ A;  1QMU A;  4ZY0 A;  3PB4 X;  2ZED A;  4DJL A;  4UIB A;  1XMB A;  3MN8 A;  2AFO A;  2OR4 A;  1M4L A;  3KQX A;  6CPA A;  2BOA A;  3PB8 X;  3D68 A;  4NJR A;  2IJZ A;  5LYD A;  2QJ8 A;  3VAT A;  3GLJ A;  4P6Y A;  3DGV A;  2V8G A;  2JEW A;  4PXC A;  1ARM A;  2AFZ A;  4G1P A;  5CBM A;  2CF4 A;  4FUU A;  1ZLI A;  4ZYQ A;  3SJE A;  1ARL A;  3KR5 A;  2AFU A;  2IMO A;  1PCA A;  1VIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...