2PRQA

X-ray crystallographic characterization of the co(ii)-substituted tris-bound form of the aminopeptidase from aeromonas proteolytica
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
publication title X-ray crystallographic characterization of the Co(II)-substituted Tris-bound form of the aminopeptidase from Aeromonas proteolytica.
pubmed doi rcsb
source organism Vibrio proteolyticus
molecule tags Hydrolase
total genus 116
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2007-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2prqA00
2F8HA 2AFWA 4ZI6A 2ZEGA 2AFUA 2ZEOA 4OKOA 3KI9A 1CP6A 4R6TA 4UEFA 3SI0A 5HVHA 3QNVA 1ARMA 4IHMA 4JZ0A 4ZY2A 2V77A 2XEFA 1ZG9A 2EK9A 1TKJA 2V8VA 2BO9A 2PIYA 2Q51A 3RAMA 1BAVA 1XMBA 4PPZA 4YU9A 1CBXA 1CP7A 1YMEA 1YW6A 4P4DA 1LANA 3N5FA 2IQ6A 3FECA 4F8ZA 4NFRA 4H2KA 1Z2LA 3VH9A 2EWBA 3CT9A 4R7MA 3KASA 4TNUA 1ELLP 3L2NA 2OR4A 4P4JA 4PXDA 4PXCA 2JBJA 2AFOA 2XEIA 3B7IA 2AFSA 4MHZA 2PJBA 2HC9A 5HVFA 2ZELA 2RB7A 2ZEPA 4R8FA 4OC2A 1ARLA 3WT4A 2PJ5A 5I4MA 3H8GA 3CPAA 4A37A 4BD9A 1YSJA 4MMOA 5LYIA 3PRTA 4NGNA 4P4BA 3KHZA 3B35A 5LRJA 5JM6A 4OP4A 4P45A 2ZEFA 2PRQA 3D68A 4WJBA 3KGQA 5HVGA 3FVLA 3KR4A 1XFOA 4P4FA 2BCOA 5K8NA 2ANPA 2GLJA 3DLJA 3BI1A 3D67A 3WC6A 4PXBA 3IJ3A 2PIZA 3PB4X 1LAPA 4DJLA 4P10A 1CPSA 4NGMA 1VHEA 4Q7AA 5D29A 3SJGA 3B2YA 1CPXA 4MHNA 3RBUA 1BLLE 4NGTA 4P44A 4UEEA 2ZEHA 4ONWA 3LMSA 3WC5A 3DGVA 5HXDA 3FH4A 2CTCA 1ELMP 4FAIA 2DEAA 1F57A 4RUHA 3GUXA 5K8OA 2PJ9A 3NH5A 1UWYA 2CIJA 4LQGA 2PJ1A 3WABA 2Q4ZA 2V8HA 4OIDA 1R3NA 1ZG7A 3FEDA 5DS0A 2AFXA 2PJAA 3PFOA 3PB9X 3PBEA 3V38A 1BPNA 1LAMA 3PB8X 4GM5A 5IB9A 2PVVA 2V8DA 2POKA 3D7HA 3GB0A 3B3VA 3JRUA 4X3RA 3GLJA 2Q43A 1LCPA 1BPMA 2PCUA 4F9VA 1TXRA 1YLOA 1TF9A 4ZX8A 3K9TA 1GYTA 3IWWA 2V8GA 4MCQA 4FWUA 3D66A 2I3CA 3I1UA 1XJOA 1Y0RA 3RZAA 4JYWA 4ZY0A 5JGFA 1AMPA 2F7VA 5THWA 3MN8A 6CPAA 4OC3A 3TX8A 3D7GA 2QVPA 1EE3P 3FF3A 1ZLIA 3MRUA 4UF4A 3BXMA 1Z5RA 3ISZA 4ZY1A 4O23A 2PJ2A 1QMUA 3PFEA 5CPAA 1XRYA 3D7FA 3CDXA 3S9NA 4ZYQA 4OC5A 3HLPA 5F09A 2FVGA 2PVWA 7CPAA 2RFHA 4W9YA 4R76A 1KWMA 3B3TA 3KL9A 4F9UA 1VIXA 2PJ8A 3H8EA 3KR5A 2PJ6A 1F2OA 3IC1A 3TC8A 1RTQA 2O4HA 2JBKA 4UIBA 1FNOA 5LYFA 3SJEA 2IMOA 3HUVA 2EK8A 1VGYA 4KSIA 2CTBA 2OOTA 4OIWA 4P6YA 4B6ZA 2CF4A 4IK2A 4TWEA 2PJCA 2HB6A 4Z65A 1LFWA 2PJ4A 2BOAA 2AFMA 3T8WA 3FX6A 2ZENA 1H8LA 3VATA 2O53A 3D4UA 4PQAA 5LYDA 4YWYA 1Z8LA 4X2TA 4IAVA 5CBMA 3FEEA 4MCRA 5LYLA 2WYRA 1Q7LA 4WWVA 3PB7X 1CG2A 4UIAA 4P4IA 3CPXA 3KHXA 3IEHA 4OC1A 2GU2A 2PE3A 2GREA 4X8IA 5ELYA 1DE4C 4UEZA 4FBEA 1YW4A 5LRKA 1PYTB 3D7DA 4EMEA 2C6GA 1Y0YA 5K8PA 2IJZA 2JEWA 3H8FA 4MRIA 3NH8A 4CPAA 1PCAA 3K2KA 3SI1A 4EFDA 3IFEA 3PEIA 4FUUA 2J9AA 4NJQA 3SI2A 5LRGA 1XBUA 3KQXA 3SJXA 3B3SA 2C1CA 4DUKA 4EWTA 2ZEMA 1CX8A 4A39A 2C6CA 2ZOGA 4OC4A 1LOKA 3KQZA 4A38A 3PB6X 4K3NA 4NGPA 3IO1A 2ZEEA 2ZOFA 3B3CA 3PBBA 4MHPA 2VL1A 1VHOA 4NGQA 4MXUA 5JH9A 3NA6A 1M4LA 1HDQA 5D8NA 3SJFA 2AFZA 4G1PA 1IY7A 3FJUA 3LWUA 4OMEA 1OBRA 3V7ZA 2ZEDA 1HDUA 4NGSA 3BHXA 5J1QA 3S9LA 1AYEA 3S9MA 3NFZA 1Y7EA 2WZNA 2G9DA 2C6PA 4NJRA 3KZWA 3BI0A 4MHYA 2NSMA 2PJ7A 2PJ0A 4OC0A 4ZX9A 2PJ3A 3ISXA 3FMCA 4P4EA 4DYOA 1NSAA 1IGBA 1QQ9A 1DTDA 3B3WA 1JQGA 8CPAA 4AXVA 5K8MA 2NYQA 4MCSA 4MCPA 1TKHA 4A94A 1HEEA 3IIBA 1F2PA 2GLFA 1R43A 1ZG8A 3VARA 2QJ8A 3NH4A 2XEJA 4PXEA 1ZLHA 2ABZA 3WC7A 4NGRA 2XEGA 1FT7A 2QYVA 1TKFA 1TF8A
chains in the Genus database with same CATH superfamily
2F8HA 2AFWA 2CNMA 2FT0A 4ZI6A 3R96A 2ZEGA 4EVYA 2B3VA 2AFUA 2ZEOA 3FNCA 2P6GA 1N71A 3MGDA 4OKOA 3TOAA 4NXYA 3KI9A 3TCVA 3CXSA 1S7KA 1CP6A 4R6TA 4RI1A 2Q4VA 4UEFA 2ZW6A 2OH1A 3SI0A 3QNVA 5HVHA 4CAVA 2ZXVA 2Z10A 1XF8A 3I9SA 1ARMA 4IHMA 4C7IA 4JZ0A 5CNPA 2B4DB 4CS0B 4ZY2A 2V77A 2R8VA 3F8KA 1KUYA 2XEFA 4BINA 5KTAA 4PSWA 1YX0A 1ZG9A 2EK9A 2WPXA 4KVXA 1TKJA 2IL4A 2V8VA 2BO9A 4HNYB 4MFZA 2PIYA 2Q51A 4NF1A 4CRZB 4U5YA 3RAMA 1BAVA 1XMBA 4CYNA 4PPZA 1YVKA 4YU9A 2CNSA 4A31A 5JPHA 2JDDA 1CBXA 2DPSA 1CP7A 4UCPA 1YMEA 1YW6A 4ORFA 4P4DA 1LANA 3N5FA 2IQ6A 3FECA 5H84A 4F8ZA 2VQYA 2Z3OA 4M6IA 4NFRA 4H2KA 1QSRA 4XPLA 3KKWA 2CY2A 2H5MA 2OZHA 3D8PA 4R3LA 1Z2LA 4UCMA 3VH9A 2EWBA 2Y0MA 1A2ZA 3CT9A 5IB0A 3S6HA 3W91A 1YVOA 1MJ9A 4R7MA 2A4NA 3KASA 2EO8A 3DR8A 4TNUA 1ELLP 3GIUA 3L2NA 4R87A 2OR4A 4P4JA 4PXDA 4CRYB 4KOWA 2QMLA 4PXCA 4LQ6A 3UY5A 1YGHA 2JBJA 1M1DA 2AFOA 2XEIA 4LUAA 4UFXA 2Z3MA 5AG5A 3B7IA 2OB0A 4QUSA 2WSAA 2PR1A 2AFSA 5IX3A 4MHZA 2VEZA 2PJBA 4YGOA 4QBJA 3QAYA 3H5ZA 2HC9A 2HV2A 5HVFA 2ZELA 4KSAA 4BMHA 1KUVA 2RB7A 4A95A 2ZEPA 3PP9A 1BOBA 4R57A 4R8FA 3F5BA 4OC2A 1ARLA 4A2ZA 3IU1A 4B13A 1LRZA 1ZO0A 2HUZA 2PJ5A 1Z4RA 3WT4A 3H8GA 3CPAA 4A37A 5I4MA 4BD9A 1YSJA 4FD4A 2B5GB 4MMOA 5F47A 5LYIA 2ZW7A 3PRTA 1S7FA 4IF5A 4K30A 4NGNA 4P4BA 5AG6A 3KHZA 1I1DA 4UWIA 3B35A 2R1IA 4XPKA 1WK4A 2ARHA 5LRJA 1CJWA 5JM6A 4OP4A 4P45A 3FB3A 1IYKA 2ZEFA 2PRQA 3D68A 4WJBA 3DDDA 3KGQA 3TO9A 5HVGA 1MJAA 4RN7A 5FVJA 3FVLA 5EMIA 3GKRA 3KR4A 2C27A 2BEIA 5HH1A 1XFOA 4P4FA 1VHSA 2BCOA 4XPDC 2K5TA 5K8NA 4GS4A 2ANPA 2GLJA 3VWDA 3DLJA 4AG7A 2VI7A 4AVCA 2FSRA 3BI1A 3D67A 1NMTA 2QIRA 3WC6A 1IYLA 4AVBA 3D2PA 4B5OA 4PXBA 3IJ3A 3RO0A 2PIZA 1XEBA 3PB4X 4A30A 3EXNA 1LAPA 4CAXA 4DJLA 4P10A 1CPSA 4NGMA 1VHEA 4Q7AA 3T90A 5D29A 3R9EA 3SJGA 3IWGA 1X10A 3W6SA 3DSBA 3CZXA 2BL1A 3SXNA 4PSXA 4C7HA 4FD6A 3B2YA 1CPXA 4MHNA 1K4JA 3RBUA 1BLLE 4NSQA 4NGTA 4P44A 4KS9A 4UEEA 1VKCA 2ZEHA 4ONWA 3LMSA 5DWNA 4JJXA 5F48A 1B87A 3WC5A 4MFPA 5EBVA 5BWAB 3DGVA 2B3UA 5HXDA 5G20A 4B10A 3FH4A 4H89A 1QSTA 2YNCA 2CTCA 5EC4A 1S3ZA 4KSFA 5C88A 1ELMP 1CM0A 1MK4A 4FAIA 2DEAA 1F57A 3GY9A 4RUHA 3GUXA 3S6GA 5I0CA 3BJ8A 2Z3PA 5K8OA 5F46A 2PJ9A 4KLWA 2WUUA 2X7BA 1UWYA 3NH5A 3B8GA 3FBUA 2CIJA 4LQGA 2FL4A 5H86A 4XNHB 5G22A 2PJ1A 2ZW4A 3WABA 2Q4ZA 3ZJ0A 2V8HA 3K9UA 4OIDA 3OWCA 1R3NA 1XOVA 2EBJA 2Z3NA 4DNCA 1IB1E 1ZG7A 3FEDA 3VWEA 3EY5A 2VZYA 4J3GA 5DS0A 2REEA 2REFA 2AFXA 4OADA 4ONUA 2PJAA 1Z8XA 4KOTA 2BUEA 4C2ZA 4YFJA 3TO6A 1JWQA 2JLMA 1M4GA 3SHPA 2PDOA 3PFOA 3PB9X 3TO7A 3PBEA 3F0AA 1QSOA 3V38A 1BPNA 3T9YA 1LAMA 2OZUA 2GANA 4U9YA 3PB8X 4GM5A 4MJ8A 3R95A 5C82A 2R7HA 5IB9A 2PVVA 2V8DA 4MY3A 2JEVA 5DWMA 2POKA 3D7HA 3GB0A 3B3VA 3JRUA 4X3RA 3GLJA 1Q2DA 2Q43A 1LCPA 1BPMA 4H6ZA 2PCUA 4KVME 1NE9A 4E8OA 1IU8A 1TXRA 3CXQA 4F9VA 5KTCA 3IGRA 1YLOA 1TF9A 4ZX8A 3P2HA 3K9TA 3G8WA 1GYTA 3DR6A 3IWWA 4CGPA 2B4BA 2V8GA 2AE6A 4FWUA 4MCQA 3D66A 4KOYA 2I3CA 4Q38A 2PC1A 1U6MA 3I1UA 1XJOA 1Y0RA 3RZAA 1L0CA 1Y7RA 4CAEA 4JYWA 1TIQA 4RS2A 4ZY0A 5JGFA 5G21A 3JVNA 1AMPA 4PV6A 3QB8A 2F7VA 1GHEA 1S5KA 2FIWA 5THWA 3MN8A 4BBHA 6CPAA 4OC3A 3TX8A 3R9GA 2DXQA 4B14A 4AB7A 3D7GA 2QVPA 3TFYA 4IUSA 5GCNA 5A27A 2OZGA 1EE3P 2KCWA 3FF3A 1ZLIA 3MRUA 4UF4A 2HQYA 1Z5RA 3BXMA 3ISZA 4HKFA 4KOXA 2PQ8A 5IV0A 1IIDA 3PGPA 4HNXB 4CGOA 4CAWA 4U9ZA 3C26A 4ZY1A 1J4JA 4PK2A 4UCNA 4O23A 5AGEA 2PJ2A 1KUXA 1QMUA 1Z8TA 3PFEA 4XPDB 4Y49C 5CPAA 1XRYA 4A33A 3D7FA 3CDXA 3S9NA 1MJBA 4ZYQA 1I12A 3RYOA 3V8IA 1S60A 4OC5A 3HLPA 5F09A 2FVGA 2PVWA 2ZW5A 7CPAA 2RFHA 4W9YA 4R76A 1KWMA 3I3GA 3R1KA 3B3TA 2J8RA 3KL9A 1VIXA 2PJ8A 3H8EA 4F9UA 2P6FA 3KR5A 2G3TA 2PJ6A 1R57A 1F2OA 2G3AA 3IC1A 2AJ6A 2ATRA 1YREA 2CNTA 3IWEA 4MY0A 3TC8A 1RTQA 5A28A 4R3KA 2O4HA 1KZFA 2JBKA 4UIBA 1FNOA 4FD5A 2BSWA 4A32A 5G1ZA 5LYFA 3SJEA 2IMOA 3HUVA 2EK8A 3BLNA 1VGYA 4YRHA 4KSIA 4KZTA 1X12A 1Z8WA 2CTBA 1AUGA 1PUAA 4NCZA 2OOTA 4OIWA 2P6EA 4H6UA 4P6YA 4JD6A 4B6ZA 2CF4A 4M6HA 5J8CA 4IK2A 4ZGYB 2Q4YA 4QB9A 2CXAA 2PJCA 4TWEA 2HB6A 4Z65A 3A9LA 1LFWA 1BO4A 2PJ4A 2BOAA 3FIXA 2AFMA 1QSMA 3S6FA 3QAHA 3T8WA 3IU2A 3FX6A 4QVTA 2ZENA 1H8LA 3VATA 2YNDA 2YNEA 4JXRA 3TT2A 2O53A 3D4UA 4PQAA 4QC6A 1PU9A 5LYDA 1IOIA 1FY7A 3EO4A 4KORA 4KVOE 4YWYA 1Z8LA 4X2TA 4M3SA 4CGMA 4M85A 1WWZA 2I79A 3FYNA 1XMTA 4NEXA 4B5PA 4IAVA 5CBMA 1NSLA 1Z9UA 3FEEA 4MCRA 5LYLA 2WYRA 4AVAA 1Q7LA 4WWVA 3PB7X 5KTDA 2B58A 4JWPA 4KUBA 1CG2A 2EUIA 2ZPAA 1ON0A 3E0KA 4UIAA 4OLLA 4P4IA 2Q7SA 3CPXA 2VZZA 4B12A 3KHXA 4II9A 3IEHA 1XIXA 2D4OA 2JDCA 2WPWA 4OC1A 2GU2A 1Z4EA 2GREA 1Q2YA 2PE3A 1DE4C 4UEZA 4X8IA 5ELYA 4FBEA 1YW4A 4AG9A 1PYTB 2G0BA 5LRKA 3D7DA 4EMEA 2PRBA 2C6GA 4KOSA 1Y0YA 5K8PA 2IJZA 1OZPA 2J8NA 4MFQA 2JEWA 3H8FA 1S7LA 4MFJA 4MRIA 3NH8A 4CYQA 4CPAA 1RO5A 1PCAA 3K2KA 3SI1A 3SXOA 4EFDA 3IFEA 1P4NA 2DF5A 1V0CA 4HNWB 4FD7A 3JUWA 1IICA 3PEIA 2J9AA 4FUUA 4NJQA 3SI2A 5LRGA 3JTKA 1XBUA 3KQXA 5ISVA 4L89A 4XNHC 3SJXA 2FS5A 2ODFA 3B3SA 4E2AA 3FXTA 2C1CA 4DUKA 2FXFA 4KLVA 4EWTA 2ZEMA 4UBRA 1CX8A 4A39A 1Y9KA 2C6CA 2ZOGA 2B4DA 4OC4A 1LOKA 3KQZA 2GE3A 1Y9WA 2VBQA 4A38A 1YLEA 3PB6X 4MFKA 4CYOA 2VXKA 4K3NA 4NGPA 5HMNA 3IO1A 3LD2A 2ZEEA 2ZOFA 3GYAA 3LACA 3RNZA 4GXHA 3B3CA 3PBBA 4MHPA 4X5KA 1SQHA 1B6BA 2VL1A 1VHOA 4OAEA 4NGQA 1Q2CA 4F6AA 2F5IA 4MXUA 5JH9A 2D4PA 4UFVA 3NA6A 2FIAA 3FRMA 1M4LA 4Y49B 4E0AA 5F49A 3TOBA 1HDQA 5D8NA 4C68A 2O28A 4MBUA 3SJFA 2AFZA 2GFQA 4MFLA 4G1PA 1IY7A 3FJUA 1YQEA 3LWUA 1OBRA 4OMEA 2ZEDA 1HDUA 4LX9A 4NGSA 3S6KA 3V7ZA 3WR7A 4C2XA 4CGNA 3BHXA 1XE4A 3S9LA 5J1QA 1AYEA 2RC4A 3D3SA 4CGLA 2EVNA 1UFHA 2PSWA 1YR0A 1Y7EA 2R98A 3NFZA 4JLYA 3S9MA 1I21A 3R9FA 2Z3KA 3P2FA 4HPSA 4C2YA 3DNSA 3NE7A 4CYPA 2WZNA 2GIVA 2G9DA 2C6PA 4NJRA 3KZWA 3BI0A 2I00A 4MHYA 2NSMA 2PJ7A 2PJ0A 4OC0A 4ZX9A 3LODA 2PJ3A 2NMTA 2Q04A 3D2MA 2Q44A 5AG4A 3EFAA 3ISXA 3FMCA 4P4EA 4DYOA 4JXQA 1NSAA 1IGBA 1QQ9A 4UA3A 1DTDA 3B3WA 2OU2A 2DPTA 3ZZIA 5E96A 4F0XA 1JQGA 2FCKA 8CPAA 4M6GA 4AXVA 1S7NA 5K8MA 1M4IA 2NYQA 4I49A 2Z0ZA 4MCSA 3BJ7A 4R9MA 3CXPA 4MCPA 3N7ZA 2Q0YA 2P0WA 4B5PB 2YGWA 2Z11A 1TKHA 4A94A 1HEEA 3IIBA 4ZBGA 1F2PA 2B5GA 4L8AA 2GLFA 4F0YA 5JQ4A 1YK3A 1R43A 1P0HA 4UWJA 3H4QA 3W6XA 4UFWA 5J8FA 2PR8A 4Q36A 1ZG8A 4KOUA 3VARA 2QECA 2QJ8A 3NH4A 3PZJA 4MHDA 4KUAA 2XEJA 5AG7A 3TTHA 2Z3LA 1RXTA 4PXEA 4CAFA 4PK3A 3NE8A 1ZLHA 2ABZA 2FE7A 3WC7A 1QSNA 4KOVA 4NGRA 1IOFA 2Q7BA 2XEGA 1FT7A 4MI4A 1M4DA 3G3SA 2J8MA 2QYVA 1TKFA 3TE4A 1TF8A 2YNCC 1M44A 3EC4A 4B11A
chains in the Genus database with same CATH topology
2F8HA 2AFWA 4ZI6A 2ZEGA 2AFUA 2ZEOA 4OKOA 3KI9A 1CP6A 4R6TA 4UEFA 3SI0A 5HVHA 3QNVA 1ARMA 4IHMA 4JZ0A 4ZY2A 2V77A 2XEFA 1ZG9A 2EK9A 1TKJA 2V8VA 2BO9A 2PIYA 2Q51A 3RAMA 1BAVA 1XMBA 4PPZA 4YU9A 1CBXA 1CP7A 1YMEA 1YW6A 4P4DA 1LANA 3N5FA 2IQ6A 3FECA 4F8ZA 4NFRA 4H2KA 1Z2LA 3VH9A 2EWBA 3CT9A 4R7MA 3KASA 4TNUA 1ELLP 3L2NA 2OR4A 4P4JA 4PXDA 4PXCA 2JBJA 2AFOA 2XEIA 3B7IA 2AFSA 4MHZA 2PJBA 2HC9A 5HVFA 2ZELA 2RB7A 2ZEPA 4R8FA 4OC2A 1ARLA 3WT4A 2PJ5A 5I4MA 3H8GA 3CPAA 4A37A 4BD9A 1YSJA 4MMOA 5LYIA 3PRTA 4NGNA 4P4BA 3KHZA 3B35A 5LRJA 5JM6A 4OP4A 4P45A 2ZEFA 2PRQA 3D68A 4WJBA 3KGQA 5HVGA 3FVLA 3KR4A 1XFOA 4P4FA 2BCOA 5K8NA 2ANPA 2GLJA 3DLJA 3BI1A 3D67A 3WC6A 4PXBA 3IJ3A 2PIZA 3PB4X 1LAPA 4DJLA 4P10A 1CPSA 4NGMA 1VHEA 4Q7AA 5D29A 3SJGA 3B2YA 1CPXA 4MHNA 3RBUA 1BLLE 4NGTA 4P44A 4UEEA 2ZEHA 4ONWA 3LMSA 3WC5A 3DGVA 5HXDA 3FH4A 2CTCA 1ELMP 4FAIA 2DEAA 1F57A 4RUHA 3GUXA 5K8OA 2PJ9A 3NH5A 1UWYA 2CIJA 4LQGA 2PJ1A 3WABA 2Q4ZA 2V8HA 4OIDA 1R3NA 1ZG7A 3FEDA 5DS0A 2AFXA 2PJAA 3PFOA 3PB9X 3PBEA 3V38A 1BPNA 1LAMA 3PB8X 4GM5A 5IB9A 2PVVA 2V8DA 2POKA 3D7HA 3GB0A 3B3VA 3JRUA 4X3RA 3GLJA 2Q43A 1LCPA 1BPMA 2PCUA 4F9VA 1TXRA 1YLOA 1TF9A 4ZX8A 3K9TA 1GYTA 3IWWA 2V8GA 4MCQA 4FWUA 3D66A 2I3CA 3I1UA 1XJOA 1Y0RA 3RZAA 4JYWA 4ZY0A 5JGFA 1AMPA 2F7VA 5THWA 3MN8A 6CPAA 4OC3A 3TX8A 3D7GA 2QVPA 1EE3P 3FF3A 1ZLIA 3MRUA 4UF4A 3BXMA 1Z5RA 3ISZA 4ZY1A 4O23A 2PJ2A 1QMUA 3PFEA 5CPAA 1XRYA 3D7FA 3CDXA 3S9NA 4ZYQA 4OC5A 3HLPA 5F09A 2FVGA 2PVWA 7CPAA 2RFHA 4W9YA 4R76A 1KWMA 3B3TA 3KL9A 4F9UA 1VIXA 2PJ8A 3H8EA 3KR5A 2PJ6A 1F2OA 3IC1A 3TC8A 1RTQA 2O4HA 2JBKA 4UIBA 1FNOA 5LYFA 3SJEA 2IMOA 3HUVA 2EK8A 1VGYA 4KSIA 2CTBA 2OOTA 4OIWA 4P6YA 4B6ZA 2CF4A 4IK2A 4TWEA 2PJCA 2HB6A 4Z65A 1LFWA 2PJ4A 2BOAA 2AFMA 3T8WA 3FX6A 2ZENA 1H8LA 3VATA 2O53A 3D4UA 4PQAA 5LYDA 4YWYA 1Z8LA 4X2TA 4IAVA 5CBMA 3FEEA 4MCRA 5LYLA 2WYRA 1Q7LA 4WWVA 3PB7X 1CG2A 4UIAA 4P4IA 3CPXA 3KHXA 3IEHA 4OC1A 2GU2A 2PE3A 2GREA 4X8IA 5ELYA 1DE4C 4UEZA 4FBEA 1YW4A 5LRKA 1PYTB 3D7DA 4EMEA 2C6GA 1Y0YA 5K8PA 2IJZA 2JEWA 3H8FA 4MRIA 3NH8A 4CPAA 1PCAA 3K2KA 3SI1A 4EFDA 3IFEA 3PEIA 4FUUA 2J9AA 4NJQA 3SI2A 5LRGA 1XBUA 3KQXA 3SJXA 3B3SA 2C1CA 4DUKA 4EWTA 2ZEMA 1CX8A 4A39A 2C6CA 2ZOGA 4OC4A 1LOKA 3KQZA 4A38A 3PB6X 4K3NA 4NGPA 3IO1A 2ZEEA 2ZOFA 3B3CA 3PBBA 4MHPA 2VL1A 1VHOA 4NGQA 4MXUA 5JH9A 3NA6A 1M4LA 1HDQA 5D8NA 3SJFA 2AFZA 4G1PA 1IY7A 3FJUA 3LWUA 4OMEA 1OBRA 3V7ZA 2ZEDA 1HDUA 4NGSA 3BHXA 5J1QA 3S9LA 1AYEA 3S9MA 3NFZA 1Y7EA 2WZNA 2G9DA 2C6PA 4NJRA 3KZWA 3BI0A 4MHYA 2NSMA 2PJ7A 2PJ0A 4OC0A 4ZX9A 2PJ3A 3ISXA 3FMCA 4P4EA 4DYOA 1NSAA 1IGBA 1QQ9A 1DTDA 3B3WA 1JQGA 8CPAA 4AXVA 5K8MA 2NYQA 4MCSA 4MCPA 1TKHA 4A94A 1HEEA 3IIBA 1F2PA 2GLFA 1R43A 1ZG8A 3VARA 2QJ8A 3NH4A 2XEJA 4PXEA 1ZLHA 2ABZA 3WC7A 4NGRA 2XEGA 1FT7A 2QYVA 1TKFA 1TF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8H A;  2AFW A;  4ZI6 A;  2ZEG A;  2AFU A;  2ZEO A;  4OKO A;  3KI9 A;  1CP6 A;  4R6T A;  4UEF A;  3SI0 A;  5HVH A;  3QNV A;  1ARM A;  4IHM A;  4JZ0 A;  4ZY2 A;  2V77 A;  2XEF A;  1ZG9 A;  2EK9 A;  1TKJ A;  2V8V A;  2BO9 A;  2PIY A;  2Q51 A;  3RAM A;  1BAV A;  1XMB A;  4PPZ A;  4YU9 A;  1CBX A;  1CP7 A;  1YME A;  1YW6 A;  4P4D A;  1LAN A;  3N5F A;  2IQ6 A;  3FEC A;  4F8Z A;  4NFR A;  4H2K A;  1Z2L A;  3VH9 A;  2EWB A;  3CT9 A;  4R7M A;  3KAS A;  4TNU A;  1ELL P;  3L2N A;  2OR4 A;  4P4J A;  4PXD A;  4PXC A;  2JBJ A;  2AFO A;  2XEI A;  3B7I A;  2AFS A;  4MHZ A;  2PJB A;  2HC9 A;  5HVF A;  2ZEL A;  2RB7 A;  2ZEP A;  4R8F A;  4OC2 A;  1ARL A;  3WT4 A;  2PJ5 A;  5I4M A;  3H8G A;  3CPA A;  4A37 A;  4BD9 A;  1YSJ A;  4MMO A;  5LYI A;  3PRT A;  4NGN A;  4P4B A;  3KHZ A;  3B35 A;  5LRJ A;  5JM6 A;  4OP4 A;  4P45 A;  2ZEF A;  2PRQ A;  3D68 A;  4WJB A;  3KGQ A;  5HVG A;  3FVL A;  3KR4 A;  1XFO A;  4P4F A;  2BCO A;  5K8N A;  2ANP A;  2GLJ A;  3DLJ A;  3BI1 A;  3D67 A;  3WC6 A;  4PXB A;  3IJ3 A;  2PIZ A;  3PB4 X;  1LAP A;  4DJL A;  4P10 A;  1CPS A;  4NGM A;  1VHE A;  4Q7A A;  5D29 A;  3SJG A;  3B2Y A;  1CPX A;  4MHN A;  3RBU A;  1BLL E;  4NGT A;  4P44 A;  4UEE A;  2ZEH A;  4ONW A;  3LMS A;  3WC5 A;  3DGV A;  5HXD A;  3FH4 A;  2CTC A;  1ELM P;  4FAI A;  2DEA A;  1F57 A;  4RUH A;  3GUX A;  5K8O A;  2PJ9 A;  3NH5 A;  1UWY A;  2CIJ A;  4LQG A;  2PJ1 A;  3WAB A;  2Q4Z A;  2V8H A;  4OID A;  1R3N A;  1ZG7 A;  3FED A;  5DS0 A;  2AFX A;  2PJA A;  3PFO A;  3PB9 X;  3PBE A;  3V38 A;  1BPN A;  1LAM A;  3PB8 X;  4GM5 A;  5IB9 A;  2PVV A;  2V8D A;  2POK A;  3D7H A;  3GB0 A;  3B3V A;  3JRU A;  4X3R A;  3GLJ A;  2Q43 A;  1LCP A;  1BPM A;  2PCU A;  4F9V A;  1TXR A;  1YLO A;  1TF9 A;  4ZX8 A;  3K9T A;  1GYT A;  3IWW A;  2V8G A;  4MCQ A;  4FWU A;  3D66 A;  2I3C A;  3I1U A;  1XJO A;  1Y0R A;  3RZA A;  4JYW A;  4ZY0 A;  5JGF A;  1AMP A;  2F7V A;  5THW A;  3MN8 A;  6CPA A;  4OC3 A;  3TX8 A;  3D7G A;  2QVP A;  1EE3 P;  3FF3 A;  1ZLI A;  3MRU A;  4UF4 A;  3BXM A;  1Z5R A;  3ISZ A;  4ZY1 A;  4O23 A;  2PJ2 A;  1QMU A;  3PFE A;  5CPA A;  1XRY A;  3D7F A;  3CDX A;  3S9N A;  4ZYQ A;  4OC5 A;  3HLP A;  5F09 A;  2FVG A;  2PVW A;  7CPA A;  2RFH A;  4W9Y A;  4R76 A;  1KWM A;  3B3T A;  3KL9 A;  4F9U A;  1VIX A;  2PJ8 A;  3H8E A;  3KR5 A;  2PJ6 A;  1F2O A;  3IC1 A;  3TC8 A;  1RTQ A;  2O4H A;  2JBK A;  4UIB A;  1FNO A;  5LYF A;  3SJE A;  2IMO A;  3HUV A;  2EK8 A;  1VGY A;  4KSI A;  2CTB A;  2OOT A;  4OIW A;  4P6Y A;  4B6Z A;  2CF4 A;  4IK2 A;  4TWE A;  2PJC A;  2HB6 A;  4Z65 A;  1LFW A;  2PJ4 A;  2BOA A;  2AFM A;  3T8W A;  3FX6 A;  2ZEN A;  1H8L A;  3VAT A;  2O53 A;  3D4U A;  4PQA A;  5LYD A;  4YWY A;  1Z8L A;  4X2T A;  4IAV A;  5CBM A;  3FEE A;  4MCR A;  5LYL A;  2WYR A;  1Q7L A;  4WWV A;  3PB7 X;  1CG2 A;  4UIA A;  4P4I A;  3CPX A;  3KHX A;  3IEH A;  4OC1 A;  2GU2 A;  2PE3 A;  2GRE A;  4X8I A;  5ELY A;  1DE4 C;  4UEZ A;  4FBE A;  1YW4 A;  5LRK A;  1PYT B;  3D7D A;  4EME A;  2C6G A;  1Y0Y A;  5K8P A;  2IJZ A;  2JEW A;  3H8F A;  4MRI A;  3NH8 A;  4CPA A;  1PCA A;  3K2K A;  3SI1 A;  4EFD A;  3IFE A;  3PEI A;  4FUU A;  2J9A A;  4NJQ A;  3SI2 A;  5LRG A;  1XBU A;  3KQX A;  3SJX A;  3B3S A;  2C1C A;  4DUK A;  4EWT A;  2ZEM A;  1CX8 A;  4A39 A;  2C6C A;  2ZOG A;  4OC4 A;  1LOK A;  3KQZ A;  4A38 A;  3PB6 X;  4K3N A;  4NGP A;  3IO1 A;  2ZEE A;  2ZOF A;  3B3C A;  3PBB A;  4MHP A;  2VL1 A;  1VHO A;  4NGQ A;  4MXU A;  5JH9 A;  3NA6 A;  1M4L A;  1HDQ A;  5D8N A;  3SJF A;  2AFZ A;  4G1P A;  1IY7 A;  3FJU A;  3LWU A;  4OME A;  1OBR A;  3V7Z A;  2ZED A;  1HDU A;  4NGS A;  3BHX A;  5J1Q A;  3S9L A;  1AYE A;  3S9M A;  3NFZ A;  1Y7E A;  2WZN A;  2G9D A;  2C6P A;  4NJR A;  3KZW A;  3BI0 A;  4MHY A;  2NSM A;  2PJ7 A;  2PJ0 A;  4OC0 A;  4ZX9 A;  2PJ3 A;  3ISX A;  3FMC A;  4P4E A;  4DYO A;  1NSA A;  1IGB A;  1QQ9 A;  1DTD A;  3B3W A;  1JQG A;  8CPA A;  4AXV A;  5K8M A;  2NYQ A;  4MCS A;  4MCP A;  1TKH A;  4A94 A;  1HEE A;  3IIB A;  1F2P A;  2GLF A;  1R43 A;  1ZG8 A;  3VAR A;  2QJ8 A;  3NH4 A;  2XEJ A;  4PXE A;  1ZLH A;  2ABZ A;  3WC7 A;  4NGR A;  2XEG A;  1FT7 A;  2QYV A;  1TKF A;  1TF8 A; 
#chains in the Genus database with same CATH topology
 2F8H A;  2AFW A;  2CNM A;  2FT0 A;  4ZI6 A;  3R96 A;  2ZEG A;  4EVY A;  2B3V A;  2AFU A;  2ZEO A;  3FNC A;  2P6G A;  1N71 A;  3MGD A;  4OKO A;  3TOA A;  4NXY A;  3KI9 A;  3TCV A;  3CXS A;  1S7K A;  1CP6 A;  4R6T A;  4RI1 A;  2Q4V A;  4UEF A;  2ZW6 A;  2OH1 A;  3SI0 A;  3QNV A;  5HVH A;  4CAV A;  2ZXV A;  2Z10 A;  1XF8 A;  3I9S A;  1ARM A;  4IHM A;  4C7I A;  4JZ0 A;  5CNP A;  2B4D B;  4CS0 B;  4ZY2 A;  2V77 A;  2R8V A;  3F8K A;  1KUY A;  2XEF A;  4BIN A;  5KTA A;  4PSW A;  1YX0 A;  1ZG9 A;  2EK9 A;  2WPX A;  4KVX A;  1TKJ A;  2IL4 A;  2V8V A;  2BO9 A;  4HNY B;  4MFZ A;  2PIY A;  2Q51 A;  4NF1 A;  4CRZ B;  4U5Y A;  3RAM A;  1BAV A;  1XMB A;  4CYN A;  4PPZ A;  1YVK A;  4YU9 A;  2CNS A;  4A31 A;  5JPH A;  2JDD A;  1CBX A;  2DPS A;  1CP7 A;  4UCP A;  1YME A;  1YW6 A;  4ORF A;  4P4D A;  1LAN A;  3N5F A;  2IQ6 A;  3FEC A;  5H84 A;  4F8Z A;  2VQY A;  2Z3O A;  4M6I A;  4NFR A;  4H2K A;  1QSR A;  4XPL A;  3KKW A;  2CY2 A;  2H5M A;  2OZH A;  3D8P A;  4R3L A;  1Z2L A;  4UCM A;  3VH9 A;  2EWB A;  2Y0M A;  1A2Z A;  3CT9 A;  5IB0 A;  3S6H A;  3W91 A;  1YVO A;  1MJ9 A;  4R7M A;  2A4N A;  3KAS A;  2EO8 A;  3DR8 A;  4TNU A;  1ELL P;  3GIU A;  3L2N A;  4R87 A;  2OR4 A;  4P4J A;  4PXD A;  4CRY B;  4KOW A;  2QML A;  4PXC A;  4LQ6 A;  3UY5 A;  1YGH A;  2JBJ A;  1M1D A;  2AFO A;  2XEI A;  4LUA A;  4UFX A;  2Z3M A;  5AG5 A;  3B7I A;  2OB0 A;  4QUS A;  2WSA A;  2PR1 A;  2AFS A;  5IX3 A;  4MHZ A;  2VEZ A;  2PJB A;  4YGO A;  4QBJ A;  3QAY A;  3H5Z A;  2HC9 A;  2HV2 A;  5HVF A;  2ZEL A;  4KSA A;  4BMH A;  1KUV A;  2RB7 A;  4A95 A;  2ZEP A;  3PP9 A;  1BOB A;  4R57 A;  4R8F A;  3F5B A;  4OC2 A;  1ARL A;  4A2Z A;  3IU1 A;  4B13 A;  1LRZ A;  1ZO0 A;  2HUZ A;  2PJ5 A;  1Z4R A;  3WT4 A;  3H8G A;  3CPA A;  4A37 A;  5I4M A;  4BD9 A;  1YSJ A;  4FD4 A;  2B5G B;  4MMO A;  5F47 A;  5LYI A;  2ZW7 A;  3PRT A;  1S7F A;  4IF5 A;  4K30 A;  4NGN A;  4P4B A;  5AG6 A;  3KHZ A;  1I1D A;  4UWI A;  3B35 A;  2R1I A;  4XPK A;  1WK4 A;  2ARH A;  5LRJ A;  1CJW A;  5JM6 A;  4OP4 A;  4P45 A;  3FB3 A;  1IYK A;  2ZEF A;  2PRQ A;  3D68 A;  4WJB A;  3DDD A;  3KGQ A;  3TO9 A;  5HVG A;  1MJA A;  4RN7 A;  5FVJ A;  3FVL A;  5EMI A;  3GKR A;  3KR4 A;  2C27 A;  2BEI A;  5HH1 A;  1XFO A;  4P4F A;  1VHS A;  2BCO A;  4XPD C;  2K5T A;  5K8N A;  4GS4 A;  2ANP A;  2GLJ A;  3VWD A;  3DLJ A;  4AG7 A;  2VI7 A;  4AVC A;  2FSR A;  3BI1 A;  3D67 A;  1NMT A;  2QIR A;  3WC6 A;  1IYL A;  4AVB A;  3D2P A;  4B5O A;  4PXB A;  3IJ3 A;  3RO0 A;  2PIZ A;  1XEB A;  3PB4 X;  4A30 A;  3EXN A;  1LAP A;  4CAX A;  4DJL A;  4P10 A;  1CPS A;  4NGM A;  1VHE A;  4Q7A A;  3T90 A;  5D29 A;  3R9E A;  3SJG A;  3IWG A;  1X10 A;  3W6S A;  3DSB A;  3CZX A;  2BL1 A;  3SXN A;  4PSX A;  4C7H A;  4FD6 A;  3B2Y A;  1CPX A;  4MHN A;  1K4J A;  3RBU A;  1BLL E;  4NSQ A;  4NGT A;  4P44 A;  4KS9 A;  4UEE A;  1VKC A;  2ZEH A;  4ONW A;  3LMS A;  5DWN A;  4JJX A;  5F48 A;  1B87 A;  3WC5 A;  4MFP A;  5EBV A;  5BWA B;  3DGV A;  2B3U A;  5HXD A;  5G20 A;  4B10 A;  3FH4 A;  4H89 A;  1QST A;  2YNC A;  2CTC A;  5EC4 A;  1S3Z A;  4KSF A;  5C88 A;  1ELM P;  1CM0 A;  1MK4 A;  4FAI A;  2DEA A;  1F57 A;  3GY9 A;  4RUH A;  3GUX A;  3S6G A;  5I0C A;  3BJ8 A;  2Z3P A;  5K8O A;  5F46 A;  2PJ9 A;  4KLW A;  2WUU A;  2X7B A;  1UWY A;  3NH5 A;  3B8G A;  3FBU A;  2CIJ A;  4LQG A;  2FL4 A;  5H86 A;  4XNH B;  5G22 A;  2PJ1 A;  2ZW4 A;  3WAB A;  2Q4Z A;  3ZJ0 A;  2V8H A;  3K9U A;  4OID A;  3OWC A;  1R3N A;  1XOV A;  2EBJ A;  2Z3N A;  4DNC A;  1IB1 E;  1ZG7 A;  3FED A;  3VWE A;  3EY5 A;  2VZY A;  4J3G A;  5DS0 A;  2REE A;  2REF A;  2AFX A;  4OAD A;  4ONU A;  2PJA A;  1Z8X A;  4KOT A;  2BUE A;  4C2Z A;  4YFJ A;  3TO6 A;  1JWQ A;  2JLM A;  1M4G A;  3SHP A;  2PDO A;  3PFO A;  3PB9 X;  3TO7 A;  3PBE A;  3F0A A;  1QSO A;  3V38 A;  1BPN A;  3T9Y A;  1LAM A;  2OZU A;  2GAN A;  4U9Y A;  3PB8 X;  4GM5 A;  4MJ8 A;  3R95 A;  5C82 A;  2R7H A;  5IB9 A;  2PVV A;  2V8D A;  4MY3 A;  2JEV A;  5DWM A;  2POK A;  3D7H A;  3GB0 A;  3B3V A;  3JRU A;  4X3R A;  3GLJ A;  1Q2D A;  2Q43 A;  1LCP A;  1BPM A;  4H6Z A;  2PCU A;  4KVM E;  1NE9 A;  4E8O A;  1IU8 A;  1TXR A;  3CXQ A;  4F9V A;  5KTC A;  3IGR A;  1YLO A;  1TF9 A;  4ZX8 A;  3P2H A;  3K9T A;  3G8W A;  1GYT A;  3DR6 A;  3IWW A;  4CGP A;  2B4B A;  2V8G A;  2AE6 A;  4FWU A;  4MCQ A;  3D66 A;  4KOY A;  2I3C A;  4Q38 A;  2PC1 A;  1U6M A;  3I1U A;  1XJO A;  1Y0R A;  3RZA A;  1L0C A;  1Y7R A;  4CAE A;  4JYW A;  1TIQ A;  4RS2 A;  4ZY0 A;  5JGF A;  5G21 A;  3JVN A;  1AMP A;  4PV6 A;  3QB8 A;  2F7V A;  1GHE A;  1S5K A;  2FIW A;  5THW A;  3MN8 A;  4BBH A;  6CPA A;  4OC3 A;  3TX8 A;  3R9G A;  2DXQ A;  4B14 A;  4AB7 A;  3D7G A;  2QVP A;  3TFY A;  4IUS A;  5GCN A;  5A27 A;  2OZG A;  1EE3 P;  2KCW A;  3FF3 A;  1ZLI A;  3MRU A;  4UF4 A;  2HQY A;  1Z5R A;  3BXM A;  3ISZ A;  4HKF A;  4KOX A;  2PQ8 A;  5IV0 A;  1IID A;  3PGP A;  4HNX B;  4CGO A;  4CAW A;  4U9Z A;  3C26 A;  4ZY1 A;  1J4J A;  4PK2 A;  4UCN A;  4O23 A;  5AGE A;  2PJ2 A;  1KUX A;  1QMU A;  1Z8T A;  3PFE A;  4XPD B;  4Y49 C;  5CPA A;  1XRY A;  4A33 A;  3D7F A;  3CDX A;  3S9N A;  1MJB A;  4ZYQ A;  1I12 A;  3RYO A;  3V8I A;  1S60 A;  4OC5 A;  3HLP A;  5F09 A;  2FVG A;  2PVW A;  2ZW5 A;  7CPA A;  2RFH A;  4W9Y A;  4R76 A;  1KWM A;  3I3G A;  3R1K A;  3B3T A;  2J8R A;  3KL9 A;  1VIX A;  2PJ8 A;  3H8E A;  4F9U A;  2P6F A;  3KR5 A;  2G3T A;  2PJ6 A;  1R57 A;  1F2O A;  2G3A A;  3IC1 A;  2AJ6 A;  2ATR A;  1YRE A;  2CNT A;  3IWE A;  4MY0 A;  3TC8 A;  1RTQ A;  5A28 A;  4R3K A;  2O4H A;  1KZF A;  2JBK A;  4UIB A;  1FNO A;  4FD5 A;  2BSW A;  4A32 A;  5G1Z A;  5LYF A;  3SJE A;  2IMO A;  3HUV A;  2EK8 A;  3BLN A;  1VGY A;  4YRH A;  4KSI A;  4KZT A;  1X12 A;  1Z8W A;  2CTB A;  1AUG A;  1PUA A;  4NCZ A;  2OOT A;  4OIW A;  2P6E A;  4H6U A;  4P6Y A;  4JD6 A;  4B6Z A;  2CF4 A;  4M6H A;  5J8C A;  4IK2 A;  4ZGY B;  2Q4Y A;  4QB9 A;  2CXA A;  2PJC A;  4TWE A;  2HB6 A;  4Z65 A;  3A9L A;  1LFW A;  1BO4 A;  2PJ4 A;  2BOA A;  3FIX A;  2AFM A;  1QSM A;  3S6F A;  3QAH A;  3T8W A;  3IU2 A;  3FX6 A;  4QVT A;  2ZEN A;  1H8L A;  3VAT A;  2YND A;  2YNE A;  4JXR A;  3TT2 A;  2O53 A;  3D4U A;  4PQA A;  4QC6 A;  1PU9 A;  5LYD A;  1IOI A;  1FY7 A;  3EO4 A;  4KOR A;  4KVO E;  4YWY A;  1Z8L A;  4X2T A;  4M3S A;  4CGM A;  4M85 A;  1WWZ A;  2I79 A;  3FYN A;  1XMT A;  4NEX A;  4B5P A;  4IAV A;  5CBM A;  1NSL A;  1Z9U A;  3FEE A;  4MCR A;  5LYL A;  2WYR A;  4AVA A;  1Q7L A;  4WWV A;  3PB7 X;  5KTD A;  2B58 A;  4JWP A;  4KUB A;  1CG2 A;  2EUI A;  2ZPA A;  1ON0 A;  3E0K A;  4UIA A;  4OLL A;  4P4I A;  2Q7S A;  3CPX A;  2VZZ A;  4B12 A;  3KHX A;  4II9 A;  3IEH A;  1XIX A;  2D4O A;  2JDC A;  2WPW A;  4OC1 A;  2GU2 A;  1Z4E A;  2GRE A;  1Q2Y A;  2PE3 A;  1DE4 C;  4UEZ A;  4X8I A;  5ELY A;  4FBE A;  1YW4 A;  4AG9 A;  1PYT B;  2G0B A;  5LRK A;  3D7D A;  4EME A;  2PRB A;  2C6G A;  4KOS A;  1Y0Y A;  5K8P A;  2IJZ A;  1OZP A;  2J8N A;  4MFQ A;  2JEW A;  3H8F A;  1S7L A;  4MFJ A;  4MRI A;  3NH8 A;  4CYQ A;  4CPA A;  1RO5 A;  1PCA A;  3K2K A;  3SI1 A;  3SXO A;  4EFD A;  3IFE A;  1P4N A;  2DF5 A;  1V0C A;  4HNW B;  4FD7 A;  3JUW A;  1IIC A;  3PEI A;  2J9A A;  4FUU A;  4NJQ A;  3SI2 A;  5LRG A;  3JTK A;  1XBU A;  3KQX A;  5ISV A;  4L89 A;  4XNH C;  3SJX A;  2FS5 A;  2ODF A;  3B3S A;  4E2A A;  3FXT A;  2C1C A;  4DUK A;  2FXF A;  4KLV A;  4EWT A;  2ZEM A;  4UBR A;  1CX8 A;  4A39 A;  1Y9K A;  2C6C A;  2ZOG A;  2B4D A;  4OC4 A;  1LOK A;  3KQZ A;  2GE3 A;  1Y9W A;  2VBQ A;  4A38 A;  1YLE A;  3PB6 X;  4MFK A;  4CYO A;  2VXK A;  4K3N A;  4NGP A;  5HMN A;  3IO1 A;  3LD2 A;  2ZEE A;  2ZOF A;  3GYA A;  3LAC A;  3RNZ A;  4GXH A;  3B3C A;  3PBB A;  4MHP A;  4X5K A;  1SQH A;  1B6B A;  2VL1 A;  1VHO A;  4OAE A;  4NGQ A;  1Q2C A;  4F6A A;  2F5I A;  4MXU A;  5JH9 A;  2D4P A;  4UFV A;  3NA6 A;  2FIA A;  3FRM A;  1M4L A;  4Y49 B;  4E0A A;  5F49 A;  3TOB A;  1HDQ A;  5D8N A;  4C68 A;  2O28 A;  4MBU A;  3SJF A;  2AFZ A;  2GFQ A;  4MFL A;  4G1P A;  1IY7 A;  3FJU A;  1YQE A;  3LWU A;  1OBR A;  4OME A;  2ZED A;  1HDU A;  4LX9 A;  4NGS A;  3S6K A;  3V7Z A;  3WR7 A;  4C2X A;  4CGN A;  3BHX A;  1XE4 A;  3S9L A;  5J1Q A;  1AYE A;  2RC4 A;  3D3S A;  4CGL A;  2EVN A;  1UFH A;  2PSW A;  1YR0 A;  1Y7E A;  2R98 A;  3NFZ A;  4JLY A;  3S9M A;  1I21 A;  3R9F A;  2Z3K A;  3P2F A;  4HPS A;  4C2Y A;  3DNS A;  3NE7 A;  4CYP A;  2WZN A;  2GIV A;  2G9D A;  2C6P A;  4NJR A;  3KZW A;  3BI0 A;  2I00 A;  4MHY A;  2NSM A;  2PJ7 A;  2PJ0 A;  4OC0 A;  4ZX9 A;  3LOD A;  2PJ3 A;  2NMT A;  2Q04 A;  3D2M A;  2Q44 A;  5AG4 A;  3EFA A;  3ISX A;  3FMC A;  4P4E A;  4DYO A;  4JXQ A;  1NSA A;  1IGB A;  1QQ9 A;  4UA3 A;  1DTD A;  3B3W A;  2OU2 A;  2DPT A;  3ZZI A;  5E96 A;  4F0X A;  1JQG A;  2FCK A;  8CPA A;  4M6G A;  4AXV A;  1S7N A;  5K8M A;  1M4I A;  2NYQ A;  4I49 A;  2Z0Z A;  4MCS A;  3BJ7 A;  4R9M A;  3CXP A;  4MCP A;  3N7Z A;  2Q0Y A;  2P0W A;  4B5P B;  2YGW A;  2Z11 A;  1TKH A;  4A94 A;  1HEE A;  3IIB A;  4ZBG A;  1F2P A;  2B5G A;  4L8A A;  2GLF A;  4F0Y A;  5JQ4 A;  1YK3 A;  1R43 A;  1P0H A;  4UWJ A;  3H4Q A;  3W6X A;  4UFW A;  5J8F A;  2PR8 A;  4Q36 A;  1ZG8 A;  4KOU A;  3VAR A;  2QEC A;  2QJ8 A;  3NH4 A;  3PZJ A;  4MHD A;  4KUA A;  2XEJ A;  5AG7 A;  3TTH A;  2Z3L A;  1RXT A;  4PXE A;  4CAF A;  4PK3 A;  3NE8 A;  1ZLH A;  2ABZ A;  2FE7 A;  3WC7 A;  1QSN A;  4KOV A;  4NGR A;  1IOF A;  2Q7B A;  2XEG A;  1FT7 A;  4MI4 A;  1M4D A;  3G3S A;  2J8M A;  2QYV A;  1TKF A;  3TE4 A;  1TF8 A;  2YNC C;  1M44 A;  3EC4 A;  4B11 A; 
#chains in the Genus database with same CATH homology
 2F8H A;  2AFW A;  4ZI6 A;  2ZEG A;  2AFU A;  2ZEO A;  4OKO A;  3KI9 A;  1CP6 A;  4R6T A;  4UEF A;  3SI0 A;  5HVH A;  3QNV A;  1ARM A;  4IHM A;  4JZ0 A;  4ZY2 A;  2V77 A;  2XEF A;  1ZG9 A;  2EK9 A;  1TKJ A;  2V8V A;  2BO9 A;  2PIY A;  2Q51 A;  3RAM A;  1BAV A;  1XMB A;  4PPZ A;  4YU9 A;  1CBX A;  1CP7 A;  1YME A;  1YW6 A;  4P4D A;  1LAN A;  3N5F A;  2IQ6 A;  3FEC A;  4F8Z A;  4NFR A;  4H2K A;  1Z2L A;  3VH9 A;  2EWB A;  3CT9 A;  4R7M A;  3KAS A;  4TNU A;  1ELL P;  3L2N A;  2OR4 A;  4P4J A;  4PXD A;  4PXC A;  2JBJ A;  2AFO A;  2XEI A;  3B7I A;  2AFS A;  4MHZ A;  2PJB A;  2HC9 A;  5HVF A;  2ZEL A;  2RB7 A;  2ZEP A;  4R8F A;  4OC2 A;  1ARL A;  3WT4 A;  2PJ5 A;  5I4M A;  3H8G A;  3CPA A;  4A37 A;  4BD9 A;  1YSJ A;  4MMO A;  5LYI A;  3PRT A;  4NGN A;  4P4B A;  3KHZ A;  3B35 A;  5LRJ A;  5JM6 A;  4OP4 A;  4P45 A;  2ZEF A;  2PRQ A;  3D68 A;  4WJB A;  3KGQ A;  5HVG A;  3FVL A;  3KR4 A;  1XFO A;  4P4F A;  2BCO A;  5K8N A;  2ANP A;  2GLJ A;  3DLJ A;  3BI1 A;  3D67 A;  3WC6 A;  4PXB A;  3IJ3 A;  2PIZ A;  3PB4 X;  1LAP A;  4DJL A;  4P10 A;  1CPS A;  4NGM A;  1VHE A;  4Q7A A;  5D29 A;  3SJG A;  3B2Y A;  1CPX A;  4MHN A;  3RBU A;  1BLL E;  4NGT A;  4P44 A;  4UEE A;  2ZEH A;  4ONW A;  3LMS A;  3WC5 A;  3DGV A;  5HXD A;  3FH4 A;  2CTC A;  1ELM P;  4FAI A;  2DEA A;  1F57 A;  4RUH A;  3GUX A;  5K8O A;  2PJ9 A;  3NH5 A;  1UWY A;  2CIJ A;  4LQG A;  2PJ1 A;  3WAB A;  2Q4Z A;  2V8H A;  4OID A;  1R3N A;  1ZG7 A;  3FED A;  5DS0 A;  2AFX A;  2PJA A;  3PFO A;  3PB9 X;  3PBE A;  3V38 A;  1BPN A;  1LAM A;  3PB8 X;  4GM5 A;  5IB9 A;  2PVV A;  2V8D A;  2POK A;  3D7H A;  3GB0 A;  3B3V A;  3JRU A;  4X3R A;  3GLJ A;  2Q43 A;  1LCP A;  1BPM A;  2PCU A;  4F9V A;  1TXR A;  1YLO A;  1TF9 A;  4ZX8 A;  3K9T A;  1GYT A;  3IWW A;  2V8G A;  4MCQ A;  4FWU A;  3D66 A;  2I3C A;  3I1U A;  1XJO A;  1Y0R A;  3RZA A;  4JYW A;  4ZY0 A;  5JGF A;  1AMP A;  2F7V A;  5THW A;  3MN8 A;  6CPA A;  4OC3 A;  3TX8 A;  3D7G A;  2QVP A;  1EE3 P;  3FF3 A;  1ZLI A;  3MRU A;  4UF4 A;  3BXM A;  1Z5R A;  3ISZ A;  4ZY1 A;  4O23 A;  2PJ2 A;  1QMU A;  3PFE A;  5CPA A;  1XRY A;  3D7F A;  3CDX A;  3S9N A;  4ZYQ A;  4OC5 A;  3HLP A;  5F09 A;  2FVG A;  2PVW A;  7CPA A;  2RFH A;  4W9Y A;  4R76 A;  1KWM A;  3B3T A;  3KL9 A;  4F9U A;  1VIX A;  2PJ8 A;  3H8E A;  3KR5 A;  2PJ6 A;  1F2O A;  3IC1 A;  3TC8 A;  1RTQ A;  2O4H A;  2JBK A;  4UIB A;  1FNO A;  5LYF A;  3SJE A;  2IMO A;  3HUV A;  2EK8 A;  1VGY A;  4KSI A;  2CTB A;  2OOT A;  4OIW A;  4P6Y A;  4B6Z A;  2CF4 A;  4IK2 A;  4TWE A;  2PJC A;  2HB6 A;  4Z65 A;  1LFW A;  2PJ4 A;  2BOA A;  2AFM A;  3T8W A;  3FX6 A;  2ZEN A;  1H8L A;  3VAT A;  2O53 A;  3D4U A;  4PQA A;  5LYD A;  4YWY A;  1Z8L A;  4X2T A;  4IAV A;  5CBM A;  3FEE A;  4MCR A;  5LYL A;  2WYR A;  1Q7L A;  4WWV A;  3PB7 X;  1CG2 A;  4UIA A;  4P4I A;  3CPX A;  3KHX A;  3IEH A;  4OC1 A;  2GU2 A;  2PE3 A;  2GRE A;  4X8I A;  5ELY A;  1DE4 C;  4UEZ A;  4FBE A;  1YW4 A;  5LRK A;  1PYT B;  3D7D A;  4EME A;  2C6G A;  1Y0Y A;  5K8P A;  2IJZ A;  2JEW A;  3H8F A;  4MRI A;  3NH8 A;  4CPA A;  1PCA A;  3K2K A;  3SI1 A;  4EFD A;  3IFE A;  3PEI A;  4FUU A;  2J9A A;  4NJQ A;  3SI2 A;  5LRG A;  1XBU A;  3KQX A;  3SJX A;  3B3S A;  2C1C A;  4DUK A;  4EWT A;  2ZEM A;  1CX8 A;  4A39 A;  2C6C A;  2ZOG A;  4OC4 A;  1LOK A;  3KQZ A;  4A38 A;  3PB6 X;  4K3N A;  4NGP A;  3IO1 A;  2ZEE A;  2ZOF A;  3B3C A;  3PBB A;  4MHP A;  2VL1 A;  1VHO A;  4NGQ A;  4MXU A;  5JH9 A;  3NA6 A;  1M4L A;  1HDQ A;  5D8N A;  3SJF A;  2AFZ A;  4G1P A;  1IY7 A;  3FJU A;  3LWU A;  4OME A;  1OBR A;  3V7Z A;  2ZED A;  1HDU A;  4NGS A;  3BHX A;  5J1Q A;  3S9L A;  1AYE A;  3S9M A;  3NFZ A;  1Y7E A;  2WZN A;  2G9D A;  2C6P A;  4NJR A;  3KZW A;  3BI0 A;  4MHY A;  2NSM A;  2PJ7 A;  2PJ0 A;  4OC0 A;  4ZX9 A;  2PJ3 A;  3ISX A;  3FMC A;  4P4E A;  4DYO A;  1NSA A;  1IGB A;  1QQ9 A;  1DTD A;  3B3W A;  1JQG A;  8CPA A;  4AXV A;  5K8M A;  2NYQ A;  4MCS A;  4MCP A;  1TKH A;  4A94 A;  1HEE A;  3IIB A;  1F2P A;  2GLF A;  1R43 A;  1ZG8 A;  3VAR A;  2QJ8 A;  3NH4 A;  2XEJ A;  4PXE A;  1ZLH A;  2ABZ A;  3WC7 A;  4NGR A;  2XEG A;  1FT7 A;  2QYV A;  1TKF A;  1TF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...